4HRNA

Structural basis for eliciting a cytotoxic effect in her2-overexpressing cancer cells via binding to the extracellular domain of her2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
121
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVNAKDEYGLTPLYLATAHGHLEIVEVLLKNGADVNAVDAIGFTPLHLAAFIGHLEIAEVLLKHGADVNAQDKFGKTAFDISIGNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Designed Ankyrin Repeat Protein H10-2-G
publication title Structural Basis for Eliciting a Cytotoxic Effect in HER2-Overexpressing Cancer Cells via Binding to the Extracellular Domain of HER2.
pubmed doi rcsb
source organism Synthetic
molecule tags Transferase/de novo protein
total genus 39
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hrnA00
1N0RA 4N5QA 3LJNA 5ENOD 5HS0A 4DRXE 1IHBA 1TR4A 3JUEA 3AAAC 4G8KA 1DCQA 4J7WA 4UUCA 1MYOA 2XZDG 3T9KA 1K3ZD 5EILA 1BD8A 5D66A 2ETAA 1OT8A 4YDWA 4HRMB 1K1BA 4K5AB 5KBAA 3W9GA 3JXIA 4O60A 2A5EA 1IKND 4C48B 2PNNA 3NOCD 3EHRA 3TWUA 4QFVA 5BXOA 2F8XK 2L6BA 1BLXB 3HG0D 4JB8P 3JXJA 5ENTD 4NIKA 5HKPA 3V31A 5CBNA 5CEAA 3DEPA 2J8SD 5JA4D 3TWXA 5AQBA 4ZHBA 3D9HA 4DX5D 3NBNB 2BKGA 5CEDB 5CERB 3J5QB 4F1PA 2Y1LE 4HI8A 5EIDA 2DZOA 5ITZF 2BKKB 4ZFHA 2HE0A 3UXGA 2ETBA 4BETA 3TWWA 3B95A 2KXPC 1N11A 4K5BA 1S70B 2B0OE 3UI2A 1DC2A 4U8VD 2F8YA 3ZKJA 4G8LA 1BU9A 4ATZD 4HBDA 4DX2A 4HLLA 4OAVB 2RFAA 5ENSD 2P2CP 2XENA 1OY3D 5ENRD 5AQ7A 4TUMA 3TWTA 2ETCA 5CBOA 4LG6A 2XEEA 4BESA 4DUIA 2AJAA 3B7BA 4QQIA 4HI9A 3TWQA 1YCSB 4BSZB 4HRNA 4Z68A 3DEOA 3V2XA 4F6RD 5KNHD 4LNUD 4A63B 5EN5D 3C5RA 5FINA 4DX7D 1QYMA 4O1PA 2QC9A 5ENPD 3J5PA 2MYOA 1SVXA 4U95D 1IXVA 2Y0BG 3ZNGA 2XEHA 4BEPA 3Q9UC 2FO1E 1SW6A 2DVWA 5HRYA 4B93B 4DX6D 2VGEA 4OAUC 4U8YD 2JABA 4DX1A 5AAOA 5BXUA 4RLYA 4HB5A 3V79K 4HQDA 3ZU7B 5EYPF 3V30A 3F6QA 4BERA 1G3NB 2DZNA 1BI8B 2KBXA 1AWCB 1WG0A 1MX4A 4CYMD 3TWSA 2ZGGA 3AJIA 3IXEA 1MX6A 4K5CA 1UOHA 3Q9NC 4J8YA 5AN8A 4GPMA 5KWDA 2NYJA 1MJ0A 4GMRA 5AQAA 2RFMA 5EYLA 4LSZE 3KEAA 3HRAA 1YMPA 3V2OA 5AARA 4HNAD 2V4HC 5KNGA 1D9SA 3ZUVB 3TWVA 1N0QA 5ENQD 4YDYA 5JMND 4O1OA 1K1AA 5EIBE 3UTMA 5CECB 3NOGD 4CZ2D 1YYHA 2V5QC 2DWZA 1BI7B 1MX2A 4U96D 2XZTG 5AQ9A 3T8KA 1AP7A 3EU9A 1A5EA 1WDYA 3SO8A 3W9FA 1NFIE 2ZGDA 5FIOA 3EHQA 2F37A 3TWRA 2QYJA 4HRLA
chains in the Genus database with same CATH superfamily
1HZ4A 3S7BA 2IOLA 1S64A 2XZDG 4KYOB 3CGHA 4PDXA 1K1BA 3ONLA 4NIKA 3ENEA 4ILIA 4AM9A 4DX5D 5CEDB 5CERB 3CVNA 1JCRA 1EPUA 3TWWA 2KXPC 4EBAG 1OCRE 4DX2A 2IONA 5FQ4A 2R03A 2OEVA 3RU0A 3G2TA 2X6IA 4TUUA 3C5RA 1TNZA 1HXIA 5T3RA 4J8EA 3AG2E 4LNGA 4DX6D 4HOSA 2WXJA 1HX8A 1FT1A 1OCCE 3B7RL 2AXVA 3TG5A 1E8WA 3EDTB 1HG5A 1XNFA 3C3QA 4KT6B 4U96D 4CDRA 2AVPA 3SHFA 3LY7A 3ESLA 3UM1A 1RZ4A 1IHBA 1IQRA 3O48A 3BEEA 3UQ3A 3CHMA 3PEUB 1H6KA 3E34A 3ZN3A 3QC1A 4FHKA 3UKUG 2L6BA 2EINE 3PUJA 2GW1A 3OXFA 2FBNA 3IHYA 2BKGA 2XRYA 3MKRA 4L1BA 4IYPA 3UXGA 3U4TA 1UN9A 3MKQA 4FULA 3LVRE 3LJ3A 4ACLA 3E30A 5KJKA 1X5BA 3IEGA 3SI5A 4AXHA 1UG3A 3TWQA 2EIME 2WPVA 4A63B 2DIWA 4DX7D 4MBGA 5LOZA 3OXGA 5AENA 3DXKG 2P9UG 4H7YA 3LYAA 3PNTB 5EYPF 4N3AA 3HDXA 3Q15A 3CVQA 3SGHA 2Q7FA 3ZYMA 3DPDA 3G2WA 3AJIA 3EJNA 3BG0B 4LSZE 3HRAA 3QWWA 4BSXA 5AARA 4HNAD 4XIFA 1D9SA 4A55A 2I1KA 3UTMA 4JHRA 4LCTA 3SFXA 2RD0A 2X6KA 3MX3A 1JUQA 5FJYA 4JW1A 5ARGA 2ZGDA 2IO2C 4GA0A 4UI9C 3LJNA 4I6GA 3I4RB 2WQ6A 4HVBA 3ZFWA 3LY8A 3UT7A 1WM5A 1TNUA 3FU5A 5EILA 3L6AA 1OT8A 1LTXA 3DSVA 3U64A 3CVUA 1D8EA 3W9GA 2FI7A 2MHKA 4OAVB 5ENTD 2OVBA 1JWGA 1EDUA 3D3MA 1Z6TA 2IU1A 3B95A 3FEXA 1N11A 3I4GA 3B13A 4U0UA 3TXMA 4UI9K 5ARFA 5AQ7A 1DVPA 3NAWA 4RG6A 2GROB 2OV8A 5FT9A 3CQCB 1B89A 2P9KG 2OOEA 2H6GA 4EZLA 5ENPD 4PH4B 4BWRA 2YHCA 4HFGA 2XRZA 5HRYA 2HYZA 4G25A 3SF4A 3VLFA 1H0AA 3D9PA 2X6HA 4F3VA 3IXEA 5KWDA 3TL5A 4J8YA 3CKCA 3Q75A 3KSQA 3RRMB 3Q7AA 4FC8A 2YINA 3I3NA 4XE0A 3ZPJA 4B8CB 4AVXA 4BFRA 5EKQD 3OTNA 3AU4A 3FTUA 3EHQA 4PUCA 1ZB1A 3T8MA 1A17A 3DPYA 2GGFA 3JUIA 4G8KA 1MYOA 5FZRA 1HG2A 3FEYA 4YDWA 4HRMB 1ZBPA 1NL4A 3LCAA 3CHSA 4U04A 3JXJA 1SA4A 3D9NA 3JCKC 3D9HA 3NBNB 2MRIA 4GTRA 1WY6A 3CQGB 4I9CA 1N4PA 4YDEA 4G8LA 2L0IA 2R59A 3PE3A 4TUMA 4B94A 1IQUA 3FTSA 2J4BA 5BT1A 4GZ5A 2VTBB 3CKBA 4BSZB 4LRZA 3TGOA 2WMOA 2Y69E 5FINA 3QNKA 1EYHA 1VDYA 2XHEA 3G2SA 5LP0A 2CHXA 3APCA 5AAOA 4GAAA 1HFAA 3CHQA 1G3NB 1KT0A 1SZAA 4K5CA 4U8HA 3QKYA 1OWMA 2V5FA 2IJGX 4KVMA 3APDA 2CFUA 3TWVA 1HO8A 4UWHA 4FLHA 4JHJA 2XCBA 2DWZA 3UIPC 4JXTA 3ABME 3AS4A 4B89A 4V3IA 5D2MC 2UWJG 5ANLA 3TWRA 3BU8A 3SZ7A 4WWOA 2LXLA 3FTZA 5LCWC 1QBQA 4J6IA 2PNNA 2X6JA 1KPSB 2A5UA 2HO1A 2Y1LE 4TXQA 1DNPA 4I17A 2LO6A 2BKKB 3ONKA 5D0QD 3ZKJA 4C0EA 4GTPA 4ATGA 1PY1A 4BT9A 3HXFA 4DI4A 2IY0C 2C0MA 4N5CA 2ILRA 5KNHD 4LNUD 2ONDA 3LEWA 2MYOA 4DI3A 1FT2A 2V4LA 3FUFA 2VYIA 4AIFA 4JPSA 2KZTB 3PEVB 1MX6A 2WB2A 3Q9NC 2MOWA 1NP7A 4BT8A 3E37A 1TN8A 4U0ZA 1H6PA 1ZU2A 4O1OA 2KM4A 2VJ8A 3QWVA 3LXUX 3CVYA 3SO8A 2LAHA 3C3RA 4GZ3A 2VTBA 2QYJA 2PM7A 3HVEA 5CMYA 4N3BA 4B0ZA 3CK7A 4J7WA 2ETAA 1TNOA 2AXUA 4I6EA 3L17A 1OWLA 2BUGA 5HKPA 2NSZA 3DSSA 4N2QA 2XQ0A 5AYWD 4F1PA 1H2UA 3NB2A 5JJ7A 4I2ZA 4K5BA 3MCXA 2B0OE 1LF8A 5FQ6A 4H7XA 1OY3D 3DSTA 3RSEG 2J49A 4QQIA 5FZSA 3NZUA 3KSLA 3ZNGA 4LNBA 1SW6A 4LEUA 2LSVA 2C0LA 5CCLA 4DX1A 3V30A 1OWPA 5FWQA 4BERA 3E33A 1GW6A 3URZA 4XEIG 4AEZC 1WG0A 1MX4A 2B6CA 5G04C 3ZXPA 1H2VC 4GZ6A 3DSUA 3TG4A 1YMPA 3ASHA 2XCCA 3RO3A 3NOGD 4ANUA 4ACKA 2DBAA 4IULA 3U9WA 4L2YA 3Q49B 2Y4UA 2PL2A 4JVSA 3CVLA 2XS8A 2WMNA 5CMWA 4GYYA 3QB2A 4CRWA 2GRQB 1NA3A 1H19A 4GA2A 3PS6A 3NOCD 3V31A 1EF1C 3RJVA 3JQ1A 4GTTA 4EECA 3FFLA 1L5JA 1X81A 3I5PA 3L54A 1TEZA 5FZQA 4APOA 2V8SE 3ZHEB 3EUVA 4JL0A 4XI9A 4YVQC 5ENRD 3HYMB 4U07A 3TWTA 3DWLG 2KC7A 2PQNA 3MV2B 2I9CA 4AOFA 4YVOA 2Y0BG 3TJPA 3L22A 1OCOE 2GRPB 4XZ4A 3AG4E 4CDNA 2UY1A 4ANXA 2FEZA 3P1UA 5CRUA 4N3CA 4N39A 3LS8A 2VSNA 1QNFA 3MJWA 2P9SG 3FU6A 2VSYA 4WAFA 1N0QA 4KMOA 4HXIA 3CSTA 4MKTA 4GMJA 1OXJA 2E2EA 3CV0A 3EU9A 5CCMA 3D9KA 3VTXA 1LD7A 4EQFA 3AAAC 3PDNA 3JYSA 3ASDA 4GYOA 2I2OA 2WXPA 2PZIA 4WWNA 3Q79A 1BLXB 4GMLA 4OVVA 3QDNA 3LPZA 4JEUA 2AXZA 4C9BB 1TN7A 3B7UX 1S70B 3RK6A 4F7AA 1INZA 4BTBA 2ETCA 5CBOA 3FDHA 3B7BA 1IHGA 4CDMA 3DEOA 4K0RA 3IKOB 4LERA 2LUHA 3OAWA 2WXFA 5DBKA 3Q7FA 1ELKA 4FHJA 3D9IA 3L9TA 2VGXB 3ASFA 2CHZA 3HXBA 5BXUA 4UI9J 3ZXSA 2ZXWE 5LFAA 2CFZA 1BI8B 2KBXA 1Z5SC 2R5SA 4GTQA 4DLQA 2AW6A 1MJ0A 4YDOA 1HE8A 5EYLA 3ML9A 2H6IA 4OVUA 1N4RA 3CVPA 2WXGA 1N9AA 3QK0A 1KZPA 5KJMA 3CVVA 1MX2A 3CLJA 4EBAA 2A4ZA 4O6FA 3PE4A 3N71A 4HRLA 5A23A 1TR4A 5HI7A 4G23A 3SY2A 4HLEA 4NURA 4Q69A 3JXIA 4FLBA 1IKND 1DCEA 3EHRA 1MHQA 3FUNA 3UIOC 3AG1E 1HH8A 5AQBA 4ZHBA 3FTWA 4FJYA 2KCLA 2DZOA 2ETBA 2WQ7A 3P2BA 3CHRA 3FUJA 4G24A 3LKUA 3UX4A 4GCNA 2M63A 3G2VA 3S7DA 1QQEA 4HOTA 2ZIRA 4LG6A 3KAEA 4F6RD 5EN5D 1JWFA 2J07A 5E76A 4BEPA 1UJJA 4X8QA 2FO1E 2YNQA 5JJ6A 2VGEA 1TJFA 4A1SA 3UT8A 4RLYA 4FA6A 1TNYA 1SZ9A 1XGWA 4GCOA 4GB9A 1AWCB 4I1OB 1UW4B 3CR3A 3TWSA 2H6HA 3S7JA 4HOUA 4NACA 2RFMA 2HR2A 4EZJA 4I2WA 2C2LA 5AIJA 4APFA 3NQPA 5G05C 3RO2A 1FCHA 1BI7B 1O1TA 3MGBA 2J09A 1W3BA 3FTVA 3Q47B 3WG7E 4KXKB 2VQ2A 1FPPA 3IBEA 1U2VG 4TV3A 3DSXA 1K3ZD 4RVBA 2BTDA 3D9OA 4O60A 4GZDA 2WM9A 3UKRG 4KVOA 4Y6WA 3UUXA 3DEPA 2J8SD 2CG2A 1MZCA 2L9BA 4JC8A 2ZISA 3J5QB 5EIDA 4G26A 1PAQA 3T5XA 4AY5A 4CT4A 4ZFHA 3UM2A 5EX3A 4J8SA 3ML8A 2PQRA 4R7LA 3U66A 4ATZD 4L2LA 3L16A 3SBTB 1OUVA 1O5MA 4J8DA 4Y6CA 2XPZA 3LDZA 3C72A 4HS2A 1PC2A 4RG9A 4B93B 3PRZA 4C0MA 1KT1A 3BQOA 5G2NA 3ZU7B 4NQ0A 2BEDA 5LCWJ 3DRAA 3UINC 2ZGGA 1WAO1 3ULEG 4F53A 1ELRA 4G11A 4PS7A 1LD8A 4GPKA 4F1SA 4BX9A 3D9LA 1K1AA 3DBSA 3KEZA 4BTAA 5B3SE 2J4DA 2YQ8A 3AS8A 4IN3B 3FH5A 2CHWA 1JCQA 1WDYA 3EU5A 4UWGA 5JHBA 2F37A 3GZ1A 4N5QA 5ENOD 1FVFA 4DJAA 4I1MA 1TN6A 3NZSA 2DCPA 3L08A 4XKBA 3QOUA 2R2LA 4C48B 4W9RA 3Q4AB 3E32A 3QARA 5B1BE 3ASGA 1E8XA 3FP3A 2ZU6B 2LXMA 1QZ2A 5B1AE 3HIZA 3L82A 3JQ0A 1P5QA 4AJWA 5ITZF 2WXLA 2IOSA 2AWIA 4U8VD 4CT0A 5M72A 1Q2ZA 4HLLA 2XGMA 4ME2A 3RKVA 3SBSA 2QY7A 3CHPA 3SQVA 2XEEA 3PZ2A 1YCSB 3ZYQA 4ABNA 4HOQA 3PNLB 1E96B 5AJLA 2VGYA 4TXPA 4U95D 1E90A 4N2SA 3MKQB 4I1AA 4CGWA 2DVWA 5DIZA 3BG1B 2E0IA 2L0TB 3CHOA 1OCZE 3F6QA 2DZNA 3FUIA 2BF0X 2EIJE 5AJDA 5AN8A 2IF4A 3RRNB 4XI0A 4MS6A 5IY5E 3ULYA 3SNXA 5T8IA 4CZ2D 4GTSA 3T5VA 1YYHA 3BUAA 1JPLA 3HHMA 2LAIA 4CGVA 1NZNA 2WXQA 5AQ9A 1A5EA 3MA5A 3FWVA 2XS1A 2P9PG 2OVFA 4FADA 4JA7A 2R05A 1BD8A 3FH8A 1YA0A 5D66A 5FQ7A 4ANVA 4WNEA 5JJTA 3FUHA 5BXOA 2P58C 4A1GA 3PZ1A 5C1DA 1O1SA 2IEJA 1HS6A 3D9MA 3ZW3A 2Y4TA 3MYVA 2OEWA 1SQMA 4PS3A 1ELWA 1V55E 1N52A 5BNWA 4HBDA 5G04J 5A7DB 4K03A 4KZ0A 2XGOA 4JHKA 4BESA 4L23A 3ZRHA 4A3TA 3G2UA 2WQHA 4HRNA 2KZTA 4FU3A 3Q73A 1O1RA 2GRLA 3DXMG 1HF8A 4TRQA 3V79K 4HQDA 3ZYKA 4CCAA 2WXNA 5J08A 5HQ8A 3HXDA 4CYMD 2Y3AA 5AQAA 4AP2A 3V2OA 3RAUA 2DYRE 5CHEE 1HU3A 3IHVA 5CECB 4GZCA 4RSYA 1N95A 4WNDA 4BY6A 4DK5A 2GRRB 3AU5A 1UJKA 4YNDA 3LY9A 2VSOE 4MRUA 2WXOA 3JUEA 3C98A 1DCQA 2DYSE 2LSUA 4LUNU 3O4ZA 1H2TC 4IRUA 2FULA 3PZ3A 4URKA 1D8DA 4QFVA 4UQZA 1KLXA 3HG0D 5CBNA 3PH0C 2GRNB 3TWXA 5JA4D 2EQXA 5J90A 2YHEA 3KS2A 4I6JA 5LX8A 4BETA 4E6HA 4GA1A 3FUKA 1TNBA 1K8KG 4NRHB 1DC2A 2F8YA 2XGSA 2I1JA 3GZ2A 5H7PA 1Z3YA 4ILGA 3ZYLA 3FY4A 4EZKA 1FVHA 3SD5A 3MV3B 3ZIMA 3PUKA 3CVXA 1QYMA 4B8AA 4DLOA 3QWPA 4I9EA 2EIKE 3DSWA 1H6OA 2WXRA 4UQYA 4OAUC 4U8YD 3MZLB 2EILE 3ASOE 3LVQE 3ABKE 1E8YA 4FP7A 2GRMA 4GPMA 2NYJA 3FTYA 4CEMA 3TXNA 5BV1A 4JA9A 4GTOA 3IV0A 5D0OD 5ENQD 1OWNA 1N4QA 5EIBE 2FF4A 5JHAA 3ULQA 3VLDA 3FHEA 3ABLE 2OCCE 5BV0A 5CRVA 4E85A 3C3OA 3CSFA 2IO3C 3R7QA 3FH7A 4Q96A 3PREA 4UUCA 1MQSA 1S0PA 3GZSA 3UMVA 1N94A 3SFYA 4U0SA 4L7TA 4RQIA 4AV7A 4TXRA 3ZHEA 3TWUA 4JD2G 4JB8P 2VSXE 5CEAA 3CK8A 3SFZA 2WXMA 4GYWA 1V54E 4GTMA 4HI8A 3ASNE 3B7SA 4WNGA 1BU9A 2CG3A 5BW8C 2RFAA 5BPPA 2P2CP 3PZ4A 3HXEA 4UWLA 3R9AB 4OYSA 3QJZA 3B7TA 1Y6IA 4J0UA 2IQCA 2XEHA 3Q9UC 3UM3A 1U3CA 2JABA 3AS5A 3FULA 4GTVA 2XPIA 2KCKA 3S7FA 3U3WA 2I6HA 4WNFA 1S63A 4KZCA 5KCMA 1N54A 2WXIA 4UQXA 3EHNA 3ZUVB 1U3DA 2R02A 1TJCA 2QZAA 5JMND 3CVWA 3PVLA 3FUEA 2X3MA 1E7VA 4ILHB 3OXLA 3RRUA 3W9FA 3GYZA 3NF1A 4M3OA 3AG3E 2FO7A 4JZYA 1Y8MA 1E8ZA 3QAQA 2KATA 3R9MA 4JEHA 5KBAA 3ZVVA 5C2YA 2WVIA 2F8XK 5FTPA 3FUDA 3FU3A 3HVEB 4WWPA 4AY6A 2R17C 2WXHA 5E75A 3Q78A 2KCVA 2HE0A 4FJZA 3FUMA 1SA5A 2HM8A 3UI2A 3EIJA 2WXKA 4J8FA 2V0PA 5ENSD 2VGXA 2NC9A 5ANRA 2J9QA 5KJLA 4DUIA 1KZOA 2P9NG 1NI1A 2QFCA 2IFUA 1TYQG 2QC9A 5G05J 3KD7A 3J5PA 2J08A 1SVXA 4PS8A 4ANWA 4XKCA 4KBQA 3UPVA 1RW2A 5FQ8A 3D9JA 3RIBA 4BX8A 5KJNA 4HORA 4HB5A 3HXCA 1NA0A 3APFA 3CK9A 1OWOA 1UOHA 3KEAA 3X2QE 5EX0A 5KNGA 2V4HC 2XPYA 5BUZA 3UT4A 4YDYA 5EDSA 2V5QC 3VTYA 2X6FA 2XEVA 1JCSA 1NFIE 2P9IG 5FIOA 3CEQA 4HI9A 1N0RA 4G1TA 5HS0A 4DRXE 3FU0A 3UM0A 3T9KA 4G2VA 4UWFA 2NXPA 2RG8A 4K5AB 3MEKA 3ESKA 3FTXA 2A5EA 1N4SA 3Q5MA 5ENNA 3TAXA 4EPZA 2RKKA 2QYUA 3E4BA 4I43A 1IYGA 4WUYA 5A6CA 3VLEA 2XENA 2PM6A 3K9IA 4MLPA 2AJAA 4Z68A 4L9PA 3V2XA 3ISMC 4GU5A 3ZEFA 4O1PA 1IXVA 3PZDA 4XX5A 2LNIA 3GW4A 4DPRA 2H6FA 4P29A 2JLBA 3EHMA 4D10C 3L13A 3CIAA 1UN8A 3S2AA 1Z3XA 3ZGQA 2F0YA 5T4YA 2X38A 3EIQC 4GMRA 4U7EB 4Q94A 3WXXA 4M7CA 1BPOA 2UY1B 2JEKA 2L6JA 4UWKA 2XZTG 3T8KA 4EHMA 1AP7A 3R7RA 5G55A 1E7UA 2P9LG 4U63A 4A3VA
chains in the Genus database with same CATH topology
1N0RA 4N5QA 3LJNA 5ENOD 5HS0A 4DRXE 1IHBA 1TR4A 3JUEA 3AAAC 4G8KA 1DCQA 4J7WA 4UUCA 1MYOA 2XZDG 3T9KA 1K3ZD 5EILA 1BD8A 5D66A 2ETAA 1OT8A 4YDWA 4HRMB 1K1BA 4K5AB 5KBAA 3W9GA 3JXIA 4O60A 2A5EA 1IKND 4C48B 2PNNA 3NOCD 3EHRA 3TWUA 4QFVA 5BXOA 2F8XK 2L6BA 1BLXB 3HG0D 4JB8P 3JXJA 5ENTD 4NIKA 5HKPA 3V31A 5CBNA 5CEAA 3DEPA 2J8SD 5JA4D 3TWXA 5AQBA 4ZHBA 3D9HA 4DX5D 3NBNB 2BKGA 5CEDB 5CERB 3J5QB 4F1PA 2Y1LE 4HI8A 5EIDA 2DZOA 5ITZF 2BKKB 4ZFHA 2HE0A 3UXGA 2ETBA 4BETA 3TWWA 3B95A 2KXPC 1N11A 4K5BA 1S70B 2B0OE 3UI2A 1DC2A 4U8VD 2F8YA 3ZKJA 4G8LA 1BU9A 4ATZD 4HBDA 4DX2A 4HLLA 4OAVB 2RFAA 5ENSD 2P2CP 2XENA 1OY3D 5ENRD 5AQ7A 4TUMA 3TWTA 2ETCA 5CBOA 4LG6A 2XEEA 4BESA 4DUIA 2AJAA 3B7BA 4QQIA 4HI9A 3TWQA 1YCSB 4BSZB 4HRNA 4Z68A 3DEOA 3V2XA 4F6RD 5KNHD 4LNUD 4A63B 5EN5D 3C5RA 5FINA 4DX7D 1QYMA 4O1PA 2QC9A 5ENPD 3J5PA 2MYOA 1SVXA 4U95D 1IXVA 2Y0BG 3ZNGA 2XEHA 4BEPA 3Q9UC 2FO1E 1SW6A 2DVWA 5HRYA 4B93B 4DX6D 2VGEA 4OAUC 4U8YD 2JABA 4DX1A 5AAOA 5BXUA 4RLYA 4HB5A 3V79K 4HQDA 3ZU7B 5EYPF 3V30A 3F6QA 4BERA 1G3NB 2DZNA 1BI8B 2KBXA 1AWCB 1WG0A 1MX4A 4CYMD 3TWSA 2ZGGA 3AJIA 3IXEA 1MX6A 4K5CA 1UOHA 3Q9NC 4J8YA 5AN8A 4GPMA 5KWDA 2NYJA 1MJ0A 4GMRA 5AQAA 2RFMA 5EYLA 4LSZE 3KEAA 3HRAA 1YMPA 3V2OA 5AARA 4HNAD 2V4HC 5KNGA 1D9SA 3ZUVB 3TWVA 1N0QA 5ENQD 4YDYA 5JMND 4O1OA 1K1AA 5EIBE 3UTMA 5CECB 3NOGD 4CZ2D 1YYHA 2V5QC 2DWZA 1BI7B 1MX2A 4U96D 2XZTG 5AQ9A 3T8KA 1AP7A 3EU9A 1A5EA 1WDYA 3SO8A 3W9FA 1NFIE 2ZGDA 5FIOA 3EHQA 2F37A 3TWRA 2QYJA 4HRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0R A;  4N5Q A;  3LJN A;  5ENO D;  5HS0 A;  4DRX E;  1IHB A;  1TR4 A;  3JUE A;  3AAA C;  4G8K A;  1DCQ A;  4J7W A;  4UUC A;  1MYO A;  2XZD G;  3T9K A;  1K3Z D;  5EIL A;  1BD8 A;  5D66 A;  2ETA A;  1OT8 A;  4YDW A;  4HRM B;  1K1B A;  4K5A B;  5KBA A;  3W9G A;  3JXI A;  4O60 A;  2A5E A;  1IKN D;  4C48 B;  2PNN A;  3NOC D;  3EHR A;  3TWU A;  4QFV A;  5BXO A;  2F8X K;  2L6B A;  1BLX B;  3HG0 D;  4JB8 P;  3JXJ A;  5ENT D;  4NIK A;  5HKP A;  3V31 A;  5CBN A;  5CEA A;  3DEP A;  2J8S D;  5JA4 D;  3TWX A;  5AQB A;  4ZHB A;  3D9H A;  4DX5 D;  3NBN B;  2BKG A;  5CED B;  5CER B;  3J5Q B;  4F1P A;  2Y1L E;  4HI8 A;  5EID A;  2DZO A;  5ITZ F;  2BKK B;  4ZFH A;  2HE0 A;  3UXG A;  2ETB A;  4BET A;  3TWW A;  3B95 A;  2KXP C;  1N11 A;  4K5B A;  1S70 B;  2B0O E;  3UI2 A;  1DC2 A;  4U8V D;  2F8Y A;  3ZKJ A;  4G8L A;  1BU9 A;  4ATZ D;  4HBD A;  4DX2 A;  4HLL A;  4OAV B;  2RFA A;  5ENS D;  2P2C P;  2XEN A;  1OY3 D;  5ENR D;  5AQ7 A;  4TUM A;  3TWT A;  2ETC A;  5CBO A;  4LG6 A;  2XEE A;  4BES A;  4DUI A;  2AJA A;  3B7B A;  4QQI A;  4HI9 A;  3TWQ A;  1YCS B;  4BSZ B;  4HRN A;  4Z68 A;  3DEO A;  3V2X A;  4F6R D;  5KNH D;  4LNU D;  4A63 B;  5EN5 D;  3C5R A;  5FIN A;  4DX7 D;  1QYM A;  4O1P A;  2QC9 A;  5ENP D;  3J5P A;  2MYO A;  1SVX A;  4U95 D;  1IXV A;  2Y0B G;  3ZNG A;  2XEH A;  4BEP A;  3Q9U C;  2FO1 E;  1SW6 A;  2DVW A;  5HRY A;  4B93 B;  4DX6 D;  2VGE A;  4OAU C;  4U8Y D;  2JAB A;  4DX1 A;  5AAO A;  5BXU A;  4RLY A;  4HB5 A;  3V79 K;  4HQD A;  3ZU7 B;  5EYP F;  3V30 A;  3F6Q A;  4BER A;  1G3N B;  2DZN A;  1BI8 B;  2KBX A;  1AWC B;  1WG0 A;  1MX4 A;  4CYM D;  3TWS A;  2ZGG A;  3AJI A;  3IXE A;  1MX6 A;  4K5C A;  1UOH A;  3Q9N C;  4J8Y A;  5AN8 A;  4GPM A;  5KWD A;  2NYJ A;  1MJ0 A;  4GMR A;  5AQA A;  2RFM A;  5EYL A;  4LSZ E;  3KEA A;  3HRA A;  1YMP A;  3V2O A;  5AAR A;  4HNA D;  2V4H C;  5KNG A;  1D9S A;  3ZUV B;  3TWV A;  1N0Q A;  5ENQ D;  4YDY A;  5JMN D;  4O1O A;  1K1A A;  5EIB E;  3UTM A;  5CEC B;  3NOG D;  4CZ2 D;  1YYH A;  2V5Q C;  2DWZ A;  1BI7 B;  1MX2 A;  4U96 D;  2XZT G;  5AQ9 A;  3T8K A;  1AP7 A;  3EU9 A;  1A5E A;  1WDY A;  3SO8 A;  3W9F A;  1NFI E;  2ZGD A;  5FIO A;  3EHQ A;  2F37 A;  3TWR A;  2QYJ A;  4HRL A; 
#chains in the Genus database with same CATH topology
 1HZ4 A;  3S7B A;  2IOL A;  1S64 A;  2XZD G;  4KYO B;  3CGH A;  4PDX A;  1K1B A;  3ONL A;  4NIK A;  3ENE A;  4ILI A;  4AM9 A;  4DX5 D;  5CED B;  5CER B;  3CVN A;  1JCR A;  1EPU A;  3TWW A;  2KXP C;  4EBA G;  1OCR E;  4DX2 A;  2ION A;  5FQ4 A;  2R03 A;  2OEV A;  3RU0 A;  3G2T A;  2X6I A;  4TUU A;  3C5R A;  1TNZ A;  1HXI A;  5T3R A;  4J8E A;  3AG2 E;  4LNG A;  4DX6 D;  4HOS A;  2WXJ A;  1HX8 A;  1FT1 A;  1OCC E;  3B7R L;  2AXV A;  3TG5 A;  1E8W A;  3EDT B;  1HG5 A;  1XNF A;  3C3Q A;  4KT6 B;  4U96 D;  4CDR A;  2AVP A;  3SHF A;  3LY7 A;  3ESL A;  3UM1 A;  1RZ4 A;  1IHB A;  1IQR A;  3O48 A;  3BEE A;  3UQ3 A;  3CHM A;  3PEU B;  1H6K A;  3E34 A;  3ZN3 A;  3QC1 A;  4FHK A;  3UKU G;  2L6B A;  2EIN E;  3PUJ A;  2GW1 A;  3OXF A;  2FBN A;  3IHY A;  2BKG A;  2XRY A;  3MKR A;  4L1B A;  4IYP A;  3UXG A;  3U4T A;  1UN9 A;  3MKQ A;  4FUL A;  3LVR E;  3LJ3 A;  4ACL A;  3E30 A;  5KJK A;  1X5B A;  3IEG A;  3SI5 A;  4AXH A;  1UG3 A;  3TWQ A;  2EIM E;  2WPV A;  4A63 B;  2DIW A;  4DX7 D;  4MBG A;  5LOZ A;  3OXG A;  5AEN A;  3DXK G;  2P9U G;  4H7Y A;  3LYA A;  3PNT B;  5EYP F;  4N3A A;  3HDX A;  3Q15 A;  3CVQ A;  3SGH A;  2Q7F A;  3ZYM A;  3DPD A;  3G2W A;  3AJI A;  3EJN A;  3BG0 B;  4LSZ E;  3HRA A;  3QWW A;  4BSX A;  5AAR A;  4HNA D;  4XIF A;  1D9S A;  4A55 A;  2I1K A;  3UTM A;  4JHR A;  4LCT A;  3SFX A;  2RD0 A;  2X6K A;  3MX3 A;  1JUQ A;  5FJY A;  4JW1 A;  5ARG A;  2ZGD A;  2IO2 C;  4GA0 A;  4UI9 C;  3LJN A;  4I6G A;  3I4R B;  2WQ6 A;  4HVB A;  3ZFW A;  3LY8 A;  3UT7 A;  1WM5 A;  1TNU A;  3FU5 A;  5EIL A;  3L6A A;  1OT8 A;  1LTX A;  3DSV A;  3U64 A;  3CVU A;  1D8E A;  3W9G A;  2FI7 A;  2MHK A;  4OAV B;  5ENT D;  2OVB A;  1JWG A;  1EDU A;  3D3M A;  1Z6T A;  2IU1 A;  3B95 A;  3FEX A;  1N11 A;  3I4G A;  3B13 A;  4U0U A;  3TXM A;  4UI9 K;  5ARF A;  5AQ7 A;  1DVP A;  3NAW A;  4RG6 A;  2GRO B;  2OV8 A;  5FT9 A;  3CQC B;  1B89 A;  2P9K G;  2OOE A;  2H6G A;  4EZL A;  5ENP D;  4PH4 B;  4BWR A;  2YHC A;  4HFG A;  2XRZ A;  5HRY A;  2HYZ A;  4G25 A;  3SF4 A;  3VLF A;  1H0A A;  3D9P A;  2X6H A;  4F3V A;  3IXE A;  5KWD A;  3TL5 A;  4J8Y A;  3CKC A;  3Q75 A;  3KSQ A;  3RRM B;  3Q7A A;  4FC8 A;  2YIN A;  3I3N A;  4XE0 A;  3ZPJ A;  4B8C B;  4AVX A;  4BFR A;  5EKQ D;  3OTN A;  3AU4 A;  3FTU A;  3EHQ A;  4PUC A;  1ZB1 A;  3T8M A;  1A17 A;  3DPY A;  2GGF A;  3JUI A;  4G8K A;  1MYO A;  5FZR A;  1HG2 A;  3FEY A;  4YDW A;  4HRM B;  1ZBP A;  1NL4 A;  3LCA A;  3CHS A;  4U04 A;  3JXJ A;  1SA4 A;  3D9N A;  3JCK C;  3D9H A;  3NBN B;  2MRI A;  4GTR A;  1WY6 A;  3CQG B;  4I9C A;  1N4P A;  4YDE A;  4G8L A;  2L0I A;  2R59 A;  3PE3 A;  4TUM A;  4B94 A;  1IQU A;  3FTS A;  2J4B A;  5BT1 A;  4GZ5 A;  2VTB B;  3CKB A;  4BSZ B;  4LRZ A;  3TGO A;  2WMO A;  2Y69 E;  5FIN A;  3QNK A;  1EYH A;  1VDY A;  2XHE A;  3G2S A;  5LP0 A;  2CHX A;  3APC A;  5AAO A;  4GAA A;  1HFA A;  3CHQ A;  1G3N B;  1KT0 A;  1SZA A;  4K5C A;  4U8H A;  3QKY A;  1OWM A;  2V5F A;  2IJG X;  4KVM A;  3APD A;  2CFU A;  3TWV A;  1HO8 A;  4UWH A;  4FLH A;  4JHJ A;  2XCB A;  2DWZ A;  3UIP C;  4JXT A;  3ABM E;  3AS4 A;  4B89 A;  4V3I A;  5D2M C;  2UWJ G;  5ANL A;  3TWR A;  3BU8 A;  3SZ7 A;  4WWO A;  2LXL A;  3FTZ A;  5LCW C;  1QBQ A;  4J6I A;  2PNN A;  2X6J A;  1KPS B;  2A5U A;  2HO1 A;  2Y1L E;  4TXQ A;  1DNP A;  4I17 A;  2LO6 A;  2BKK B;  3ONK A;  5D0Q D;  3ZKJ A;  4C0E A;  4GTP A;  4ATG A;  1PY1 A;  4BT9 A;  3HXF A;  4DI4 A;  2IY0 C;  2C0M A;  4N5C A;  2ILR A;  5KNH D;  4LNU D;  2OND A;  3LEW A;  2MYO A;  4DI3 A;  1FT2 A;  2V4L A;  3FUF A;  2VYI A;  4AIF A;  4JPS A;  2KZT B;  3PEV B;  1MX6 A;  2WB2 A;  3Q9N C;  2MOW A;  1NP7 A;  4BT8 A;  3E37 A;  1TN8 A;  4U0Z A;  1H6P A;  1ZU2 A;  4O1O A;  2KM4 A;  2VJ8 A;  3QWV A;  3LXU X;  3CVY A;  3SO8 A;  2LAH A;  3C3R A;  4GZ3 A;  2VTB A;  2QYJ A;  2PM7 A;  3HVE A;  5CMY A;  4N3B A;  4B0Z A;  3CK7 A;  4J7W A;  2ETA A;  1TNO A;  2AXU A;  4I6E A;  3L17 A;  1OWL A;  2BUG A;  5HKP A;  2NSZ A;  3DSS A;  4N2Q A;  2XQ0 A;  5AYW D;  4F1P A;  1H2U A;  3NB2 A;  5JJ7 A;  4I2Z A;  4K5B A;  3MCX A;  2B0O E;  1LF8 A;  5FQ6 A;  4H7X A;  1OY3 D;  3DST A;  3RSE G;  2J49 A;  4QQI A;  5FZS A;  3NZU A;  3KSL A;  3ZNG A;  4LNB A;  1SW6 A;  4LEU A;  2LSV A;  2C0L A;  5CCL A;  4DX1 A;  3V30 A;  1OWP A;  5FWQ A;  4BER A;  3E33 A;  1GW6 A;  3URZ A;  4XEI G;  4AEZ C;  1WG0 A;  1MX4 A;  2B6C A;  5G04 C;  3ZXP A;  1H2V C;  4GZ6 A;  3DSU A;  3TG4 A;  1YMP A;  3ASH A;  2XCC A;  3RO3 A;  3NOG D;  4ANU A;  4ACK A;  2DBA A;  4IUL A;  3U9W A;  4L2Y A;  3Q49 B;  2Y4U A;  2PL2 A;  4JVS A;  3CVL A;  2XS8 A;  2WMN A;  5CMW A;  4GYY A;  3QB2 A;  4CRW A;  2GRQ B;  1NA3 A;  1H19 A;  4GA2 A;  3PS6 A;  3NOC D;  3V31 A;  1EF1 C;  3RJV A;  3JQ1 A;  4GTT A;  4EEC A;  3FFL A;  1L5J A;  1X81 A;  3I5P A;  3L54 A;  1TEZ A;  5FZQ A;  4APO A;  2V8S E;  3ZHE B;  3EUV A;  4JL0 A;  4XI9 A;  4YVQ C;  5ENR D;  3HYM B;  4U07 A;  3TWT A;  3DWL G;  2KC7 A;  2PQN A;  3MV2 B;  2I9C A;  4AOF A;  4YVO A;  2Y0B G;  3TJP A;  3L22 A;  1OCO E;  2GRP B;  4XZ4 A;  3AG4 E;  4CDN A;  2UY1 A;  4ANX A;  2FEZ A;  3P1U A;  5CRU A;  4N3C A;  4N39 A;  3LS8 A;  2VSN A;  1QNF A;  3MJW A;  2P9S G;  3FU6 A;  2VSY A;  4WAF A;  1N0Q A;  4KMO A;  4HXI A;  3CST A;  4MKT A;  4GMJ A;  1OXJ A;  2E2E A;  3CV0 A;  3EU9 A;  5CCM A;  3D9K A;  3VTX A;  1LD7 A;  4EQF A;  3AAA C;  3PDN A;  3JYS A;  3ASD A;  4GYO A;  2I2O A;  2WXP A;  2PZI A;  4WWN A;  3Q79 A;  1BLX B;  4GML A;  4OVV A;  3QDN A;  3LPZ A;  4JEU A;  2AXZ A;  4C9B B;  1TN7 A;  3B7U X;  1S70 B;  3RK6 A;  4F7A A;  1INZ A;  4BTB A;  2ETC A;  5CBO A;  3FDH A;  3B7B A;  1IHG A;  4CDM A;  3DEO A;  4K0R A;  3IKO B;  4LER A;  2LUH A;  3OAW A;  2WXF A;  5DBK A;  3Q7F A;  1ELK A;  4FHJ A;  3D9I A;  3L9T A;  2VGX B;  3ASF A;  2CHZ A;  3HXB A;  5BXU A;  4UI9 J;  3ZXS A;  2ZXW E;  5LFA A;  2CFZ A;  1BI8 B;  2KBX A;  1Z5S C;  2R5S A;  4GTQ A;  4DLQ A;  2AW6 A;  1MJ0 A;  4YDO A;  1HE8 A;  5EYL A;  3ML9 A;  2H6I A;  4OVU A;  1N4R A;  3CVP A;  2WXG A;  1N9A A;  3QK0 A;  1KZP A;  5KJM A;  3CVV A;  1MX2 A;  3CLJ A;  4EBA A;  2A4Z A;  4O6F A;  3PE4 A;  3N71 A;  4HRL A;  5A23 A;  1TR4 A;  5HI7 A;  4G23 A;  3SY2 A;  4HLE A;  4NUR A;  4Q69 A;  3JXI A;  4FLB A;  1IKN D;  1DCE A;  3EHR A;  1MHQ A;  3FUN A;  3UIO C;  3AG1 E;  1HH8 A;  5AQB A;  4ZHB A;  3FTW A;  4FJY A;  2KCL A;  2DZO A;  2ETB A;  2WQ7 A;  3P2B A;  3CHR A;  3FUJ A;  4G24 A;  3LKU A;  3UX4 A;  4GCN A;  2M63 A;  3G2V A;  3S7D A;  1QQE A;  4HOT A;  2ZIR A;  4LG6 A;  3KAE A;  4F6R D;  5EN5 D;  1JWF A;  2J07 A;  5E76 A;  4BEP A;  1UJJ A;  4X8Q A;  2FO1 E;  2YNQ A;  5JJ6 A;  2VGE A;  1TJF A;  4A1S A;  3UT8 A;  4RLY A;  4FA6 A;  1TNY A;  1SZ9 A;  1XGW A;  4GCO A;  4GB9 A;  1AWC B;  4I1O B;  1UW4 B;  3CR3 A;  3TWS A;  2H6H A;  3S7J A;  4HOU A;  4NAC A;  2RFM A;  2HR2 A;  4EZJ A;  4I2W A;  2C2L A;  5AIJ A;  4APF A;  3NQP A;  5G05 C;  3RO2 A;  1FCH A;  1BI7 B;  1O1T A;  3MGB A;  2J09 A;  1W3B A;  3FTV A;  3Q47 B;  3WG7 E;  4KXK B;  2VQ2 A;  1FPP A;  3IBE A;  1U2V G;  4TV3 A;  3DSX A;  1K3Z D;  4RVB A;  2BTD A;  3D9O A;  4O60 A;  4GZD A;  2WM9 A;  3UKR G;  4KVO A;  4Y6W A;  3UUX A;  3DEP A;  2J8S D;  2CG2 A;  1MZC A;  2L9B A;  4JC8 A;  2ZIS A;  3J5Q B;  5EID A;  4G26 A;  1PAQ A;  3T5X A;  4AY5 A;  4CT4 A;  4ZFH A;  3UM2 A;  5EX3 A;  4J8S A;  3ML8 A;  2PQR A;  4R7L A;  3U66 A;  4ATZ D;  4L2L A;  3L16 A;  3SBT B;  1OUV A;  1O5M A;  4J8D A;  4Y6C A;  2XPZ A;  3LDZ A;  3C72 A;  4HS2 A;  1PC2 A;  4RG9 A;  4B93 B;  3PRZ A;  4C0M A;  1KT1 A;  3BQO A;  5G2N A;  3ZU7 B;  4NQ0 A;  2BED A;  5LCW J;  3DRA A;  3UIN C;  2ZGG A;  1WAO 1;  3ULE G;  4F53 A;  1ELR A;  4G11 A;  4PS7 A;  1LD8 A;  4GPK A;  4F1S A;  4BX9 A;  3D9L A;  1K1A A;  3DBS A;  3KEZ A;  4BTA A;  5B3S E;  2J4D A;  2YQ8 A;  3AS8 A;  4IN3 B;  3FH5 A;  2CHW A;  1JCQ A;  1WDY A;  3EU5 A;  4UWG A;  5JHB A;  2F37 A;  3GZ1 A;  4N5Q A;  5ENO D;  1FVF A;  4DJA A;  4I1M A;  1TN6 A;  3NZS A;  2DCP A;  3L08 A;  4XKB A;  3QOU A;  2R2L A;  4C48 B;  4W9R A;  3Q4A B;  3E32 A;  3QAR A;  5B1B E;  3ASG A;  1E8X A;  3FP3 A;  2ZU6 B;  2LXM A;  1QZ2 A;  5B1A E;  3HIZ A;  3L82 A;  3JQ0 A;  1P5Q A;  4AJW A;  5ITZ F;  2WXL A;  2IOS A;  2AWI A;  4U8V D;  4CT0 A;  5M72 A;  1Q2Z A;  4HLL A;  2XGM A;  4ME2 A;  3RKV A;  3SBS A;  2QY7 A;  3CHP A;  3SQV A;  2XEE A;  3PZ2 A;  1YCS B;  3ZYQ A;  4ABN A;  4HOQ A;  3PNL B;  1E96 B;  5AJL A;  2VGY A;  4TXP A;  4U95 D;  1E90 A;  4N2S A;  3MKQ B;  4I1A A;  4CGW A;  2DVW A;  5DIZ A;  3BG1 B;  2E0I A;  2L0T B;  3CHO A;  1OCZ E;  3F6Q A;  2DZN A;  3FUI A;  2BF0 X;  2EIJ E;  5AJD A;  5AN8 A;  2IF4 A;  3RRN B;  4XI0 A;  4MS6 A;  5IY5 E;  3ULY A;  3SNX A;  5T8I A;  4CZ2 D;  4GTS A;  3T5V A;  1YYH A;  3BUA A;  1JPL A;  3HHM A;  2LAI A;  4CGV A;  1NZN A;  2WXQ A;  5AQ9 A;  1A5E A;  3MA5 A;  3FWV A;  2XS1 A;  2P9P G;  2OVF A;  4FAD A;  4JA7 A;  2R05 A;  1BD8 A;  3FH8 A;  1YA0 A;  5D66 A;  5FQ7 A;  4ANV A;  4WNE A;  5JJT A;  3FUH A;  5BXO A;  2P58 C;  4A1G A;  3PZ1 A;  5C1D A;  1O1S A;  2IEJ A;  1HS6 A;  3D9M A;  3ZW3 A;  2Y4T A;  3MYV A;  2OEW A;  1SQM A;  4PS3 A;  1ELW A;  1V55 E;  1N52 A;  5BNW A;  4HBD A;  5G04 J;  5A7D B;  4K03 A;  4KZ0 A;  2XGO A;  4JHK A;  4BES A;  4L23 A;  3ZRH A;  4A3T A;  3G2U A;  2WQH A;  4HRN A;  2KZT A;  4FU3 A;  3Q73 A;  1O1R A;  2GRL A;  3DXM G;  1HF8 A;  4TRQ A;  3V79 K;  4HQD A;  3ZYK A;  4CCA A;  2WXN A;  5J08 A;  5HQ8 A;  3HXD A;  4CYM D;  2Y3A A;  5AQA A;  4AP2 A;  3V2O A;  3RAU A;  2DYR E;  5CHE E;  1HU3 A;  3IHV A;  5CEC B;  4GZC A;  4RSY A;  1N95 A;  4WND A;  4BY6 A;  4DK5 A;  2GRR B;  3AU5 A;  1UJK A;  4YND A;  3LY9 A;  2VSO E;  4MRU A;  2WXO A;  3JUE A;  3C98 A;  1DCQ A;  2DYS E;  2LSU A;  4LUN U;  3O4Z A;  1H2T C;  4IRU A;  2FUL A;  3PZ3 A;  4URK A;  1D8D A;  4QFV A;  4UQZ A;  1KLX A;  3HG0 D;  5CBN A;  3PH0 C;  2GRN B;  3TWX A;  5JA4 D;  2EQX A;  5J90 A;  2YHE A;  3KS2 A;  4I6J A;  5LX8 A;  4BET A;  4E6H A;  4GA1 A;  3FUK A;  1TNB A;  1K8K G;  4NRH B;  1DC2 A;  2F8Y A;  2XGS A;  2I1J A;  3GZ2 A;  5H7P A;  1Z3Y A;  4ILG A;  3ZYL A;  3FY4 A;  4EZK A;  1FVH A;  3SD5 A;  3MV3 B;  3ZIM A;  3PUK A;  3CVX A;  1QYM A;  4B8A A;  4DLO A;  3QWP A;  4I9E A;  2EIK E;  3DSW A;  1H6O A;  2WXR A;  4UQY A;  4OAU C;  4U8Y D;  3MZL B;  2EIL E;  3ASO E;  3LVQ E;  3ABK E;  1E8Y A;  4FP7 A;  2GRM A;  4GPM A;  2NYJ A;  3FTY A;  4CEM A;  3TXN A;  5BV1 A;  4JA9 A;  4GTO A;  3IV0 A;  5D0O D;  5ENQ D;  1OWN A;  1N4Q A;  5EIB E;  2FF4 A;  5JHA A;  3ULQ A;  3VLD A;  3FHE A;  3ABL E;  2OCC E;  5BV0 A;  5CRV A;  4E85 A;  3C3O A;  3CSF A;  2IO3 C;  3R7Q A;  3FH7 A;  4Q96 A;  3PRE A;  4UUC A;  1MQS A;  1S0P A;  3GZS A;  3UMV A;  1N94 A;  3SFY A;  4U0S A;  4L7T A;  4RQI A;  4AV7 A;  4TXR A;  3ZHE A;  3TWU A;  4JD2 G;  4JB8 P;  2VSX E;  5CEA A;  3CK8 A;  3SFZ A;  2WXM A;  4GYW A;  1V54 E;  4GTM A;  4HI8 A;  3ASN E;  3B7S A;  4WNG A;  1BU9 A;  2CG3 A;  5BW8 C;  2RFA A;  5BPP A;  2P2C P;  3PZ4 A;  3HXE A;  4UWL A;  3R9A B;  4OYS A;  3QJZ A;  3B7T A;  1Y6I A;  4J0U A;  2IQC A;  2XEH A;  3Q9U C;  3UM3 A;  1U3C A;  2JAB A;  3AS5 A;  3FUL A;  4GTV A;  2XPI A;  2KCK A;  3S7F A;  3U3W A;  2I6H A;  4WNF A;  1S63 A;  4KZC A;  5KCM A;  1N54 A;  2WXI A;  4UQX A;  3EHN A;  3ZUV B;  1U3D A;  2R02 A;  1TJC A;  2QZA A;  5JMN D;  3CVW A;  3PVL A;  3FUE A;  2X3M A;  1E7V A;  4ILH B;  3OXL A;  3RRU A;  3W9F A;  3GYZ A;  3NF1 A;  4M3O A;  3AG3 E;  2FO7 A;  4JZY A;  1Y8M A;  1E8Z A;  3QAQ A;  2KAT A;  3R9M A;  4JEH A;  5KBA A;  3ZVV A;  5C2Y A;  2WVI A;  2F8X K;  5FTP A;  3FUD A;  3FU3 A;  3HVE B;  4WWP A;  4AY6 A;  2R17 C;  2WXH A;  5E75 A;  3Q78 A;  2KCV A;  2HE0 A;  4FJZ A;  3FUM A;  1SA5 A;  2HM8 A;  3UI2 A;  3EIJ A;  2WXK A;  4J8F A;  2V0P A;  5ENS D;  2VGX A;  2NC9 A;  5ANR A;  2J9Q A;  5KJL A;  4DUI A;  1KZO A;  2P9N G;  1NI1 A;  2QFC A;  2IFU A;  1TYQ G;  2QC9 A;  5G05 J;  3KD7 A;  3J5P A;  2J08 A;  1SVX A;  4PS8 A;  4ANW A;  4XKC A;  4KBQ A;  3UPV A;  1RW2 A;  5FQ8 A;  3D9J A;  3RIB A;  4BX8 A;  5KJN A;  4HOR A;  4HB5 A;  3HXC A;  1NA0 A;  3APF A;  3CK9 A;  1OWO A;  1UOH A;  3KEA A;  3X2Q E;  5EX0 A;  5KNG A;  2V4H C;  2XPY A;  5BUZ A;  3UT4 A;  4YDY A;  5EDS A;  2V5Q C;  3VTY A;  2X6F A;  2XEV A;  1JCS A;  1NFI E;  2P9I G;  5FIO A;  3CEQ A;  4HI9 A;  1N0R A;  4G1T A;  5HS0 A;  4DRX E;  3FU0 A;  3UM0 A;  3T9K A;  4G2V A;  4UWF A;  2NXP A;  2RG8 A;  4K5A B;  3MEK A;  3ESK A;  3FTX A;  2A5E A;  1N4S A;  3Q5M A;  5ENN A;  3TAX A;  4EPZ A;  2RKK A;  2QYU A;  3E4B A;  4I43 A;  1IYG A;  4WUY A;  5A6C A;  3VLE A;  2XEN A;  2PM6 A;  3K9I A;  4MLP A;  2AJA A;  4Z68 A;  4L9P A;  3V2X A;  3ISM C;  4GU5 A;  3ZEF A;  4O1P A;  1IXV A;  3PZD A;  4XX5 A;  2LNI A;  3GW4 A;  4DPR A;  2H6F A;  4P29 A;  2JLB A;  3EHM A;  4D10 C;  3L13 A;  3CIA A;  1UN8 A;  3S2A A;  1Z3X A;  3ZGQ A;  2F0Y A;  5T4Y A;  2X38 A;  3EIQ C;  4GMR A;  4U7E B;  4Q94 A;  3WXX A;  4M7C A;  1BPO A;  2UY1 B;  2JEK A;  2L6J A;  4UWK A;  2XZT G;  3T8K A;  4EHM A;  1AP7 A;  3R7R A;  5G55 A;  1E7U A;  2P9L G;  4U63 A;  4A3V A; 
#chains in the Genus database with same CATH homology
 1N0R A;  4N5Q A;  3LJN A;  5ENO D;  5HS0 A;  4DRX E;  1IHB A;  1TR4 A;  3JUE A;  3AAA C;  4G8K A;  1DCQ A;  4J7W A;  4UUC A;  1MYO A;  2XZD G;  3T9K A;  1K3Z D;  5EIL A;  1BD8 A;  5D66 A;  2ETA A;  1OT8 A;  4YDW A;  4HRM B;  1K1B A;  4K5A B;  5KBA A;  3W9G A;  3JXI A;  4O60 A;  2A5E A;  1IKN D;  4C48 B;  2PNN A;  3NOC D;  3EHR A;  3TWU A;  4QFV A;  5BXO A;  2F8X K;  2L6B A;  1BLX B;  3HG0 D;  4JB8 P;  3JXJ A;  5ENT D;  4NIK A;  5HKP A;  3V31 A;  5CBN A;  5CEA A;  3DEP A;  2J8S D;  5JA4 D;  3TWX A;  5AQB A;  4ZHB A;  3D9H A;  4DX5 D;  3NBN B;  2BKG A;  5CED B;  5CER B;  3J5Q B;  4F1P A;  2Y1L E;  4HI8 A;  5EID A;  2DZO A;  5ITZ F;  2BKK B;  4ZFH A;  2HE0 A;  3UXG A;  2ETB A;  4BET A;  3TWW A;  3B95 A;  2KXP C;  1N11 A;  4K5B A;  1S70 B;  2B0O E;  3UI2 A;  1DC2 A;  4U8V D;  2F8Y A;  3ZKJ A;  4G8L A;  1BU9 A;  4ATZ D;  4HBD A;  4DX2 A;  4HLL A;  4OAV B;  2RFA A;  5ENS D;  2P2C P;  2XEN A;  1OY3 D;  5ENR D;  5AQ7 A;  4TUM A;  3TWT A;  2ETC A;  5CBO A;  4LG6 A;  2XEE A;  4BES A;  4DUI A;  2AJA A;  3B7B A;  4QQI A;  4HI9 A;  3TWQ A;  1YCS B;  4BSZ B;  4HRN A;  4Z68 A;  3DEO A;  3V2X A;  4F6R D;  5KNH D;  4LNU D;  4A63 B;  5EN5 D;  3C5R A;  5FIN A;  4DX7 D;  1QYM A;  4O1P A;  2QC9 A;  5ENP D;  3J5P A;  2MYO A;  1SVX A;  4U95 D;  1IXV A;  2Y0B G;  3ZNG A;  2XEH A;  4BEP A;  3Q9U C;  2FO1 E;  1SW6 A;  2DVW A;  5HRY A;  4B93 B;  4DX6 D;  2VGE A;  4OAU C;  4U8Y D;  2JAB A;  4DX1 A;  5AAO A;  5BXU A;  4RLY A;  4HB5 A;  3V79 K;  4HQD A;  3ZU7 B;  5EYP F;  3V30 A;  3F6Q A;  4BER A;  1G3N B;  2DZN A;  1BI8 B;  2KBX A;  1AWC B;  1WG0 A;  1MX4 A;  4CYM D;  3TWS A;  2ZGG A;  3AJI A;  3IXE A;  1MX6 A;  4K5C A;  1UOH A;  3Q9N C;  4J8Y A;  5AN8 A;  4GPM A;  5KWD A;  2NYJ A;  1MJ0 A;  4GMR A;  5AQA A;  2RFM A;  5EYL A;  4LSZ E;  3KEA A;  3HRA A;  1YMP A;  3V2O A;  5AAR A;  4HNA D;  2V4H C;  5KNG A;  1D9S A;  3ZUV B;  3TWV A;  1N0Q A;  5ENQ D;  4YDY A;  5JMN D;  4O1O A;  1K1A A;  5EIB E;  3UTM A;  5CEC B;  3NOG D;  4CZ2 D;  1YYH A;  2V5Q C;  2DWZ A;  1BI7 B;  1MX2 A;  4U96 D;  2XZT G;  5AQ9 A;  3T8K A;  1AP7 A;  3EU9 A;  1A5E A;  1WDY A;  3SO8 A;  3W9F A;  1NFI E;  2ZGD A;  5FIO A;  3EHQ A;  2F37 A;  3TWR A;  2QYJ A;  4HRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...