5D2MC

Complex between human sumo2-rangap1, ubc9 and znf451
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
158
structure length
158
Chain Sequence
b'PPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Structural basis for catalytic activation by the human ZNF451 SUMO E3 ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase,protein binding
total genus 56
structure length 158
sequence length 158
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 5d2mC00
2GRPB 5D2MC 3UIPC 2GROB 2IY0C 2GRNB 2GRRB 2GRQB 2IO2C 3UIOC 2IO3C 1Z5SC 3UINC 1KPSB
chains in the Genus database with same CATH superfamily
1WAO1 2A4ZA 3UI2A 3RKVA 3B7TA 4FLHA 2R05A 2I1KA 1W3BA 3FDHA 4WAFA 4KYOB 3QK0A 4EECA 5DBKA 5KCMA 3S7JA 1PY1A 3TGOA 4GMRA 2FO7A 3LEWA 2VJ8A 2J08A 4Y6CA 2WXHA 2R59A 4EBAG 3FU5A 3DEPA 4GB9A 3PEVB 3FU0A 4LCTA 2CHXA 3JUIA 4J8FA 4FU3A 2I6HA 1OCCE 1HH8A 4DX7D 2X3MA 4V3IA 3V2XA 2KCKA 4GA1A 3T9KA 1OT8A 1O1RA 3V2OA 2JLBA 5BV0A 1IHBA 4B0ZA 1MX6A 3CVWA 3PZDA 1JWFA 3ASOE 2XQ0A 1SVXA 3CVVA 2IOSA 2DVWA 1OWOA 3WG7E 5ANLA 3LY9A 1IXVA 5JHBA 5E75A 4RG9A 2XHEA 3ZW3A 3URZA 1KPSB 2VSXE 1A17A 1ELRA 3FUKA 4CYMD 3JXJA 1FVHA 3ML8A 3AU5A 3AG4E 4JPSA 3MEKA 2VGYA 3FU3A 3HG0D 2P58C 3LPZA 2LUHA 1S70B 4O1OA 2XCBA 1X5BA 3HXFA 4ILHB 1O1TA 2DIWA 5JJ6A 2P9NG 3IHVA 1MX4A 4RVBA 1YYHA 1U3DA 5JJTA 1H6OA 4GMJA 4BSXA 1QZ2A 3PE3A 2DYRE 2P2CP 4DLQA 4N2QA 4XX5A 2PL2A 5FZQA 3MKRA 1IQUA 3ZNGA 4KZ0A 1HS6A 4JA7A 4L1BA 4IYPA 3RU0A 3PUKA 4DRXE 3ASFA 4HOQA 2XGOA 3LJ3A 3HRAA 1FPPA 2HE0A 4M7CA 2FEZA 2F37A 3D9PA 1HFAA 3JXIA 4L9PA 4EHMA 4URKA 3LKUA 4PS8A 4ANWA 2R03A 2OVFA 3HXDA 3APFA 3UKRG 2YQ8A 1RZ4A 1TJCA 1OWPA 1ZBPA 2GRMA 4BFRA 2KM4A 4Z68A 3BQOA 4RQIA 4KXKB 1FCHA 3HXCA 1Y6IA 4TRQA 2J8SD 4HOUA 4HXIA 3ULYA 2MHKA 2FO1E 4I17A 1D8EA 3TWVA 2V0PA 4GZ5A 2PM7A 4GCOA 4GPKA 3I3NA 3BUAA 4G23A 2WXFA 4ABNA 5AARA 5T8IA 1INZA 4U0UA 1ELWA 4U0ZA 4AY6A 2AJAA 1N54A 4YDOA 3CSTA 2WXRA 4EZJA 2RKKA 3LCAA 4J0UA 3D3MA 2X6IA 5AQAA 3G2VA 2KZTA 3TWUA 1LD8A 2IJGX 4B8AA 5LP0A 2DYSE 3ISMC 5DIZA 4G26A 3BG1B 5CBNA 3DSSA 4GMLA 5ANRA 2GRQB 2FF4A 2P9KG 3PE4A 2F8YA 3SY2A 1UJKA 3UINC 5G04J 3ZXPA 3J5PA 3UXGA 1A5EA 3AG1E 3S7BA 2BEDA 1UG3A 2ZGGA 4ATGA 3RRUA 3C3RA 5AN8A 1H2UA 2EQXA 3CQGB 3AS8A 4FP7A 4N3BA 3HYMB 2GRLA 4I6EA 4GTTA 1N9AA 3FEYA 3DRAA 4AOFA 2PZIA 3VTXA 3IEGA 3UTMA 3CVPA 5BW8C 5BXUA 3BEEA 2NC9A 4UI9C 4J7WA 3E30A 4PS7A 2J4BA 3TWXA 4K0RA 3FUIA 4WNDA 5HKPA 4ILIA 3BU8A 1B89A 4UWFA 4GTQA 2WVIA 3ZHEB 5BPPA 3X2QE 5LCWC 4BT9A 5AQBA 4B94A 4CT4A 1MHQA 3SF4A 4AV7A 4EZKA 2RG8A 1IQRA 4I43A 3CQCB 2V8SE 1SZAA 5A7DB 5JA4D 4A3VA 3TWRA 1N4PA 4J8EA 4DJAA 4FHKA 3UIOC 4HORA 4CDNA 4NURA 3ASGA 1YA0A 5T3RA 4QFVA 5ENOD 4HRNA 3F6QA 4X8QA 1OUVA 2P9IG 1HF8A 4G1TA 3ZXSA 4BEPA 4I9EA 5G55A 3S7FA 5AJDA 3E34A 3R9AB 1SA4A 3DSUA 4F1PA 3JCKC 1E8ZA 5KJMA 4ANVA 4WUYA 1IHGA 1E90A 3GZ1A 3JQ1A 3L82A 2XEEA 2FULA 5A6CA 4TUUA 5BXOA 3SGHA 2MRIA 4KVOA 4AJWA 3NZSA 4AY5A 3CHSA 2RD0A 4CT0A 2WB2A 2J9QA 4U07A 2F8XK 2YHCA 1E8XA 4HFGA 3ZUVB 4OAUC 4AEZC 3R7QA 2ZU6B 2Y3AA 3CSFA 4ZHBA 3LVRE 1QNFA 2ZIRA 4K5BA 1MJ0A 1O1SA 2LNIA 4XI0A 4F53A 2PQNA 4R7LA 3E32A 3FY4A 3CK8A 3DWLG 2WQHA 1V55E 2WMNA 1WM5A 4WNGA 5KWDA 3ABKE 3G2UA 2QFCA 1S0PA 4C9BB 3CLJA 3R9MA 3TG5A 1JCRA 3G2TA 4N3CA 4GAAA 2WXGA 3KEAA 2HM8A 2AW6A 3QKYA 3ZGQA 3QC1A 4Q96A 3AS4A 3PNTB 2WXKA 4HOSA 3Q7FA 4UI9K 4BX8A 2WXMA 2J07A 4JD2G 3SFYA 1N52A 3Q4AB 3FTXA 2H6FA 1EDUA 4LRZA 3SQVA 3U3WA 1TN7A 4DI3A 5CRUA 5B3SE 4CRWA 1OXJA 5CMWA 2OCCE 4KMOA 2EILE 2IQCA 2CHWA 4N5CA 4MKTA 2VGXB 3Q47B 3DSXA 4Q94A 2A5EA 4K5CA 3S7DA 2I1JA 4FADA 3TJPA 4IRUA 3L16A 4AIFA 2J49A 2ONDA 2P9LG 5T4YA 4N3AA 1OCOE 4GZ6A 3FH7A 3ZEFA 2XENA 4HLLA 4XZ4A 4EZLA 3FTUA 4U04A 3JYSA 3ZYKA 2L6JA 3CGHA 3D9JA 3EIQC 4HLEA 2CFZA 4FC8A 3RK6A 2EIKE 3QB2A 3LYAA 3Q73A 3PS6A 2ILRA 3L17A 5EX0A 2VGEA 1N95A 2B0OE 4A63B 4HI8A 4GYYA 1TEZA 1EPUA 3QDNA 3UM2A 3EDTB 4BTAA 3UM1A 3NAWA 2VYIA 3FH8A 5ARFA 2C2LA 1RW2A 2GRPB 2VSYA 4PDXA 1TJFA 4ANXA 3B7RL 2OOEA 4FJYA 5CECB 4HRLA 4MLPA 3RSEG 1XNFA 1ZB1A 5KJKA 3FTVA 3I4GA 4C0MA 4Q69A 2KATA 3SD5A 5FZSA 2QZAA 3UKUG 4P29A 4KZCA 2NXPA 4GTSA 3FTZA 2ETCA 3IHYA 5FWQA 3UT8A 4GA2A 5G05J 2WXLA 5G04C 4ZFHA 4HS2A 4F6RD 4I6GA 5BT1A 5FQ6A 2WXIA 2V4LA 4JA9A 4H7XA 1SA5A 3UMVA 2R5SA 1IKND 1JUQA 3FUNA 1XGWA 1QQEA 3V30A 3DBSA 3GW4A 4BY6A 2X38A 5AENA 2BF0X 1H0AA 3EJNA 1Z5SC 4FHJA 1N4RA 3QWVA 1KZOA 4ATZD 2WXPA 4XEIG 4E85A 1K1BA 4CGVA 3Q78A 4FLBA 3CR3A 3B13A 4JHRA 4HOTA 3QAQA 4CZ2D 4YNDA 4U95D 5J08A 3IKOB 5ENTD 2P9UG 3TG4A 3P1UA 4C48B 1G3NB 4DX5D 1E7VA 2BTDA 3NOGD 4OVVA 2XRYA 2V5FA 4LNGA 1H19A 4AM9A 3ZHEA 4DX2A 3VLFA 3FU6A 5G2NA 3ZPJA 4UQXA 1HU3A 3HXEA 4XE0A 3IBEA 2BKKB 3GZSA 4JXTA 3PNLB 2AXZA 4TXQA 1OWLA 2IFUA 5FIOA 1KZPA 3RO2A 3ML9A 5CEAA 5D0QD 2P9PG 3TWWA 2F0YA 3MV3B 2X6HA 1S63A 3HXBA 4HB5A 4B93B 3FEXA 5D0OD 5FQ8A 4F1SA 4HBDA 3CVUA 2WMOA 2ETAA 2E2EA 1PC2A 1JCQA 4WNEA 3SI5A 1EF1C 1E7UA 4JEHA 4KVMA 1AWCB 3AJIA 3LY8A 4XKBA 3KSLA 5KNHD 3ONKA 2L9BA 3ZVVA 2RFAA 3MZLB 2ZGDA 5BUZA 3DSVA 4BT8A 4HI9A 3MJWA 4GTRA 3FH5A 4G2VA 5JHAA 5KNGA 1NA3A 2QYJA 4NIKA 2IO3C 3UUXA 4DLOA 3OXFA 3D9NA 4TUMA 4CDMA 2DZNA 4ACKA 3SBTB 2IONA 4BX9A 1UN9A 5FTPA 3UT7A 3AG2E 1BD8A 1N94A 3GZ2A 3HHMA 2HR2A 2HO1A 2Y4TA 4HVBA 2VTBB 3FULA 1MYOA 2DWZA 2IF4A 2XEHA 2XS8A 4U8YD 3ZFWA 3ABME 4DPRA 1K3ZD 3Q15A 2PQRA 4M3OA 1MX2A 3DPYA 3L6AA 2XZDG 1MQSA 1E8WA 3LXUX 1HG2A 3MA5A 4YDEA 1TNUA 3FFLA 3BG0B 3CK7A 3MKQA 1UOHA 1SW6A 4DX1A 3P2BA 3CHPA 4J8YA 3EHMA 3EU9A 1NL4A 3DXKG 3PH0C 4G11A 3EIJA 3ZYLA 2OVBA 4E6HA 2I2OA 3FTYA 4QQIA 4N39A 1Z6TA 5FQ7A 4DX6D 5CHEE 3FUDA 4G24A 5CEDB 4GZ3A 2GRNB 1D8DA 1ELKA 3ASNE 4MS6A 1HX8A 2KC7A 3ZYMA 2XPYA 5CRVA 3CHRA 2J09A 2ZXWE 3CVQA 4A55A 1DCQA 2LSVA 2Q7FA 3GYZA 3CVYA 4APOA 1KLXA 3UT4A 3FTSA 4I1MA 5ENRD 3UM3A 3EHRA 2LAIA 2DZOA 1JWGA 2Y1LE 5JMND 1YMPA 1DVPA 3U9WA 1ZU2A 3MV2B 1BI8B 3AG3E 4LG6A 3U66A 3TWTA 1DNPA 4I2ZA 2L0TB 2VGXA 1H2VC 3Q75A 4EPZA 3PZ1A 2XPIA 3RRMB 3U4TA 4J6IA 1S64A 5B1AE 4EQFA 2KCVA 3RAUA 2LXMA 1WY6A 4YVOA 4GZDA 2H6GA 4GZCA 4HNAD 2OEVA 5KJNA 4HQDA 2WXJA 1D9SA 2ETBA 4NACA 3S2AA 3UQ3A 2BKGA 1BPOA 3PZ4A 4JZYA 3FUFA 2QC9A 4U96D 3HVEB 4UWGA 4JC8A 3DEOA 2UY1B 3MGBA 1L5JA 5EX3A 3MKQB 1OCZE 2ZISA 3LS8A 5AJLA 3MCXA 2QY7A 5ENNA 2WQ7A 2V4HC 1K8KG 1IYGA 4GCNA 3EUVA 3PUJA 4I1AA 1JPLA 3SNXA 2EIJE 3NQPA 2NYJA 5G05C 5EYLA 2FBNA 1SZ9A 4N5QA 5EIDA 4MBGA 3NB2A 2MOWA 5BNWA 3LY7A 3EHNA 4AVXA 4I6JA 3CVXA 3DPDA 1MZCA 4JEUA 5IY5E 2WPVA 5HRYA 3CVNA 3V31A 4PUCA 4WWOA 1O5MA 2A5UA 3B7SA 3FHEA 4JHKA 4NQ0A 2WM9A 2GGFA 3CVLA 3L13A 1TNOA 3KSQA 3K9IA 4DUIA 1WG0A 4AXHA 1UN8A 1OWMA 3C3QA 3CKCA 3O48A 3C72A 3RRNB 3SFXA 3D9LA 3VLDA 1E8YA 1TN6A 1TNZA 4U0SA 4KBQA 4DI4A 1PAQA 4APFA 4CEMA 4C0EA 3PREA 2LXLA 4O6FA 3FUHA 3DXMG 4L2LA 2UWJG 3Q7AA 2IU1A 4CGWA 4A3TA 4LEUA 3KD7A 2OEWA 2LAHA 2GRRB 2AXUA 5C1DA 3VTYA 5BV1A 4G25A 3C98A 1N0QA 1DC2A 4L23A 2WQ6A 3TXMA 1Z3YA 1N0RA 2YINA 3J5QB 4TXPA 3QWPA 4U8VD 4BTBA 4U8HA 3ZRHA 2OV8A 2XEVA 2WXNA 3FUJA 3L08A 3JUEA 4GU5A 3ESKA 3ASHA 3UM0A 5CMYA 3D9OA 4GTVA 3EHQA 2XGSA 1JCSA 1LF8A 3QNKA 1AP7A 3B95A 3CHMA 5EYPF 2PNNA 3LJNA 3I5PA 2EINE 3I4RB 3TL5A 4YVQC 1HXIA 2CHZA 1HE8A 3ZKJA 5A23A 3NF1A 4B8CB 4F7AA 3L54A 4GTPA 4J8SA 3FUEA 3PEUB 5FJYA 3U64A 1OCRE 3E4BA 4TXRA 3ULQA 4PS3A 3T8KA 4UQYA 5FINA 3B7UX 2HYZA 3CHQA 4RSYA 4DK5A 3KEZA 3G2SA 3WXXA 4O1PA 3D9KA 1N4QA 5AQ7A 1UW4B 4GTOA 3FTWA 5FT9A 3R7RA 1GW6A 3UX4A 3D9HA 2AXVA 3MYVA 4UQZA 2IY0C 2Y0BG 5D66A 3RIBA 5ENSD 2I9CA 2FI7A 3UPVA 5KBAA 1VDYA 5FZRA 2XS1A 2X6KA 2VTBA 1YCSB 3QOUA 2H6IA 3TWSA 4BERA 4U7EB 2B6CA 3QJZA 4OAVB 3Q79A 2PM6A 2XCCA 3L9TA 3FWVA 3HIZA 3HDXA 1HO8A 1BI7B 5H7PA 2DCPA 3N71A 3AAAC 1TN8A 4NRHB 4UWLA 4CDRA 5AIJA 1FVFA 4A1SA 2XPZA 4GTMA 2CG3A 5CBOA 3O4ZA 4WNFA 1Q2ZA 1P5QA 2NSZA 1Y8MA 4G8LA 4AP2A 3CIAA 2YNQA 5FQ4A 3SFZA 1H6KA 3OXLA 3SBSA 4GA0A 4IN3B 2YHEA 5EDSA 4FA6A 4JVSA 5E76A 3ASDA 2BUGA 2EIME 4I9CA 1U3CA 3CKBA 4HRMB 3OXGA 5HQ8A 3IV0A 4GYOA 3ESLA 4D10C 1HG5A 3C5RA 4LERA 3T8MA 2KXPC 2AWIA 3T5VA 4ACLA 1H2TC 5HS0A 3E33A 3KAEA 3L22A 4L2YA 3TXNA 3W9FA 4U63A 4B89A 1SQMA 1QYMA 2CG2A 4GYWA 3ONLA 2R02A 4OVUA 2X6JA 3OAWA 1U2VG 4UUCA 1TYQG 2MYOA 2Y4UA 4BWRA 2QYUA 5HI7A 2VQ2A 3V79K 5EN5D 2IO2C 3AU4A 1N11A 1BLXB 3SO8A 1TR4A 4I1OB 2R2LA 1NZNA 2H6HA 2WXOA 5LX8A 1OWNA 1QBQA 1TNYA 3DSTA 4CCAA 1NI1A 5AAOA 1N4SA 3ZIMA 3HVEA 4FJZA 2XGMA 4A1GA 2UY1A 4K03A 1H6PA 3JQ0A 1NFIE 2AVPA 1KT0A 3EU5A 4G8KA 4TV3A 3IXEA 4UWHA 4MRUA 4UWKA 2VSOE 2VSNA 3ENEA 2GW1A 1UJJA 1OY3D 3TAXA 1NA0A 4YDYA 2C0MA 2L6BA 3KS2A 1E96B 2KZTB 4KT6B 4BESA 5LFAA 5CERB 3VLEA 4RG6A 3APCA 3PVLA 2GROB 5JJ7A 2Y69E 2KCLA 3CHOA 5C2YA 1DCEA 4N2SA 1X81A 4I2WA 4JL0A 2P9SG 4LNUD 4L7TA 2V5QC 4WWNA 4W9RA 3CK9A 4IULA 3CV0A 2LSUA 4EBAA 3NBNB 1HZ4A 5AQ9A 5EILA 3ZYQA 2JEKA 2XZTG 1EYHA 3C3OA 5ENQD 1LTXA 1WDYA 1NP7A 3NZUA 3W9GA 4F3VA 3RJVA 4YDWA 5ARGA 2R17C 2KBXA 3G2WA 2C0LA 4JHJA 3NOCD 3T5XA 4ME2A 5D2MC 3Q9NC 4XIFA 1KT1A 2IEJA 3FP3A 5KJLA 4Y6WA 3LVQE 3PRZA 3RO3A 4JB8P 4RLYA 2WXQA 4H7YA 4LUNU 2IOLA 5ITZF 2JABA 3CEQA 4K5AB 4ILGA 3ZN3A 2X6FA 4FULA 3QARA 5M72A 4J8DA 4UI9J 4WWPA 3UIPC 5AYWD 1BU9A 1FT1A 3B7BA 2CFUA 3D9IA 3QWWA 5EIBE 1FT2A 5LCWJ 4ANUA 5ENPD 1LD7A 2M63A 3AS5A 3LDZA 2DBAA 2L0IA 3ZU7B 3APDA 4BSZB 5B1BE 3Q49B 4LNBA 3PZ2A 4JW1A 3SZ7A 3ULEG 4XKCA 5J90A 4BETA 4LSZE 3D9MA 5LOZA 3ABLE 3E37A 1K1AA 4OYSA 2LO6A 3FUMA 3OTNA 5CCMA 3MX3A 3SHFA 5CCLA 2RFMA 4XI9A 5EKQD 4PH4B 2E0IA 3PZ3A 1V54E 1TNBA 3Q5MA 4O60A 2J4DA 3TWQA 3DSWA 2XRZA 3PDNA 4GPMA 1Z3XA 3Q9UC
chains in the Genus database with same CATH topology
2GRPB 5D2MC 3UIPC 2GROB 2IY0C 2GRNB 2GRRB 2GRQB 2IO2C 3UIOC 2IO3C 1Z5SC 3UINC 1KPSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRP B;  5D2M C;  3UIP C;  2GRO B;  2IY0 C;  2GRN B;  2GRR B;  2GRQ B;  2IO2 C;  3UIO C;  2IO3 C;  1Z5S C;  3UIN C;  1KPS B; 
#chains in the Genus database with same CATH topology
 1WAO 1;  2A4Z A;  3UI2 A;  3RKV A;  3B7T A;  4FLH A;  2R05 A;  2I1K A;  1W3B A;  3FDH A;  4WAF A;  4KYO B;  3QK0 A;  4EEC A;  5DBK A;  5KCM A;  3S7J A;  1PY1 A;  3TGO A;  4GMR A;  2FO7 A;  3LEW A;  2VJ8 A;  2J08 A;  4Y6C A;  2WXH A;  2R59 A;  4EBA G;  3FU5 A;  3DEP A;  4GB9 A;  3PEV B;  3FU0 A;  4LCT A;  2CHX A;  3JUI A;  4J8F A;  4FU3 A;  2I6H A;  1OCC E;  1HH8 A;  4DX7 D;  2X3M A;  4V3I A;  3V2X A;  2KCK A;  4GA1 A;  3T9K A;  1OT8 A;  1O1R A;  3V2O A;  2JLB A;  5BV0 A;  1IHB A;  4B0Z A;  1MX6 A;  3CVW A;  3PZD A;  1JWF A;  3ASO E;  2XQ0 A;  1SVX A;  3CVV A;  2IOS A;  2DVW A;  1OWO A;  3WG7 E;  5ANL A;  3LY9 A;  1IXV A;  5JHB A;  5E75 A;  4RG9 A;  2XHE A;  3ZW3 A;  3URZ A;  1KPS B;  2VSX E;  1A17 A;  1ELR A;  3FUK A;  4CYM D;  3JXJ A;  1FVH A;  3ML8 A;  3AU5 A;  3AG4 E;  4JPS A;  3MEK A;  2VGY A;  3FU3 A;  3HG0 D;  2P58 C;  3LPZ A;  2LUH A;  1S70 B;  4O1O A;  2XCB A;  1X5B A;  3HXF A;  4ILH B;  1O1T A;  2DIW A;  5JJ6 A;  2P9N G;  3IHV A;  1MX4 A;  4RVB A;  1YYH A;  1U3D A;  5JJT A;  1H6O A;  4GMJ A;  4BSX A;  1QZ2 A;  3PE3 A;  2DYR E;  2P2C P;  4DLQ A;  4N2Q A;  4XX5 A;  2PL2 A;  5FZQ A;  3MKR A;  1IQU A;  3ZNG A;  4KZ0 A;  1HS6 A;  4JA7 A;  4L1B A;  4IYP A;  3RU0 A;  3PUK A;  4DRX E;  3ASF A;  4HOQ A;  2XGO A;  3LJ3 A;  3HRA A;  1FPP A;  2HE0 A;  4M7C A;  2FEZ A;  2F37 A;  3D9P A;  1HFA A;  3JXI A;  4L9P A;  4EHM A;  4URK A;  3LKU A;  4PS8 A;  4ANW A;  2R03 A;  2OVF A;  3HXD A;  3APF A;  3UKR G;  2YQ8 A;  1RZ4 A;  1TJC A;  1OWP A;  1ZBP A;  2GRM A;  4BFR A;  2KM4 A;  4Z68 A;  3BQO A;  4RQI A;  4KXK B;  1FCH A;  3HXC A;  1Y6I A;  4TRQ A;  2J8S D;  4HOU A;  4HXI A;  3ULY A;  2MHK A;  2FO1 E;  4I17 A;  1D8E A;  3TWV A;  2V0P A;  4GZ5 A;  2PM7 A;  4GCO A;  4GPK A;  3I3N A;  3BUA A;  4G23 A;  2WXF A;  4ABN A;  5AAR A;  5T8I A;  1INZ A;  4U0U A;  1ELW A;  4U0Z A;  4AY6 A;  2AJA A;  1N54 A;  4YDO A;  3CST A;  2WXR A;  4EZJ A;  2RKK A;  3LCA A;  4J0U A;  3D3M A;  2X6I A;  5AQA A;  3G2V A;  2KZT A;  3TWU A;  1LD8 A;  2IJG X;  4B8A A;  5LP0 A;  2DYS E;  3ISM C;  5DIZ A;  4G26 A;  3BG1 B;  5CBN A;  3DSS A;  4GML A;  5ANR A;  2GRQ B;  2FF4 A;  2P9K G;  3PE4 A;  2F8Y A;  3SY2 A;  1UJK A;  3UIN C;  5G04 J;  3ZXP A;  3J5P A;  3UXG A;  1A5E A;  3AG1 E;  3S7B A;  2BED A;  1UG3 A;  2ZGG A;  4ATG A;  3RRU A;  3C3R A;  5AN8 A;  1H2U A;  2EQX A;  3CQG B;  3AS8 A;  4FP7 A;  4N3B A;  3HYM B;  2GRL A;  4I6E A;  4GTT A;  1N9A A;  3FEY A;  3DRA A;  4AOF A;  2PZI A;  3VTX A;  3IEG A;  3UTM A;  3CVP A;  5BW8 C;  5BXU A;  3BEE A;  2NC9 A;  4UI9 C;  4J7W A;  3E30 A;  4PS7 A;  2J4B A;  3TWX A;  4K0R A;  3FUI A;  4WND A;  5HKP A;  4ILI A;  3BU8 A;  1B89 A;  4UWF A;  4GTQ A;  2WVI A;  3ZHE B;  5BPP A;  3X2Q E;  5LCW C;  4BT9 A;  5AQB A;  4B94 A;  4CT4 A;  1MHQ A;  3SF4 A;  4AV7 A;  4EZK A;  2RG8 A;  1IQR A;  4I43 A;  3CQC B;  2V8S E;  1SZA A;  5A7D B;  5JA4 D;  4A3V A;  3TWR A;  1N4P A;  4J8E A;  4DJA A;  4FHK A;  3UIO C;  4HOR A;  4CDN A;  4NUR A;  3ASG A;  1YA0 A;  5T3R A;  4QFV A;  5ENO D;  4HRN A;  3F6Q A;  4X8Q A;  1OUV A;  2P9I G;  1HF8 A;  4G1T A;  3ZXS A;  4BEP A;  4I9E A;  5G55 A;  3S7F A;  5AJD A;  3E34 A;  3R9A B;  1SA4 A;  3DSU A;  4F1P A;  3JCK C;  1E8Z A;  5KJM A;  4ANV A;  4WUY A;  1IHG A;  1E90 A;  3GZ1 A;  3JQ1 A;  3L82 A;  2XEE A;  2FUL A;  5A6C A;  4TUU A;  5BXO A;  3SGH A;  2MRI A;  4KVO A;  4AJW A;  3NZS A;  4AY5 A;  3CHS A;  2RD0 A;  4CT0 A;  2WB2 A;  2J9Q A;  4U07 A;  2F8X K;  2YHC A;  1E8X A;  4HFG A;  3ZUV B;  4OAU C;  4AEZ C;  3R7Q A;  2ZU6 B;  2Y3A A;  3CSF A;  4ZHB A;  3LVR E;  1QNF A;  2ZIR A;  4K5B A;  1MJ0 A;  1O1S A;  2LNI A;  4XI0 A;  4F53 A;  2PQN A;  4R7L A;  3E32 A;  3FY4 A;  3CK8 A;  3DWL G;  2WQH A;  1V55 E;  2WMN A;  1WM5 A;  4WNG A;  5KWD A;  3ABK E;  3G2U A;  2QFC A;  1S0P A;  4C9B B;  3CLJ A;  3R9M A;  3TG5 A;  1JCR A;  3G2T A;  4N3C A;  4GAA A;  2WXG A;  3KEA A;  2HM8 A;  2AW6 A;  3QKY A;  3ZGQ A;  3QC1 A;  4Q96 A;  3AS4 A;  3PNT B;  2WXK A;  4HOS A;  3Q7F A;  4UI9 K;  4BX8 A;  2WXM A;  2J07 A;  4JD2 G;  3SFY A;  1N52 A;  3Q4A B;  3FTX A;  2H6F A;  1EDU A;  4LRZ A;  3SQV A;  3U3W A;  1TN7 A;  4DI3 A;  5CRU A;  5B3S E;  4CRW A;  1OXJ A;  5CMW A;  2OCC E;  4KMO A;  2EIL E;  2IQC A;  2CHW A;  4N5C A;  4MKT A;  2VGX B;  3Q47 B;  3DSX A;  4Q94 A;  2A5E A;  4K5C A;  3S7D A;  2I1J A;  4FAD A;  3TJP A;  4IRU A;  3L16 A;  4AIF A;  2J49 A;  2OND A;  2P9L G;  5T4Y A;  4N3A A;  1OCO E;  4GZ6 A;  3FH7 A;  3ZEF A;  2XEN A;  4HLL A;  4XZ4 A;  4EZL A;  3FTU A;  4U04 A;  3JYS A;  3ZYK A;  2L6J A;  3CGH A;  3D9J A;  3EIQ C;  4HLE A;  2CFZ A;  4FC8 A;  3RK6 A;  2EIK E;  3QB2 A;  3LYA A;  3Q73 A;  3PS6 A;  2ILR A;  3L17 A;  5EX0 A;  2VGE A;  1N95 A;  2B0O E;  4A63 B;  4HI8 A;  4GYY A;  1TEZ A;  1EPU A;  3QDN A;  3UM2 A;  3EDT B;  4BTA A;  3UM1 A;  3NAW A;  2VYI A;  3FH8 A;  5ARF A;  2C2L A;  1RW2 A;  2GRP B;  2VSY A;  4PDX A;  1TJF A;  4ANX A;  3B7R L;  2OOE A;  4FJY A;  5CEC B;  4HRL A;  4MLP A;  3RSE G;  1XNF A;  1ZB1 A;  5KJK A;  3FTV A;  3I4G A;  4C0M A;  4Q69 A;  2KAT A;  3SD5 A;  5FZS A;  2QZA A;  3UKU G;  4P29 A;  4KZC A;  2NXP A;  4GTS A;  3FTZ A;  2ETC A;  3IHY A;  5FWQ A;  3UT8 A;  4GA2 A;  5G05 J;  2WXL A;  5G04 C;  4ZFH A;  4HS2 A;  4F6R D;  4I6G A;  5BT1 A;  5FQ6 A;  2WXI A;  2V4L A;  4JA9 A;  4H7X A;  1SA5 A;  3UMV A;  2R5S A;  1IKN D;  1JUQ A;  3FUN A;  1XGW A;  1QQE A;  3V30 A;  3DBS A;  3GW4 A;  4BY6 A;  2X38 A;  5AEN A;  2BF0 X;  1H0A A;  3EJN A;  1Z5S C;  4FHJ A;  1N4R A;  3QWV A;  1KZO A;  4ATZ D;  2WXP A;  4XEI G;  4E85 A;  1K1B A;  4CGV A;  3Q78 A;  4FLB A;  3CR3 A;  3B13 A;  4JHR A;  4HOT A;  3QAQ A;  4CZ2 D;  4YND A;  4U95 D;  5J08 A;  3IKO B;  5ENT D;  2P9U G;  3TG4 A;  3P1U A;  4C48 B;  1G3N B;  4DX5 D;  1E7V A;  2BTD A;  3NOG D;  4OVV A;  2XRY A;  2V5F A;  4LNG A;  1H19 A;  4AM9 A;  3ZHE A;  4DX2 A;  3VLF A;  3FU6 A;  5G2N A;  3ZPJ A;  4UQX A;  1HU3 A;  3HXE A;  4XE0 A;  3IBE A;  2BKK B;  3GZS A;  4JXT A;  3PNL B;  2AXZ A;  4TXQ A;  1OWL A;  2IFU A;  5FIO A;  1KZP A;  3RO2 A;  3ML9 A;  5CEA A;  5D0Q D;  2P9P G;  3TWW A;  2F0Y A;  3MV3 B;  2X6H A;  1S63 A;  3HXB A;  4HB5 A;  4B93 B;  3FEX A;  5D0O D;  5FQ8 A;  4F1S A;  4HBD A;  3CVU A;  2WMO A;  2ETA A;  2E2E A;  1PC2 A;  1JCQ A;  4WNE A;  3SI5 A;  1EF1 C;  1E7U A;  4JEH A;  4KVM A;  1AWC B;  3AJI A;  3LY8 A;  4XKB A;  3KSL A;  5KNH D;  3ONK A;  2L9B A;  3ZVV A;  2RFA A;  3MZL B;  2ZGD A;  5BUZ A;  3DSV A;  4BT8 A;  4HI9 A;  3MJW A;  4GTR A;  3FH5 A;  4G2V A;  5JHA A;  5KNG A;  1NA3 A;  2QYJ A;  4NIK A;  2IO3 C;  3UUX A;  4DLO A;  3OXF A;  3D9N A;  4TUM A;  4CDM A;  2DZN A;  4ACK A;  3SBT B;  2ION A;  4BX9 A;  1UN9 A;  5FTP A;  3UT7 A;  3AG2 E;  1BD8 A;  1N94 A;  3GZ2 A;  3HHM A;  2HR2 A;  2HO1 A;  2Y4T A;  4HVB A;  2VTB B;  3FUL A;  1MYO A;  2DWZ A;  2IF4 A;  2XEH A;  2XS8 A;  4U8Y D;  3ZFW A;  3ABM E;  4DPR A;  1K3Z D;  3Q15 A;  2PQR A;  4M3O A;  1MX2 A;  3DPY A;  3L6A A;  2XZD G;  1MQS A;  1E8W A;  3LXU X;  1HG2 A;  3MA5 A;  4YDE A;  1TNU A;  3FFL A;  3BG0 B;  3CK7 A;  3MKQ A;  1UOH A;  1SW6 A;  4DX1 A;  3P2B A;  3CHP A;  4J8Y A;  3EHM A;  3EU9 A;  1NL4 A;  3DXK G;  3PH0 C;  4G11 A;  3EIJ A;  3ZYL A;  2OVB A;  4E6H A;  2I2O A;  3FTY A;  4QQI A;  4N39 A;  1Z6T A;  5FQ7 A;  4DX6 D;  5CHE E;  3FUD A;  4G24 A;  5CED B;  4GZ3 A;  2GRN B;  1D8D A;  1ELK A;  3ASN E;  4MS6 A;  1HX8 A;  2KC7 A;  3ZYM A;  2XPY A;  5CRV A;  3CHR A;  2J09 A;  2ZXW E;  3CVQ A;  4A55 A;  1DCQ A;  2LSV A;  2Q7F A;  3GYZ A;  3CVY A;  4APO A;  1KLX A;  3UT4 A;  3FTS A;  4I1M A;  5ENR D;  3UM3 A;  3EHR A;  2LAI A;  2DZO A;  1JWG A;  2Y1L E;  5JMN D;  1YMP A;  1DVP A;  3U9W A;  1ZU2 A;  3MV2 B;  1BI8 B;  3AG3 E;  4LG6 A;  3U66 A;  3TWT A;  1DNP A;  4I2Z A;  2L0T B;  2VGX A;  1H2V C;  3Q75 A;  4EPZ A;  3PZ1 A;  2XPI A;  3RRM B;  3U4T A;  4J6I A;  1S64 A;  5B1A E;  4EQF A;  2KCV A;  3RAU A;  2LXM A;  1WY6 A;  4YVO A;  4GZD A;  2H6G A;  4GZC A;  4HNA D;  2OEV A;  5KJN A;  4HQD A;  2WXJ A;  1D9S A;  2ETB A;  4NAC A;  3S2A A;  3UQ3 A;  2BKG A;  1BPO A;  3PZ4 A;  4JZY A;  3FUF A;  2QC9 A;  4U96 D;  3HVE B;  4UWG A;  4JC8 A;  3DEO A;  2UY1 B;  3MGB A;  1L5J A;  5EX3 A;  3MKQ B;  1OCZ E;  2ZIS A;  3LS8 A;  5AJL A;  3MCX A;  2QY7 A;  5ENN A;  2WQ7 A;  2V4H C;  1K8K G;  1IYG A;  4GCN A;  3EUV A;  3PUJ A;  4I1A A;  1JPL A;  3SNX A;  2EIJ E;  3NQP A;  2NYJ A;  5G05 C;  5EYL A;  2FBN A;  1SZ9 A;  4N5Q A;  5EID A;  4MBG A;  3NB2 A;  2MOW A;  5BNW A;  3LY7 A;  3EHN A;  4AVX A;  4I6J A;  3CVX A;  3DPD A;  1MZC A;  4JEU A;  5IY5 E;  2WPV A;  5HRY A;  3CVN A;  3V31 A;  4PUC A;  4WWO A;  1O5M A;  2A5U A;  3B7S A;  3FHE A;  4JHK A;  4NQ0 A;  2WM9 A;  2GGF A;  3CVL A;  3L13 A;  1TNO A;  3KSQ A;  3K9I A;  4DUI A;  1WG0 A;  4AXH A;  1UN8 A;  1OWM A;  3C3Q A;  3CKC A;  3O48 A;  3C72 A;  3RRN B;  3SFX A;  3D9L A;  3VLD A;  1E8Y A;  1TN6 A;  1TNZ A;  4U0S A;  4KBQ A;  4DI4 A;  1PAQ A;  4APF A;  4CEM A;  4C0E A;  3PRE A;  2LXL A;  4O6F A;  3FUH A;  3DXM G;  4L2L A;  2UWJ G;  3Q7A A;  2IU1 A;  4CGW A;  4A3T A;  4LEU A;  3KD7 A;  2OEW A;  2LAH A;  2GRR B;  2AXU A;  5C1D A;  3VTY A;  5BV1 A;  4G25 A;  3C98 A;  1N0Q A;  1DC2 A;  4L23 A;  2WQ6 A;  3TXM A;  1Z3Y A;  1N0R A;  2YIN A;  3J5Q B;  4TXP A;  3QWP A;  4U8V D;  4BTB A;  4U8H A;  3ZRH A;  2OV8 A;  2XEV A;  2WXN A;  3FUJ A;  3L08 A;  3JUE A;  4GU5 A;  3ESK A;  3ASH A;  3UM0 A;  5CMY A;  3D9O A;  4GTV A;  3EHQ A;  2XGS A;  1JCS A;  1LF8 A;  3QNK A;  1AP7 A;  3B95 A;  3CHM A;  5EYP F;  2PNN A;  3LJN A;  3I5P A;  2EIN E;  3I4R B;  3TL5 A;  4YVQ C;  1HXI A;  2CHZ A;  1HE8 A;  3ZKJ A;  5A23 A;  3NF1 A;  4B8C B;  4F7A A;  3L54 A;  4GTP A;  4J8S A;  3FUE A;  3PEU B;  5FJY A;  3U64 A;  1OCR E;  3E4B A;  4TXR A;  3ULQ A;  4PS3 A;  3T8K A;  4UQY A;  5FIN A;  3B7U X;  2HYZ A;  3CHQ A;  4RSY A;  4DK5 A;  3KEZ A;  3G2S A;  3WXX A;  4O1P A;  3D9K A;  1N4Q A;  5AQ7 A;  1UW4 B;  4GTO A;  3FTW A;  5FT9 A;  3R7R A;  1GW6 A;  3UX4 A;  3D9H A;  2AXV A;  3MYV A;  4UQZ A;  2IY0 C;  2Y0B G;  5D66 A;  3RIB A;  5ENS D;  2I9C A;  2FI7 A;  3UPV A;  5KBA A;  1VDY A;  5FZR A;  2XS1 A;  2X6K A;  2VTB A;  1YCS B;  3QOU A;  2H6I A;  3TWS A;  4BER A;  4U7E B;  2B6C A;  3QJZ A;  4OAV B;  3Q79 A;  2PM6 A;  2XCC A;  3L9T A;  3FWV A;  3HIZ A;  3HDX A;  1HO8 A;  1BI7 B;  5H7P A;  2DCP A;  3N71 A;  3AAA C;  1TN8 A;  4NRH B;  4UWL A;  4CDR A;  5AIJ A;  1FVF A;  4A1S A;  2XPZ A;  4GTM A;  2CG3 A;  5CBO A;  3O4Z A;  4WNF A;  1Q2Z A;  1P5Q A;  2NSZ A;  1Y8M A;  4G8L A;  4AP2 A;  3CIA A;  2YNQ A;  5FQ4 A;  3SFZ A;  1H6K A;  3OXL A;  3SBS A;  4GA0 A;  4IN3 B;  2YHE A;  5EDS A;  4FA6 A;  4JVS A;  5E76 A;  3ASD A;  2BUG A;  2EIM E;  4I9C A;  1U3C A;  3CKB A;  4HRM B;  3OXG A;  5HQ8 A;  3IV0 A;  4GYO A;  3ESL A;  4D10 C;  1HG5 A;  3C5R A;  4LER A;  3T8M A;  2KXP C;  2AWI A;  3T5V A;  4ACL A;  1H2T C;  5HS0 A;  3E33 A;  3KAE A;  3L22 A;  4L2Y A;  3TXN A;  3W9F A;  4U63 A;  4B89 A;  1SQM A;  1QYM A;  2CG2 A;  4GYW A;  3ONL A;  2R02 A;  4OVU A;  2X6J A;  3OAW A;  1U2V G;  4UUC A;  1TYQ G;  2MYO A;  2Y4U A;  4BWR A;  2QYU A;  5HI7 A;  2VQ2 A;  3V79 K;  5EN5 D;  2IO2 C;  3AU4 A;  1N11 A;  1BLX B;  3SO8 A;  1TR4 A;  4I1O B;  2R2L A;  1NZN A;  2H6H A;  2WXO A;  5LX8 A;  1OWN A;  1QBQ A;  1TNY A;  3DST A;  4CCA A;  1NI1 A;  5AAO A;  1N4S A;  3ZIM A;  3HVE A;  4FJZ A;  2XGM A;  4A1G A;  2UY1 A;  4K03 A;  1H6P A;  3JQ0 A;  1NFI E;  2AVP A;  1KT0 A;  3EU5 A;  4G8K A;  4TV3 A;  3IXE A;  4UWH A;  4MRU A;  4UWK A;  2VSO E;  2VSN A;  3ENE A;  2GW1 A;  1UJJ A;  1OY3 D;  3TAX A;  1NA0 A;  4YDY A;  2C0M A;  2L6B A;  3KS2 A;  1E96 B;  2KZT B;  4KT6 B;  4BES A;  5LFA A;  5CER B;  3VLE A;  4RG6 A;  3APC A;  3PVL A;  2GRO B;  5JJ7 A;  2Y69 E;  2KCL A;  3CHO A;  5C2Y A;  1DCE A;  4N2S A;  1X81 A;  4I2W A;  4JL0 A;  2P9S G;  4LNU D;  4L7T A;  2V5Q C;  4WWN A;  4W9R A;  3CK9 A;  4IUL A;  3CV0 A;  2LSU A;  4EBA A;  3NBN B;  1HZ4 A;  5AQ9 A;  5EIL A;  3ZYQ A;  2JEK A;  2XZT G;  1EYH A;  3C3O A;  5ENQ D;  1LTX A;  1WDY A;  1NP7 A;  3NZU A;  3W9G A;  4F3V A;  3RJV A;  4YDW A;  5ARG A;  2R17 C;  2KBX A;  3G2W A;  2C0L A;  4JHJ A;  3NOC D;  3T5X A;  4ME2 A;  5D2M C;  3Q9N C;  4XIF A;  1KT1 A;  2IEJ A;  3FP3 A;  5KJL A;  4Y6W A;  3LVQ E;  3PRZ A;  3RO3 A;  4JB8 P;  4RLY A;  2WXQ A;  4H7Y A;  4LUN U;  2IOL A;  5ITZ F;  2JAB A;  3CEQ A;  4K5A B;  4ILG A;  3ZN3 A;  2X6F A;  4FUL A;  3QAR A;  5M72 A;  4J8D A;  4UI9 J;  4WWP A;  3UIP C;  5AYW D;  1BU9 A;  1FT1 A;  3B7B A;  2CFU A;  3D9I A;  3QWW A;  5EIB E;  1FT2 A;  5LCW J;  4ANU A;  5ENP D;  1LD7 A;  2M63 A;  3AS5 A;  3LDZ A;  2DBA A;  2L0I A;  3ZU7 B;  3APD A;  4BSZ B;  5B1B E;  3Q49 B;  4LNB A;  3PZ2 A;  4JW1 A;  3SZ7 A;  3ULE G;  4XKC A;  5J90 A;  4BET A;  4LSZ E;  3D9M A;  5LOZ A;  3ABL E;  3E37 A;  1K1A A;  4OYS A;  2LO6 A;  3FUM A;  3OTN A;  5CCM A;  3MX3 A;  3SHF A;  5CCL A;  2RFM A;  4XI9 A;  5EKQ D;  4PH4 B;  2E0I A;  3PZ3 A;  1V54 E;  1TNB A;  3Q5M A;  4O60 A;  2J4D A;  3TWQ A;  3DSW A;  2XRZ A;  3PDN A;  4GPM A;  1Z3X A;  3Q9U C; 
#chains in the Genus database with same CATH homology
 2GRP B;  5D2M C;  3UIP C;  2GRO B;  2IY0 C;  2GRN B;  2GRR B;  2GRQ B;  2IO2 C;  3UIO C;  2IO3 C;  1Z5S C;  3UIN C;  1KPS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...