4TXRA

Crystal structure of lip5 n-terminal domain complexed with chmp1b mim and chmp5 mim
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
159
structure length
158
Chain Sequence
LAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Charged multivesicular body protein 1b
publication title A Novel Mechanism of Regulating the ATPase VPS4 by Its Cofactor LIP5 and the Endosomal Sorting Complex Required for Transport (ESCRT)-III Protein CHMP5.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 158
sequence length 159
ec nomenclature
pdb deposition date 2014-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 4txrA00
2LXLA 4TXPA 2LUHA 5H7PA 4TXQA 4U7EB 4TXRA 2RKKA 2LXMA
chains in the Genus database with same CATH superfamily
4FP7A 5FQ7A 2FO1E 2I2OA 3G2SA 3RO3A 3CHQA 1OCZE 4ANUA 3QB2A 1OY3D 3B7RL 3MGBA 4KYOB 3FULA 4DLQA 2C2LA 3UMVA 3DPYA 5FWQA 4ANXA 1NFIE 1OWLA 4OAUC 3VLEA 4DX6D 3T9KA 1OUVA 3HXFA 3JXIA 3SQVA 3Q79A 4LSZE 3UXGA 2JLBA 1BU9A 2WXNA 1UW4B 5BXOA 3W9FA 3C3RA 4FHJA 2VGYA 3SBTB 3FH7A 1OWNA 5KBAA 5BXUA 1S63A 5CERB 3ESLA 2V8SE 3R9MA 4C9BB 3SFZA 5HKPA 1NI1A 1K3ZD 3E30A 5J90A 3CVLA 4I1MA 4N5CA 3DEOA 4E6HA 4GPKA 4XI0A 1HFAA 5IY5E 4CRWA 4K03A 1FT1A 2EINE 3FTWA 1A5EA 2ILRA 3NF1A 3KAEA 1N0QA 4B8CB 2XS1A 3CHSA 4DI3A 1TYQG 2I1JA 5C2YA 4Q94A 2KCLA 3DPDA 5EYPF 3I3NA 5E75A 2LSUA 2WXRA 1MX2A 5CCMA 1UN8A 3Q49B 3DXKG 4GYYA 3T8KA 1SVXA 4JL0A 4I1AA 2IJGX 2XENA 2WVIA 2YINA 4J8YA 3GW4A 3G2TA 2HYZA 4U04A 3B7UX 1D8EA 3HVEB 1DNPA 1OCCE 3T8MA 2X6HA 4JB8P 3LVRE 3PUJA 3IHYA 2GRQB 4NURA 3E4BA 5ANRA 2NC9A 3V2XA 1FPPA 2QFCA 2PL2A 2BKGA 4GTRA 3ZW3A 3ZXSA 2VTBB 4AVXA 3FUJA 4NIKA 2EILE 3LDZA 3V30A 1NA3A 3RSEG 3CVWA 3L08A 4BWRA 2P9LG 4JXTA 3FHEA 4RG9A 4OVUA 3I4GA 2PQNA 3GYZA 4EZLA 2V5QC 5G04J 4CDRA 4APFA 1HE8A 4JHRA 4J7WA 3UINC 3B13A 2ZGGA 2E2EA 3CVUA 3IEGA 4LNGA 3G2WA 4HORA 2IF4A 3ZYLA 5HQ8A 4XX5A 2X3MA 2XEVA 4CZ2D 3HIZA 3UI2A 3CQCB 3K9IA 4TXQA 4TRQA 5AARA 5FZQA 3QWWA 4UQYA 1UN9A 2J4BA 1SZAA 3HYMB 2Y4TA 3PZDA 4CDMA 2H6HA 2J8SD 3QWPA 4HRLA 3B7SA 5CBNA 3BU8A 4UQXA 4A1SA 4U7EB 4F6RD 4EBAA 3SZ7A 4DPRA 3SF4A 1YYHA 1OXJA 2DZOA 3HRAA 3S7DA 3TXMA 3E37A 1TEZA 3HDXA 1DVPA 1LTXA 1KT1A 3SFYA 3SI5A 5D2MC 5BNWA 3LY7A 5KCMA 2P2CP 3RO2A 3SFXA 2H6IA 3L22A 5JMND 4C48B 2AVPA 3NOGD 1N52A 3L6AA 3SD5A 3HVEA 3QJZA 2LAIA 1H0AA 3NBNB 4XKBA 4GA1A 2ONDA 4CGVA 1ZBPA 4K0RA 1N94A 4PS3A 1O1RA 1NZNA 3AS4A 3AG3E 3VLDA 3PUKA 4Q96A 2ETCA 1Z3XA 4U63A 4G11A 2ETBA 2GRMA 2VTBA 3ZXPA 3TWSA 4HVBA 1N0RA 3FTYA 3PEUB 3QDNA 1ZU2A 2Y3AA 3AS5A 3E33A 3EIQC 3DSUA 1N95A 4AM9A 1IQRA 2XGOA 4Y6CA 2R02A 5ENTD 4AOFA 3CVVA 3MV3B 5D0QD 3OXGA 3AG2E 3L54A 3MA5A 3GZSA 4HOTA 2P9NG 5ENNA 3LJ3A 5ENSD 2XRZA 3L9TA 3UT7A 3C72A 4ACKA 3MYVA 4X8QA 2XCCA 2EIKE 1HU3A 2X6KA 3CVQA 3LS8A 2Q7FA 3EHNA 3QKYA 2IO3C 4GTTA 1AP7A 3CHOA 4F7AA 1A17A 2Y0BG 1U3CA 2M63A 1TJCA 3VLFA 3Q7FA 1EF1C 5KJKA 2BUGA 5KJNA 4GTVA 1U2VG 5LOZA 3NZUA 2GGFA 4HLEA 2MYOA 4WUYA 4J6IA 4XEIG 4F3VA 4DI4A 4IYPA 2Y69E 2EQXA 4NACA 4UQZA 2QYJA 3FUHA 2YHCA 3BG1B 1K1AA 3C5RA 4ABNA 4YVQC 5ARFA 4GTMA 3FTUA 3ZYQA 3T5VA 4M3OA 3TAXA 4FU3A 5CRVA 1E7VA 5FQ6A 1IKND 2QY7A 2VJ8A 5B1AE 2IFUA 2KXPC 2CG2A 2R17C 1DCEA 4HI9A 2XRYA 3L82A 4DUIA 2VYIA 4MS6A 3O4ZA 2NYJA 3D9JA 5DIZA 1OWPA 3FTXA 4RVBA 4P29A 2FF4A 3PEVB 3ASHA 2DIWA 4ATZD 5LCWC 4ZHBA 4GPMA 1JWFA 1IHGA 2FBNA 4UWKA 4JEHA 3SHFA 2IONA 4BSXA 2PQRA 4KZ0A 1D8DA 4GZ6A 3SY2A 3KS2A 2ZIRA 5G04C 2GRNB 3RRMB 2ZISA 4I9EA 4TUUA 1IYGA 4B8AA 1GW6A 3ASOE 1JCQA 1PY1A 3B7TA 2AXZA 2DCPA 4LRZA 2AXUA 5G55A 3EDTB 3FEXA 2AW6A 3UM1A 3CVNA 1UG3A 2VQ2A 4HS2A 4UWGA 4FC8A 3Q9NC 4GCOA 4XKCA 4LERA 4YNDA 1NL4A 3EHQA 3MZLB 3J5QB 3BUAA 3MV2B 3ZRHA 4L9PA 3CK8A 1D9SA 1DC2A 4FHKA 3D9KA 4FLHA 3FUEA 4MRUA 4A1GA 3TL5A 2BF0X 1JUQA 1IXVA 4ILHB 5ANLA 3PH0C 5CRUA 2CHWA 2J07A 4N5QA 1O1TA 5G05J 4GMLA 1OWMA 4GCNA 5EX0A 2P9IG 5KJMA 2A5EA 3CVYA 1H19A 2P9KG 4GZ5A 4YVOA 4U8HA 4OAVB 2H6FA 3FWVA 4Z68A 3AAAC 4CDNA 5KJLA 5EX3A 2WB2A 3UKUG 3APDA 5JJTA 3W9GA 3CR3A 3EJNA 2RFAA 4UWHA 3FTVA 3RK6A 3APFA 4U8YD 1E96B 3KEZA 3HG0D 2B0OE 1LD8A 5HS0A 4GU5A 2WXGA 5AIJA 3ZIMA 1KZOA 1FVHA 3PNLB 2F8XK 3U64A 4RQIA 3CSTA 2IEJA 3FUDA 4FLBA 1LF8A 4L1BA 4GTOA 3KSLA 1O1SA 3ZYKA 4G26A 5AYWD 3PNTB 3U9WA 1JCSA 1S70B 1P5QA 2UY1B 3TGOA 4UI9J 4K5CA 4MLPA 3ASGA 3CVXA 3E34A 4H7XA 3CKCA 2LO6A 3LVQE 1IQUA 4EHMA 4TXRA 1H2UA 3FU6A 1TNBA 4HFGA 1XNFA 4AY6A 3MJWA 4IN3B 2QZAA 1INZA 4KMOA 2MRIA 4J0UA 1JWGA 3TXNA 1V54E 3V2OA 3IV0A 2OCCE 4DLOA 4PH4B 4GTQA 3HXEA 5CEDB 1HG2A 4I2ZA 5ENRD 1TNUA 4I6JA 5CCLA 5J08A 3I5PA 4BTBA 3TG4A 5C1DA 3DEPA 1PAQA 3P2BA 1N9AA 1N4PA 3J5PA 1HXIA 2OEVA 4KZCA 4U07A 1HZ4A 2CHZA 4KT6B 2I9CA 2J09A 5BUZA 3WXXA 3EIJA 3QARA 2PM6A 3PS6A 2J08A 4O1PA 2R05A 1JCRA 3MKRA 2R03A 2L9BA 1BI8B 5AAOA 2XS8A 3CHMA 5EIDA 2CFUA 3LCAA 5T4YA 4AXHA 1RZ4A 4QFVA 1Q2ZA 4G24A 2HO1A 4GMJA 1N54A 4L23A 2R5SA 2B6CA 3CQGB 3GZ1A 4LCTA 2X38A 4U96D 3ZPJA 2A4ZA 2GRRB 4YDEA 4XE0A 2WMOA 2WM9A 3NZSA 2FULA 4A3TA 3FTZA 4EZKA 5BT1A 3TWXA 3DWLG 4DX2A 3TWVA 2F37A 2L6BA 1U3DA 1MX4A 2UY1A 2FEZA 3D9MA 3AU4A 3PZ1A 3ZHEB 2WXKA 3ML8A 4G1TA 1HX8A 5LX8A 3TWUA 3PE4A 2RG8A 4LG6A 4GYOA 1OCRE 3OXFA 3U66A 1X81A 3MCXA 3S7BA 4L2LA 2V4LA 1ELWA 4G8LA 3OTNA 4HRNA 1Y6IA 2PZIA 2OVBA 4HOSA 2BKKB 2CHXA 3UT4A 1UJJA 2VSYA 5BW8C 5A23A 4FJZA 3D9PA 3B7BA 3UKRG 3UT8A 5CBOA 2EIME 1WG0A 2XGMA 4GB9A 4KVMA 4U0SA 1UOHA 2VGEA 5AQ9A 2WXOA 2VGXB 4OYSA 4M7CA 3UM0A 4MBGA 2J9QA 1H6PA 4ZFHA 2KATA 3BG0B 5FZRA 3F6QA 3BEEA 5BV1A 4MKTA 3CK7A 3ABLE 3DRAA 2R59A 2PM7A 3C3QA 1MX6A 4DK5A 1TN6A 2E0IA 4K5AB 4N2QA 3N71A 3SO8A 3ULQA 4CYMD 4A63B 3PE3A 1YMPA 1RW2A 4UWFA 3U4TA 4WWOA 4H7YA 3ESKA 2F8YA 3DSVA 3AS8A 3FFLA 3FUKA 4XZ4A 1E8YA 1TN7A 2L0TB 1E90A 4GMRA 4APOA 3QAQA 3ZVVA 4ANWA 3QK0A 1E7UA 3FY4A 1K1BA 4NQ0A 2LXMA 3R9AB 3ZHEA 1E8WA 4WNFA 3VTYA 4LNUD 5JJ6A 5M72A 4U8VD 2KC7A 4AV7A 4KVOA 5JHAA 1QNFA 2P9UG 2XZTG 3OXLA 4UI9C 3NOCD 4PUCA 3PVLA 1ELKA 4BETA 4EQFA 4Q69A 3ZU7B 3DSTA 3URZA 4XIFA 3DSXA 1H2TC 3L13A 3KEAA 1NA0A 3ONLA 4TUMA 3X2QE 3Q78A 3ZUVB 3Q47B 1S0PA 2Y4UA 4I9CA 4F53A 1Z3YA 2BTDA 5HRYA 4BFRA 1NP7A 3PZ2A 1WDYA 4N3CA 5A7DB 1ELRA 4J8SA 3ML9A 3CV0A 3HXBA 2OEWA 1V55E 2VGXA 3PZ4A 3D9OA 3ZNGA 1UJKA 2YQ8A 3G2VA 1BD8A 4RSYA 3C98A 2H6GA 1E8XA 3APCA 4G2VA 3RU0A 2FO7A 4PS8A 4OVVA 4E85A 3HXCA 2PNNA 4DJAA 1HG5A 3UPVA 1SA5A 2X6JA 4J8EA 2HR2A 4BESA 4ATGA 3ONKA 3QC1A 4J8DA 1AWCB 4BT9A 4HLLA 1MQSA 3FUFA 5JA4D 4AEZC 2IO2C 5KWDA 3Q4AB 2V5FA 3LPZA 3V31A 4G23A 4JHJA 1VDYA 2KCKA 2WXHA 5HI7A 5D0OD 4I6EA 3CKBA 2P9SG 1ZB1A 4G25A 5CHEE 4IRUA 3FDHA 3D3MA 4EPZA 4F1SA 4N3BA 1QZ2A 3ZN3A 3LKUA 5E76A 2XPIA 2A5UA 3ZGQA 4HBDA 3ASNE 3CK9A 3TWRA 4YDYA 3T5XA 4U95D 2WQHA 3MX3A 2DBAA 1BLXB 4GTPA 4D10C 3ENEA 1LD7A 1TNYA 2WQ6A 1FCHA 3IXEA 2AWIA 3MKQB 3JQ0A 3EU9A 4V3IA 4BSZB 3FEYA 2ETAA 4CGWA 3ABKE 2L0IA 1FT2A 2X6IA 4CEMA 1KLXA 4JHKA 3RIBA 5FJYA 2J49A 3JUIA 1TNZA 2WQ7A 4TV3A 1N4SA 2KZTB 1KT0A 1H6KA 3R7RA 1MJ0A 3TWWA 3NAWA 4N2SA 1N11A 3SGHA 2WXJA 3RKVA 3FUIA 2XPZA 5AQAA 4HNAD 2P9PG 2NXPA 2DWZA 2GROB 1BPOA 4JW1A 3WG7E 4QQIA 4I17A 1O5MA 2IQCA 4EBAG 2XPYA 3DSWA 1SW6A 4I2WA 3Q7AA 4O6FA 3QOUA 2MOWA 2WMNA 3FU3A 4K5BA 3PDNA 1WY6A 1EPUA 2ZU6B 4JD2G 2HM8A 5D66A 3S7FA 3D9IA 1DCQA 2XQ0A 2GW1A 2OVFA 2BEDA 2R2LA 4L7TA 3I4RB 1B89A 3CVPA 3SBSA 4I6GA 1HS6A 4N39A 3E32A 5FT9A 2WXLA 1KPSB 5EKQD 2LNIA 2OV8A 5CMWA 2F0YA 3RAUA 5ENPD 2XEHA 5FQ8A 4UUCA 2DZNA 1HH8A 2CFZA 4ACLA 5LCWJ 5KNGA 1PC2A 4LEUA 5AJDA 3UIOC 3Q5MA 3JCKC 3FUMA 4I1OB 2DYRE 2JEKA 2XGSA 4I43A 3Q9UC 3ABME 1G3NB 3Q73A 4JVSA 3MKQA 4PDXA 4F1PA 1X5BA 4B89A 3ISMC 1SQMA 3BQOA 3FU0A 5ARGA 1QQEA 4A55A 4FULA 4BY6A 3MEKA 3KSQA 3Q15A 1L5JA 3FUNA 2VSNA 3R7QA 5CEAA 2GRPB 2ZXWE 1XGWA 4C0EA 2KZTA 4U0ZA 4BX8A 5LFAA 4WNEA 2RKKA 1H2VC 1BI7B 1MZCA 3EHMA 5T8IA 5ENQD 1H6OA 5FINA 1S64A 4EECA 3ZFWA 4GA0A 2L6JA 5CMYA 1Z6TA 5AQ7A 4ME2A 3ULEG 2UWJG 3FH5A 5FTPA 3FH8A 3ASDA 2XZDG 3V79K 4HB5A 3D9LA 5AQBA 1QYMA 4L2YA 2WPVA 5EIBE 4JC8A 3UUXA 5JJ7A 3EU5A 4DX5D 3U3WA 4W9RA 2EIJE 3UTMA 2LSVA 2VSOE 4WNGA 3JYSA 3CEQA 1KZPA 5EDSA 4BTAA 3ASFA 5KNHD 3D9NA 3DBSA 1HF8A 3ULYA 2OOEA 3LJNA 4NRHB 4LNBA 4WWNA 5A6CA 3ZKJA 5BPPA 1OWOA 4FJYA 2LUHA 3TWQA 3RRNB 4O1OA 2AJAA 3CLJA 5FIOA 3ZYMA 3D9HA 4HQDA 5JHBA 3JUEA 1Z5SC 1WM5A 2QC9A 3LEWA 4ILIA 4U0UA 3GZ2A 3NB2A 4YDOA 1SZ9A 5G05C 4IULA 4A3VA 4GYWA 3FU5A 3G2UA 4RLYA 2IU1A 4B94A 2V0PA 3S2AA 1OT8A 2J4DA 3UX4A 3AJIA 2P58C 4TXPA 3Q75A 4YDWA 2DVWA 5FQ4A 1YA0A 3RRUA 3QWVA 4UWLA 3P1UA 4GA2A 3JXJA 1OCOE 3PREA 3DSSA 4B0ZA 4GTSA 2V4HC 3CIAA 1JPLA 1Y8MA 4FADA 5ITZF 4JPSA 4WWPA 2ZGDA 2VSXE 3LY8A 4ILGA 4BX9A 2XCBA 4DX1A 5FZSA 2RFMA 4GZ3A 4URKA 2WXPA 2XHEA 4EZJA 3FP3A 4WAFA 1TN8A 3AG1E 4DRXE 2IY0C 2QYUA 4ANVA 3O48A 1YCSB 3UQ3A 4JEUA 3TWTA 3CHRA 2I6HA 1MYOA 4CT0A 3CHPA 5ENOD 4AJWA 1K8KG 2WXMA 4AP2A 1MHQA 4KXKB 4GZCA 4LUNU 5AENA 5H7PA 4CCAA 3PRZA 2DYSE 2WXQA 3PZ3A 2NSZA 3L16A 3VTXA 5EILA 2WXIA 3UM2A 3AG4E 4CT4A 3S7JA 4R7LA 3KD7A 2IOSA 2MHKA 3EHRA 3DXMG 2LAHA 4G8KA 4JA9A 2YNQA 4RG6A 4N3AA 2KM4A 3AU5A 1TJFA 2XEEA 3TJPA 4PS7A 2C0LA 4JZYA 2Y1LE 3LXUX 5AJLA 3L17A 2GRLA 5LP0A 5T3RA 4WNDA 2C0MA 5B3SE 4AIFA 4O60A 3EUVA 2AXVA 3C3OA 3RJVA 4AY5A 4BT8A 5DBKA 1EDUA 5AN8A 5B1BE 4JA7A 2KCVA 5EYLA 3IHVA 3LYAA 5BV0A 1N4QA 4C0MA 2X6FA 5G2NA 2I1KA 4GZDA 1EYHA 4Y6WA 3UM3A 3QNKA 2WXFA 3CGHA 1W3BA 4DX7D 2RD0A 1E8ZA 1TR4A 3UIPC 2LXLA 4HRMB 3JQ1A 2FI7A 5CECB 4HOUA 1SA4A 1WAO1 1HO8A 2JABA 4B93B 4BEPA 4XI9A 1TNOA 4UI9K 4GAAA 2YHEA 3CSFA 3FTSA 4FA6A 3B95A 4HOQA 1QBQA 2KBXA 4BERA 3HXDA 4HI8A 3ZEFA 3NQPA 3OAWA 1IHBA 3HHMA 4KBQA 2HE0A 5EN5D 4HXIA 3TG5A 2CG3A 3SNXA 3IKOB 1N4RA 1FVFA 2IOLA 3LY9A 3IBEA 4J8FA
chains in the Genus database with same CATH topology
2LXLA 4TXPA 2LUHA 5H7PA 4TXQA 4U7EB 4TXRA 2RKKA 2LXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXL A;  4TXP A;  2LUH A;  5H7P A;  4TXQ A;  4U7E B;  4TXR A;  2RKK A;  2LXM A; 
#chains in the Genus database with same CATH topology
 4FP7 A;  5FQ7 A;  2FO1 E;  2I2O A;  3G2S A;  3RO3 A;  3CHQ A;  1OCZ E;  4ANU A;  3QB2 A;  1OY3 D;  3B7R L;  3MGB A;  4KYO B;  3FUL A;  4DLQ A;  2C2L A;  3UMV A;  3DPY A;  5FWQ A;  4ANX A;  1NFI E;  1OWL A;  4OAU C;  3VLE A;  4DX6 D;  3T9K A;  1OUV A;  3HXF A;  3JXI A;  3SQV A;  3Q79 A;  4LSZ E;  3UXG A;  2JLB A;  1BU9 A;  2WXN A;  1UW4 B;  5BXO A;  3W9F A;  3C3R A;  4FHJ A;  2VGY A;  3SBT B;  3FH7 A;  1OWN A;  5KBA A;  5BXU A;  1S63 A;  5CER B;  3ESL A;  2V8S E;  3R9M A;  4C9B B;  3SFZ A;  5HKP A;  1NI1 A;  1K3Z D;  3E30 A;  5J90 A;  3CVL A;  4I1M A;  4N5C A;  3DEO A;  4E6H A;  4GPK A;  4XI0 A;  1HFA A;  5IY5 E;  4CRW A;  4K03 A;  1FT1 A;  2EIN E;  3FTW A;  1A5E A;  2ILR A;  3NF1 A;  3KAE A;  1N0Q A;  4B8C B;  2XS1 A;  3CHS A;  4DI3 A;  1TYQ G;  2I1J A;  5C2Y A;  4Q94 A;  2KCL A;  3DPD A;  5EYP F;  3I3N A;  5E75 A;  2LSU A;  2WXR A;  1MX2 A;  5CCM A;  1UN8 A;  3Q49 B;  3DXK G;  4GYY A;  3T8K A;  1SVX A;  4JL0 A;  4I1A A;  2IJG X;  2XEN A;  2WVI A;  2YIN A;  4J8Y A;  3GW4 A;  3G2T A;  2HYZ A;  4U04 A;  3B7U X;  1D8E A;  3HVE B;  1DNP A;  1OCC E;  3T8M A;  2X6H A;  4JB8 P;  3LVR E;  3PUJ A;  3IHY A;  2GRQ B;  4NUR A;  3E4B A;  5ANR A;  2NC9 A;  3V2X A;  1FPP A;  2QFC A;  2PL2 A;  2BKG A;  4GTR A;  3ZW3 A;  3ZXS A;  2VTB B;  4AVX A;  3FUJ A;  4NIK A;  2EIL E;  3LDZ A;  3V30 A;  1NA3 A;  3RSE G;  3CVW A;  3L08 A;  4BWR A;  2P9L G;  4JXT A;  3FHE A;  4RG9 A;  4OVU A;  3I4G A;  2PQN A;  3GYZ A;  4EZL A;  2V5Q C;  5G04 J;  4CDR A;  4APF A;  1HE8 A;  4JHR A;  4J7W A;  3UIN C;  3B13 A;  2ZGG A;  2E2E A;  3CVU A;  3IEG A;  4LNG A;  3G2W A;  4HOR A;  2IF4 A;  3ZYL A;  5HQ8 A;  4XX5 A;  2X3M A;  2XEV A;  4CZ2 D;  3HIZ A;  3UI2 A;  3CQC B;  3K9I A;  4TXQ A;  4TRQ A;  5AAR A;  5FZQ A;  3QWW A;  4UQY A;  1UN9 A;  2J4B A;  1SZA A;  3HYM B;  2Y4T A;  3PZD A;  4CDM A;  2H6H A;  2J8S D;  3QWP A;  4HRL A;  3B7S A;  5CBN A;  3BU8 A;  4UQX A;  4A1S A;  4U7E B;  4F6R D;  4EBA A;  3SZ7 A;  4DPR A;  3SF4 A;  1YYH A;  1OXJ A;  2DZO A;  3HRA A;  3S7D A;  3TXM A;  3E37 A;  1TEZ A;  3HDX A;  1DVP A;  1LTX A;  1KT1 A;  3SFY A;  3SI5 A;  5D2M C;  5BNW A;  3LY7 A;  5KCM A;  2P2C P;  3RO2 A;  3SFX A;  2H6I A;  3L22 A;  5JMN D;  4C48 B;  2AVP A;  3NOG D;  1N52 A;  3L6A A;  3SD5 A;  3HVE A;  3QJZ A;  2LAI A;  1H0A A;  3NBN B;  4XKB A;  4GA1 A;  2OND A;  4CGV A;  1ZBP A;  4K0R A;  1N94 A;  4PS3 A;  1O1R A;  1NZN A;  3AS4 A;  3AG3 E;  3VLD A;  3PUK A;  4Q96 A;  2ETC A;  1Z3X A;  4U63 A;  4G11 A;  2ETB A;  2GRM A;  2VTB A;  3ZXP A;  3TWS A;  4HVB A;  1N0R A;  3FTY A;  3PEU B;  3QDN A;  1ZU2 A;  2Y3A A;  3AS5 A;  3E33 A;  3EIQ C;  3DSU A;  1N95 A;  4AM9 A;  1IQR A;  2XGO A;  4Y6C A;  2R02 A;  5ENT D;  4AOF A;  3CVV A;  3MV3 B;  5D0Q D;  3OXG A;  3AG2 E;  3L54 A;  3MA5 A;  3GZS A;  4HOT A;  2P9N G;  5ENN A;  3LJ3 A;  5ENS D;  2XRZ A;  3L9T A;  3UT7 A;  3C72 A;  4ACK A;  3MYV A;  4X8Q A;  2XCC A;  2EIK E;  1HU3 A;  2X6K A;  3CVQ A;  3LS8 A;  2Q7F A;  3EHN A;  3QKY A;  2IO3 C;  4GTT A;  1AP7 A;  3CHO A;  4F7A A;  1A17 A;  2Y0B G;  1U3C A;  2M63 A;  1TJC A;  3VLF A;  3Q7F A;  1EF1 C;  5KJK A;  2BUG A;  5KJN A;  4GTV A;  1U2V G;  5LOZ A;  3NZU A;  2GGF A;  4HLE A;  2MYO A;  4WUY A;  4J6I A;  4XEI G;  4F3V A;  4DI4 A;  4IYP A;  2Y69 E;  2EQX A;  4NAC A;  4UQZ A;  2QYJ A;  3FUH A;  2YHC A;  3BG1 B;  1K1A A;  3C5R A;  4ABN A;  4YVQ C;  5ARF A;  4GTM A;  3FTU A;  3ZYQ A;  3T5V A;  4M3O A;  3TAX A;  4FU3 A;  5CRV A;  1E7V A;  5FQ6 A;  1IKN D;  2QY7 A;  2VJ8 A;  5B1A E;  2IFU A;  2KXP C;  2CG2 A;  2R17 C;  1DCE A;  4HI9 A;  2XRY A;  3L82 A;  4DUI A;  2VYI A;  4MS6 A;  3O4Z A;  2NYJ A;  3D9J A;  5DIZ A;  1OWP A;  3FTX A;  4RVB A;  4P29 A;  2FF4 A;  3PEV B;  3ASH A;  2DIW A;  4ATZ D;  5LCW C;  4ZHB A;  4GPM A;  1JWF A;  1IHG A;  2FBN A;  4UWK A;  4JEH A;  3SHF A;  2ION A;  4BSX A;  2PQR A;  4KZ0 A;  1D8D A;  4GZ6 A;  3SY2 A;  3KS2 A;  2ZIR A;  5G04 C;  2GRN B;  3RRM B;  2ZIS A;  4I9E A;  4TUU A;  1IYG A;  4B8A A;  1GW6 A;  3ASO E;  1JCQ A;  1PY1 A;  3B7T A;  2AXZ A;  2DCP A;  4LRZ A;  2AXU A;  5G55 A;  3EDT B;  3FEX A;  2AW6 A;  3UM1 A;  3CVN A;  1UG3 A;  2VQ2 A;  4HS2 A;  4UWG A;  4FC8 A;  3Q9N C;  4GCO A;  4XKC A;  4LER A;  4YND A;  1NL4 A;  3EHQ A;  3MZL B;  3J5Q B;  3BUA A;  3MV2 B;  3ZRH A;  4L9P A;  3CK8 A;  1D9S A;  1DC2 A;  4FHK A;  3D9K A;  4FLH A;  3FUE A;  4MRU A;  4A1G A;  3TL5 A;  2BF0 X;  1JUQ A;  1IXV A;  4ILH B;  5ANL A;  3PH0 C;  5CRU A;  2CHW A;  2J07 A;  4N5Q A;  1O1T A;  5G05 J;  4GML A;  1OWM A;  4GCN A;  5EX0 A;  2P9I G;  5KJM A;  2A5E A;  3CVY A;  1H19 A;  2P9K G;  4GZ5 A;  4YVO A;  4U8H A;  4OAV B;  2H6F A;  3FWV A;  4Z68 A;  3AAA C;  4CDN A;  5KJL A;  5EX3 A;  2WB2 A;  3UKU G;  3APD A;  5JJT A;  3W9G A;  3CR3 A;  3EJN A;  2RFA A;  4UWH A;  3FTV A;  3RK6 A;  3APF A;  4U8Y D;  1E96 B;  3KEZ A;  3HG0 D;  2B0O E;  1LD8 A;  5HS0 A;  4GU5 A;  2WXG A;  5AIJ A;  3ZIM A;  1KZO A;  1FVH A;  3PNL B;  2F8X K;  3U64 A;  4RQI A;  3CST A;  2IEJ A;  3FUD A;  4FLB A;  1LF8 A;  4L1B A;  4GTO A;  3KSL A;  1O1S A;  3ZYK A;  4G26 A;  5AYW D;  3PNT B;  3U9W A;  1JCS A;  1S70 B;  1P5Q A;  2UY1 B;  3TGO A;  4UI9 J;  4K5C A;  4MLP A;  3ASG A;  3CVX A;  3E34 A;  4H7X A;  3CKC A;  2LO6 A;  3LVQ E;  1IQU A;  4EHM A;  4TXR A;  1H2U A;  3FU6 A;  1TNB A;  4HFG A;  1XNF A;  4AY6 A;  3MJW A;  4IN3 B;  2QZA A;  1INZ A;  4KMO A;  2MRI A;  4J0U A;  1JWG A;  3TXN A;  1V54 E;  3V2O A;  3IV0 A;  2OCC E;  4DLO A;  4PH4 B;  4GTQ A;  3HXE A;  5CED B;  1HG2 A;  4I2Z A;  5ENR D;  1TNU A;  4I6J A;  5CCL A;  5J08 A;  3I5P A;  4BTB A;  3TG4 A;  5C1D A;  3DEP A;  1PAQ A;  3P2B A;  1N9A A;  1N4P A;  3J5P A;  1HXI A;  2OEV A;  4KZC A;  4U07 A;  1HZ4 A;  2CHZ A;  4KT6 B;  2I9C A;  2J09 A;  5BUZ A;  3WXX A;  3EIJ A;  3QAR A;  2PM6 A;  3PS6 A;  2J08 A;  4O1P A;  2R05 A;  1JCR A;  3MKR A;  2R03 A;  2L9B A;  1BI8 B;  5AAO A;  2XS8 A;  3CHM A;  5EID A;  2CFU A;  3LCA A;  5T4Y A;  4AXH A;  1RZ4 A;  4QFV A;  1Q2Z A;  4G24 A;  2HO1 A;  4GMJ A;  1N54 A;  4L23 A;  2R5S A;  2B6C A;  3CQG B;  3GZ1 A;  4LCT A;  2X38 A;  4U96 D;  3ZPJ A;  2A4Z A;  2GRR B;  4YDE A;  4XE0 A;  2WMO A;  2WM9 A;  3NZS A;  2FUL A;  4A3T A;  3FTZ A;  4EZK A;  5BT1 A;  3TWX A;  3DWL G;  4DX2 A;  3TWV A;  2F37 A;  2L6B A;  1U3D A;  1MX4 A;  2UY1 A;  2FEZ A;  3D9M A;  3AU4 A;  3PZ1 A;  3ZHE B;  2WXK A;  3ML8 A;  4G1T A;  1HX8 A;  5LX8 A;  3TWU A;  3PE4 A;  2RG8 A;  4LG6 A;  4GYO A;  1OCR E;  3OXF A;  3U66 A;  1X81 A;  3MCX A;  3S7B A;  4L2L A;  2V4L A;  1ELW A;  4G8L A;  3OTN A;  4HRN A;  1Y6I A;  2PZI A;  2OVB A;  4HOS A;  2BKK B;  2CHX A;  3UT4 A;  1UJJ A;  2VSY A;  5BW8 C;  5A23 A;  4FJZ A;  3D9P A;  3B7B A;  3UKR G;  3UT8 A;  5CBO A;  2EIM E;  1WG0 A;  2XGM A;  4GB9 A;  4KVM A;  4U0S A;  1UOH A;  2VGE A;  5AQ9 A;  2WXO A;  2VGX B;  4OYS A;  4M7C A;  3UM0 A;  4MBG A;  2J9Q A;  1H6P A;  4ZFH A;  2KAT A;  3BG0 B;  5FZR A;  3F6Q A;  3BEE A;  5BV1 A;  4MKT A;  3CK7 A;  3ABL E;  3DRA A;  2R59 A;  2PM7 A;  3C3Q A;  1MX6 A;  4DK5 A;  1TN6 A;  2E0I A;  4K5A B;  4N2Q A;  3N71 A;  3SO8 A;  3ULQ A;  4CYM D;  4A63 B;  3PE3 A;  1YMP A;  1RW2 A;  4UWF A;  3U4T A;  4WWO A;  4H7Y A;  3ESK A;  2F8Y A;  3DSV A;  3AS8 A;  3FFL A;  3FUK A;  4XZ4 A;  1E8Y A;  1TN7 A;  2L0T B;  1E90 A;  4GMR A;  4APO A;  3QAQ A;  3ZVV A;  4ANW A;  3QK0 A;  1E7U A;  3FY4 A;  1K1B A;  4NQ0 A;  2LXM A;  3R9A B;  3ZHE A;  1E8W A;  4WNF A;  3VTY A;  4LNU D;  5JJ6 A;  5M72 A;  4U8V D;  2KC7 A;  4AV7 A;  4KVO A;  5JHA A;  1QNF A;  2P9U G;  2XZT G;  3OXL A;  4UI9 C;  3NOC D;  4PUC A;  3PVL A;  1ELK A;  4BET A;  4EQF A;  4Q69 A;  3ZU7 B;  3DST A;  3URZ A;  4XIF A;  3DSX A;  1H2T C;  3L13 A;  3KEA A;  1NA0 A;  3ONL A;  4TUM A;  3X2Q E;  3Q78 A;  3ZUV B;  3Q47 B;  1S0P A;  2Y4U A;  4I9C A;  4F53 A;  1Z3Y A;  2BTD A;  5HRY A;  4BFR A;  1NP7 A;  3PZ2 A;  1WDY A;  4N3C A;  5A7D B;  1ELR A;  4J8S A;  3ML9 A;  3CV0 A;  3HXB A;  2OEW A;  1V55 E;  2VGX A;  3PZ4 A;  3D9O A;  3ZNG A;  1UJK A;  2YQ8 A;  3G2V A;  1BD8 A;  4RSY A;  3C98 A;  2H6G A;  1E8X A;  3APC A;  4G2V A;  3RU0 A;  2FO7 A;  4PS8 A;  4OVV A;  4E85 A;  3HXC A;  2PNN A;  4DJA A;  1HG5 A;  3UPV A;  1SA5 A;  2X6J A;  4J8E A;  2HR2 A;  4BES A;  4ATG A;  3ONK A;  3QC1 A;  4J8D A;  1AWC B;  4BT9 A;  4HLL A;  1MQS A;  3FUF A;  5JA4 D;  4AEZ C;  2IO2 C;  5KWD A;  3Q4A B;  2V5F A;  3LPZ A;  3V31 A;  4G23 A;  4JHJ A;  1VDY A;  2KCK A;  2WXH A;  5HI7 A;  5D0O D;  4I6E A;  3CKB A;  2P9S G;  1ZB1 A;  4G25 A;  5CHE E;  4IRU A;  3FDH A;  3D3M A;  4EPZ A;  4F1S A;  4N3B A;  1QZ2 A;  3ZN3 A;  3LKU A;  5E76 A;  2XPI A;  2A5U A;  3ZGQ A;  4HBD A;  3ASN E;  3CK9 A;  3TWR A;  4YDY A;  3T5X A;  4U95 D;  2WQH A;  3MX3 A;  2DBA A;  1BLX B;  4GTP A;  4D10 C;  3ENE A;  1LD7 A;  1TNY A;  2WQ6 A;  1FCH A;  3IXE A;  2AWI A;  3MKQ B;  3JQ0 A;  3EU9 A;  4V3I A;  4BSZ B;  3FEY A;  2ETA A;  4CGW A;  3ABK E;  2L0I A;  1FT2 A;  2X6I A;  4CEM A;  1KLX A;  4JHK A;  3RIB A;  5FJY A;  2J49 A;  3JUI A;  1TNZ A;  2WQ7 A;  4TV3 A;  1N4S A;  2KZT B;  1KT0 A;  1H6K A;  3R7R A;  1MJ0 A;  3TWW A;  3NAW A;  4N2S A;  1N11 A;  3SGH A;  2WXJ A;  3RKV A;  3FUI A;  2XPZ A;  5AQA A;  4HNA D;  2P9P G;  2NXP A;  2DWZ A;  2GRO B;  1BPO A;  4JW1 A;  3WG7 E;  4QQI A;  4I17 A;  1O5M A;  2IQC A;  4EBA G;  2XPY A;  3DSW A;  1SW6 A;  4I2W A;  3Q7A A;  4O6F A;  3QOU A;  2MOW A;  2WMN A;  3FU3 A;  4K5B A;  3PDN A;  1WY6 A;  1EPU A;  2ZU6 B;  4JD2 G;  2HM8 A;  5D66 A;  3S7F A;  3D9I A;  1DCQ A;  2XQ0 A;  2GW1 A;  2OVF A;  2BED A;  2R2L A;  4L7T A;  3I4R B;  1B89 A;  3CVP A;  3SBS A;  4I6G A;  1HS6 A;  4N39 A;  3E32 A;  5FT9 A;  2WXL A;  1KPS B;  5EKQ D;  2LNI A;  2OV8 A;  5CMW A;  2F0Y A;  3RAU A;  5ENP D;  2XEH A;  5FQ8 A;  4UUC A;  2DZN A;  1HH8 A;  2CFZ A;  4ACL A;  5LCW J;  5KNG A;  1PC2 A;  4LEU A;  5AJD A;  3UIO C;  3Q5M A;  3JCK C;  3FUM A;  4I1O B;  2DYR E;  2JEK A;  2XGS A;  4I43 A;  3Q9U C;  3ABM E;  1G3N B;  3Q73 A;  4JVS A;  3MKQ A;  4PDX A;  4F1P A;  1X5B A;  4B89 A;  3ISM C;  1SQM A;  3BQO A;  3FU0 A;  5ARG A;  1QQE A;  4A55 A;  4FUL A;  4BY6 A;  3MEK A;  3KSQ A;  3Q15 A;  1L5J A;  3FUN A;  2VSN A;  3R7Q A;  5CEA A;  2GRP B;  2ZXW E;  1XGW A;  4C0E A;  2KZT A;  4U0Z A;  4BX8 A;  5LFA A;  4WNE A;  2RKK A;  1H2V C;  1BI7 B;  1MZC A;  3EHM A;  5T8I A;  5ENQ D;  1H6O A;  5FIN A;  1S64 A;  4EEC A;  3ZFW A;  4GA0 A;  2L6J A;  5CMY A;  1Z6T A;  5AQ7 A;  4ME2 A;  3ULE G;  2UWJ G;  3FH5 A;  5FTP A;  3FH8 A;  3ASD A;  2XZD G;  3V79 K;  4HB5 A;  3D9L A;  5AQB A;  1QYM A;  4L2Y A;  2WPV A;  5EIB E;  4JC8 A;  3UUX A;  5JJ7 A;  3EU5 A;  4DX5 D;  3U3W A;  4W9R A;  2EIJ E;  3UTM A;  2LSV A;  2VSO E;  4WNG A;  3JYS A;  3CEQ A;  1KZP A;  5EDS A;  4BTA A;  3ASF A;  5KNH D;  3D9N A;  3DBS A;  1HF8 A;  3ULY A;  2OOE A;  3LJN A;  4NRH B;  4LNB A;  4WWN A;  5A6C A;  3ZKJ A;  5BPP A;  1OWO A;  4FJY A;  2LUH A;  3TWQ A;  3RRN B;  4O1O A;  2AJA A;  3CLJ A;  5FIO A;  3ZYM A;  3D9H A;  4HQD A;  5JHB A;  3JUE A;  1Z5S C;  1WM5 A;  2QC9 A;  3LEW A;  4ILI A;  4U0U A;  3GZ2 A;  3NB2 A;  4YDO A;  1SZ9 A;  5G05 C;  4IUL A;  4A3V A;  4GYW A;  3FU5 A;  3G2U A;  4RLY A;  2IU1 A;  4B94 A;  2V0P A;  3S2A A;  1OT8 A;  2J4D A;  3UX4 A;  3AJI A;  2P58 C;  4TXP A;  3Q75 A;  4YDW A;  2DVW A;  5FQ4 A;  1YA0 A;  3RRU A;  3QWV A;  4UWL A;  3P1U A;  4GA2 A;  3JXJ A;  1OCO E;  3PRE A;  3DSS A;  4B0Z A;  4GTS A;  2V4H C;  3CIA A;  1JPL A;  1Y8M A;  4FAD A;  5ITZ F;  4JPS A;  4WWP A;  2ZGD A;  2VSX E;  3LY8 A;  4ILG A;  4BX9 A;  2XCB A;  4DX1 A;  5FZS A;  2RFM A;  4GZ3 A;  4URK A;  2WXP A;  2XHE A;  4EZJ A;  3FP3 A;  4WAF A;  1TN8 A;  3AG1 E;  4DRX E;  2IY0 C;  2QYU A;  4ANV A;  3O48 A;  1YCS B;  3UQ3 A;  4JEU A;  3TWT A;  3CHR A;  2I6H A;  1MYO A;  4CT0 A;  3CHP A;  5ENO D;  4AJW A;  1K8K G;  2WXM A;  4AP2 A;  1MHQ A;  4KXK B;  4GZC A;  4LUN U;  5AEN A;  5H7P A;  4CCA A;  3PRZ A;  2DYS E;  2WXQ A;  3PZ3 A;  2NSZ A;  3L16 A;  3VTX A;  5EIL A;  2WXI A;  3UM2 A;  3AG4 E;  4CT4 A;  3S7J A;  4R7L A;  3KD7 A;  2IOS A;  2MHK A;  3EHR A;  3DXM G;  2LAH A;  4G8K A;  4JA9 A;  2YNQ A;  4RG6 A;  4N3A A;  2KM4 A;  3AU5 A;  1TJF A;  2XEE A;  3TJP A;  4PS7 A;  2C0L A;  4JZY A;  2Y1L E;  3LXU X;  5AJL A;  3L17 A;  2GRL A;  5LP0 A;  5T3R A;  4WND A;  2C0M A;  5B3S E;  4AIF A;  4O60 A;  3EUV A;  2AXV A;  3C3O A;  3RJV A;  4AY5 A;  4BT8 A;  5DBK A;  1EDU A;  5AN8 A;  5B1B E;  4JA7 A;  2KCV A;  5EYL A;  3IHV A;  3LYA A;  5BV0 A;  1N4Q A;  4C0M A;  2X6F A;  5G2N A;  2I1K A;  4GZD A;  1EYH A;  4Y6W A;  3UM3 A;  3QNK A;  2WXF A;  3CGH A;  1W3B A;  4DX7 D;  2RD0 A;  1E8Z A;  1TR4 A;  3UIP C;  2LXL A;  4HRM B;  3JQ1 A;  2FI7 A;  5CEC B;  4HOU A;  1SA4 A;  1WAO 1;  1HO8 A;  2JAB A;  4B93 B;  4BEP A;  4XI9 A;  1TNO A;  4UI9 K;  4GAA A;  2YHE A;  3CSF A;  3FTS A;  4FA6 A;  3B95 A;  4HOQ A;  1QBQ A;  2KBX A;  4BER A;  3HXD A;  4HI8 A;  3ZEF A;  3NQP A;  3OAW A;  1IHB A;  3HHM A;  4KBQ A;  2HE0 A;  5EN5 D;  4HXI A;  3TG5 A;  2CG3 A;  3SNX A;  3IKO B;  1N4R A;  1FVF A;  2IOL A;  3LY9 A;  3IBE A;  4J8F A; 
#chains in the Genus database with same CATH homology
 2LXL A;  4TXP A;  2LUH A;  5H7P A;  4TXQ A;  4U7E B;  4TXR A;  2RKK A;  2LXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...