5D2MC

Complex between human sumo2-rangap1, ubc9 and znf451
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
158
structure length
158
Chain Sequence
PPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase,protein binding
molecule keywords SUMO-conjugating enzyme UBC9
publication title Structural basis for catalytic activation by the human ZNF451 SUMO E3 ligase.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 158
sequence length 158
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 5d2mC00
2GRRB 3UINC 3UIPC 2GRNB 2IO3C 2IO2C 1Z5SC 2GROB 5D2MC 1KPSB 2GRPB 3UIOC 2IY0C 2GRQB
chains in the Genus database with same CATH superfamily
3DSWA 3NQPA 4JC8A 1X5BA 4A1SA 3G2SA 4UI9J 3VTYA 3D9LA 4FJYA 4I2ZA 2RFAA 3CHMA 1BU9A 4G8LA 5ARFA 3EIJA 5D66A 4ILHB 5ENNA 3QOUA 4KXKB 5G04C 4I1OB 3QB2A 1LF8A 2JABA 2L6JA 3FWVA 2XPYA 5ENTD 1JUQA 4TXPA 5BV0A 3S2AA 4U04A 3CVNA 4G24A 5KJKA 1WM5A 3IHYA 2HE0A 1HO8A 2HYZA 2PZIA 3EJNA 3RU0A 4Q69A 1TJFA 3CVWA 1NA3A 5BT1A 2J07A 5IY5E 1NZNA 1NFIE 3LXUX 3Q15A 3TWWA 4K5BA 2Y4TA 4C9BB 2PM6A 3TL5A 2L6BA 4DJAA 3ENEA 1YYHA 4BT9A 4CDNA 4DI3A 4AY6A 4IN3B 3ZYLA 2WPVA 4TXRA 4HBDA 3FTSA 3ISMC 2Y4UA 5DIZA 4BETA 4MS6A 2A4ZA 3RRMB 4XI0A 3DEOA 3JQ0A 3JUEA 2VGYA 3P2BA 2EIJE 2NYJA 3L82A 3NF1A 3ZYQA 4I1MA 3L17A 3EHQA 3JCKC 4XKCA 3Q5MA 3C3RA 4N2SA 3LJNA 5KNGA 3LY7A 5CEDB 3T9KA 4IULA 3FY4A 4JEUA 1SA4A 3UINC 2KCVA 4KMOA 2WXJA 5CECB 3L08A 1AP7A 2I1JA 2C2LA 4GYWA 3LCAA 4ATZD 3BUAA 3ZN3A 2GRMA 4DK5A 1PAQA 3SF4A 5ENQD 5JJTA 5ENPD 2WB2A 2P9LG 2UWJG 1D9SA 2C0LA 1IYGA 3PUKA 2MRIA 1DVPA 3PZ4A 2LSUA 4G25A 1O1TA 2R2LA 1V54E 2CHZA 2IY0C 1NI1A 2V8SE 3TJPA 1W3BA 3HXCA 2I1KA 3D9KA 3ZHEA 2IQCA 1IXVA 2YHEA 4TXQA 4X8QA 3FHEA 4LG6A 3FH8A 5CCLA 3FTZA 3U3WA 4GYYA 3JUIA 2QZAA 2WXGA 3AS5A 3ZVVA 4FLHA 4GTMA 3HRAA 2VGEA 4HQDA 3DSTA 3C3QA 4F1SA 4WWPA 5G2NA 2PM7A 3TWRA 3FDHA 2XCBA 2KZTA 2XCCA 1HS6A 4K03A 1U3CA 1E8ZA 2XRZA 1KPSB 2HM8A 5G04J 4OVVA 1VDYA 1Y8MA 4AEZC 5FT9A 4AOFA 3OXLA 4HFGA 3Q73A 4LUNU 5HI7A 4H7YA 2WMOA 3BG1B 1FT1A 4DX1A 3MYVA 3PS6A 4Q94A 4GA1A 3R7RA 4IYPA 3QWWA 4BFRA 4OYSA 3Q7AA 2LSVA 4A3TA 5D2MC 3G2VA 1TYQG 1HG2A 4GA0A 5CBOA 4ANWA 3WXXA 3AAAC 1E8YA 2VTBB 1AWCB 2BUGA 4WNGA 4LNBA 3CHRA 2FO7A 3CHSA 4BWRA 2EILE 4U95D 1H2VC 5AJLA 2FEZA 5FZSA 4V3IA 1PC2A 3SO8A 1H6PA 2R5SA 4FHKA 3FUIA 2WQ7A 3U4TA 3NZSA 1E7VA 4FJZA 4CDMA 2VYIA 1HG5A 4WUYA 2LO6A 2H6HA 1H6OA 3TGOA 3CVPA 4RQIA 2IONA 3ZYKA 4GTTA 5T3RA 4BY6A 1Y6IA 4FHJA 3L6AA 3LKUA 1EF1C 4I9EA 4C0EA 3L22A 3UT8A 1QZ2A 3FTVA 4UI9C 1SA5A 3PVLA 2LAHA 4KVMA 3CVLA 1SVXA 2J4BA 5CCMA 4BESA 2WXNA 4I6GA 3KEZA 3PEVB 1LD8A 4MRUA 3D9PA 3T5XA 4LCTA 4NRHB 1Z5SC 3APDA 1KLXA 4CEMA 4Z68A 4ANUA 3E33A 3SNXA 3FUHA 1DC2A 3D9HA 2FO1E 3IKOB 1UW4B 3QKYA 5ANRA 3NOGD 2GRRB 3DSXA 4URKA 3FTUA 4N3BA 2QFCA 3FUDA 4U8VD 1ELWA 3HXBA 1MHQA 4ILGA 5E76A 3DSUA 3LDZA 3PEUB 4J0UA 3HYMB 2V0PA 5LP0A 1FT2A 4YNDA 1KT0A 5EYLA 5AYWD 3CHOA 2XRYA 1WDYA 2J4DA 5BXOA 3E4BA 2X6IA 3Q7FA 3AU4A 1EYHA 2AXZA 2CFUA 4KT6B 4BSXA 2DZNA 3UTMA 1ELKA 5B1AE 4I43A 1BI8B 4JB8P 5KWDA 2OVBA 3V2OA 4A63B 4HNAD 5KJMA 3L54A 3EU9A 4J8SA 4HLEA 3V79K 1BLXB 3RKVA 4W9RA 2WXLA 3PZ3A 1LTXA 3KSLA 4IRUA 2XEVA 2IO3C 2A5UA 2V4HC 3T8KA 2GRPB 3FTYA 4AJWA 1E8WA 4KZCA 1DCEA 4HOSA 4U63A 4JL0A 4GZ5A 4HORA 5FINA 1JWFA 1OCRE 4O1PA 3DPDA 5KBAA 2QY7A 2X6KA 2J49A 2LUHA 1H2TC 5EIBE 2P58C 2VSYA 4GTRA 4GMRA 2GRNB 2IFUA 5J08A 3UIOC 4DPRA 1H2UA 4PS3A 3TWUA 4CGWA 3MGBA 2Y0BG 2BF0X 2B6CA 3LJ3A 3MEKA 4YVOA 5G55A 3C98A 2H6FA 2PQNA 1ELRA 1IHBA 4ME2A 5BPPA 2LNIA 2BEDA 4GZDA 4UQYA 5FJYA 3NAWA 3EUVA 3PNTB 2J09A 4UWLA 4Y6WA 1N4SA 3SZ7A 3P1UA 4R7LA 3IBEA 2R03A 3CSFA 3PNLB 2CFZA 5HRYA 3URZA 4U8YD 3L9TA 3ML9A 2LXLA 3ABLE 4U96D 1OUVA 3HG0D 1HZ4A 3QNKA 4JPSA 4Q96A 3SHFA 4L23A 1OWPA 3MKRA 3UM1A 2QYJA 4U0UA 3CGHA 4ANXA 4BX8A 1ZBPA 3ZKJA 2GRLA 2DWZA 4N3CA 3HVEB 4UWHA 2ZIRA 3RIBA 2XZTG 2R17C 4M7CA 3CVVA 3TWQA 3T5VA 2RD0A 4I6EA 4GZ6A 4ACKA 2VQ2A 1DNPA 4I2WA 3FULA 4JHJA 1QQEA 3IV0A 1N4RA 3QK0A 3MCXA 5KCMA 4QQIA 3S7DA 3UM2A 3ASDA 4BSZB 5ANLA 5CBNA 1D8DA 5HS0A 3KSQA 2XGOA 3IXEA 4RLYA 5AQ7A 3ZYMA 3TG4A 3GZ1A 3ULEG 2UY1B 1EDUA 3LVRE 3Q79A 3R9MA 1S64A 3DRAA 5ENSD 3AS8A 2BKGA 4LSZE 4HXIA 2ZISA 4LNGA 4JEHA 4CT4A 2WXRA 3O48A 4UQXA 2WM9A 2IEJA 2CHWA 4U07A 5AAOA 3D9OA 3E37A 1HF8A 4AP2A 5CERB 3EHRA 5EILA 2WXOA 3CK7A 4FULA 3MA5A 2NSZA 3G2TA 1RW2A 4DUIA 1LD7A 1WG0A 3UM3A 4UI9K 4BTAA 3K9IA 1NP7A 3FUEA 1H0AA 3PE4A 4A3VA 3I4RB 4O60A 3VLEA 3FTXA 2DYSE 3SGHA 3CSTA 2YINA 5AQAA 3S7JA 1YMPA 3ASFA 4HRNA 4B89A 1FVHA 3W9GA 4HVBA 1L5JA 4J8EA 3TG5A 3PZ2A 3PDNA 2XENA 5EX3A 4I9CA 5FZQA 4NACA 3NOCD 3X2QE 3UIPC 4XX5A 1MQSA 2EIKE 3QDNA 2RKKA 1Z3YA 2OOEA 3C72A 3CV0A 3I4GA 3ZRHA 3MV2B 3PUJA 2WXHA 3I3NA 1TNBA 4YDYA 5CEAA 4J8YA 3ZGQA 4GA2A 4FC8A 4GCOA 4OVUA 3CK8A 2XGSA 2XGMA 4BTBA 3B7TA 4ZFHA 1JWGA 3ZUVB 1INZA 1D8EA 3AG4E 4XZ4A 5B3SE 3SFYA 1H6KA 4JA7A 1BPOA 5JHBA 1IKND 5AARA 4RG9A 1UJKA 4U7EB 4G23A 4C48B 4PS7A 1TR4A 3B7RL 4XIFA 3FEXA 4BX9A 3TAXA 2VSNA 3R9AB 4N2QA 2P9SG 4JD2G 2QC9A 4JXTA 2KCKA 3ABME 2VTBA 2P9KG 3O4ZA 3W9FA 4OAUC 1OCCE 3AG3E 3TWVA 2WXPA 3ASOE 5HQ8A 2Y1LE 3Q75A 3KD7A 4B0ZA 3T8MA 2AJAA 3ABKE 2KATA 4J7WA 5JA4D 1WAO1 2DYRE 5D0QD 4BEPA 2P2CP 5AENA 2OVFA 4APFA 4FA6A 2C0MA 2MYOA 1KZPA 2KXPC 5EDSA 4G11A 1UN9A 3EDTB 5CRVA 4HOQA 1TNUA 4JHKA 4O1OA 5EYPF 3MV3B 4HB5A 5KJLA 3NZUA 1HU3A 3D3MA 3TXNA 4EBAG 1OCZE 5A6CA 3MKQB 4AY5A 2BKKB 3FP3A 5KNHD 4B94A 2GW1A 2P9PG 2AXVA 4GYOA 2X6HA 5T4YA 4UUCA 3IHVA 5BW8C 4GMJA 3OXGA 2ZGDA 5BUZA 2H6GA 1TNOA 1HX8A 1H19A 3QWVA 1N9AA 5AQ9A 5T8IA 2WMNA 1E7UA 4ILIA 3NB2A 2GROB 4PDXA 5ENRD 4JHRA 5H7PA 3UUXA 4FLBA 1JCQA 1K8KG 3RO3A 3LY9A 4JVSA 5CMWA 1MX4A 4J8DA 3FU5A 2OEWA 4NIKA 3E34A 3ZNGA 5ITZF 4N3AA 2EQXA 3WG7E 3CLJA 3D9JA 2R59A 4DX2A 3J5QB 4HRMB 1S70B 3SQVA 3U64A 1UN8A 3LS8A 4AIFA 4ABNA 4A55A 4DRXE 2KCLA 4FU3A 3PE3A 2E2EA 3ZXSA 3EU5A 2NXPA 4PS8A 3DSSA 2F37A 4G8KA 1K1AA 4Y6CA 4LEUA 2YNQA 4LERA 4F7AA 2EIME 2VSOE 3V31A 3C3OA 3CEQA 2WXKA 3F6QA 4KVOA 5HKPA 1FCHA 3E30A 4HLLA 4DLQA 3FUNA 3LPZA 3N71A 4I6JA 1N4QA 1S63A 1ZU2A 3FFLA 3SD5A 3PRZA 2HR2A 3KAEA 2XS8A 1IQRA 1TN8A 3HXFA 4AVXA 3SI5A 2VGXB 5EN5D 3EHMA 4GTQA 3V2XA 5G05C 5FZRA 4ACLA 1JPLA 1HH8A 3CHQA 1SW6A 4I1AA 2X6JA 4XEIG 3UMVA 5BNWA 3AU5A 4WWNA 4MBGA 3DSVA 3DEPA 2I2OA 2IF4A 4G26A 3ML8A 4U8HA 4J8FA 1OWMA 1TJCA 4CYMD 3HXEA 4MKTA 3V30A 3ESLA 4CCAA 4DLOA 5B1BE 3SBSA 3MX3A 2RG8A 5CHEE 5FQ6A 3FUKA 4YDEA 1N0QA 4LNUD 2L0IA 4K5CA 5LFAA 2ETAA 3APCA 5JJ6A 1QNFA 4PH4B 4KBQA 4RSYA 4WAFA 2GRQB 3E32A 3VLFA 2F0YA 2I9CA 1IHGA 3B7BA 1G3NB 4WNEA 3R7QA 2FULA 3HVEA 4I17A 2CHXA 1V55E 3J5PA 4GPMA 2V5QC 3RRNB 1OWLA 1X81A 5D0OD 3LVQE 4E6HA 5J90A 4EZKA 1BI7B 3UT7A 2Y69E 1HFAA 5BV1A 1E96B 2CG3A 2XEHA 3PZDA 4E85A 4NQ0A 4K5AB 5AQBA 3OAWA 2Q7FA 2FF4A 3FUFA 3AJIA 3HIZA 2HO1A 5ENOD 4C0MA 2DBAA 3ZIMA 3TWXA 1TNYA 4ATGA 1QBQA 4L9PA 2YHCA 4QFVA 4GB9A 3ZXPA 4TUMA 2UY1A 4HS2A 3RJVA 4DX5D 2ETBA 3AG1E 4HOTA 4J6IA 5EKQD 2X3MA 2X38A 3GZ2A 4WWOA 3TWTA 4FADA 4KYOB 1YA0A 5FTPA 2M63A 5JMND 3U66A 3RSEG 4L2YA 1Z6TA 3FUMA 1O5MA 3D9MA 4B93B 3VTXA 4P29A 2DCPA 2LAIA 4H7XA 4K0RA 4CGVA 5FIOA 2I6HA 2KC7A 2A5EA 3LYAA 1JCRA 3BG0B 4GU5A 3UPVA 4UWGA 4GTSA 3JXJA 2XHEA 4WNFA 2XEEA 2E0IA 5EIDA 2R02A 3Q78A 4M3OA 4GTOA 5G05J 4B8CB 3GW4A 3RRUA 4G1TA 4APOA 3D9NA 3CVYA 4GTPA 1QYMA 1WY6A 2ILRA 5ARGA 1RZ4A 3D9IA 1XNFA 1GW6A 4L1BA 2AWIA 2FBNA 2WXFA 2V5FA 1IQUA 3Q4AB 2IU1A 4HOUA 4DX7D 2OEVA 4F1PA 4F3VA 4DX6D 4F6RD 3ULYA 1DCQA 3SY2A 4ZHBA 5A7DB 2J9QA 3EHNA 5CMYA 3PZ1A 3ASGA 1E90A 2B0OE 3C5RA 2WQHA 2IJGX 3B7UX 5LCWJ 4AXHA 5FQ4A 4EQFA 4GZ3A 2AW6A 3OXFA 3HDXA 5FQ7A 1OT8A 3S7BA 5KJNA 2IOLA 3AG2E 3DWLG 1KZOA 3NBNB 3TXMA 1EPUA 2DZOA 5LOZA 3TWSA 1P5QA 3ZHEB 4EHMA 1N95A 2ETCA 4OAVB 1O1SA 1ZB1A 1A17A 1YCSB 2PL2A 1B89A 2YQ8A 2ONDA 2XS1A 3MJWA 3UKUG 3G2UA 3HHMA 3FU0A 3PREA 4JA9A 2KZTB 3UKRG 1UG3A 1NA0A 3B95A 2AXUA 2WQ6A 3ONKA 4GPKA 4KZ0A 4ANVA 3KEAA 3QARA 3JXIA 3CVQA 4TV3A 2QYUA 2AVPA 5DBKA 3IEGA 1MX2A 3DPYA 3UT4A 1N52A 5AIJA 3CHPA 1N94A 4UQZA 3VLDA 3G2WA 3ZFWA 4F53A 3DBSA 3S7FA 3GZSA 4N39A 3DXKG 4WNDA 1MYOA 2BTDA 2OV8A 2Y3AA 5BXUA 1N54A 2XPIA 3JQ1A 2DIWA 1N4PA 3ZW3A 4HI8A 3MKQA 3ZEFA 2F8YA 3BEEA 2KBXA 5FWQA 1A5EA 3UXGA 3ASHA 2WVIA 4EECA 1N11A 1TNZA 2J8SD 3SFXA 4BT8A 3EIQC 1E8XA 1KT1A 4CRWA 3MZLB 2KM4A 3QC1A 5LX8A 1HE8A 4NURA 4CT0A 5E75A 3DXMG 5AN8A 2L0TB 1SQMA 2XPZA 5C2YA 3CK9A 5C1DA 4AV7A 2P9IG 3ESKA 4A1GA 3HXDA 5EX0A 4HI9A 1BD8A 3QAQA 3FH5A 2NC9A 3ZU7B 4CZ2D 4XE0A 1OXJA 3SBTB 1UJJA 4EZLA 5FQ8A 1XGWA 4FP7A 3RO2A 3UX4A 4BERA 4TUUA 1MJ0A 2WXQA 3CQCB 2WXMA 4YDOA 4JZYA 3RAUA 2J08A 2WXIA 4UWKA 2ZU6B 3B7SA 2P9UG 3UI2A 3FEYA 2OCCE 4JW1A 3CQGB 2GGFA 3FU3A 2PQRA 3UQ3A 2XZDG 1Q2ZA 4U0ZA 3QWPA 2H6IA 2FI7A 3CKCA 4UWFA 4L7TA 4N5QA 2MOWA 1SZ9A 1JCSA 3APFA 4B8AA 1TN6A 3CR3A 3ULQA 3KS2A 2EINE 4GCNA 2L9BA 3FTWA 2XQ0A 5AJDA 3FH7A 2IOSA 3CVXA 1TEZA 2VJ8A 3Q49B 3JYSA 3ONLA 1TN7A 3L16A 1OWOA 3B13A 2VGXA 2DVWA 2ZXWE 1FPPA 3ZPJA 3CKBA 1U2VG 3Q47B 4EZJA 2JLBA 2P9NG 3UM0A 4GTVA 1Z3XA 5CRUA 4YVQC 1N0RA 3RK6A 5A23A 1NL4A 1SZAA 4D10C 3U9WA 4AM9A 2X6FA 4GZCA 2F8XK 4N5CA 1MX6A 4CDRA 1FVFA 2CG2A 2ZGGA 3LY8A 4GAAA 5M72A 4EPZA 3I5PA 4GMLA 3CIAA 4L2LA 2R05A 1S0PA 3ASNE 4TRQA 2LXMA 4XKBA 3OTNA 1UOHA 3GYZA 3SFZA 4HRLA 2JEKA 2IO2C 4RG6A 4XI9A 1OWNA 3FUJA 4RVBA 5JHAA 3AS4A 5JJ7A 1O1RA 1OCOE 3L13A 4LRZA 1HXIA 4DI4A 4G2VA 1OY3D 2V4LA 3BQOA 4PUCA 3Q9UC 2RFMA 2PNNA 1K3ZD 5LCWC 1MZCA 3QJZA 4MLPA 4EBAA 2VSXE 1K1BA 4U0SA 1PY1A 3FU6A 3Q9NC 3LEWA 1U3DA 3BU8A 2MHKA 3PH0C 3CVUA 4O6FA 4YDWA
chains in the Genus database with same CATH topology
2GRRB 3UINC 3UIPC 2GRNB 2IO3C 2IO2C 1Z5SC 2GROB 5D2MC 1KPSB 2GRPB 3UIOC 2IY0C 2GRQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRR B;  3UIN C;  3UIP C;  2GRN B;  2IO3 C;  2IO2 C;  1Z5S C;  2GRO B;  5D2M C;  1KPS B;  2GRP B;  3UIO C;  2IY0 C;  2GRQ B; 
#chains in the Genus database with same CATH topology
 3DSW A;  3NQP A;  4JC8 A;  1X5B A;  4A1S A;  3G2S A;  4UI9 J;  3VTY A;  3D9L A;  4FJY A;  4I2Z A;  2RFA A;  3CHM A;  1BU9 A;  4G8L A;  5ARF A;  3EIJ A;  5D66 A;  4ILH B;  5ENN A;  3QOU A;  4KXK B;  5G04 C;  4I1O B;  3QB2 A;  1LF8 A;  2JAB A;  2L6J A;  3FWV A;  2XPY A;  5ENT D;  1JUQ A;  4TXP A;  5BV0 A;  3S2A A;  4U04 A;  3CVN A;  4G24 A;  5KJK A;  1WM5 A;  3IHY A;  2HE0 A;  1HO8 A;  2HYZ A;  2PZI A;  3EJN A;  3RU0 A;  4Q69 A;  1TJF A;  3CVW A;  1NA3 A;  5BT1 A;  2J07 A;  5IY5 E;  1NZN A;  1NFI E;  3LXU X;  3Q15 A;  3TWW A;  4K5B A;  2Y4T A;  4C9B B;  2PM6 A;  3TL5 A;  2L6B A;  4DJA A;  3ENE A;  1YYH A;  4BT9 A;  4CDN A;  4DI3 A;  4AY6 A;  4IN3 B;  3ZYL A;  2WPV A;  4TXR A;  4HBD A;  3FTS A;  3ISM C;  2Y4U A;  5DIZ A;  4BET A;  4MS6 A;  2A4Z A;  3RRM B;  4XI0 A;  3DEO A;  3JQ0 A;  3JUE A;  2VGY A;  3P2B A;  2EIJ E;  2NYJ A;  3L82 A;  3NF1 A;  3ZYQ A;  4I1M A;  3L17 A;  3EHQ A;  3JCK C;  4XKC A;  3Q5M A;  3C3R A;  4N2S A;  3LJN A;  5KNG A;  3LY7 A;  5CED B;  3T9K A;  4IUL A;  3FY4 A;  4JEU A;  1SA4 A;  3UIN C;  2KCV A;  4KMO A;  2WXJ A;  5CEC B;  3L08 A;  1AP7 A;  2I1J A;  2C2L A;  4GYW A;  3LCA A;  4ATZ D;  3BUA A;  3ZN3 A;  2GRM A;  4DK5 A;  1PAQ A;  3SF4 A;  5ENQ D;  5JJT A;  5ENP D;  2WB2 A;  2P9L G;  2UWJ G;  1D9S A;  2C0L A;  1IYG A;  3PUK A;  2MRI A;  1DVP A;  3PZ4 A;  2LSU A;  4G25 A;  1O1T A;  2R2L A;  1V54 E;  2CHZ A;  2IY0 C;  1NI1 A;  2V8S E;  3TJP A;  1W3B A;  3HXC A;  2I1K A;  3D9K A;  3ZHE A;  2IQC A;  1IXV A;  2YHE A;  4TXQ A;  4X8Q A;  3FHE A;  4LG6 A;  3FH8 A;  5CCL A;  3FTZ A;  3U3W A;  4GYY A;  3JUI A;  2QZA A;  2WXG A;  3AS5 A;  3ZVV A;  4FLH A;  4GTM A;  3HRA A;  2VGE A;  4HQD A;  3DST A;  3C3Q A;  4F1S A;  4WWP A;  5G2N A;  2PM7 A;  3TWR A;  3FDH A;  2XCB A;  2KZT A;  2XCC A;  1HS6 A;  4K03 A;  1U3C A;  1E8Z A;  2XRZ A;  1KPS B;  2HM8 A;  5G04 J;  4OVV A;  1VDY A;  1Y8M A;  4AEZ C;  5FT9 A;  4AOF A;  3OXL A;  4HFG A;  3Q73 A;  4LUN U;  5HI7 A;  4H7Y A;  2WMO A;  3BG1 B;  1FT1 A;  4DX1 A;  3MYV A;  3PS6 A;  4Q94 A;  4GA1 A;  3R7R A;  4IYP A;  3QWW A;  4BFR A;  4OYS A;  3Q7A A;  2LSV A;  4A3T A;  5D2M C;  3G2V A;  1TYQ G;  1HG2 A;  4GA0 A;  5CBO A;  4ANW A;  3WXX A;  3AAA C;  1E8Y A;  2VTB B;  1AWC B;  2BUG A;  4WNG A;  4LNB A;  3CHR A;  2FO7 A;  3CHS A;  4BWR A;  2EIL E;  4U95 D;  1H2V C;  5AJL A;  2FEZ A;  5FZS A;  4V3I A;  1PC2 A;  3SO8 A;  1H6P A;  2R5S A;  4FHK A;  3FUI A;  2WQ7 A;  3U4T A;  3NZS A;  1E7V A;  4FJZ A;  4CDM A;  2VYI A;  1HG5 A;  4WUY A;  2LO6 A;  2H6H A;  1H6O A;  3TGO A;  3CVP A;  4RQI A;  2ION A;  3ZYK A;  4GTT A;  5T3R A;  4BY6 A;  1Y6I A;  4FHJ A;  3L6A A;  3LKU A;  1EF1 C;  4I9E A;  4C0E A;  3L22 A;  3UT8 A;  1QZ2 A;  3FTV A;  4UI9 C;  1SA5 A;  3PVL A;  2LAH A;  4KVM A;  3CVL A;  1SVX A;  2J4B A;  5CCM A;  4BES A;  2WXN A;  4I6G A;  3KEZ A;  3PEV B;  1LD8 A;  4MRU A;  3D9P A;  3T5X A;  4LCT A;  4NRH B;  1Z5S C;  3APD A;  1KLX A;  4CEM A;  4Z68 A;  4ANU A;  3E33 A;  3SNX A;  3FUH A;  1DC2 A;  3D9H A;  2FO1 E;  3IKO B;  1UW4 B;  3QKY A;  5ANR A;  3NOG D;  2GRR B;  3DSX A;  4URK A;  3FTU A;  4N3B A;  2QFC A;  3FUD A;  4U8V D;  1ELW A;  3HXB A;  1MHQ A;  4ILG A;  5E76 A;  3DSU A;  3LDZ A;  3PEU B;  4J0U A;  3HYM B;  2V0P A;  5LP0 A;  1FT2 A;  4YND A;  1KT0 A;  5EYL A;  5AYW D;  3CHO A;  2XRY A;  1WDY A;  2J4D A;  5BXO A;  3E4B A;  2X6I A;  3Q7F A;  3AU4 A;  1EYH A;  2AXZ A;  2CFU A;  4KT6 B;  4BSX A;  2DZN A;  3UTM A;  1ELK A;  5B1A E;  4I43 A;  1BI8 B;  4JB8 P;  5KWD A;  2OVB A;  3V2O A;  4A63 B;  4HNA D;  5KJM A;  3L54 A;  3EU9 A;  4J8S A;  4HLE A;  3V79 K;  1BLX B;  3RKV A;  4W9R A;  2WXL A;  3PZ3 A;  1LTX A;  3KSL A;  4IRU A;  2XEV A;  2IO3 C;  2A5U A;  2V4H C;  3T8K A;  2GRP B;  3FTY A;  4AJW A;  1E8W A;  4KZC A;  1DCE A;  4HOS A;  4U63 A;  4JL0 A;  4GZ5 A;  4HOR A;  5FIN A;  1JWF A;  1OCR E;  4O1P A;  3DPD A;  5KBA A;  2QY7 A;  2X6K A;  2J49 A;  2LUH A;  1H2T C;  5EIB E;  2P58 C;  2VSY A;  4GTR A;  4GMR A;  2GRN B;  2IFU A;  5J08 A;  3UIO C;  4DPR A;  1H2U A;  4PS3 A;  3TWU A;  4CGW A;  3MGB A;  2Y0B G;  2BF0 X;  2B6C A;  3LJ3 A;  3MEK A;  4YVO A;  5G55 A;  3C98 A;  2H6F A;  2PQN A;  1ELR A;  1IHB A;  4ME2 A;  5BPP A;  2LNI A;  2BED A;  4GZD A;  4UQY A;  5FJY A;  3NAW A;  3EUV A;  3PNT B;  2J09 A;  4UWL A;  4Y6W A;  1N4S A;  3SZ7 A;  3P1U A;  4R7L A;  3IBE A;  2R03 A;  3CSF A;  3PNL B;  2CFZ A;  5HRY A;  3URZ A;  4U8Y D;  3L9T A;  3ML9 A;  2LXL A;  3ABL E;  4U96 D;  1OUV A;  3HG0 D;  1HZ4 A;  3QNK A;  4JPS A;  4Q96 A;  3SHF A;  4L23 A;  1OWP A;  3MKR A;  3UM1 A;  2QYJ A;  4U0U A;  3CGH A;  4ANX A;  4BX8 A;  1ZBP A;  3ZKJ A;  2GRL A;  2DWZ A;  4N3C A;  3HVE B;  4UWH A;  2ZIR A;  3RIB A;  2XZT G;  2R17 C;  4M7C A;  3CVV A;  3TWQ A;  3T5V A;  2RD0 A;  4I6E A;  4GZ6 A;  4ACK A;  2VQ2 A;  1DNP A;  4I2W A;  3FUL A;  4JHJ A;  1QQE A;  3IV0 A;  1N4R A;  3QK0 A;  3MCX A;  5KCM A;  4QQI A;  3S7D A;  3UM2 A;  3ASD A;  4BSZ B;  5ANL A;  5CBN A;  1D8D A;  5HS0 A;  3KSQ A;  2XGO A;  3IXE A;  4RLY A;  5AQ7 A;  3ZYM A;  3TG4 A;  3GZ1 A;  3ULE G;  2UY1 B;  1EDU A;  3LVR E;  3Q79 A;  3R9M A;  1S64 A;  3DRA A;  5ENS D;  3AS8 A;  2BKG A;  4LSZ E;  4HXI A;  2ZIS A;  4LNG A;  4JEH A;  4CT4 A;  2WXR A;  3O48 A;  4UQX A;  2WM9 A;  2IEJ A;  2CHW A;  4U07 A;  5AAO A;  3D9O A;  3E37 A;  1HF8 A;  4AP2 A;  5CER B;  3EHR A;  5EIL A;  2WXO A;  3CK7 A;  4FUL A;  3MA5 A;  2NSZ A;  3G2T A;  1RW2 A;  4DUI A;  1LD7 A;  1WG0 A;  3UM3 A;  4UI9 K;  4BTA A;  3K9I A;  1NP7 A;  3FUE A;  1H0A A;  3PE4 A;  4A3V A;  3I4R B;  4O60 A;  3VLE A;  3FTX A;  2DYS E;  3SGH A;  3CST A;  2YIN A;  5AQA A;  3S7J A;  1YMP A;  3ASF A;  4HRN A;  4B89 A;  1FVH A;  3W9G A;  4HVB A;  1L5J A;  4J8E A;  3TG5 A;  3PZ2 A;  3PDN A;  2XEN A;  5EX3 A;  4I9C A;  5FZQ A;  4NAC A;  3NOC D;  3X2Q E;  3UIP C;  4XX5 A;  1MQS A;  2EIK E;  3QDN A;  2RKK A;  1Z3Y A;  2OOE A;  3C72 A;  3CV0 A;  3I4G A;  3ZRH A;  3MV2 B;  3PUJ A;  2WXH A;  3I3N A;  1TNB A;  4YDY A;  5CEA A;  4J8Y A;  3ZGQ A;  4GA2 A;  4FC8 A;  4GCO A;  4OVU A;  3CK8 A;  2XGS A;  2XGM A;  4BTB A;  3B7T A;  4ZFH A;  1JWG A;  3ZUV B;  1INZ A;  1D8E A;  3AG4 E;  4XZ4 A;  5B3S E;  3SFY A;  1H6K A;  4JA7 A;  1BPO A;  5JHB A;  1IKN D;  5AAR A;  4RG9 A;  1UJK A;  4U7E B;  4G23 A;  4C48 B;  4PS7 A;  1TR4 A;  3B7R L;  4XIF A;  3FEX A;  4BX9 A;  3TAX A;  2VSN A;  3R9A B;  4N2Q A;  2P9S G;  4JD2 G;  2QC9 A;  4JXT A;  2KCK A;  3ABM E;  2VTB A;  2P9K G;  3O4Z A;  3W9F A;  4OAU C;  1OCC E;  3AG3 E;  3TWV A;  2WXP A;  3ASO E;  5HQ8 A;  2Y1L E;  3Q75 A;  3KD7 A;  4B0Z A;  3T8M A;  2AJA A;  3ABK E;  2KAT A;  4J7W A;  5JA4 D;  1WAO 1;  2DYR E;  5D0Q D;  4BEP A;  2P2C P;  5AEN A;  2OVF A;  4APF A;  4FA6 A;  2C0M A;  2MYO A;  1KZP A;  2KXP C;  5EDS A;  4G11 A;  1UN9 A;  3EDT B;  5CRV A;  4HOQ A;  1TNU A;  4JHK A;  4O1O A;  5EYP F;  3MV3 B;  4HB5 A;  5KJL A;  3NZU A;  1HU3 A;  3D3M A;  3TXN A;  4EBA G;  1OCZ E;  5A6C A;  3MKQ B;  4AY5 A;  2BKK B;  3FP3 A;  5KNH D;  4B94 A;  2GW1 A;  2P9P G;  2AXV A;  4GYO A;  2X6H A;  5T4Y A;  4UUC A;  3IHV A;  5BW8 C;  4GMJ A;  3OXG A;  2ZGD A;  5BUZ A;  2H6G A;  1TNO A;  1HX8 A;  1H19 A;  3QWV A;  1N9A A;  5AQ9 A;  5T8I A;  2WMN A;  1E7U A;  4ILI A;  3NB2 A;  2GRO B;  4PDX A;  5ENR D;  4JHR A;  5H7P A;  3UUX A;  4FLB A;  1JCQ A;  1K8K G;  3RO3 A;  3LY9 A;  4JVS A;  5CMW A;  1MX4 A;  4J8D A;  3FU5 A;  2OEW A;  4NIK A;  3E34 A;  3ZNG A;  5ITZ F;  4N3A A;  2EQX A;  3WG7 E;  3CLJ A;  3D9J A;  2R59 A;  4DX2 A;  3J5Q B;  4HRM B;  1S70 B;  3SQV A;  3U64 A;  1UN8 A;  3LS8 A;  4AIF A;  4ABN A;  4A55 A;  4DRX E;  2KCL A;  4FU3 A;  3PE3 A;  2E2E A;  3ZXS A;  3EU5 A;  2NXP A;  4PS8 A;  3DSS A;  2F37 A;  4G8K A;  1K1A A;  4Y6C A;  4LEU A;  2YNQ A;  4LER A;  4F7A A;  2EIM E;  2VSO E;  3V31 A;  3C3O A;  3CEQ A;  2WXK A;  3F6Q A;  4KVO A;  5HKP A;  1FCH A;  3E30 A;  4HLL A;  4DLQ A;  3FUN A;  3LPZ A;  3N71 A;  4I6J A;  1N4Q A;  1S63 A;  1ZU2 A;  3FFL A;  3SD5 A;  3PRZ A;  2HR2 A;  3KAE A;  2XS8 A;  1IQR A;  1TN8 A;  3HXF A;  4AVX A;  3SI5 A;  2VGX B;  5EN5 D;  3EHM A;  4GTQ A;  3V2X A;  5G05 C;  5FZR A;  4ACL A;  1JPL A;  1HH8 A;  3CHQ A;  1SW6 A;  4I1A A;  2X6J A;  4XEI G;  3UMV A;  5BNW A;  3AU5 A;  4WWN A;  4MBG A;  3DSV A;  3DEP A;  2I2O A;  2IF4 A;  4G26 A;  3ML8 A;  4U8H A;  4J8F A;  1OWM A;  1TJC A;  4CYM D;  3HXE A;  4MKT A;  3V30 A;  3ESL A;  4CCA A;  4DLO A;  5B1B E;  3SBS A;  3MX3 A;  2RG8 A;  5CHE E;  5FQ6 A;  3FUK A;  4YDE A;  1N0Q A;  4LNU D;  2L0I A;  4K5C A;  5LFA A;  2ETA A;  3APC A;  5JJ6 A;  1QNF A;  4PH4 B;  4KBQ A;  4RSY A;  4WAF A;  2GRQ B;  3E32 A;  3VLF A;  2F0Y A;  2I9C A;  1IHG A;  3B7B A;  1G3N B;  4WNE A;  3R7Q A;  2FUL A;  3HVE A;  4I17 A;  2CHX A;  1V55 E;  3J5P A;  4GPM A;  2V5Q C;  3RRN B;  1OWL A;  1X81 A;  5D0O D;  3LVQ E;  4E6H A;  5J90 A;  4EZK A;  1BI7 B;  3UT7 A;  2Y69 E;  1HFA A;  5BV1 A;  1E96 B;  2CG3 A;  2XEH A;  3PZD A;  4E85 A;  4NQ0 A;  4K5A B;  5AQB A;  3OAW A;  2Q7F A;  2FF4 A;  3FUF A;  3AJI A;  3HIZ A;  2HO1 A;  5ENO D;  4C0M A;  2DBA A;  3ZIM A;  3TWX A;  1TNY A;  4ATG A;  1QBQ A;  4L9P A;  2YHC A;  4QFV A;  4GB9 A;  3ZXP A;  4TUM A;  2UY1 A;  4HS2 A;  3RJV A;  4DX5 D;  2ETB A;  3AG1 E;  4HOT A;  4J6I A;  5EKQ D;  2X3M A;  2X38 A;  3GZ2 A;  4WWO A;  3TWT A;  4FAD A;  4KYO B;  1YA0 A;  5FTP A;  2M63 A;  5JMN D;  3U66 A;  3RSE G;  4L2Y A;  1Z6T A;  3FUM A;  1O5M A;  3D9M A;  4B93 B;  3VTX A;  4P29 A;  2DCP A;  2LAI A;  4H7X A;  4K0R A;  4CGV A;  5FIO A;  2I6H A;  2KC7 A;  2A5E A;  3LYA A;  1JCR A;  3BG0 B;  4GU5 A;  3UPV A;  4UWG A;  4GTS A;  3JXJ A;  2XHE A;  4WNF A;  2XEE A;  2E0I A;  5EID A;  2R02 A;  3Q78 A;  4M3O A;  4GTO A;  5G05 J;  4B8C B;  3GW4 A;  3RRU A;  4G1T A;  4APO A;  3D9N A;  3CVY A;  4GTP A;  1QYM A;  1WY6 A;  2ILR A;  5ARG A;  1RZ4 A;  3D9I A;  1XNF A;  1GW6 A;  4L1B A;  2AWI A;  2FBN A;  2WXF A;  2V5F A;  1IQU A;  3Q4A B;  2IU1 A;  4HOU A;  4DX7 D;  2OEV A;  4F1P A;  4F3V A;  4DX6 D;  4F6R D;  3ULY A;  1DCQ A;  3SY2 A;  4ZHB A;  5A7D B;  2J9Q A;  3EHN A;  5CMY A;  3PZ1 A;  3ASG A;  1E90 A;  2B0O E;  3C5R A;  2WQH A;  2IJG X;  3B7U X;  5LCW J;  4AXH A;  5FQ4 A;  4EQF A;  4GZ3 A;  2AW6 A;  3OXF A;  3HDX A;  5FQ7 A;  1OT8 A;  3S7B A;  5KJN A;  2IOL A;  3AG2 E;  3DWL G;  1KZO A;  3NBN B;  3TXM A;  1EPU A;  2DZO A;  5LOZ A;  3TWS A;  1P5Q A;  3ZHE B;  4EHM A;  1N95 A;  2ETC A;  4OAV B;  1O1S A;  1ZB1 A;  1A17 A;  1YCS B;  2PL2 A;  1B89 A;  2YQ8 A;  2OND A;  2XS1 A;  3MJW A;  3UKU G;  3G2U A;  3HHM A;  3FU0 A;  3PRE A;  4JA9 A;  2KZT B;  3UKR G;  1UG3 A;  1NA0 A;  3B95 A;  2AXU A;  2WQ6 A;  3ONK A;  4GPK A;  4KZ0 A;  4ANV A;  3KEA A;  3QAR A;  3JXI A;  3CVQ A;  4TV3 A;  2QYU A;  2AVP A;  5DBK A;  3IEG A;  1MX2 A;  3DPY A;  3UT4 A;  1N52 A;  5AIJ A;  3CHP A;  1N94 A;  4UQZ A;  3VLD A;  3G2W A;  3ZFW A;  4F53 A;  3DBS A;  3S7F A;  3GZS A;  4N39 A;  3DXK G;  4WND A;  1MYO A;  2BTD A;  2OV8 A;  2Y3A A;  5BXU A;  1N54 A;  2XPI A;  3JQ1 A;  2DIW A;  1N4P A;  3ZW3 A;  4HI8 A;  3MKQ A;  3ZEF A;  2F8Y A;  3BEE A;  2KBX A;  5FWQ A;  1A5E A;  3UXG A;  3ASH A;  2WVI A;  4EEC A;  1N11 A;  1TNZ A;  2J8S D;  3SFX A;  4BT8 A;  3EIQ C;  1E8X A;  1KT1 A;  4CRW A;  3MZL B;  2KM4 A;  3QC1 A;  5LX8 A;  1HE8 A;  4NUR A;  4CT0 A;  5E75 A;  3DXM G;  5AN8 A;  2L0T B;  1SQM A;  2XPZ A;  5C2Y A;  3CK9 A;  5C1D A;  4AV7 A;  2P9I G;  3ESK A;  4A1G A;  3HXD A;  5EX0 A;  4HI9 A;  1BD8 A;  3QAQ A;  3FH5 A;  2NC9 A;  3ZU7 B;  4CZ2 D;  4XE0 A;  1OXJ A;  3SBT B;  1UJJ A;  4EZL A;  5FQ8 A;  1XGW A;  4FP7 A;  3RO2 A;  3UX4 A;  4BER A;  4TUU A;  1MJ0 A;  2WXQ A;  3CQC B;  2WXM A;  4YDO A;  4JZY A;  3RAU A;  2J08 A;  2WXI A;  4UWK A;  2ZU6 B;  3B7S A;  2P9U G;  3UI2 A;  3FEY A;  2OCC E;  4JW1 A;  3CQG B;  2GGF A;  3FU3 A;  2PQR A;  3UQ3 A;  2XZD G;  1Q2Z A;  4U0Z A;  3QWP A;  2H6I A;  2FI7 A;  3CKC A;  4UWF A;  4L7T A;  4N5Q A;  2MOW A;  1SZ9 A;  1JCS A;  3APF A;  4B8A A;  1TN6 A;  3CR3 A;  3ULQ A;  3KS2 A;  2EIN E;  4GCN A;  2L9B A;  3FTW A;  2XQ0 A;  5AJD A;  3FH7 A;  2IOS A;  3CVX A;  1TEZ A;  2VJ8 A;  3Q49 B;  3JYS A;  3ONL A;  1TN7 A;  3L16 A;  1OWO A;  3B13 A;  2VGX A;  2DVW A;  2ZXW E;  1FPP A;  3ZPJ A;  3CKB A;  1U2V G;  3Q47 B;  4EZJ A;  2JLB A;  2P9N G;  3UM0 A;  4GTV A;  1Z3X A;  5CRU A;  4YVQ C;  1N0R A;  3RK6 A;  5A23 A;  1NL4 A;  1SZA A;  4D10 C;  3U9W A;  4AM9 A;  2X6F A;  4GZC A;  2F8X K;  4N5C A;  1MX6 A;  4CDR A;  1FVF A;  2CG2 A;  2ZGG A;  3LY8 A;  4GAA A;  5M72 A;  4EPZ A;  3I5P A;  4GML A;  3CIA A;  4L2L A;  2R05 A;  1S0P A;  3ASN E;  4TRQ A;  2LXM A;  4XKB A;  3OTN A;  1UOH A;  3GYZ A;  3SFZ A;  4HRL A;  2JEK A;  2IO2 C;  4RG6 A;  4XI9 A;  1OWN A;  3FUJ A;  4RVB A;  5JHA A;  3AS4 A;  5JJ7 A;  1O1R A;  1OCO E;  3L13 A;  4LRZ A;  1HXI A;  4DI4 A;  4G2V A;  1OY3 D;  2V4L A;  3BQO A;  4PUC A;  3Q9U C;  2RFM A;  2PNN A;  1K3Z D;  5LCW C;  1MZC A;  3QJZ A;  4MLP A;  4EBA A;  2VSX E;  1K1B A;  4U0S A;  1PY1 A;  3FU6 A;  3Q9N C;  3LEW A;  1U3D A;  3BU8 A;  2MHK A;  3PH0 C;  3CVU A;  4O6F A;  4YDW A; 
#chains in the Genus database with same CATH homology
 2GRR B;  3UIN C;  3UIP C;  2GRN B;  2IO3 C;  2IO2 C;  1Z5S C;  2GRO B;  5D2M C;  1KPS B;  2GRP B;  3UIO C;  2IY0 C;  2GRQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...