3AG2E

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ag2E00
5IY5E 3AG1E 1OCRE 3ABME 2EIME 2EILE 1OCCE 3AG3E 5B1BE 1V54E 2ZXWE 3ASNE 3WG7E 5B3SE 2EINE 3AG2E 3ABLE 3X2QE 2OCCE 3AG4E 5B1AE 1V55E 2EIJE 2DYRE 2DYSE 3ABKE 2EIKE 1OCOE 2Y69E 3ASOE 1OCZE
chains in the Genus database with same CATH superfamily
2NC9A 3FFLA 2KC7A 2MYOA 4HI8A 2WVIA 5BV0A 2V8SE 2NXPA 3I4RB 4LRZA 1QZ2A 4K5BA 3CVYA 4FHKA 2XQ0A 3E37A 2CFUA 1DC2A 1UOHA 3ASHA 4UWGA 4TUMA 2XPYA 3V79K 1TNBA 4WWOA 2PL2A 3ESLA 4HORA 3L9TA 1S63A 4B89A 5EX3A 2X38A 5H7PA 3DRAA 2ETBA 1OXJA 4MRUA 1DNPA 1FVHA 2KCVA 4U0UA 4DUIA 3VLFA 4UWFA 3EJNA 2VSYA 4M3OA 4L9PA 3UM1A 3FTVA 4GB9A 3E32A 4ATZD 1AP7A 4WNEA 5BW8C 3O4ZA 4TRQA 4HRNA 3UT7A 3ZYQA 3T5XA 2ZIRA 2P9IG 3CVWA 4I2WA 3QNKA 1KPSB 3TWWA 1SA5A 3ENEA 2DZOA 4LUNU 3ESKA 3RK6A 3TAXA 4G23A 1H2UA 2KXPC 4I1AA 3NOGD 2IOSA 5JMND 5AAOA 4N2QA 4ME2A 3FH7A 3ULYA 4CGWA 3U3WA 3CIAA 2L0IA 3DSWA 3FTWA 1KZPA 4I6JA 2VSXE 2QYUA 5BPPA 4HXIA 2Y4TA 3OXFA 3MGBA 4JPSA 2CHZA 2IU1A 1N0QA 2ZGDA 4EZKA 2J9QA 3QWVA 5KCMA 2YHCA 2WXPA 3FTSA 4GCOA 3LY8A 5KJMA 3CHRA 4CEMA 2P9UG 1XNFA 2YHEA 5ARGA 2XEEA 4FU3A 4L23A 3V2OA 2XEHA 1UW4B 2L0TB 2WXKA 1MX2A 4BX9A 3W9GA 2ETCA 2VGXB 5HKPA 3MX3A 2WMNA 1UJKA 1BD8A 3MKRA 1HE8A 1B89A 2RFMA 4L2LA 4RQIA 1TN7A 5BUZA 1ELKA 4J8DA 1QQEA 4C48B 1BU9A 3FEYA 3GZ2A 2VQ2A 4KVOA 2V0PA 3EIJA 3MV2B 1SZ9A 4BESA 1OWNA 3ONLA 2Y1LE 1E8ZA 2OCCE 5CHEE 3PE3A 5EDSA 3TWUA 5D0OD 2H6FA 4JL0A 1OCZE 2PM7A 1FPPA 2L6BA 3CQGB 4W9RA 3UI2A 4ANWA 3HDXA 4IYPA 1E7UA 5ENNA 3NB2A 3ZEFA 1E8XA 5CCMA 2CHWA 2R17C 4L1BA 3PEUB 3MA5A 4KMOA 2LXLA 4KXKB 1NA0A 3B13A 4I6GA 4ACKA 3CHPA 3CKCA 2NYJA 4DLQA 1ELRA 4Q69A 1MQSA 4GTQA 2GRMA 4IN3B 5EKQD 3HXEA 4PUCA 3U64A 4BSZB 2IY0C 5HS0A 4GA2A 3NZSA 3SD5A 4BETA 2VSNA 2UY1B 5LOZA 4X8QA 2F8YA 4F1PA 2J4BA 2I1KA 4N5CA 2GROB 3PH0C 3ZVVA 3B7BA 2IQCA 4F1SA 3D9MA 4WWPA 1BLXB 2AW6A 4ACLA 2ONDA 3MKQA 3UKRG 1HF8A 3AG3E 2LAIA 3O48A 4TXQA 4DX7D 5CBNA 3NBNB 4N5QA 4CT0A 1QNFA 4FA6A 2R05A 1H2VC 5FJYA 2FI7A 2C2LA 1JWFA 5LCWJ 1FT1A 2KZTA 3NZUA 4WNFA 4OAVB 1TJFA 4A55A 5EYLA 3AS4A 1O1TA 5FQ8A 4BT8A 1IQUA 2J8SD 1OWOA 3EIQC 5G04C 1EDUA 3IXEA 3RRMB 4YDOA 1TNUA 3JUIA 5FWQA 4J7WA 4KT6B 3QWPA 2KZTB 4FADA 2J09A 3BU8A 3SI5A 2GRNB 3LS8A 1YYHA 2F8XK 2P9LG 3CVUA 3FDHA 3FUIA 5ENPD 1WG0A 3D3MA 3APDA 4JC8A 2IONA 2ZGGA 4MLPA 4AV7A 3TG5A 3FTZA 2ZISA 4GAAA 3MJWA 3JCKC 3AU4A 3OXLA 4JHJA 2C0LA 3UUXA 2WQ7A 4JB8P 3RAUA 1HX8A 4JXTA 2AJAA 4J8FA 2RG8A 5BXUA 1FVFA 3KEZA 5T4YA 4B8AA 3V2XA 4GZ3A 3FHEA 2FF4A 3ABLE 3P1UA 4NURA 3MV3B 4HLLA 3B7TA 2EIKE 2VGEA 3PZ3A 3SFXA 1TN8A 1P5QA 4APOA 1S64A 3TXMA 3QWWA 3EDTB 5FINA 5KJNA 2VYIA 2IJGX 5ENOD 1MJ0A 1OUVA 1TJCA 1WY6A 5BNWA 5AYWD 4Y6WA 1BI7B 3KEAA 5CRVA 4MS6A 1N4SA 1OCCE 3EHQA 4HS2A 3ZYKA 5AQ7A 1TN6A 2IO3C 3U4TA 2WXRA 3LEWA 1D9SA 3SQVA 3TWQA 5G05C 4OVUA 1N4RA 3FUNA 3QK0A 4G2VA 4XI9A 2HR2A 3E34A 3MEKA 4JA9A 4GTOA 1AWCB 1TNYA 4DI3A 5G04J 1H6PA 2WXFA 2EQXA 2WM9A 3EU5A 5D0QD 2L9BA 4JHRA 2GW1A 4U0SA 2BEDA 4TXPA 1LTXA 4DI4A 5J08A 2EILE 5C2YA 3FWVA 2WXJA 1SQMA 3B95A 2WXOA 4C0MA 3HIZA 5CECB 4D10C 4AEZC 1V55E 4WNDA 3S2AA 3JQ1A 4UWKA 3BQOA 4J0UA 4LEUA 3QARA 5BXOA 5IY5E 4HI9A 3LPZA 1MZCA 3PNLB 4PDXA 3AS8A 2KCLA 1A17A 3VLEA 3TGOA 4HLEA 5EX0A 4TUUA 4ZFHA 3LVRE 3ZUVB 4AP2A 2XZDG 3ZXSA 3CVLA 1LF8A 4RG6A 2GRQB 3PDNA 4H7XA 2VSOE 5CMYA 3CVVA 2X6HA 3N71A 3D9JA 3QJZA 4G1TA 4GYWA 3L22A 3B7UX 4A63B 3ISMC 3PZ4A 3PZDA 3FTXA 4LNGA 3CVPA 4E6HA 2YQ8A 3APCA 3S7BA 1V54E 3HG0D 3RRUA 2E0IA 3ONKA 1Y8MA 5AQAA 1N0RA 5G55A 3IHVA 5A7DB 1W3BA 4U07A 3DSVA 3Q47B 4GTVA 4JD2G 2VGXA 2R59A 3Q78A 2J08A 2QYJA 5ENRD 3ZIMA 5AENA 2H6HA 3IEGA 2P9SG 4U8YD 2XPIA 2Y4UA 4LNUD 2RKKA 3AG1E 3TG4A 3GZ1A 2FO1E 3LVQE 1QYMA 1DVPA 1RZ4A 3L82A 4B93B 3UT4A 3Q75A 1KZOA 4AVXA 4BT9A 2R5SA 3ABKE 3ZN3A 1MYOA 3GW4A 5EILA 1BPOA 3RO2A 1PAQA 1H6OA 1MHQA 3X2QE 3D9OA 2OOEA 1K3ZD 4RVBA 2MOWA 4A3VA 4AIFA 2WXGA 3DWLG 5M72A 1JCQA 4GTPA 2DIWA 4NACA 3D9KA 2QC9A 3L13A 1TR4A 1EYHA 4LCTA 4M7CA 4BFRA 4BTBA 5T8IA 5ITZF 3BG0B 4K5AB 3RIBA 2J07A 4XI0A 2P2CP 5CMWA 2XHEA 4UQZA 5ARFA 3UT8A 3CHQA 3PEVB 3UM3A 3IKOB 4CCAA 1WM5A 3AG2E 2LSUA 4IRUA 2A4ZA 2XGSA 3PE4A 3SBSA 1ZU2A 1U3DA 3C72A 3ZHEB 1JPLA 4HVBA 3PREA 4CDRA 3ZYMA 5JHAA 4GU5A 5FIOA 5E76A 4F3VA 4FP7A 3SGHA 1HS6A 4N3CA 4BTAA 4N39A 2LAHA 2WXHA 5FZSA 1NZNA 1OWLA 1D8DA 3F6QA 3BEEA 2CG2A 4ILGA 3CEQA 2CFZA 4MBGA 1OWPA 1N54A 1IKND 4J8EA 4U96D 4E85A 1E8YA 3Q49B 3L17A 4O6FA 5AIJA 3ZRHA 2BF0X 2IF4A 1NL4A 2L6JA 3WG7E 3HXFA 4UWHA 5ENSD 4OYSA 2HM8A 3TWSA 5KNHD 1OWMA 1IYGA 3SHFA 4A3TA 3LYAA 3CVNA 1ZB1A 3FU3A 3DEPA 2Y0BG 3SFZA 2FULA 5BV1A 3BUAA 3ZW3A 4YNDA 5A6CA 4I9EA 2WXIA 4U0ZA 4GA1A 4UWLA 4PS8A 3V30A 4APFA 1EPUA 4YDWA 4O1OA 4F6RD 1SW6A 3CSFA 3LDZA 4HOQA 3CV0A 1O5MA 5HI7A 2WQHA 3TWTA 4GMLA 5HQ8A 3D9HA 5KJKA 2LXMA 3S7DA 4AJWA 2H6GA 3FTUA 1E96B 1DCEA 4GMJA 5LP0A 4C0EA 3MZLB 4XZ4A 1WAO1 3JQ0A 2MRIA 3I4GA 4DX5D 1OCRE 4ILIA 3ABME 2VTBA 4XIFA 3C3QA 2LO6A 3C3OA 3LKUA 2DZNA 3D9NA 4U7EB 3AG4E 3UTMA 4Y6CA 3DSUA 2DWZA 4CDMA 1E8WA 2DBAA 4RG9A 3VTYA 3V31A 5DBKA 3ASDA 2Y3AA 4PS3A 4GPKA 3Q79A 4XX5A 3OAWA 1Q2ZA 3L54A 4OVVA 1INZA 1JUQA 1H6KA 1X5BA 4DPRA 2DVWA 4DX1A 3GYZA 1JCRA 5KWDA 4U8HA 3KS2A 4JEHA 5JHBA 3C98A 2B0OE 4YDYA 5E75A 2X6JA 3T8MA 3DPYA 5A23A 3CQCB 3EHMA 4ZHBA 2UWJG 3K9IA 2JABA 4B0ZA 5LX8A 3AAAC 5LCWC 2BTDA 1HU3A 3KSLA 1NA3A 5CBOA 4HOUA 2HYZA 4JA7A 2XCCA 2XPZA 4DRXE 2I2OA 4B94A 4N3BA 2XGOA 4I6EA 4XEIG 3S7JA 4CYMD 2A5EA 4ANUA 2CG3A 4CGVA 2KM4A 3VTXA 4MKTA 4GYYA 3HXCA 1D8EA 4GZCA 2KCKA 1L5JA 3QC1A 2FEZA 5EIDA 4HNAD 2V4LA 5CRUA 2F0YA 1UJJA 1N52A 3G2SA 4AY6A 4CT4A 3FUJA 3MKQB 2A5UA 2P9KG 4QFVA 4O60A 3SZ7A 4EPZA 1LD7A 4J6IA 1YA0A 5ANRA 5C1DA 4DLOA 5CCLA 2AXVA 4EBAA 3UINC 1OT8A 2WXLA 1E7VA 5HRYA 1SA4A 3LY9A 3DXKG 1K1AA 3QB2A 4HOSA 4I17A 5DIZA 2LUHA 2P9NG 2XRYA 4BY6A 3PUKA 1FCHA 3JYSA 4CRWA 3CK8A 4JHKA 2AVPA 4Z68A 1KT0A 4KBQA 3RJVA 4AM9A 3SY2A 3SFYA 1LD8A 1EF1C 2JLBA 3CR3A 1YCSB 4G8KA 1U3CA 4GMRA 3PNTB 1H0AA 2GRPB 4GCNA 2VGYA 1MX6A 3QAQA 1H2TC 5T3RA 4N3AA 4WAFA 3T8KA 3Q9NC 2J4DA 3T5VA 3ZPJA 1A5EA 2WXNA 3ULEG 5JJ7A 1PY1A 1Z5SC 4G25A 1O1RA 2XZTG 1NFIE 2WQ6A 3GZSA 3CKBA 1QBQA 2X3MA 3APFA 3VLDA 3Q4AB 4ANVA 3SBTB 2BKGA 2XRZA 4GZ5A 3CK7A 4FC8A 3RKVA 5EIBE 3UKUG 3J5QB 3ZNGA 4B8CB 3DBSA 4UI9K 2WB2A 3UMVA 4EHMA 4ANXA 3EHNA 3U9WA 4U95D 5FT9A 3EUVA 3ZU7B 3FUDA 4LSZE 3FU6A 2IOLA 3Q15A 1PC2A 3QKYA 1RW2A 1X81A 3FEXA 3CVXA 3DPDA 4BSXA 2EINE 2X6FA 2R03A 1WDYA 4A1GA 2X6KA 3I5PA 4IULA 2J49A 5ENQD 4I2ZA 3TWVA 3UIOC 4NQ0A 5CEAA 1ELWA 4UQXA 2VTBB 3B7RL 5AQ9A 5J90A 4UI9C 4WNGA 5EYPF 3NOCD 2IEJA 3ZXPA 4WWNA 1TNZA 3QDNA 2FO7A 1NI1A 2YNQA 3ZKJA 3PS6A 4YDEA 1HH8A 2ZXWE 2PQNA 1TNOA 3IBEA 4WUYA 4TV3A 4JVSA 4HB5A 4F53A 1HG2A 2YINA 3LJ3A 3OXGA 4GTTA 2UY1A 4ABNA 3C5RA 3R7RA 1K8KG 3NAWA 4QQIA 2P9PG 3HYMB 1N94A 2AWIA 4OAUC 3PVLA 4NIKA 5D2MC 2XENA 3R9MA 4EECA 2H6IA 5KJLA 2PQRA 5FTPA 5B3SE 4FLHA 2V5QC 1Z3XA 1XGWA 3PZ2A 4CZ2D 1S0PA 3EHRA 2GRRB 4K03A 1Z3YA 2WMOA 1IXVA 5AJLA 3UXGA 3FH8A 3URZA 4HBDA 3ZHEA 4XE0A 2PZIA 4BEPA 2IFUA 4U63A 4XKCA 3FU0A 3Q73A 2I9CA 1JWGA 5FQ4A 3CHSA 1IQRA 4I1OB 3CHMA 4HFGA 2IO2C 3UM0A 1H19A 2AXUA 3DEOA 3CVQA 3ASFA 3Q7AA 3IHYA 3UPVA 1TEZA 4LNBA 3C3RA 1KT1A 1S70B 2C0MA 2PM6A 3RRNB 3Q9UC 3NQPA 3HHMA 4NRHB 3HXBA 3E4BA 3W9FA 4BWRA 3HRAA 3TL5A 3TJPA 2OVBA 3KD7A 1SVXA 3ZGQA 5ENTD 3SNXA 2XEVA 4GZ6A 2I1JA 2NSZA 3QOUA 1N95A 4EZLA 4FULA 2X6IA 4CDNA 2AXZA 4L7TA 3AS5A 4EBAG 2MHKA 3U66A 3KSQA 2XS8A 3LXUX 4AY5A 2QFCA 4GTSA 4EZJA 1JCSA 4G8LA 4YVQC 2DCPA 4Q96A 3CLJA 4AXHA 3FUHA 4EQFA 1UN8A 2EIME 3DSSA 3FUKA 4GTRA 4N2SA 3AU5A 1HZ4A 5KBAA 4HOTA 4U04A 4ILHB 1N4QA 2FBNA 5B1AE 5JJ6A 3KAEA 5D66A 4KZCA 3Q7FA 2HO1A 1O1SA 2V4HC 2WXMA 3LJNA 3FH5A 4JZYA 3L08A 4I43A 3RSEG 3PRZA 5LFAA 4P29A 4KZ0A 2GGFA 1HFAA 4J8YA 1HO8A 3BG1B 4RLYA 2LNIA 4O1PA 2XCBA 2QZAA 3FY4A 1UG3A 2EIJE 3MYVA 2CHXA 4YVOA 4K0RA 5FQ7A 4LG6A 4L2YA 1K1BA 2F37A 3TXNA 4FJYA 5FZQA 2OEVA 2RFAA 4FJZA 5CERB 3FUEA 2DYSE 3I3NA 2KATA 2M63A 3RO3A 2Q7FA 4Q94A 2R2LA 4J8SA 5G2NA 2VJ8A 4KVMA 4JW1A 3ZFWA 3MCXA 5KNGA 5ANLA 3FUMA 2JEKA 4U8VD 3DSTA 5AJDA 2OVFA 5AN8A 5JA4D 3FUFA 4R7LA 2BKKB 4GZDA 5JJTA 2I6HA 4I9CA 2ZU6B 3HXDA 5EN5D 3TWXA 4DJAA 1OY3D 1BI8B 3FP3A 3PZ1A 3OTNA 3SO8A 3B7SA 2BUGA 3FU5A 4G24A 1MX4A 3PUJA 3SF4A 3Q5MA 3EU9A 3L6AA 1N4PA 3D9IA 1NP7A 2KBXA 1Z6TA 1G3NB 2OEWA 4UI9J 2R02A 4DK5A 3E30A 3ML8A 2LSVA 3R7QA 3UM2A 4KYOB 2B6CA 2Y69E 5FZRA 1YMPA 3FULA 3NF1A 5B1BE 3ASNE 2V5FA 2ILRA 4I1MA 4AOFA 1IHBA 4DX2A 2WPVA 3S7FA 1SZAA 3ULQA 4URKA 3CGHA 2WXQA 3E33A 4GA0A 3G2UA 3ZYLA 3LCAA 3TWRA 3AJIA 3WXXA 4DX6D 5BT1A 4C9BB 4H7YA 5CEDB 4K5CA 3T9KA 2E2EA 4G11A 1Y6IA 1DCQA 3JUEA 3JXJA 1N11A 4UQYA 3R9AB 3FTYA 1FT2A 4HRLA 4F7AA 4GTMA 3CSTA 5FQ6A 1IHGA 4A1SA 4RSYA 1U2VG 3DSXA 2ETAA 3LY7A 4HRMB 4BX8A 2QY7A 1TYQG 1GW6A 4FHJA 4UUCA 1HG5A 3D9LA 3HVEB 1HXIA 2OV8A 3ASGA 3G2VA 4HQDA 3UX4A 1ZBPA 3UIPC 4LERA 4G26A 4JEUA 3CHOA 3RU0A 3J5PA 3JXIA 1N9AA 5AQBA 4ATGA 2DYRE 3UQ3A 1OCOE 3P2BA 2XS1A 4V3IA 5AARA 4GYOA 3DXMG 2RD0A 2HE0A 4FLBA 2P58C 4PH4B 3CK9A 2PNNA 2GRLA 5G05J 3ML9A 1E90A 1VDYA 4TXRA 3HVEA 3G2TA 3L16A 2XGMA 3G2WA 4GPMA 1KLXA 4XKBA 4BERA 4PS7A 3IV0A 3D9PA 3ASOE 1UN9A
chains in the Genus database with same CATH topology
5IY5E 3AG1E 1OCRE 3ABME 2EIME 2EILE 1OCCE 3AG3E 5B1BE 1V54E 2ZXWE 3ASNE 3WG7E 5B3SE 2EINE 3AG2E 3ABLE 3X2QE 2OCCE 3AG4E 5B1AE 1V55E 2EIJE 2DYRE 2DYSE 3ABKE 2EIKE 1OCOE 2Y69E 3ASOE 1OCZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IY5 E;  3AG1 E;  1OCR E;  3ABM E;  2EIM E;  2EIL E;  1OCC E;  3AG3 E;  5B1B E;  1V54 E;  2ZXW E;  3ASN E;  3WG7 E;  5B3S E;  2EIN E;  3AG2 E;  3ABL E;  3X2Q E;  2OCC E;  3AG4 E;  5B1A E;  1V55 E;  2EIJ E;  2DYR E;  2DYS E;  3ABK E;  2EIK E;  1OCO E;  2Y69 E;  3ASO E;  1OCZ E; 
#chains in the Genus database with same CATH topology
 2NC9 A;  3FFL A;  2KC7 A;  2MYO A;  4HI8 A;  2WVI A;  5BV0 A;  2V8S E;  2NXP A;  3I4R B;  4LRZ A;  1QZ2 A;  4K5B A;  3CVY A;  4FHK A;  2XQ0 A;  3E37 A;  2CFU A;  1DC2 A;  1UOH A;  3ASH A;  4UWG A;  4TUM A;  2XPY A;  3V79 K;  1TNB A;  4WWO A;  2PL2 A;  3ESL A;  4HOR A;  3L9T A;  1S63 A;  4B89 A;  5EX3 A;  2X38 A;  5H7P A;  3DRA A;  2ETB A;  1OXJ A;  4MRU A;  1DNP A;  1FVH A;  2KCV A;  4U0U A;  4DUI A;  3VLF A;  4UWF A;  3EJN A;  2VSY A;  4M3O A;  4L9P A;  3UM1 A;  3FTV A;  4GB9 A;  3E32 A;  4ATZ D;  1AP7 A;  4WNE A;  5BW8 C;  3O4Z A;  4TRQ A;  4HRN A;  3UT7 A;  3ZYQ A;  3T5X A;  2ZIR A;  2P9I G;  3CVW A;  4I2W A;  3QNK A;  1KPS B;  3TWW A;  1SA5 A;  3ENE A;  2DZO A;  4LUN U;  3ESK A;  3RK6 A;  3TAX A;  4G23 A;  1H2U A;  2KXP C;  4I1A A;  3NOG D;  2IOS A;  5JMN D;  5AAO A;  4N2Q A;  4ME2 A;  3FH7 A;  3ULY A;  4CGW A;  3U3W A;  3CIA A;  2L0I A;  3DSW A;  3FTW A;  1KZP A;  4I6J A;  2VSX E;  2QYU A;  5BPP A;  4HXI A;  2Y4T A;  3OXF A;  3MGB A;  4JPS A;  2CHZ A;  2IU1 A;  1N0Q A;  2ZGD A;  4EZK A;  2J9Q A;  3QWV A;  5KCM A;  2YHC A;  2WXP A;  3FTS A;  4GCO A;  3LY8 A;  5KJM A;  3CHR A;  4CEM A;  2P9U G;  1XNF A;  2YHE A;  5ARG A;  2XEE A;  4FU3 A;  4L23 A;  3V2O A;  2XEH A;  1UW4 B;  2L0T B;  2WXK A;  1MX2 A;  4BX9 A;  3W9G A;  2ETC A;  2VGX B;  5HKP A;  3MX3 A;  2WMN A;  1UJK A;  1BD8 A;  3MKR A;  1HE8 A;  1B89 A;  2RFM A;  4L2L A;  4RQI A;  1TN7 A;  5BUZ A;  1ELK A;  4J8D A;  1QQE A;  4C48 B;  1BU9 A;  3FEY A;  3GZ2 A;  2VQ2 A;  4KVO A;  2V0P A;  3EIJ A;  3MV2 B;  1SZ9 A;  4BES A;  1OWN A;  3ONL A;  2Y1L E;  1E8Z A;  2OCC E;  5CHE E;  3PE3 A;  5EDS A;  3TWU A;  5D0O D;  2H6F A;  4JL0 A;  1OCZ E;  2PM7 A;  1FPP A;  2L6B A;  3CQG B;  4W9R A;  3UI2 A;  4ANW A;  3HDX A;  4IYP A;  1E7U A;  5ENN A;  3NB2 A;  3ZEF A;  1E8X A;  5CCM A;  2CHW A;  2R17 C;  4L1B A;  3PEU B;  3MA5 A;  4KMO A;  2LXL A;  4KXK B;  1NA0 A;  3B13 A;  4I6G A;  4ACK A;  3CHP A;  3CKC A;  2NYJ A;  4DLQ A;  1ELR A;  4Q69 A;  1MQS A;  4GTQ A;  2GRM A;  4IN3 B;  5EKQ D;  3HXE A;  4PUC A;  3U64 A;  4BSZ B;  2IY0 C;  5HS0 A;  4GA2 A;  3NZS A;  3SD5 A;  4BET A;  2VSN A;  2UY1 B;  5LOZ A;  4X8Q A;  2F8Y A;  4F1P A;  2J4B A;  2I1K A;  4N5C A;  2GRO B;  3PH0 C;  3ZVV A;  3B7B A;  2IQC A;  4F1S A;  3D9M A;  4WWP A;  1BLX B;  2AW6 A;  4ACL A;  2OND A;  3MKQ A;  3UKR G;  1HF8 A;  3AG3 E;  2LAI A;  3O48 A;  4TXQ A;  4DX7 D;  5CBN A;  3NBN B;  4N5Q A;  4CT0 A;  1QNF A;  4FA6 A;  2R05 A;  1H2V C;  5FJY A;  2FI7 A;  2C2L A;  1JWF A;  5LCW J;  1FT1 A;  2KZT A;  3NZU A;  4WNF A;  4OAV B;  1TJF A;  4A55 A;  5EYL A;  3AS4 A;  1O1T A;  5FQ8 A;  4BT8 A;  1IQU A;  2J8S D;  1OWO A;  3EIQ C;  5G04 C;  1EDU A;  3IXE A;  3RRM B;  4YDO A;  1TNU A;  3JUI A;  5FWQ A;  4J7W A;  4KT6 B;  3QWP A;  2KZT B;  4FAD A;  2J09 A;  3BU8 A;  3SI5 A;  2GRN B;  3LS8 A;  1YYH A;  2F8X K;  2P9L G;  3CVU A;  3FDH A;  3FUI A;  5ENP D;  1WG0 A;  3D3M A;  3APD A;  4JC8 A;  2ION A;  2ZGG A;  4MLP A;  4AV7 A;  3TG5 A;  3FTZ A;  2ZIS A;  4GAA A;  3MJW A;  3JCK C;  3AU4 A;  3OXL A;  4JHJ A;  2C0L A;  3UUX A;  2WQ7 A;  4JB8 P;  3RAU A;  1HX8 A;  4JXT A;  2AJA A;  4J8F A;  2RG8 A;  5BXU A;  1FVF A;  3KEZ A;  5T4Y A;  4B8A A;  3V2X A;  4GZ3 A;  3FHE A;  2FF4 A;  3ABL E;  3P1U A;  4NUR A;  3MV3 B;  4HLL A;  3B7T A;  2EIK E;  2VGE A;  3PZ3 A;  3SFX A;  1TN8 A;  1P5Q A;  4APO A;  1S64 A;  3TXM A;  3QWW A;  3EDT B;  5FIN A;  5KJN A;  2VYI A;  2IJG X;  5ENO D;  1MJ0 A;  1OUV A;  1TJC A;  1WY6 A;  5BNW A;  5AYW D;  4Y6W A;  1BI7 B;  3KEA A;  5CRV A;  4MS6 A;  1N4S A;  1OCC E;  3EHQ A;  4HS2 A;  3ZYK A;  5AQ7 A;  1TN6 A;  2IO3 C;  3U4T A;  2WXR A;  3LEW A;  1D9S A;  3SQV A;  3TWQ A;  5G05 C;  4OVU A;  1N4R A;  3FUN A;  3QK0 A;  4G2V A;  4XI9 A;  2HR2 A;  3E34 A;  3MEK A;  4JA9 A;  4GTO A;  1AWC B;  1TNY A;  4DI3 A;  5G04 J;  1H6P A;  2WXF A;  2EQX A;  2WM9 A;  3EU5 A;  5D0Q D;  2L9B A;  4JHR A;  2GW1 A;  4U0S A;  2BED A;  4TXP A;  1LTX A;  4DI4 A;  5J08 A;  2EIL E;  5C2Y A;  3FWV A;  2WXJ A;  1SQM A;  3B95 A;  2WXO A;  4C0M A;  3HIZ A;  5CEC B;  4D10 C;  4AEZ C;  1V55 E;  4WND A;  3S2A A;  3JQ1 A;  4UWK A;  3BQO A;  4J0U A;  4LEU A;  3QAR A;  5BXO A;  5IY5 E;  4HI9 A;  3LPZ A;  1MZC A;  3PNL B;  4PDX A;  3AS8 A;  2KCL A;  1A17 A;  3VLE A;  3TGO A;  4HLE A;  5EX0 A;  4TUU A;  4ZFH A;  3LVR E;  3ZUV B;  4AP2 A;  2XZD G;  3ZXS A;  3CVL A;  1LF8 A;  4RG6 A;  2GRQ B;  3PDN A;  4H7X A;  2VSO E;  5CMY A;  3CVV A;  2X6H A;  3N71 A;  3D9J A;  3QJZ A;  4G1T A;  4GYW A;  3L22 A;  3B7U X;  4A63 B;  3ISM C;  3PZ4 A;  3PZD A;  3FTX A;  4LNG A;  3CVP A;  4E6H A;  2YQ8 A;  3APC A;  3S7B A;  1V54 E;  3HG0 D;  3RRU A;  2E0I A;  3ONK A;  1Y8M A;  5AQA A;  1N0R A;  5G55 A;  3IHV A;  5A7D B;  1W3B A;  4U07 A;  3DSV A;  3Q47 B;  4GTV A;  4JD2 G;  2VGX A;  2R59 A;  3Q78 A;  2J08 A;  2QYJ A;  5ENR D;  3ZIM A;  5AEN A;  2H6H A;  3IEG A;  2P9S G;  4U8Y D;  2XPI A;  2Y4U A;  4LNU D;  2RKK A;  3AG1 E;  3TG4 A;  3GZ1 A;  2FO1 E;  3LVQ E;  1QYM A;  1DVP A;  1RZ4 A;  3L82 A;  4B93 B;  3UT4 A;  3Q75 A;  1KZO A;  4AVX A;  4BT9 A;  2R5S A;  3ABK E;  3ZN3 A;  1MYO A;  3GW4 A;  5EIL A;  1BPO A;  3RO2 A;  1PAQ A;  1H6O A;  1MHQ A;  3X2Q E;  3D9O A;  2OOE A;  1K3Z D;  4RVB A;  2MOW A;  4A3V A;  4AIF A;  2WXG A;  3DWL G;  5M72 A;  1JCQ A;  4GTP A;  2DIW A;  4NAC A;  3D9K A;  2QC9 A;  3L13 A;  1TR4 A;  1EYH A;  4LCT A;  4M7C A;  4BFR A;  4BTB A;  5T8I A;  5ITZ F;  3BG0 B;  4K5A B;  3RIB A;  2J07 A;  4XI0 A;  2P2C P;  5CMW A;  2XHE A;  4UQZ A;  5ARF A;  3UT8 A;  3CHQ A;  3PEV B;  3UM3 A;  3IKO B;  4CCA A;  1WM5 A;  3AG2 E;  2LSU A;  4IRU A;  2A4Z A;  2XGS A;  3PE4 A;  3SBS A;  1ZU2 A;  1U3D A;  3C72 A;  3ZHE B;  1JPL A;  4HVB A;  3PRE A;  4CDR A;  3ZYM A;  5JHA A;  4GU5 A;  5FIO A;  5E76 A;  4F3V A;  4FP7 A;  3SGH A;  1HS6 A;  4N3C A;  4BTA A;  4N39 A;  2LAH A;  2WXH A;  5FZS A;  1NZN A;  1OWL A;  1D8D A;  3F6Q A;  3BEE A;  2CG2 A;  4ILG A;  3CEQ A;  2CFZ A;  4MBG A;  1OWP A;  1N54 A;  1IKN D;  4J8E A;  4U96 D;  4E85 A;  1E8Y A;  3Q49 B;  3L17 A;  4O6F A;  5AIJ A;  3ZRH A;  2BF0 X;  2IF4 A;  1NL4 A;  2L6J A;  3WG7 E;  3HXF A;  4UWH A;  5ENS D;  4OYS A;  2HM8 A;  3TWS A;  5KNH D;  1OWM A;  1IYG A;  3SHF A;  4A3T A;  3LYA A;  3CVN A;  1ZB1 A;  3FU3 A;  3DEP A;  2Y0B G;  3SFZ A;  2FUL A;  5BV1 A;  3BUA A;  3ZW3 A;  4YND A;  5A6C A;  4I9E A;  2WXI A;  4U0Z A;  4GA1 A;  4UWL A;  4PS8 A;  3V30 A;  4APF A;  1EPU A;  4YDW A;  4O1O A;  4F6R D;  1SW6 A;  3CSF A;  3LDZ A;  4HOQ A;  3CV0 A;  1O5M A;  5HI7 A;  2WQH A;  3TWT A;  4GML A;  5HQ8 A;  3D9H A;  5KJK A;  2LXM A;  3S7D A;  4AJW A;  2H6G A;  3FTU A;  1E96 B;  1DCE A;  4GMJ A;  5LP0 A;  4C0E A;  3MZL B;  4XZ4 A;  1WAO 1;  3JQ0 A;  2MRI A;  3I4G A;  4DX5 D;  1OCR E;  4ILI A;  3ABM E;  2VTB A;  4XIF A;  3C3Q A;  2LO6 A;  3C3O A;  3LKU A;  2DZN A;  3D9N A;  4U7E B;  3AG4 E;  3UTM A;  4Y6C A;  3DSU A;  2DWZ A;  4CDM A;  1E8W A;  2DBA A;  4RG9 A;  3VTY A;  3V31 A;  5DBK A;  3ASD A;  2Y3A A;  4PS3 A;  4GPK A;  3Q79 A;  4XX5 A;  3OAW A;  1Q2Z A;  3L54 A;  4OVV A;  1INZ A;  1JUQ A;  1H6K A;  1X5B A;  4DPR A;  2DVW A;  4DX1 A;  3GYZ A;  1JCR A;  5KWD A;  4U8H A;  3KS2 A;  4JEH A;  5JHB A;  3C98 A;  2B0O E;  4YDY A;  5E75 A;  2X6J A;  3T8M A;  3DPY A;  5A23 A;  3CQC B;  3EHM A;  4ZHB A;  2UWJ G;  3K9I A;  2JAB A;  4B0Z A;  5LX8 A;  3AAA C;  5LCW C;  2BTD A;  1HU3 A;  3KSL A;  1NA3 A;  5CBO A;  4HOU A;  2HYZ A;  4JA7 A;  2XCC A;  2XPZ A;  4DRX E;  2I2O A;  4B94 A;  4N3B A;  2XGO A;  4I6E A;  4XEI G;  3S7J A;  4CYM D;  2A5E A;  4ANU A;  2CG3 A;  4CGV A;  2KM4 A;  3VTX A;  4MKT A;  4GYY A;  3HXC A;  1D8E A;  4GZC A;  2KCK A;  1L5J A;  3QC1 A;  2FEZ A;  5EID A;  4HNA D;  2V4L A;  5CRU A;  2F0Y A;  1UJJ A;  1N52 A;  3G2S A;  4AY6 A;  4CT4 A;  3FUJ A;  3MKQ B;  2A5U A;  2P9K G;  4QFV A;  4O60 A;  3SZ7 A;  4EPZ A;  1LD7 A;  4J6I A;  1YA0 A;  5ANR A;  5C1D A;  4DLO A;  5CCL A;  2AXV A;  4EBA A;  3UIN C;  1OT8 A;  2WXL A;  1E7V A;  5HRY A;  1SA4 A;  3LY9 A;  3DXK G;  1K1A A;  3QB2 A;  4HOS A;  4I17 A;  5DIZ A;  2LUH A;  2P9N G;  2XRY A;  4BY6 A;  3PUK A;  1FCH A;  3JYS A;  4CRW A;  3CK8 A;  4JHK A;  2AVP A;  4Z68 A;  1KT0 A;  4KBQ A;  3RJV A;  4AM9 A;  3SY2 A;  3SFY A;  1LD8 A;  1EF1 C;  2JLB A;  3CR3 A;  1YCS B;  4G8K A;  1U3C A;  4GMR A;  3PNT B;  1H0A A;  2GRP B;  4GCN A;  2VGY A;  1MX6 A;  3QAQ A;  1H2T C;  5T3R A;  4N3A A;  4WAF A;  3T8K A;  3Q9N C;  2J4D A;  3T5V A;  3ZPJ A;  1A5E A;  2WXN A;  3ULE G;  5JJ7 A;  1PY1 A;  1Z5S C;  4G25 A;  1O1R A;  2XZT G;  1NFI E;  2WQ6 A;  3GZS A;  3CKB A;  1QBQ A;  2X3M A;  3APF A;  3VLD A;  3Q4A B;  4ANV A;  3SBT B;  2BKG A;  2XRZ A;  4GZ5 A;  3CK7 A;  4FC8 A;  3RKV A;  5EIB E;  3UKU G;  3J5Q B;  3ZNG A;  4B8C B;  3DBS A;  4UI9 K;  2WB2 A;  3UMV A;  4EHM A;  4ANX A;  3EHN A;  3U9W A;  4U95 D;  5FT9 A;  3EUV A;  3ZU7 B;  3FUD A;  4LSZ E;  3FU6 A;  2IOL A;  3Q15 A;  1PC2 A;  3QKY A;  1RW2 A;  1X81 A;  3FEX A;  3CVX A;  3DPD A;  4BSX A;  2EIN E;  2X6F A;  2R03 A;  1WDY A;  4A1G A;  2X6K A;  3I5P A;  4IUL A;  2J49 A;  5ENQ D;  4I2Z A;  3TWV A;  3UIO C;  4NQ0 A;  5CEA A;  1ELW A;  4UQX A;  2VTB B;  3B7R L;  5AQ9 A;  5J90 A;  4UI9 C;  4WNG A;  5EYP F;  3NOC D;  2IEJ A;  3ZXP A;  4WWN A;  1TNZ A;  3QDN A;  2FO7 A;  1NI1 A;  2YNQ A;  3ZKJ A;  3PS6 A;  4YDE A;  1HH8 A;  2ZXW E;  2PQN A;  1TNO A;  3IBE A;  4WUY A;  4TV3 A;  4JVS A;  4HB5 A;  4F53 A;  1HG2 A;  2YIN A;  3LJ3 A;  3OXG A;  4GTT A;  2UY1 A;  4ABN A;  3C5R A;  3R7R A;  1K8K G;  3NAW A;  4QQI A;  2P9P G;  3HYM B;  1N94 A;  2AWI A;  4OAU C;  3PVL A;  4NIK A;  5D2M C;  2XEN A;  3R9M A;  4EEC A;  2H6I A;  5KJL A;  2PQR A;  5FTP A;  5B3S E;  4FLH A;  2V5Q C;  1Z3X A;  1XGW A;  3PZ2 A;  4CZ2 D;  1S0P A;  3EHR A;  2GRR B;  4K03 A;  1Z3Y A;  2WMO A;  1IXV A;  5AJL A;  3UXG A;  3FH8 A;  3URZ A;  4HBD A;  3ZHE A;  4XE0 A;  2PZI A;  4BEP A;  2IFU A;  4U63 A;  4XKC A;  3FU0 A;  3Q73 A;  2I9C A;  1JWG A;  5FQ4 A;  3CHS A;  1IQR A;  4I1O B;  3CHM A;  4HFG A;  2IO2 C;  3UM0 A;  1H19 A;  2AXU A;  3DEO A;  3CVQ A;  3ASF A;  3Q7A A;  3IHY A;  3UPV A;  1TEZ A;  4LNB A;  3C3R A;  1KT1 A;  1S70 B;  2C0M A;  2PM6 A;  3RRN B;  3Q9U C;  3NQP A;  3HHM A;  4NRH B;  3HXB A;  3E4B A;  3W9F A;  4BWR A;  3HRA A;  3TL5 A;  3TJP A;  2OVB A;  3KD7 A;  1SVX A;  3ZGQ A;  5ENT D;  3SNX A;  2XEV A;  4GZ6 A;  2I1J A;  2NSZ A;  3QOU A;  1N95 A;  4EZL A;  4FUL A;  2X6I A;  4CDN A;  2AXZ A;  4L7T A;  3AS5 A;  4EBA G;  2MHK A;  3U66 A;  3KSQ A;  2XS8 A;  3LXU X;  4AY5 A;  2QFC A;  4GTS A;  4EZJ A;  1JCS A;  4G8L A;  4YVQ C;  2DCP A;  4Q96 A;  3CLJ A;  4AXH A;  3FUH A;  4EQF A;  1UN8 A;  2EIM E;  3DSS A;  3FUK A;  4GTR A;  4N2S A;  3AU5 A;  1HZ4 A;  5KBA A;  4HOT A;  4U04 A;  4ILH B;  1N4Q A;  2FBN A;  5B1A E;  5JJ6 A;  3KAE A;  5D66 A;  4KZC A;  3Q7F A;  2HO1 A;  1O1S A;  2V4H C;  2WXM A;  3LJN A;  3FH5 A;  4JZY A;  3L08 A;  4I43 A;  3RSE G;  3PRZ A;  5LFA A;  4P29 A;  4KZ0 A;  2GGF A;  1HFA A;  4J8Y A;  1HO8 A;  3BG1 B;  4RLY A;  2LNI A;  4O1P A;  2XCB A;  2QZA A;  3FY4 A;  1UG3 A;  2EIJ E;  3MYV A;  2CHX A;  4YVO A;  4K0R A;  5FQ7 A;  4LG6 A;  4L2Y A;  1K1B A;  2F37 A;  3TXN A;  4FJY A;  5FZQ A;  2OEV A;  2RFA A;  4FJZ A;  5CER B;  3FUE A;  2DYS E;  3I3N A;  2KAT A;  2M63 A;  3RO3 A;  2Q7F A;  4Q94 A;  2R2L A;  4J8S A;  5G2N A;  2VJ8 A;  4KVM A;  4JW1 A;  3ZFW A;  3MCX A;  5KNG A;  5ANL A;  3FUM A;  2JEK A;  4U8V D;  3DST A;  5AJD A;  2OVF A;  5AN8 A;  5JA4 D;  3FUF A;  4R7L A;  2BKK B;  4GZD A;  5JJT A;  2I6H A;  4I9C A;  2ZU6 B;  3HXD A;  5EN5 D;  3TWX A;  4DJA A;  1OY3 D;  1BI8 B;  3FP3 A;  3PZ1 A;  3OTN A;  3SO8 A;  3B7S A;  2BUG A;  3FU5 A;  4G24 A;  1MX4 A;  3PUJ A;  3SF4 A;  3Q5M A;  3EU9 A;  3L6A A;  1N4P A;  3D9I A;  1NP7 A;  2KBX A;  1Z6T A;  1G3N B;  2OEW A;  4UI9 J;  2R02 A;  4DK5 A;  3E30 A;  3ML8 A;  2LSV A;  3R7Q A;  3UM2 A;  4KYO B;  2B6C A;  2Y69 E;  5FZR A;  1YMP A;  3FUL A;  3NF1 A;  5B1B E;  3ASN E;  2V5F A;  2ILR A;  4I1M A;  4AOF A;  1IHB A;  4DX2 A;  2WPV A;  3S7F A;  1SZA A;  3ULQ A;  4URK A;  3CGH A;  2WXQ A;  3E33 A;  4GA0 A;  3G2U A;  3ZYL A;  3LCA A;  3TWR A;  3AJI A;  3WXX A;  4DX6 D;  5BT1 A;  4C9B B;  4H7Y A;  5CED B;  4K5C A;  3T9K A;  2E2E A;  4G11 A;  1Y6I A;  1DCQ A;  3JUE A;  3JXJ A;  1N11 A;  4UQY A;  3R9A B;  3FTY A;  1FT2 A;  4HRL A;  4F7A A;  4GTM A;  3CST A;  5FQ6 A;  1IHG A;  4A1S A;  4RSY A;  1U2V G;  3DSX A;  2ETA A;  3LY7 A;  4HRM B;  4BX8 A;  2QY7 A;  1TYQ G;  1GW6 A;  4FHJ A;  4UUC A;  1HG5 A;  3D9L A;  3HVE B;  1HXI A;  2OV8 A;  3ASG A;  3G2V A;  4HQD A;  3UX4 A;  1ZBP A;  3UIP C;  4LER A;  4G26 A;  4JEU A;  3CHO A;  3RU0 A;  3J5P A;  3JXI A;  1N9A A;  5AQB A;  4ATG A;  2DYR E;  3UQ3 A;  1OCO E;  3P2B A;  2XS1 A;  4V3I A;  5AAR A;  4GYO A;  3DXM G;  2RD0 A;  2HE0 A;  4FLB A;  2P58 C;  4PH4 B;  3CK9 A;  2PNN A;  2GRL A;  5G05 J;  3ML9 A;  1E90 A;  1VDY A;  4TXR A;  3HVE A;  3G2T A;  3L16 A;  2XGM A;  3G2W A;  4GPM A;  1KLX A;  4XKB A;  4BER A;  4PS7 A;  3IV0 A;  3D9P A;  3ASO E;  1UN9 A; 
#chains in the Genus database with same CATH homology
 5IY5 E;  3AG1 E;  1OCR E;  3ABM E;  2EIM E;  2EIL E;  1OCC E;  3AG3 E;  5B1B E;  1V54 E;  2ZXW E;  3ASN E;  3WG7 E;  5B3S E;  2EIN E;  3AG2 E;  3ABL E;  3X2Q E;  2OCC E;  3AG4 E;  5B1A E;  1V55 E;  2EIJ E;  2DYR E;  2DYS E;  3ABK E;  2EIK E;  1OCO E;  2Y69 E;  3ASO E;  1OCZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...