5D2MC

Complex between human sumo2-rangap1, ubc9 and znf451
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
158
structure length
158
Chain Sequence
PPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for catalytic activation by the human ZNF451 SUMO E3 ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase,protein binding
molecule keywords SUMO-conjugating enzyme UBC9
total genus 56
structure length 158
sequence length 158
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 5d2mC00
3UINC 1Z5SC 2IO2C 3UIPC 3UIOC 2GRPB 2IY0C 2GRRB 2GRQB 2IO3C 5D2MC 1KPSB 2GRNB 2GROB
chains in the Genus database with same CATH superfamily
3S7DA 4GAAA 4ANUA 3EIQC 2R02A 1SZ9A 1TR4A 1UN8A 4ABNA 2P2CP 2IO3C 3CHRA 2J4DA 2L6JA 5EX0A 1HS6A 3D9LA 3ASFA 3FTYA 4HI9A 3ISMC 4XKBA 4U95D 3HVEA 2V4LA 1SQMA 3F6QA 3L9TA 4BSZB 2BTDA 2Q7FA 2Y4UA 4L9PA 1YA0A 3NOCD 2BEDA 1U3DA 1H0AA 1ZB1A 4L2YA 3E32A 2KZTB 4UQZA 3V31A 4ATZD 4EECA 1U2VG 3PEUB 1DCEA 3JUEA 1NA0A 3UIPC 4GB9A 3C72A 3L22A 4DK5A 2CG2A 4HRNA 4TV3A 4A1GA 3ZPJA 2WXMA 4AY5A 1H6PA 4I6JA 3L54A 4MS6A 2IY0C 4G8LA 1SA4A 5KBAA 4GTVA 3BG1B 4LRZA 4GTOA 3FTSA 2IEJA 4AOFA 3O48A 2XEEA 2R03A 3LJ3A 4R7LA 4NIKA 3OXFA 4IYPA 2WMOA 2B6CA 2UY1A 2WMNA 3FH7A 5FZRA 2RFAA 5CCLA 5FTPA 4K03A 5D2MC 3QWWA 4AXHA 1TN8A 5A6CA 3FEYA 4URKA 1BPOA 3ABKE 5E76A 2L9BA 4J8DA 1H2UA 4U8YD 3HYMB 4EHMA 2YHCA 2LSUA 4J8EA 4F3VA 2J08A 3PZDA 4IULA 2NYJA 1SA5A 5EIDA 4K0RA 3RIBA 5ENOD 2AVPA 4J8YA 2YNQA 3J5QB 4JA9A 5G05C 3DSUA 2OOEA 1Z3XA 1Y8MA 3Q73A 2CHWA 3ML8A 1PY1A 3IHVA 3ZRHA 1N95A 3JCKC 4CRWA 5AQ7A 3FUIA 4M7CA 4UI9C 4AVXA 4CT4A 1SZAA 1ZU2A 3VLFA 1UOHA 4E85A 2PZIA 5T8IA 2LUHA 1EYHA 3T9KA 5LCWC 2V4HC 2R2LA 1WY6A 3DEPA 4Y6CA 2KCKA 4GA0A 3L16A 4GTRA 3KAEA 4NQ0A 4B8AA 3Q5MA 4B94A 3TGOA 4HB5A 5D66A 4JEUA 1UJKA 3MYVA 3FUEA 3S7BA 4XI9A 4DI4A 3HIZA 5ENPD 5ANRA 2WXIA 4LNBA 3UM3A 3B7TA 4K5AB 3SD5A 3P2BA 4U0SA 2XGOA 3TG5A 3C5RA 1HXIA 2Y1LE 2QYJA 3Q47B 2GRRB 2I6HA 3U9WA 3TG4A 5JMND 4WUYA 4UUCA 4GYYA 3B95A 3ZXPA 1E8WA 1Y6IA 3ZU7B 4KMOA 3TXMA 2WXJA 4B93B 3CEQA 3ZHEB 5B1BE 3UTMA 3ZXSA 1V55E 4YVQC 4QFVA 5CMYA 3T5XA 1IKND 3KS2A 4I2WA 3SNXA 4PUCA 2IONA 3ASDA 4ILHB 3IBEA 4KXKB 3RSEG 4L1BA 4XI0A 2IQCA 4FULA 3LPZA 5DIZA 2PQRA 2PM6A 4IRUA 5LCWJ 3CK9A 5AAOA 4G25A 1H6OA 1VDYA 1S63A 2FBNA 3ESLA 2Y0BG 1TJCA 2QZAA 4GTTA 3ZNGA 1WAO1 3FUHA 3IV0A 4BSXA 2J9QA 3EIJA 3ZYQA 4F1SA 1UJJA 2LAHA 3ML9A 1HFAA 1N4SA 1TJFA 4JHRA 2H6IA 3JXJA 3R7RA 4EZKA 1OWOA 1G3NB 3TWXA 4Y6WA 2XEHA 3ULYA 3MGBA 4L23A 3OTNA 5FQ6A 3CVLA 1NI1A 3LVRE 4BEPA 3AS8A 4EZJA 5EYPF 2UY1B 2XHEA 2I2OA 4JC8A 1X5BA 3KD7A 2X3MA 3URZA 3UUXA 4V3IA 3JQ0A 3CLJA 1V54E 3AAAC 3CHQA 1B89A 4RVBA 1UN9A 2QFCA 5FZSA 3ZEFA 5CRUA 2DCPA 3ONKA 4BTBA 4GMLA 4HNAD 4BT9A 3JQ1A 2WQHA 3AG4E 3C3OA 3T8KA 5FIOA 5FQ7A 3SFXA 3QC1A 4FP7A 5CMWA 4U0UA 1H2TC 4TRQA 3RU0A 4CDRA 4CGVA 1BU9A 3TWUA 1N0RA 4F6RD 1FT1A 4AEZC 2BKKB 1K3ZD 4LEUA 1OWMA 1MX4A 2BUGA 4HOSA 2ZGGA 1MZCA 5G55A 4DUIA 1ELRA 2FO1E 3ZYLA 3UT8A 4DI3A 5HKPA 4UWKA 1NA3A 4NRHB 1OY3D 4FADA 2A5UA 3U64A 2IU1A 4BY6A 3DWLG 2ZGDA 3C3QA 1SW6A 1S70B 4J8FA 1D8DA 4NURA 4APFA 3E33A 2NSZA 2P9NG 2VGYA 3CHOA 3UINC 3Q7FA 4C9BB 1LD7A 2DYSE 4H7YA 4JA7A 1XGWA 4PS7A 2QC9A 3ESKA 4N5QA 2ZXWE 1IXVA 1TEZA 4RSYA 3CVNA 3ZHEA 4U07A 3D9PA 3PNTB 2DYRE 4MRUA 5LX8A 4DX1A 3QAQA 3E4BA 1SVXA 1UG3A 5G04C 2VGEA 4XZ4A 5AJDA 3ZUVB 4CZ2D 4EBAA 3GW4A 3ENEA 2GRMA 5A7DB 4GMJA 2YINA 4N3AA 4HRLA 4DX2A 3DSVA 4U8VD 3MZLB 2JLBA 4C0EA 2VTBA 5KJLA 4N3BA 3SO8A 2J09A 1HF8A 1N4PA 4AM9A 1PC2A 3FUDA 2R5SA 3TWTA 5JHAA 2FF4A 3AG3E 3TWRA 2XGSA 5KCMA 1NP7A 2GRQB 3CVPA 3PZ1A 3IHYA 3Q4AB 3W9GA 2AWIA 4OVVA 2EILE 2FULA 1JCQA 3NOGD 2A5EA 1H6KA 3L6AA 2OVFA 3IXEA 1YYHA 3JUIA 2AXZA 3E37A 2VSOE 2XZTG 2MOWA 2XS1A 4H7XA 4GTMA 4BT8A 2FO7A 4UWGA 3W9FA 1S64A 3KSQA 4LSZE 3FTWA 2P9IG 2VSNA 5ENQD 4XE0A 4YDWA 2VSYA 4FJZA 5AQBA 1N94A 3OXLA 4TUMA 5KJKA 4GMRA 3QJZA 2KXPC 3HXEA 4TXPA 3Q78A 1JCRA 3UKUG 3ZN3A 5JJTA 2WXOA 3QWVA 2OEVA 3TWVA 4BERA 5T4YA 1K1BA 4J0UA 1MX2A 1O5MA 4HRMB 4FHKA 2EINE 1E8YA 2UWJG 4FLBA 3LCAA 4LCTA 1JCSA 1KZPA 3APFA 2EIKE 3NAWA 3EJNA 4G11A 2ETBA 3G2VA 4HI8A 2YQ8A 1TNUA 3FEXA 3T5VA 3HVEB 2VTBB 1N52A 4FC8A 3FU5A 4BESA 4AV7A 2WQ6A 4KZ0A 3UPVA 1AWCB 3S7FA 2I1KA 3QNKA 5KNHD 4N2QA 4N3CA 3HXDA 3UQ3A 3UXGA 4A1SA 5FZQA 2JEKA 2AXVA 4JVSA 4JPSA 1ELKA 4GTPA 4G23A 2H6FA 3FP3A 3PREA 4KBQA 3RKVA 5KJNA 4HS2A 1DCQA 4JL0A 2ETCA 3N71A 4C0MA 3CVVA 3HHMA 2E2EA 1RZ4A 4OVUA 4ANVA 3LKUA 1BLXB 2DZOA 2C0MA 2XRZA 4JXTA 2XCCA 3ZKJA 1Z6TA 4HOQA 2XENA 1P5QA 4ZHBA 3J5PA 5BT1A 3ZYMA 4A63B 4U8HA 3LJNA 3NZSA 3BU8A 4KZCA 4LUNU 1IYGA 4JW1A 3T8MA 2WXGA 4FLHA 3S2AA 5CEDB 5BW8C 4U63A 2GROB 3BEEA 3GZ1A 3FTUA 2VJ8A 4I1AA 3G2TA 3SQVA 4B0ZA 3DPYA 2EIME 4HXIA 4GZCA 3AS5A 1ELWA 5CCMA 4N39A 1E7VA 3UI2A 3I4GA 3TWSA 3QARA 4UWHA 3FTXA 4CEMA 2X6IA 2P9UG 3MKQA 5AIJA 2KATA 3ASNE 1NL4A 5CBNA 1IQUA 2C0LA 3UM0A 4ACKA 2X6HA 3D9NA 3EHMA 3X2QE 5D0QD 3WXXA 2ZISA 2WM9A 1TYQG 2J07A 1TNBA 5ENSD 4PH4B 4UQYA 1OWNA 3R7QA 4JHKA 3PE3A 4GTSA 5BUZA 3PDNA 4JHJA 3CK8A 5BPPA 3AG1E 3HXCA 2LNIA 4ATGA 3CVQA 4WWOA 4HLLA 4GA2A 5CRVA 5JJ7A 4ME2A 1E8ZA 3ULEG 4DJAA 2RD0A 4UI9J 3EUVA 3ABLE 4TXRA 4K5BA 5B1AE 5JJ6A 3FUFA 3AG2E 4J7WA 2ZU6B 5G05J 2V5FA 4UQXA 5LFAA 2X6FA 3DXKG 1HU3A 4CYMD 3V79K 4XX5A 3E34A 2P9LG 2F8YA 5AN8A 3TWQA 3FDHA 3DPDA 1A17A 2XPZA 3GZ2A 3JYSA 3CHMA 2XCBA 3D9OA 1JWGA 1OXJA 4FU3A 1OWPA 3FUNA 5BV0A 3QKYA 3DSSA 5FINA 2KC7A 1PAQA 4G8KA 4XKCA 2ETAA 5AARA 1UW4B 5ITZF 5FJYA 3FFLA 3NBNB 3B7BA 1WM5A 4FJYA 3FTVA 4DX5D 4GA1A 2GRPB 2C2LA 2WQ7A 4D10C 3OAWA 3RK6A 4HQDA 4O1PA 1XNFA 3EDTB 1A5EA 4KT6B 3SFZA 5BXUA 1DVPA 4EZLA 2XZDG 3PZ2A 1D9SA 1EPUA 3V2XA 5AJLA 3DXMG 4I43A 5EX3A 3CK7A 4TXQA 4DLOA 2CHXA 3PNLB 2QYUA 4B8CB 1QYMA 3UT4A 5HQ8A 3C98A 2EIJE 3O4ZA 5A23A 4N2SA 1FVFA 1MQSA 2AW6A 4UWLA 3SGHA 4ILGA 2OVBA 3CHSA 2MHKA 4U04A 4WNFA 1JWFA 3I3NA 4U7EB 3PRZA 2CHZA 2IJGX 3U4TA 3CQGB 1HZ4A 4CGWA 1U3CA 1MX6A 4DX6D 1E7UA 1W3BA 3SBTB 3Q9UC 1YCSB 3GYZA 3PZ3A 2LAIA 4B89A 4EQFA 4KVOA 4GU5A 4CT0A 3SY2A 4BETA 1INZA 4HORA 5AQAA 1LD8A 4LG6A 3Q15A 4HBDA 2KBXA 3MV3B 5JHBA 2QY7A 3EU5A 5ENNA 3MKQB 2R05A 4IN3B 4GPKA 2HYZA 4GZ6A 4CCAA 4I6EA 1MHQA 1O1RA 1KLXA 4GYOA 3R9MA 2GW1A 3CR3A 3PEVB 3ABME 4GPMA 3FULA 3PE4A 4W9RA 3UM1A 3CHPA 5HI7A 3SBSA 4GCOA 3QOUA 3L17A 3UIOC 3KSLA 3UMVA 4OYSA 4Z68A 4YDYA 3TJPA 4AJWA 3QWPA 3SFYA 2Y69E 1ZBPA 3CVUA 5KNGA 3UT7A 2KCVA 1L5JA 3CVWA 1HG5A 3B7SA 1K1AA 2PM7A 3FH8A 3FU6A 2P58C 2WXKA 4JD2G 1FT2A 4UI9K 4BWRA 5FWQA 4Q69A 3NZUA 1OCOE 3CGHA 5FT9A 3DSTA 2XRYA 5FQ8A 1DC2A 4DLQA 2I1JA 3NF1A 4I1MA 2LXMA 4I17A 3C3RA 2B0OE 3TWWA 5B3SE 4RQIA 3ONLA 3VLEA 5AENA 5CEAA 3D9IA 1Z3YA 2KCLA 4BTAA 3ULQA 1MYOA 3B7UX 5EDSA 4GZDA 3SI5A 4FA6A 3NB2A 3RO3A 2JABA 1TNOA 2F0YA 5EIBE 3FH5A 4O1OA 1IHGA 3PUKA 2VGXB 4F53A 4PS8A 3L82A 3R9AB 1OCZE 3D3MA 4C48B 2AXUA 3CQCB 4HFGA 3FUMA 4L7TA 2WXRA 3VLDA 1YMPA 2OCCE 1E90A 1QQEA 2Y3AA 4JB8P 2P9PG 3EHQA 3ZGQA 1TNYA 2WB2A 3QB2A 3L08A 4KVMA 2E0IA 3LY9A 2VQ2A 2DZNA 3ZW3A 3FY4A 1S0PA 3KEZA 4ACLA 1NFIE 4N5CA 3LS8A 4AP2A 1BI8B 3GZSA 4J6IA 3WG7E 4WWPA 3Q79A 2LXLA 2WPVA 5CERB 4DPRA 3FU3A 4HOTA 1OT8A 4RG9A 5ENTD 4EPZA 4AY6A 4GCNA 4WAFA 4MBGA 3Q9NC 1JUQA 3LXUX 4JZYA 2J8SD 3TL5A 2HO1A 4O60A 2BKGA 2FI7A 2A4ZA 2PNNA 2VSXE 3P1UA 4MKTA 3BUAA 4TUUA 4X8QA 5G2NA 4GZ3A 2FEZA 2DVWA 3ASGA 1O1TA 2IOLA 2L0TB 2P9SG 4J8SA 3MKRA 2X6JA 3AU4A 4ILIA 3HXFA 3LYAA 3CVYA 1N9AA 1OUVA 4P29A 3SHFA 1N54A 3VTXA 3RRMB 2H6HA 5J90A 4G1TA 3PH0C 2GGFA 3TXNA 3Q49B 4QQIA 5E75A 2YHEA 1FVHA 2HR2A 1N4QA 1FCHA 4ANWA 4I9CA 4DRXE 1Q2ZA 2WXNA 2PQNA 1RW2A 4I6GA 2V0PA 4EBAG 5H7PA 1N11A 3EHNA 3EHRA 5KWDA 3CSFA 1OCRE 5C2YA 1HO8A 4WWNA 1LF8A 3Q75A 2RFMA 1OCCE 4YVOA 3D9HA 2WXFA 3ZFWA 4BX8A 1HE8A 4M3OA 4U0ZA 4XIFA 2EQXA 1E96B 4YNDA 1GW6A 5CHEE 3KEAA 3QK0A 3DRAA 3D9MA 3APCA 4YDOA 4G24A 3DEOA 2CG3A 2LSVA 2XEVA 5M72A 4GZ5A 1AP7A 1H19A 3MEKA 3AS4A 2WVIA 2IO2C 4APOA 1X81A 3ZIMA 1JPLA 2DWZA 4HLEA 5FQ4A 2L0IA 1OWLA 1Z5SC 4YDEA 2OV8A 3B13A 3G2UA 1HG2A 5BNWA 3PZ4A 3HRAA 5J08A 1KPSB 2XQ0A 1KZOA 3MJWA 3FUKA 5LOZA 3RO2A 4U96D 5D0OD 4GTQA 1TN6A 4LNUD 1NZNA 5HRYA 3APDA 3OXGA 1QBQA 2WXHA 3DBSA 1HH8A 4F7AA 1QZ2A 1LTXA 1IHBA 4G2VA 1KT1A 3TAXA 4Q94A 1TN7A 2Y4TA 4Q96A 4MLPA 3PUJA 3U3WA 3D9JA 2L6BA 3V30A 2NXPA 1DNPA 3CKCA 5CECB 4OAUC 3DSWA 3UKRG 3I5PA 3IEGA 1WG0A 3NQPA 3PS6A 1EDUA 3CSTA 1QNFA 1D8EA 4WNGA 5ARFA 4XEIG 5AYWD 3LVQE 1WDYA 5KJMA 4PS3A 4E6HA 4O6FA 2J49A 3B7RL 2H6GA 2DBAA 3MV2B 3ZYKA 5BV1A 5EILA 3JXIA 4LERA 4GYWA 4PDXA 2WXQA 2NC9A 4RLYA 2J4BA 3LY7A 1MJ0A 4LNGA 3V2OA 2RKKA 4KYOB 2LO6A 5C1DA 3MA5A 5EN5D 4ANXA 3SF4A 4A3TA 3BQOA 4A3VA 2MYOA 2XPYA 3AU5A 3LDZA 2WXPA 1E8XA 3G2WA 1K8KG 2F8XK 3AJIA 4WNDA 3S7JA 4I9EA 2CFZA 4OAVB 4UWFA 5JA4D 4AIFA 1IQRA 4DX7D 2X38A 4F1PA 2IFUA 3D9KA 3FTZA 2BF0X 2I9CA 4BFRA 5CBOA 3HXBA 3CVXA 4I1OB 3RRUA 3ASHA 2PL2A 3BG0B 3FU0A 1EF1C 3SZ7A 3UX4A 4HOUA 3RJVA 3HG0D 3FHEA 4ZFHA 2V5QC 2X6KA 3E30A 3G2SA 2VYIA 3L13A 3EU9A 5ENRD 5EKQD 3K9IA 5DBKA 1TNZA 2GRNB 2IF4A 4HVBA 4RG6A 4CDMA 3I4RB 3DSXA 2XS8A 1N4RA 2F37A 3RAUA 2IOSA 4I2ZA 4FHJA 3PVLA 5BXOA 5LP0A 4A55A 3VTYA 1HX8A 2V8SE 1O1SA 2R17C 3LY8A 5G04J 4BX9A 2HM8A 2GRLA 3ZVVA 4L2LA 3UM2A 5IY5E 2VGXA 2XGMA 2WXLA 4G26A 2AJAA 4K5CA 1BD8A 3ASOE 5ARGA 3MCXA 4CDNA 2ILRA 3CV0A 2KZTA 1N0QA 3FUJA 1FPPA 3FWVA 2ONDA 1BI7B 3LEWA 3U66A 2CFUA 2R59A 3CIAA 5ANLA 1H2VC 5HS0A 1KT0A 4JEHA 2DIWA 2HE0A 4NACA 2M63A 3Q7AA 5AQ9A 4WNEA 5T3RA 3RRNB 5EYLA 3CKBA 3HDXA 2ZIRA 2MRIA 2OEWA 3MX3A 3QDNA 2P9KG 2RG8A 2KM4A 3IKOB 2XPIA
chains in the Genus database with same CATH topology
3UINC 1Z5SC 2IO2C 3UIPC 3UIOC 2GRPB 2IY0C 2GRRB 2GRQB 2IO3C 5D2MC 1KPSB 2GRNB 2GROB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIN C;  1Z5S C;  2IO2 C;  3UIP C;  3UIO C;  2GRP B;  2IY0 C;  2GRR B;  2GRQ B;  2IO3 C;  5D2M C;  1KPS B;  2GRN B;  2GRO B; 
#chains in the Genus database with same CATH topology
 3S7D A;  4GAA A;  4ANU A;  3EIQ C;  2R02 A;  1SZ9 A;  1TR4 A;  1UN8 A;  4ABN A;  2P2C P;  2IO3 C;  3CHR A;  2J4D A;  2L6J A;  5EX0 A;  1HS6 A;  3D9L A;  3ASF A;  3FTY A;  4HI9 A;  3ISM C;  4XKB A;  4U95 D;  3HVE A;  2V4L A;  1SQM A;  3F6Q A;  3L9T A;  4BSZ B;  2BTD A;  2Q7F A;  2Y4U A;  4L9P A;  1YA0 A;  3NOC D;  2BED A;  1U3D A;  1H0A A;  1ZB1 A;  4L2Y A;  3E32 A;  2KZT B;  4UQZ A;  3V31 A;  4ATZ D;  4EEC A;  1U2V G;  3PEU B;  1DCE A;  3JUE A;  1NA0 A;  3UIP C;  4GB9 A;  3C72 A;  3L22 A;  4DK5 A;  2CG2 A;  4HRN A;  4TV3 A;  4A1G A;  3ZPJ A;  2WXM A;  4AY5 A;  1H6P A;  4I6J A;  3L54 A;  4MS6 A;  2IY0 C;  4G8L A;  1SA4 A;  5KBA A;  4GTV A;  3BG1 B;  4LRZ A;  4GTO A;  3FTS A;  2IEJ A;  4AOF A;  3O48 A;  2XEE A;  2R03 A;  3LJ3 A;  4R7L A;  4NIK A;  3OXF A;  4IYP A;  2WMO A;  2B6C A;  2UY1 A;  2WMN A;  3FH7 A;  5FZR A;  2RFA A;  5CCL A;  5FTP A;  4K03 A;  5D2M C;  3QWW A;  4AXH A;  1TN8 A;  5A6C A;  3FEY A;  4URK A;  1BPO A;  3ABK E;  5E76 A;  2L9B A;  4J8D A;  1H2U A;  4U8Y D;  3HYM B;  4EHM A;  2YHC A;  2LSU A;  4J8E A;  4F3V A;  2J08 A;  3PZD A;  4IUL A;  2NYJ A;  1SA5 A;  5EID A;  4K0R A;  3RIB A;  5ENO D;  2AVP A;  4J8Y A;  2YNQ A;  3J5Q B;  4JA9 A;  5G05 C;  3DSU A;  2OOE A;  1Z3X A;  1Y8M A;  3Q73 A;  2CHW A;  3ML8 A;  1PY1 A;  3IHV A;  3ZRH A;  1N95 A;  3JCK C;  4CRW A;  5AQ7 A;  3FUI A;  4M7C A;  4UI9 C;  4AVX A;  4CT4 A;  1SZA A;  1ZU2 A;  3VLF A;  1UOH A;  4E85 A;  2PZI A;  5T8I A;  2LUH A;  1EYH A;  3T9K A;  5LCW C;  2V4H C;  2R2L A;  1WY6 A;  3DEP A;  4Y6C A;  2KCK A;  4GA0 A;  3L16 A;  4GTR A;  3KAE A;  4NQ0 A;  4B8A A;  3Q5M A;  4B94 A;  3TGO A;  4HB5 A;  5D66 A;  4JEU A;  1UJK A;  3MYV A;  3FUE A;  3S7B A;  4XI9 A;  4DI4 A;  3HIZ A;  5ENP D;  5ANR A;  2WXI A;  4LNB A;  3UM3 A;  3B7T A;  4K5A B;  3SD5 A;  3P2B A;  4U0S A;  2XGO A;  3TG5 A;  3C5R A;  1HXI A;  2Y1L E;  2QYJ A;  3Q47 B;  2GRR B;  2I6H A;  3U9W A;  3TG4 A;  5JMN D;  4WUY A;  4UUC A;  4GYY A;  3B95 A;  3ZXP A;  1E8W A;  1Y6I A;  3ZU7 B;  4KMO A;  3TXM A;  2WXJ A;  4B93 B;  3CEQ A;  3ZHE B;  5B1B E;  3UTM A;  3ZXS A;  1V55 E;  4YVQ C;  4QFV A;  5CMY A;  3T5X A;  1IKN D;  3KS2 A;  4I2W A;  3SNX A;  4PUC A;  2ION A;  3ASD A;  4ILH B;  3IBE A;  4KXK B;  3RSE G;  4L1B A;  4XI0 A;  2IQC A;  4FUL A;  3LPZ A;  5DIZ A;  2PQR A;  2PM6 A;  4IRU A;  5LCW J;  3CK9 A;  5AAO A;  4G25 A;  1H6O A;  1VDY A;  1S63 A;  2FBN A;  3ESL A;  2Y0B G;  1TJC A;  2QZA A;  4GTT A;  3ZNG A;  1WAO 1;  3FUH A;  3IV0 A;  4BSX A;  2J9Q A;  3EIJ A;  3ZYQ A;  4F1S A;  1UJJ A;  2LAH A;  3ML9 A;  1HFA A;  1N4S A;  1TJF A;  4JHR A;  2H6I A;  3JXJ A;  3R7R A;  4EZK A;  1OWO A;  1G3N B;  3TWX A;  4Y6W A;  2XEH A;  3ULY A;  3MGB A;  4L23 A;  3OTN A;  5FQ6 A;  3CVL A;  1NI1 A;  3LVR E;  4BEP A;  3AS8 A;  4EZJ A;  5EYP F;  2UY1 B;  2XHE A;  2I2O A;  4JC8 A;  1X5B A;  3KD7 A;  2X3M A;  3URZ A;  3UUX A;  4V3I A;  3JQ0 A;  3CLJ A;  1V54 E;  3AAA C;  3CHQ A;  1B89 A;  4RVB A;  1UN9 A;  2QFC A;  5FZS A;  3ZEF A;  5CRU A;  2DCP A;  3ONK A;  4BTB A;  4GML A;  4HNA D;  4BT9 A;  3JQ1 A;  2WQH A;  3AG4 E;  3C3O A;  3T8K A;  5FIO A;  5FQ7 A;  3SFX A;  3QC1 A;  4FP7 A;  5CMW A;  4U0U A;  1H2T C;  4TRQ A;  3RU0 A;  4CDR A;  4CGV A;  1BU9 A;  3TWU A;  1N0R A;  4F6R D;  1FT1 A;  4AEZ C;  2BKK B;  1K3Z D;  4LEU A;  1OWM A;  1MX4 A;  2BUG A;  4HOS A;  2ZGG A;  1MZC A;  5G55 A;  4DUI A;  1ELR A;  2FO1 E;  3ZYL A;  3UT8 A;  4DI3 A;  5HKP A;  4UWK A;  1NA3 A;  4NRH B;  1OY3 D;  4FAD A;  2A5U A;  3U64 A;  2IU1 A;  4BY6 A;  3DWL G;  2ZGD A;  3C3Q A;  1SW6 A;  1S70 B;  4J8F A;  1D8D A;  4NUR A;  4APF A;  3E33 A;  2NSZ A;  2P9N G;  2VGY A;  3CHO A;  3UIN C;  3Q7F A;  4C9B B;  1LD7 A;  2DYS E;  4H7Y A;  4JA7 A;  1XGW A;  4PS7 A;  2QC9 A;  3ESK A;  4N5Q A;  2ZXW E;  1IXV A;  1TEZ A;  4RSY A;  3CVN A;  3ZHE A;  4U07 A;  3D9P A;  3PNT B;  2DYR E;  4MRU A;  5LX8 A;  4DX1 A;  3QAQ A;  3E4B A;  1SVX A;  1UG3 A;  5G04 C;  2VGE A;  4XZ4 A;  5AJD A;  3ZUV B;  4CZ2 D;  4EBA A;  3GW4 A;  3ENE A;  2GRM A;  5A7D B;  4GMJ A;  2YIN A;  4N3A A;  4HRL A;  4DX2 A;  3DSV A;  4U8V D;  3MZL B;  2JLB A;  4C0E A;  2VTB A;  5KJL A;  4N3B A;  3SO8 A;  2J09 A;  1HF8 A;  1N4P A;  4AM9 A;  1PC2 A;  3FUD A;  2R5S A;  3TWT A;  5JHA A;  2FF4 A;  3AG3 E;  3TWR A;  2XGS A;  5KCM A;  1NP7 A;  2GRQ B;  3CVP A;  3PZ1 A;  3IHY A;  3Q4A B;  3W9G A;  2AWI A;  4OVV A;  2EIL E;  2FUL A;  1JCQ A;  3NOG D;  2A5E A;  1H6K A;  3L6A A;  2OVF A;  3IXE A;  1YYH A;  3JUI A;  2AXZ A;  3E37 A;  2VSO E;  2XZT G;  2MOW A;  2XS1 A;  4H7X A;  4GTM A;  4BT8 A;  2FO7 A;  4UWG A;  3W9F A;  1S64 A;  3KSQ A;  4LSZ E;  3FTW A;  2P9I G;  2VSN A;  5ENQ D;  4XE0 A;  4YDW A;  2VSY A;  4FJZ A;  5AQB A;  1N94 A;  3OXL A;  4TUM A;  5KJK A;  4GMR A;  3QJZ A;  2KXP C;  3HXE A;  4TXP A;  3Q78 A;  1JCR A;  3UKU G;  3ZN3 A;  5JJT A;  2WXO A;  3QWV A;  2OEV A;  3TWV A;  4BER A;  5T4Y A;  1K1B A;  4J0U A;  1MX2 A;  1O5M A;  4HRM B;  4FHK A;  2EIN E;  1E8Y A;  2UWJ G;  4FLB A;  3LCA A;  4LCT A;  1JCS A;  1KZP A;  3APF A;  2EIK E;  3NAW A;  3EJN A;  4G11 A;  2ETB A;  3G2V A;  4HI8 A;  2YQ8 A;  1TNU A;  3FEX A;  3T5V A;  3HVE B;  2VTB B;  1N52 A;  4FC8 A;  3FU5 A;  4BES A;  4AV7 A;  2WQ6 A;  4KZ0 A;  3UPV A;  1AWC B;  3S7F A;  2I1K A;  3QNK A;  5KNH D;  4N2Q A;  4N3C A;  3HXD A;  3UQ3 A;  3UXG A;  4A1S A;  5FZQ A;  2JEK A;  2AXV A;  4JVS A;  4JPS A;  1ELK A;  4GTP A;  4G23 A;  2H6F A;  3FP3 A;  3PRE A;  4KBQ A;  3RKV A;  5KJN A;  4HS2 A;  1DCQ A;  4JL0 A;  2ETC A;  3N71 A;  4C0M A;  3CVV A;  3HHM A;  2E2E A;  1RZ4 A;  4OVU A;  4ANV A;  3LKU A;  1BLX B;  2DZO A;  2C0M A;  2XRZ A;  4JXT A;  2XCC A;  3ZKJ A;  1Z6T A;  4HOQ A;  2XEN A;  1P5Q A;  4ZHB A;  3J5P A;  5BT1 A;  3ZYM A;  4A63 B;  4U8H A;  3LJN A;  3NZS A;  3BU8 A;  4KZC A;  4LUN U;  1IYG A;  4JW1 A;  3T8M A;  2WXG A;  4FLH A;  3S2A A;  5CED B;  5BW8 C;  4U63 A;  2GRO B;  3BEE A;  3GZ1 A;  3FTU A;  2VJ8 A;  4I1A A;  3G2T A;  3SQV A;  4B0Z A;  3DPY A;  2EIM E;  4HXI A;  4GZC A;  3AS5 A;  1ELW A;  5CCM A;  4N39 A;  1E7V A;  3UI2 A;  3I4G A;  3TWS A;  3QAR A;  4UWH A;  3FTX A;  4CEM A;  2X6I A;  2P9U G;  3MKQ A;  5AIJ A;  2KAT A;  3ASN E;  1NL4 A;  5CBN A;  1IQU A;  2C0L A;  3UM0 A;  4ACK A;  2X6H A;  3D9N A;  3EHM A;  3X2Q E;  5D0Q D;  3WXX A;  2ZIS A;  2WM9 A;  1TYQ G;  2J07 A;  1TNB A;  5ENS D;  4PH4 B;  4UQY A;  1OWN A;  3R7Q A;  4JHK A;  3PE3 A;  4GTS A;  5BUZ A;  3PDN A;  4JHJ A;  3CK8 A;  5BPP A;  3AG1 E;  3HXC A;  2LNI A;  4ATG A;  3CVQ A;  4WWO A;  4HLL A;  4GA2 A;  5CRV A;  5JJ7 A;  4ME2 A;  1E8Z A;  3ULE G;  4DJA A;  2RD0 A;  4UI9 J;  3EUV A;  3ABL E;  4TXR A;  4K5B A;  5B1A E;  5JJ6 A;  3FUF A;  3AG2 E;  4J7W A;  2ZU6 B;  5G05 J;  2V5F A;  4UQX A;  5LFA A;  2X6F A;  3DXK G;  1HU3 A;  4CYM D;  3V79 K;  4XX5 A;  3E34 A;  2P9L G;  2F8Y A;  5AN8 A;  3TWQ A;  3FDH A;  3DPD A;  1A17 A;  2XPZ A;  3GZ2 A;  3JYS A;  3CHM A;  2XCB A;  3D9O A;  1JWG A;  1OXJ A;  4FU3 A;  1OWP A;  3FUN A;  5BV0 A;  3QKY A;  3DSS A;  5FIN A;  2KC7 A;  1PAQ A;  4G8K A;  4XKC A;  2ETA A;  5AAR A;  1UW4 B;  5ITZ F;  5FJY A;  3FFL A;  3NBN B;  3B7B A;  1WM5 A;  4FJY A;  3FTV A;  4DX5 D;  4GA1 A;  2GRP B;  2C2L A;  2WQ7 A;  4D10 C;  3OAW A;  3RK6 A;  4HQD A;  4O1P A;  1XNF A;  3EDT B;  1A5E A;  4KT6 B;  3SFZ A;  5BXU A;  1DVP A;  4EZL A;  2XZD G;  3PZ2 A;  1D9S A;  1EPU A;  3V2X A;  5AJL A;  3DXM G;  4I43 A;  5EX3 A;  3CK7 A;  4TXQ A;  4DLO A;  2CHX A;  3PNL B;  2QYU A;  4B8C B;  1QYM A;  3UT4 A;  5HQ8 A;  3C98 A;  2EIJ E;  3O4Z A;  5A23 A;  4N2S A;  1FVF A;  1MQS A;  2AW6 A;  4UWL A;  3SGH A;  4ILG A;  2OVB A;  3CHS A;  2MHK A;  4U04 A;  4WNF A;  1JWF A;  3I3N A;  4U7E B;  3PRZ A;  2CHZ A;  2IJG X;  3U4T A;  3CQG B;  1HZ4 A;  4CGW A;  1U3C A;  1MX6 A;  4DX6 D;  1E7U A;  1W3B A;  3SBT B;  3Q9U C;  1YCS B;  3GYZ A;  3PZ3 A;  2LAI A;  4B89 A;  4EQF A;  4KVO A;  4GU5 A;  4CT0 A;  3SY2 A;  4BET A;  1INZ A;  4HOR A;  5AQA A;  1LD8 A;  4LG6 A;  3Q15 A;  4HBD A;  2KBX A;  3MV3 B;  5JHB A;  2QY7 A;  3EU5 A;  5ENN A;  3MKQ B;  2R05 A;  4IN3 B;  4GPK A;  2HYZ A;  4GZ6 A;  4CCA A;  4I6E A;  1MHQ A;  1O1R A;  1KLX A;  4GYO A;  3R9M A;  2GW1 A;  3CR3 A;  3PEV B;  3ABM E;  4GPM A;  3FUL A;  3PE4 A;  4W9R A;  3UM1 A;  3CHP A;  5HI7 A;  3SBS A;  4GCO A;  3QOU A;  3L17 A;  3UIO C;  3KSL A;  3UMV A;  4OYS A;  4Z68 A;  4YDY A;  3TJP A;  4AJW A;  3QWP A;  3SFY A;  2Y69 E;  1ZBP A;  3CVU A;  5KNG A;  3UT7 A;  2KCV A;  1L5J A;  3CVW A;  1HG5 A;  3B7S A;  1K1A A;  2PM7 A;  3FH8 A;  3FU6 A;  2P58 C;  2WXK A;  4JD2 G;  1FT2 A;  4UI9 K;  4BWR A;  5FWQ A;  4Q69 A;  3NZU A;  1OCO E;  3CGH A;  5FT9 A;  3DST A;  2XRY A;  5FQ8 A;  1DC2 A;  4DLQ A;  2I1J A;  3NF1 A;  4I1M A;  2LXM A;  4I17 A;  3C3R A;  2B0O E;  3TWW A;  5B3S E;  4RQI A;  3ONL A;  3VLE A;  5AEN A;  5CEA A;  3D9I A;  1Z3Y A;  2KCL A;  4BTA A;  3ULQ A;  1MYO A;  3B7U X;  5EDS A;  4GZD A;  3SI5 A;  4FA6 A;  3NB2 A;  3RO3 A;  2JAB A;  1TNO A;  2F0Y A;  5EIB E;  3FH5 A;  4O1O A;  1IHG A;  3PUK A;  2VGX B;  4F53 A;  4PS8 A;  3L82 A;  3R9A B;  1OCZ E;  3D3M A;  4C48 B;  2AXU A;  3CQC B;  4HFG A;  3FUM A;  4L7T A;  2WXR A;  3VLD A;  1YMP A;  2OCC E;  1E90 A;  1QQE A;  2Y3A A;  4JB8 P;  2P9P G;  3EHQ A;  3ZGQ A;  1TNY A;  2WB2 A;  3QB2 A;  3L08 A;  4KVM A;  2E0I A;  3LY9 A;  2VQ2 A;  2DZN A;  3ZW3 A;  3FY4 A;  1S0P A;  3KEZ A;  4ACL A;  1NFI E;  4N5C A;  3LS8 A;  4AP2 A;  1BI8 B;  3GZS A;  4J6I A;  3WG7 E;  4WWP A;  3Q79 A;  2LXL A;  2WPV A;  5CER B;  4DPR A;  3FU3 A;  4HOT A;  1OT8 A;  4RG9 A;  5ENT D;  4EPZ A;  4AY6 A;  4GCN A;  4WAF A;  4MBG A;  3Q9N C;  1JUQ A;  3LXU X;  4JZY A;  2J8S D;  3TL5 A;  2HO1 A;  4O60 A;  2BKG A;  2FI7 A;  2A4Z A;  2PNN A;  2VSX E;  3P1U A;  4MKT A;  3BUA A;  4TUU A;  4X8Q A;  5G2N A;  4GZ3 A;  2FEZ A;  2DVW A;  3ASG A;  1O1T A;  2IOL A;  2L0T B;  2P9S G;  4J8S A;  3MKR A;  2X6J A;  3AU4 A;  4ILI A;  3HXF A;  3LYA A;  3CVY A;  1N9A A;  1OUV A;  4P29 A;  3SHF A;  1N54 A;  3VTX A;  3RRM B;  2H6H A;  5J90 A;  4G1T A;  3PH0 C;  2GGF A;  3TXN A;  3Q49 B;  4QQI A;  5E75 A;  2YHE A;  1FVH A;  2HR2 A;  1N4Q A;  1FCH A;  4ANW A;  4I9C A;  4DRX E;  1Q2Z A;  2WXN A;  2PQN A;  1RW2 A;  4I6G A;  2V0P A;  4EBA G;  5H7P A;  1N11 A;  3EHN A;  3EHR A;  5KWD A;  3CSF A;  1OCR E;  5C2Y A;  1HO8 A;  4WWN A;  1LF8 A;  3Q75 A;  2RFM A;  1OCC E;  4YVO A;  3D9H A;  2WXF A;  3ZFW A;  4BX8 A;  1HE8 A;  4M3O A;  4U0Z A;  4XIF A;  2EQX A;  1E96 B;  4YND A;  1GW6 A;  5CHE E;  3KEA A;  3QK0 A;  3DRA A;  3D9M A;  3APC A;  4YDO A;  4G24 A;  3DEO A;  2CG3 A;  2LSV A;  2XEV A;  5M72 A;  4GZ5 A;  1AP7 A;  1H19 A;  3MEK A;  3AS4 A;  2WVI A;  2IO2 C;  4APO A;  1X81 A;  3ZIM A;  1JPL A;  2DWZ A;  4HLE A;  5FQ4 A;  2L0I A;  1OWL A;  1Z5S C;  4YDE A;  2OV8 A;  3B13 A;  3G2U A;  1HG2 A;  5BNW A;  3PZ4 A;  3HRA A;  5J08 A;  1KPS B;  2XQ0 A;  1KZO A;  3MJW A;  3FUK A;  5LOZ A;  3RO2 A;  4U96 D;  5D0O D;  4GTQ A;  1TN6 A;  4LNU D;  1NZN A;  5HRY A;  3APD A;  3OXG A;  1QBQ A;  2WXH A;  3DBS A;  1HH8 A;  4F7A A;  1QZ2 A;  1LTX A;  1IHB A;  4G2V A;  1KT1 A;  3TAX A;  4Q94 A;  1TN7 A;  2Y4T A;  4Q96 A;  4MLP A;  3PUJ A;  3U3W A;  3D9J A;  2L6B A;  3V30 A;  2NXP A;  1DNP A;  3CKC A;  5CEC B;  4OAU C;  3DSW A;  3UKR G;  3I5P A;  3IEG A;  1WG0 A;  3NQP A;  3PS6 A;  1EDU A;  3CST A;  1QNF A;  1D8E A;  4WNG A;  5ARF A;  4XEI G;  5AYW D;  3LVQ E;  1WDY A;  5KJM A;  4PS3 A;  4E6H A;  4O6F A;  2J49 A;  3B7R L;  2H6G A;  2DBA A;  3MV2 B;  3ZYK A;  5BV1 A;  5EIL A;  3JXI A;  4LER A;  4GYW A;  4PDX A;  2WXQ A;  2NC9 A;  4RLY A;  2J4B A;  3LY7 A;  1MJ0 A;  4LNG A;  3V2O A;  2RKK A;  4KYO B;  2LO6 A;  5C1D A;  3MA5 A;  5EN5 D;  4ANX A;  3SF4 A;  4A3T A;  3BQO A;  4A3V A;  2MYO A;  2XPY A;  3AU5 A;  3LDZ A;  2WXP A;  1E8X A;  3G2W A;  1K8K G;  2F8X K;  3AJI A;  4WND A;  3S7J A;  4I9E A;  2CFZ A;  4OAV B;  4UWF A;  5JA4 D;  4AIF A;  1IQR A;  4DX7 D;  2X38 A;  4F1P A;  2IFU A;  3D9K A;  3FTZ A;  2BF0 X;  2I9C A;  4BFR A;  5CBO A;  3HXB A;  3CVX A;  4I1O B;  3RRU A;  3ASH A;  2PL2 A;  3BG0 B;  3FU0 A;  1EF1 C;  3SZ7 A;  3UX4 A;  4HOU A;  3RJV A;  3HG0 D;  3FHE A;  4ZFH A;  2V5Q C;  2X6K A;  3E30 A;  3G2S A;  2VYI A;  3L13 A;  3EU9 A;  5ENR D;  5EKQ D;  3K9I A;  5DBK A;  1TNZ A;  2GRN B;  2IF4 A;  4HVB A;  4RG6 A;  4CDM A;  3I4R B;  3DSX A;  2XS8 A;  1N4R A;  2F37 A;  3RAU A;  2IOS A;  4I2Z A;  4FHJ A;  3PVL A;  5BXO A;  5LP0 A;  4A55 A;  3VTY A;  1HX8 A;  2V8S E;  1O1S A;  2R17 C;  3LY8 A;  5G04 J;  4BX9 A;  2HM8 A;  2GRL A;  3ZVV A;  4L2L A;  3UM2 A;  5IY5 E;  2VGX A;  2XGM A;  2WXL A;  4G26 A;  2AJA A;  4K5C A;  1BD8 A;  3ASO E;  5ARG A;  3MCX A;  4CDN A;  2ILR A;  3CV0 A;  2KZT A;  1N0Q A;  3FUJ A;  1FPP A;  3FWV A;  2OND A;  1BI7 B;  3LEW A;  3U66 A;  2CFU A;  2R59 A;  3CIA A;  5ANL A;  1H2V C;  5HS0 A;  1KT0 A;  4JEH A;  2DIW A;  2HE0 A;  4NAC A;  2M63 A;  3Q7A A;  5AQ9 A;  4WNE A;  5T3R A;  3RRN B;  5EYL A;  3CKB A;  3HDX A;  2ZIR A;  2MRI A;  2OEW A;  3MX3 A;  3QDN A;  2P9K G;  2RG8 A;  2KM4 A;  3IKO B;  2XPI A; 
#chains in the Genus database with same CATH homology
 3UIN C;  1Z5S C;  2IO2 C;  3UIP C;  3UIO C;  2GRP B;  2IY0 C;  2GRR B;  2GRQ B;  2IO3 C;  5D2M C;  1KPS B;  2GRN B;  2GRO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...