4HRNA

Structural basis for eliciting a cytotoxic effect in her2-overexpressing cancer cells via binding to the extracellular domain of her2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
121
Chain Sequence
b'DLGKKLLEAARAGQDDEVRILMANGADVNAKDEYGLTPLYLATAHGHLEIVEVLLKNGADVNAVDAIGFTPLHLAAFIGHLEIAEVLLKHGADVNAQDKFGKTAFDISIGNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Designed Ankyrin Repeat Protein H10-2-G
publication title Structural Basis for Eliciting a Cytotoxic Effect in HER2-Overexpressing Cancer Cells via Binding to the Extracellular Domain of HER2.
pubmed doi rcsb
source organism Synthetic
molecule tags Transferase/de novo protein
total genus 39
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hrnA00
2MYOA 3EHRA 4BESA 1OT8A 4QFVA 1G3NB 2HE0A 4RLYA 4U95D 5EILA 1WG0A 2VGEA 5JMND 3KEAA 5AAOA 2ZGDA 5CBOA 2KXPC 4N5QA 3ZNGA 3TWTA 3ZU7B 4NIKA 2ZGGA 2DZOA 2DVWA 4DRXE 3Q9UC 4HI8A 1OY3D 1MJ0A 5HKPA 3NOGD 3T9KA 2AJAA 1BI8B 3AAAC 2RFAA 5BXOA 3B7BA 4U8VD 5KBAA 2B0OE 3NOCD 5KNHD 5FIOA 4DX5D 5AARA 4HBDA 4HNAD 1NFIE 4U8YD 3HRAA 3C5RA 1MX6A 1N0RA 2XZTG 4O1PA 3D9HA 3ZKJA 1A5EA 2RFMA 2XEEA 3TWRA 4K5CA 3UI2A 1QYMA 3J5PA 5CBNA 2ETCA 1SW6A 2QC9A 3EU9A 1D9SA 4HRMB 5FINA 3V79K 2Y0BG 4LG6A 5CECB 2L6BA 4F1PA 4DX1A 4CZ2D 5AQ9A 1S70B 4O60A 1SVXA 4DUIA 2FO1E 4F6RD 1YMPA 4K5AB 1MYOA 3Q9NC 3V2OA 4HI9A 2F8YA 4BSZB 4TUMA 5CERB 3DEPA 5ENQD 5CEAA 3ZUVB 5EYLA 4G8KA 5AQBA 3TWUA 1N11A 3DEOA 5AN8A 4Z68A 4ZHBA 3V2XA 3TWVA 4OAUC 4O1OA 2QYJA 1K1AA 4BEPA 5ENOD 1WDYA 1N0QA 4DX2A 4HRNA 3TWSA 3TWQA 4GMRA 4QQIA 4LSZE 2DZNA 3AJIA 2NYJA 1DCQA 2ETAA 1BI7B 5HRYA 1K3ZD 3TWXA 4DX7D 5KWDA 5ENSD 4YDWA 5ITZF 2J8SD 2XZDG 3IXEA 4DX6D 3UTMA 5HS0A 4C48B 2V5QC 2BKGA 1AP7A 4A63B 1K1BA 1IHBA 5AQAA 4BETA 4OAVB 1YCSB 2DWZA 4HB5A 3EHQA 4ZFHA 5ENRD 5EIBE 1YYHA 2XEHA 5D66A 4B93B 4HRLA 5CEDB 2F8XK 4HQDA 5BXUA 3V30A 1AWCB 5AQ7A 2JABA 3W9GA 1BLXB 5EYPF 1MX4A 3V31A 2F37A 2XENA 5ENPD 5EN5D 2PNNA 2ETBA 1MX2A 3HG0D 1UOHA 3JXIA 4BERA 3B95A 3T8KA 3JXJA 4J7WA 3J5QB 3SO8A 4K5BA 4JB8P 1TR4A 2KBXA 4CYMD 3TWWA 1BD8A 5EIDA 4J8YA 3F6QA 4GPMA 3LJNA 1IKND 2V4HC 4G8LA 4YDYA 5KNGA 4ATZD 5JA4D 1DC2A 3UXGA 4U96D 1BU9A 2Y1LE 5ENTD 1IXVA 2BKKB 3JUEA 4HLLA 2P2CP 3W9FA 4UUCA 3NBNB 4LNUD 2A5EA
chains in the Genus database with same CATH superfamily
1H6OA 4Q96A 1KZPA 2L0TB 3RRNB 1O5MA 1KT0A 4J6IA 3ZGQA 1PAQA 2HM8A 1E7VA 3OXLA 3HXBA 1KT1A 5FZSA 3FFLA 3BG0B 3ZKJA 2RFMA 3KEZA 2J4BA 4HXIA 1RZ4A 2EQXA 4MBGA 4ILIA 5FQ8A 4F1PA 4FC8A 3SGHA 2R2LA 4FP7A 1HE8A 3PZ4A 3MCXA 1H6KA 1KZOA 4EBAG 3EIJA 2IU1A 3CVVA 4G8KA 3C3QA 3FH7A 2XS1A 4UWFA 4XI0A 3D9IA 3T8MA 4I2WA 3U9WA 4O6FA 4FLHA 2YHCA 1H19A 5BPPA 1O1RA 2DBAA 3V30A 5AQ7A 2WPVA 2WXLA 3LEWA 2HR2A 3HG0D 4BERA 4EHMA 2WMOA 4JB8P 2FBNA 3ZHEB 2IJGX 4AM9A 3FHEA 4CGWA 3CEQA 4UQYA 2FF4A 3GZSA 3DSWA 5JMND 4CGVA 2WXIA 3I5PA 4OVUA 1ELWA 5FJYA 3AG2E 3JQ1A 4LUNU 1IQUA 3FTWA 4U8YD 1N0RA 2XEEA 3NQPA 5CBNA 4E6HA 3URZA 5LFAA 3CVWA 3EU9A 4WNEA 4HOQA 5CECB 3OAWA 3APDA 5E75A 4RG9A 4O60A 3ASDA 3MX3A 5HI7A 5ARFA 5ARGA 1UJKA 2XGMA 4U04A 3CVPA 4YDEA 4BY6A 3Q49B 1HXIA 3EDTB 3E37A 3T5XA 4ANXA 4DX2A 2WMNA 1L5JA 3DSUA 1K3ZD 5B3SE 4OYSA 3Q7AA 2R59A 3C3RA 1IHBA 3HXFA 4MKTA 1SZ9A 2IQCA 3CHOA 4ZFHA 4G11A 3ZW3A 2XEHA 4TXPA 1AWCB 1BLXB 1KPSB 2XENA 5JJ6A 1HFAA 4CDRA 2L6JA 3NAWA 2VJ8A 3L6AA 1SQMA 3TGOA 3APFA 2PZIA 3RRMB 4B89A 4BT8A 3NBNB 3D9KA 1LD7A 4BESA 4U95D 4RLYA 1FPPA 3B7SA 2RG8A 4XKCA 3DXKG 1OCCE 4UQZA 3D9PA 1N95A 2AJAA 2WXKA 4IULA 2CG3A 5KBAA 3SFZA 2NXPA 4C0MA 3TXMA 3PUKA 2DIWA 4JHJA 3CGHA 1FVHA 3I4GA 5DIZA 4URKA 5HQ8A 1SW6A 5G05C 3PS6A 4CCAA 2EILE 1XGWA 5G04C 3MV2B 3ASHA 3TL5A 4AY6A 3DEPA 4EZLA 2WXNA 3FUNA 3CKBA 5AJLA 5KJKA 3FUDA 1QZ2A 4J8FA 5KWDA 4F7AA 4DI3A 5AQAA 3IEGA 4H7XA 3ABME 2F8XK 1MHQA 2X6IA 3FU6A 5EYPF 1ELKA 3V31A 2P9KG 2MRIA 3SO8A 2GRNB 1BD8A 2XPZA 1E8WA 2BEDA 2R02A 2VTBA 1Y8MA 3SFYA 3L08A 3EJNA 4I6EA 5FQ6A 3EHRA 4XZ4A 3MJWA 3FTVA 3E34A 3CR3A 2KXPC 2P9PG 1HH8A 4FJYA 5DBKA 3CVYA 3NOGD 1ZB1A 4J8SA 3HHMA 3RAUA 4FHKA 3UPVA 3Q15A 2MHKA 4J8DA 5CHEE 3TWRA 3APCA 3C3OA 4HRMB 4G1TA 3CK8A 2DCPA 1N9AA 2AXVA 4F6RD 4K5AB 4J8EA 5FZRA 4PUCA 4GB9A 3ZUVB 5EYLA 5AQBA 3LVRE 1GW6A 4G24A 1WDYA 1TN8A 4U8HA 3B7UX 3ZYMA 2VGXA 5ITZF 4ILGA 3UTMA 4DPRA 4C48B 1TN6A 1HZ4A 1TNYA 4OAVB 4LNBA 2R05A 4FU3A 5JHAA 2CHZA 3FTSA 2LUHA 4WUYA 3FUEA 3ISMC 4WWPA 3LY8A 1Z3YA 2BUGA 4JA9A 3OXGA 1DVPA 3TWWA 5KNGA 1JUQA 1N54A 3ZYLA 1Z5SC 5AAOA 2WXPA 4KZ0A 4R7LA 4GCNA 2ZGGA 4A3VA 2XPYA 3CLJA 5HKPA 4AVXA 1SA4A 2WXQA 3C72A 4CDNA 2QYUA 4DX5D 4HNAD 3MEKA 4JVSA 4XKBA 1MX6A 4IN3B 2P58C 4BX9A 3FWVA 2XRYA 3LS8A 2VQ2A 2XPIA 2GRQB 2NSZA 2DYSE 3V79K 3E32A 3KS2A 5KJNA 2VSOE 5KJMA 2FO1E 4GYYA 5H7PA 3ASOE 2BTDA 2F8YA 3P1UA 2IO3C 3GW4A 1N11A 4PH4B 3DXMG 4N3BA 3QDNA 4GTQA 2LXMA 1TJFA 4DI4A 2R03A 4RVBA 3I3NA 3UMVA 4RSYA 2IOSA 2OV8A 4PS7A 3UUXA 5BUZA 2XS8A 3ASGA 1UW4B 2ZIRA 3TJPA 3BEEA 4JD2G 5EIDA 3SQVA 4GPMA 3MKRA 1ELRA 5G55A 2UY1B 4UUCA 5JHBA 1OT8A 4QFVA 1G3NB 2HE0A 3CVLA 3HXEA 2H6GA 1EPUA 1Z6TA 5CBOA 1TJCA 1N94A 3KSLA 3S7DA 3RO3A 1JCSA 3T9KA 1BI8B 2WXJA 4GU5A 3Q5MA 4I9EA 2EIJE 3ZXPA 4K03A 2WXOA 5J90A 3J5PA 4KVOA 5FINA 3HVEB 2Y0BG 3HIZA 1UN8A 3SI5A 2GROB 2CFZA 1MYOA 4BX8A 4HI9A 3TWUA 3ZVVA 3MYVA 3R7QA 2XEVA 2J9QA 5ENOD 3MKQA 1IQRA 2DZNA 3JUIA 4GYOA 3VTXA 4BSXA 5A7DB 3PZ1A 2PQRA 5ENNA 2J09A 1YYHA 3PZDA 4B93B 1Z3XA 5G05J 3LCAA 4JL0A 4PDXA 3B7RL 3CHMA 1TNZA 2ETBA 2IY0C 2I2OA 2P9NG 2X6KA 3QAQA 3F6QA 1D8EA 3L17A 5JA4D 2X3MA 3DPDA 3QB2A 4U0SA 5LOZA 4XX5A 5EILA 2V4LA 3SD5A 1WG0A 4GTTA 4HOSA 4NIKA 4HOTA 4EZJA 4RQIA 4X8QA 4WWOA 2FO7A 3ZRHA 3Q79A 1OWMA 2P9SG 3PH0C 3R7RA 5AARA 3PNLB 4I1AA 1NFIE 1WM5A 3C5RA 5IY5E 2I6HA 4UWHA 4GCOA 4MLPA 2C2LA 5BT1A 3NZSA 4HVBA 4UQXA 1WY6A 1K8KG 3UM0A 4FADA 4AIFA 1SVXA 5A23A 4H7YA 3Q73A 3PDNA 4CDMA 3ABKE 3QOUA 1JCRA 1TN7A 1TYQG 3RRUA 3FEYA 3DSTA 4J0UA 2HYZA 2LAHA 2VSYA 2YNQA 3B7TA 5FQ7A 3AJIA 3DPYA 1TEZA 1JPLA 4RG6A 3AG4E 2LAIA 4YDOA 2OCCE 1Y6IA 1V54E 3FUKA 4D10C 4I1MA 2LSUA 4TXQA 3U66A 4B8AA 5CEDB 3KSQA 3G2WA 5CRUA 3P2BA 2PNNA 2EIKE 2EIME 3EIQC 3HYMB 4C9BB 1E96B 5LP0A 4J7WA 2DYRE 3I4RB 4YDYA 1S63A 2IONA 3PE3A 4N5CA 1UG3A 2IOLA 3X2QE 4GZ5A 2MYOA 4B8CB 2AW6A 4W9RA 2C0LA 3KD7A 2WXFA 4DRXE 3Q9UC 4GZ3A 3VTYA 2B0OE 4CRWA 2YQ8A 4HBDA 4C0EA 2VSXE 2AXZA 2RKKA 4NACA 3UM3A 1A17A 3D9HA 1LF8A 3Q7FA 4U63A 3RK6A 3D9JA 3CIAA 2UWJG 3S2AA 3LXUX 4E85A 3QWWA 4JW1A 3EU5A 2ILRA 5ENQD 5CEAA 1E8XA 2XGSA 4G26A 3JCKC 3KAEA 3L22A 4LNGA 1K1AA 3CHSA 4F53A 3CVQA 4GZCA 4HRNA 1Q2ZA 2IEJA 4L7TA 3UIOC 4DX7D 4FJZA 3TG5A 3O4ZA 4GZ6A 5HS0A 2KZTA 4A63B 2WXRA 3U4TA 3FTZA 1X81A 1HG2A 4UWKA 2WQ6A 4HORA 4UI9C 1MX2A 3UT4A 2X38A 1TR4A 3VLFA 3S7JA 4TRQA 4AY5A 4EPZA 4L1BA 4NURA 5T8IA 3MA5A 1BU9A 1E90A 1IXVA 3W9FA 4IYPA 2V8SE 5JJTA 3HXCA 1LD8A 2M63A 4N39A 2VGEA 3IBEA 4WNGA 4L9PA 4UWGA 4CT4A 3WG7E 4CEMA 1H2TC 3ESLA 1MJ0A 5KCMA 3TG4A 3FTUA 2Y4UA 3HRAA 4BWRA 4GTVA 2V0PA 2ETCA 3AG3E 5A6CA 4LG6A 4JHKA 3TAXA 4DX1A 3U3WA 4CZ2D 2OVFA 3Q75A 2J07A 1EYHA 2RD0A 4A1GA 5EX0A 3LY9A 3PE4A 3Q4AB 2GRPB 4KZCA 3CV0A 2OOEA 3LY7A 4U07A 5JJ7A 4U0ZA 4AP2A 3FULA 4XE0A 4OAUC 3FUIA 3QWVA 3AG1E 3K9IA 5CCMA 1N4QA 2NYJA 2H6IA 3G2SA 1WAO1 4HOUA 4UWLA 2ZISA 1B89A 1FCHA 4JC8A 4AOFA 3ASNE 1AP7A 4N3AA 5LX8A 4DJAA 5AIJA 2AXUA 2VYIA 3LJ3A 4XEIG 5BW8C 3LPZA 3L54A 2ZU6B 4ATGA 4K5BA 1NZNA 2XHEA 3PEUB 3LJNA 3UXGA 2I9CA 2Y1LE 3PZ3A 5M72A 2LXLA 2WXHA 3BUAA 4I9CA 3T5VA 3L9TA 3KEAA 3S7FA 3ZNGA 2H6HA 4ILHB 2C0MA 3FEXA 2DVWA 3CSTA 3AU5A 2RFAA 2I1JA 1FT2A 3LYAA 3UI2A 3NF1A 3SHFA 1SZAA 1E8YA 2X6JA 2L6BA 3GZ2A 3LKUA 3MV3B 5ANLA 1OCRE 2Y69E 5FT9A 5G2NA 3V2OA 2AWIA 4OVVA 1DNPA 1OWNA 1S0PA 2X6FA 4YVOA 2Y3AA 5C1DA 2KZTB 4M3OA 4DX6D 1HG5A 1U3CA 2BKGA 1K1BA 3QJZA 4Y6WA 4A3TA 3ZHEA 5D66A 1UN9A 2QFCA 4KT6B 4I6GA 4DLOA 2KBXA 5E76A 3FH8A 1SA5A 3IKOB 5EDSA 4GA1A 2R17C 3TXNA 3DSXA 3CSFA 3FU3A 3PEVB 1RW2A 2Q7FA 5BV1A 1TNBA 5CMYA 2DZOA 1OCOE 2WXGA 4EZKA 3AAAC 2VTBB 3AS5A 5FIOA 3S7BA 2GW1A 3DSVA 2XZTG 4EQFA 4P29A 1QYMA 4G25A 1N4PA 1EDUA 1FT1A 2P9LG 4HLEA 1NP7A 3O48A 3C98A 2L9BA 1IHGA 2JLBA 3VLEA 3QKYA 3ENEA 2F0YA 1VDYA 4BT9A 3UIPC 4BFRA 1LTXA 1OWPA 3PVLA 2XQ0A 4L23A 2FI7A 2NC9A 4BEPA 4QQIA 2ETAA 3JYSA 2AVPA 4ANUA 5ENSD 4KVMA 4JEUA 4XIFA 1ZBPA 1H0AA 1HU3A 3PRZA 4HRLA 5BXUA 4I43A 4ABNA 2XRZA 3CVXA 1UOHA 2PM7A 2VGXB 3B95A 3CQCB 2GRRB 4FHJA 3ML8A 3NZUA 3VLDA 4G8LA 2IF4A 3SFXA 3QARA 3RJVA 4U96D 2OEVA 3ML9A 2VGYA 3FY4A 5T3RA 5B1AE 3ZU7B 3ZYKA 3RIBA 3FUMA 2ZXWE 5G04J 1NA0A 4U8VD 4GMJA 3NOCD 5EKQD 2KCVA 4UI9J 4L2LA 4F3VA 3D3MA 3ASFA 1PY1A 3MZLB 3PREA 4PS8A 4JZYA 1E8ZA 2A5UA 1YMPA 4BSZB 4JPSA 1OCZE 3FTXA 4ZHBA 5AN8A 1E7UA 4O1OA 1N0QA 4JA7A 1FVFA 2OVBA 5EX3A 3IXEA 3CHQA 4IRUA 2WQ7A 4APOA 3UM1A 4HFGA 4BETA 3ZYQA 4JHRA 1S64A 4HB5A 3EHQA 3SY2A 2WXMA 2LNIA 2JABA 3ULYA 3L82A 2IO2C 3ZN3A 4EBAA 5BNWA 1PC2A 2KATA 1OWLA 3CKCA 4J8YA 1DCEA 5D0QD 3D9OA 4GTSA 4CT0A 2GGFA 2A5EA 2YINA 4PS3A 3CVUA 3B13A 4G2VA 4MS6A 3D9MA 1QBQA 4GTMA 3ZFWA 4GTOA 1OY3D 1MQSA 4GA2A 3GYZA 5BXOA 4L2YA 3D9NA 4TXRA 4GTPA 4ACKA 2IFUA 3QWPA 2E0IA 5LCWC 1NA3A 2QC9A 1EF1C 4M7CA 3FH5A 4FULA 3AS4A 3FU5A 4XI9A 3Q9NC 3UT7A 5D0OD 4TUMA 2EINE 2YHEA 3DWLG 3MGBA 3SF4A 3V2XA 2B6CA 3QK0A 2QYJA 1MZCA 5AJDA 1V55E 1DCQA 1ZU2A 1BI7B 1W3BA 4YDWA 5J08A 2J8SD 3G2VA 4MRUA 1JWFA 3HXDA 2V5QC 3CK7A 3FU0A 1YCSB 5EIBE 5ENRD 2HO1A 4N3CA 2KCLA 3G2UA 4G23A 3MKQB 3U64A 3ABLE 3T8KA 2GRMA 4A55A 1P5QA 3UT8A 1DC2A 4ATZD 3NB2A 4YNDA 1X5BA 3FUJA 2A4ZA 2XCCA 4BTBA 3SZ7A 3BG1B 3E30A 4ANVA 2P9IG 2FULA 3SNXA 4N5QA 3TWTA 1D8DA 1OUVA 2GRLA 2J4DA 3B7BA 5KNHD 4N2SA 3UQ3A 3CK9A 3RO2A 4UI9K 2PL2A 1N4RA 4AJWA 2CFUA 3UKRG 3SBTB 2WB2A 5AQ9A 1S70B 3ONKA 3G2TA 4U0UA 3FDHA 1O1TA 1QQEA 4ACLA 4AEZC 4TUUA 5CERB 3FUHA 5FTPA 3DEOA 3RU0A 3E33A 4K0RA 2PM6A 4GMRA 5HRYA 3TWXA 3L13A 5FQ4A 2XZDG 4F1SA 4WAFA 3UINC 3FP3A 2DWZA 4WWNA 4HQDA 4I2ZA 2UY1A 3W9GA 1MX4A 5ENPD 1U3DA 1KLXA 2KC7A 3ONLA 1INZA 5CMWA 3R9MA 3FTYA 2BKKB 4HLLA 2P2CP 5T4YA 2V5FA 4B0ZA 1NL4A 3PUJA 3CHRA 2ZGDA 5ANRA 4BTAA 2J49A 3HVEA 4I17A 2XGOA 4TV3A 4LRZA 4ME2A 3JQ0A 3ZPJA 1HX8A 4APFA 3LDZA 3LVQE 3ULEG 2KM4A 5KJLA 4O1PA 3EHNA 1BPOA 4GMLA 4B94A 1A5EA 1O1SA 4K5CA 3BQOA 1D9SA 3ULQA 4AV7A 5B1BE 1UJJA 3AU4A 1JCQA 2P9UG 4DUIA 3IV0A 4NRHB 1U2VG 2OEWA 3UKUG 5AENA 3ZIMA 1IYGA 3RKVA 2JEKA 2PQNA 4Z68A 3PNTB 3CQGB 3IHYA 1N52A 3TWVA 1H2UA 3WXXA 4DLQA 4I6JA 2LO6A 4FLBA 2J08A 2QZAA 1NI1A 4LEUA 4LCTA 1TNUA 3AS8A 3IHVA 4Q94A 4GYWA 3EUVA 2WM9A 1OXJA 2WQHA 1YA0A 2F37A 4WNFA 2BF0X 2XCBA 4I1OB 4Q69A 3JXJA 2X6HA 4KBQA 2WVIA 3EHMA 1IKND 2V4HC 2H6FA 1H2VC 5ENTD 5D2MC 4LNUD 4GAAA 3DSSA 5AYWD 3OTNA 4U7EB 4AXHA 2MOWA 5C2YA 3SBSA 4JXTA 2CHWA 4GZDA 3BU8A 4HI8A 3GZ1A 4GA0A 1TNOA 4A1SA 3RSEG 3HDXA 3PZ2A 5CCLA 1JWGA 4KMOA 2E2EA 4JEHA 1XNFA 3UM2A 3ESKA 4LERA 2CG2A 2LSVA 2CHXA 2R5SA 3FUFA 2KCKA 2VSNA 3Q78A 2QY7A 1HF8A 4YVQC 3N71A 3UX4A 3DBSA 3CHPA 2I1KA 4KXKB 4EECA 4ANWA 4FA6A 4HS2A 3TWSA 3TWQA 3Q47B 4LSZE 1N4SA 3QC1A 1HO8A 3ZEFA 2L0IA 2FEZA 5FWQA 5BV0A 3OXFA 3DRAA 5LCWJ 3D9LA 4Y6CA 1QNFA 4GPKA 3R9AB 3ZXSA 2ONDA 4WNDA 2Y4TA 4GTRA 5EN5D 3JXIA 4V3IA 3QNKA 4NQ0A 1HS6A 3J5QB 4KYOB 3CVNA 3E4BA 4CYMD 3L16A 1OWOA 5CRVA 4DK5A 5FZQA 4N2QA 1H6PA 3JUEA
chains in the Genus database with same CATH topology
2MYOA 3EHRA 4BESA 1OT8A 4QFVA 1G3NB 2HE0A 4RLYA 4U95D 5EILA 1WG0A 2VGEA 5JMND 3KEAA 5AAOA 2ZGDA 5CBOA 2KXPC 4N5QA 3ZNGA 3TWTA 3ZU7B 4NIKA 2ZGGA 2DZOA 2DVWA 4DRXE 3Q9UC 4HI8A 1OY3D 1MJ0A 5HKPA 3NOGD 3T9KA 2AJAA 1BI8B 3AAAC 2RFAA 5BXOA 3B7BA 4U8VD 5KBAA 2B0OE 3NOCD 5KNHD 5FIOA 4DX5D 5AARA 4HBDA 4HNAD 1NFIE 4U8YD 3HRAA 3C5RA 1MX6A 1N0RA 2XZTG 4O1PA 3D9HA 3ZKJA 1A5EA 2RFMA 2XEEA 3TWRA 4K5CA 3UI2A 1QYMA 3J5PA 5CBNA 2ETCA 1SW6A 2QC9A 3EU9A 1D9SA 4HRMB 5FINA 3V79K 2Y0BG 4LG6A 5CECB 2L6BA 4F1PA 4DX1A 4CZ2D 5AQ9A 1S70B 4O60A 1SVXA 4DUIA 2FO1E 4F6RD 1YMPA 4K5AB 1MYOA 3Q9NC 3V2OA 4HI9A 2F8YA 4BSZB 4TUMA 5CERB 3DEPA 5ENQD 5CEAA 3ZUVB 5EYLA 4G8KA 5AQBA 3TWUA 1N11A 3DEOA 5AN8A 4Z68A 4ZHBA 3V2XA 3TWVA 4OAUC 4O1OA 2QYJA 1K1AA 4BEPA 5ENOD 1WDYA 1N0QA 4DX2A 4HRNA 3TWSA 3TWQA 4GMRA 4QQIA 4LSZE 2DZNA 3AJIA 2NYJA 1DCQA 2ETAA 1BI7B 5HRYA 1K3ZD 3TWXA 4DX7D 5KWDA 5ENSD 4YDWA 5ITZF 2J8SD 2XZDG 3IXEA 4DX6D 3UTMA 5HS0A 4C48B 2V5QC 2BKGA 1AP7A 4A63B 1K1BA 1IHBA 5AQAA 4BETA 4OAVB 1YCSB 2DWZA 4HB5A 3EHQA 4ZFHA 5ENRD 5EIBE 1YYHA 2XEHA 5D66A 4B93B 4HRLA 5CEDB 2F8XK 4HQDA 5BXUA 3V30A 1AWCB 5AQ7A 2JABA 3W9GA 1BLXB 5EYPF 1MX4A 3V31A 2F37A 2XENA 5ENPD 5EN5D 2PNNA 2ETBA 1MX2A 3HG0D 1UOHA 3JXIA 4BERA 3B95A 3T8KA 3JXJA 4J7WA 3J5QB 3SO8A 4K5BA 4JB8P 1TR4A 2KBXA 4CYMD 3TWWA 1BD8A 5EIDA 4J8YA 3F6QA 4GPMA 3LJNA 1IKND 2V4HC 4G8LA 4YDYA 5KNGA 4ATZD 5JA4D 1DC2A 3UXGA 4U96D 1BU9A 2Y1LE 5ENTD 1IXVA 2BKKB 3JUEA 4HLLA 2P2CP 3W9FA 4UUCA 3NBNB 4LNUD 2A5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MYO A;  3EHR A;  4BES A;  1OT8 A;  4QFV A;  1G3N B;  2HE0 A;  4RLY A;  4U95 D;  5EIL A;  1WG0 A;  2VGE A;  5JMN D;  3KEA A;  5AAO A;  2ZGD A;  5CBO A;  2KXP C;  4N5Q A;  3ZNG A;  3TWT A;  3ZU7 B;  4NIK A;  2ZGG A;  2DZO A;  2DVW A;  4DRX E;  3Q9U C;  4HI8 A;  1OY3 D;  1MJ0 A;  5HKP A;  3NOG D;  3T9K A;  2AJA A;  1BI8 B;  3AAA C;  2RFA A;  5BXO A;  3B7B A;  4U8V D;  5KBA A;  2B0O E;  3NOC D;  5KNH D;  5FIO A;  4DX5 D;  5AAR A;  4HBD A;  4HNA D;  1NFI E;  4U8Y D;  3HRA A;  3C5R A;  1MX6 A;  1N0R A;  2XZT G;  4O1P A;  3D9H A;  3ZKJ A;  1A5E A;  2RFM A;  2XEE A;  3TWR A;  4K5C A;  3UI2 A;  1QYM A;  3J5P A;  5CBN A;  2ETC A;  1SW6 A;  2QC9 A;  3EU9 A;  1D9S A;  4HRM B;  5FIN A;  3V79 K;  2Y0B G;  4LG6 A;  5CEC B;  2L6B A;  4F1P A;  4DX1 A;  4CZ2 D;  5AQ9 A;  1S70 B;  4O60 A;  1SVX A;  4DUI A;  2FO1 E;  4F6R D;  1YMP A;  4K5A B;  1MYO A;  3Q9N C;  3V2O A;  4HI9 A;  2F8Y A;  4BSZ B;  4TUM A;  5CER B;  3DEP A;  5ENQ D;  5CEA A;  3ZUV B;  5EYL A;  4G8K A;  5AQB A;  3TWU A;  1N11 A;  3DEO A;  5AN8 A;  4Z68 A;  4ZHB A;  3V2X A;  3TWV A;  4OAU C;  4O1O A;  2QYJ A;  1K1A A;  4BEP A;  5ENO D;  1WDY A;  1N0Q A;  4DX2 A;  4HRN A;  3TWS A;  3TWQ A;  4GMR A;  4QQI A;  4LSZ E;  2DZN A;  3AJI A;  2NYJ A;  1DCQ A;  2ETA A;  1BI7 B;  5HRY A;  1K3Z D;  3TWX A;  4DX7 D;  5KWD A;  5ENS D;  4YDW A;  5ITZ F;  2J8S D;  2XZD G;  3IXE A;  4DX6 D;  3UTM A;  5HS0 A;  4C48 B;  2V5Q C;  2BKG A;  1AP7 A;  4A63 B;  1K1B A;  1IHB A;  5AQA A;  4BET A;  4OAV B;  1YCS B;  2DWZ A;  4HB5 A;  3EHQ A;  4ZFH A;  5ENR D;  5EIB E;  1YYH A;  2XEH A;  5D66 A;  4B93 B;  4HRL A;  5CED B;  2F8X K;  4HQD A;  5BXU A;  3V30 A;  1AWC B;  5AQ7 A;  2JAB A;  3W9G A;  1BLX B;  5EYP F;  1MX4 A;  3V31 A;  2F37 A;  2XEN A;  5ENP D;  5EN5 D;  2PNN A;  2ETB A;  1MX2 A;  3HG0 D;  1UOH A;  3JXI A;  4BER A;  3B95 A;  3T8K A;  3JXJ A;  4J7W A;  3J5Q B;  3SO8 A;  4K5B A;  4JB8 P;  1TR4 A;  2KBX A;  4CYM D;  3TWW A;  1BD8 A;  5EID A;  4J8Y A;  3F6Q A;  4GPM A;  3LJN A;  1IKN D;  2V4H C;  4G8L A;  4YDY A;  5KNG A;  4ATZ D;  5JA4 D;  1DC2 A;  3UXG A;  4U96 D;  1BU9 A;  2Y1L E;  5ENT D;  1IXV A;  2BKK B;  3JUE A;  4HLL A;  2P2C P;  3W9F A;  4UUC A;  3NBN B;  4LNU D;  2A5E A; 
#chains in the Genus database with same CATH topology
 1H6O A;  4Q96 A;  1KZP A;  2L0T B;  3RRN B;  1O5M A;  1KT0 A;  4J6I A;  3ZGQ A;  1PAQ A;  2HM8 A;  1E7V A;  3OXL A;  3HXB A;  1KT1 A;  5FZS A;  3FFL A;  3BG0 B;  3ZKJ A;  2RFM A;  3KEZ A;  2J4B A;  4HXI A;  1RZ4 A;  2EQX A;  4MBG A;  4ILI A;  5FQ8 A;  4F1P A;  4FC8 A;  3SGH A;  2R2L A;  4FP7 A;  1HE8 A;  3PZ4 A;  3MCX A;  1H6K A;  1KZO A;  4EBA G;  3EIJ A;  2IU1 A;  3CVV A;  4G8K A;  3C3Q A;  3FH7 A;  2XS1 A;  4UWF A;  4XI0 A;  3D9I A;  3T8M A;  4I2W A;  3U9W A;  4O6F A;  4FLH A;  2YHC A;  1H19 A;  5BPP A;  1O1R A;  2DBA A;  3V30 A;  5AQ7 A;  2WPV A;  2WXL A;  3LEW A;  2HR2 A;  3HG0 D;  4BER A;  4EHM A;  2WMO A;  4JB8 P;  2FBN A;  3ZHE B;  2IJG X;  4AM9 A;  3FHE A;  4CGW A;  3CEQ A;  4UQY A;  2FF4 A;  3GZS A;  3DSW A;  5JMN D;  4CGV A;  2WXI A;  3I5P A;  4OVU A;  1ELW A;  5FJY A;  3AG2 E;  3JQ1 A;  4LUN U;  1IQU A;  3FTW A;  4U8Y D;  1N0R A;  2XEE A;  3NQP A;  5CBN A;  4E6H A;  3URZ A;  5LFA A;  3CVW A;  3EU9 A;  4WNE A;  4HOQ A;  5CEC B;  3OAW A;  3APD A;  5E75 A;  4RG9 A;  4O60 A;  3ASD A;  3MX3 A;  5HI7 A;  5ARF A;  5ARG A;  1UJK A;  2XGM A;  4U04 A;  3CVP A;  4YDE A;  4BY6 A;  3Q49 B;  1HXI A;  3EDT B;  3E37 A;  3T5X A;  4ANX A;  4DX2 A;  2WMN A;  1L5J A;  3DSU A;  1K3Z D;  5B3S E;  4OYS A;  3Q7A A;  2R59 A;  3C3R A;  1IHB A;  3HXF A;  4MKT A;  1SZ9 A;  2IQC A;  3CHO A;  4ZFH A;  4G11 A;  3ZW3 A;  2XEH A;  4TXP A;  1AWC B;  1BLX B;  1KPS B;  2XEN A;  5JJ6 A;  1HFA A;  4CDR A;  2L6J A;  3NAW A;  2VJ8 A;  3L6A A;  1SQM A;  3TGO A;  3APF A;  2PZI A;  3RRM B;  4B89 A;  4BT8 A;  3NBN B;  3D9K A;  1LD7 A;  4BES A;  4U95 D;  4RLY A;  1FPP A;  3B7S A;  2RG8 A;  4XKC A;  3DXK G;  1OCC E;  4UQZ A;  3D9P A;  1N95 A;  2AJA A;  2WXK A;  4IUL A;  2CG3 A;  5KBA A;  3SFZ A;  2NXP A;  4C0M A;  3TXM A;  3PUK A;  2DIW A;  4JHJ A;  3CGH A;  1FVH A;  3I4G A;  5DIZ A;  4URK A;  5HQ8 A;  1SW6 A;  5G05 C;  3PS6 A;  4CCA A;  2EIL E;  1XGW A;  5G04 C;  3MV2 B;  3ASH A;  3TL5 A;  4AY6 A;  3DEP A;  4EZL A;  2WXN A;  3FUN A;  3CKB A;  5AJL A;  5KJK A;  3FUD A;  1QZ2 A;  4J8F A;  5KWD A;  4F7A A;  4DI3 A;  5AQA A;  3IEG A;  4H7X A;  3ABM E;  2F8X K;  1MHQ A;  2X6I A;  3FU6 A;  5EYP F;  1ELK A;  3V31 A;  2P9K G;  2MRI A;  3SO8 A;  2GRN B;  1BD8 A;  2XPZ A;  1E8W A;  2BED A;  2R02 A;  2VTB A;  1Y8M A;  3SFY A;  3L08 A;  3EJN A;  4I6E A;  5FQ6 A;  3EHR A;  4XZ4 A;  3MJW A;  3FTV A;  3E34 A;  3CR3 A;  2KXP C;  2P9P G;  1HH8 A;  4FJY A;  5DBK A;  3CVY A;  3NOG D;  1ZB1 A;  4J8S A;  3HHM A;  3RAU A;  4FHK A;  3UPV A;  3Q15 A;  2MHK A;  4J8D A;  5CHE E;  3TWR A;  3APC A;  3C3O A;  4HRM B;  4G1T A;  3CK8 A;  2DCP A;  1N9A A;  2AXV A;  4F6R D;  4K5A B;  4J8E A;  5FZR A;  4PUC A;  4GB9 A;  3ZUV B;  5EYL A;  5AQB A;  3LVR E;  1GW6 A;  4G24 A;  1WDY A;  1TN8 A;  4U8H A;  3B7U X;  3ZYM A;  2VGX A;  5ITZ F;  4ILG A;  3UTM A;  4DPR A;  4C48 B;  1TN6 A;  1HZ4 A;  1TNY A;  4OAV B;  4LNB A;  2R05 A;  4FU3 A;  5JHA A;  2CHZ A;  3FTS A;  2LUH A;  4WUY A;  3FUE A;  3ISM C;  4WWP A;  3LY8 A;  1Z3Y A;  2BUG A;  4JA9 A;  3OXG A;  1DVP A;  3TWW A;  5KNG A;  1JUQ A;  1N54 A;  3ZYL A;  1Z5S C;  5AAO A;  2WXP A;  4KZ0 A;  4R7L A;  4GCN A;  2ZGG A;  4A3V A;  2XPY A;  3CLJ A;  5HKP A;  4AVX A;  1SA4 A;  2WXQ A;  3C72 A;  4CDN A;  2QYU A;  4DX5 D;  4HNA D;  3MEK A;  4JVS A;  4XKB A;  1MX6 A;  4IN3 B;  2P58 C;  4BX9 A;  3FWV A;  2XRY A;  3LS8 A;  2VQ2 A;  2XPI A;  2GRQ B;  2NSZ A;  2DYS E;  3V79 K;  3E32 A;  3KS2 A;  5KJN A;  2VSO E;  5KJM A;  2FO1 E;  4GYY A;  5H7P A;  3ASO E;  2BTD A;  2F8Y A;  3P1U A;  2IO3 C;  3GW4 A;  1N11 A;  4PH4 B;  3DXM G;  4N3B A;  3QDN A;  4GTQ A;  2LXM A;  1TJF A;  4DI4 A;  2R03 A;  4RVB A;  3I3N A;  3UMV A;  4RSY A;  2IOS A;  2OV8 A;  4PS7 A;  3UUX A;  5BUZ A;  2XS8 A;  3ASG A;  1UW4 B;  2ZIR A;  3TJP A;  3BEE A;  4JD2 G;  5EID A;  3SQV A;  4GPM A;  3MKR A;  1ELR A;  5G55 A;  2UY1 B;  4UUC A;  5JHB A;  1OT8 A;  4QFV A;  1G3N B;  2HE0 A;  3CVL A;  3HXE A;  2H6G A;  1EPU A;  1Z6T A;  5CBO A;  1TJC A;  1N94 A;  3KSL A;  3S7D A;  3RO3 A;  1JCS A;  3T9K A;  1BI8 B;  2WXJ A;  4GU5 A;  3Q5M A;  4I9E A;  2EIJ E;  3ZXP A;  4K03 A;  2WXO A;  5J90 A;  3J5P A;  4KVO A;  5FIN A;  3HVE B;  2Y0B G;  3HIZ A;  1UN8 A;  3SI5 A;  2GRO B;  2CFZ A;  1MYO A;  4BX8 A;  4HI9 A;  3TWU A;  3ZVV A;  3MYV A;  3R7Q A;  2XEV A;  2J9Q A;  5ENO D;  3MKQ A;  1IQR A;  2DZN A;  3JUI A;  4GYO A;  3VTX A;  4BSX A;  5A7D B;  3PZ1 A;  2PQR A;  5ENN A;  2J09 A;  1YYH A;  3PZD A;  4B93 B;  1Z3X A;  5G05 J;  3LCA A;  4JL0 A;  4PDX A;  3B7R L;  3CHM A;  1TNZ A;  2ETB A;  2IY0 C;  2I2O A;  2P9N G;  2X6K A;  3QAQ A;  3F6Q A;  1D8E A;  3L17 A;  5JA4 D;  2X3M A;  3DPD A;  3QB2 A;  4U0S A;  5LOZ A;  4XX5 A;  5EIL A;  2V4L A;  3SD5 A;  1WG0 A;  4GTT A;  4HOS A;  4NIK A;  4HOT A;  4EZJ A;  4RQI A;  4X8Q A;  4WWO A;  2FO7 A;  3ZRH A;  3Q79 A;  1OWM A;  2P9S G;  3PH0 C;  3R7R A;  5AAR A;  3PNL B;  4I1A A;  1NFI E;  1WM5 A;  3C5R A;  5IY5 E;  2I6H A;  4UWH A;  4GCO A;  4MLP A;  2C2L A;  5BT1 A;  3NZS A;  4HVB A;  4UQX A;  1WY6 A;  1K8K G;  3UM0 A;  4FAD A;  4AIF A;  1SVX A;  5A23 A;  4H7Y A;  3Q73 A;  3PDN A;  4CDM A;  3ABK E;  3QOU A;  1JCR A;  1TN7 A;  1TYQ G;  3RRU A;  3FEY A;  3DST A;  4J0U A;  2HYZ A;  2LAH A;  2VSY A;  2YNQ A;  3B7T A;  5FQ7 A;  3AJI A;  3DPY A;  1TEZ A;  1JPL A;  4RG6 A;  3AG4 E;  2LAI A;  4YDO A;  2OCC E;  1Y6I A;  1V54 E;  3FUK A;  4D10 C;  4I1M A;  2LSU A;  4TXQ A;  3U66 A;  4B8A A;  5CED B;  3KSQ A;  3G2W A;  5CRU A;  3P2B A;  2PNN A;  2EIK E;  2EIM E;  3EIQ C;  3HYM B;  4C9B B;  1E96 B;  5LP0 A;  4J7W A;  2DYR E;  3I4R B;  4YDY A;  1S63 A;  2ION A;  3PE3 A;  4N5C A;  1UG3 A;  2IOL A;  3X2Q E;  4GZ5 A;  2MYO A;  4B8C B;  2AW6 A;  4W9R A;  2C0L A;  3KD7 A;  2WXF A;  4DRX E;  3Q9U C;  4GZ3 A;  3VTY A;  2B0O E;  4CRW A;  2YQ8 A;  4HBD A;  4C0E A;  2VSX E;  2AXZ A;  2RKK A;  4NAC A;  3UM3 A;  1A17 A;  3D9H A;  1LF8 A;  3Q7F A;  4U63 A;  3RK6 A;  3D9J A;  3CIA A;  2UWJ G;  3S2A A;  3LXU X;  4E85 A;  3QWW A;  4JW1 A;  3EU5 A;  2ILR A;  5ENQ D;  5CEA A;  1E8X A;  2XGS A;  4G26 A;  3JCK C;  3KAE A;  3L22 A;  4LNG A;  1K1A A;  3CHS A;  4F53 A;  3CVQ A;  4GZC A;  4HRN A;  1Q2Z A;  2IEJ A;  4L7T A;  3UIO C;  4DX7 D;  4FJZ A;  3TG5 A;  3O4Z A;  4GZ6 A;  5HS0 A;  2KZT A;  4A63 B;  2WXR A;  3U4T A;  3FTZ A;  1X81 A;  1HG2 A;  4UWK A;  2WQ6 A;  4HOR A;  4UI9 C;  1MX2 A;  3UT4 A;  2X38 A;  1TR4 A;  3VLF A;  3S7J A;  4TRQ A;  4AY5 A;  4EPZ A;  4L1B A;  4NUR A;  5T8I A;  3MA5 A;  1BU9 A;  1E90 A;  1IXV A;  3W9F A;  4IYP A;  2V8S E;  5JJT A;  3HXC A;  1LD8 A;  2M63 A;  4N39 A;  2VGE A;  3IBE A;  4WNG A;  4L9P A;  4UWG A;  4CT4 A;  3WG7 E;  4CEM A;  1H2T C;  3ESL A;  1MJ0 A;  5KCM A;  3TG4 A;  3FTU A;  2Y4U A;  3HRA A;  4BWR A;  4GTV A;  2V0P A;  2ETC A;  3AG3 E;  5A6C A;  4LG6 A;  4JHK A;  3TAX A;  4DX1 A;  3U3W A;  4CZ2 D;  2OVF A;  3Q75 A;  2J07 A;  1EYH A;  2RD0 A;  4A1G A;  5EX0 A;  3LY9 A;  3PE4 A;  3Q4A B;  2GRP B;  4KZC A;  3CV0 A;  2OOE A;  3LY7 A;  4U07 A;  5JJ7 A;  4U0Z A;  4AP2 A;  3FUL A;  4XE0 A;  4OAU C;  3FUI A;  3QWV A;  3AG1 E;  3K9I A;  5CCM A;  1N4Q A;  2NYJ A;  2H6I A;  3G2S A;  1WAO 1;  4HOU A;  4UWL A;  2ZIS A;  1B89 A;  1FCH A;  4JC8 A;  4AOF A;  3ASN E;  1AP7 A;  4N3A A;  5LX8 A;  4DJA A;  5AIJ A;  2AXU A;  2VYI A;  3LJ3 A;  4XEI G;  5BW8 C;  3LPZ A;  3L54 A;  2ZU6 B;  4ATG A;  4K5B A;  1NZN A;  2XHE A;  3PEU B;  3LJN A;  3UXG A;  2I9C A;  2Y1L E;  3PZ3 A;  5M72 A;  2LXL A;  2WXH A;  3BUA A;  4I9C A;  3T5V A;  3L9T A;  3KEA A;  3S7F A;  3ZNG A;  2H6H A;  4ILH B;  2C0M A;  3FEX A;  2DVW A;  3CST A;  3AU5 A;  2RFA A;  2I1J A;  1FT2 A;  3LYA A;  3UI2 A;  3NF1 A;  3SHF A;  1SZA A;  1E8Y A;  2X6J A;  2L6B A;  3GZ2 A;  3LKU A;  3MV3 B;  5ANL A;  1OCR E;  2Y69 E;  5FT9 A;  5G2N A;  3V2O A;  2AWI A;  4OVV A;  1DNP A;  1OWN A;  1S0P A;  2X6F A;  4YVO A;  2Y3A A;  5C1D A;  2KZT B;  4M3O A;  4DX6 D;  1HG5 A;  1U3C A;  2BKG A;  1K1B A;  3QJZ A;  4Y6W A;  4A3T A;  3ZHE A;  5D66 A;  1UN9 A;  2QFC A;  4KT6 B;  4I6G A;  4DLO A;  2KBX A;  5E76 A;  3FH8 A;  1SA5 A;  3IKO B;  5EDS A;  4GA1 A;  2R17 C;  3TXN A;  3DSX A;  3CSF A;  3FU3 A;  3PEV B;  1RW2 A;  2Q7F A;  5BV1 A;  1TNB A;  5CMY A;  2DZO A;  1OCO E;  2WXG A;  4EZK A;  3AAA C;  2VTB B;  3AS5 A;  5FIO A;  3S7B A;  2GW1 A;  3DSV A;  2XZT G;  4EQF A;  4P29 A;  1QYM A;  4G25 A;  1N4P A;  1EDU A;  1FT1 A;  2P9L G;  4HLE A;  1NP7 A;  3O48 A;  3C98 A;  2L9B A;  1IHG A;  2JLB A;  3VLE A;  3QKY A;  3ENE A;  2F0Y A;  1VDY A;  4BT9 A;  3UIP C;  4BFR A;  1LTX A;  1OWP A;  3PVL A;  2XQ0 A;  4L23 A;  2FI7 A;  2NC9 A;  4BEP A;  4QQI A;  2ETA A;  3JYS A;  2AVP A;  4ANU A;  5ENS D;  4KVM A;  4JEU A;  4XIF A;  1ZBP A;  1H0A A;  1HU3 A;  3PRZ A;  4HRL A;  5BXU A;  4I43 A;  4ABN A;  2XRZ A;  3CVX A;  1UOH A;  2PM7 A;  2VGX B;  3B95 A;  3CQC B;  2GRR B;  4FHJ A;  3ML8 A;  3NZU A;  3VLD A;  4G8L A;  2IF4 A;  3SFX A;  3QAR A;  3RJV A;  4U96 D;  2OEV A;  3ML9 A;  2VGY A;  3FY4 A;  5T3R A;  5B1A E;  3ZU7 B;  3ZYK A;  3RIB A;  3FUM A;  2ZXW E;  5G04 J;  1NA0 A;  4U8V D;  4GMJ A;  3NOC D;  5EKQ D;  2KCV A;  4UI9 J;  4L2L A;  4F3V A;  3D3M A;  3ASF A;  1PY1 A;  3MZL B;  3PRE A;  4PS8 A;  4JZY A;  1E8Z A;  2A5U A;  1YMP A;  4BSZ B;  4JPS A;  1OCZ E;  3FTX A;  4ZHB A;  5AN8 A;  1E7U A;  4O1O A;  1N0Q A;  4JA7 A;  1FVF A;  2OVB A;  5EX3 A;  3IXE A;  3CHQ A;  4IRU A;  2WQ7 A;  4APO A;  3UM1 A;  4HFG A;  4BET A;  3ZYQ A;  4JHR A;  1S64 A;  4HB5 A;  3EHQ A;  3SY2 A;  2WXM A;  2LNI A;  2JAB A;  3ULY A;  3L82 A;  2IO2 C;  3ZN3 A;  4EBA A;  5BNW A;  1PC2 A;  2KAT A;  1OWL A;  3CKC A;  4J8Y A;  1DCE A;  5D0Q D;  3D9O A;  4GTS A;  4CT0 A;  2GGF A;  2A5E A;  2YIN A;  4PS3 A;  3CVU A;  3B13 A;  4G2V A;  4MS6 A;  3D9M A;  1QBQ A;  4GTM A;  3ZFW A;  4GTO A;  1OY3 D;  1MQS A;  4GA2 A;  3GYZ A;  5BXO A;  4L2Y A;  3D9N A;  4TXR A;  4GTP A;  4ACK A;  2IFU A;  3QWP A;  2E0I A;  5LCW C;  1NA3 A;  2QC9 A;  1EF1 C;  4M7C A;  3FH5 A;  4FUL A;  3AS4 A;  3FU5 A;  4XI9 A;  3Q9N C;  3UT7 A;  5D0O D;  4TUM A;  2EIN E;  2YHE A;  3DWL G;  3MGB A;  3SF4 A;  3V2X A;  2B6C A;  3QK0 A;  2QYJ A;  1MZC A;  5AJD A;  1V55 E;  1DCQ A;  1ZU2 A;  1BI7 B;  1W3B A;  4YDW A;  5J08 A;  2J8S D;  3G2V A;  4MRU A;  1JWF A;  3HXD A;  2V5Q C;  3CK7 A;  3FU0 A;  1YCS B;  5EIB E;  5ENR D;  2HO1 A;  4N3C A;  2KCL A;  3G2U A;  4G23 A;  3MKQ B;  3U64 A;  3ABL E;  3T8K A;  2GRM A;  4A55 A;  1P5Q A;  3UT8 A;  1DC2 A;  4ATZ D;  3NB2 A;  4YND A;  1X5B A;  3FUJ A;  2A4Z A;  2XCC A;  4BTB A;  3SZ7 A;  3BG1 B;  3E30 A;  4ANV A;  2P9I G;  2FUL A;  3SNX A;  4N5Q A;  3TWT A;  1D8D A;  1OUV A;  2GRL A;  2J4D A;  3B7B A;  5KNH D;  4N2S A;  3UQ3 A;  3CK9 A;  3RO2 A;  4UI9 K;  2PL2 A;  1N4R A;  4AJW A;  2CFU A;  3UKR G;  3SBT B;  2WB2 A;  5AQ9 A;  1S70 B;  3ONK A;  3G2T A;  4U0U A;  3FDH A;  1O1T A;  1QQE A;  4ACL A;  4AEZ C;  4TUU A;  5CER B;  3FUH A;  5FTP A;  3DEO A;  3RU0 A;  3E33 A;  4K0R A;  2PM6 A;  4GMR A;  5HRY A;  3TWX A;  3L13 A;  5FQ4 A;  2XZD G;  4F1S A;  4WAF A;  3UIN C;  3FP3 A;  2DWZ A;  4WWN A;  4HQD A;  4I2Z A;  2UY1 A;  3W9G A;  1MX4 A;  5ENP D;  1U3D A;  1KLX A;  2KC7 A;  3ONL A;  1INZ A;  5CMW A;  3R9M A;  3FTY A;  2BKK B;  4HLL A;  2P2C P;  5T4Y A;  2V5F A;  4B0Z A;  1NL4 A;  3PUJ A;  3CHR A;  2ZGD A;  5ANR A;  4BTA A;  2J49 A;  3HVE A;  4I17 A;  2XGO A;  4TV3 A;  4LRZ A;  4ME2 A;  3JQ0 A;  3ZPJ A;  1HX8 A;  4APF A;  3LDZ A;  3LVQ E;  3ULE G;  2KM4 A;  5KJL A;  4O1P A;  3EHN A;  1BPO A;  4GML A;  4B94 A;  1A5E A;  1O1S A;  4K5C A;  3BQO A;  1D9S A;  3ULQ A;  4AV7 A;  5B1B E;  1UJJ A;  3AU4 A;  1JCQ A;  2P9U G;  4DUI A;  3IV0 A;  4NRH B;  1U2V G;  2OEW A;  3UKU G;  5AEN A;  3ZIM A;  1IYG A;  3RKV A;  2JEK A;  2PQN A;  4Z68 A;  3PNT B;  3CQG B;  3IHY A;  1N52 A;  3TWV A;  1H2U A;  3WXX A;  4DLQ A;  4I6J A;  2LO6 A;  4FLB A;  2J08 A;  2QZA A;  1NI1 A;  4LEU A;  4LCT A;  1TNU A;  3AS8 A;  3IHV A;  4Q94 A;  4GYW A;  3EUV A;  2WM9 A;  1OXJ A;  2WQH A;  1YA0 A;  2F37 A;  4WNF A;  2BF0 X;  2XCB A;  4I1O B;  4Q69 A;  3JXJ A;  2X6H A;  4KBQ A;  2WVI A;  3EHM A;  1IKN D;  2V4H C;  2H6F A;  1H2V C;  5ENT D;  5D2M C;  4LNU D;  4GAA A;  3DSS A;  5AYW D;  3OTN A;  4U7E B;  4AXH A;  2MOW A;  5C2Y A;  3SBS A;  4JXT A;  2CHW A;  4GZD A;  3BU8 A;  4HI8 A;  3GZ1 A;  4GA0 A;  1TNO A;  4A1S A;  3RSE G;  3HDX A;  3PZ2 A;  5CCL A;  1JWG A;  4KMO A;  2E2E A;  4JEH A;  1XNF A;  3UM2 A;  3ESK A;  4LER A;  2CG2 A;  2LSV A;  2CHX A;  2R5S A;  3FUF A;  2KCK A;  2VSN A;  3Q78 A;  2QY7 A;  1HF8 A;  4YVQ C;  3N71 A;  3UX4 A;  3DBS A;  3CHP A;  2I1K A;  4KXK B;  4EEC A;  4ANW A;  4FA6 A;  4HS2 A;  3TWS A;  3TWQ A;  3Q47 B;  4LSZ E;  1N4S A;  3QC1 A;  1HO8 A;  3ZEF A;  2L0I A;  2FEZ A;  5FWQ A;  5BV0 A;  3OXF A;  3DRA A;  5LCW J;  3D9L A;  4Y6C A;  1QNF A;  4GPK A;  3R9A B;  3ZXS A;  2OND A;  4WND A;  2Y4T A;  4GTR A;  5EN5 D;  3JXI A;  4V3I A;  3QNK A;  4NQ0 A;  1HS6 A;  3J5Q B;  4KYO B;  3CVN A;  3E4B A;  4CYM D;  3L16 A;  1OWO A;  5CRV A;  4DK5 A;  5FZQ A;  4N2Q A;  1H6P A;  3JUE A; 
#chains in the Genus database with same CATH homology
 2MYO A;  3EHR A;  4BES A;  1OT8 A;  4QFV A;  1G3N B;  2HE0 A;  4RLY A;  4U95 D;  5EIL A;  1WG0 A;  2VGE A;  5JMN D;  3KEA A;  5AAO A;  2ZGD A;  5CBO A;  2KXP C;  4N5Q A;  3ZNG A;  3TWT A;  3ZU7 B;  4NIK A;  2ZGG A;  2DZO A;  2DVW A;  4DRX E;  3Q9U C;  4HI8 A;  1OY3 D;  1MJ0 A;  5HKP A;  3NOG D;  3T9K A;  2AJA A;  1BI8 B;  3AAA C;  2RFA A;  5BXO A;  3B7B A;  4U8V D;  5KBA A;  2B0O E;  3NOC D;  5KNH D;  5FIO A;  4DX5 D;  5AAR A;  4HBD A;  4HNA D;  1NFI E;  4U8Y D;  3HRA A;  3C5R A;  1MX6 A;  1N0R A;  2XZT G;  4O1P A;  3D9H A;  3ZKJ A;  1A5E A;  2RFM A;  2XEE A;  3TWR A;  4K5C A;  3UI2 A;  1QYM A;  3J5P A;  5CBN A;  2ETC A;  1SW6 A;  2QC9 A;  3EU9 A;  1D9S A;  4HRM B;  5FIN A;  3V79 K;  2Y0B G;  4LG6 A;  5CEC B;  2L6B A;  4F1P A;  4DX1 A;  4CZ2 D;  5AQ9 A;  1S70 B;  4O60 A;  1SVX A;  4DUI A;  2FO1 E;  4F6R D;  1YMP A;  4K5A B;  1MYO A;  3Q9N C;  3V2O A;  4HI9 A;  2F8Y A;  4BSZ B;  4TUM A;  5CER B;  3DEP A;  5ENQ D;  5CEA A;  3ZUV B;  5EYL A;  4G8K A;  5AQB A;  3TWU A;  1N11 A;  3DEO A;  5AN8 A;  4Z68 A;  4ZHB A;  3V2X A;  3TWV A;  4OAU C;  4O1O A;  2QYJ A;  1K1A A;  4BEP A;  5ENO D;  1WDY A;  1N0Q A;  4DX2 A;  4HRN A;  3TWS A;  3TWQ A;  4GMR A;  4QQI A;  4LSZ E;  2DZN A;  3AJI A;  2NYJ A;  1DCQ A;  2ETA A;  1BI7 B;  5HRY A;  1K3Z D;  3TWX A;  4DX7 D;  5KWD A;  5ENS D;  4YDW A;  5ITZ F;  2J8S D;  2XZD G;  3IXE A;  4DX6 D;  3UTM A;  5HS0 A;  4C48 B;  2V5Q C;  2BKG A;  1AP7 A;  4A63 B;  1K1B A;  1IHB A;  5AQA A;  4BET A;  4OAV B;  1YCS B;  2DWZ A;  4HB5 A;  3EHQ A;  4ZFH A;  5ENR D;  5EIB E;  1YYH A;  2XEH A;  5D66 A;  4B93 B;  4HRL A;  5CED B;  2F8X K;  4HQD A;  5BXU A;  3V30 A;  1AWC B;  5AQ7 A;  2JAB A;  3W9G A;  1BLX B;  5EYP F;  1MX4 A;  3V31 A;  2F37 A;  2XEN A;  5ENP D;  5EN5 D;  2PNN A;  2ETB A;  1MX2 A;  3HG0 D;  1UOH A;  3JXI A;  4BER A;  3B95 A;  3T8K A;  3JXJ A;  4J7W A;  3J5Q B;  3SO8 A;  4K5B A;  4JB8 P;  1TR4 A;  2KBX A;  4CYM D;  3TWW A;  1BD8 A;  5EID A;  4J8Y A;  3F6Q A;  4GPM A;  3LJN A;  1IKN D;  2V4H C;  4G8L A;  4YDY A;  5KNG A;  4ATZ D;  5JA4 D;  1DC2 A;  3UXG A;  4U96 D;  1BU9 A;  2Y1L E;  5ENT D;  1IXV A;  2BKK B;  3JUE A;  4HLL A;  2P2C P;  3W9F A;  4UUC A;  3NBN B;  4LNU D;  2A5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...