4HRNA

Structural basis for eliciting a cytotoxic effect in her2-overexpressing cancer cells via binding to the extracellular domain of her2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
121
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVNAKDEYGLTPLYLATAHGHLEIVEVLLKNGADVNAVDAIGFTPLHLAAFIGHLEIAEVLLKHGADVNAQDKFGKTAFDISIGNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/de novo protein
molecule keywords Designed Ankyrin Repeat Protein H10-2-G
publication title Structural Basis for Eliciting a Cytotoxic Effect in HER2-Overexpressing Cancer Cells via Binding to the Extracellular Domain of HER2.
pubmed doi rcsb
source organism Synthetic
total genus 39
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hrnA00
4HBDA 2L6BA 3HRAA 4ATZD 2XZDG 1AWCB 4HQDA 1BI8B 2XZTG 3J5QB 4B93B 4BSZB 3TWVA 1OY3D 2QC9A 4DX7D 2XENA 4BEPA 1SVXA 4YDWA 2XEHA 4O1OA 1A5EA 2ZGGA 4J8YA 2V4HC 3V2XA 4U8YD 3TWRA 2BKGA 5EIDA 5D66A 2F8YA 2F8XK 4Z68A 5HS0A 4GPMA 4K5BA 3ZUVB 4HLLA 2RFMA 2NYJA 2F37A 3HG0D 3Q9NC 5BXUA 2HE0A 5EIBE 1MX6A 5JA4D 5FINA 1S70B 4GMRA 1G3NB 1MX2A 1K1AA 5KNHD 1SW6A 1NFIE 3J5PA 5ENSD 2V5QC 2J8SD 4UUCA 3EU9A 5AARA 2DVWA 3T8KA 3V79K 5JMND 3KEAA 4QFVA 4BERA 4DRXE 3V2OA 3V31A 5CEDB 5AN8A 3NBNB 5ENOD 4OAUC 3D9HA 3UTMA 1MX4A 1IHBA 3TWSA 1K3ZD 2DWZA 1IKND 3NOGD 4G8LA 4DX6D 1D9SA 4HI9A 4U95D 5HRYA 1N0QA 3W9GA 3EHRA 4DX1A 3TWQA 1N11A 5ENRD 3W9FA 4O1PA 3AAAC 4NIKA 5ENPD 3ZNGA 4LG6A 1BD8A 1MYOA 1WDYA 1IXVA 4CYMD 2KBXA 4A63B 1BI7B 2P2CP 2ETBA 4YDYA 2ZGDA 2ETAA 2Y0BG 5ENTD 5AQAA 3LJNA 4O60A 4DUIA 1DCQA 1MJ0A 4HI8A 3Q9UC 5KBAA 1TR4A 1DC2A 2Y1LE 5CERB 2B0OE 1BU9A 4HB5A 2BKKB 5FIOA 4OAVB 2A5EA 5ITZF 3DEOA 4BETA 4N5QA 3V30A 2DZOA 4F1PA 1YYHA 2XEEA 4RLYA 4C48B 5CBOA 5HKPA 2FO1E 4J7WA 2QYJA 3C5RA 3IXEA 4G8KA 1AP7A 5EILA 2AJAA 4K5CA 5AQBA 3ZU7B 4DX2A 5EN5D 5BXOA 5KNGA 4ZFHA 4LNUD 4K5AB 2DZNA 4LSZE 2ETCA 3F6QA 2JABA 3JXJA 2KXPC 5CBNA 4QQIA 4HRLA 3B95A 5EYPF 2MYOA 2VGEA 3JUEA 5AQ7A 4DX5D 1K1BA 2RFAA 3NOCD 5CECB 5KWDA 1N0RA 4HRMB 2PNNA 3AJIA 3JXIA 1UOHA 3DEPA 4TUMA 1QYMA 3TWXA 5EYLA 4ZHBA 4F6RD 1YCSB 1BLXB 1WG0A 3TWTA 5ENQD 4U96D 5AAOA 3TWUA 4U8VD 4BESA 3UXGA 3SO8A 5AQ9A 3ZKJA 3TWWA 3EHQA 4HRNA 4CZ2D 3B7BA 3UI2A 1OT8A 3T9KA 1YMPA 4HNAD 4JB8P 5CEAA
chains in the Genus database with same CATH superfamily
2A5UA 2XCCA 5LOZA 1JUQA 4NRHB 3CIAA 4XI9A 1O1SA 4GZDA 1BPOA 1PC2A 3CVPA 5EIDA 2XQ0A 2YQ8A 1HF8A 3IEGA 4MRUA 5G2NA 2YINA 2UY1B 3CK7A 3FTUA 2PQNA 3VLDA 1MHQA 2H6HA 3V31A 3GW4A 2KCKA 3Q75A 5HI7A 4YDEA 3KSLA 4BT8A 4JA7A 3FU6A 4ME2A 4URKA 3PRZA 1HH8A 3D9OA 2P9NG 3QK0A 1WAO1 4GTTA 4JL0A 1BI7B 2P2CP 4DLQA 2ZGDA 2HO1A 4XIFA 4UQXA 2XS8A 4ILGA 3S7BA 5FIOA 3R7QA 3LY9A 4KT6B 4BY6A 4A3TA 3PUKA 2P9IG 3DPYA 3SFXA 4K5CA 4CT0A 4DX2A 4JZYA 4CT4A 3SQVA 4K5AB 4G1TA 4HRLA 4I17A 2VSOE 4EZKA 2PNNA 4EBAA 3ZVVA 1UOHA 2WB2A 4GTMA 2ZXWE 2I6HA 3CK8A 4DK5A 4CDMA 3ZXSA 3ABKE 5FJYA 3T9KA 2IF4A 4JB8P 3SZ7A 2WXOA 3J5QB 3TWVA 4YDOA 3FH5A 5J08A 2XEHA 4O1OA 5JJ7A 2FBNA 3U66A 3LJ3A 2CHXA 5D66A 5FQ6A 2OV8A 2L9BA 1FT1A 3EHMA 3PZ3A 4YNDA 5D0OD 4U0UA 1MX2A 3FUDA 4TRQA 4XEIG 5JMND 1O1TA 4H7YA 2L6JA 2GRMA 2KZTA 1WY6A 2OCCE 4L7TA 3PREA 3E4BA 3CSTA 4ANUA 1UJJA 3DXMG 3JCKC 3TGOA 1TNZA 1MYOA 4NURA 3MV3B 4AV7A 2P58C 5EKQD 2Y1LE 4JPSA 2B0OE 3Q78A 3U64A 1YYHA 3MV2B 1O5MA 3ULQA 4H7XA 4UQYA 3QARA 2OOEA 4AY6A 2X6IA 2IO3C 4DX5D 2RKKA 4AM9A 5HQ8A 1H2TC 3CVVA 3L22A 3L54A 3APDA 3DWLG 3RO3A 3CV0A 3ZYQA 2HR2A 1OWNA 2FEZA 2LAHA 5EDSA 3TWWA 2WXNA 2H6GA 5EX3A 3ESLA 5CRUA 3ZHEA 3QWPA 1NL4A 1HZ4A 2X6FA 3SF4A 1QQEA 1SVXA 4E6HA 4J8YA 1UN9A 4WNEA 5FZRA 5ENNA 4GYOA 2FULA 3KEZA 3ZUVB 4K5BA 3CVQA 2Y4UA 1N52A 2WM9A 2LSUA 4GA1A 3BG1B 5KJNA 4IYPA 2V5QC 3T8KA 3CVNA 3KEAA 3KSQA 1YA0A 4UI9C 3UTMA 3CK9A 5HRYA 4CEMA 4ABNA 5B1AE 4FADA 1H6OA 1OWMA 1UG3A 4XX5A 4Y6WA 3ZNGA 4N2QA 2DYSE 2GRPB 3CVXA 4WAFA 5KJKA 3APFA 2Y0BG 3FULA 3Q9UC 2R17C 4FP7A 4HB5A 1X81A 3G2TA 3AG4E 4RSYA 4J6IA 5BXOA 1TN7A 3S7DA 2KZTB 3ESKA 4KYOB 5EYPF 3E30A 4PS7A 1N0RA 3EIQC 3LKUA 2PZIA 4BESA 3RSEG 1NZNA 3Q5MA 4KVMA 4D10C 4CGWA 4HRNA 4OVVA 3HXBA 3FTYA 4BTAA 1Z3XA 1BI8B 5JHAA 2NSZA 4DJAA 2I1KA 5FZQA 3FH8A 4ANVA 3TG4A 3ABLE 4XKBA 2VGYA 4JA9A 4YVOA 4HLLA 2F37A 1TJFA 4GTQA 2E0IA 4APFA 1X5BA 2BTDA 2X6JA 1O1RA 4XKCA 3VLFA 1TYQG 2AXVA 3RJVA 3ZHEB 2P9UG 2Y69E 2LXLA 4WUYA 1XGWA 1D8DA 2J4BA 2J9QA 1QBQA 4FHKA 3IV0A 1E8ZA 2J09A 3UUXA 4A1SA 4I6JA 3HXDA 2FO1E 1HG2A 2QYJA 4GZCA 1ELKA 5G04C 3ASOE 4AVXA 4UWLA 1UW4B 3FUJA 4EZLA 3HXCA 1QYMA 4F6RD 3E34A 3UXGA 4B8CB 3SO8A 5AQ9A 2PQRA 3OXLA 3WG7E 2XGOA 3G2VA 3FUNA 1HX8A 4APOA 1KZPA 1U3DA 4BSZB 3JQ1A 3T5XA 3FTVA 2UY1A 5CMYA 3UIPC 2ZIRA 4ANWA 2CG2A 3ZYKA 4Z68A 2WXQA 4K03A 4MBGA 1P5QA 3HG0D 5BXUA 1S70B 5KNHD 1SZAA 3L9TA 3I4RB 1ZU2A 2WXRA 1ZBPA 3V2OA 3MKRA 2EIJE 2P9PG 4OYSA 1GW6A 2DCPA 1DVPA 1NA3A 4MLPA 4Q69A 5B3SE 3W9GA 2RD0A 3UM0A 1WM5A 4ACLA 5ENPD 5KCMA 4O60A 1DCQA 3PS6A 5M72A 2R05A 2VSNA 2QYUA 3I5PA 2WXJA 3BQOA 3OTNA 3D9JA 3SD5A 3EUVA 1KLXA 1HU3A 2AJAA 2WXFA 3PNLB 2KXPC 2H6FA 3JUEA 4U7EB 5CECB 4WWNA 3KD7A 3ZFWA 5A23A 2WMNA 5AJLA 2PM7A 5EYLA 5FQ8A 3C3QA 1BLXB 2WQHA 3CR3A 5BPPA 2OEWA 2ZISA 5ARFA 2WXLA 3EHQA 4BX8A 5CMWA 3GZ1A 3B7BA 2R2LA 5D0QD 1YMPA 3ZYMA 3X2QE 4GPKA 3D9MA 2IO2C 1OCCE 1OY3D 1DNPA 3PZ2A 4BSXA 4YDWA 4N3AA 2VYIA 3L6AA 1L5JA 2ZU6B 5AENA 3URZA 4A55A 4A1GA 3J5PA 4L2YA 5AIJA 3FHEA 4N3BA 4GU5A 4DRXE 3EHNA 5AN8A 3TG5A 3ASNE 3ONKA 2DWZA 1OWOA 2X6KA 5ENRD 1IHGA 1N94A 1JCQA 2ETBA 3ZN3A 2V5FA 1Y6IA 2XGMA 1XNFA 2XRYA 1HG5A 1TR4A 3SGHA 2C2LA 1DC2A 1SA5A 4J0UA 4ILHB 2WXIA 3U4TA 5EILA 4B0ZA 4KBQA 4U07A 4G2VA 3ZU7B 3FUEA 4ZFHA 2VGEA 4EZJA 3D9IA 5H7PA 5T8IA 5KWDA 3UX4A 4HRMB 3AS5A 2GRNB 1N4SA 3JXIA 4TUMA 3Q47B 5J90A 4FJYA 3ZEFA 1TNYA 3UT7A 2X3MA 5ENQD 2EIKE 5AAOA 5BW8C 4CRWA 4LNBA 2KCLA 2EIME 3FTZA 2XS1A 5CEAA 4HBDA 3HRAA 1LD7A 3R9MA 3QNKA 2IY0C 4B93B 3SBTB 5B1BE 2XENA 3CVWA 3D9KA 2R02A 2V4HC 3V2XA 3SFZA 5DBKA 2OVFA 2GRRB 1EPUA 4GTOA 1K1AA 5CCMA 4KZCA 1OCOE 3CEQA 3CKBA 1FT2A 3AG1E 5KJLA 1FVHA 2HM8A 3HYMB 5ANRA 2VJ8A 3CHSA 5IY5E 1K3ZD 1D9SA 4HI9A 2XGSA 4RG9A 5G05J 4HXIA 4EECA 3PZDA 1IYGA 4P29A 3D9NA 3PE3A 3DSXA 4JEHA 3UM1A 4CCAA 2R59A 4CDRA 1E7VA 4C9BB 3RRMB 4WNDA 3Q79A 3CHOA 5KBAA 3FUHA 4JVSA 1H0AA 2BKKB 4FULA 3WXXA 3TXMA 5ITZF 4GYYA 3DEOA 4ATGA 4C48B 3FTSA 3DRAA 1RW2A 2XEVA 1KT1A 4JHKA 3SY2A 1N4QA 2JABA 3JXJA 3O48A 1VDYA 5AQ7A 4W9RA 3D9PA 2L0IA 1JWGA 3BUAA 3ML9A 2WXPA 3LEWA 4F53A 2AVPA 3PUJA 1E7UA 3OXGA 3ZKJA 1NI1A 2XZDG 2R03A 1A17A 2WVIA 1ZB1A 2YNQA 3E32A 2LO6A 4ILIA 2BKGA 3QKYA 3CSFA 3GYZA 3HXEA 5FQ4A 2F8XK 3PEVB 2CFZA 2GRQB 3ASHA 3S7FA 5AARA 1S0PA 1S64A 5FQ7A 2AWIA 3LPZA 3NBNB 2BUGA 3ZGQA 2LSVA 2WXHA 4JHJA 4XI0A 4GA2A 1IKND 3ISMC 1N0QA 4PUCA 1N11A 3I4GA 1D8EA 4AIFA 3FH7A 1WDYA 4IN3B 4WWOA 2ETAA 3HVEA 3RAUA 4N39A 3ABME 4KZ0A 5CERB 2A5EA 1H2VC 3PEUB 5G55A 3B7TA 4K0RA 1NP7A 4MS6A 4FJZA 5BV0A 1E96B 4L1BA 2RFAA 1Q2ZA 5T3RA 3QAQA 4F7AA 3G2UA 4GZ6A 2B6CA 4UWKA 1WG0A 4LERA 3CHMA 3TL5A 3RK6A 5E75A 5A6CA 3FUIA 1OUVA 4BT9A 3NF1A 1FVFA 1OT8A 2I1JA 3B13A 1LF8A 3QWWA 1ELRA 2XRZA 4GA0A 3ZYLA 5C1DA 2WXKA 3FWVA 2LUHA 3RRUA 3CVUA 4C0EA 3LS8A 2RFMA 3I3NA 3ULEG 1MX6A 5JA4D 4J8FA 4A3VA 3IHVA 5BNWA 3MKQA 3IBEA 4JW1A 3LVRE 1MX4A 1ELWA 3FDHA 3ONLA 2FO7A 4U04A 2BEDA 3CHQA 3U9WA 5CRVA 2LXMA 5FWQA 4YDYA 5ENTD 2XPYA 1MJ0A 2GROB 4TXRA 2LNIA 4I6GA 4OAVB 2NXPA 4N5QA 5CBOA 4I2WA 1UN8A 1W3BA 4DPRA 4LNUD 2VSYA 1H19A 4GTSA 5BUZA 3EIJA 3R7RA 3FU5A 1TNBA 4I2ZA 3DEPA 3FEYA 3TWUA 1S63A 3HVEB 4I43A 2C0MA 3FUKA 4CZ2D 4AY5A 5A7DB 4HOSA 2BF0X 2KCVA 4ATZD 4U0ZA 2XZTG 3ZIMA 1INZA 4UWHA 5HS0A 4GPMA 3QC1A 1SW6A 4G25A 2P9KG 2J8SD 4UUCA 3N71A 4IULA 4QFVA 3DSSA 3DBSA 5ENOD 4PS3A 3D9HA 4RVBA 1KT0A 2IFUA 3W9FA 4DI3A 3NB2A 1KZOA 4UWGA 1BD8A 1HFAA 5E76A 2VTBB 3C3RA 1U2VG 1OWPA 3AG2E 3CKCA 3T8MA 5LP0A 2FF4A 1Z6TA 3R9AB 1FPPA 3GZ2A 4N5CA 4G8KA 5KJMA 1JWFA 5LCWJ 1H2UA 3MKQB 3DSWA 2C0LA 3PNTB 3SBSA 4TXPA 1UJKA 1B89A 3LVQE 2GGFA 2I2OA 3DSTA 4GB9A 4Q94A 2VQ2A 3UQ3A 4ANXA 4AJWA 3P2BA 1YCSB 2GRLA 3TWTA 4I9CA 4DLOA 2J4DA 4RG6A 2WMOA 4HNAD 2L6BA 4HQDA 3UT4A 2QC9A 3SHFA 3FY4A 2IU1A 1SA4A 1V55E 4NQ0A 3VTXA 4JXTA 4XE0A 3P1UA 1NFIE 4N2SA 4C0MA 3UPVA 2EINE 3C3OA 4AP2A 4GCNA 3CLJA 3QOUA 4HVBA 1Y8MA 3TWSA 2IONA 4GYWA 4OVUA 3SI5A 3NZUA 4LEUA 3JYSA 4AXHA 4LCTA 5DIZA 3TAXA 2IQCA 2P9LG 3NAWA 4XZ4A 3MJWA 3MEKA 3AG3E 3SFYA 1AP7A 2H6IA 3CHPA 5ARGA 4GMLA 4FLBA 2OVBA 3RIBA 1RZ4A 4QQIA 2CHZA 3LDZA 3U3WA 4B8AA 4JEUA 3L82A 4KVOA 4U96D 4U8VD 3FTWA 1DCEA 2IJGX 4PDXA 2XCBA 4U63A 2PL2A 4BTBA 2YHEA 3S2AA 1TEZA 3DSUA 2NC9A 1MZCA 1TJCA 3B7UX 3PZ1A 2M63A 5FINA 1G3NB 3MX3A 3BG0B 2I9CA 2DVWA 1K8KG 3V79K 2LAIA 4HORA 4AOFA 4WWPA 4LUNU 1E90A 1HE8A 1H6PA 4EBAG 3TWQA 5D2MC 3DSVA 3FU3A 4LG6A 4JHRA 1HO8A 2QFCA 4NACA 4CYMD 2WQ6A 4A63B 5G05C 4HOTA 2Y3AA 2VSXE 4LNGA 3RO2A 4J8SA 4N3CA 3Q7AA 4I9EA 5FT9A 2RG8A 3D3MA 3IXEA 5CCLA 3ML8A 2ONDA 4LSZE 3F6QA 4GZ3A 5T4YA 1TN6A 2MYOA 3Q49B 4FA6A 1V54E 2V8SE 3Q4AB 3FU0A 2OEVA 3T5VA 2CFUA 4WNFA 3EU5A 3GZSA 3CGHA 3BEEA 1E8XA 3ZXPA 3AU4A 3PVLA 2J49A 2EQXA 1N4RA 4U8YD 4F1SA 1SZ9A 5JHBA 5AYWD 1PY1A 2YHCA 2HE0A 1N95A 4JC8A 4I1MA 3CHRA 4Q96A 4BERA 1EYHA 5LFAA 1MQSA 1JCSA 3E33A 5ANLA 1IHBA 3FUFA 3AU5A 3JUIA 1QNFA 3NQPA 1QZ2A 3CQCB 3AAAC 2J08A 4GMJA 3LY7A 4FHJA 3C72A 3FP3A 3MCXA 3IKOB 4HOUA 3C98A 4U8HA 4LRZA 2X6HA 5AQAA 3EJNA 2KC7A 2KATA 4UWFA 3ASFA 3Q73A 3VTYA 4BETA 3V30A 4F1PA 2DZOA 4RLYA 2XEEA 4GTRA 4J7WA 2DIWA 1KPSB 1LD8A 3PDNA 1EDUA 2ETCA 4U0SA 4IRUA 4E85A 2F0YA 5CBNA 4UI9K 3FTXA 2MOWA 2QZAA 4YVQC 4J8DA 2PM6A 1HXIA 3LY8A 2IOSA 2J07A 3UI2A 5FTPA 3VLEA 2DBAA 3UINC 4BFRA 2IOLA 1OCRE 2X38A 1A5EA 3NZSA 3EDTB 3G2SA 2F8YA 4I1AA 3RU0A 4AEZC 4I1OB 4UI9J 4GMRA 5ENSD 1HS6A 4L23A 4R7LA 4KMOA 4ACKA 1PAQA 5CEDB 1NA0A 4BWRA 1OXJA 2AW6A 4B89A 3Q7FA 2VTBA 3QJZA 4HFGA 4X8QA 4O1PA 3MGBA 3MZLB 3UM2A 4PS8A 3BU8A 4J8EA 3LYAA 4HI8A 3HIZA 1BU9A 2WPVA 5CHEE 5BV1A 4HOQA 4KXKB 3ZW3A 2QY7A 3B7SA 5EN5D 4DI4A 3PH0C 3FUMA 4GZ5A 4EHMA 2IEJA 4PH4B 3B95A 2WQ7A 1N54A 3OAWA 5BT1A 2DYRE 1E8YA 2ILRA 3Q15A 2JLBA 1TNUA 4G26A 2A4ZA 4BX9A 3UMVA 4L9PA 3DXKG 3E37A 4FU3A 3AS8A 4DX7D 4M3OA 3RKVA 3UKUG 2ZGGA 4G23A 1H6KA 2XHEA 2FI7A 4HLEA 3CVLA 3B7RL 3APCA 1OWLA 2NYJA 3ZRHA 3EU9A 4CDNA 1IQRA 4V3IA 2R5SA 3ENEA 3RRNB 4OAUC 4G8LA 4U95D 4TXQA 5LX8A 4DX1A 3EHRA 2XPZA 3FEXA 3UIOC 4NIKA 2Q7FA 4FLHA 3OXFA 1IXVA 4GTPA 4RQIA 3QB2A 4WNGA 1JCRA 5JJTA 3LJNA 2HYZA 4Y6CA 5G04J 3CQGB 2V0PA 2VGXA 5HKPA 3C5RA 1OCZE 3PE4A 2DZNA 4CGVA 1N9AA 3JQ0A 2AXUA 1K1BA 3TXNA 2Y4TA 1JPLA 1TNOA 3AJIA 3SNXA 5LCWC 4I6EA 3LXUX 4GAAA 4ZHBA 1IQUA 5AJDA 2L0TB 3KAEA 2V4LA 3ULYA 3HXFA 3QDNA 2KM4A 4TV3A 1AWCB 3DPDA 3IHYA 2CG3A 1LTXA 1EF1C 4TUUA 4BEPA 3D9LA 3HHMA 2UWJG 3HDXA 3TWRA 3UKRG 2P9SG 5C2YA 3Q9NC 5EIBE 1FCHA 2JEKA 2WXGA 5JJ6A 3S7JA 4EPZA 3ZPJA 1TN8A 2MRIA 5FZSA 4O6FA 3L08A 1Z3YA 4F3VA 4JD2G 3NOGD 4DX6D 5EX0A 4UQZA 3ASGA 3QWVA 3AS4A 4FC8A 3L16A 3MA5A 2GW1A 2KBXA 3TJPA 3ASDA 4DUIA 1SQMA 2E2EA 4B94A 4G11A 2XPIA 3KS2A 4L2LA 3CVYA 4GTVA 4HS2A 1Z5SC 5AQBA 3UT8A 5KNGA 3L17A 3K9IA 3LCAA 4GCOA 1E8WA 1U3CA 2EILE 3FFLA 3NOCD 2WXMA 1N4PA 3O4ZA 3G2WA 3UM3A 3MYVA 2AXZA 3TWXA 4MKTA 2CHWA 3L13A 3PZ4A 4EQFA 4G24A 2MHKA 4M7CA 2VGXB
chains in the Genus database with same CATH topology
4HBDA 2L6BA 3HRAA 4ATZD 2XZDG 1AWCB 4HQDA 1BI8B 2XZTG 3J5QB 4B93B 4BSZB 3TWVA 1OY3D 2QC9A 4DX7D 2XENA 4BEPA 1SVXA 4YDWA 2XEHA 4O1OA 1A5EA 2ZGGA 4J8YA 2V4HC 3V2XA 4U8YD 3TWRA 2BKGA 5EIDA 5D66A 2F8YA 2F8XK 4Z68A 5HS0A 4GPMA 4K5BA 3ZUVB 4HLLA 2RFMA 2NYJA 2F37A 3HG0D 3Q9NC 5BXUA 2HE0A 5EIBE 1MX6A 5JA4D 5FINA 1S70B 4GMRA 1G3NB 1MX2A 1K1AA 5KNHD 1SW6A 1NFIE 3J5PA 5ENSD 2V5QC 2J8SD 4UUCA 3EU9A 5AARA 2DVWA 3T8KA 3V79K 5JMND 3KEAA 4QFVA 4BERA 4DRXE 3V2OA 3V31A 5CEDB 5AN8A 3NBNB 5ENOD 4OAUC 3D9HA 3UTMA 1MX4A 1IHBA 3TWSA 1K3ZD 2DWZA 1IKND 3NOGD 4G8LA 4DX6D 1D9SA 4HI9A 4U95D 5HRYA 1N0QA 3W9GA 3EHRA 4DX1A 3TWQA 1N11A 5ENRD 3W9FA 4O1PA 3AAAC 4NIKA 5ENPD 3ZNGA 4LG6A 1BD8A 1MYOA 1WDYA 1IXVA 4CYMD 2KBXA 4A63B 1BI7B 2P2CP 2ETBA 4YDYA 2ZGDA 2ETAA 2Y0BG 5ENTD 5AQAA 3LJNA 4O60A 4DUIA 1DCQA 1MJ0A 4HI8A 3Q9UC 5KBAA 1TR4A 1DC2A 2Y1LE 5CERB 2B0OE 1BU9A 4HB5A 2BKKB 5FIOA 4OAVB 2A5EA 5ITZF 3DEOA 4BETA 4N5QA 3V30A 2DZOA 4F1PA 1YYHA 2XEEA 4RLYA 4C48B 5CBOA 5HKPA 2FO1E 4J7WA 2QYJA 3C5RA 3IXEA 4G8KA 1AP7A 5EILA 2AJAA 4K5CA 5AQBA 3ZU7B 4DX2A 5EN5D 5BXOA 5KNGA 4ZFHA 4LNUD 4K5AB 2DZNA 4LSZE 2ETCA 3F6QA 2JABA 3JXJA 2KXPC 5CBNA 4QQIA 4HRLA 3B95A 5EYPF 2MYOA 2VGEA 3JUEA 5AQ7A 4DX5D 1K1BA 2RFAA 3NOCD 5CECB 5KWDA 1N0RA 4HRMB 2PNNA 3AJIA 3JXIA 1UOHA 3DEPA 4TUMA 1QYMA 3TWXA 5EYLA 4ZHBA 4F6RD 1YCSB 1BLXB 1WG0A 3TWTA 5ENQD 4U96D 5AAOA 3TWUA 4U8VD 4BESA 3UXGA 3SO8A 5AQ9A 3ZKJA 3TWWA 3EHQA 4HRNA 4CZ2D 3B7BA 3UI2A 1OT8A 3T9KA 1YMPA 4HNAD 4JB8P 5CEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBD A;  2L6B A;  3HRA A;  4ATZ D;  2XZD G;  1AWC B;  4HQD A;  1BI8 B;  2XZT G;  3J5Q B;  4B93 B;  4BSZ B;  3TWV A;  1OY3 D;  2QC9 A;  4DX7 D;  2XEN A;  4BEP A;  1SVX A;  4YDW A;  2XEH A;  4O1O A;  1A5E A;  2ZGG A;  4J8Y A;  2V4H C;  3V2X A;  4U8Y D;  3TWR A;  2BKG A;  5EID A;  5D66 A;  2F8Y A;  2F8X K;  4Z68 A;  5HS0 A;  4GPM A;  4K5B A;  3ZUV B;  4HLL A;  2RFM A;  2NYJ A;  2F37 A;  3HG0 D;  3Q9N C;  5BXU A;  2HE0 A;  5EIB E;  1MX6 A;  5JA4 D;  5FIN A;  1S70 B;  4GMR A;  1G3N B;  1MX2 A;  1K1A A;  5KNH D;  1SW6 A;  1NFI E;  3J5P A;  5ENS D;  2V5Q C;  2J8S D;  4UUC A;  3EU9 A;  5AAR A;  2DVW A;  3T8K A;  3V79 K;  5JMN D;  3KEA A;  4QFV A;  4BER A;  4DRX E;  3V2O A;  3V31 A;  5CED B;  5AN8 A;  3NBN B;  5ENO D;  4OAU C;  3D9H A;  3UTM A;  1MX4 A;  1IHB A;  3TWS A;  1K3Z D;  2DWZ A;  1IKN D;  3NOG D;  4G8L A;  4DX6 D;  1D9S A;  4HI9 A;  4U95 D;  5HRY A;  1N0Q A;  3W9G A;  3EHR A;  4DX1 A;  3TWQ A;  1N11 A;  5ENR D;  3W9F A;  4O1P A;  3AAA C;  4NIK A;  5ENP D;  3ZNG A;  4LG6 A;  1BD8 A;  1MYO A;  1WDY A;  1IXV A;  4CYM D;  2KBX A;  4A63 B;  1BI7 B;  2P2C P;  2ETB A;  4YDY A;  2ZGD A;  2ETA A;  2Y0B G;  5ENT D;  5AQA A;  3LJN A;  4O60 A;  4DUI A;  1DCQ A;  1MJ0 A;  4HI8 A;  3Q9U C;  5KBA A;  1TR4 A;  1DC2 A;  2Y1L E;  5CER B;  2B0O E;  1BU9 A;  4HB5 A;  2BKK B;  5FIO A;  4OAV B;  2A5E A;  5ITZ F;  3DEO A;  4BET A;  4N5Q A;  3V30 A;  2DZO A;  4F1P A;  1YYH A;  2XEE A;  4RLY A;  4C48 B;  5CBO A;  5HKP A;  2FO1 E;  4J7W A;  2QYJ A;  3C5R A;  3IXE A;  4G8K A;  1AP7 A;  5EIL A;  2AJA A;  4K5C A;  5AQB A;  3ZU7 B;  4DX2 A;  5EN5 D;  5BXO A;  5KNG A;  4ZFH A;  4LNU D;  4K5A B;  2DZN A;  4LSZ E;  2ETC A;  3F6Q A;  2JAB A;  3JXJ A;  2KXP C;  5CBN A;  4QQI A;  4HRL A;  3B95 A;  5EYP F;  2MYO A;  2VGE A;  3JUE A;  5AQ7 A;  4DX5 D;  1K1B A;  2RFA A;  3NOC D;  5CEC B;  5KWD A;  1N0R A;  4HRM B;  2PNN A;  3AJI A;  3JXI A;  1UOH A;  3DEP A;  4TUM A;  1QYM A;  3TWX A;  5EYL A;  4ZHB A;  4F6R D;  1YCS B;  1BLX B;  1WG0 A;  3TWT A;  5ENQ D;  4U96 D;  5AAO A;  3TWU A;  4U8V D;  4BES A;  3UXG A;  3SO8 A;  5AQ9 A;  3ZKJ A;  3TWW A;  3EHQ A;  4HRN A;  4CZ2 D;  3B7B A;  3UI2 A;  1OT8 A;  3T9K A;  1YMP A;  4HNA D;  4JB8 P;  5CEA A; 
#chains in the Genus database with same CATH topology
 2A5U A;  2XCC A;  5LOZ A;  1JUQ A;  4NRH B;  3CIA A;  4XI9 A;  1O1S A;  4GZD A;  1BPO A;  1PC2 A;  3CVP A;  5EID A;  2XQ0 A;  2YQ8 A;  1HF8 A;  3IEG A;  4MRU A;  5G2N A;  2YIN A;  2UY1 B;  3CK7 A;  3FTU A;  2PQN A;  3VLD A;  1MHQ A;  2H6H A;  3V31 A;  3GW4 A;  2KCK A;  3Q75 A;  5HI7 A;  4YDE A;  3KSL A;  4BT8 A;  4JA7 A;  3FU6 A;  4ME2 A;  4URK A;  3PRZ A;  1HH8 A;  3D9O A;  2P9N G;  3QK0 A;  1WAO 1;  4GTT A;  4JL0 A;  1BI7 B;  2P2C P;  4DLQ A;  2ZGD A;  2HO1 A;  4XIF A;  4UQX A;  2XS8 A;  4ILG A;  3S7B A;  5FIO A;  3R7Q A;  3LY9 A;  4KT6 B;  4BY6 A;  4A3T A;  3PUK A;  2P9I G;  3DPY A;  3SFX A;  4K5C A;  4CT0 A;  4DX2 A;  4JZY A;  4CT4 A;  3SQV A;  4K5A B;  4G1T A;  4HRL A;  4I17 A;  2VSO E;  4EZK A;  2PNN A;  4EBA A;  3ZVV A;  1UOH A;  2WB2 A;  4GTM A;  2ZXW E;  2I6H A;  3CK8 A;  4DK5 A;  4CDM A;  3ZXS A;  3ABK E;  5FJY A;  3T9K A;  2IF4 A;  4JB8 P;  3SZ7 A;  2WXO A;  3J5Q B;  3TWV A;  4YDO A;  3FH5 A;  5J08 A;  2XEH A;  4O1O A;  5JJ7 A;  2FBN A;  3U66 A;  3LJ3 A;  2CHX A;  5D66 A;  5FQ6 A;  2OV8 A;  2L9B A;  1FT1 A;  3EHM A;  3PZ3 A;  4YND A;  5D0O D;  4U0U A;  1MX2 A;  3FUD A;  4TRQ A;  4XEI G;  5JMN D;  1O1T A;  4H7Y A;  2L6J A;  2GRM A;  2KZT A;  1WY6 A;  2OCC E;  4L7T A;  3PRE A;  3E4B A;  3CST A;  4ANU A;  1UJJ A;  3DXM G;  3JCK C;  3TGO A;  1TNZ A;  1MYO A;  4NUR A;  3MV3 B;  4AV7 A;  2P58 C;  5EKQ D;  2Y1L E;  4JPS A;  2B0O E;  3Q78 A;  3U64 A;  1YYH A;  3MV2 B;  1O5M A;  3ULQ A;  4H7X A;  4UQY A;  3QAR A;  2OOE A;  4AY6 A;  2X6I A;  2IO3 C;  4DX5 D;  2RKK A;  4AM9 A;  5HQ8 A;  1H2T C;  3CVV A;  3L22 A;  3L54 A;  3APD A;  3DWL G;  3RO3 A;  3CV0 A;  3ZYQ A;  2HR2 A;  1OWN A;  2FEZ A;  2LAH A;  5EDS A;  3TWW A;  2WXN A;  2H6G A;  5EX3 A;  3ESL A;  5CRU A;  3ZHE A;  3QWP A;  1NL4 A;  1HZ4 A;  2X6F A;  3SF4 A;  1QQE A;  1SVX A;  4E6H A;  4J8Y A;  1UN9 A;  4WNE A;  5FZR A;  5ENN A;  4GYO A;  2FUL A;  3KEZ A;  3ZUV B;  4K5B A;  3CVQ A;  2Y4U A;  1N52 A;  2WM9 A;  2LSU A;  4GA1 A;  3BG1 B;  5KJN A;  4IYP A;  2V5Q C;  3T8K A;  3CVN A;  3KEA A;  3KSQ A;  1YA0 A;  4UI9 C;  3UTM A;  3CK9 A;  5HRY A;  4CEM A;  4ABN A;  5B1A E;  4FAD A;  1H6O A;  1OWM A;  1UG3 A;  4XX5 A;  4Y6W A;  3ZNG A;  4N2Q A;  2DYS E;  2GRP B;  3CVX A;  4WAF A;  5KJK A;  3APF A;  2Y0B G;  3FUL A;  3Q9U C;  2R17 C;  4FP7 A;  4HB5 A;  1X81 A;  3G2T A;  3AG4 E;  4RSY A;  4J6I A;  5BXO A;  1TN7 A;  3S7D A;  2KZT B;  3ESK A;  4KYO B;  5EYP F;  3E30 A;  4PS7 A;  1N0R A;  3EIQ C;  3LKU A;  2PZI A;  4BES A;  3RSE G;  1NZN A;  3Q5M A;  4KVM A;  4D10 C;  4CGW A;  4HRN A;  4OVV A;  3HXB A;  3FTY A;  4BTA A;  1Z3X A;  1BI8 B;  5JHA A;  2NSZ A;  4DJA A;  2I1K A;  5FZQ A;  3FH8 A;  4ANV A;  3TG4 A;  3ABL E;  4XKB A;  2VGY A;  4JA9 A;  4YVO A;  4HLL A;  2F37 A;  1TJF A;  4GTQ A;  2E0I A;  4APF A;  1X5B A;  2BTD A;  2X6J A;  1O1R A;  4XKC A;  3VLF A;  1TYQ G;  2AXV A;  3RJV A;  3ZHE B;  2P9U G;  2Y69 E;  2LXL A;  4WUY A;  1XGW A;  1D8D A;  2J4B A;  2J9Q A;  1QBQ A;  4FHK A;  3IV0 A;  1E8Z A;  2J09 A;  3UUX A;  4A1S A;  4I6J A;  3HXD A;  2FO1 E;  1HG2 A;  2QYJ A;  4GZC A;  1ELK A;  5G04 C;  3ASO E;  4AVX A;  4UWL A;  1UW4 B;  3FUJ A;  4EZL A;  3HXC A;  1QYM A;  4F6R D;  3E34 A;  3UXG A;  4B8C B;  3SO8 A;  5AQ9 A;  2PQR A;  3OXL A;  3WG7 E;  2XGO A;  3G2V A;  3FUN A;  1HX8 A;  4APO A;  1KZP A;  1U3D A;  4BSZ B;  3JQ1 A;  3T5X A;  3FTV A;  2UY1 A;  5CMY A;  3UIP C;  2ZIR A;  4ANW A;  2CG2 A;  3ZYK A;  4Z68 A;  2WXQ A;  4K03 A;  4MBG A;  1P5Q A;  3HG0 D;  5BXU A;  1S70 B;  5KNH D;  1SZA A;  3L9T A;  3I4R B;  1ZU2 A;  2WXR A;  1ZBP A;  3V2O A;  3MKR A;  2EIJ E;  2P9P G;  4OYS A;  1GW6 A;  2DCP A;  1DVP A;  1NA3 A;  4MLP A;  4Q69 A;  5B3S E;  3W9G A;  2RD0 A;  3UM0 A;  1WM5 A;  4ACL A;  5ENP D;  5KCM A;  4O60 A;  1DCQ A;  3PS6 A;  5M72 A;  2R05 A;  2VSN A;  2QYU A;  3I5P A;  2WXJ A;  3BQO A;  3OTN A;  3D9J A;  3SD5 A;  3EUV A;  1KLX A;  1HU3 A;  2AJA A;  2WXF A;  3PNL B;  2KXP C;  2H6F A;  3JUE A;  4U7E B;  5CEC B;  4WWN A;  3KD7 A;  3ZFW A;  5A23 A;  2WMN A;  5AJL A;  2PM7 A;  5EYL A;  5FQ8 A;  3C3Q A;  1BLX B;  2WQH A;  3CR3 A;  5BPP A;  2OEW A;  2ZIS A;  5ARF A;  2WXL A;  3EHQ A;  4BX8 A;  5CMW A;  3GZ1 A;  3B7B A;  2R2L A;  5D0Q D;  1YMP A;  3ZYM A;  3X2Q E;  4GPK A;  3D9M A;  2IO2 C;  1OCC E;  1OY3 D;  1DNP A;  3PZ2 A;  4BSX A;  4YDW A;  4N3A A;  2VYI A;  3L6A A;  1L5J A;  2ZU6 B;  5AEN A;  3URZ A;  4A55 A;  4A1G A;  3J5P A;  4L2Y A;  5AIJ A;  3FHE A;  4N3B A;  4GU5 A;  4DRX E;  3EHN A;  5AN8 A;  3TG5 A;  3ASN E;  3ONK A;  2DWZ A;  1OWO A;  2X6K A;  5ENR D;  1IHG A;  1N94 A;  1JCQ A;  2ETB A;  3ZN3 A;  2V5F A;  1Y6I A;  2XGM A;  1XNF A;  2XRY A;  1HG5 A;  1TR4 A;  3SGH A;  2C2L A;  1DC2 A;  1SA5 A;  4J0U A;  4ILH B;  2WXI A;  3U4T A;  5EIL A;  4B0Z A;  4KBQ A;  4U07 A;  4G2V A;  3ZU7 B;  3FUE A;  4ZFH A;  2VGE A;  4EZJ A;  3D9I A;  5H7P A;  5T8I A;  5KWD A;  3UX4 A;  4HRM B;  3AS5 A;  2GRN B;  1N4S A;  3JXI A;  4TUM A;  3Q47 B;  5J90 A;  4FJY A;  3ZEF A;  1TNY A;  3UT7 A;  2X3M A;  5ENQ D;  2EIK E;  5AAO A;  5BW8 C;  4CRW A;  4LNB A;  2KCL A;  2EIM E;  3FTZ A;  2XS1 A;  5CEA A;  4HBD A;  3HRA A;  1LD7 A;  3R9M A;  3QNK A;  2IY0 C;  4B93 B;  3SBT B;  5B1B E;  2XEN A;  3CVW A;  3D9K A;  2R02 A;  2V4H C;  3V2X A;  3SFZ A;  5DBK A;  2OVF A;  2GRR B;  1EPU A;  4GTO A;  1K1A A;  5CCM A;  4KZC A;  1OCO E;  3CEQ A;  3CKB A;  1FT2 A;  3AG1 E;  5KJL A;  1FVH A;  2HM8 A;  3HYM B;  5ANR A;  2VJ8 A;  3CHS A;  5IY5 E;  1K3Z D;  1D9S A;  4HI9 A;  2XGS A;  4RG9 A;  5G05 J;  4HXI A;  4EEC A;  3PZD A;  1IYG A;  4P29 A;  3D9N A;  3PE3 A;  3DSX A;  4JEH A;  3UM1 A;  4CCA A;  2R59 A;  4CDR A;  1E7V A;  4C9B B;  3RRM B;  4WND A;  3Q79 A;  3CHO A;  5KBA A;  3FUH A;  4JVS A;  1H0A A;  2BKK B;  4FUL A;  3WXX A;  3TXM A;  5ITZ F;  4GYY A;  3DEO A;  4ATG A;  4C48 B;  3FTS A;  3DRA A;  1RW2 A;  2XEV A;  1KT1 A;  4JHK A;  3SY2 A;  1N4Q A;  2JAB A;  3JXJ A;  3O48 A;  1VDY A;  5AQ7 A;  4W9R A;  3D9P A;  2L0I A;  1JWG A;  3BUA A;  3ML9 A;  2WXP A;  3LEW A;  4F53 A;  2AVP A;  3PUJ A;  1E7U A;  3OXG A;  3ZKJ A;  1NI1 A;  2XZD G;  2R03 A;  1A17 A;  2WVI A;  1ZB1 A;  2YNQ A;  3E32 A;  2LO6 A;  4ILI A;  2BKG A;  3QKY A;  3CSF A;  3GYZ A;  3HXE A;  5FQ4 A;  2F8X K;  3PEV B;  2CFZ A;  2GRQ B;  3ASH A;  3S7F A;  5AAR A;  1S0P A;  1S64 A;  5FQ7 A;  2AWI A;  3LPZ A;  3NBN B;  2BUG A;  3ZGQ A;  2LSV A;  2WXH A;  4JHJ A;  4XI0 A;  4GA2 A;  1IKN D;  3ISM C;  1N0Q A;  4PUC A;  1N11 A;  3I4G A;  1D8E A;  4AIF A;  3FH7 A;  1WDY A;  4IN3 B;  4WWO A;  2ETA A;  3HVE A;  3RAU A;  4N39 A;  3ABM E;  4KZ0 A;  5CER B;  2A5E A;  1H2V C;  3PEU B;  5G55 A;  3B7T A;  4K0R A;  1NP7 A;  4MS6 A;  4FJZ A;  5BV0 A;  1E96 B;  4L1B A;  2RFA A;  1Q2Z A;  5T3R A;  3QAQ A;  4F7A A;  3G2U A;  4GZ6 A;  2B6C A;  4UWK A;  1WG0 A;  4LER A;  3CHM A;  3TL5 A;  3RK6 A;  5E75 A;  5A6C A;  3FUI A;  1OUV A;  4BT9 A;  3NF1 A;  1FVF A;  1OT8 A;  2I1J A;  3B13 A;  1LF8 A;  3QWW A;  1ELR A;  2XRZ A;  4GA0 A;  3ZYL A;  5C1D A;  2WXK A;  3FWV A;  2LUH A;  3RRU A;  3CVU A;  4C0E A;  3LS8 A;  2RFM A;  3I3N A;  3ULE G;  1MX6 A;  5JA4 D;  4J8F A;  4A3V A;  3IHV A;  5BNW A;  3MKQ A;  3IBE A;  4JW1 A;  3LVR E;  1MX4 A;  1ELW A;  3FDH A;  3ONL A;  2FO7 A;  4U04 A;  2BED A;  3CHQ A;  3U9W A;  5CRV A;  2LXM A;  5FWQ A;  4YDY A;  5ENT D;  2XPY A;  1MJ0 A;  2GRO B;  4TXR A;  2LNI A;  4I6G A;  4OAV B;  2NXP A;  4N5Q A;  5CBO A;  4I2W A;  1UN8 A;  1W3B A;  4DPR A;  4LNU D;  2VSY A;  1H19 A;  4GTS A;  5BUZ A;  3EIJ A;  3R7R A;  3FU5 A;  1TNB A;  4I2Z A;  3DEP A;  3FEY A;  3TWU A;  1S63 A;  3HVE B;  4I43 A;  2C0M A;  3FUK A;  4CZ2 D;  4AY5 A;  5A7D B;  4HOS A;  2BF0 X;  2KCV A;  4ATZ D;  4U0Z A;  2XZT G;  3ZIM A;  1INZ A;  4UWH A;  5HS0 A;  4GPM A;  3QC1 A;  1SW6 A;  4G25 A;  2P9K G;  2J8S D;  4UUC A;  3N71 A;  4IUL A;  4QFV A;  3DSS A;  3DBS A;  5ENO D;  4PS3 A;  3D9H A;  4RVB A;  1KT0 A;  2IFU A;  3W9F A;  4DI3 A;  3NB2 A;  1KZO A;  4UWG A;  1BD8 A;  1HFA A;  5E76 A;  2VTB B;  3C3R A;  1U2V G;  1OWP A;  3AG2 E;  3CKC A;  3T8M A;  5LP0 A;  2FF4 A;  1Z6T A;  3R9A B;  1FPP A;  3GZ2 A;  4N5C A;  4G8K A;  5KJM A;  1JWF A;  5LCW J;  1H2U A;  3MKQ B;  3DSW A;  2C0L A;  3PNT B;  3SBS A;  4TXP A;  1UJK A;  1B89 A;  3LVQ E;  2GGF A;  2I2O A;  3DST A;  4GB9 A;  4Q94 A;  2VQ2 A;  3UQ3 A;  4ANX A;  4AJW A;  3P2B A;  1YCS B;  2GRL A;  3TWT A;  4I9C A;  4DLO A;  2J4D A;  4RG6 A;  2WMO A;  4HNA D;  2L6B A;  4HQD A;  3UT4 A;  2QC9 A;  3SHF A;  3FY4 A;  2IU1 A;  1SA4 A;  1V55 E;  4NQ0 A;  3VTX A;  4JXT A;  4XE0 A;  3P1U A;  1NFI E;  4N2S A;  4C0M A;  3UPV A;  2EIN E;  3C3O A;  4AP2 A;  4GCN A;  3CLJ A;  3QOU A;  4HVB A;  1Y8M A;  3TWS A;  2ION A;  4GYW A;  4OVU A;  3SI5 A;  3NZU A;  4LEU A;  3JYS A;  4AXH A;  4LCT A;  5DIZ A;  3TAX A;  2IQC A;  2P9L G;  3NAW A;  4XZ4 A;  3MJW A;  3MEK A;  3AG3 E;  3SFY A;  1AP7 A;  2H6I A;  3CHP A;  5ARG A;  4GML A;  4FLB A;  2OVB A;  3RIB A;  1RZ4 A;  4QQI A;  2CHZ A;  3LDZ A;  3U3W A;  4B8A A;  4JEU A;  3L82 A;  4KVO A;  4U96 D;  4U8V D;  3FTW A;  1DCE A;  2IJG X;  4PDX A;  2XCB A;  4U63 A;  2PL2 A;  4BTB A;  2YHE A;  3S2A A;  1TEZ A;  3DSU A;  2NC9 A;  1MZC A;  1TJC A;  3B7U X;  3PZ1 A;  2M63 A;  5FIN A;  1G3N B;  3MX3 A;  3BG0 B;  2I9C A;  2DVW A;  1K8K G;  3V79 K;  2LAI A;  4HOR A;  4AOF A;  4WWP A;  4LUN U;  1E90 A;  1HE8 A;  1H6P A;  4EBA G;  3TWQ A;  5D2M C;  3DSV A;  3FU3 A;  4LG6 A;  4JHR A;  1HO8 A;  2QFC A;  4NAC A;  4CYM D;  2WQ6 A;  4A63 B;  5G05 C;  4HOT A;  2Y3A A;  2VSX E;  4LNG A;  3RO2 A;  4J8S A;  4N3C A;  3Q7A A;  4I9E A;  5FT9 A;  2RG8 A;  3D3M A;  3IXE A;  5CCL A;  3ML8 A;  2OND A;  4LSZ E;  3F6Q A;  4GZ3 A;  5T4Y A;  1TN6 A;  2MYO A;  3Q49 B;  4FA6 A;  1V54 E;  2V8S E;  3Q4A B;  3FU0 A;  2OEV A;  3T5V A;  2CFU A;  4WNF A;  3EU5 A;  3GZS A;  3CGH A;  3BEE A;  1E8X A;  3ZXP A;  3AU4 A;  3PVL A;  2J49 A;  2EQX A;  1N4R A;  4U8Y D;  4F1S A;  1SZ9 A;  5JHB A;  5AYW D;  1PY1 A;  2YHC A;  2HE0 A;  1N95 A;  4JC8 A;  4I1M A;  3CHR A;  4Q96 A;  4BER A;  1EYH A;  5LFA A;  1MQS A;  1JCS A;  3E33 A;  5ANL A;  1IHB A;  3FUF A;  3AU5 A;  3JUI A;  1QNF A;  3NQP A;  1QZ2 A;  3CQC B;  3AAA C;  2J08 A;  4GMJ A;  3LY7 A;  4FHJ A;  3C72 A;  3FP3 A;  3MCX A;  3IKO B;  4HOU A;  3C98 A;  4U8H A;  4LRZ A;  2X6H A;  5AQA A;  3EJN A;  2KC7 A;  2KAT A;  4UWF A;  3ASF A;  3Q73 A;  3VTY A;  4BET A;  3V30 A;  4F1P A;  2DZO A;  4RLY A;  2XEE A;  4GTR A;  4J7W A;  2DIW A;  1KPS B;  1LD8 A;  3PDN A;  1EDU A;  2ETC A;  4U0S A;  4IRU A;  4E85 A;  2F0Y A;  5CBN A;  4UI9 K;  3FTX A;  2MOW A;  2QZA A;  4YVQ C;  4J8D A;  2PM6 A;  1HXI A;  3LY8 A;  2IOS A;  2J07 A;  3UI2 A;  5FTP A;  3VLE A;  2DBA A;  3UIN C;  4BFR A;  2IOL A;  1OCR E;  2X38 A;  1A5E A;  3NZS A;  3EDT B;  3G2S A;  2F8Y A;  4I1A A;  3RU0 A;  4AEZ C;  4I1O B;  4UI9 J;  4GMR A;  5ENS D;  1HS6 A;  4L23 A;  4R7L A;  4KMO A;  4ACK A;  1PAQ A;  5CED B;  1NA0 A;  4BWR A;  1OXJ A;  2AW6 A;  4B89 A;  3Q7F A;  2VTB A;  3QJZ A;  4HFG A;  4X8Q A;  4O1P A;  3MGB A;  3MZL B;  3UM2 A;  4PS8 A;  3BU8 A;  4J8E A;  3LYA A;  4HI8 A;  3HIZ A;  1BU9 A;  2WPV A;  5CHE E;  5BV1 A;  4HOQ A;  4KXK B;  3ZW3 A;  2QY7 A;  3B7S A;  5EN5 D;  4DI4 A;  3PH0 C;  3FUM A;  4GZ5 A;  4EHM A;  2IEJ A;  4PH4 B;  3B95 A;  2WQ7 A;  1N54 A;  3OAW A;  5BT1 A;  2DYR E;  1E8Y A;  2ILR A;  3Q15 A;  2JLB A;  1TNU A;  4G26 A;  2A4Z A;  4BX9 A;  3UMV A;  4L9P A;  3DXK G;  3E37 A;  4FU3 A;  3AS8 A;  4DX7 D;  4M3O A;  3RKV A;  3UKU G;  2ZGG A;  4G23 A;  1H6K A;  2XHE A;  2FI7 A;  4HLE A;  3CVL A;  3B7R L;  3APC A;  1OWL A;  2NYJ A;  3ZRH A;  3EU9 A;  4CDN A;  1IQR A;  4V3I A;  2R5S A;  3ENE A;  3RRN B;  4OAU C;  4G8L A;  4U95 D;  4TXQ A;  5LX8 A;  4DX1 A;  3EHR A;  2XPZ A;  3FEX A;  3UIO C;  4NIK A;  2Q7F A;  4FLH A;  3OXF A;  1IXV A;  4GTP A;  4RQI A;  3QB2 A;  4WNG A;  1JCR A;  5JJT A;  3LJN A;  2HYZ A;  4Y6C A;  5G04 J;  3CQG B;  2V0P A;  2VGX A;  5HKP A;  3C5R A;  1OCZ E;  3PE4 A;  2DZN A;  4CGV A;  1N9A A;  3JQ0 A;  2AXU A;  1K1B A;  3TXN A;  2Y4T A;  1JPL A;  1TNO A;  3AJI A;  3SNX A;  5LCW C;  4I6E A;  3LXU X;  4GAA A;  4ZHB A;  1IQU A;  5AJD A;  2L0T B;  3KAE A;  2V4L A;  3ULY A;  3HXF A;  3QDN A;  2KM4 A;  4TV3 A;  1AWC B;  3DPD A;  3IHY A;  2CG3 A;  1LTX A;  1EF1 C;  4TUU A;  4BEP A;  3D9L A;  3HHM A;  2UWJ G;  3HDX A;  3TWR A;  3UKR G;  2P9S G;  5C2Y A;  3Q9N C;  5EIB E;  1FCH A;  2JEK A;  2WXG A;  5JJ6 A;  3S7J A;  4EPZ A;  3ZPJ A;  1TN8 A;  2MRI A;  5FZS A;  4O6F A;  3L08 A;  1Z3Y A;  4F3V A;  4JD2 G;  3NOG D;  4DX6 D;  5EX0 A;  4UQZ A;  3ASG A;  3QWV A;  3AS4 A;  4FC8 A;  3L16 A;  3MA5 A;  2GW1 A;  2KBX A;  3TJP A;  3ASD A;  4DUI A;  1SQM A;  2E2E A;  4B94 A;  4G11 A;  2XPI A;  3KS2 A;  4L2L A;  3CVY A;  4GTV A;  4HS2 A;  1Z5S C;  5AQB A;  3UT8 A;  5KNG A;  3L17 A;  3K9I A;  3LCA A;  4GCO A;  1E8W A;  1U3C A;  2EIL E;  3FFL A;  3NOC D;  2WXM A;  1N4P A;  3O4Z A;  3G2W A;  3UM3 A;  3MYV A;  2AXZ A;  3TWX A;  4MKT A;  2CHW A;  3L13 A;  3PZ4 A;  4EQF A;  4G24 A;  2MHK A;  4M7C A;  2VGX B; 
#chains in the Genus database with same CATH homology
 4HBD A;  2L6B A;  3HRA A;  4ATZ D;  2XZD G;  1AWC B;  4HQD A;  1BI8 B;  2XZT G;  3J5Q B;  4B93 B;  4BSZ B;  3TWV A;  1OY3 D;  2QC9 A;  4DX7 D;  2XEN A;  4BEP A;  1SVX A;  4YDW A;  2XEH A;  4O1O A;  1A5E A;  2ZGG A;  4J8Y A;  2V4H C;  3V2X A;  4U8Y D;  3TWR A;  2BKG A;  5EID A;  5D66 A;  2F8Y A;  2F8X K;  4Z68 A;  5HS0 A;  4GPM A;  4K5B A;  3ZUV B;  4HLL A;  2RFM A;  2NYJ A;  2F37 A;  3HG0 D;  3Q9N C;  5BXU A;  2HE0 A;  5EIB E;  1MX6 A;  5JA4 D;  5FIN A;  1S70 B;  4GMR A;  1G3N B;  1MX2 A;  1K1A A;  5KNH D;  1SW6 A;  1NFI E;  3J5P A;  5ENS D;  2V5Q C;  2J8S D;  4UUC A;  3EU9 A;  5AAR A;  2DVW A;  3T8K A;  3V79 K;  5JMN D;  3KEA A;  4QFV A;  4BER A;  4DRX E;  3V2O A;  3V31 A;  5CED B;  5AN8 A;  3NBN B;  5ENO D;  4OAU C;  3D9H A;  3UTM A;  1MX4 A;  1IHB A;  3TWS A;  1K3Z D;  2DWZ A;  1IKN D;  3NOG D;  4G8L A;  4DX6 D;  1D9S A;  4HI9 A;  4U95 D;  5HRY A;  1N0Q A;  3W9G A;  3EHR A;  4DX1 A;  3TWQ A;  1N11 A;  5ENR D;  3W9F A;  4O1P A;  3AAA C;  4NIK A;  5ENP D;  3ZNG A;  4LG6 A;  1BD8 A;  1MYO A;  1WDY A;  1IXV A;  4CYM D;  2KBX A;  4A63 B;  1BI7 B;  2P2C P;  2ETB A;  4YDY A;  2ZGD A;  2ETA A;  2Y0B G;  5ENT D;  5AQA A;  3LJN A;  4O60 A;  4DUI A;  1DCQ A;  1MJ0 A;  4HI8 A;  3Q9U C;  5KBA A;  1TR4 A;  1DC2 A;  2Y1L E;  5CER B;  2B0O E;  1BU9 A;  4HB5 A;  2BKK B;  5FIO A;  4OAV B;  2A5E A;  5ITZ F;  3DEO A;  4BET A;  4N5Q A;  3V30 A;  2DZO A;  4F1P A;  1YYH A;  2XEE A;  4RLY A;  4C48 B;  5CBO A;  5HKP A;  2FO1 E;  4J7W A;  2QYJ A;  3C5R A;  3IXE A;  4G8K A;  1AP7 A;  5EIL A;  2AJA A;  4K5C A;  5AQB A;  3ZU7 B;  4DX2 A;  5EN5 D;  5BXO A;  5KNG A;  4ZFH A;  4LNU D;  4K5A B;  2DZN A;  4LSZ E;  2ETC A;  3F6Q A;  2JAB A;  3JXJ A;  2KXP C;  5CBN A;  4QQI A;  4HRL A;  3B95 A;  5EYP F;  2MYO A;  2VGE A;  3JUE A;  5AQ7 A;  4DX5 D;  1K1B A;  2RFA A;  3NOC D;  5CEC B;  5KWD A;  1N0R A;  4HRM B;  2PNN A;  3AJI A;  3JXI A;  1UOH A;  3DEP A;  4TUM A;  1QYM A;  3TWX A;  5EYL A;  4ZHB A;  4F6R D;  1YCS B;  1BLX B;  1WG0 A;  3TWT A;  5ENQ D;  4U96 D;  5AAO A;  3TWU A;  4U8V D;  4BES A;  3UXG A;  3SO8 A;  5AQ9 A;  3ZKJ A;  3TWW A;  3EHQ A;  4HRN A;  4CZ2 D;  3B7B A;  3UI2 A;  1OT8 A;  3T9K A;  1YMP A;  4HNA D;  4JB8 P;  5CEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...