4TXRA

Crystal structure of lip5 n-terminal domain complexed with chmp1b mim and chmp5 mim
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
159
structure length
158
Chain Sequence
LAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Charged multivesicular body protein 1b
publication title A Novel Mechanism of Regulating the ATPase VPS4 by Its Cofactor LIP5 and the Endosomal Sorting Complex Required for Transport (ESCRT)-III Protein CHMP5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 67
structure length 158
sequence length 159
ec nomenclature
pdb deposition date 2014-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 4txrA00
2LXLA 2LUHA 4U7EB 5H7PA 2RKKA 4TXQA 4TXPA 4TXRA 2LXMA
chains in the Genus database with same CATH superfamily
1QNFA 1JWFA 2VSOE 5EDSA 1YCSB 1N94A 2BKKB 2OOEA 3TJPA 1TEZA 3UM2A 3FU3A 3R7RA 3NAWA 3D9NA 3RRNB 2LO6A 2AXUA 1HE8A 1TNUA 4AEZC 1YYHA 2PNNA 3C72A 5FJYA 5AN8A 2YHCA 3FUMA 4JHJA 2P9NG 5HQ8A 4N3CA 4TRQA 5ENSD 5LX8A 4K5BA 3Q78A 3T5XA 3D9PA 1WY6A 2Y1LE 4AOFA 2VSNA 1E8ZA 3QWWA 2RD0A 3KEZA 3FULA 3CK8A 3BQOA 4APOA 2WVIA 4APFA 5LCWJ 2UY1A 2WXJA 4O6FA 2WXGA 1HS6A 5AQ7A 3DWLG 4F1SA 4JHRA 2LNIA 2YINA 3ZNGA 4ATGA 1OCZE 2B6CA 1OWNA 5CMWA 2P2CP 2ZGGA 2WMNA 3UIPC 4I1AA 3PS6A 1OCRE 1FVFA 3JUIA 1P5QA 4LEUA 3SBTB 4FC8A 3UM1A 1JPLA 4XKCA 2AWIA 3CK7A 4A3VA 3DXKG 2MHKA 4L7TA 4B89A 2AVPA 2VGEA 2X6HA 4UI9K 1TN7A 3FUEA 5EX0A 3FDHA 3DSTA 1U2VG 4BT9A 3MGBA 3SI5A 4G23A 4NRHB 3S7BA 4N39A 3KSLA 2XS8A 3NBNB 3JQ0A 4MRUA 2IO3C 3NOCD 3CVVA 2AXZA 1HX8A 3E33A 3MKQA 1KPSB 2Y4UA 5ENNA 4HB5A 5KBAA 3ZXPA 4GCNA 4PS7A 4HFGA 4EPZA 1H2UA 4GCOA 1V55E 2WXOA 2XZTG 1WG0A 4GTQA 3L9TA 4B8CB 2A5UA 2WXPA 3APFA 3G2SA 1Y6IA 2PM6A 2KCKA 3AG3E 1KLXA 4ANUA 5FQ4A 2RKKA 2H6HA 4FA6A 4ZFHA 5T3RA 3JYSA 1SW6A 3B7UX 4L2YA 3L54A 5B1BE 2WXNA 3AS5A 3DSUA 4LCTA 3APDA 1JUQA 2CHZA 3SNXA 2RG8A 4ANWA 3MV2B 4ACKA 5KNGA 2XCBA 3C3QA 4FLHA 3ML8A 1E7UA 2H6IA 4FJYA 3PUKA 1E8XA 3QB2A 4RG9A 4FJZA 5HKPA 3HXEA 1KZOA 4G1TA 5KNHD 2ETBA 4G8LA 4GYWA 5FZSA 3NZSA 4UWHA 5BW8C 1OXJA 1N52A 2V5QC 4C0MA 2P9KG 3ZFWA 4LG6A 2Y69E 3NQPA 4I6JA 3PUJA 2C2LA 2R17C 3DSVA 3Q5MA 5JJ7A 1HZ4A 1IYGA 3AG4E 4BT8A 3LY8A 2X6KA 4KBQA 2CHWA 3RIBA 4DUIA 3CK9A 3UX4A 1E7VA 3HVEA 3UI2A 2C0MA 3KEAA 1O1TA 3V2XA 4BSXA 2DVWA 1NZNA 2YNQA 5CEDB 3DPDA 4P29A 2ONDA 5KJKA 4N2QA 1N4SA 4HS2A 1HG2A 2IQCA 3C98A 4CDMA 1H6PA 5AJLA 1O1SA 2DZNA 4UWLA 3SGHA 1BD8A 5C1DA 1GW6A 1BU9A 1QYMA 3CGHA 4PDXA 1DVPA 4G2VA 4AV7A 4Q94A 4J0UA 3FTXA 4RQIA 3LS8A 5KJNA 3EU5A 4WWOA 2DIWA 3FH5A 3ZHEB 4A1SA 2XEEA 3UKUG 4B0ZA 3NOGD 2HO1A 4I6EA 1N4RA 1DNPA 4NQ0A 3ASFA 4DLQA 3IHVA 1LTXA 3UIOC 2L6JA 3FP3A 2WQ7A 2A5EA 2P9LG 2V4HC 3LVQE 3U4TA 2EINE 5JHAA 2EIKE 2WPVA 3U64A 5AAOA 2LSUA 2FF4A 2IO2C 3ISMC 2DYRE 4LSZE 2OCCE 4HNAD 4I2ZA 2R59A 4OAUC 2PQNA 3L82A 4E6HA 4IN3B 3ASNE 4O1PA 3ESLA 5ENPD 3MCXA 5JJ6A 5FZQA 3ABKE 3RAUA 4WAFA 3QNKA 3FHEA 4NURA 5G55A 4HOUA 2J09A 4U8HA 5LP0A 3RRUA 4G25A 2WXIA 1H19A 2P9IG 2V8SE 4Q96A 3QWVA 4YDYA 5M72A 4HLLA 5EYPF 4BEPA 3EIJA 2OEVA 3ZIMA 3RO3A 2JLBA 5AIJA 4JL0A 1MX6A 4ABNA 5CCLA 4GTOA 5BUZA 4GTTA 2QY7A 3G2WA 4K03A 5AQ9A 3S7FA 4HLEA 3TL5A 5BV0A 2OVBA 1HF8A 2PM7A 5HI7A 3ABME 3K9IA 3P2BA 2J08A 1IQUA 3Q9UC 4ILGA 4GPMA 3FUDA 2MOWA 3TWWA 2DZOA 2E2EA 1PC2A 3PZ3A 2V4LA 4LERA 5G2NA 3FH7A 3PZ2A 3LJNA 4PH4B 1MHQA 3BEEA 2GRNB 3O48A 4KXKB 5FINA 3CHPA 1N11A 3IEGA 4KVMA 3FEXA 5FQ6A 4OVVA 2BF0X 1KT0A 4EECA 2WXKA 2R03A 3QWPA 4GA1A 3L17A 3AU5A 4GB9A 3FU6A 4RG6A 3L13A 5CERB 3LDZA 3EHRA 1EF1C 1MJ0A 3CIAA 4ACLA 4XEIG 4UQZA 3IBEA 3TWRA 3ZXSA 4GU5A 1TJFA 1ELWA 2KZTB 3T8MA 4GA0A 5ITZF 1FVHA 3PEUB 4DX6D 3FTVA 3R9MA 1IXVA 4CT4A 5ENTD 2VGXB 3SZ7A 2VTBA 2E0IA 2IU1A 4WUYA 4BX9A 2OEWA 2LXLA 4AXHA 2F8XK 3KD7A 3ONLA 1QBQA 4BY6A 4WWNA 4NACA 4RLYA 1OT8A 1XGWA 4QQIA 4JC8A 5D66A 4UWFA 5A6CA 3IXEA 4EQFA 3C5RA 2KBXA 4J8YA 4A55A 2WXRA 2OV8A 4I9EA 4DRXE 4GTMA 3BG1B 3U3WA 3VTXA 3HVEB 1OWOA 1LD8A 4E85A 3VLEA 4EHMA 4WNDA 2L9BA 3HXBA 3B7TA 3CR3A 4HRMB 4CT0A 2LSVA 2WM9A 4HBDA 3CVNA 4TV3A 3ZW3A 3ULEG 3URZA 2VSYA 1V54E 2R5SA 1N0QA 4FHKA 4G24A 1MX2A 4TUUA 1XNFA 5BT1A 2XPZA 4N3AA 4JA7A 4U8VD 3FUKA 3B13A 3MV3B 5LFAA 3U66A 2NYJA 4C0EA 3SY2A 4EZKA 1H6OA 4GTPA 3TXMA 1D8DA 4AVXA 2FULA 4HVBA 3HXFA 5ANRA 4PUCA 4ILIA 2IF4A 3DXMG 3SBSA 4F53A 1OUVA 5T4YA 4A63B 1NA0A 2KC7A 3I4GA 1OWLA 4DX7D 3FEYA 4PS8A 2JABA 1L5JA 3ZU7B 2I1KA 4KZ0A 4I1MA 5FTPA 5JMND 3LXUX 3OTNA 1N0RA 2P9SG 1TNBA 4I6GA 2XEVA 3Q47B 5BV1A 1WDYA 2LAHA 1HU3A 4BSZB 4C48B 2KCVA 4RVBA 4GTRA 1OWMA 1BLXB 1NL4A 5E76A 4HXIA 3EJNA 5CRVA 2XPYA 3UPVA 2F37A 2PZIA 2X3MA 3TWQA 3VLFA 2CFZA 1MQSA 1NA3A 3T5VA 3IKOB 3UXGA 4OVUA 3D9MA 3ZN3A 3CHRA 3PZDA 3QOUA 3VTYA 4BETA 4WNGA 2F8YA 4WNEA 1UW4B 3GZ2A 4U7EB 4W9RA 3CVWA 3ASHA 4GMRA 4F7AA 1H6KA 1Q2ZA 1E8WA 3Q9NC 1SZAA 1NFIE 3LVRE 3CVQA 4URKA 5CBNA 1HO8A 5AYWD 3PZ1A 2J9QA 4IRUA 4DI4A 1INZA 5G04C 4I1OB 3ZVVA 2I6HA 4JVSA 3B95A 3Q15A 3JCKC 3RKVA 3HDXA 5FQ7A 3I3NA 1UOHA 5H7PA 4K0RA 3TGOA 3D9JA 5D0OD 1D9SA 2XHEA 4GZCA 4EBAA 4RSYA 5EYLA 4F6RD 3DSXA 3QK0A 1K8KG 4JA9A 2CG2A 1OWPA 3B7BA 1YA0A 1HXIA 3CHMA 2WXLA 1H2TC 4XIFA 4DX2A 4GZ5A 3QAQA 3UM3A 4ANVA 1K3ZD 4DX5D 5FQ8A 3S7JA 4YNDA 5CEAA 1JWGA 2ETAA 5A23A 1W3BA 5G04J 2L6BA 4N3BA 1S70B 4GZ3A 3GW4A 4GMLA 3TWVA 1HG5A 3JQ1A 1UN9A 3UT4A 4MBGA 1ZU2A 2P58C 1TJCA 1FT1A 4L23A 2XGMA 1U3CA 2DCPA 3L6AA 4LUNU 3CVYA 4Z68A 3PH0C 3FUNA 5KJLA 4L9PA 4BFRA 3TG4A 1S0PA 5AQAA 4HOTA 2ZGDA 4DLOA 2EQXA 1WM5A 2P9UG 2EIME 3C3RA 3LCAA 3ZYMA 4I17A 2OVFA 3MYVA 3TWSA 4CDRA 2QFCA 2LUHA 4I9CA 1IKND 3QKYA 3DEPA 3SFXA 5JA4D 1PY1A 4CDNA 1X81A 1HH8A 5D0QD 1SQMA 3SO8A 1X5BA 3ULQA 4NIKA 2UY1B 2XRZA 4HRLA 1S63A 2NC9A 4DPRA 4X8QA 3ESKA 3L08A 4AY6A 1NP7A 3AS4A 5G05C 4H7YA 1Y8MA 3CKBA 3SQVA 5EIBE 4GAAA 4N5CA 1B89A 5D2MC 5EIDA 3TWTA 3PE4A 3EU9A 2L0IA 4FULA 2XZDG 3UT7A 3ASDA 1WAO1 4LNBA 4TUMA 3CHOA 1DC2A 2IY0C 5IY5E 2AXVA 1FCHA 4LRZA 4HI9A 2BTDA 2J8SD 4L2LA 4M7CA 5BPPA 1AWCB 2MYOA 3E4BA 4U8YD 2UWJG 1N9AA 3CQCB 3D3MA 1OY3D 3HIZA 1DCEA 1ELRA 5BXUA 3E32A 3MKQB 4UQXA 5G05J 2BUGA 4AIFA 4H7XA 2WQ6A 3BG0B 4BWRA 2GRMA 4J7WA 2XGSA 4FHJA 3LKUA 3UQ3A 1A17A 4G8KA 4BESA 3D9KA 4BERA 4U04A 2A4ZA 4Y6WA 4WNFA 2KCLA 3PEVB 3QC1A 3PVLA 3PNLB 1QQEA 2HM8A 3HYMB 2CFUA 1TNYA 4UUCA 2VSXE 4N2SA 2F0YA 4L1BA 3G2TA 1AP7A 4LNGA 1N95A 3I5PA 3AU4A 4QFVA 3HRAA 1FPPA 1E8YA 3SF4A 1Z3XA 3RK6A 4HOQA 4XZ4A 3TXNA 4FU3A 3ULYA 2J4BA 3UTMA 1DCQA 5LOZA 2KATA 2GRPB 3CQGB 1BI8B 3EHMA 4GTVA 2J49A 4ILHB 3Q49B 2GW1A 1N54A 3EDTB 4KYOB 5J90A 1VDYA 3AS8A 2IONA 1O1RA 3FY4A 4ANXA 4U96D 1OCCE 3ABLE 3S2AA 3Q4AB 3CV0A 2I1JA 3PE3A 3WG7E 2WQHA 4Y6CA 5EX3A 2GROB 2GRLA 3FWVA 5DIZA 1N4QA 4CGVA 2XS1A 2I2OA 3DEOA 4BX8A 4J6IA 4KVOA 3V2OA 2J4DA 4BTAA 2FO1E 2B0OE 5CECB 1A5EA 4U0SA 3W9GA 3DPYA 3D9IA 3HG0D 2WXFA 2FBNA 3FUFA 3RRMB 2KM4A 2EILE 3WXXA 3CSFA 3LYAA 4I2WA 3FTUA 5BNWA 2IOLA 2DWZA 4XI9A 2XENA 4GPKA 2YQ8A 1EDUA 3KS2A 3T8KA 3Q7AA 3QJZA 2PQRA 1EYHA 1Z3YA 1O5MA 3ZEFA 5AQBA 3ZHEA 3FH8A 4TXQA 3JXIA 4U0ZA 4LNUD 4R7LA 4Q69A 3FUHA 3B7RL 4MLPA 5EN5D 4B8AA 3OXFA 1N4PA 2Y4TA 3LY9A 3Q73A 3ASGA 5JJTA 5AJDA 3CVXA 3AG1E 3E30A 2BEDA 1IHGA 4V3IA 1JCRA 1OCOE 3ML9A 1MYOA 2GRRB 3ONKA 3UM0A 5JHBA 4JEUA 4M3OA 3MEKA 3LPZA 3E37A 5ANLA 4EZLA 2RFMA 2AW6A 3E34A 1ZBPA 4TXRA 5CBOA 1LF8A 3MZLB 3DSWA 3MX3A 5DBKA 4U0UA 4O1OA 4JW1A 3FU0A 2WXMA 4CEMA 2AJAA 3PZ4A 4PS3A 5FZRA 3UT8A 4J8EA 1E90A 2QZAA 5E75A 3ZGQA 1MZCA 3SD5A 2WMOA 1H0AA 2R05A 4KMOA 4F1PA 3JUEA 1TN6A 1HFAA 3MJWA 4D10C 4YVOA 3GZ1A 3O4ZA 3EHNA 5CCMA 2VJ8A 4JD2G 2Y3AA 2X6FA 2IOSA 4HQDA 2FI7A 3OAWA 5ARFA 3ZRHA 5B3SE 1UN8A 3LJ3A 1SVXA 2GGFA 3Q75A 4CZ2D 2CG3A 3ZPJA 1KT1A 2FEZA 4FADA 3CVLA 1Z5SC 2YHEA 1UJKA 5AENA 4YDOA 3PREA 2C0LA 4FP7A 1E96B 3V30A 4U07A 3RO2A 2VYIA 1BI7B 2ILRA 5FIOA 3SFZA 5FWQA 1Z6TA 3D9LA 5KCMA 4CRWA 2V5FA 3F6QA 1EPUA 2R2LA 1TNZA 1PAQA 3GYZA 3AG2E 4AM9A 3VLDA 2JEKA 3FTYA 2XQ0A 5HS0A 4K5AB 2LAIA 1MX4A 3LEWA 3P1UA 3ZYKA 1ELKA 1ZB1A 3CEQA 3B7SA 3D9HA 3UUXA 3D9OA 2KZTA 2LXMA 2CHXA 3RJVA 2HR2A 4U63A 3L22A 4GZDA 1H2VC 4U95D 3FU5A 4GTSA 2XGOA 5EILA 3N71A 4UI9C 5CHEE 3CVUA 2VGXA 2Y0BG 4CYMD 3KAEA 4ZHBA 1RZ4A 3FFLA 3U9WA 1D8EA 3X2QE 5CRUA 1TR4A 4K5CA 4GYOA 3UINC 3IHYA 2IJGX 1YMPA 4AY5A 2RFAA 2WXQA 2XRYA 1G3NB 4XKBA 3BUAA 4GA2A 3NB2A 3HXCA 3CSTA 5B1AE 3KSQA 1TYQG 3J5PA 5ENOD 3SFYA 2M63A 5EKQD 3W9FA 2VTBB 1UG3A 3PRZA 4EBAG 4TXPA 2EIJE 3BU8A 4HI8A 2H6GA 1BPOA 4GZ6A 4UI9J 4KZCA 2XCCA 2IEJA 4DX1A 3Q7FA 3ZYLA 2P9PG 3V79K 3MA5A 4MS6A 1IHBA 3G2UA 3FTSA 4YDWA 2BKGA 1RW2A 4J8FA 4UWGA 2X6IA 4DJAA 4J8DA 3EUVA 5CMYA 1TN8A 3S7DA 4O60A 3DBSA 5ENRD 5KJMA 2L0TB 3FUIA 5KWDA 3CHQA 3QDNA 4MKTA 5BXOA 1K1BA 4ME2A 3FTZA 4XX5A 3ZYQA 4XE0A 4YVQC 5C2YA 2VQ2A 5ARGA 3TWUA 1JCQA 4EZJA 1KZPA 3HXDA 3JXJA 4WWPA 2H6FA 4XI0A 4CCAA 5AARA 3CLJA 3DSSA 4JHKA 4JPSA 4JZYA 3NF1A 4N5QA 2QYJA 3CHSA 2NSZA 4IULA 5T8IA 3C3OA 3ZKJA 3EIQC 3DRAA 3Q79A 4GMJA 3CKCA 5FT9A 3TAXA 1LD7A 2VGYA 3ENEA 5A7DB 3R9AB 2GRQB 2X6JA 3J5QB 2ZIRA 3ASOE 3GZSA 2MRIA 4AP2A 2IFUA 2I9CA 2XEHA 2X38A 4UQYA 3PNTB 4G26A 3UKRG 3I4RB 4OYSA 3T9KA 4JB8P 3FTWA 1TNOA 4YDEA 2DBAA 3FUJA 3LY7A 3SHFA 2HE0A 2DYSE 3CVPA 2ZU6B 1FT2A 4IYPA 1IQRA 2WB2A 1K1AA 3TG5A 5HRYA 2FO7A 4JXTA 4DK5A 1QZ2A 3ZUVB 3OXLA 1S64A 2KXPC 3OXGA 4I43A 4HOSA 1SA4A 3RU0A 2ZISA 4G11A 4JEHA 4AJWA 4FLBA 4ATZD 3APCA 4KT6B 3RSEG 4F3VA 1SZ9A 4HORA 4GYYA 1UJJA 2NXPA 3V31A 2ETCA 4HRNA 3R7QA 3L16A 4J8SA 5J08A 2R02A 3AJIA 2ZXWE 3G2VA 2HYZA 4BTBA 4DI3A 4B93B 1JCSA 2V0PA 1NI1A 4A3TA 3TWXA 3EHQA 3NZUA 4C9BB 2QC9A 2WXHA 3MKRA 2QYUA 4OAVB 4CGWA 3AAAC 3HHMA 2Q7FA 1U3DA 4UWKA 2J07A 2PL2A 3IV0A 3PDNA 5LCWC 5ENQD 3UMVA 4B94A 1SA5A 4A1GA 3QARA 2XPIA
chains in the Genus database with same CATH topology
2LXLA 2LUHA 4U7EB 5H7PA 2RKKA 4TXQA 4TXPA 4TXRA 2LXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXL A;  2LUH A;  4U7E B;  5H7P A;  2RKK A;  4TXQ A;  4TXP A;  4TXR A;  2LXM A; 
#chains in the Genus database with same CATH topology
 1QNF A;  1JWF A;  2VSO E;  5EDS A;  1YCS B;  1N94 A;  2BKK B;  2OOE A;  3TJP A;  1TEZ A;  3UM2 A;  3FU3 A;  3R7R A;  3NAW A;  3D9N A;  3RRN B;  2LO6 A;  2AXU A;  1HE8 A;  1TNU A;  4AEZ C;  1YYH A;  2PNN A;  3C72 A;  5FJY A;  5AN8 A;  2YHC A;  3FUM A;  4JHJ A;  2P9N G;  5HQ8 A;  4N3C A;  4TRQ A;  5ENS D;  5LX8 A;  4K5B A;  3Q78 A;  3T5X A;  3D9P A;  1WY6 A;  2Y1L E;  4AOF A;  2VSN A;  1E8Z A;  3QWW A;  2RD0 A;  3KEZ A;  3FUL A;  3CK8 A;  3BQO A;  4APO A;  2WVI A;  4APF A;  5LCW J;  2UY1 A;  2WXJ A;  4O6F A;  2WXG A;  1HS6 A;  5AQ7 A;  3DWL G;  4F1S A;  4JHR A;  2LNI A;  2YIN A;  3ZNG A;  4ATG A;  1OCZ E;  2B6C A;  1OWN A;  5CMW A;  2P2C P;  2ZGG A;  2WMN A;  3UIP C;  4I1A A;  3PS6 A;  1OCR E;  1FVF A;  3JUI A;  1P5Q A;  4LEU A;  3SBT B;  4FC8 A;  3UM1 A;  1JPL A;  4XKC A;  2AWI A;  3CK7 A;  4A3V A;  3DXK G;  2MHK A;  4L7T A;  4B89 A;  2AVP A;  2VGE A;  2X6H A;  4UI9 K;  1TN7 A;  3FUE A;  5EX0 A;  3FDH A;  3DST A;  1U2V G;  4BT9 A;  3MGB A;  3SI5 A;  4G23 A;  4NRH B;  3S7B A;  4N39 A;  3KSL A;  2XS8 A;  3NBN B;  3JQ0 A;  4MRU A;  2IO3 C;  3NOC D;  3CVV A;  2AXZ A;  1HX8 A;  3E33 A;  3MKQ A;  1KPS B;  2Y4U A;  5ENN A;  4HB5 A;  5KBA A;  3ZXP A;  4GCN A;  4PS7 A;  4HFG A;  4EPZ A;  1H2U A;  4GCO A;  1V55 E;  2WXO A;  2XZT G;  1WG0 A;  4GTQ A;  3L9T A;  4B8C B;  2A5U A;  2WXP A;  3APF A;  3G2S A;  1Y6I A;  2PM6 A;  2KCK A;  3AG3 E;  1KLX A;  4ANU A;  5FQ4 A;  2RKK A;  2H6H A;  4FA6 A;  4ZFH A;  5T3R A;  3JYS A;  1SW6 A;  3B7U X;  4L2Y A;  3L54 A;  5B1B E;  2WXN A;  3AS5 A;  3DSU A;  4LCT A;  3APD A;  1JUQ A;  2CHZ A;  3SNX A;  2RG8 A;  4ANW A;  3MV2 B;  4ACK A;  5KNG A;  2XCB A;  3C3Q A;  4FLH A;  3ML8 A;  1E7U A;  2H6I A;  4FJY A;  3PUK A;  1E8X A;  3QB2 A;  4RG9 A;  4FJZ A;  5HKP A;  3HXE A;  1KZO A;  4G1T A;  5KNH D;  2ETB A;  4G8L A;  4GYW A;  5FZS A;  3NZS A;  4UWH A;  5BW8 C;  1OXJ A;  1N52 A;  2V5Q C;  4C0M A;  2P9K G;  3ZFW A;  4LG6 A;  2Y69 E;  3NQP A;  4I6J A;  3PUJ A;  2C2L A;  2R17 C;  3DSV A;  3Q5M A;  5JJ7 A;  1HZ4 A;  1IYG A;  3AG4 E;  4BT8 A;  3LY8 A;  2X6K A;  4KBQ A;  2CHW A;  3RIB A;  4DUI A;  3CK9 A;  3UX4 A;  1E7V A;  3HVE A;  3UI2 A;  2C0M A;  3KEA A;  1O1T A;  3V2X A;  4BSX A;  2DVW A;  1NZN A;  2YNQ A;  5CED B;  3DPD A;  4P29 A;  2OND A;  5KJK A;  4N2Q A;  1N4S A;  4HS2 A;  1HG2 A;  2IQC A;  3C98 A;  4CDM A;  1H6P A;  5AJL A;  1O1S A;  2DZN A;  4UWL A;  3SGH A;  1BD8 A;  5C1D A;  1GW6 A;  1BU9 A;  1QYM A;  3CGH A;  4PDX A;  1DVP A;  4G2V A;  4AV7 A;  4Q94 A;  4J0U A;  3FTX A;  4RQI A;  3LS8 A;  5KJN A;  3EU5 A;  4WWO A;  2DIW A;  3FH5 A;  3ZHE B;  4A1S A;  2XEE A;  3UKU G;  4B0Z A;  3NOG D;  2HO1 A;  4I6E A;  1N4R A;  1DNP A;  4NQ0 A;  3ASF A;  4DLQ A;  3IHV A;  1LTX A;  3UIO C;  2L6J A;  3FP3 A;  2WQ7 A;  2A5E A;  2P9L G;  2V4H C;  3LVQ E;  3U4T A;  2EIN E;  5JHA A;  2EIK E;  2WPV A;  3U64 A;  5AAO A;  2LSU A;  2FF4 A;  2IO2 C;  3ISM C;  2DYR E;  4LSZ E;  2OCC E;  4HNA D;  4I2Z A;  2R59 A;  4OAU C;  2PQN A;  3L82 A;  4E6H A;  4IN3 B;  3ASN E;  4O1P A;  3ESL A;  5ENP D;  3MCX A;  5JJ6 A;  5FZQ A;  3ABK E;  3RAU A;  4WAF A;  3QNK A;  3FHE A;  4NUR A;  5G55 A;  4HOU A;  2J09 A;  4U8H A;  5LP0 A;  3RRU A;  4G25 A;  2WXI A;  1H19 A;  2P9I G;  2V8S E;  4Q96 A;  3QWV A;  4YDY A;  5M72 A;  4HLL A;  5EYP F;  4BEP A;  3EIJ A;  2OEV A;  3ZIM A;  3RO3 A;  2JLB A;  5AIJ A;  4JL0 A;  1MX6 A;  4ABN A;  5CCL A;  4GTO A;  5BUZ A;  4GTT A;  2QY7 A;  3G2W A;  4K03 A;  5AQ9 A;  3S7F A;  4HLE A;  3TL5 A;  5BV0 A;  2OVB A;  1HF8 A;  2PM7 A;  5HI7 A;  3ABM E;  3K9I A;  3P2B A;  2J08 A;  1IQU A;  3Q9U C;  4ILG A;  4GPM A;  3FUD A;  2MOW A;  3TWW A;  2DZO A;  2E2E A;  1PC2 A;  3PZ3 A;  2V4L A;  4LER A;  5G2N A;  3FH7 A;  3PZ2 A;  3LJN A;  4PH4 B;  1MHQ A;  3BEE A;  2GRN B;  3O48 A;  4KXK B;  5FIN A;  3CHP A;  1N11 A;  3IEG A;  4KVM A;  3FEX A;  5FQ6 A;  4OVV A;  2BF0 X;  1KT0 A;  4EEC A;  2WXK A;  2R03 A;  3QWP A;  4GA1 A;  3L17 A;  3AU5 A;  4GB9 A;  3FU6 A;  4RG6 A;  3L13 A;  5CER B;  3LDZ A;  3EHR A;  1EF1 C;  1MJ0 A;  3CIA A;  4ACL A;  4XEI G;  4UQZ A;  3IBE A;  3TWR A;  3ZXS A;  4GU5 A;  1TJF A;  1ELW A;  2KZT B;  3T8M A;  4GA0 A;  5ITZ F;  1FVH A;  3PEU B;  4DX6 D;  3FTV A;  3R9M A;  1IXV A;  4CT4 A;  5ENT D;  2VGX B;  3SZ7 A;  2VTB A;  2E0I A;  2IU1 A;  4WUY A;  4BX9 A;  2OEW A;  2LXL A;  4AXH A;  2F8X K;  3KD7 A;  3ONL A;  1QBQ A;  4BY6 A;  4WWN A;  4NAC A;  4RLY A;  1OT8 A;  1XGW A;  4QQI A;  4JC8 A;  5D66 A;  4UWF A;  5A6C A;  3IXE A;  4EQF A;  3C5R A;  2KBX A;  4J8Y A;  4A55 A;  2WXR A;  2OV8 A;  4I9E A;  4DRX E;  4GTM A;  3BG1 B;  3U3W A;  3VTX A;  3HVE B;  1OWO A;  1LD8 A;  4E85 A;  3VLE A;  4EHM A;  4WND A;  2L9B A;  3HXB A;  3B7T A;  3CR3 A;  4HRM B;  4CT0 A;  2LSV A;  2WM9 A;  4HBD A;  3CVN A;  4TV3 A;  3ZW3 A;  3ULE G;  3URZ A;  2VSY A;  1V54 E;  2R5S A;  1N0Q A;  4FHK A;  4G24 A;  1MX2 A;  4TUU A;  1XNF A;  5BT1 A;  2XPZ A;  4N3A A;  4JA7 A;  4U8V D;  3FUK A;  3B13 A;  3MV3 B;  5LFA A;  3U66 A;  2NYJ A;  4C0E A;  3SY2 A;  4EZK A;  1H6O A;  4GTP A;  3TXM A;  1D8D A;  4AVX A;  2FUL A;  4HVB A;  3HXF A;  5ANR A;  4PUC A;  4ILI A;  2IF4 A;  3DXM G;  3SBS A;  4F53 A;  1OUV A;  5T4Y A;  4A63 B;  1NA0 A;  2KC7 A;  3I4G A;  1OWL A;  4DX7 D;  3FEY A;  4PS8 A;  2JAB A;  1L5J A;  3ZU7 B;  2I1K A;  4KZ0 A;  4I1M A;  5FTP A;  5JMN D;  3LXU X;  3OTN A;  1N0R A;  2P9S G;  1TNB A;  4I6G A;  2XEV A;  3Q47 B;  5BV1 A;  1WDY A;  2LAH A;  1HU3 A;  4BSZ B;  4C48 B;  2KCV A;  4RVB A;  4GTR A;  1OWM A;  1BLX B;  1NL4 A;  5E76 A;  4HXI A;  3EJN A;  5CRV A;  2XPY A;  3UPV A;  2F37 A;  2PZI A;  2X3M A;  3TWQ A;  3VLF A;  2CFZ A;  1MQS A;  1NA3 A;  3T5V A;  3IKO B;  3UXG A;  4OVU A;  3D9M A;  3ZN3 A;  3CHR A;  3PZD A;  3QOU A;  3VTY A;  4BET A;  4WNG A;  2F8Y A;  4WNE A;  1UW4 B;  3GZ2 A;  4U7E B;  4W9R A;  3CVW A;  3ASH A;  4GMR A;  4F7A A;  1H6K A;  1Q2Z A;  1E8W A;  3Q9N C;  1SZA A;  1NFI E;  3LVR E;  3CVQ A;  4URK A;  5CBN A;  1HO8 A;  5AYW D;  3PZ1 A;  2J9Q A;  4IRU A;  4DI4 A;  1INZ A;  5G04 C;  4I1O B;  3ZVV A;  2I6H A;  4JVS A;  3B95 A;  3Q15 A;  3JCK C;  3RKV A;  3HDX A;  5FQ7 A;  3I3N A;  1UOH A;  5H7P A;  4K0R A;  3TGO A;  3D9J A;  5D0O D;  1D9S A;  2XHE A;  4GZC A;  4EBA A;  4RSY A;  5EYL A;  4F6R D;  3DSX A;  3QK0 A;  1K8K G;  4JA9 A;  2CG2 A;  1OWP A;  3B7B A;  1YA0 A;  1HXI A;  3CHM A;  2WXL A;  1H2T C;  4XIF A;  4DX2 A;  4GZ5 A;  3QAQ A;  3UM3 A;  4ANV A;  1K3Z D;  4DX5 D;  5FQ8 A;  3S7J A;  4YND A;  5CEA A;  1JWG A;  2ETA A;  5A23 A;  1W3B A;  5G04 J;  2L6B A;  4N3B A;  1S70 B;  4GZ3 A;  3GW4 A;  4GML A;  3TWV A;  1HG5 A;  3JQ1 A;  1UN9 A;  3UT4 A;  4MBG A;  1ZU2 A;  2P58 C;  1TJC A;  1FT1 A;  4L23 A;  2XGM A;  1U3C A;  2DCP A;  3L6A A;  4LUN U;  3CVY A;  4Z68 A;  3PH0 C;  3FUN A;  5KJL A;  4L9P A;  4BFR A;  3TG4 A;  1S0P A;  5AQA A;  4HOT A;  2ZGD A;  4DLO A;  2EQX A;  1WM5 A;  2P9U G;  2EIM E;  3C3R A;  3LCA A;  3ZYM A;  4I17 A;  2OVF A;  3MYV A;  3TWS A;  4CDR A;  2QFC A;  2LUH A;  4I9C A;  1IKN D;  3QKY A;  3DEP A;  3SFX A;  5JA4 D;  1PY1 A;  4CDN A;  1X81 A;  1HH8 A;  5D0Q D;  1SQM A;  3SO8 A;  1X5B A;  3ULQ A;  4NIK A;  2UY1 B;  2XRZ A;  4HRL A;  1S63 A;  2NC9 A;  4DPR A;  4X8Q A;  3ESK A;  3L08 A;  4AY6 A;  1NP7 A;  3AS4 A;  5G05 C;  4H7Y A;  1Y8M A;  3CKB A;  3SQV A;  5EIB E;  4GAA A;  4N5C A;  1B89 A;  5D2M C;  5EID A;  3TWT A;  3PE4 A;  3EU9 A;  2L0I A;  4FUL A;  2XZD G;  3UT7 A;  3ASD A;  1WAO 1;  4LNB A;  4TUM A;  3CHO A;  1DC2 A;  2IY0 C;  5IY5 E;  2AXV A;  1FCH A;  4LRZ A;  4HI9 A;  2BTD A;  2J8S D;  4L2L A;  4M7C A;  5BPP A;  1AWC B;  2MYO A;  3E4B A;  4U8Y D;  2UWJ G;  1N9A A;  3CQC B;  3D3M A;  1OY3 D;  3HIZ A;  1DCE A;  1ELR A;  5BXU A;  3E32 A;  3MKQ B;  4UQX A;  5G05 J;  2BUG A;  4AIF A;  4H7X A;  2WQ6 A;  3BG0 B;  4BWR A;  2GRM A;  4J7W A;  2XGS A;  4FHJ A;  3LKU A;  3UQ3 A;  1A17 A;  4G8K A;  4BES A;  3D9K A;  4BER A;  4U04 A;  2A4Z A;  4Y6W A;  4WNF A;  2KCL A;  3PEV B;  3QC1 A;  3PVL A;  3PNL B;  1QQE A;  2HM8 A;  3HYM B;  2CFU A;  1TNY A;  4UUC A;  2VSX E;  4N2S A;  2F0Y A;  4L1B A;  3G2T A;  1AP7 A;  4LNG A;  1N95 A;  3I5P A;  3AU4 A;  4QFV A;  3HRA A;  1FPP A;  1E8Y A;  3SF4 A;  1Z3X A;  3RK6 A;  4HOQ A;  4XZ4 A;  3TXN A;  4FU3 A;  3ULY A;  2J4B A;  3UTM A;  1DCQ A;  5LOZ A;  2KAT A;  2GRP B;  3CQG B;  1BI8 B;  3EHM A;  4GTV A;  2J49 A;  4ILH B;  3Q49 B;  2GW1 A;  1N54 A;  3EDT B;  4KYO B;  5J90 A;  1VDY A;  3AS8 A;  2ION A;  1O1R A;  3FY4 A;  4ANX A;  4U96 D;  1OCC E;  3ABL E;  3S2A A;  3Q4A B;  3CV0 A;  2I1J A;  3PE3 A;  3WG7 E;  2WQH A;  4Y6C A;  5EX3 A;  2GRO B;  2GRL A;  3FWV A;  5DIZ A;  1N4Q A;  4CGV A;  2XS1 A;  2I2O A;  3DEO A;  4BX8 A;  4J6I A;  4KVO A;  3V2O A;  2J4D A;  4BTA A;  2FO1 E;  2B0O E;  5CEC B;  1A5E A;  4U0S A;  3W9G A;  3DPY A;  3D9I A;  3HG0 D;  2WXF A;  2FBN A;  3FUF A;  3RRM B;  2KM4 A;  2EIL E;  3WXX A;  3CSF A;  3LYA A;  4I2W A;  3FTU A;  5BNW A;  2IOL A;  2DWZ A;  4XI9 A;  2XEN A;  4GPK A;  2YQ8 A;  1EDU A;  3KS2 A;  3T8K A;  3Q7A A;  3QJZ A;  2PQR A;  1EYH A;  1Z3Y A;  1O5M A;  3ZEF A;  5AQB A;  3ZHE A;  3FH8 A;  4TXQ A;  3JXI A;  4U0Z A;  4LNU D;  4R7L A;  4Q69 A;  3FUH A;  3B7R L;  4MLP A;  5EN5 D;  4B8A A;  3OXF A;  1N4P A;  2Y4T A;  3LY9 A;  3Q73 A;  3ASG A;  5JJT A;  5AJD A;  3CVX A;  3AG1 E;  3E30 A;  2BED A;  1IHG A;  4V3I A;  1JCR A;  1OCO E;  3ML9 A;  1MYO A;  2GRR B;  3ONK A;  3UM0 A;  5JHB A;  4JEU A;  4M3O A;  3MEK A;  3LPZ A;  3E37 A;  5ANL A;  4EZL A;  2RFM A;  2AW6 A;  3E34 A;  1ZBP A;  4TXR A;  5CBO A;  1LF8 A;  3MZL B;  3DSW A;  3MX3 A;  5DBK A;  4U0U A;  4O1O A;  4JW1 A;  3FU0 A;  2WXM A;  4CEM A;  2AJA A;  3PZ4 A;  4PS3 A;  5FZR A;  3UT8 A;  4J8E A;  1E90 A;  2QZA A;  5E75 A;  3ZGQ A;  1MZC A;  3SD5 A;  2WMO A;  1H0A A;  2R05 A;  4KMO A;  4F1P A;  3JUE A;  1TN6 A;  1HFA A;  3MJW A;  4D10 C;  4YVO A;  3GZ1 A;  3O4Z A;  3EHN A;  5CCM A;  2VJ8 A;  4JD2 G;  2Y3A A;  2X6F A;  2IOS A;  4HQD A;  2FI7 A;  3OAW A;  5ARF A;  3ZRH A;  5B3S E;  1UN8 A;  3LJ3 A;  1SVX A;  2GGF A;  3Q75 A;  4CZ2 D;  2CG3 A;  3ZPJ A;  1KT1 A;  2FEZ A;  4FAD A;  3CVL A;  1Z5S C;  2YHE A;  1UJK A;  5AEN A;  4YDO A;  3PRE A;  2C0L A;  4FP7 A;  1E96 B;  3V30 A;  4U07 A;  3RO2 A;  2VYI A;  1BI7 B;  2ILR A;  5FIO A;  3SFZ A;  5FWQ A;  1Z6T A;  3D9L A;  5KCM A;  4CRW A;  2V5F A;  3F6Q A;  1EPU A;  2R2L A;  1TNZ A;  1PAQ A;  3GYZ A;  3AG2 E;  4AM9 A;  3VLD A;  2JEK A;  3FTY A;  2XQ0 A;  5HS0 A;  4K5A B;  2LAI A;  1MX4 A;  3LEW A;  3P1U A;  3ZYK A;  1ELK A;  1ZB1 A;  3CEQ A;  3B7S A;  3D9H A;  3UUX A;  3D9O A;  2KZT A;  2LXM A;  2CHX A;  3RJV A;  2HR2 A;  4U63 A;  3L22 A;  4GZD A;  1H2V C;  4U95 D;  3FU5 A;  4GTS A;  2XGO A;  5EIL A;  3N71 A;  4UI9 C;  5CHE E;  3CVU A;  2VGX A;  2Y0B G;  4CYM D;  3KAE A;  4ZHB A;  1RZ4 A;  3FFL A;  3U9W A;  1D8E A;  3X2Q E;  5CRU A;  1TR4 A;  4K5C A;  4GYO A;  3UIN C;  3IHY A;  2IJG X;  1YMP A;  4AY5 A;  2RFA A;  2WXQ A;  2XRY A;  1G3N B;  4XKB A;  3BUA A;  4GA2 A;  3NB2 A;  3HXC A;  3CST A;  5B1A E;  3KSQ A;  1TYQ G;  3J5P A;  5ENO D;  3SFY A;  2M63 A;  5EKQ D;  3W9F A;  2VTB B;  1UG3 A;  3PRZ A;  4EBA G;  4TXP A;  2EIJ E;  3BU8 A;  4HI8 A;  2H6G A;  1BPO A;  4GZ6 A;  4UI9 J;  4KZC A;  2XCC A;  2IEJ A;  4DX1 A;  3Q7F A;  3ZYL A;  2P9P G;  3V79 K;  3MA5 A;  4MS6 A;  1IHB A;  3G2U A;  3FTS A;  4YDW A;  2BKG A;  1RW2 A;  4J8F A;  4UWG A;  2X6I A;  4DJA A;  4J8D A;  3EUV A;  5CMY A;  1TN8 A;  3S7D A;  4O60 A;  3DBS A;  5ENR D;  5KJM A;  2L0T B;  3FUI A;  5KWD A;  3CHQ A;  3QDN A;  4MKT A;  5BXO A;  1K1B A;  4ME2 A;  3FTZ A;  4XX5 A;  3ZYQ A;  4XE0 A;  4YVQ C;  5C2Y A;  2VQ2 A;  5ARG A;  3TWU A;  1JCQ A;  4EZJ A;  1KZP A;  3HXD A;  3JXJ A;  4WWP A;  2H6F A;  4XI0 A;  4CCA A;  5AAR A;  3CLJ A;  3DSS A;  4JHK A;  4JPS A;  4JZY A;  3NF1 A;  4N5Q A;  2QYJ A;  3CHS A;  2NSZ A;  4IUL A;  5T8I A;  3C3O A;  3ZKJ A;  3EIQ C;  3DRA A;  3Q79 A;  4GMJ A;  3CKC A;  5FT9 A;  3TAX A;  1LD7 A;  2VGY A;  3ENE A;  5A7D B;  3R9A B;  2GRQ B;  2X6J A;  3J5Q B;  2ZIR A;  3ASO E;  3GZS A;  2MRI A;  4AP2 A;  2IFU A;  2I9C A;  2XEH A;  2X38 A;  4UQY A;  3PNT B;  4G26 A;  3UKR G;  3I4R B;  4OYS A;  3T9K A;  4JB8 P;  3FTW A;  1TNO A;  4YDE A;  2DBA A;  3FUJ A;  3LY7 A;  3SHF A;  2HE0 A;  2DYS E;  3CVP A;  2ZU6 B;  1FT2 A;  4IYP A;  1IQR A;  2WB2 A;  1K1A A;  3TG5 A;  5HRY A;  2FO7 A;  4JXT A;  4DK5 A;  1QZ2 A;  3ZUV B;  3OXL A;  1S64 A;  2KXP C;  3OXG A;  4I43 A;  4HOS A;  1SA4 A;  3RU0 A;  2ZIS A;  4G11 A;  4JEH A;  4AJW A;  4FLB A;  4ATZ D;  3APC A;  4KT6 B;  3RSE G;  4F3V A;  1SZ9 A;  4HOR A;  4GYY A;  1UJJ A;  2NXP A;  3V31 A;  2ETC A;  4HRN A;  3R7Q A;  3L16 A;  4J8S A;  5J08 A;  2R02 A;  3AJI A;  2ZXW E;  3G2V A;  2HYZ A;  4BTB A;  4DI3 A;  4B93 B;  1JCS A;  2V0P A;  1NI1 A;  4A3T A;  3TWX A;  3EHQ A;  3NZU A;  4C9B B;  2QC9 A;  2WXH A;  3MKR A;  2QYU A;  4OAV B;  4CGW A;  3AAA C;  3HHM A;  2Q7F A;  1U3D A;  4UWK A;  2J07 A;  2PL2 A;  3IV0 A;  3PDN A;  5LCW C;  5ENQ D;  3UMV A;  4B94 A;  1SA5 A;  4A1G A;  3QAR A;  2XPI A; 
#chains in the Genus database with same CATH homology
 2LXL A;  2LUH A;  4U7E B;  5H7P A;  2RKK A;  4TXQ A;  4TXP A;  4TXR A;  2LXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...