3AG2E

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ag2E00
1V55E 2EIJE 3AG3E 2DYRE 2ZXWE 3ABME 2EILE 1OCRE 3AG1E 2EIKE 1OCZE 5B1BE 1OCOE 2Y69E 5B1AE 3AG4E 1OCCE 5B3SE 2EIME 2EINE 3WG7E 3AG2E 3X2QE 3ASOE 2DYSE 3ABKE 3ABLE 5IY5E 2OCCE 1V54E 3ASNE
chains in the Genus database with same CATH superfamily
4I9CA 3LVRE 4GTTA 2J07A 5AARA 4KXKB 4C0EA 4XZ4A 4JEUA 3AS4A 3QNKA 3ASGA 5CERB 3JUEA 1H2UA 4YNDA 2PZIA 1UN8A 3TAXA 4GTSA 3DSWA 2WXNA 5CBOA 2YINA 3MJWA 3UM1A 2OEWA 3OXFA 3MYVA 3HYMB 3AU5A 3APCA 4BESA 4HNAD 4I1MA 3PREA 2GRQB 2X38A 4U96D 2NYJA 1YMPA 1ELRA 3KD7A 3V30A 4YVQC 1IKND 4BETA 4HS2A 1QYMA 4L9PA 5HRYA 5ENTD 3Q79A 2DIWA 4N3CA 3LCAA 3APDA 3Q47B 5JMND 3AG2E 4JHJA 1ZBPA 1ZB1A 3BEEA 3FEYA 4G8KA 3JXJA 3FTXA 4BERA 2J4DA 3KEZA 3QDNA 3T8MA 1OXJA 3LXUX 3DRAA 4G8LA 2WMOA 3GZSA 4AXHA 2IJGX 4WNFA 3CHSA 2X6JA 2FF4A 3PS6A 5KWDA 2H6FA 4I2WA 2RKKA 4V3IA 3DSSA 3DEOA 2H6HA 4U04A 4GAAA 2IFUA 1D9SA 4L7TA 2HO1A 1KZOA 2P58C 1BI8B 3ASOE 4JW1A 4U8VD 1NA3A 1OWPA 1BPOA 3UM2A 4N5CA 3ZGQA 3TXMA 3MZLB 1IQUA 3UT8A 2F8YA 3B7UX 1QQEA 4JD2G 4EPZA 4ABNA 4APFA 1UOHA 4A3VA 3CEQA 5KJLA 4EECA 2WXGA 4XI9A 4JHRA 2F8XK 4JC8A 5AIJA 3ZFWA 1WM5A 4F1SA 2J9QA 3PH0C 2HM8A 2V8SE 3D9MA 3KSQA 2DVWA 2CHZA 3I5PA 3ZXSA 2IO3C 3FU0A 1TJCA 3SO8A 5EYPF 4EBAG 4H7XA 2BEDA 1N4RA 2WXFA 1IQRA 4N3AA 1LF8A 1WDYA 5ENNA 3MKQA 3HG0D 3T9KA 4WWOA 2I9CA 3SZ7A 5KNGA 3SQVA 4G25A 3E30A 3TWXA 3UTMA 5FJYA 1N94A 2WXLA 1Z5SC 4DPRA 4B8CB 1N4QA 1L5JA 3QB2A 3ZXPA 2L6BA 2IU1A 1LTXA 2LSUA 3FTVA 4WNEA 1SA5A 3B7BA 1NI1A 5BT1A 4HBDA 3FUHA 2WXRA 3DEPA 1W3BA 2A5EA 3IXEA 4L2YA 3ZPJA 3HXBA 2GRPB 3D9PA 3MA5A 2PNNA 2RFMA 3LJ3A 4RQIA 5G55A 5H7PA 2XHEA 4TRQA 2BTDA 3SY2A 1FCHA 1AP7A 3D9HA 4U07A 4UWHA 2YNQA 3ABLE 1HXIA 3R7QA 3J5PA 4TUMA 1JWFA 3ML8A 3UIPC 4GZ3A 4OVUA 4DK5A 2MHKA 3KSLA 3TWTA 4BY6A 3FTYA 4IRUA 2IOSA 1UN9A 4GYYA 3CVQA 1BD8A 2P9LG 1TEZA 2JLBA 3AG1E 2GGFA 4GTPA 5FIOA 3OXGA 1DCQA 1WAO1 4AM9A 4G26A 5AAOA 3T5VA 3V31A 2DZOA 1RZ4A 2WMNA 3FU3A 1S70B 3FUMA 2AJAA 3CVPA 4EZJA 4OYSA 1H19A 5CHEE 4UUCA 2XZDG 4XX5A 5BXOA 3D9KA 2UY1A 4GU5A 4HRMB 3DPDA 3G2SA 1X5BA 1MX2A 1D8EA 4G23A 4UWLA 2H6GA 1HS6A 1MJ0A 3ZN3A 1NZNA 3UX4A 5D66A 4J8EA 3Q7FA 2KM4A 3D9NA 4PDXA 4R7LA 3G2VA 3ULQA 2KZTB 4DI4A 3C3RA 4JHKA 4I6JA 4I17A 4GTMA 4O60A 1NP7A 1JUQA 1YYHA 4WUYA 4XEIG 1OUVA 3L54A 5ARGA 1QZ2A 3HVEB 4MLPA 4AJWA 4C9BB 4CDNA 2VSYA 4U8HA 1ZU2A 4L23A 1BU9A 4CDRA 4CGVA 2AWIA 4A1GA 5FQ6A 4G11A 3NZUA 5IY5E 3U64A 5G04J 1V55E 4JA7A 5EX3A 3RK6A 2NXPA 3L9TA 1OCZE 3MX3A 3AS5A 3DSVA 3HXFA 3TJPA 2ETCA 3CQGB 3ZUVB 5LCWJ 1SQMA 1YA0A 4U0SA 1TJFA 5FTPA 1JCRA 4YDEA 4BEPA 5B1AE 1E7VA 1K3ZD 1LD8A 1N11A 3LY8A 5FZSA 3C98A 5LX8A 5FT9A 5AQ7A 4O6FA 4GYOA 2P9KG 4ILIA 4G2VA 3QAQA 4HLLA 1OT8A 1OWMA 5E76A 2I6HA 2PM6A 3MGBA 1Y8MA 4HB5A 4GMLA 3L82A 4G1TA 5BNWA 2P9SG 2X3MA 1UG3A 3RSEG 4GMRA 1BLXB 4BFRA 4F3VA 1OWLA 2WXMA 2ZXWE 3HIZA 4O1OA 4U7EB 2OV8A 2DZNA 4DLOA 4B0ZA 4A63B 3L6AA 5CECB 1E8YA 3CHQA 2V4HC 4DX7D 2XZTG 2P9NG 2FEZA 2Y4UA 4FHJA 4BT8A 2YHEA 3HVEA 3RRUA 4M7CA 4HI8A 2P9IG 4LNUD 2WXKA 3D9IA 4JB8P 4ANVA 4GCNA 3PNTB 2GRLA 2KBXA 4FLHA 3IHYA 4MS6A 1D8DA 4UI9K 1IYGA 5BV1A 4GTOA 4HFGA 3U4TA 1EF1C 2CG2A 4XIFA 5EILA 4GB9A 4N5QA 2AXVA 4F6RD 4CRWA 1H2VC 1LD7A 3NOCD 4DLQA 4XE0A 1SZAA 4GPKA 3JUIA 1U3CA 2VSNA 4JEHA 4IULA 3CK7A 2KCKA 4KZCA 2M63A 4PS3A 1MHQA 4QFVA 1ELKA 5EX0A 5HQ8A 4LSZE 2ZGGA 4GA0A 2BF0X 3FH5A 3LYAA 4G24A 3S2AA 3ENEA 4HLEA 3TG5A 3UKUG 3HXDA 4F7AA 3FTUA 2CFZA 5FQ4A 3FUNA 3Q49B 2ZU6B 1E8WA 4OAUC 1MX4A 3NBNB 2LAIA 3E37A 3TWVA 3UKRG 5KJMA 2GRMA 3KEAA 5M72A 2XGSA 4LNGA 3I4GA 2VGXA 4EZLA 4GCOA 4U0UA 2PM7A 1HG2A 2WXIA 4DX1A 5AQAA 5ENPD 3E32A 4UQXA 3C5RA 5BV0A 3CHRA 2Y0BG 3Q73A 4BTAA 4C48B 3WG7E 3MKQB 2X6KA 3JXIA 4B94A 1NFIE 1K1AA 3UIOC 3KAEA 3L17A 1DNPA 2JABA 3G2WA 1HF8A 2QYJA 2LNIA 4FJZA 3Q15A 2L0IA 2OVFA 1SA4A 4E6HA 3PEUB 3FUDA 1TNZA 2X6HA 4U63A 2LUHA 2VYIA 5AN8A 4XI0A 5AQBA 3SNXA 3TL5A 3ULYA 4ILGA 5EIDA 1HH8A 4JXTA 3E4BA 2ZISA 2ONDA 1HO8A 3CHPA 1IHBA 3ONKA 4F53A 3SFYA 3MV2B 1FVHA 1DVPA 3V2OA 3CVVA 4U95D 3ZW3A 4D10C 1N0QA 1Q2ZA 2R02A 3LEWA 5B1BE 2Y69E 3ZEFA 2Y4TA 1HZ4A 3B7RL 5JHBA 2CHXA 4HQDA 4GA2A 5LCWC 3QK0A 5D2MC 2IQCA 3CGHA 2E2EA 4UI9C 3VTXA 3U66A 5CEDB 2C2LA 1BI7B 4LCTA 2WXJA 5T3RA 5EDSA 3AJIA 3LDZA 1DC2A 2X6FA 3DBSA 3FTWA 3ZHEB 5CMYA 4AEZC 4J6IA 1HU3A 3TWRA 3TWWA 2EIME 3QKYA 5BW8C 3X2QE 4K0RA 3ABKE 5FQ8A 4XKBA 1MZCA 5CRVA 4U0ZA 3FP3A 5FZQA 3QWVA 3RRMB 4BT9A 4GZ5A 4L1BA 3SF4A 3VLDA 1AWCB 3D3MA 1Z3XA 5LP0A 1JWGA 4C0MA 1SW6A 1S64A 3FH8A 5JA4D 1HFAA 3PDNA 3CVNA 4MKTA 2XEEA 4EQFA 1TR4A 3W9GA 3KS2A 3ZHEA 3F6QA 1E8ZA 1HE8A 3S7JA 3LPZA 5HI7A 3ZU7B 1EYHA 2GROB 2DBAA 5FQ7A 3PZ2A 3RIBA 5EYLA 4B93B 1E90A 1KZPA 5E75A 4KZ0A 2NSZA 3RU0A 3JQ0A 1DCEA 2OOEA 4YVOA 4AOFA 3MEKA 3PEVB 5ANLA 3I4RB 2FULA 4I1OB 1N9AA 4HRLA 4WWPA 1E8XA 2Y1LE 4HOSA 4JZYA 3BUAA 5D0QD 3EHMA 3O48A 3T8KA 1PC2A 1HG5A 3J5QB 5A7DB 1E96B 4BWRA 2UWJG 4I43A 4LNBA 4AV7A 4FC8A 4XKCA 3ABME 1WG0A 3FUKA 3C3QA 2A5UA 4MBGA 3AU4A 2CFUA 2BKKB 3NF1A 4BSXA 5KJNA 2R05A 1SVXA 2HYZA 3TWSA 3JQ1A 1KPSB 4DX6D 5KNHD 3PUJA 3QOUA 2J49A 3R7RA 3TWQA 4LRZA 3ESLA 2ZIRA 4ZHBA 5FZRA 4DI3A 1O1TA 5D0OD 4LEUA 1XNFA 4FU3A 5BXUA 3G2TA 3QWWA 1SZ9A 2DYSE 5DBKA 2OEVA 4PH4B 3Q78A 3DXKG 4K5CA 3ZYKA 4RSYA 3Q9UC 3AG4E 2XPYA 3D9LA 2L9BA 4N3BA 4B89A 4Q94A 2XQ0A 3FUJA 2VSOE 2FBNA 3Q75A 1TNYA 5ARFA 1NA0A 4KYOB 3FWVA 1INZA 3DPYA 4ME2A 1QBQA 3CVUA 4YDYA 1O1RA 1H2TC 1TNBA 3VLEA 3L22A 3ZIMA 3LY9A 4J8YA 3OTNA 2WXPA 1KT0A 1K1BA 4Q69A 4KMOA 2Q7FA 5T4YA 3Q9NC 1OWOA 4ILHB 2BKGA 3PZ1A 2KCVA 3ZNGA 1Z6TA 5T8IA 3ASNE 1FVFA 2MYOA 4A3TA 5G05J 2ETBA 3LKUA 2MRIA 2IO2C 2VGEA 1OCRE 1KLXA 3BQOA 2KCLA 3ZYMA 3T5XA 1FPPA 1O1SA 4UQZA 2LXMA 4UWGA 4J0UA 3PZDA 3D9OA 3D9JA 5AYWD 3RJVA 2QFCA 4CYMD 3ASFA 1EDUA 3NZSA 4W9RA 4GYWA 3TXNA 2EILE 2VTBA 3URZA 3S7FA 3PE4A 1N0RA 4NIKA 2XRZA 4PS7A 4GMJA 2L0TB 1MYOA 4LG6A 2X6IA 3ZVVA 3Q4AB 5EN5D 3CVLA 4OAVB 4ATGA 4HOTA 2VTBB 2WVIA 1JCQA 5AENA 1UJKA 1A17A 4JA9A 2XGOA 3ESKA 5JJ6A 2R2LA 4I9EA 4FLBA 3GW4A 3K9IA 2KZTA 3UM0A 3UT4A 2DYRE 2XCCA 5AJDA 4N2QA 2E0IA 1E7UA 1HX8A 2VQ2A 3PVLA 2VGXB 3PNLB 5ENQD 3PZ3A 5CEAA 3E33A 3SBTB 3IKOB 5A23A 1P5QA 3L08A 3EHRA 3ZKJA 2P9PG 4HVBA 1PAQA 3RKVA 5A6CA 4O1PA 4K5BA 3UM3A 2C0LA 2AW6A 4NRHB 1TN6A 3TWUA 4KT6B 2VSXE 4HOQA 2XGMA 3ISMC 5HKPA 1QNFA 3DWLG 2A4ZA 2ILRA 1H6KA 2UY1B 3CVWA 4JVSA 4A1SA 1TYQG 2QYUA 3OAWA 4ANUA 3CIAA 4GZCA 4QQIA 4U8YD 5DIZA 5G05C 1PY1A 4WNGA 4GTQA 4FHKA 1TN7A 3EDTB 3UUXA 1N52A 3UT7A 2I1KA 1N54A 1MX6A 4CGWA 4BX9A 2HR2A 2WQHA 4WAFA 3LY7A 3FY4A 3EU9A 1V54E 2C0MA 3TGOA 1IHGA 2XPIA 3NAWA 4M3OA 3SFZA 2XS1A 2FO7A 1TNUA 3LVQE 3L13A 4I6EA 4HOUA 2J08A 4PUCA 1OWNA 4FADA 2FO1E 5FINA 3FU5A 2P2CP 5G04C 4DJAA 2YQ8A 4H7YA 4AY5A 2I2OA 3ZRHA 3G2UA 2I1JA 3PE3A 2ZGDA 2KC7A 2PQRA 3RO3A 3CHMA 3CHOA 1UW4B 2V0PA 2EINE 4I6GA 3U3WA 3QC1A 4ACLA 4KVOA 4HXIA 1S63A 3HRAA 3NB2A 4UWFA 3AG3E 4GA1A 3MCXA 4Z68A 2H6IA 3VTYA 4NQ0A 3QJZA 4J8SA 4UQYA 4LUNU 3RAUA 4IYPA 3JYSA 4EHMA 3B7SA 2GRNB 4HI9A 1H0AA 1MQSA 2QZAA 3EIJA 2IONA 5CCLA 3R9AB 3FTZA 3CVYA 4CDMA 3GYZA 4DX5D 1IXVA 4I1AA 3IEGA 3FUEA 2R59A 4URKA 1UJJA 2RFAA 2RD0A 3SI5A 3DSXA 4YDOA 4DX2A 1VDYA 3EHNA 4NURA 3CR3A 3TG4A 2CG3A 2LO6A 5CRUA 2V5QC 3W9FA 1Z3YA 4FULA 3EUVA 5B3SE 2XEVA 3HXCA 3P1UA 4TXQA 4WNDA 5JHAA 5KBAA 2XRYA 3UINC 4BSZB 4CCAA 3GZ2A 5J90A 2EIKE 4F1PA 1H6OA 5CBNA 3CKCA 3CK8A 4APOA 5CMWA 4FP7A 3S7BA 1EPUA 4TV3A 2OCCE 2WPVA 2P9UG 1G3NB 3RRNB 4EBAA 3FUIA 4L2LA 4MRUA 4ANXA 4ACKA 3ML9A 4GTRA 4WWNA 3NOGD 2J4BA 3BU8A 5KJKA 3CKBA 4ATZD 3CK9A 3CV0A 3N71A 5LFAA 3Q7AA 4ZFHA 4K03A 2QY7A 4BTBA 3IBEA 4RVBA 2WXQA 1NL4A 3DXMG 1FT2A 2YHCA 4AP2A 1JPLA 4N2SA 3EU5A 2GW1A 2F0YA 4UWKA 2BUGA 4HORA 4CT4A 4J8DA 2WM9A 4AVXA 5JJ7A 4CZ2D 4GPMA 3BG0B 2VGYA 4DUIA 4KBQA 2WXHA 2FI7A 1XGWA 5KCMA 4BX8A 1N4PA 3CQCB 3HDXA 4X8QA 3U9WA 4JPSA 3B95A 3SFXA 3FH7A 3OXLA 3FHEA 1WY6A 2V4LA 2XEHA 3E34A 4RG6A 3ONLA 3GZ1A 4TXPA 4IN3B 4HRNA 1K8KG 5ANRA 3SGHA 4Y6CA 5G2NA 3B7TA 2IEJA 4GTVA 3RO2A 5ITZF 4A55A 2LSVA 3LS8A 3MV3B 4B8AA 3CVXA 1FT1A 5BUZA 3APFA 4ANWA 3O4ZA 3ASDA 3AS8A 5BPPA 3FEXA 3C3OA 3L16A 2R5SA 1OCOE 3QWPA 3CLJA 3ZYQA 3FDHA 4YDWA 5AQ9A 3NQPA 3UMVA 4CT0A 4AY6A 3UPVA 3CSTA 3C72A 4TXRA 3FUFA 3R9MA 4GZDA 4RLYA 3PUKA 2IF4A 2AXZA 2J8SD 4AIFA 1TNOA 3DSUA 1N95A 4FJYA 4E85A 5ENRD 2WQ7A 3DSTA 2B0OE 5HS0A 3ZYLA 5C2YA 2EIJE 4TUUA 2V5FA 5AJLA 2R17C 2MOWA 3WXXA 2RG8A 2NC9A 3UQ3A 3V2XA 1Y6IA 3UI2A 2CHWA 4P29A 3HXEA 4I2ZA 4DRXE 3V79K 2XPZA 1A5EA 4EZKA 4OVVA 1TN8A 5ENSD 5LOZA 2IY0C 3FU6A 3EJNA 4UI9J 1N4SA 1ELWA 2DCPA 4Q96A 4GZ6A 3IV0A 1H6PA 3VLFA 2AXUA 4J8FA 3AAAC 2B6CA 5JJTA 3I3NA 2R03A 5C1DA 2KXPC 5EKQD 1OY3D 3MKRA 5EIBE 4N39A 2F37A 2VJ8A 1B89A 2OVBA 4Y6WA 4KVMA 3Q5MA 5J08A 4RG9A 2WXOA 3S7DA 2HE0A 1YCSB 3QARA 2PQNA 2GRRB 2ETAA 3PRZA 2XCBA 3IHVA 2PL2A 1O5MA 3FTSA 3CSFA 2WB2A 1RW2A 2IOLA 4PS8A 2JEKA 3ULEG 1OCCE 2Y3AA 3FULA 2AVPA 2WQ6A 3UXGA 4LERA 3SBSA 1X81A 2J09A 2XS8A 3FFLA 4CEMA 2DWZA 1U3DA 2KATA 1U2VG 3BG1B 1S0PA 5ENOD 4JL0A 4J7WA 3ASHA 3SD5A 4K5AB 1JCSA 2LXLA 2QC9A 5CCMA 2L6JA 3PZ4A 3JCKC 3HHMA 3P2BA 3EIQC 3EHQA 2LAHA 2EQXA 2XENA 3B13A 1GW6A 4NACA 4FA6A 3LJNA 1KT1A 5FWQA 3SHFA
chains in the Genus database with same CATH topology
1V55E 2EIJE 3AG3E 2DYRE 2ZXWE 3ABME 2EILE 1OCRE 3AG1E 2EIKE 1OCZE 5B1BE 1OCOE 2Y69E 5B1AE 3AG4E 1OCCE 5B3SE 2EIME 2EINE 3WG7E 3AG2E 3X2QE 3ASOE 2DYSE 3ABKE 3ABLE 5IY5E 2OCCE 1V54E 3ASNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V55 E;  2EIJ E;  3AG3 E;  2DYR E;  2ZXW E;  3ABM E;  2EIL E;  1OCR E;  3AG1 E;  2EIK E;  1OCZ E;  5B1B E;  1OCO E;  2Y69 E;  5B1A E;  3AG4 E;  1OCC E;  5B3S E;  2EIM E;  2EIN E;  3WG7 E;  3AG2 E;  3X2Q E;  3ASO E;  2DYS E;  3ABK E;  3ABL E;  5IY5 E;  2OCC E;  1V54 E;  3ASN E; 
#chains in the Genus database with same CATH topology
 4I9C A;  3LVR E;  4GTT A;  2J07 A;  5AAR A;  4KXK B;  4C0E A;  4XZ4 A;  4JEU A;  3AS4 A;  3QNK A;  3ASG A;  5CER B;  3JUE A;  1H2U A;  4YND A;  2PZI A;  1UN8 A;  3TAX A;  4GTS A;  3DSW A;  2WXN A;  5CBO A;  2YIN A;  3MJW A;  3UM1 A;  2OEW A;  3OXF A;  3MYV A;  3HYM B;  3AU5 A;  3APC A;  4BES A;  4HNA D;  4I1M A;  3PRE A;  2GRQ B;  2X38 A;  4U96 D;  2NYJ A;  1YMP A;  1ELR A;  3KD7 A;  3V30 A;  4YVQ C;  1IKN D;  4BET A;  4HS2 A;  1QYM A;  4L9P A;  5HRY A;  5ENT D;  3Q79 A;  2DIW A;  4N3C A;  3LCA A;  3APD A;  3Q47 B;  5JMN D;  3AG2 E;  4JHJ A;  1ZBP A;  1ZB1 A;  3BEE A;  3FEY A;  4G8K A;  3JXJ A;  3FTX A;  4BER A;  2J4D A;  3KEZ A;  3QDN A;  3T8M A;  1OXJ A;  3LXU X;  3DRA A;  4G8L A;  2WMO A;  3GZS A;  4AXH A;  2IJG X;  4WNF A;  3CHS A;  2X6J A;  2FF4 A;  3PS6 A;  5KWD A;  2H6F A;  4I2W A;  2RKK A;  4V3I A;  3DSS A;  3DEO A;  2H6H A;  4U04 A;  4GAA A;  2IFU A;  1D9S A;  4L7T A;  2HO1 A;  1KZO A;  2P58 C;  1BI8 B;  3ASO E;  4JW1 A;  4U8V D;  1NA3 A;  1OWP A;  1BPO A;  3UM2 A;  4N5C A;  3ZGQ A;  3TXM A;  3MZL B;  1IQU A;  3UT8 A;  2F8Y A;  3B7U X;  1QQE A;  4JD2 G;  4EPZ A;  4ABN A;  4APF A;  1UOH A;  4A3V A;  3CEQ A;  5KJL A;  4EEC A;  2WXG A;  4XI9 A;  4JHR A;  2F8X K;  4JC8 A;  5AIJ A;  3ZFW A;  1WM5 A;  4F1S A;  2J9Q A;  3PH0 C;  2HM8 A;  2V8S E;  3D9M A;  3KSQ A;  2DVW A;  2CHZ A;  3I5P A;  3ZXS A;  2IO3 C;  3FU0 A;  1TJC A;  3SO8 A;  5EYP F;  4EBA G;  4H7X A;  2BED A;  1N4R A;  2WXF A;  1IQR A;  4N3A A;  1LF8 A;  1WDY A;  5ENN A;  3MKQ A;  3HG0 D;  3T9K A;  4WWO A;  2I9C A;  3SZ7 A;  5KNG A;  3SQV A;  4G25 A;  3E30 A;  3TWX A;  3UTM A;  5FJY A;  1N94 A;  2WXL A;  1Z5S C;  4DPR A;  4B8C B;  1N4Q A;  1L5J A;  3QB2 A;  3ZXP A;  2L6B A;  2IU1 A;  1LTX A;  2LSU A;  3FTV A;  4WNE A;  1SA5 A;  3B7B A;  1NI1 A;  5BT1 A;  4HBD A;  3FUH A;  2WXR A;  3DEP A;  1W3B A;  2A5E A;  3IXE A;  4L2Y A;  3ZPJ A;  3HXB A;  2GRP B;  3D9P A;  3MA5 A;  2PNN A;  2RFM A;  3LJ3 A;  4RQI A;  5G55 A;  5H7P A;  2XHE A;  4TRQ A;  2BTD A;  3SY2 A;  1FCH A;  1AP7 A;  3D9H A;  4U07 A;  4UWH A;  2YNQ A;  3ABL E;  1HXI A;  3R7Q A;  3J5P A;  4TUM A;  1JWF A;  3ML8 A;  3UIP C;  4GZ3 A;  4OVU A;  4DK5 A;  2MHK A;  3KSL A;  3TWT A;  4BY6 A;  3FTY A;  4IRU A;  2IOS A;  1UN9 A;  4GYY A;  3CVQ A;  1BD8 A;  2P9L G;  1TEZ A;  2JLB A;  3AG1 E;  2GGF A;  4GTP A;  5FIO A;  3OXG A;  1DCQ A;  1WAO 1;  4AM9 A;  4G26 A;  5AAO A;  3T5V A;  3V31 A;  2DZO A;  1RZ4 A;  2WMN A;  3FU3 A;  1S70 B;  3FUM A;  2AJA A;  3CVP A;  4EZJ A;  4OYS A;  1H19 A;  5CHE E;  4UUC A;  2XZD G;  4XX5 A;  5BXO A;  3D9K A;  2UY1 A;  4GU5 A;  4HRM B;  3DPD A;  3G2S A;  1X5B A;  1MX2 A;  1D8E A;  4G23 A;  4UWL A;  2H6G A;  1HS6 A;  1MJ0 A;  3ZN3 A;  1NZN A;  3UX4 A;  5D66 A;  4J8E A;  3Q7F A;  2KM4 A;  3D9N A;  4PDX A;  4R7L A;  3G2V A;  3ULQ A;  2KZT B;  4DI4 A;  3C3R A;  4JHK A;  4I6J A;  4I17 A;  4GTM A;  4O60 A;  1NP7 A;  1JUQ A;  1YYH A;  4WUY A;  4XEI G;  1OUV A;  3L54 A;  5ARG A;  1QZ2 A;  3HVE B;  4MLP A;  4AJW A;  4C9B B;  4CDN A;  2VSY A;  4U8H A;  1ZU2 A;  4L23 A;  1BU9 A;  4CDR A;  4CGV A;  2AWI A;  4A1G A;  5FQ6 A;  4G11 A;  3NZU A;  5IY5 E;  3U64 A;  5G04 J;  1V55 E;  4JA7 A;  5EX3 A;  3RK6 A;  2NXP A;  3L9T A;  1OCZ E;  3MX3 A;  3AS5 A;  3DSV A;  3HXF A;  3TJP A;  2ETC A;  3CQG B;  3ZUV B;  5LCW J;  1SQM A;  1YA0 A;  4U0S A;  1TJF A;  5FTP A;  1JCR A;  4YDE A;  4BEP A;  5B1A E;  1E7V A;  1K3Z D;  1LD8 A;  1N11 A;  3LY8 A;  5FZS A;  3C98 A;  5LX8 A;  5FT9 A;  5AQ7 A;  4O6F A;  4GYO A;  2P9K G;  4ILI A;  4G2V A;  3QAQ A;  4HLL A;  1OT8 A;  1OWM A;  5E76 A;  2I6H A;  2PM6 A;  3MGB A;  1Y8M A;  4HB5 A;  4GML A;  3L82 A;  4G1T A;  5BNW A;  2P9S G;  2X3M A;  1UG3 A;  3RSE G;  4GMR A;  1BLX B;  4BFR A;  4F3V A;  1OWL A;  2WXM A;  2ZXW E;  3HIZ A;  4O1O A;  4U7E B;  2OV8 A;  2DZN A;  4DLO A;  4B0Z A;  4A63 B;  3L6A A;  5CEC B;  1E8Y A;  3CHQ A;  2V4H C;  4DX7 D;  2XZT G;  2P9N G;  2FEZ A;  2Y4U A;  4FHJ A;  4BT8 A;  2YHE A;  3HVE A;  3RRU A;  4M7C A;  4HI8 A;  2P9I G;  4LNU D;  2WXK A;  3D9I A;  4JB8 P;  4ANV A;  4GCN A;  3PNT B;  2GRL A;  2KBX A;  4FLH A;  3IHY A;  4MS6 A;  1D8D A;  4UI9 K;  1IYG A;  5BV1 A;  4GTO A;  4HFG A;  3U4T A;  1EF1 C;  2CG2 A;  4XIF A;  5EIL A;  4GB9 A;  4N5Q A;  2AXV A;  4F6R D;  4CRW A;  1H2V C;  1LD7 A;  3NOC D;  4DLQ A;  4XE0 A;  1SZA A;  4GPK A;  3JUI A;  1U3C A;  2VSN A;  4JEH A;  4IUL A;  3CK7 A;  2KCK A;  4KZC A;  2M63 A;  4PS3 A;  1MHQ A;  4QFV A;  1ELK A;  5EX0 A;  5HQ8 A;  4LSZ E;  2ZGG A;  4GA0 A;  2BF0 X;  3FH5 A;  3LYA A;  4G24 A;  3S2A A;  3ENE A;  4HLE A;  3TG5 A;  3UKU G;  3HXD A;  4F7A A;  3FTU A;  2CFZ A;  5FQ4 A;  3FUN A;  3Q49 B;  2ZU6 B;  1E8W A;  4OAU C;  1MX4 A;  3NBN B;  2LAI A;  3E37 A;  3TWV A;  3UKR G;  5KJM A;  2GRM A;  3KEA A;  5M72 A;  2XGS A;  4LNG A;  3I4G A;  2VGX A;  4EZL A;  4GCO A;  4U0U A;  2PM7 A;  1HG2 A;  2WXI A;  4DX1 A;  5AQA A;  5ENP D;  3E32 A;  4UQX A;  3C5R A;  5BV0 A;  3CHR A;  2Y0B G;  3Q73 A;  4BTA A;  4C48 B;  3WG7 E;  3MKQ B;  2X6K A;  3JXI A;  4B94 A;  1NFI E;  1K1A A;  3UIO C;  3KAE A;  3L17 A;  1DNP A;  2JAB A;  3G2W A;  1HF8 A;  2QYJ A;  2LNI A;  4FJZ A;  3Q15 A;  2L0I A;  2OVF A;  1SA4 A;  4E6H A;  3PEU B;  3FUD A;  1TNZ A;  2X6H A;  4U63 A;  2LUH A;  2VYI A;  5AN8 A;  4XI0 A;  5AQB A;  3SNX A;  3TL5 A;  3ULY A;  4ILG A;  5EID A;  1HH8 A;  4JXT A;  3E4B A;  2ZIS A;  2OND A;  1HO8 A;  3CHP A;  1IHB A;  3ONK A;  4F53 A;  3SFY A;  3MV2 B;  1FVH A;  1DVP A;  3V2O A;  3CVV A;  4U95 D;  3ZW3 A;  4D10 C;  1N0Q A;  1Q2Z A;  2R02 A;  3LEW A;  5B1B E;  2Y69 E;  3ZEF A;  2Y4T A;  1HZ4 A;  3B7R L;  5JHB A;  2CHX A;  4HQD A;  4GA2 A;  5LCW C;  3QK0 A;  5D2M C;  2IQC A;  3CGH A;  2E2E A;  4UI9 C;  3VTX A;  3U66 A;  5CED B;  2C2L A;  1BI7 B;  4LCT A;  2WXJ A;  5T3R A;  5EDS A;  3AJI A;  3LDZ A;  1DC2 A;  2X6F A;  3DBS A;  3FTW A;  3ZHE B;  5CMY A;  4AEZ C;  4J6I A;  1HU3 A;  3TWR A;  3TWW A;  2EIM E;  3QKY A;  5BW8 C;  3X2Q E;  4K0R A;  3ABK E;  5FQ8 A;  4XKB A;  1MZC A;  5CRV A;  4U0Z A;  3FP3 A;  5FZQ A;  3QWV A;  3RRM B;  4BT9 A;  4GZ5 A;  4L1B A;  3SF4 A;  3VLD A;  1AWC B;  3D3M A;  1Z3X A;  5LP0 A;  1JWG A;  4C0M A;  1SW6 A;  1S64 A;  3FH8 A;  5JA4 D;  1HFA A;  3PDN A;  3CVN A;  4MKT A;  2XEE A;  4EQF A;  1TR4 A;  3W9G A;  3KS2 A;  3ZHE A;  3F6Q A;  1E8Z A;  1HE8 A;  3S7J A;  3LPZ A;  5HI7 A;  3ZU7 B;  1EYH A;  2GRO B;  2DBA A;  5FQ7 A;  3PZ2 A;  3RIB A;  5EYL A;  4B93 B;  1E90 A;  1KZP A;  5E75 A;  4KZ0 A;  2NSZ A;  3RU0 A;  3JQ0 A;  1DCE A;  2OOE A;  4YVO A;  4AOF A;  3MEK A;  3PEV B;  5ANL A;  3I4R B;  2FUL A;  4I1O B;  1N9A A;  4HRL A;  4WWP A;  1E8X A;  2Y1L E;  4HOS A;  4JZY A;  3BUA A;  5D0Q D;  3EHM A;  3O48 A;  3T8K A;  1PC2 A;  1HG5 A;  3J5Q B;  5A7D B;  1E96 B;  4BWR A;  2UWJ G;  4I43 A;  4LNB A;  4AV7 A;  4FC8 A;  4XKC A;  3ABM E;  1WG0 A;  3FUK A;  3C3Q A;  2A5U A;  4MBG A;  3AU4 A;  2CFU A;  2BKK B;  3NF1 A;  4BSX A;  5KJN A;  2R05 A;  1SVX A;  2HYZ A;  3TWS A;  3JQ1 A;  1KPS B;  4DX6 D;  5KNH D;  3PUJ A;  3QOU A;  2J49 A;  3R7R A;  3TWQ A;  4LRZ A;  3ESL A;  2ZIR A;  4ZHB A;  5FZR A;  4DI3 A;  1O1T A;  5D0O D;  4LEU A;  1XNF A;  4FU3 A;  5BXU A;  3G2T A;  3QWW A;  1SZ9 A;  2DYS E;  5DBK A;  2OEV A;  4PH4 B;  3Q78 A;  3DXK G;  4K5C A;  3ZYK A;  4RSY A;  3Q9U C;  3AG4 E;  2XPY A;  3D9L A;  2L9B A;  4N3B A;  4B89 A;  4Q94 A;  2XQ0 A;  3FUJ A;  2VSO E;  2FBN A;  3Q75 A;  1TNY A;  5ARF A;  1NA0 A;  4KYO B;  3FWV A;  1INZ A;  3DPY A;  4ME2 A;  1QBQ A;  3CVU A;  4YDY A;  1O1R A;  1H2T C;  1TNB A;  3VLE A;  3L22 A;  3ZIM A;  3LY9 A;  4J8Y A;  3OTN A;  2WXP A;  1KT0 A;  1K1B A;  4Q69 A;  4KMO A;  2Q7F A;  5T4Y A;  3Q9N C;  1OWO A;  4ILH B;  2BKG A;  3PZ1 A;  2KCV A;  3ZNG A;  1Z6T A;  5T8I A;  3ASN E;  1FVF A;  2MYO A;  4A3T A;  5G05 J;  2ETB A;  3LKU A;  2MRI A;  2IO2 C;  2VGE A;  1OCR E;  1KLX A;  3BQO A;  2KCL A;  3ZYM A;  3T5X A;  1FPP A;  1O1S A;  4UQZ A;  2LXM A;  4UWG A;  4J0U A;  3PZD A;  3D9O A;  3D9J A;  5AYW D;  3RJV A;  2QFC A;  4CYM D;  3ASF A;  1EDU A;  3NZS A;  4W9R A;  4GYW A;  3TXN A;  2EIL E;  2VTB A;  3URZ A;  3S7F A;  3PE4 A;  1N0R A;  4NIK A;  2XRZ A;  4PS7 A;  4GMJ A;  2L0T B;  1MYO A;  4LG6 A;  2X6I A;  3ZVV A;  3Q4A B;  5EN5 D;  3CVL A;  4OAV B;  4ATG A;  4HOT A;  2VTB B;  2WVI A;  1JCQ A;  5AEN A;  1UJK A;  1A17 A;  4JA9 A;  2XGO A;  3ESK A;  5JJ6 A;  2R2L A;  4I9E A;  4FLB A;  3GW4 A;  3K9I A;  2KZT A;  3UM0 A;  3UT4 A;  2DYR E;  2XCC A;  5AJD A;  4N2Q A;  2E0I A;  1E7U A;  1HX8 A;  2VQ2 A;  3PVL A;  2VGX B;  3PNL B;  5ENQ D;  3PZ3 A;  5CEA A;  3E33 A;  3SBT B;  3IKO B;  5A23 A;  1P5Q A;  3L08 A;  3EHR A;  3ZKJ A;  2P9P G;  4HVB A;  1PAQ A;  3RKV A;  5A6C A;  4O1P A;  4K5B A;  3UM3 A;  2C0L A;  2AW6 A;  4NRH B;  1TN6 A;  3TWU A;  4KT6 B;  2VSX E;  4HOQ A;  2XGM A;  3ISM C;  5HKP A;  1QNF A;  3DWL G;  2A4Z A;  2ILR A;  1H6K A;  2UY1 B;  3CVW A;  4JVS A;  4A1S A;  1TYQ G;  2QYU A;  3OAW A;  4ANU A;  3CIA A;  4GZC A;  4QQI A;  4U8Y D;  5DIZ A;  5G05 C;  1PY1 A;  4WNG A;  4GTQ A;  4FHK A;  1TN7 A;  3EDT B;  3UUX A;  1N52 A;  3UT7 A;  2I1K A;  1N54 A;  1MX6 A;  4CGW A;  4BX9 A;  2HR2 A;  2WQH A;  4WAF A;  3LY7 A;  3FY4 A;  3EU9 A;  1V54 E;  2C0M A;  3TGO A;  1IHG A;  2XPI A;  3NAW A;  4M3O A;  3SFZ A;  2XS1 A;  2FO7 A;  1TNU A;  3LVQ E;  3L13 A;  4I6E A;  4HOU A;  2J08 A;  4PUC A;  1OWN A;  4FAD A;  2FO1 E;  5FIN A;  3FU5 A;  2P2C P;  5G04 C;  4DJA A;  2YQ8 A;  4H7Y A;  4AY5 A;  2I2O A;  3ZRH A;  3G2U A;  2I1J A;  3PE3 A;  2ZGD A;  2KC7 A;  2PQR A;  3RO3 A;  3CHM A;  3CHO A;  1UW4 B;  2V0P A;  2EIN E;  4I6G A;  3U3W A;  3QC1 A;  4ACL A;  4KVO A;  4HXI A;  1S63 A;  3HRA A;  3NB2 A;  4UWF A;  3AG3 E;  4GA1 A;  3MCX A;  4Z68 A;  2H6I A;  3VTY A;  4NQ0 A;  3QJZ A;  4J8S A;  4UQY A;  4LUN U;  3RAU A;  4IYP A;  3JYS A;  4EHM A;  3B7S A;  2GRN B;  4HI9 A;  1H0A A;  1MQS A;  2QZA A;  3EIJ A;  2ION A;  5CCL A;  3R9A B;  3FTZ A;  3CVY A;  4CDM A;  3GYZ A;  4DX5 D;  1IXV A;  4I1A A;  3IEG A;  3FUE A;  2R59 A;  4URK A;  1UJJ A;  2RFA A;  2RD0 A;  3SI5 A;  3DSX A;  4YDO A;  4DX2 A;  1VDY A;  3EHN A;  4NUR A;  3CR3 A;  3TG4 A;  2CG3 A;  2LO6 A;  5CRU A;  2V5Q C;  3W9F A;  1Z3Y A;  4FUL A;  3EUV A;  5B3S E;  2XEV A;  3HXC A;  3P1U A;  4TXQ A;  4WND A;  5JHA A;  5KBA A;  2XRY A;  3UIN C;  4BSZ B;  4CCA A;  3GZ2 A;  5J90 A;  2EIK E;  4F1P A;  1H6O A;  5CBN A;  3CKC A;  3CK8 A;  4APO A;  5CMW A;  4FP7 A;  3S7B A;  1EPU A;  4TV3 A;  2OCC E;  2WPV A;  2P9U G;  1G3N B;  3RRN B;  4EBA A;  3FUI A;  4L2L A;  4MRU A;  4ANX A;  4ACK A;  3ML9 A;  4GTR A;  4WWN A;  3NOG D;  2J4B A;  3BU8 A;  5KJK A;  3CKB A;  4ATZ D;  3CK9 A;  3CV0 A;  3N71 A;  5LFA A;  3Q7A A;  4ZFH A;  4K03 A;  2QY7 A;  4BTB A;  3IBE A;  4RVB A;  2WXQ A;  1NL4 A;  3DXM G;  1FT2 A;  2YHC A;  4AP2 A;  1JPL A;  4N2S A;  3EU5 A;  2GW1 A;  2F0Y A;  4UWK A;  2BUG A;  4HOR A;  4CT4 A;  4J8D A;  2WM9 A;  4AVX A;  5JJ7 A;  4CZ2 D;  4GPM A;  3BG0 B;  2VGY A;  4DUI A;  4KBQ A;  2WXH A;  2FI7 A;  1XGW A;  5KCM A;  4BX8 A;  1N4P A;  3CQC B;  3HDX A;  4X8Q A;  3U9W A;  4JPS A;  3B95 A;  3SFX A;  3FH7 A;  3OXL A;  3FHE A;  1WY6 A;  2V4L A;  2XEH A;  3E34 A;  4RG6 A;  3ONL A;  3GZ1 A;  4TXP A;  4IN3 B;  4HRN A;  1K8K G;  5ANR A;  3SGH A;  4Y6C A;  5G2N A;  3B7T A;  2IEJ A;  4GTV A;  3RO2 A;  5ITZ F;  4A55 A;  2LSV A;  3LS8 A;  3MV3 B;  4B8A A;  3CVX A;  1FT1 A;  5BUZ A;  3APF A;  4ANW A;  3O4Z A;  3ASD A;  3AS8 A;  5BPP A;  3FEX A;  3C3O A;  3L16 A;  2R5S A;  1OCO E;  3QWP A;  3CLJ A;  3ZYQ A;  3FDH A;  4YDW A;  5AQ9 A;  3NQP A;  3UMV A;  4CT0 A;  4AY6 A;  3UPV A;  3CST A;  3C72 A;  4TXR A;  3FUF A;  3R9M A;  4GZD A;  4RLY A;  3PUK A;  2IF4 A;  2AXZ A;  2J8S D;  4AIF A;  1TNO A;  3DSU A;  1N95 A;  4FJY A;  4E85 A;  5ENR D;  2WQ7 A;  3DST A;  2B0O E;  5HS0 A;  3ZYL A;  5C2Y A;  2EIJ E;  4TUU A;  2V5F A;  5AJL A;  2R17 C;  2MOW A;  3WXX A;  2RG8 A;  2NC9 A;  3UQ3 A;  3V2X A;  1Y6I A;  3UI2 A;  2CHW A;  4P29 A;  3HXE A;  4I2Z A;  4DRX E;  3V79 K;  2XPZ A;  1A5E A;  4EZK A;  4OVV A;  1TN8 A;  5ENS D;  5LOZ A;  2IY0 C;  3FU6 A;  3EJN A;  4UI9 J;  1N4S A;  1ELW A;  2DCP A;  4Q96 A;  4GZ6 A;  3IV0 A;  1H6P A;  3VLF A;  2AXU A;  4J8F A;  3AAA C;  2B6C A;  5JJT A;  3I3N A;  2R03 A;  5C1D A;  2KXP C;  5EKQ D;  1OY3 D;  3MKR A;  5EIB E;  4N39 A;  2F37 A;  2VJ8 A;  1B89 A;  2OVB A;  4Y6W A;  4KVM A;  3Q5M A;  5J08 A;  4RG9 A;  2WXO A;  3S7D A;  2HE0 A;  1YCS B;  3QAR A;  2PQN A;  2GRR B;  2ETA A;  3PRZ A;  2XCB A;  3IHV A;  2PL2 A;  1O5M A;  3FTS A;  3CSF A;  2WB2 A;  1RW2 A;  2IOL A;  4PS8 A;  2JEK A;  3ULE G;  1OCC E;  2Y3A A;  3FUL A;  2AVP A;  2WQ6 A;  3UXG A;  4LER A;  3SBS A;  1X81 A;  2J09 A;  2XS8 A;  3FFL A;  4CEM A;  2DWZ A;  1U3D A;  2KAT A;  1U2V G;  3BG1 B;  1S0P A;  5ENO D;  4JL0 A;  4J7W A;  3ASH A;  3SD5 A;  4K5A B;  1JCS A;  2LXL A;  2QC9 A;  5CCM A;  2L6J A;  3PZ4 A;  3JCK C;  3HHM A;  3P2B A;  3EIQ C;  3EHQ A;  2LAH A;  2EQX A;  2XEN A;  3B13 A;  1GW6 A;  4NAC A;  4FA6 A;  3LJN A;  1KT1 A;  5FWQ A;  3SHF A; 
#chains in the Genus database with same CATH homology
 1V55 E;  2EIJ E;  3AG3 E;  2DYR E;  2ZXW E;  3ABM E;  2EIL E;  1OCR E;  3AG1 E;  2EIK E;  1OCZ E;  5B1B E;  1OCO E;  2Y69 E;  5B1A E;  3AG4 E;  1OCC E;  5B3S E;  2EIM E;  2EIN E;  3WG7 E;  3AG2 E;  3X2Q E;  3ASO E;  2DYS E;  3ABK E;  3ABL E;  5IY5 E;  2OCC E;  1V54 E;  3ASN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...