4TXRA

Crystal structure of lip5 n-terminal domain complexed with chmp1b mim and chmp5 mim
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
159
structure length
158
Chain Sequence
b'LAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Charged multivesicular body protein 1b
publication title A Novel Mechanism of Regulating the ATPase VPS4 by Its Cofactor LIP5 and the Endosomal Sorting Complex Required for Transport (ESCRT)-III Protein CHMP5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 67
structure length 158
sequence length 159
ec nomenclature
pdb deposition date 2014-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 4txrA00
4TXRA 2LXLA 2LXMA 4TXPA 4U7EB 4TXQA 2LUHA 2RKKA 5H7PA
chains in the Genus database with same CATH superfamily
5D0OD 2NC9A 3MV3B 5ENQD 3FY4A 1H19A 2KATA 4XI0A 4DRXE 2EINE 4GZ5A 3O48A 3GZ2A 5T4YA 4DPRA 3ZUVB 2P9UG 4LERA 3UM1A 4YDYA 5BXOA 4GPKA 3ZPJA 1IQUA 1E7VA 1DCQA 2FEZA 3UT4A 5BT1A 3G2WA 4BETA 3RK6A 2BTDA 2YINA 3E34A 2IO3C 3NF1A 2V5FA 4GYWA 3D9JA 1TNYA 2J49A 2XEVA 3ZYQA 4YVQC 1JPLA 2VQ2A 2GRNB 1S63A 2KM4A 3EHNA 4URKA 2GRQB 4HLLA 2PL2A 5CMYA 5ENSD 3UUXA 4WWPA 5J08A 1HF8A 2AWIA 4MKTA 3PREA 2JLBA 5HS0A 2XRYA 4WWOA 4DX6D 4GTPA 3C72A 3FUMA 4N39A 4G1TA 5G04J 3QWWA 3SFXA 1L5JA 4HNAD 1EPUA 3FEYA 3I5PA 4BESA 1HO8A 3FUIA 3KEAA 3DPDA 4J8FA 2KBXA 5CHEE 3TWRA 2RKKA 3C5RA 2H6IA 4IYPA 1KZOA 2XRZA 5FINA 3ASOE 3CK7A 4EBAG 2BUGA 3IXEA 3CLJA 4G8KA 1P5QA 5KJLA 1LD7A 3CSTA 5LP0A 4GYYA 2RFAA 4TUUA 4GU5A 3SHFA 4XEIG 4ZFHA 2VSNA 5C2YA 3DSVA 3L9TA 3HYMB 2GRPB 1TJCA 4B94A 3NZSA 1E8XA 5AIJA 3R7RA 3MJWA 3FDHA 2JABA 1QZ2A 3ZEFA 3CKBA 1N4QA 2IO2C 1N95A 2IF4A 2X6HA 2J08A 1H0AA 1HG5A 2DBAA 3UMVA 3IBEA 4FLBA 4TXPA 1O5MA 3FTWA 1D8DA 4RG9A 3RRUA 2FO1E 1V54E 1KT0A 3VTXA 4I6EA 4JVSA 4N2SA 3FUKA 3TXNA 5CBOA 2RG8A 4ATGA 4FULA 4FHKA 4LNGA 1ELRA 3BEEA 4K5CA 5EX0A 4BSZB 2F0YA 3RRMB 3E32A 3VLEA 1NI1A 4EQFA 2WXFA 5BUZA 4U04A 2LAIA 4C0MA 1UOHA 1RW2A 1FT2A 2ETAA 1TNOA 2P9IG 2FO7A 1SW6A 2MRIA 4G24A 1KLXA 3U3WA 1U3DA 2VSXE 1UJJA 3E37A 5D0QD 3DEOA 3ZFWA 4HVBA 3CVYA 3IHYA 4ACKA 2R02A 1E8YA 3ONLA 4D10C 4Q96A 5ENRD 2I2OA 4G8LA 5AENA 3HVEB 2AJAA 1B89A 4CDNA 4FLHA 3CVVA 4APOA 3ZHEA 2DIWA 2X6KA 4V3IA 4NRHB 4FJYA 4O60A 2VSOE 1D8EA 1PAQA 1NP7A 1TNBA 4LCTA 1FPPA 4UQYA 3LY7A 3CVQA 3FU0A 1YA0A 3MX3A 4GAAA 2ZGGA 1E96B 3PE3A 3KS2A 1OY3D 3TGOA 4JC8A 5BPPA 3FTVA 2NSZA 4FJZA 3JYSA 2P2CP 4PH4B 3UM0A 5H7PA 3V2OA 3AG3E 3AS5A 4Y6WA 1LF8A 2P9NG 5JA4D 3DBSA 3PVLA 5FZQA 2VGXA 5ITZF 3D9KA 1FT1A 4I1MA 2R59A 2A5EA 1G3NB 3TXMA 4DX2A 3LVQE 3URZA 3ZU7B 4JHRA 3L54A 5E76A 2IFUA 3FUFA 5D66A 2Y1LE 2XENA 4KZCA 2WXRA 2WXGA 3FEXA 5B1BE 3CVPA 3RIBA 2HM8A 2XQ0A 2Q7FA 4U8YD 4XI9A 4GZCA 4NIKA 3E4BA 3KSQA 4HB5A 3ZXSA 4C0EA 4I1AA 2Y4TA 5M72A 1N9AA 4CEMA 4B89A 2X6IA 2AVPA 1SA4A 3C98A 4GTSA 2AW6A 3Q9UC 1U2VG 3EIJA 2HE0A 4A55A 1S64A 3T8MA 4U63A 2B0OE 5CRVA 2L9BA 1UN8A 3TWVA 4KXKB 5KNGA 3AJIA 4WNEA 4NQ0A 3MEKA 1IXVA 4DX5D 4L23A 1N94A 5G55A 4GMLA 5CRUA 2WMOA 3ENEA 4U0UA 1V55E 2JEKA 3APCA 3OAWA 4RLYA 3APFA 1IYGA 3J5QB 2NYJA 4C9BB 2AXVA 4GA2A 1ZBPA 3PNLB 2E0IA 4HI9A 4I2WA 4GTOA 3D9MA 3LKUA 5ENOD 4BERA 2VJ8A 2EILE 2X6JA 3N71A 5BV1A 2LXLA 4WUYA 1H6OA 3ULYA 4RG6A 4OVVA 4AOFA 1N4RA 4FU3A 1KPSB 3WG7E 2EIME 1DVPA 2WMNA 2GROB 3Q49B 2LAHA 5HQ8A 3KAEA 2J07A 3JUEA 1LTXA 3TL5A 5G05J 2WXOA 5G04C 1TEZA 1NL4A 2DZOA 2OEVA 2NXPA 4DLQA 4YDWA 3JCKC 2IQCA 3U66A 3UPVA 4JL0A 1Z3YA 1QBQA 5ENNA 5ARGA 3TWTA 4I6GA 3S7FA 2P9PG 5AQBA 2EIKE 4YVOA 5AAOA 2R05A 4JB8P 3RO2A 3ZHEB 4GMRA 2YHEA 3FH7A 2ZXWE 4GTQA 1MHQA 3HXDA 5FZRA 2WXLA 4B8CB 4UI9K 4GCNA 4BX9A 2E2EA 2PZIA 3TWWA 2V4HC 5LFAA 1TR4A 1NA3A 3EHMA 4DJAA 4HBDA 2VGEA 4LSZE 3PZDA 3DSXA 3SBTB 5AN8A 3Q7AA 1UG3A 4BFRA 2IU1A 3HRAA 3TWXA 5IY5E 2IJGX 2YQ8A 3DEPA 3SI5A 1MQSA 1HH8A 3B7BA 3ESLA 4I1OB 5AQAA 2DZNA 3DWLG 3PZ3A 4KBQA 4XX5A 2GRRB 5KNHD 2V0PA 4OAVB 4AY6A 2CG2A 1N4PA 1JCQA 3Q5MA 3ASHA 1NFIE 5AQ7A 4L2YA 1YYHA 4HS2A 1TJFA 4B8AA 4H7YA 3TWQA 5HI7A 1OCOE 2F37A 3QWPA 4JEUA 1XGWA 3CKCA 3D3MA 1ZU2A 1Z3XA 1OCZE 4CDRA 2J4BA 1EF1C 1WAO1 4GA1A 1MYOA 5BNWA 3ZNGA 1JCRA 3FUEA 3NZUA 1INZA 1HU3A 3LEWA 4J8YA 3MKQA 3L13A 2OV8A 4F1SA 1FVHA 1OWMA 2XZDG 4EBAA 1E8ZA 3QJZA 5EX3A 5CECB 2PQNA 2H6HA 2ZISA 4U8HA 3OXFA 2F8XK 1X81A 3FUHA 4CT0A 3JQ0A 3JQ1A 3SBSA 5JMND 3SF4A 5B3SE 4W9RA 3GZSA 3EJNA 3CHQA 2QC9A 4HXIA 1OWOA 1BI7B 3OXGA 1WY6A 4G11A 1YMPA 3OXLA 5FZSA 3NB2A 2WXIA 3MKRA 3KD7A 3CHPA 4DI3A 4OVUA 1HX8A 3L22A 3L82A 4U95D 4WNGA 3UIOC 4AJWA 3FFLA 3EUVA 1LD8A 2DVWA 3VTYA 2CHZA 4E6HA 4BT9A 4O6FA 4ANWA 1TNZA 2FI7A 3I4GA 2KC7A 2J09A 1HG2A 3FU3A 3MZLB 1DC2A 1OXJA 1TN6A 3Q4AB 2WXPA 3PDNA 3DXMG 1NZNA 4JEHA 4LRZA 4UWHA 1AP7A 5CBNA 3Q75A 3L08A 3RU0A 3PE4A 4MRUA 1SZ9A 3D9NA 1S0PA 3FH8A 5AJDA 3BUAA 4U0SA 4OAUC 4JA7A 2H6GA 5BW8C 3D9PA 2Y0BG 4EHMA 3MGBA 3IV0A 3ISMC 3LY8A 4I9CA 1OCCE 1EYHA 3LJ3A 1IHBA 3AG1E 4L9PA 2MOWA 4M3OA 4K5AB 4CDMA 4A3TA 3B7UX 3SGHA 4N5QA 3U4TA 3PUJA 5DBKA 5EIBE 1WM5A 5FIOA 4HRLA 3DSSA 4F7AA 3K9IA 1TYQG 3LS8A 5FT9A 4UI9J 5CCMA 3CVUA 4WWNA 4EECA 3J5PA 4AV7A 3FHEA 4G25A 3R9AB 2BF0X 3KSLA 3ZW3A 3UT8A 2KCKA 3ABME 3CGHA 3FP3A 4BT8A 4YNDA 3ZGQA 4KVMA 3FULA 4FC8A 5EDSA 1YCSB 2XGSA 1E8WA 5BXUA 4AXHA 2XCCA 1BU9A 2DYRE 2WQHA 2BEDA 5EYLA 3HDXA 3LJNA 3UKRG 3RAUA 3APDA 3NOGD 5HKPA 4RVBA 2CG3A 3IKOB 3FTYA 1O1TA 4Q94A 1H2TC 5JHBA 3O4ZA 2XGOA 4G23A 3LDZA 3CSFA 3DSWA 2IOLA 4DX1A 3Q7FA 3C3OA 3NQPA 1BPOA 4CT4A 3AS4A 3PH0C 1Q2ZA 5FQ7A 3X2QE 4APFA 2LXMA 5G05C 3PZ4A 3EHQA 4GCOA 1QQEA 5JJ7A 4AY5A 3CVXA 3RRNB 1WDYA 2HYZA 3DSUA 3Q47B 5T3RA 2BKGA 1N52A 1BI8B 3EIQC 4XIFA 5FJYA 2WM9A 2MYOA 1KZPA 3BQOA 4MS6A 2QYUA 3AG4E 4IN3B 4ACLA 5AYWD 3DSTA 5E75A 4TRQA 1BD8A 3EU5A 3B13A 1QNFA 3JUIA 3PS6A 4PS3A 5LCWJ 1OCRE 4A3VA 2PM6A 4DUIA 4X8QA 1PC2A 1OWNA 2X3MA 4UUCA 1SQMA 3QNKA 3T5XA 3MYVA 4C48B 3FTZA 3W9FA 2J4DA 2XPIA 4TUMA 3SZ7A 2A4ZA 1Z5SC 2XPZA 1Y8MA 4YDEA 2VTBA 1HS6A 5JJ6A 3UI2A 1W3BA 4MBGA 2Y4UA 1HFAA 3RJVA 2OVBA 2XEEA 4HI8A 3V30A 4GZ6A 3D9LA 3UM3A 5A6CA 3KEZA 4XKCA 4BX8A 4FP7A 2Y69E 4N3BA 1A5EA 3B7TA 4L2LA 3ZYKA 1MX6A 4YDOA 3HIZA 1E90A 3Q73A 1KT1A 3UIPC 1QYMA 3ML9A 3BG0B 1OT8A 2XEHA 4N3AA 2L0TB 4LUNU 1VDYA 1Y6IA 2I1JA 4RQIA 1DCEA 2R5SA 3QOUA 4BTAA 4I43A 3T8KA 5CMWA 5A7DB 4JZYA 4KT6B 1OWPA 4XE0A 3QAQA 4HRMB 1MJ0A 4TV3A 1TN7A 3PEUB 5LX8A 4DK5A 3D9OA 4JXTA 4J7WA 3HXCA 3TG5A 3DRAA 3QWVA 3L16A 4ATZD 4I6JA 3ABLE 3CHOA 4NACA 4AEZC 4FADA 3L6AA 2XS1A 4HLEA 3WXXA 3QC1A 3PRZA 2R17C 2I9CA 3HXBA 3HG0D 3HXFA 4QQIA 1S70B 1AWCB 3UINC 3ZRHA 5FWQA 3FU6A 4F3VA 1E7UA 3AU4A 2RD0A 5CERB 1K1AA 4BTBA 3QKYA 3VLFA 1O1RA 4JD2G 2R03A 2DYSE 3HVEA 1ELWA 2AXZA 2HR2A 3ESKA 3E30A 2ZGDA 3QB2A 2RFMA 2DWZA 5ARFA 5JJTA 2GW1A 3W9GA 2EQXA 3ONKA 2A5UA 3SFZA 3SFYA 2IOSA 3LYAA 2KZTA 5EYPF 4N5CA 3G2TA 2I1KA 3FTSA 1BLXB 4AIFA 2CHXA 4EZLA 2QZAA 3ZXPA 4J8EA 3ZYMA 1JWGA 2XZTG 2PM7A 2LSUA 3U9WA 3AAAC 2VGXB 4JHJA 4TXRA 4CRWA 4UQXA 3QARA 4AM9A 2FBNA 1UW4B 4PDXA 2LO6A 2QY7A 4GZ3A 5EN5D 5DIZA 4GTRA 1H2VC 4L7TA 3RKVA 3MCXA 4BSXA 4JW1A 4G26A 2PQRA 5C1DA 2UWJG 3CIAA 2HO1A 4J6IA 2L0IA 2ETCA 4XZ4A 3UX4A 1HZ4A 3SY2A 2WXMA 1JWFA 2WQ7A 3PNTB 5A23A 4UQZA 2YHCA 4GTVA 3G2SA 2I6HA 4ABNA 2ILRA 2C0LA 3FUJA 4LG6A 2XS8A 2KXPC 2V8SE 2CFZA 3VLDA 3AS8A 4GA0A 4BY6A 2OOEA 3ASFA 1D9SA 3ZIMA 2YNQA 2J9QA 4UI9C 3NOCD 3OTNA 1FVFA 1JCSA 3UXGA 2CHWA 3DXKG 1H6PA 2WXNA 2PNNA 1U3CA 3TWSA 3Q9NC 5CEDB 4O1PA 1K3ZD 4KZ0A 4U96D 4M7CA 4G2VA 4UWGA 2OEWA 3V79K 3FUNA 2VTBB 3G2VA 2FF4A 3JXIA 5KCMA 1TNUA 3IHVA 4RSYA 2F8YA 4HOSA 4K5BA 1N0RA 5AARA 5ANRA 4KYOB 3HXEA 3QK0A 2KCVA 3EU9A 2DCPA 4DX7D 2OCCE 2R2LA 3UKUG 2MHKA 3P1UA 4CCAA 1K8KG 2VSYA 2X38A 2XCBA 2H6FA 3GW4A 2LUHA 3ULQA 2P9KG 4DLOA 3UTMA 4DI4A 3B95A 3T5VA 3PUKA 3MA5A 3ML8A 4K03A 3UM2A 4EPZA 4GTTA 4GMJA 3ASNE 5T8IA 3S7DA 3B7RL 3CR3A 4GPMA 4QFVA 4U7EB 1H6KA 3FU5A 4XKBA 4N3CA 1TN8A 2UY1A 3S7JA 2Y3AA 2GGFA 1UN9A 4ANXA 2VGYA 2IONA 5EIDA 4U8VD 4J0UA 4EZKA 1O1SA 2QFCA 3SQVA 3MV2B 4MLPA 4F6RD 2P9SG 5AQ9A 3Q15A 4CYMD 4HOQA 1N4SA 2WQ6A 4J8DA 4ME2A 4H7XA 4A1SA 3GYZA 5LCWC 4N2QA 2P9LG 3NAWA 3TG4A 1NA0A 4EZJA 3L17A 4CZ2D 4LNUD 3ZN3A 2KCLA 5CCLA 3CVWA 3P2BA 4WNFA 2B6CA 4P29A 4ANVA 3NBNB 1MZCA 2LNIA 2FULA 2GRMA 1N0QA 5ANLA 4FA6A 5FTPA 3CHMA 3U64A 2KZTB 4B93B 3EHRA 4L1BA 3BG1B 3ULEG 5KWDA 3DPYA 2XPYA 5KJMA 3EDTB 3SD5A 3C3QA 3R7QA 3CVLA 2WXHA 4IRUA 1H2UA 3B7SA 2V4LA 2XGMA 3S7BA 4R7LA 3LPZA 2ZU6B 3ZYLA 3ASGA 3UQ3A 4A63B 1PY1A 5LOZA 2IEJA 3SNXA 4GZDA 3PEVB 2LSVA 4I9EA 3TJPA 5FQ6A 1SVXA 4I2ZA 3QDNA 2V5QC 4JHKA 2C0MA 4O1OA 4J8SA 3I4RB 1IHGA 3D9HA 3S2AA 5FQ8A 4FHJA 3MKQB 4F53A 3V2XA 4WAFA 1Z6TA 3CV0A 1EDUA 2C2LA 5FQ4A 3Q78A 1OUVA 1N54A 1X5BA 1XNFA 4U0ZA 4JPSA 2M63A 5J90A 2IY0C 3FTXA 3CHSA 1RZ4A 1OWLA 2ZIRA 3FUDA 3IEGA 4AP2A 1MX4A 1HXIA 1DNPA 4CGVA 3LY9A 3CK8A 2ETBA 2BKKB 5BV0A 4UWFA 1FCHA 4JA9A 4GYOA 3CQGB 2WXJA 1ZB1A 4KVOA 5B1AE 3CEQA 4HOUA 1IQRA 3JXJA 4NURA 5JHAA 4PS7A 3CVNA 4ANUA 2WXKA 4ZHBA 4IULA 3PZ1A 3LXUX 4TXQA 5KJKA 1WG0A 4Z68A 1JUQA 3AG2E 2WVIA 4PS8A 4U07A 5G2NA 5D2MC 3FH5A 3LVRE 3CK9A 4HORA 3PZ2A 4HFGA 3HHMA 2GRLA 3LCAA 4BEPA 4OYSA 5HRYA 2J8SD 5KJNA 3ZVVA 4LEUA 2AXUA 1GW6A 2UY1B 4BWRA 4HRNA 3CQCB 2WB2A 3FTUA 1IKND 2ONDA 3D9IA 4K0RA 3RSEG 3R9MA 3TWUA 3V31A 1HE8A 1ELKA 2X6FA 3C3RA 1SA5A 3TAXA 1UJKA 4UWLA 4LNBA 5AJLA 4AVXA 4ILIA 4I17A 4PUCA 1N11A 3FWVA 1SZAA 2WPVA 5KBAA 3I3NA 4Y6CA 3ASDA 1MX2A 3F6QA 4HOTA 4HQDA 4WNDA 2XHEA 3RO3A 4Q69A 5EKQD 5ENPD 2WXQA 4F1PA 2L6BA 3AU5A 1K1BA 4UWKA 3ZKJA 5EILA 5CEAA 1A17A 4A1GA 2VYIA 3UT7A 3E33A 4E85A 3T9KA 4KMOA 5ENTD 2OVFA 3ABKE 3G2UA 4GB9A 3BU8A 2QYJA 2EIJE 3Q79A 4GTMA 4ILGA 2L6JA 3GZ1A 4ILHB 2P58C 3CHRA 3SO8A 4CGWA 4B0ZA 2CFUA
chains in the Genus database with same CATH topology
4TXRA 2LXLA 2LXMA 4TXPA 4U7EB 4TXQA 2LUHA 2RKKA 5H7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TXR A;  2LXL A;  2LXM A;  4TXP A;  4U7E B;  4TXQ A;  2LUH A;  2RKK A;  5H7P A; 
#chains in the Genus database with same CATH topology
 5D0O D;  2NC9 A;  3MV3 B;  5ENQ D;  3FY4 A;  1H19 A;  2KAT A;  4XI0 A;  4DRX E;  2EIN E;  4GZ5 A;  3O48 A;  3GZ2 A;  5T4Y A;  4DPR A;  3ZUV B;  2P9U G;  4LER A;  3UM1 A;  4YDY A;  5BXO A;  4GPK A;  3ZPJ A;  1IQU A;  1E7V A;  1DCQ A;  2FEZ A;  3UT4 A;  5BT1 A;  3G2W A;  4BET A;  3RK6 A;  2BTD A;  2YIN A;  3E34 A;  2IO3 C;  3NF1 A;  2V5F A;  4GYW A;  3D9J A;  1TNY A;  2J49 A;  2XEV A;  3ZYQ A;  4YVQ C;  1JPL A;  2VQ2 A;  2GRN B;  1S63 A;  2KM4 A;  3EHN A;  4URK A;  2GRQ B;  4HLL A;  2PL2 A;  5CMY A;  5ENS D;  3UUX A;  4WWP A;  5J08 A;  1HF8 A;  2AWI A;  4MKT A;  3PRE A;  2JLB A;  5HS0 A;  2XRY A;  4WWO A;  4DX6 D;  4GTP A;  3C72 A;  3FUM A;  4N39 A;  4G1T A;  5G04 J;  3QWW A;  3SFX A;  1L5J A;  4HNA D;  1EPU A;  3FEY A;  3I5P A;  4BES A;  1HO8 A;  3FUI A;  3KEA A;  3DPD A;  4J8F A;  2KBX A;  5CHE E;  3TWR A;  2RKK A;  3C5R A;  2H6I A;  4IYP A;  1KZO A;  2XRZ A;  5FIN A;  3ASO E;  3CK7 A;  4EBA G;  2BUG A;  3IXE A;  3CLJ A;  4G8K A;  1P5Q A;  5KJL A;  1LD7 A;  3CST A;  5LP0 A;  4GYY A;  2RFA A;  4TUU A;  4GU5 A;  3SHF A;  4XEI G;  4ZFH A;  2VSN A;  5C2Y A;  3DSV A;  3L9T A;  3HYM B;  2GRP B;  1TJC A;  4B94 A;  3NZS A;  1E8X A;  5AIJ A;  3R7R A;  3MJW A;  3FDH A;  2JAB A;  1QZ2 A;  3ZEF A;  3CKB A;  1N4Q A;  2IO2 C;  1N95 A;  2IF4 A;  2X6H A;  2J08 A;  1H0A A;  1HG5 A;  2DBA A;  3UMV A;  3IBE A;  4FLB A;  4TXP A;  1O5M A;  3FTW A;  1D8D A;  4RG9 A;  3RRU A;  2FO1 E;  1V54 E;  1KT0 A;  3VTX A;  4I6E A;  4JVS A;  4N2S A;  3FUK A;  3TXN A;  5CBO A;  2RG8 A;  4ATG A;  4FUL A;  4FHK A;  4LNG A;  1ELR A;  3BEE A;  4K5C A;  5EX0 A;  4BSZ B;  2F0Y A;  3RRM B;  3E32 A;  3VLE A;  1NI1 A;  4EQF A;  2WXF A;  5BUZ A;  4U04 A;  2LAI A;  4C0M A;  1UOH A;  1RW2 A;  1FT2 A;  2ETA A;  1TNO A;  2P9I G;  2FO7 A;  1SW6 A;  2MRI A;  4G24 A;  1KLX A;  3U3W A;  1U3D A;  2VSX E;  1UJJ A;  3E37 A;  5D0Q D;  3DEO A;  3ZFW A;  4HVB A;  3CVY A;  3IHY A;  4ACK A;  2R02 A;  1E8Y A;  3ONL A;  4D10 C;  4Q96 A;  5ENR D;  2I2O A;  4G8L A;  5AEN A;  3HVE B;  2AJA A;  1B89 A;  4CDN A;  4FLH A;  3CVV A;  4APO A;  3ZHE A;  2DIW A;  2X6K A;  4V3I A;  4NRH B;  4FJY A;  4O60 A;  2VSO E;  1D8E A;  1PAQ A;  1NP7 A;  1TNB A;  4LCT A;  1FPP A;  4UQY A;  3LY7 A;  3CVQ A;  3FU0 A;  1YA0 A;  3MX3 A;  4GAA A;  2ZGG A;  1E96 B;  3PE3 A;  3KS2 A;  1OY3 D;  3TGO A;  4JC8 A;  5BPP A;  3FTV A;  2NSZ A;  4FJZ A;  3JYS A;  2P2C P;  4PH4 B;  3UM0 A;  5H7P A;  3V2O A;  3AG3 E;  3AS5 A;  4Y6W A;  1LF8 A;  2P9N G;  5JA4 D;  3DBS A;  3PVL A;  5FZQ A;  2VGX A;  5ITZ F;  3D9K A;  1FT1 A;  4I1M A;  2R59 A;  2A5E A;  1G3N B;  3TXM A;  4DX2 A;  3LVQ E;  3URZ A;  3ZU7 B;  4JHR A;  3L54 A;  5E76 A;  2IFU A;  3FUF A;  5D66 A;  2Y1L E;  2XEN A;  4KZC A;  2WXR A;  2WXG A;  3FEX A;  5B1B E;  3CVP A;  3RIB A;  2HM8 A;  2XQ0 A;  2Q7F A;  4U8Y D;  4XI9 A;  4GZC A;  4NIK A;  3E4B A;  3KSQ A;  4HB5 A;  3ZXS A;  4C0E A;  4I1A A;  2Y4T A;  5M72 A;  1N9A A;  4CEM A;  4B89 A;  2X6I A;  2AVP A;  1SA4 A;  3C98 A;  4GTS A;  2AW6 A;  3Q9U C;  1U2V G;  3EIJ A;  2HE0 A;  4A55 A;  1S64 A;  3T8M A;  4U63 A;  2B0O E;  5CRV A;  2L9B A;  1UN8 A;  3TWV A;  4KXK B;  5KNG A;  3AJI A;  4WNE A;  4NQ0 A;  3MEK A;  1IXV A;  4DX5 D;  4L23 A;  1N94 A;  5G55 A;  4GML A;  5CRU A;  2WMO A;  3ENE A;  4U0U A;  1V55 E;  2JEK A;  3APC A;  3OAW A;  4RLY A;  3APF A;  1IYG A;  3J5Q B;  2NYJ A;  4C9B B;  2AXV A;  4GA2 A;  1ZBP A;  3PNL B;  2E0I A;  4HI9 A;  4I2W A;  4GTO A;  3D9M A;  3LKU A;  5ENO D;  4BER A;  2VJ8 A;  2EIL E;  2X6J A;  3N71 A;  5BV1 A;  2LXL A;  4WUY A;  1H6O A;  3ULY A;  4RG6 A;  4OVV A;  4AOF A;  1N4R A;  4FU3 A;  1KPS B;  3WG7 E;  2EIM E;  1DVP A;  2WMN A;  2GRO B;  3Q49 B;  2LAH A;  5HQ8 A;  3KAE A;  2J07 A;  3JUE A;  1LTX A;  3TL5 A;  5G05 J;  2WXO A;  5G04 C;  1TEZ A;  1NL4 A;  2DZO A;  2OEV A;  2NXP A;  4DLQ A;  4YDW A;  3JCK C;  2IQC A;  3U66 A;  3UPV A;  4JL0 A;  1Z3Y A;  1QBQ A;  5ENN A;  5ARG A;  3TWT A;  4I6G A;  3S7F A;  2P9P G;  5AQB A;  2EIK E;  4YVO A;  5AAO A;  2R05 A;  4JB8 P;  3RO2 A;  3ZHE B;  4GMR A;  2YHE A;  3FH7 A;  2ZXW E;  4GTQ A;  1MHQ A;  3HXD A;  5FZR A;  2WXL A;  4B8C B;  4UI9 K;  4GCN A;  4BX9 A;  2E2E A;  2PZI A;  3TWW A;  2V4H C;  5LFA A;  1TR4 A;  1NA3 A;  3EHM A;  4DJA A;  4HBD A;  2VGE A;  4LSZ E;  3PZD A;  3DSX A;  3SBT B;  5AN8 A;  3Q7A A;  1UG3 A;  4BFR A;  2IU1 A;  3HRA A;  3TWX A;  5IY5 E;  2IJG X;  2YQ8 A;  3DEP A;  3SI5 A;  1MQS A;  1HH8 A;  3B7B A;  3ESL A;  4I1O B;  5AQA A;  2DZN A;  3DWL G;  3PZ3 A;  4KBQ A;  4XX5 A;  2GRR B;  5KNH D;  2V0P A;  4OAV B;  4AY6 A;  2CG2 A;  1N4P A;  1JCQ A;  3Q5M A;  3ASH A;  1NFI E;  5AQ7 A;  4L2Y A;  1YYH A;  4HS2 A;  1TJF A;  4B8A A;  4H7Y A;  3TWQ A;  5HI7 A;  1OCO E;  2F37 A;  3QWP A;  4JEU A;  1XGW A;  3CKC A;  3D3M A;  1ZU2 A;  1Z3X A;  1OCZ E;  4CDR A;  2J4B A;  1EF1 C;  1WAO 1;  4GA1 A;  1MYO A;  5BNW A;  3ZNG A;  1JCR A;  3FUE A;  3NZU A;  1INZ A;  1HU3 A;  3LEW A;  4J8Y A;  3MKQ A;  3L13 A;  2OV8 A;  4F1S A;  1FVH A;  1OWM A;  2XZD G;  4EBA A;  1E8Z A;  3QJZ A;  5EX3 A;  5CEC B;  2PQN A;  2H6H A;  2ZIS A;  4U8H A;  3OXF A;  2F8X K;  1X81 A;  3FUH A;  4CT0 A;  3JQ0 A;  3JQ1 A;  3SBS A;  5JMN D;  3SF4 A;  5B3S E;  4W9R A;  3GZS A;  3EJN A;  3CHQ A;  2QC9 A;  4HXI A;  1OWO A;  1BI7 B;  3OXG A;  1WY6 A;  4G11 A;  1YMP A;  3OXL A;  5FZS A;  3NB2 A;  2WXI A;  3MKR A;  3KD7 A;  3CHP A;  4DI3 A;  4OVU A;  1HX8 A;  3L22 A;  3L82 A;  4U95 D;  4WNG A;  3UIO C;  4AJW A;  3FFL A;  3EUV A;  1LD8 A;  2DVW A;  3VTY A;  2CHZ A;  4E6H A;  4BT9 A;  4O6F A;  4ANW A;  1TNZ A;  2FI7 A;  3I4G A;  2KC7 A;  2J09 A;  1HG2 A;  3FU3 A;  3MZL B;  1DC2 A;  1OXJ A;  1TN6 A;  3Q4A B;  2WXP A;  3PDN A;  3DXM G;  1NZN A;  4JEH A;  4LRZ A;  4UWH A;  1AP7 A;  5CBN A;  3Q75 A;  3L08 A;  3RU0 A;  3PE4 A;  4MRU A;  1SZ9 A;  3D9N A;  1S0P A;  3FH8 A;  5AJD A;  3BUA A;  4U0S A;  4OAU C;  4JA7 A;  2H6G A;  5BW8 C;  3D9P A;  2Y0B G;  4EHM A;  3MGB A;  3IV0 A;  3ISM C;  3LY8 A;  4I9C A;  1OCC E;  1EYH A;  3LJ3 A;  1IHB A;  3AG1 E;  4L9P A;  2MOW A;  4M3O A;  4K5A B;  4CDM A;  4A3T A;  3B7U X;  3SGH A;  4N5Q A;  3U4T A;  3PUJ A;  5DBK A;  5EIB E;  1WM5 A;  5FIO A;  4HRL A;  3DSS A;  4F7A A;  3K9I A;  1TYQ G;  3LS8 A;  5FT9 A;  4UI9 J;  5CCM A;  3CVU A;  4WWN A;  4EEC A;  3J5P A;  4AV7 A;  3FHE A;  4G25 A;  3R9A B;  2BF0 X;  3KSL A;  3ZW3 A;  3UT8 A;  2KCK A;  3ABM E;  3CGH A;  3FP3 A;  4BT8 A;  4YND A;  3ZGQ A;  4KVM A;  3FUL A;  4FC8 A;  5EDS A;  1YCS B;  2XGS A;  1E8W A;  5BXU A;  4AXH A;  2XCC A;  1BU9 A;  2DYR E;  2WQH A;  2BED A;  5EYL A;  3HDX A;  3LJN A;  3UKR G;  3RAU A;  3APD A;  3NOG D;  5HKP A;  4RVB A;  2CG3 A;  3IKO B;  3FTY A;  1O1T A;  4Q94 A;  1H2T C;  5JHB A;  3O4Z A;  2XGO A;  4G23 A;  3LDZ A;  3CSF A;  3DSW A;  2IOL A;  4DX1 A;  3Q7F A;  3C3O A;  3NQP A;  1BPO A;  4CT4 A;  3AS4 A;  3PH0 C;  1Q2Z A;  5FQ7 A;  3X2Q E;  4APF A;  2LXM A;  5G05 C;  3PZ4 A;  3EHQ A;  4GCO A;  1QQE A;  5JJ7 A;  4AY5 A;  3CVX A;  3RRN B;  1WDY A;  2HYZ A;  3DSU A;  3Q47 B;  5T3R A;  2BKG A;  1N52 A;  1BI8 B;  3EIQ C;  4XIF A;  5FJY A;  2WM9 A;  2MYO A;  1KZP A;  3BQO A;  4MS6 A;  2QYU A;  3AG4 E;  4IN3 B;  4ACL A;  5AYW D;  3DST A;  5E75 A;  4TRQ A;  1BD8 A;  3EU5 A;  3B13 A;  1QNF A;  3JUI A;  3PS6 A;  4PS3 A;  5LCW J;  1OCR E;  4A3V A;  2PM6 A;  4DUI A;  4X8Q A;  1PC2 A;  1OWN A;  2X3M A;  4UUC A;  1SQM A;  3QNK A;  3T5X A;  3MYV A;  4C48 B;  3FTZ A;  3W9F A;  2J4D A;  2XPI A;  4TUM A;  3SZ7 A;  2A4Z A;  1Z5S C;  2XPZ A;  1Y8M A;  4YDE A;  2VTB A;  1HS6 A;  5JJ6 A;  3UI2 A;  1W3B A;  4MBG A;  2Y4U A;  1HFA A;  3RJV A;  2OVB A;  2XEE A;  4HI8 A;  3V30 A;  4GZ6 A;  3D9L A;  3UM3 A;  5A6C A;  3KEZ A;  4XKC A;  4BX8 A;  4FP7 A;  2Y69 E;  4N3B A;  1A5E A;  3B7T A;  4L2L A;  3ZYK A;  1MX6 A;  4YDO A;  3HIZ A;  1E90 A;  3Q73 A;  1KT1 A;  3UIP C;  1QYM A;  3ML9 A;  3BG0 B;  1OT8 A;  2XEH A;  4N3A A;  2L0T B;  4LUN U;  1VDY A;  1Y6I A;  2I1J A;  4RQI A;  1DCE A;  2R5S A;  3QOU A;  4BTA A;  4I43 A;  3T8K A;  5CMW A;  5A7D B;  4JZY A;  4KT6 B;  1OWP A;  4XE0 A;  3QAQ A;  4HRM B;  1MJ0 A;  4TV3 A;  1TN7 A;  3PEU B;  5LX8 A;  4DK5 A;  3D9O A;  4JXT A;  4J7W A;  3HXC A;  3TG5 A;  3DRA A;  3QWV A;  3L16 A;  4ATZ D;  4I6J A;  3ABL E;  3CHO A;  4NAC A;  4AEZ C;  4FAD A;  3L6A A;  2XS1 A;  4HLE A;  3WXX A;  3QC1 A;  3PRZ A;  2R17 C;  2I9C A;  3HXB A;  3HG0 D;  3HXF A;  4QQI A;  1S70 B;  1AWC B;  3UIN C;  3ZRH A;  5FWQ A;  3FU6 A;  4F3V A;  1E7U A;  3AU4 A;  2RD0 A;  5CER B;  1K1A A;  4BTB A;  3QKY A;  3VLF A;  1O1R A;  4JD2 G;  2R03 A;  2DYS E;  3HVE A;  1ELW A;  2AXZ A;  2HR2 A;  3ESK A;  3E30 A;  2ZGD A;  3QB2 A;  2RFM A;  2DWZ A;  5ARF A;  5JJT A;  2GW1 A;  3W9G A;  2EQX A;  3ONK A;  2A5U A;  3SFZ A;  3SFY A;  2IOS A;  3LYA A;  2KZT A;  5EYP F;  4N5C A;  3G2T A;  2I1K A;  3FTS A;  1BLX B;  4AIF A;  2CHX A;  4EZL A;  2QZA A;  3ZXP A;  4J8E A;  3ZYM A;  1JWG A;  2XZT G;  2PM7 A;  2LSU A;  3U9W A;  3AAA C;  2VGX B;  4JHJ A;  4TXR A;  4CRW A;  4UQX A;  3QAR A;  4AM9 A;  2FBN A;  1UW4 B;  4PDX A;  2LO6 A;  2QY7 A;  4GZ3 A;  5EN5 D;  5DIZ A;  4GTR A;  1H2V C;  4L7T A;  3RKV A;  3MCX A;  4BSX A;  4JW1 A;  4G26 A;  2PQR A;  5C1D A;  2UWJ G;  3CIA A;  2HO1 A;  4J6I A;  2L0I A;  2ETC A;  4XZ4 A;  3UX4 A;  1HZ4 A;  3SY2 A;  2WXM A;  1JWF A;  2WQ7 A;  3PNT B;  5A23 A;  4UQZ A;  2YHC A;  4GTV A;  3G2S A;  2I6H A;  4ABN A;  2ILR A;  2C0L A;  3FUJ A;  4LG6 A;  2XS8 A;  2KXP C;  2V8S E;  2CFZ A;  3VLD A;  3AS8 A;  4GA0 A;  4BY6 A;  2OOE A;  3ASF A;  1D9S A;  3ZIM A;  2YNQ A;  2J9Q A;  4UI9 C;  3NOC D;  3OTN A;  1FVF A;  1JCS A;  3UXG A;  2CHW A;  3DXK G;  1H6P A;  2WXN A;  2PNN A;  1U3C A;  3TWS A;  3Q9N C;  5CED B;  4O1P A;  1K3Z D;  4KZ0 A;  4U96 D;  4M7C A;  4G2V A;  4UWG A;  2OEW A;  3V79 K;  3FUN A;  2VTB B;  3G2V A;  2FF4 A;  3JXI A;  5KCM A;  1TNU A;  3IHV A;  4RSY A;  2F8Y A;  4HOS A;  4K5B A;  1N0R A;  5AAR A;  5ANR A;  4KYO B;  3HXE A;  3QK0 A;  2KCV A;  3EU9 A;  2DCP A;  4DX7 D;  2OCC E;  2R2L A;  3UKU G;  2MHK A;  3P1U A;  4CCA A;  1K8K G;  2VSY A;  2X38 A;  2XCB A;  2H6F A;  3GW4 A;  2LUH A;  3ULQ A;  2P9K G;  4DLO A;  3UTM A;  4DI4 A;  3B95 A;  3T5V A;  3PUK A;  3MA5 A;  3ML8 A;  4K03 A;  3UM2 A;  4EPZ A;  4GTT A;  4GMJ A;  3ASN E;  5T8I A;  3S7D A;  3B7R L;  3CR3 A;  4GPM A;  4QFV A;  4U7E B;  1H6K A;  3FU5 A;  4XKB A;  4N3C A;  1TN8 A;  2UY1 A;  3S7J A;  2Y3A A;  2GGF A;  1UN9 A;  4ANX A;  2VGY A;  2ION A;  5EID A;  4U8V D;  4J0U A;  4EZK A;  1O1S A;  2QFC A;  3SQV A;  3MV2 B;  4MLP A;  4F6R D;  2P9S G;  5AQ9 A;  3Q15 A;  4CYM D;  4HOQ A;  1N4S A;  2WQ6 A;  4J8D A;  4ME2 A;  4H7X A;  4A1S A;  3GYZ A;  5LCW C;  4N2Q A;  2P9L G;  3NAW A;  3TG4 A;  1NA0 A;  4EZJ A;  3L17 A;  4CZ2 D;  4LNU D;  3ZN3 A;  2KCL A;  5CCL A;  3CVW A;  3P2B A;  4WNF A;  2B6C A;  4P29 A;  4ANV A;  3NBN B;  1MZC A;  2LNI A;  2FUL A;  2GRM A;  1N0Q A;  5ANL A;  4FA6 A;  5FTP A;  3CHM A;  3U64 A;  2KZT B;  4B93 B;  3EHR A;  4L1B A;  3BG1 B;  3ULE G;  5KWD A;  3DPY A;  2XPY A;  5KJM A;  3EDT B;  3SD5 A;  3C3Q A;  3R7Q A;  3CVL A;  2WXH A;  4IRU A;  1H2U A;  3B7S A;  2V4L A;  2XGM A;  3S7B A;  4R7L A;  3LPZ A;  2ZU6 B;  3ZYL A;  3ASG A;  3UQ3 A;  4A63 B;  1PY1 A;  5LOZ A;  2IEJ A;  3SNX A;  4GZD A;  3PEV B;  2LSV A;  4I9E A;  3TJP A;  5FQ6 A;  1SVX A;  4I2Z A;  3QDN A;  2V5Q C;  4JHK A;  2C0M A;  4O1O A;  4J8S A;  3I4R B;  1IHG A;  3D9H A;  3S2A A;  5FQ8 A;  4FHJ A;  3MKQ B;  4F53 A;  3V2X A;  4WAF A;  1Z6T A;  3CV0 A;  1EDU A;  2C2L A;  5FQ4 A;  3Q78 A;  1OUV A;  1N54 A;  1X5B A;  1XNF A;  4U0Z A;  4JPS A;  2M63 A;  5J90 A;  2IY0 C;  3FTX A;  3CHS A;  1RZ4 A;  1OWL A;  2ZIR A;  3FUD A;  3IEG A;  4AP2 A;  1MX4 A;  1HXI A;  1DNP A;  4CGV A;  3LY9 A;  3CK8 A;  2ETB A;  2BKK B;  5BV0 A;  4UWF A;  1FCH A;  4JA9 A;  4GYO A;  3CQG B;  2WXJ A;  1ZB1 A;  4KVO A;  5B1A E;  3CEQ A;  4HOU A;  1IQR A;  3JXJ A;  4NUR A;  5JHA A;  4PS7 A;  3CVN A;  4ANU A;  2WXK A;  4ZHB A;  4IUL A;  3PZ1 A;  3LXU X;  4TXQ A;  5KJK A;  1WG0 A;  4Z68 A;  1JUQ A;  3AG2 E;  2WVI A;  4PS8 A;  4U07 A;  5G2N A;  5D2M C;  3FH5 A;  3LVR E;  3CK9 A;  4HOR A;  3PZ2 A;  4HFG A;  3HHM A;  2GRL A;  3LCA A;  4BEP A;  4OYS A;  5HRY A;  2J8S D;  5KJN A;  3ZVV A;  4LEU A;  2AXU A;  1GW6 A;  2UY1 B;  4BWR A;  4HRN A;  3CQC B;  2WB2 A;  3FTU A;  1IKN D;  2OND A;  3D9I A;  4K0R A;  3RSE G;  3R9M A;  3TWU A;  3V31 A;  1HE8 A;  1ELK A;  2X6F A;  3C3R A;  1SA5 A;  3TAX A;  1UJK A;  4UWL A;  4LNB A;  5AJL A;  4AVX A;  4ILI A;  4I17 A;  4PUC A;  1N11 A;  3FWV A;  1SZA A;  2WPV A;  5KBA A;  3I3N A;  4Y6C A;  3ASD A;  1MX2 A;  3F6Q A;  4HOT A;  4HQD A;  4WND A;  2XHE A;  3RO3 A;  4Q69 A;  5EKQ D;  5ENP D;  2WXQ A;  4F1P A;  2L6B A;  3AU5 A;  1K1B A;  4UWK A;  3ZKJ A;  5EIL A;  5CEA A;  1A17 A;  4A1G A;  2VYI A;  3UT7 A;  3E33 A;  4E85 A;  3T9K A;  4KMO A;  5ENT D;  2OVF A;  3ABK E;  3G2U A;  4GB9 A;  3BU8 A;  2QYJ A;  2EIJ E;  3Q79 A;  4GTM A;  4ILG A;  2L6J A;  3GZ1 A;  4ILH B;  2P58 C;  3CHR A;  3SO8 A;  4CGW A;  4B0Z A;  2CFU A; 
#chains in the Genus database with same CATH homology
 4TXR A;  2LXL A;  2LXM A;  4TXP A;  4U7E B;  4TXQ A;  2LUH A;  2RKK A;  5H7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...