5D2MC

Complex between human sumo2-rangap1, ubc9 and znf451
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
158
structure length
158
Chain Sequence
PPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Structural basis for catalytic activation by the human ZNF451 SUMO E3 ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase,protein binding
total genus 56
structure length 158
sequence length 158
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 5d2mC00
2GROB 1KPSB 3UIPC 2IO2C 3UIOC 2GRNB 1Z5SC 5D2MC 2IY0C 2IO3C 3UINC 2GRQB 2GRPB 2GRRB
chains in the Genus database with same CATH superfamily
4YDOA 3MCXA 4V3IA 3C98A 4AY5A 2AXVA 4HRLA 5FZQA 3U3WA 1A5EA 3SY2A 1B89A 4ACKA 3AJIA 1S0PA 1N9AA 2A5UA 5CECB 5DBKA 5T3RA 2R5SA 3U4TA 1N4QA 1NZNA 4GA0A 3V2XA 4APOA 1PY1A 4DLOA 2EINE 3QDNA 5EILA 2XEEA 2KBXA 4BX9A 3S2AA 1O5MA 4OAUC 3TWWA 3Q9NC 4GZ6A 3G2TA 3I5PA 1SZAA 4J8FA 4HVBA 3EHQA 1UJKA 2LAHA 4ZFHA 2NYJA 3L13A 5JJ6A 4FADA 5DIZA 3QWWA 2L6JA 3UINC 3GZ2A 4JVSA 4LUNU 4AM9A 4CGWA 3CHRA 3MGBA 4KXKB 3UUXA 3DPDA 3PS6A 4MRUA 3JXIA 3RSEG 1LF8A 3ZYLA 3HXDA 3DPYA 3T8MA 2I9CA 4ANXA 4J7WA 4ME2A 3QKYA 4K5BA 3ASNE 1OT8A 3CVUA 3UQ3A 1BPOA 4BX8A 4U8YD 3Q9UC 3B7BA 3BG0B 3ZVVA 2V5FA 3FH5A 1HU3A 4AJWA 2XGSA 1BI8B 3Q4AB 3TWUA 3LJNA 3UM2A 2XRZA 1LD8A 3UM0A 5AIJA 4KYOB 2WPVA 3IXEA 4CZ2D 2EQXA 3TXMA 1WY6A 3PEUB 5FJYA 5AJLA 1S70B 4I1MA 3B7UX 5EIBE 2RKKA 2XS8A 4HLLA 3T5XA 2P9KG 1IQRA 3NB2A 1Z5SC 4NQ0A 4HB5A 4L1BA 3UM1A 1OWNA 4G1TA 4LNGA 1K3ZD 2WXLA 2MOWA 1EDUA 4YVQC 4U0SA 4I1AA 5CMWA 5M72A 3JCKC 2ZIRA 4A63B 3LVRE 1DNPA 3LY7A 4J0UA 3G2UA 4B89A 4FHJA 3Q78A 1FPPA 1H2TC 2ZU6B 4HORA 2LNIA 3AG3E 3ZNGA 3ULYA 4G23A 5ENSD 2XCCA 3CVXA 3V30A 3EIJA 4FU3A 2PQRA 3FP3A 2CG2A 4YDYA 3UIOC 3R9MA 4I9EA 4YNDA 5AAOA 4KZCA 3KD7A 1WM5A 3ZHEB 3RAUA 1X5BA 1LTXA 1BU9A 2GRQB 4TUUA 2V5QC 3HG0D 2I1JA 2VSXE 2XZTG 3SFZA 1SQMA 1JWGA 3S7JA 2DBAA 3PEVB 2FEZA 4JD2G 2F8XK 3GZSA 4AXHA 2IOLA 3HHMA 1N11A 3CHSA 4AY6A 4EECA 4BTBA 2IJGX 1WDYA 3FUNA 3I4GA 4TXQA 1OXJA 1TNBA 3W9GA 2GRMA 2JLBA 1E8WA 1NFIE 1L5JA 4H7YA 3OAWA 2KCVA 4G24A 4AEZC 5CRVA 5A7DB 5BPPA 5EKQD 5LOZA 3MJWA 1H0AA 1Y8MA 3GZ1A 1H6KA 4A3VA 5FWQA 2XHEA 2X6FA 1K1BA 5LCWJ 1S64A 3UT4A 3L6AA 5JMND 2A5EA 3LY9A 4CT0A 3EHNA 4B93B 3ASOE 3FTXA 1TR4A 4BESA 4G8LA 2C0LA 2BTDA 2EIME 2QY7A 4EZKA 4WNGA 5JHBA 1AP7A 3Q15A 4AVXA 3ZYMA 4GMJA 3ZEFA 2BEDA 2HE0A 2XZDG 4GB9A 1K8KG 3CLJA 3FULA 2HM8A 2I2OA 1WAO1 4UWHA 3TWRA 5T8IA 2WQ6A 2VGYA 5AYWD 3S7DA 3TWVA 3SBSA 4TV3A 2MRIA 4P29A 5HQ8A 3FUDA 2DWZA 4DPRA 2R59A 2XPIA 5CERB 5LFAA 1E8YA 3LS8A 3NQPA 4GZDA 3B7RL 4NIKA 1FVFA 3LKUA 1D8DA 1OY3D 3KS2A 3B13A 4X8QA 4Q69A 1IQUA 3PZ2A 3CEQA 1V54E 2HO1A 1BD8A 1IXVA 1DVPA 4I9CA 5A6CA 3AS8A 2KC7A 1TN6A 3DSXA 1EYHA 1TYQG 4A1SA 3P1UA 2MYOA 2ONDA 1NA3A 2ZGGA 1MHQA 3CK7A 4LSZE 4W9RA 3SBTB 4LNBA 3CGHA 5AARA 2OVFA 2C2LA 3APDA 3DBSA 1UW4B 4JZYA 4BERA 3CQGB 2WXPA 3AU5A 1RZ4A 3NZUA 4FJYA 3HVEB 3B95A 2XQ0A 2P58C 1HH8A 1OCCE 3NOGD 2QFCA 1H6OA 2I6HA 3OXGA 4MBGA 5ANLA 1KT1A 1BI7B 3SNXA 4UWGA 1DCQA 3ZU7B 4BEPA 2J08A 5ENRD 1KT0A 4TXPA 4N3CA 5G04J 4JHRA 4CDRA 5KJMA 2R03A 3CSTA 3ZIMA 3FTVA 4PDXA 3B7SA 4Q94A 4GA1A 3VLFA 1UOHA 1HFAA 3C72A 1QQEA 5J08A 4MS6A 4N3AA 4FC8A 4JXTA 2FF4A 2Y69E 1HS6A 4D10C 2LO6A 3APCA 4NACA 5FINA 3BQOA 4J6IA 1TEZA 3PNLB 2H6FA 5FIOA 2E0IA 2FO1E 5FTPA 4CRWA 1N52A 3E34A 3PUKA 3D9KA 5J90A 2V0PA 3FUJA 3FU3A 3TWXA 4FP7A 4C0EA 4CDMA 4AP2A 1SA5A 3DXMG 3CVNA 3EU9A 1MZCA 2X6JA 1XGWA 2QYJA 3BU8A 4YDWA 4UI9K 3RRMB 3PE4A 5JHAA 4HRMB 4U63A 3CVVA 2HYZA 3ZHEA 3QAQA 5ENTD 1O1SA 4RLYA 2J49A 3JUIA 4BSXA 1YMPA 1MX2A 3J5QB 4O60A 3FTYA 4DI4A 5T4YA 1U3DA 5KCMA 4EZLA 2WXGA 4N5CA 3MV2B 1TNYA 4A3TA 3FTSA 4MLPA 4B94A 2KCLA 3WXXA 3FFLA 1OCOE 2XRYA 3EIQC 4HRNA 2A4ZA 3MV3B 1K1AA 3V2OA 4I1OB 4I6EA 1XNFA 4HNAD 4LRZA 3Q49B 3L08A 3RRUA 5BW8C 3CK9A 4E6HA 1INZA 5HS0A 3SHFA 1E96B 3SGHA 5D2MC 5FQ8A 3PH0C 3RU0A 3MEKA 1FVHA 3LDZA 4L9PA 1ELWA 3R7RA 4Y6WA 3RKVA 3T9KA 5CEDB 3GYZA 2PM7A 5KNGA 4UQZA 4A55A 3FUEA 4B8AA 4HFGA 4F1SA 3BUAA 5CMYA 4UWLA 3QJZA 2GRPB 3FU5A 1O1TA 4ACLA 3FTZA 2GRLA 3CVYA 4EBAA 3D9PA 3WG7E 3G2VA 5FQ6A 5FQ7A 1MYOA 1N4RA 2VSOE 2EIJE 4K03A 4L2LA 3TGOA 4GTQA 3B7TA 4WNFA 5AN8A 2GW1A 4XIFA 3SFYA 4EPZA 1IHGA 3O48A 5EIDA 3VLEA 1LD7A 3ZYKA 4L2YA 4DX5D 2VYIA 1OUVA 3QNKA 3PZDA 2GROB 1MQSA 5KJLA 3SFXA 4UQXA 1P5QA 3Q75A 3Q7AA 4B8CB 3CKBA 1KZOA 5ENOD 3KEZA 4GTRA 2IO3C 3UPVA 4XE0A 3OXFA 4BSZB 4GTOA 5B1BE 2YNQA 4FJZA 1D9SA 4APFA 2J4BA 4O1OA 2J4DA 1E7UA 3K9IA 2GGFA 3UTMA 2L6BA 4BWRA 2ETAA 2ETCA 3UT7A 2WXJA 3D9IA 1RW2A 1HZ4A 3PUJA 3HXBA 2J09A 4GMLA 4AOFA 2ILRA 4J8YA 5KNHD 2BKGA 3ABLE 4EHMA 3CHQA 2IU1A 4WWNA 4I6JA 2NXPA 1G3NB 3FEYA 3D9LA 2VGXB 3HVEA 2B0OE 4O6FA 1N4PA 4XEIG 3KAEA 4GTVA 1HX8A 3CVPA 1A17A 3IHYA 4IYPA 1WG0A 2V4HC 3RK6A 2WXNA 2XCBA 5G05C 2GRRB 5BT1A 3IHVA 3FUHA 2P9PG 3UXGA 3AG4E 4WAFA 2VJ8A 1YYHA 3ASFA 3KSQA 4RG6A 2MHKA 1OWPA 3HIZA 3D9OA 2Y4UA 3FU0A 2IEJA 3Q47B 1FT1A 1W3BA 2AW6A 4Q96A 3HRAA 4PS7A 2KZTA 2EIKE 3AS5A 2KCKA 3ZUVB 3I4RB 4JW1A 2AJAA 3TAXA 4GZCA 1DC2A 5BXOA 4GTTA 3L82A 2LSUA 3CHOA 2KATA 1MJ0A 5CBNA 3URZA 2WXRA 3ULQA 4F53A 2ZISA 3N71A 1HF8A 4GCOA 4E85A 2CFUA 2AXUA 2X38A 4MKTA 4N2SA 4GZ3A 4HS2A 2J9QA 2YHCA 4JEUA 2DZOA 4G25A 3CVWA 4I17A 1TNOA 3SZ7A 2WQ7A 2XPYA 3J5PA 1UN9A 2WM9A 3DSUA 3RRNB 3I3NA 3UKRG 1QNFA 4GA2A 2LXLA 2BKKB 3UIPC 3TWSA 3F6QA 2OCCE 3JXJA 3DRAA 3ENEA 1QBQA 4F6RD 2OEWA 2BF0X 3L17A 2R2LA 4M3OA 4WNEA 3D9NA 2Y4TA 4ATZD 3QC1A 4HXIA 4RQIA 5JJ7A 4QFVA 5BV0A 4ANVA 4IN3B 2IF4A 3LVQE 4DLQA 1IYGA 1QYMA 2AXZA 3QB2A 2LAIA 4RG9A 2P9IG 1IHBA 3FUFA 2F37A 2QC9A 4XX5A 3ZRHA 2UY1B 4CEMA 4GAAA 1TJCA 2Y3AA 4DX2A 4NURA 4ABNA 3C5RA 5IY5E 4GPKA 2DYSE 3CV0A 1U3CA 5CCLA 3JYSA 4N39A 3QARA 1JCRA 2XS1A 1H2VC 3FY4A 2IFUA 4TUMA 1NP7A 3AG2E 1UJJA 1KLXA 5ANRA 3R9AB 3LJ3A 2WMNA 2XEVA 3UMVA 2I1KA 4F7AA 4PUCA 4R7LA 2H6IA 2FO7A 5D0QD 4JA9A 3Q73A 3CVLA 3DEOA 3ML8A 4IULA 4N5QA 4NRHB 1EF1C 1JWFA 3HXFA 4XKCA 5ENNA 4UWKA 4UI9C 3LPZA 3RIBA 2X3MA 3CHPA 2IONA 1IKND 3UM3A 2KXPC 2PNNA 4TRQA 3IBEA 5D0OD 3D3MA 2XGOA 3AAAC 1NI1A 3PZ1A 5HKPA 3FWVA 3QOUA 1H6PA 3NAWA 2X6KA 2PZIA 4DK5A 1HO8A 2IO2C 3ESLA 4K5AB 4HBDA 3RO2A 2LSVA 3LY8A 1SA4A 4C48B 2YHEA 3ML9A 1D8EA 3O4ZA 3P2BA 3AG1E 2WVIA 3VLDA 2WXIA 1PAQA 2J07A 2B6CA 2DYRE 4FA6A 3X2QE 5KJNA 4DX1A 2UWJG 3L54A 2H6GA 5FZSA 3HDXA 4AV7A 4BT8A 4DX6D 1YCSB 1DCEA 1N94A 4N2QA 4GTSA 3TG5A 4URKA 3SD5A 4GTMA 5EYLA 2XPZA 1E8ZA 3G2WA 1U2VG 3E32A 3Q79A 5EX0A 5H7PA 1ELRA 3QWVA 2L0TB 3ZFWA 4L23A 3FU6A 4I6GA 3EUVA 3PVLA 4H7XA 2WXOA 2JEKA 4JEHA 3CHMA 4DJAA 3E37A 4CGVA 4WNDA 3PE3A 4F1PA 2VGXA 5FZRA 3AU4A 4RVBA 4GTPA 3GW4A 1OWOA 2WXKA 5KWDA 2L9BA 4U04A 3ISMC 3MKQB 5EX3A 4DRXE 5E75A 2RFAA 5LX8A 2CHXA 1N95A 2WXMA 5AJDA 3EHRA 1UN8A 1KZPA 3ZXSA 1Q2ZA 1Z6TA 2P9UG 3FDHA 4EBAG 5FQ4A 3ZGQA 1TJFA 3E30A 3LXUX 3HYMB 1OWMA 4GPMA 5BV1A 5AQ7A 3JQ1A 5ARFA 3ZW3A 4C9BB 4FHKA 4GYWA 2RG8A 2Y0BG 3L9TA 3PNTB 1ZB1A 3D9JA 4OVVA 3CIAA 4K5CA 2VQ2A 2WQHA 3PZ4A 2FBNA 3CK8A 2OV8A 5CCMA 3IKOB 1Z3XA 5AQBA 3TXNA 5FT9A 3V31A 3Q5MA 2RD0A 3BG1B 2V4LA 4HI8A 3KSLA 4JA7A 1TN8A 4U96D 5C2YA 2ETBA 2OVBA 2YINA 1SW6A 5KJKA 4OAVB 1NA0A 2J8SD 1TNZA 2JABA 4Y6CA 2BUGA 3TG4A 4BY6A 3NOCD 4Z68A 4U95D 2VTBB 2WXQA 4UWFA 4C0MA 2DZNA 4OVUA 5BNWA 3ONKA 3SO8A 3APFA 4M7CA 4J8SA 4EQFA 4HOTA 4DI3A 3EHMA 4FLHA 4WUYA 4G11A 2OOEA 4JL0A 2CHZA 4IRUA 2LUHA 3ZYQA 4UUCA 4WWOA 5JJTA 3C3QA 2P2CP 2PL2A 2UY1A 2R05A 3KEAA 1KPSB 3CQCB 2AWIA 3TWTA 5BXUA 2X6HA 3UKUG 3JUEA 1TNUA 4GCNA 3IEGA 4QQIA 2E2EA 2CG3A 2P9NG 2XGMA 5KBAA 2WB2A 3FUIA 2DIWA 3ZKJA 1H2UA 1MX6A 2R02A 5C1DA 1N0QA 4BFRA 4HOUA 2FULA 5B3SE 3ZXPA 1E8XA 4GZ5A 4JC8A 3NZSA 4ATGA 4B0ZA 3C3OA 3S7BA 5AQAA 3FTUA 2VGEA 3L22A 4OYSA 2HR2A 5ARGA 4UQYA 1OWLA 4BT9A 3AS4A 1HG2A 1EPUA 4KZ0A 1FT2A 4XI9A 4J8DA 3LCAA 1E7VA 3FUKA 4ANWA 3BEEA 3DEPA 2IQCA 4KT6B 1BLXB 5G05J 1UG3A 2VSYA 4KBQA 2GRNB 1MX4A 4XKBA 2Q7FA 3L16A 5E76A 3FHEA 4GYYA 1ZU2A 4XZ4A 5HI7A 3ZN3A 2CHWA 2VSNA 3EDTB 4U8VD 4HLEA 3ABKE 3RO3A 4KVOA 2IOSA 4DX7D 4LERA 2OEVA 2RFMA 3MX3A 3PDNA 3ZPJA 2L0IA 3S7FA 2LXMA 1AWCB 3QK0A 4KVMA 3E33A 1JCSA 1SVXA 4AIFA 4LNUD 3TJPA 3SQVA 5AQ9A 4G2VA 4I2ZA 2Y1LE 2IY0C 4XI0A 3U66A 1E90A 3DXKG 3V79K 3OTNA 1JCQA 3DSSA 4G8KA 2KM4A 3E4BA 5G55A 3FUMA 2AVPA 3DSTA 3W9FA 3TL5A 5LCWC 4PH4B 3EU5A 3MKRA 4PS3A 1N4SA 2ZGDA 5ENQD 3OXLA 3U9WA 3JQ0A 3DWLG 5LP0A 2QZAA 3ABME 5AENA 2WXFA 1N0RA 3PZ3A 3MKQA 2F0YA 4N3BA 3NF1A 4LEUA 1PC2A 5EDSA 3T5VA 3SF4A 1FCHA 3QWPA 1JPLA 3CKCA 4JB8P 4GYOA 4DUIA 3MA5A 3UI2A 3D9MA 1OCRE 4U8HA 3CVQA 1HXIA 5B1AE 5D66A 4K0RA 3R7QA 4EZJA 2M63A 2XEHA 3PREA 3MZLB 4FLBA 4LCTA 1NL4A 1HE8A 4WWPA 2QYUA 4G26A 3HXCA 2WMOA 5CBOA 4JHKA 2P9SG 4ANUA 3CSFA 4I43A 4CCAA 3MYVA 5A23A 3LYAA 4GU5A 2WXHA 3FEXA 1ELKA 2F8YA 5G2NA 3UT8A 1VDYA 1JUQA 4HOQA 4CDNA 4FULA 2PQNA 2FI7A 3VTYA 1YA0A 1QZ2A 2EILE 2YQ8A 5HRYA 4I2WA 4CYMD 5EYPF 2V8SE 3ULEG 4BETA 3C3RA 3U64A 3CR3A 4YVOA 2CFZA 2DVWA 3ASHA 3ONLA 2H6HA 3IV0A 3EJNA 4UI9J 3Q7FA 4HQDA 2VTBA 2NSZA 4U0UA 3TWQA 4TXRA 1ZBPA 2PM6A 4PS8A 3VTXA 4JHJA 3T8KA 4F3VA 4A1GA 2XENA 4CT4A 2NC9A 4JPSA 4RSYA 4HI9A 2C0MA 4U07A 3NBNB 4ILGA 3DSVA 2X6IA 3FH7A 5G04C 1Z3YA 3FTWA 4KMOA 4J8EA 4LG6A 1O1RA 1S63A 3SI5A 5ITZF 1X81A 2KZTB 4ILIA 5BUZA 2P9LG 5CRUA 1OCZE 4U0ZA 4ILHB 4BTAA 2DCPA 5CEAA 1GW6A 3ASDA 1TN7A 1N54A 3PRZA 5CHEE 3ASGA 1HG5A 4L7TA 5ENPD 3RJVA 3D9HA 4O1PA 3LEWA 4GMRA 4U7EB 3G2SA 2ZXWE 3DSWA 4YDEA 3ESKA 3FH8A 1Y6IA 2R17C 1SZ9A 3HXEA 4HOSA 1V55E 5EN5D 3UX4A 4ZHBA 1H19A 5JA4D
chains in the Genus database with same CATH topology
2GROB 1KPSB 3UIPC 2IO2C 3UIOC 2GRNB 1Z5SC 5D2MC 2IY0C 2IO3C 3UINC 2GRQB 2GRPB 2GRRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRO B;  1KPS B;  3UIP C;  2IO2 C;  3UIO C;  2GRN B;  1Z5S C;  5D2M C;  2IY0 C;  2IO3 C;  3UIN C;  2GRQ B;  2GRP B;  2GRR B; 
#chains in the Genus database with same CATH topology
 4YDO A;  3MCX A;  4V3I A;  3C98 A;  4AY5 A;  2AXV A;  4HRL A;  5FZQ A;  3U3W A;  1A5E A;  3SY2 A;  1B89 A;  4ACK A;  3AJI A;  1S0P A;  1N9A A;  2A5U A;  5CEC B;  5DBK A;  5T3R A;  2R5S A;  3U4T A;  1N4Q A;  1NZN A;  4GA0 A;  3V2X A;  4APO A;  1PY1 A;  4DLO A;  2EIN E;  3QDN A;  5EIL A;  2XEE A;  2KBX A;  4BX9 A;  3S2A A;  1O5M A;  4OAU C;  3TWW A;  3Q9N C;  4GZ6 A;  3G2T A;  3I5P A;  1SZA A;  4J8F A;  4HVB A;  3EHQ A;  1UJK A;  2LAH A;  4ZFH A;  2NYJ A;  3L13 A;  5JJ6 A;  4FAD A;  5DIZ A;  3QWW A;  2L6J A;  3UIN C;  3GZ2 A;  4JVS A;  4LUN U;  4AM9 A;  4CGW A;  3CHR A;  3MGB A;  4KXK B;  3UUX A;  3DPD A;  3PS6 A;  4MRU A;  3JXI A;  3RSE G;  1LF8 A;  3ZYL A;  3HXD A;  3DPY A;  3T8M A;  2I9C A;  4ANX A;  4J7W A;  4ME2 A;  3QKY A;  4K5B A;  3ASN E;  1OT8 A;  3CVU A;  3UQ3 A;  1BPO A;  4BX8 A;  4U8Y D;  3Q9U C;  3B7B A;  3BG0 B;  3ZVV A;  2V5F A;  3FH5 A;  1HU3 A;  4AJW A;  2XGS A;  1BI8 B;  3Q4A B;  3TWU A;  3LJN A;  3UM2 A;  2XRZ A;  1LD8 A;  3UM0 A;  5AIJ A;  4KYO B;  2WPV A;  3IXE A;  4CZ2 D;  2EQX A;  3TXM A;  1WY6 A;  3PEU B;  5FJY A;  5AJL A;  1S70 B;  4I1M A;  3B7U X;  5EIB E;  2RKK A;  2XS8 A;  4HLL A;  3T5X A;  2P9K G;  1IQR A;  3NB2 A;  1Z5S C;  4NQ0 A;  4HB5 A;  4L1B A;  3UM1 A;  1OWN A;  4G1T A;  4LNG A;  1K3Z D;  2WXL A;  2MOW A;  1EDU A;  4YVQ C;  4U0S A;  4I1A A;  5CMW A;  5M72 A;  3JCK C;  2ZIR A;  4A63 B;  3LVR E;  1DNP A;  3LY7 A;  4J0U A;  3G2U A;  4B89 A;  4FHJ A;  3Q78 A;  1FPP A;  1H2T C;  2ZU6 B;  4HOR A;  2LNI A;  3AG3 E;  3ZNG A;  3ULY A;  4G23 A;  5ENS D;  2XCC A;  3CVX A;  3V30 A;  3EIJ A;  4FU3 A;  2PQR A;  3FP3 A;  2CG2 A;  4YDY A;  3UIO C;  3R9M A;  4I9E A;  4YND A;  5AAO A;  4KZC A;  3KD7 A;  1WM5 A;  3ZHE B;  3RAU A;  1X5B A;  1LTX A;  1BU9 A;  2GRQ B;  4TUU A;  2V5Q C;  3HG0 D;  2I1J A;  2VSX E;  2XZT G;  3SFZ A;  1SQM A;  1JWG A;  3S7J A;  2DBA A;  3PEV B;  2FEZ A;  4JD2 G;  2F8X K;  3GZS A;  4AXH A;  2IOL A;  3HHM A;  1N11 A;  3CHS A;  4AY6 A;  4EEC A;  4BTB A;  2IJG X;  1WDY A;  3FUN A;  3I4G A;  4TXQ A;  1OXJ A;  1TNB A;  3W9G A;  2GRM A;  2JLB A;  1E8W A;  1NFI E;  1L5J A;  4H7Y A;  3OAW A;  2KCV A;  4G24 A;  4AEZ C;  5CRV A;  5A7D B;  5BPP A;  5EKQ D;  5LOZ A;  3MJW A;  1H0A A;  1Y8M A;  3GZ1 A;  1H6K A;  4A3V A;  5FWQ A;  2XHE A;  2X6F A;  1K1B A;  5LCW J;  1S64 A;  3UT4 A;  3L6A A;  5JMN D;  2A5E A;  3LY9 A;  4CT0 A;  3EHN A;  4B93 B;  3ASO E;  3FTX A;  1TR4 A;  4BES A;  4G8L A;  2C0L A;  2BTD A;  2EIM E;  2QY7 A;  4EZK A;  4WNG A;  5JHB A;  1AP7 A;  3Q15 A;  4AVX A;  3ZYM A;  4GMJ A;  3ZEF A;  2BED A;  2HE0 A;  2XZD G;  4GB9 A;  1K8K G;  3CLJ A;  3FUL A;  2HM8 A;  2I2O A;  1WAO 1;  4UWH A;  3TWR A;  5T8I A;  2WQ6 A;  2VGY A;  5AYW D;  3S7D A;  3TWV A;  3SBS A;  4TV3 A;  2MRI A;  4P29 A;  5HQ8 A;  3FUD A;  2DWZ A;  4DPR A;  2R59 A;  2XPI A;  5CER B;  5LFA A;  1E8Y A;  3LS8 A;  3NQP A;  4GZD A;  3B7R L;  4NIK A;  1FVF A;  3LKU A;  1D8D A;  1OY3 D;  3KS2 A;  3B13 A;  4X8Q A;  4Q69 A;  1IQU A;  3PZ2 A;  3CEQ A;  1V54 E;  2HO1 A;  1BD8 A;  1IXV A;  1DVP A;  4I9C A;  5A6C A;  3AS8 A;  2KC7 A;  1TN6 A;  3DSX A;  1EYH A;  1TYQ G;  4A1S A;  3P1U A;  2MYO A;  2OND A;  1NA3 A;  2ZGG A;  1MHQ A;  3CK7 A;  4LSZ E;  4W9R A;  3SBT B;  4LNB A;  3CGH A;  5AAR A;  2OVF A;  2C2L A;  3APD A;  3DBS A;  1UW4 B;  4JZY A;  4BER A;  3CQG B;  2WXP A;  3AU5 A;  1RZ4 A;  3NZU A;  4FJY A;  3HVE B;  3B95 A;  2XQ0 A;  2P58 C;  1HH8 A;  1OCC E;  3NOG D;  2QFC A;  1H6O A;  2I6H A;  3OXG A;  4MBG A;  5ANL A;  1KT1 A;  1BI7 B;  3SNX A;  4UWG A;  1DCQ A;  3ZU7 B;  4BEP A;  2J08 A;  5ENR D;  1KT0 A;  4TXP A;  4N3C A;  5G04 J;  4JHR A;  4CDR A;  5KJM A;  2R03 A;  3CST A;  3ZIM A;  3FTV A;  4PDX A;  3B7S A;  4Q94 A;  4GA1 A;  3VLF A;  1UOH A;  1HFA A;  3C72 A;  1QQE A;  5J08 A;  4MS6 A;  4N3A A;  4FC8 A;  4JXT A;  2FF4 A;  2Y69 E;  1HS6 A;  4D10 C;  2LO6 A;  3APC A;  4NAC A;  5FIN A;  3BQO A;  4J6I A;  1TEZ A;  3PNL B;  2H6F A;  5FIO A;  2E0I A;  2FO1 E;  5FTP A;  4CRW A;  1N52 A;  3E34 A;  3PUK A;  3D9K A;  5J90 A;  2V0P A;  3FUJ A;  3FU3 A;  3TWX A;  4FP7 A;  4C0E A;  4CDM A;  4AP2 A;  1SA5 A;  3DXM G;  3CVN A;  3EU9 A;  1MZC A;  2X6J A;  1XGW A;  2QYJ A;  3BU8 A;  4YDW A;  4UI9 K;  3RRM B;  3PE4 A;  5JHA A;  4HRM B;  4U63 A;  3CVV A;  2HYZ A;  3ZHE A;  3QAQ A;  5ENT D;  1O1S A;  4RLY A;  2J49 A;  3JUI A;  4BSX A;  1YMP A;  1MX2 A;  3J5Q B;  4O60 A;  3FTY A;  4DI4 A;  5T4Y A;  1U3D A;  5KCM A;  4EZL A;  2WXG A;  4N5C A;  3MV2 B;  1TNY A;  4A3T A;  3FTS A;  4MLP A;  4B94 A;  2KCL A;  3WXX A;  3FFL A;  1OCO E;  2XRY A;  3EIQ C;  4HRN A;  2A4Z A;  3MV3 B;  1K1A A;  3V2O A;  4I1O B;  4I6E A;  1XNF A;  4HNA D;  4LRZ A;  3Q49 B;  3L08 A;  3RRU A;  5BW8 C;  3CK9 A;  4E6H A;  1INZ A;  5HS0 A;  3SHF A;  1E96 B;  3SGH A;  5D2M C;  5FQ8 A;  3PH0 C;  3RU0 A;  3MEK A;  1FVH A;  3LDZ A;  4L9P A;  1ELW A;  3R7R A;  4Y6W A;  3RKV A;  3T9K A;  5CED B;  3GYZ A;  2PM7 A;  5KNG A;  4UQZ A;  4A55 A;  3FUE A;  4B8A A;  4HFG A;  4F1S A;  3BUA A;  5CMY A;  4UWL A;  3QJZ A;  2GRP B;  3FU5 A;  1O1T A;  4ACL A;  3FTZ A;  2GRL A;  3CVY A;  4EBA A;  3D9P A;  3WG7 E;  3G2V A;  5FQ6 A;  5FQ7 A;  1MYO A;  1N4R A;  2VSO E;  2EIJ E;  4K03 A;  4L2L A;  3TGO A;  4GTQ A;  3B7T A;  4WNF A;  5AN8 A;  2GW1 A;  4XIF A;  3SFY A;  4EPZ A;  1IHG A;  3O48 A;  5EID A;  3VLE A;  1LD7 A;  3ZYK A;  4L2Y A;  4DX5 D;  2VYI A;  1OUV A;  3QNK A;  3PZD A;  2GRO B;  1MQS A;  5KJL A;  3SFX A;  4UQX A;  1P5Q A;  3Q75 A;  3Q7A A;  4B8C B;  3CKB A;  1KZO A;  5ENO D;  3KEZ A;  4GTR A;  2IO3 C;  3UPV A;  4XE0 A;  3OXF A;  4BSZ B;  4GTO A;  5B1B E;  2YNQ A;  4FJZ A;  1D9S A;  4APF A;  2J4B A;  4O1O A;  2J4D A;  1E7U A;  3K9I A;  2GGF A;  3UTM A;  2L6B A;  4BWR A;  2ETA A;  2ETC A;  3UT7 A;  2WXJ A;  3D9I A;  1RW2 A;  1HZ4 A;  3PUJ A;  3HXB A;  2J09 A;  4GML A;  4AOF A;  2ILR A;  4J8Y A;  5KNH D;  2BKG A;  3ABL E;  4EHM A;  3CHQ A;  2IU1 A;  4WWN A;  4I6J A;  2NXP A;  1G3N B;  3FEY A;  3D9L A;  2VGX B;  3HVE A;  2B0O E;  4O6F A;  1N4P A;  4XEI G;  3KAE A;  4GTV A;  1HX8 A;  3CVP A;  1A17 A;  3IHY A;  4IYP A;  1WG0 A;  2V4H C;  3RK6 A;  2WXN A;  2XCB A;  5G05 C;  2GRR B;  5BT1 A;  3IHV A;  3FUH A;  2P9P G;  3UXG A;  3AG4 E;  4WAF A;  2VJ8 A;  1YYH A;  3ASF A;  3KSQ A;  4RG6 A;  2MHK A;  1OWP A;  3HIZ A;  3D9O A;  2Y4U A;  3FU0 A;  2IEJ A;  3Q47 B;  1FT1 A;  1W3B A;  2AW6 A;  4Q96 A;  3HRA A;  4PS7 A;  2KZT A;  2EIK E;  3AS5 A;  2KCK A;  3ZUV B;  3I4R B;  4JW1 A;  2AJA A;  3TAX A;  4GZC A;  1DC2 A;  5BXO A;  4GTT A;  3L82 A;  2LSU A;  3CHO A;  2KAT A;  1MJ0 A;  5CBN A;  3URZ A;  2WXR A;  3ULQ A;  4F53 A;  2ZIS A;  3N71 A;  1HF8 A;  4GCO A;  4E85 A;  2CFU A;  2AXU A;  2X38 A;  4MKT A;  4N2S A;  4GZ3 A;  4HS2 A;  2J9Q A;  2YHC A;  4JEU A;  2DZO A;  4G25 A;  3CVW A;  4I17 A;  1TNO A;  3SZ7 A;  2WQ7 A;  2XPY A;  3J5P A;  1UN9 A;  2WM9 A;  3DSU A;  3RRN B;  3I3N A;  3UKR G;  1QNF A;  4GA2 A;  2LXL A;  2BKK B;  3UIP C;  3TWS A;  3F6Q A;  2OCC E;  3JXJ A;  3DRA A;  3ENE A;  1QBQ A;  4F6R D;  2OEW A;  2BF0 X;  3L17 A;  2R2L A;  4M3O A;  4WNE A;  3D9N A;  2Y4T A;  4ATZ D;  3QC1 A;  4HXI A;  4RQI A;  5JJ7 A;  4QFV A;  5BV0 A;  4ANV A;  4IN3 B;  2IF4 A;  3LVQ E;  4DLQ A;  1IYG A;  1QYM A;  2AXZ A;  3QB2 A;  2LAI A;  4RG9 A;  2P9I G;  1IHB A;  3FUF A;  2F37 A;  2QC9 A;  4XX5 A;  3ZRH A;  2UY1 B;  4CEM A;  4GAA A;  1TJC A;  2Y3A A;  4DX2 A;  4NUR A;  4ABN A;  3C5R A;  5IY5 E;  4GPK A;  2DYS E;  3CV0 A;  1U3C A;  5CCL A;  3JYS A;  4N39 A;  3QAR A;  1JCR A;  2XS1 A;  1H2V C;  3FY4 A;  2IFU A;  4TUM A;  1NP7 A;  3AG2 E;  1UJJ A;  1KLX A;  5ANR A;  3R9A B;  3LJ3 A;  2WMN A;  2XEV A;  3UMV A;  2I1K A;  4F7A A;  4PUC A;  4R7L A;  2H6I A;  2FO7 A;  5D0Q D;  4JA9 A;  3Q73 A;  3CVL A;  3DEO A;  3ML8 A;  4IUL A;  4N5Q A;  4NRH B;  1EF1 C;  1JWF A;  3HXF A;  4XKC A;  5ENN A;  4UWK A;  4UI9 C;  3LPZ A;  3RIB A;  2X3M A;  3CHP A;  2ION A;  1IKN D;  3UM3 A;  2KXP C;  2PNN A;  4TRQ A;  3IBE A;  5D0O D;  3D3M A;  2XGO A;  3AAA C;  1NI1 A;  3PZ1 A;  5HKP A;  3FWV A;  3QOU A;  1H6P A;  3NAW A;  2X6K A;  2PZI A;  4DK5 A;  1HO8 A;  2IO2 C;  3ESL A;  4K5A B;  4HBD A;  3RO2 A;  2LSV A;  3LY8 A;  1SA4 A;  4C48 B;  2YHE A;  3ML9 A;  1D8E A;  3O4Z A;  3P2B A;  3AG1 E;  2WVI A;  3VLD A;  2WXI A;  1PAQ A;  2J07 A;  2B6C A;  2DYR E;  4FA6 A;  3X2Q E;  5KJN A;  4DX1 A;  2UWJ G;  3L54 A;  2H6G A;  5FZS A;  3HDX A;  4AV7 A;  4BT8 A;  4DX6 D;  1YCS B;  1DCE A;  1N94 A;  4N2Q A;  4GTS A;  3TG5 A;  4URK A;  3SD5 A;  4GTM A;  5EYL A;  2XPZ A;  1E8Z A;  3G2W A;  1U2V G;  3E32 A;  3Q79 A;  5EX0 A;  5H7P A;  1ELR A;  3QWV A;  2L0T B;  3ZFW A;  4L23 A;  3FU6 A;  4I6G A;  3EUV A;  3PVL A;  4H7X A;  2WXO A;  2JEK A;  4JEH A;  3CHM A;  4DJA A;  3E37 A;  4CGV A;  4WND A;  3PE3 A;  4F1P A;  2VGX A;  5FZR A;  3AU4 A;  4RVB A;  4GTP A;  3GW4 A;  1OWO A;  2WXK A;  5KWD A;  2L9B A;  4U04 A;  3ISM C;  3MKQ B;  5EX3 A;  4DRX E;  5E75 A;  2RFA A;  5LX8 A;  2CHX A;  1N95 A;  2WXM A;  5AJD A;  3EHR A;  1UN8 A;  1KZP A;  3ZXS A;  1Q2Z A;  1Z6T A;  2P9U G;  3FDH A;  4EBA G;  5FQ4 A;  3ZGQ A;  1TJF A;  3E30 A;  3LXU X;  3HYM B;  1OWM A;  4GPM A;  5BV1 A;  5AQ7 A;  3JQ1 A;  5ARF A;  3ZW3 A;  4C9B B;  4FHK A;  4GYW A;  2RG8 A;  2Y0B G;  3L9T A;  3PNT B;  1ZB1 A;  3D9J A;  4OVV A;  3CIA A;  4K5C A;  2VQ2 A;  2WQH A;  3PZ4 A;  2FBN A;  3CK8 A;  2OV8 A;  5CCM A;  3IKO B;  1Z3X A;  5AQB A;  3TXN A;  5FT9 A;  3V31 A;  3Q5M A;  2RD0 A;  3BG1 B;  2V4L A;  4HI8 A;  3KSL A;  4JA7 A;  1TN8 A;  4U96 D;  5C2Y A;  2ETB A;  2OVB A;  2YIN A;  1SW6 A;  5KJK A;  4OAV B;  1NA0 A;  2J8S D;  1TNZ A;  2JAB A;  4Y6C A;  2BUG A;  3TG4 A;  4BY6 A;  3NOC D;  4Z68 A;  4U95 D;  2VTB B;  2WXQ A;  4UWF A;  4C0M A;  2DZN A;  4OVU A;  5BNW A;  3ONK A;  3SO8 A;  3APF A;  4M7C A;  4J8S A;  4EQF A;  4HOT A;  4DI3 A;  3EHM A;  4FLH A;  4WUY A;  4G11 A;  2OOE A;  4JL0 A;  2CHZ A;  4IRU A;  2LUH A;  3ZYQ A;  4UUC A;  4WWO A;  5JJT A;  3C3Q A;  2P2C P;  2PL2 A;  2UY1 A;  2R05 A;  3KEA A;  1KPS B;  3CQC B;  2AWI A;  3TWT A;  5BXU A;  2X6H A;  3UKU G;  3JUE A;  1TNU A;  4GCN A;  3IEG A;  4QQI A;  2E2E A;  2CG3 A;  2P9N G;  2XGM A;  5KBA A;  2WB2 A;  3FUI A;  2DIW A;  3ZKJ A;  1H2U A;  1MX6 A;  2R02 A;  5C1D A;  1N0Q A;  4BFR A;  4HOU A;  2FUL A;  5B3S E;  3ZXP A;  1E8X A;  4GZ5 A;  4JC8 A;  3NZS A;  4ATG A;  4B0Z A;  3C3O A;  3S7B A;  5AQA A;  3FTU A;  2VGE A;  3L22 A;  4OYS A;  2HR2 A;  5ARG A;  4UQY A;  1OWL A;  4BT9 A;  3AS4 A;  1HG2 A;  1EPU A;  4KZ0 A;  1FT2 A;  4XI9 A;  4J8D A;  3LCA A;  1E7V A;  3FUK A;  4ANW A;  3BEE A;  3DEP A;  2IQC A;  4KT6 B;  1BLX B;  5G05 J;  1UG3 A;  2VSY A;  4KBQ A;  2GRN B;  1MX4 A;  4XKB A;  2Q7F A;  3L16 A;  5E76 A;  3FHE A;  4GYY A;  1ZU2 A;  4XZ4 A;  5HI7 A;  3ZN3 A;  2CHW A;  2VSN A;  3EDT B;  4U8V D;  4HLE A;  3ABK E;  3RO3 A;  4KVO A;  2IOS A;  4DX7 D;  4LER A;  2OEV A;  2RFM A;  3MX3 A;  3PDN A;  3ZPJ A;  2L0I A;  3S7F A;  2LXM A;  1AWC B;  3QK0 A;  4KVM A;  3E33 A;  1JCS A;  1SVX A;  4AIF A;  4LNU D;  3TJP A;  3SQV A;  5AQ9 A;  4G2V A;  4I2Z A;  2Y1L E;  2IY0 C;  4XI0 A;  3U66 A;  1E90 A;  3DXK G;  3V79 K;  3OTN A;  1JCQ A;  3DSS A;  4G8K A;  2KM4 A;  3E4B A;  5G55 A;  3FUM A;  2AVP A;  3DST A;  3W9F A;  3TL5 A;  5LCW C;  4PH4 B;  3EU5 A;  3MKR A;  4PS3 A;  1N4S A;  2ZGD A;  5ENQ D;  3OXL A;  3U9W A;  3JQ0 A;  3DWL G;  5LP0 A;  2QZA A;  3ABM E;  5AEN A;  2WXF A;  1N0R A;  3PZ3 A;  3MKQ A;  2F0Y A;  4N3B A;  3NF1 A;  4LEU A;  1PC2 A;  5EDS A;  3T5V A;  3SF4 A;  1FCH A;  3QWP A;  1JPL A;  3CKC A;  4JB8 P;  4GYO A;  4DUI A;  3MA5 A;  3UI2 A;  3D9M A;  1OCR E;  4U8H A;  3CVQ A;  1HXI A;  5B1A E;  5D66 A;  4K0R A;  3R7Q A;  4EZJ A;  2M63 A;  2XEH A;  3PRE A;  3MZL B;  4FLB A;  4LCT A;  1NL4 A;  1HE8 A;  4WWP A;  2QYU A;  4G26 A;  3HXC A;  2WMO A;  5CBO A;  4JHK A;  2P9S G;  4ANU A;  3CSF A;  4I43 A;  4CCA A;  3MYV A;  5A23 A;  3LYA A;  4GU5 A;  2WXH A;  3FEX A;  1ELK A;  2F8Y A;  5G2N A;  3UT8 A;  1VDY A;  1JUQ A;  4HOQ A;  4CDN A;  4FUL A;  2PQN A;  2FI7 A;  3VTY A;  1YA0 A;  1QZ2 A;  2EIL E;  2YQ8 A;  5HRY A;  4I2W A;  4CYM D;  5EYP F;  2V8S E;  3ULE G;  4BET A;  3C3R A;  3U64 A;  3CR3 A;  4YVO A;  2CFZ A;  2DVW A;  3ASH A;  3ONL A;  2H6H A;  3IV0 A;  3EJN A;  4UI9 J;  3Q7F A;  4HQD A;  2VTB A;  2NSZ A;  4U0U A;  3TWQ A;  4TXR A;  1ZBP A;  2PM6 A;  4PS8 A;  3VTX A;  4JHJ A;  3T8K A;  4F3V A;  4A1G A;  2XEN A;  4CT4 A;  2NC9 A;  4JPS A;  4RSY A;  4HI9 A;  2C0M A;  4U07 A;  3NBN B;  4ILG A;  3DSV A;  2X6I A;  3FH7 A;  5G04 C;  1Z3Y A;  3FTW A;  4KMO A;  4J8E A;  4LG6 A;  1O1R A;  1S63 A;  3SI5 A;  5ITZ F;  1X81 A;  2KZT B;  4ILI A;  5BUZ A;  2P9L G;  5CRU A;  1OCZ E;  4U0Z A;  4ILH B;  4BTA A;  2DCP A;  5CEA A;  1GW6 A;  3ASD A;  1TN7 A;  1N54 A;  3PRZ A;  5CHE E;  3ASG A;  1HG5 A;  4L7T A;  5ENP D;  3RJV A;  3D9H A;  4O1P A;  3LEW A;  4GMR A;  4U7E B;  3G2S A;  2ZXW E;  3DSW A;  4YDE A;  3ESK A;  3FH8 A;  1Y6I A;  2R17 C;  1SZ9 A;  3HXE A;  4HOS A;  1V55 E;  5EN5 D;  3UX4 A;  4ZHB A;  1H19 A;  5JA4 D; 
#chains in the Genus database with same CATH homology
 2GRO B;  1KPS B;  3UIP C;  2IO2 C;  3UIO C;  2GRN B;  1Z5S C;  5D2M C;  2IY0 C;  2IO3 C;  3UIN C;  2GRQ B;  2GRP B;  2GRR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...