4I6EA

A vertebrate cryptochrome
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
490
structure length
471
Chain Sequence
b'ASSVHWFRKGLRLHDNPALLAAVARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQEDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKANANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-2
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 156
structure length 471
sequence length 490
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6eA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6eA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6eA01
1JILA 3HL4A 1N3LA 2A84A 3CLSC 4EG6A 1QTQA 1OBCA 1F7VA 2PZBA 2NZ2A 4ZCSA 1OWPA 1Y42X 1WOYA 2E89A 4CT0A 3ND5A 1FYDA 4QREA 1OWOA 2WQ7A 1MRZA 1NUQA 1WXIA 4QBTA 3CVVA 4EG1A 3IOEA 3FDXA 2JA2A 1EFPA 3I05A 3IMCA 2PZ8A 1N1DA 4L2IA 3PXUA 2VTBA 4MW0A 2C5SA 4KPUB 3IVXA 4ARCA 2VXOA 1O94D 3OP1A 4MW6A 2QJFA 3RK1A 4KKVA 1YUNA 4MVCA 3RHSA 1HYBA 4MUGA 4DJAA 1G8HA 2DLCX 1M83A 5HUJA 3E27A 1V47A 1O95D 1QRUA 4Q16A 3HFJA 3FI0A 1U3DA 1T9GS 1J21A 2A1UA 3FWKA 1F7UA 4NZPA 4DLPA 2DUMA 1XNHA 1VBMA 4EF6A 1WXGA 2H29A 2GM3A 2CV0A 1KAMA 2O8VA 3AIIA 4KR9A 3A2KA 2BYTA 4YP7A 1COZA 3G6KA 5DASA 3Q4GA 3K32A 1J1UA 3X1MA 4ZT3A 1O97D 2DXIA 1MB2A 2PXHA 3BL5A 4CDNA 1EJ2A 1GN8A 3CA8A 5AHWA 1G8FA 3UOWA 2TS1A 5HUHA 5JBNA 1KQNA 1K92A 3ZUGA 3D6UA 2CYBA 2AZXA 4MVXA 1NURA 1PFVA 2I1LA 1WXHA 2XRZA 2A1TS 1R6TA 1QRSA 2HGZA 3HGMA 1N77A 1NUSA 1LI7A 3H05A 1M8GA 4ZCPA 3QTTA 2YXNA 1SURA 4U63A 2WB2A 4MWCA 1G59A 5J59A 2PFSA 4ZT5A 3OTWA 4ND6A 2E18A 5KHAA 1TYBE 2AG6A 1M8JA 1H3NA 4DE5A 3KFLA 3SP1A 1QU3A 3CVYA 2CT8A 3IOCA 1N78A 4HPWA 1FFYA 1KKUA 1IQ0A 4OJMX 3TZEA 2E21A 1EXDA 1ZH6A 3G59A 1O6BA 2XRYA 3IUEA 3U1VA 2QUJA 2A86A 2ZUFA 1XNJA 3L93A 1N2OA 1LI5A 3DLAA 3LE8A 5FNZA 3DPIA 2A88A 1VBKA 4L2IB 1D2RA 2GKSA 3UY4A 2G36A 4WSOA 3TQIA 1R6XA 2PZAA 1J20A 2WSIA 2J09A 1TFUA 1JIJA 1A8HA 1KORA 1QU2A 4MWDA 2ZUEA 1M8PA 1N2EA 4DDKA 5TGTA 1MJHA 2QUIA 2YWCA 4I6JA 3FOCA 3IH5A 3TZLA 1X8XA 4ZCTA 4NX2A 1J1ZA 3DO8A 3S3TA 4JFAA 2O5RA 2A1UB 1NSYA 4MQ6A 3QTBA 5LM3A 2E0IA 2CV1A 1F4LA 4E1AA 4XFJA 1NI5A 1ULHA 4MUNA 1GZUA 1MBZA 3H99A 1NYLA 4MUFA 5DEOA 3FETA 3IODA 5J5AA 3NBAA 4WNYA 1Q15A 1S4MA 3RFFA 4GU5A 3QE4A 1GTRA 3GLVA 1K4MA 1BS2A 5TEWA 3RJZA 1EUYA 4NATA 2CYAA 2QTRA 4S1OA 3INNA 1F9AA 2JAXA 1Q19A 2JANA 2J4DA 2D54A 4MWBA 1N2HA 1KH1A 1K4KA 4K0RA 3PNBA 3C8ZA 4PBSA 1YULA 1J70A 3HMQA 1T6XA 2GOYA 3M5WA 2Z3VA 4ARIA 1P7PA 1XNGA 1QRTA 2CFOA 1H1TA 5DK4A 3ZJUA 2DEUA 1N2JA 1LW7A 3ZGZA 1ZJWA 1N2IA 3MUEA 3H97A 3VGJA 4EG7A 2IELA 4G6ZA 4ZCRA 1TYAE 1KQOA 4UZEA 4YP5A 1T9GR 1PG2A 5LFAA 4JXZA 3D6VA 3CLUD 2EL7A 1IQRA 1KH2A 3F3MA 3MMXA 1IVSA 3IVCA 5F23A 4GRIA 4R0NA 1JECA 3ILVA 1JZQA 3FY4A 1M1ZA 3H9BA 1UFVA 2X1LA 3UMVA 4AQ7A 2RD2A 1QNFA 4HK4A 3X1JA 1Q77A 1WXFA 3CVUA 2ZP1A 1WKBA 2Z09A 2Z08A 4DDHA 4UZFA 3CVWA 1U0BB 4EFKA 1XJQA 3VU8A 3CLTC 2A1TR 1O96B 4YP6A 1OBHA 3ZJVA 3CVXA 1O5TA 3COWA 1TYDE 1ZUNA 1PFWA 2QUKA 1H3EA 1OWLA 1OWNA 1OWMA 3X1KA 3A04A 4ZT6A 1I6MA 1QJCA 1R6UA 5DB4A 3FNRA 3PNYA 4KR7A 3GMIA 2IP1A 4EG8A 1B6TA 2H2AA 3COZA 2R5WA 3CLUC 4QRDA 3ZXSA 3IDFA 1N75A 4MW1A 1MB9A 4MUIA 1U3CA 2J5BA 5H16A 1KQPA 2X1MA 2HZ7A 1WQ3A 2HMAA 2IJGX 1K97A 2X3FA 1KH3A 1M8KA 2PIDA 3JXEA 2CV2A 1O96A 2QJOA 2J07A 1GAXA 4ND7A 1ZH0A 2B7LA 2YY5A 3RK0A 2CUZA 3ND6A 1EUQA 1TEZA 4MWEA 1JEDA 1VBNA 3G5AA 1KP2A 1WY5A 4MW7A 3AL0C 1YIAA 4EG4A 1EE1A 5IHXA 3N05A 4FZJA 1TQ8A 3KT0A 4EG3A 1MAWA 1DNPA 1T6YA 3IUBA 3NV7A 1VLHA 1H3FA 4RPIA 3ZXIA 2V0CA 1I6LA 2QTNA 1PG0A 3FH0A 2A7XA 3P0HA 1JIKA 3IMEA 1J09A 4MW5A 1IHOA 5K0TA 1WXEA 4F3RA 4I6GA 3TNJA 2QUHA 1NP7A 3ZJTA 4G5YA 4PBRA 1I6KA 1U7XA 4MVWA 3MXTA 1X6VA 4MLPA 4P2BA 1N2BA 5J58A 3CR8A 3ND7A 4JZYA 2D13A 4DDMA 3PNVA 3SZ3A 3RBAA 4Q93A 3P52A 3SDBA 2DPLA 1JMVA 1YUMA 2RE8A 4XSVA 5KWVA 1MOPA 4R2MA 4X0EA 4OUDA 5FO1A 3HZRA 3ZIUA 1ILEA 3IMGA 3P0JA 4CDMA 4PY2A 3LCJA 1N2GA 1I2DA 1EFVA 1WJGA 3AFHA 3NBKA 3COYA 3L92A 4J76A 3A05A 4KR6A 3CLTD 3DV2A 5K0SA 3CLRC 5HG0A 2V0GA 2OV4A 1WQ4A 1G8GA 4MVYA 4RUKA 5FO0A 1JZSA 2A4MA 3AKZA 2EJCA 3KT8A 3AG6A 1T6ZA 1KP3A 1KR2A 4I6EA 4NDAA 1YIDA 2QTMA 1NUPA 5TEVA 1GTSA 3UK2A 1JIIA 3TS1A 4PBTA 2PG3A 3COVA 2X0KA 3SEQA 4ZCQA 3KT3A 4KPUA 4NAHA 1MAUA 4ZT7A 3N2YA 5KCMA 2WQ6A 1QQTA 3FG9A 3FHJA 3AG5A 2J08A 2DETA 4H3SA 1KAQA 3IVGA 1V8FA 5H7XA 4MW9A 2CSXA 4G5FA 3PRHA 4MUEA 3HV0A 4MAFA 3MLAA 1O94C 4JXXA 4J75A 2BTEA 5TS2A 1IRXA 1NUTA 4CQNA 3ISJA 4XFDA 1JEEA 1NUUA 4TS1A 1GPMA 3K9WA 1O95C 1U7DA 1O0BA 1YI8A 2NSYA 1RQGA 4YMIA 3ELBA 2DR2A 3CLSD 4U7JA 1VL2A 4MUKA 3FIUA 1TYCA 4MW4A 2AKEA 1CT9A 4ZT4A 1O0CA 4EGAA 4HJXA 3SZGA 5BNZA 1WZ2A 2D5BA 2CYCA 4MUHA 1MC1A 2QJTA 4NAUA 1IQUA 4HJRA 3GUZA 4MUJA 3TQOA 1JHDA 1O97C 1M8FA 4EG5A 3H9CA 2OQ2A 5EKDA 3Q10A 3VRHA 2DERA 3N9IA 1IFXA 4K03A 5LLTA 4JYZA 3Q12A 3IOBA 3MLBA 3LOQA 1OD6A 1JGTA 4ZT2A 1GLNA 3SEZA 5IJXA 1EFPB 3A4IA 3N8HA 4BWVA 1NZJA 3SYTA 4OUDB 4AS1A 4MULA 4DNXA 2YWBA 4U8HA 1Q11A 4MW2A 4R2LA 1IH8A 4YBRA 3UC5A 4A91A 2VTBB 3KT6A 1PFYA 3P0IA 4F4HA 3CLRD 1PFUA 1EFVB
chains in the Genus database with same CATH superfamily
4MS3B 4NIMA 4MB2A 4KRYA 4IEEA 1M2GA 1P5JA 1M3SA 3I61A 4WI1A 3WMWA 5A4AA 2QQ5A 3UJ9A 2EF1A 4MW6A 4ZRDA 4DQXA 2MSCB 4AUMA 1H1DA 5CA1A 1RABA 1JHMA 4QFBA 1D1SA 3PFCA 3T41A 1RYFA 5F12A 5I6DA 1J21A 4H9GA 3JD3A 4QOGA 4FN5A 2X8BA 1H4TA 1WY7A 3EXFB 5TMDA 1XDBA 2X0RA 4KZCA 4DCCA 3EIJA 2EQAA 2PWYA 1KK0A 5DKFA 1MO3A 3UW3A 4MPTA 4DCJA 3EDRA 4H15A 5KNCH 1O89A 3UUFA 2ZRBA 3V2GA 2YV3A 2KB0A 2ZBRA 4WE3A 1PNOA 3V2UA 4JP3A 4RK0A 3T7CA 3L7YA 3EVAA 2PLFA 2JH8A 1MRNA 4IP0A 3R7DA 1M2OA 3KSZO 4G67A 1XWIA 5A9SA 3HU2A 3AI1A 4OPMA 2W2PA 2IKSA 5LU8A 1CUEA 2CVHA 2OCYC 5AM1A 1X8JA 3D4BA 1N2OA 1U9IC 3ZDDA 2FXIA 4RD3A 1GQRA 4QO7A 5IK2A 2Z2XA 2QHXA 2ZS9A 1T3ZA 121PA 3K8QA 4ZJZA 1SN7A 4EBAG 4FQ8A 2CBXA 4F1JA 2A5GA 4U8VD 3ZCUA 3KKZA 3UTDA 4UASA 3F2VA 4BO2A 2AJBA 3FFTA 3E2PA 5I3ZA 3KKLA 5GV7A 5B1EA 1F6WA 4DIKA 1JJFA 4I1UA 2GZ3A 1DC5A 2V7QA 4XUDA 3ORQA 4RHEA 3FFAA 4RZXA 5FI5A 4HYQA 5KKNB 5BQFA 2Z3VA 2Z83A 2Q9AA 5E7JA 4Y2QA 4ENSA 3OZUA 4DZRA 3SD7A 5B3KA 5DNVA 1H0KA 3P4UA 5M2QA 1QZTA 2WMYA 4LXYA 1V1RB 1PR3A 2R6JA 4X8HA 2QQEA 1O9HA 4HRNA 4O0MA 1CYEA 1UM9B 4JI1B 1C41A 3RVRA 5KREA 4EHJA 1VL5A 1UFVA 1AS2A 3DMYA 5KSOA 1IIBA 3KWMA 3CKMA 3A1EA 1E2HA 2C2WA 5CVEA 1KEEB 1L7EA 4BVBA 1U0BB 4DYHA 3PZDA 2XYGA 3SEFA 4II7A 2Z2IA 4CKEB 4J0IA 1WQ1R 2FMXA 1U6JA 2A9QA 4WXEA 1JXOA 2GF2A 2VQ3A 3IXMA 5BV8A 1X3LA 3NHSA 1TLFA 4DCUA 4FSXA 3QPDA 1TEZA 2G1UA 3DDWA 1MW9X 3EQ7A 3VNAA 1GZ5A 3RBZA 4FQ5A 4DR7B 4DSAA 4LY3A 3UOGA 1H93A 5KTSA 4GZMA 2I80A 3FSRA 3V33A 4MI1A 1YZGA 4CMBA 1VI6A 3OD5A 2C2MA 2N75A 4G8CA 4EW1A 2QRZA 1GADO 2ERCA 2QUZA 3OHSX 3FRJA 2X9GA 4UD2A 3CHQA 3PEWA 3L92A 4PU0A 5JNSA 4E3ZA 1N33B 4HAXA 5B57C 5I9MA 3W8DA 1YA4A 3LKVA 2VYNA 3PUVA 2CHQA 1S64A 3MW8A 5CM2Z 4MYTA 4FOSA 1RI1A 5IVIA 3PE4A 1XTRA 1OFVA 5AQ7A 3HKEB 4UBIA 1DQRA 3IVGA 4YCJA 1SOAA 5AHKA 2Z95A 4HNVA 3P9SA 2LCIA 2YOFA 1HZJA 4DBVO 3AM4A 4P7KA 5AW6A 1CUXA 3F67A 1O95C 4HNUA 4CN8A 4ENVA 2O52A 2XAAA 4ZI5A 2VJBA 4XIGS 3TOZA 1GYQA 3RQSA 4CMJA 4LMBA 4EG5A 3PEUB 4GD3Q 3Q10A 1W3BA 2CVZA 4UTVA 3EAQA 5BYJA 2A5FA 2C7RA 4Z8XA 1TJ4A 4MLZA 3WK7A 1SH7A 3KLMX 1XRMA 1DL5A 4MJ7A 2IX3A 3DZFA 3LT2A 2WMOB 1NUQA 3DB2A 1TO1E 3SQOA 1FY2A 3DUFA 4D26A 5KSYA 2VTBA 5EYPF 4QC2A 3O9VA 4DXHA 1AP7A 3JAWA 5IVDA 2F17A 1VE5A 2WHPB 1SCBA 3PICA 3DSSA 3CN9A 1E96B 2IIQA 3FPEA 4NNPA 3VHLB 1RD4A 3RTDA 1H69A 1E2BA 3BGOS 4JKOA 3NJRA 1U99A 3QEMA 2NGRA 5HJ2A 1SC3A 3VI3B 1QQ5A 1OU0A 1MVOA 3AHFA 3E84A 2J67A 3LFTA 2CXPA 1OY1A 1M8GA 1TUIA 3IQDB 1KIFA 5CDFA 2ILTA 2K4MA 3PX7A 5BYAA 5K9ZA 3M4NA 3CWCA 2CNKA 2AG6A 3HBJA 1CJSA 4FGUA 3E8XA 2WXIA 3SSOA 4U7TB 4L4ZA 5C32A 2H9YA 2H6FA 1H8ED 1KHTA 4FP7A 3PS9A 3WWPA 1X9HA 4UUPA 1HDCA 2J3LA 2J09A 2J5RA 4OG2A 3AKDA 2Q29A 4E4TA 3DNMA 3V79K 3AZOA 1FB5A 1S0PA 2JGLA 2ST1A 2ZZKA 5KDLA 5AQEA 3VU9B 1M5UA 5IT0A 4IXNA 2Q4BA 2O1EA 4CTOA 4AP2A 3FLEA 4AZTA 1NL4A 4Z9XA 2J85A 2AMJA 1C3OB 4BEBA 2QPAA 2W6OA 4B31A 5D3QA 3L0YA 4WDRA 1PW7A 4D9CA 1O5MA 3OQ1A 3HN2A 4UEJA 3H16A 2L18A 3D9MA 1SY7A 1Y1QA 4X20B 3QITA 5DYNA 4ESHA 3ELUA 1ADBA 5C0OE 2PS3A 1ATIA 1LRKA 1JDTA 5SZIA 3GH1A 3G0OA 3HKCA 4FHDA 3E8MA 3GJQA 3R3ZA 4M0MA 4J9UE 3LXXA 3C3BA 1Z3XA 4UU1A 2X1LA 3J7TA 3LCUA 3BWXA 2PUGA 1X7GA 2O2GA 1OAOA 4MGYR 2P3QA 1C3JA 1O96B 3IBYA 4HQ0A 1L5FA 4OGGA 4ROTA 4NF2A 2CXNA 5J4YA 2QJWA 3CEMA 1LPMA 1RJ9B 3IO5A 4HH4A 4GXRA 1XVVA 3RRUA 2P4HX 1DU4A 2XGSA 2OOEA 4HQNA 3V4VB 2ORWA 3EFHA 4BSZB 5IHXA 4C6RA 5E4FA 3ZXYA 2I0FA 1ZITA 3D5QA 5AVWA 3KIPA 4FGSA 1WXEA 4FS8A 1NVMB 1CE8A 3OUUA 2Y0PA 5D85A 3BTSA 3CY6A 4ZARA 1X6VA 3MQ2A 4P2BA 2I7TA 4CM4A 3P52A 3K9BA 4LDJA 1DKUA 5LQUA 3CX4A 3T1HB 1CULC 2CEKA 1T2UA 5JWRA 3FWVA 3DQZA 4WX2B 5LB4A 5K0SA 5L8VA 3GP3A 3L1HA 1KO8A 3N2NA 3FP3A 3HXLA 5EXEA 3CHRA 3KAJA 4MHTA 4PFKA 4UUOA 3VZDA 4HFGA 2G4LA 5TPZD 4EZJA 5JTUA 4EF4A 3Q15A 1J4AA 4UFNA 3D81A 1G3NB 3G0IA 1JIQA 1FP7A 2C9ZA 1TUEA 1LPBB 3Q3EA 2GK3A 3O8NA 4JLAA 3GH3A 4QIHA 5IEJA 2VDNB 4PFQA 1NYTA 1G9XA 3VR6D 1FPMA 2ZZMA 1XZHA 3J5QB 3QPVA 4R2WA 1T36A 4DLNA 5KYWA 4R3UC 4C4ZA 2B4AA 1BJTA 1UQRA 5EXSA 5A0TA 3OMLA 3CEAA 4BGEA 1ZOIA 2PCLA 5A23A 4YIHA 4YMUA 4LYAA 4C87A 4RKRA 4BSXA 1Z8FA 3A4TA 5ALHA 3T0FA 1Z62A 5MGBA 3D3JA 3TQTA 1NLFA 1NG9A 1B76A 3VU1A 4MJ3A 4F1SA 3QLVC 1TYQG 2HJGA 1EDUA 3PPXA 2YQ4A 3Q9SA 5D66A 3OP1A 4MVJI 221PA 3A9CA 4A2PA 3RHSA 1BXGA 1L5HA 1T9GS 4HZIA 1ZD9A 4ZHSA 1ELOA 2R84A 3R3SA 2JLBA 2GYUA 1O4WA 2D1FA 2Q4EA 3ICPA 1EM8A 3U3MA 4P4SA 1HO8A 3FUXA 1E9AA 2QRGA 2H85A 4KX5A 4DI4A 1W8IA 1CB7A 1UJCA 5FLYA 2KCKA 4R8LA 3WIVA 3O93A 2C99A 5ALNA 4XDZA 3T5BA 3TMAA 4RPLA 3RWBA 1Y5NA 2BLNA 4MS4A 7AT1A 2QY6A 4OQXA 3IFSA 1OHHA 1T9DA 2VHCA 2D00A 4MGIR 4S12A 1Y8ZA 2BTDA 1OF1A 4HQOA 2FEXA 2KW5A 3S3TA 3SNKA 4P1ZA 1KTVA 3OFND 3U2QA 3W04A 3HH8A 4F93B 3JZDA 1RIFA 1NI5A 1CQIB 2WT8A 1SC9A 3OA0A 2FMFA 2B4KA 2VSQA 3TJMA 5TR9A 1GQYA 2FW6A 3C7DB 3QE4A 1YQWA 3L4BC 5DSTA 3CRZA 5AJVB 3Q6IA 4Q1VA 1FFWA 4DQLA 3VVCA 4GPMA 1A5SB 2DHEA 3QBDA 3HE3A 4DSUA 1CJCA 3MUEA 3ZNQA 4JHKA 5FA8A 4UNQA 2W83A 4EJ0A 3ZVKA 3ENQA 4U3JB 4WNDA 3DE1X 1Z8DA 3O91A 3ESDA 4OIFA 2KLBA 2JGDB 2C9YA 1W36C 1X7WB 4N9WA 1QGYA 4WCVA 5KOHA 2P9LG 4YRIA 3WLFA 1W9MA 4OYRA 4EB6A 1YV9A 3HKBA 4AJEA 3JARB 1QE0A 3KZXA 3U62A 1TU0A 5BV0A 2KBEA 1TKCA 4ILKA 3E1KA 4BL5A 5AR1A 2HW8A 2IDJA 2V6FA 3PGJA 3OZGA 3F2IA 1HZZC 1Z5PA 1S3GA 1E61A 2Z30A 1A5TA 3OE7D 4A2QA 4JIMA 3HM2A 1WDYA 3VTZA 3VPDA 3S0JA 1T6YA 2BFWA 3HJRA 3D2AA 1I10A 3KYCA 4AP9A 4BLPA 3WLAA 2X8JA 4Y1RB 3CR8A 3OJOA 1RYNA 2G8LA 2F67A 2FQWA 2VNKA 1S5PA 1OA1A 4LGYA 4H0NA 4XIIA 1P7ZA 3SQNA 1P1BA 1C14A 3I2FA 2Q5FA 1ETHA 4EVSA 2O8BA 4BWYA 3ERCA 4DCOA 1Y1SA 1PQPA 2WYHA 5C5DA 1C9JA 2XMZA 4MGEA 1JIVA 4TXJA 5A06A 4HOSA 3BPSA 3O4GA 2ZRNA 1BEEA 2OWEA 4GOLD 1PJZA 1IIRA 3CEJA 4FZRA 3FG9A 4DMUB 1V3VA 3BZUA 1IEQA 4WKGA 1WPGA 3ZWAA 2Q8NA 1O08A 3CK9A 3MQ4A 4UE2A 4AY3A 3Q40A 3LUFA 5CYGA 3L0CA 4LTMA 1YRQA 4CEIA 2HX1A 2JJQA 2BBSA 3ZKWB 1J8QA 1A7JA 4JI7B 3WGJA 4YJGA 4HVAA 1ODJA 1NIJA 2VDWB 4BKUA 2PA0A 3PSAA 2YDXA 1XP5A 3U4HA 3FCCA 4JDUA 3W7VA 3GAAA 1P1CA 2E4AA 3SYMA 1KKMA 3CX8A 2CFCA 3PQCA 3PVCA 2HL6A 5HSGA 2FKAA 4JLMA 3H5NA 4XA8A 1W87A 4HLQB 3R20A 2PBFA 3OTGA 4YHBA 2B1JA 1MQ8B 1JYSA 1KP9A 1QCDA 4MVJM 1QCZA 3QSGA 3EPRA 1Q92A 2R65A 3DKIA 4S2UA 1EFDN 2W2XA 1SW6A 3KQLA 1E1RD 3MYYA 5EYPA 3A9RA 5IJAA 1P4GA 4W82A 2BT4A 5C7YA 2VJMA 4UNRA 4QYTA 4MUGA 3DMFA 3DCIA 2BFAA 3NOVA 3NDPA 3QOUA 1MABA 5CTAA 4PV7A 4AY4A 2F1JA 4QYXA 1E63A 3CN7A 5LZ7A 3IXQA 3IJ5A 3C1UA 3LF1A 4UI9J 3BXHA 1Y0BA 5BMVB 2ZXWE 5JTTA 4CIYA 5E75A 4A0FA 1F9EA 1E9DA 3KVOA 4WADA 2BFDA 2HGZA 2VUTA 4D57A 2GN0A 1XA0A 1N94A 4Z2AA 4EMSA 1WKCA 1ZLYA 2PQ6A 3SJUA 2WUVA 3RKUA 3THYB 1AJEA 5C34B 5HIAA 4MDFA 1YZ3A 3L06A 4RD0A 3SJCA 4ESEA 1RACA 2W8BA 5B4UA 3B7BA 1K8ZB 5EGNA 2I2DA 4AN4A 3G2JA 1F8GA 2H9IA 5LMZA 5MGNA 4G5GA 2PZGA 1HYEA 1PT5A 1EFHA 1M66A 1V7CA 5IAAA 1QH8A 1JG1A 4DCTA 1ZUHA 4YRQA 5GONF 1FDOA 4FJ0A 3ZBTA 4F3KA 3EISA 3EHDA 5HZKA 3T8KA 1EA5A 3T5VA 4QODA 4CKCB 3ANSA 1FNNA 2EIKE 1E60A 3ENEA 4MUFA 3A6LA 4D45A 5BRAA 4GDMA 1U28A 1P5FA 2B69A 5H8WA 4G1UC 1K7YA 1H2ZA 1N0HA 1N4AA 3K9CA 4UREA 5CFLA 4BO0A 3HUTA 5CK4A 1UN8A 1FDUA 1XLUA 2I1KA 2KWIA 1JFRA 4ETIA 4B7UA 3VJLA 3WHKA 3B95A 3R7AA 1J49A 1YS7A 1IY0A 3HR4A 3UXGA 3JATA 3TRKA 5A5DA 3TLYA 2GFQA 5KJNA 2QAGC 2OBMA 2IYVA 3AV3A 1IONA 1N2CA 2EQXA 2IPXA 4EUKA 1QQ6A 1BJKA 1N2XA 4C05A 3CGGA 2PCJA 1EDZA 5JY1A 2EBWA 4CL3A 2A0XA 1ESDA 3FUTA 3E9ZA 2PFKA 3V7YA 1NT4A 3OCVA 2DUJA 3GMDA 2GBIA 3RASA 1ZHFA 2Q2NA 2Q50A 2J07A 1WU8A 4RDIA 1H2UA 2V54A 1H6CA 3X3HA 2EERA 1RCUA 3VZRA 3IUBA 3V2XA 4NWIA 2K6GA 1Y7TA 2JAUA 4TM7A 3GO4A 3WA6A 1B41A 2G1PA 5CEAA 1M1NB 3MWGA 5LP6C 4MICA 1DV2A 2YH2A 3WRYA 3OE4A 4QD3A 1T1IA 1N1MA 1JW9B 4TYNA 1W75A 1AB6A 4MQ5A 3DM9B 4C29A 4LKOA 4F1KA 3JTEA 1I4EB 2R48A 5G0WA 2H00A 4IVRA 2WF6A 4DMFA 3U4MA 2MYPA 3H6KA 4DNQA 3Q88A 3G13A 4EHIA 4YQFA 4UXJA 1B2LA 2A9KA 5AUQA 3F8SA 4KODA 3KT3A 4NYJR 4ZAXA 3QUQA 4IIJF 3DDCA 3N2LA 4BN4A 1C7RA 2V58A 1T15A 2O1SA 2OL4A 2H5LA 5AW1A 1PJ2A 1K6MA 4TS1A 4TUYB 1QE5A 4J1TC 2F1OA 5HPYB 3T3EA 1V3UA 1WZUA 3QFFA 1G18A 2RGNA 1DZ3A 2Y8EA 3G5MA 1GAWA 4S24A 4FR2A 3EXG2 1Z35A 4UWGA 1NP3A 4DMCA 3OZRA 1E1QD 3W5SA 4OQFA 4KO3S 1WNFA 1UDCA 1HQCA 4CIAA 4MW2A 4JL6A 3CJTA 4HDKA 1YQEA 5LLDA 4D4MA 3IILA 2GB4A 3UT5A 3RO7A 3QKSA 2BTQA 4WVLA 4FKBA 1L9XA 1OCZE 1CUVA 1IY9A 4C5CA 1KYTA 4XAQA 4UBKA 1W1IA 2BOVA 4C7BA 5CJPA 5BVHA 3DKRA 1II8B 5JNUA 1X7XB 1OLUB 3LC2O 3VU0A 1V47A 4Z51A 2WU1A 2WE7A 1U2DC 4I9UA 2PY6A 3I1YA 2C4NA 2QI9F 2I67A 4Y2RA 4APOA 4IZOA 4XCQA 1H5UA 4O5AA 4NG5A 4WK0B 1ONBA 4PG8A 4WV3A 4EA8A 1KJWA 2ISSD 3ZE8A 1I51A 1RWNA 1KQ3A 1YS1X 3U9TA 3FZGA 2FXVA 4U63A 2WB2A 4MV4A 1AURA 3RO2A 1N0RA 4H1HA 5CA0F 2AG0A 4U7DA 2NTEA 2H6IA 4WACA 4HMPA 2BEJA 4G5RA 2LNIA 1AGPA 5JFGA 3JQEA 5DK6A 3ZCRA 3JVIA 1NN0A 1IQ0A 3UJ6A 1T9KA 4DC0A 2P40A 3QNWA 1EYHA 3G59A 1I0LA 1A95A 3ETCA 3K1YA 3OPYA 4Z5XA 3ZHEA 1NF2A 1TM7E 2QS9A 5T8IA 8ATCA 1XCPA 3DEFA 2NV6A 4YMVA 4O8ZA 2XXAB 1BA3A 2ZU6A 3RC9A 1P73A 3FUIA 3CUYA 3T7SA 4LFAB 3C3MA 3BAZA 3IVAA 4H3KB 2VVTA 1UFOA 1VLJA 3LX8A 5BY2A 4D7AA 1IDOA 2TSYB 1GZUA 3FYUA 3VLDA 1UXIA 2VT6A 3LCAA 2HEGA 3FETA 5ERXA 3MCXA 5DNAA 3O84A 4NI5A 3OX3A 3CLJA 1Q6ZA 1DTWA 3IL2A 2PA3A 3CO5A 3ABKE 2DBYA 4WBXC 3HUUA 1ECFA 3PC8A 3GZTB 4JBIA 3PG5A 1SXHA 3MT7A 3FTEA 1JT9A 1RXUA 1C1XB 2DRIA 1HF3A 4OEHA 1PZFA 2FN4A 4G0QA 1ZIPA 1WXQA 3L0IB 2CZQA 1C50A 1NZDA 2DFVA 3KPYA 1G5FA 5FYDA 4P53A 4HEQA 4S0ZA 4FULA 3DZKA 1NXTA 2C9CA 2EINE 4O59O 3MT0A 4HB2A 3ZWMA 4KKXB 2UU9B 1EIWA 2EW1A 3ZGLA 4M0CA 2LDBA 3VYWA 4DX7D 1XCLA 1JDBC 1CIJA 3V8PA 1TUBB 1NW9B 4N5MA 5LJIA 5TVGA 3H9JA 2P2DA 5AUNB 3CSUA 4DRXA 4I9EA 3S5JA 2EOAA 2XWPA 4P7JA 1NASA 2OE2A 1VLHA 4DDTA 2HQOA 3G9QA 4LUNU 4KAAA 4DSOA 2A7XA 4YJDA 2F3TA 4U7PB 3NYWA 5IM5A 1EESA 4EHNA 1ECJA 1NXSA 3VX4A 4F6CA 4CLRA 3LLMA 2WSBA 1T0IA 4LOLA 5KJCA 1BCRA 3W5IA 4XSVA 4GCNA 1UT8A 4JXKA 1PS0A 3BEOA 1BYIA 4EYGA 3OPMA 3RWOA 4DPRA 2CMDA 3ACBA 5BW8A 1YDMA 4PN3A 3LLUA 2ZIXB 4KR6A 5CNKA 3F6CA 3EEYA 1K3ZD 3AI3A 4FMDF 5SZHB 1ECGA 4TYWA 1MNQA 4G5HA 3RRZA 4YV0A 5ED4A 2VGXA 4YQZA 3KXKA 1ZINA 3GR6A 3HTXA 1FMCA 2OXEA 2VK4A 2BELA 2GHTA 3PEVA 3ED5A 3K9NA 2IYRA 3MLAA 1CZRA 4CQLA 4FC6A 1RI3A 2EATA 4D4IA 1T5SA 1UDWA 4B5KA 3GRRA 4JI3B 3GEPA 3IP6A 4MUKA 2M9MA 2FPLA 4HVBA 2WU3A 3RSOA 2CYCA 1Z4OA 4PLZA 2C4UA 3GUZA 4DKJA 3WO0A 4ZTBA 3UFXB 2OOKA 1GY8A 3MZ0A 1NL3A 5EKDA 3HDTA 3RJMA 4QFDA 3MLBA 2I9CA 3A27A 3Q3JB 4PSKA 3L7MA 1ISRA 4Z9FA 1XXHA 3B6KA 3PE6A 4MA5A 2PR7A 3R0VA 3MWDB 2MSEB 3JD4A 4C5BA 3HB9A 2BP7A 1OWPA 2AJDA 1ADGA 5IMSA 4HZUB 4QTUB 1NJ6A 1UP6A 2FEAA 3KOXA 5FQ7A 2XHZA 4ENQA 1DADA 3DZDA 2PBRA 4I36A 5IJ9B 3I42A 1H65A 3V34A 1JLRA 3QPAA 1W5FA 4EFNA 1W0JD 2Q07A 5KWDA 4XWOA 2Y05A 1F0YA 1Z6YA 4C01A 1C80A 2AUMA 1TCVA 3QVGA 1K6JA 4QLOA 4ZTUB 3NI2A 3K6RA 3GF4A 2CJWA 1UMDA 2XTZA 5FHQA 4DX6D 1UN9A 4WTOA 2VZLA 2JJMA 2QTTA 3TSAA 1AN0A 1KJ8A 5CW1A 4GNRA 3F7OA 1M1YA 1V6AA 4U2GA 4QU0A 1N6HA 1HLPA 4H4DA 2FN3A 4DREA 1RQNA 5BWNA 3VOAA 3PEYA 2R7KA 1XQ9A 3DEKA 4YCSA 5LQSA 2OHXA 1VYTA 1IXRC 3HVRA 3LQRA 3PWSA 4PNZA 4A0RA 5A5VA 1X15A 1WB6A 4G0MA 3AETA 3EYAA 1XTQA 3M1YA 2YHIA 3ENNA 5FWXB 3FTSA 4FEEA 2ATXA 4I14A 2PX3A 2PMBA 4X64B 2IIPA 3EZNA 5GONA 1LSSA 1N2CE 2BMEA 3KUXA 1DKOA 1PJLA 1L5YA 4GECA 4L3OA 5K8JB 3SLRA 1Q1NA 3G9ZA 2PAAA 2MSDB 2VFAA 1H6OA 4CR8A 2QXUA 5AOCA 4BCCA 2FQYA 3X1DA 1BFKA 3RFFA 1YR2A 4JBXA 4UEWA 4OHCA 2C42A 1E6WA 3UIPC 1TGVA 3NTXA 3W5JA 2QYHA 1NDQA 4TN5A 3PNBA 3I39X 2I1WA 4LNHA 2X40A 3WL6A 4ARIA 5D51S 3BGDA 2P9PG 5FTNA 1G7CA 1QFMA 3E3OA 3V8QA 3OOSA 2C8VA 1TNOA 1AB5A 4HRAA 1EVIA 4W7HA 1DEHA 3IVCA 1T5TA 4MRPA 3OTHA 4BERA 4Q9AA 5CD9A 5HS0A 2BFCB 1VYHA 1ZMTA 1R0BA 1DC3A 3NKFA 5C1OA 4U1RA 3JALB 2PWAA 4B4DA 3BCHA 3KJEA 3E4CA 1AKWA 4XSHA 3KDAA 1A0OA 1GNVA 1VHWA 1OLSA 4X93A 4UCFA 1L5JA 4D41A 3C1TA 4ZZ1A 3ROTA 3DL0A 5C52B 4IXWA 1L7PA 3WGIA 4CLHA 3RC2A 5EZYA 3D9PA 2AEEA 3MGGA 3AEYA 3HHPA 1Z8NA 4BRWA 1XVAA 2ZG6A 3EJWA 1VBFA 2JFWA 4LXHA 1OTYA 3ZWKA 1GKIA 2BI8A 4N0MA 3EZGA 1YZVA 3HDJA 4YASA 1W9HA 2ZRMA 3TIXB 1QK4A 3ME5A 5KWVA 3TAHA 1RLUA 1HDOA 2P41A 1GO2A 1S01A 4OY3A 3GJRA 2SKCA 4H6PA 4QYMA 5BOVA 2QNRA 4BTBA 1ZD1A 1T1EA 1E2LA 3OT1B 4ZI7F 4Z4EA 2COUA 5D3MA 3LHSA 4UJ3A 2P2SA 1H9BA 1LBHA 1II0A 2PSEA 5FO0A 1KP3A 1SK8A 4KGZA 2NM0A 4IIJA 4FFBA 1CG6A 1ZX1A 1U2GC 5JALA 2PYZA 5EX3A 4YAWA 1DDOA 1NOKA 3G89A 3RVJA 4B9EA 1G21E 2ZUTA 2C04A 3D7SA 1DIAA 1YR6A 1BCSB 3B36A 3DCJA 3NKVA 3SIXA 3HGTA 2KMLA 3W5CA 3L0BA 3ZN2A 2OYCA 4JL0A 3AINA 5D1NA 1I2BA 1JQAA 4PZUA 5DI3B 5K0JA 4JLUA 5HM6A 2H4JA 2WYOA 4LV8B 1FFDA 4QJ5A 5EIBC 1KGSA 3OIWA 3ECCA 2H08A 3WG7E 4PYRA 2YOGA 1N0WA 5DZSA 3BKWA 4PG7A 4B3SB 2PBLA 4DCMA 4AY5A 4DMGA 3PV0A 4KIUA 5JJKA 4AVXA 1P4JA 4J94A 3FCXA 2VDPB 4C7OB 1NP6A 3W9SA 3AY7A 4B6RA 2F9LA 1XTPA 3RHTA 2FY8A 1RLTA 5EWMA 1PJCA 3QLUC 4RM2A 2NP6A 1I1OA 2DKFA 4WESB 3QKUA 4NZOA 1T2EA 3N6XA 1SA0B 2CHVA 3AWIA 3FROA 3G9TA 4EDFA 1ZOOA 2WHQA 3IMFA 3GFBA 2P9NG 3O82A 1WP4A 1M6HA 1E3SA 2X4DA 2XR1A 1KYXA 3IIIA 5CA0A 4TTRA 2BM8A 3CS3A 3V1UA 1EVKA 1B8VA 2JL1A 4JHXA 2NU9A 5LDDC 4E33A 2FX5A 1YRAA 5E4TA 2FV8A 3L18A 2VWQA 2ZATA 5DISB 2FUKA 3TLCA 4DG9A 1VPTA 3GPIA 4QO8A 3MJFA 2VK1A 4W9NA 4EPVA 1MX5A 2H2GA 3K9LA 1KZGB 3KZCA 3UUWA 1R8SA 3TDNA 4MWDA 1GKUB 4BPBA 2DKNA 1BMFD 5BYKA 1J1ZA 5U9CA 3RDPA 2B2XA 1B0UA 4DA4A 3ETEA 5J47A 3HNOA 2MYNA 3GB9A 3QWFA 2H5JA 3N28A 1A9XB 1TKAA 5F9MA 5FPQA 3ZJ5A 1AMOA 4MI3A 4ANVA 4B85A 3RHZA 4B3JA 3DM5A 2WZCA 5LX8A 4JLVA 4B7CA 3WWOA 1THMA 4OP1A 1HR0B 1Q14A 4BMXA 3REOA 3R7WB 2G4VA 4FWTA 4KDRA 3ZIMA 3B70A 1L0BA 3ESXA 2R8BA 1OAKA 4I2VA 3W5UA 1ZK0A 4CHGA 5ENQD 3JU3A 3KLNA 1QLWA 4PPNA 3ZU4A 1Z37A 4MLDA 2RK4A 2QN3A 3MUNA 4MQMA 4LRZA 1A88A 2GHQA 3HBLA 5JS7A 1F8FA 1JMKC 1KYVA 2XMPA 1UUFA 1M1ZA 1QR6A 2ZKIA 4UAUA 2W5UA 1JEQA 2HJ9A 3FTNA 3KHSA 1PF7E 4IJ5A 1X19A 4R7ZA 4A8JA 1NATA 1RXCA 3PGKA 4Q19A 1LDGA 3LX6A 4GZ5A 1HSZA 4Q4AA 2ABWA 3D9OA 1RKUA 1C7QA 3PREA 3NB2A 3AKYA 3RVKA 1CHNA 1WF6A 3EGCA 1DC6A 2PH7A 1U0JA 1LPAB 4R7TA 1RQXA 1PLKA 2CLIB 3O21A 2NVWA 4LOIA 1N6PA 4DLTA 1LF5A 2V59A 3S1AA 2WJHA 1YQ9A 4GTOA 2IDKA 1IQPA 4IO1A 3LWDA 4GXQA 1ST3A 5LVAA 4UU8A 3OEWA 1Y8AA 2JEOA 3ZJTA 5HRCA 5LD2B 4UI9K 2I6QA 4WA7A 4D5GA 2VG8A 2PGIA 4X3PA 5GZ6A 1NULA 4QXMA 3RS3A 4ZQGA 3UM1A 1J0BA 1GGNA 4C0QC 2CN1A 4QULA 3CURA 2I4IA 4BQNA 1Z33A 3Q3IA 2HUNA 3VO8A 2O57A 4GTPA 1VJTA 3OCYA 2FZWA 4EW3A 3HDGA 5LNK6 2B2NA 3K0FA 4DPMA 3F5MA 3UWSA 3P9ZA 3IAM6 1XZQA 2ZYVX 4UKDA 1W4ZA 2ONZA 2HWXA 5JCXA 3BQMB 2GCIA 3K35A 2I2AA 2FZ4A 1PJAA 4TRRA 4YRTA 1O0BA 3EZ6A 2VP2A 2PLWA 2NNLD 1XTKA 3Q79A 1DIRA 3O8RA 2A59A 2QTHA 5TNXA 2Q5OA 3X2SA 1R4NB 4URUR 3TE7A 3WYBA 1ZGAA 5M04A 4TRMA 4KQMA 3PRYA 2Q1WA 4E5UA 2DERA 3ADOA 1OD6A 3CPEA 1MN6A 3FNEA 3FFWA 4KFUA 1EX6A 1X1AA 3TLAA 3TLZA 2Y0DA 3OZ7A 4C0BA 3REQB 4D8VA 5DYGA 4GP9A 2QDKA 2JDID 3U7FB 4EL5A 1DUIA 2P9UG 3GQBA 2IC5A 1X9GA 4HRMB 5FZSA 2ECPA 5LKAA 1S8AA 5ADWA 1B8UA 5KYTA 4WN9A 5IYZF 4ATGA 5AXDA 3LVRE 5FOVA 3ORRA 4HFNA 3DMRA 2AR9A 3IEMA 5FQOA 3LQ1A 1T3TA 4O2LA 2Q8PA 3EVBA 1K5HA 3F98A 3TKAA 1V7ZA 3QLTA 3HDYA 3EZYA 4FLBA 1MX2A 4W1PA 1CVIA 1KI3A 4BNXA 2HZBA 4J43A 5GJWC 2WY2D 2G82A 4R71A 3U9WA 1SZPA 2P75A 1YACA 2WHEA 2QL6A 2REXB 3K6KA 4HFJA 5KNHD 1E3JA 2FHSA 4GPBA 5BWMA 2NUTA 2WTNA 1Q1EA 2ZK7A 1BLXB 2WP8J 4F56A 5BQ3A 5EKXA 4RM3A 5BRJA 2IZ5A 2A86A 2ZUFA 3L93A 4HWOA 2GEFA 1LD8A 4AW9A 2W7TA 1TFUA 3R3XA 4PF1A 1Z0UA 3PCXA 4LY6A 1QO7A 1YYHA 2OV3A 5AKZA 2BM1A 5AUPB 3T7TA 3ROQA 2CV1A 4PZDA 3FSJX 1LF8A 1GEGA 1NVKA 4A15A 3I9FA 4FGJA 4DS3A 1Q6YA 1VKNA 3NYQA 1EUYA 4AJ4A 3UYKA 4U6NA 4URXR 3GHYA 1C8VB 2WIJA 2DY0A 3DT8A 1P75A 3HMQA 1NW5A 1P7CA 3U80A 2CWWA 4HCJA 4CQMD 2H4HA 4QM6A 5GGXA 3N0VA 5FUBA 1ZY2A 5F4ZA 4E88A 1JJIA 3PYMA 5ALZA 1KQOA 4G4IA 3BCRA 2HYZA 3G2OA 3D2LA 4JCCA 1HFJA 2HD4A 1LBIA 2BFNA 3RWMB 2XT9A 5JUWA 4HN4B 2VTKA 3WSTA 3CVWA 4H59A 4B3TB 5AVQA 3RTAA 1IOLA 1U7OA 2ZSJA 5H4GA 5J4LA 4D3SA 2J33A 2E6KA 4IRUB 3I53A 2VH1A 1GPBA 1UAGA 3CPJB 3GRAA 1ZICA 2H1HA 1KDRA 1Y8QB 5FZRA 3QVTA 1X1EA 2O20A 4X1YB 3KZNA 3S40A 2Q2VA 5BSVA 5KYUB 4OKIA 2OMKA 5F7ZA 1L8AA 1I4LD 2WWRA 4UCWA 1DO2A 2LVBA 1O54A 4GX5A 1Z2AA 1SBCA 1QWSA 2FSGA 1Z6PA 5JAMA 3QOXA 1Q0RA 4DDMA 2FH5B 2OYSA 2ZJZA 2C7OA 2JAPA 4C0SA 4NQ0A 3O3OB 3G17A 3QARA 1DWOA 4G0XA 2C9MA 3MF4A 4ZI7A 5FI1B 3U0BA 2NXWA 1CNEA 3KB6A 4N49A 4JJAA 1JQ5A 1Z2PX 2BDTA 2XE6A 4KLNA 2XSZA 4YV1A 5FTMA 3KEMA 1WUJS 4RK1A 1CF2O 1U1CA 4JC4A 1SUPA 5MHTA 4PBTA 4C06A 3SBOA 1V54E 1FMJA 3IHWA 1NUAA 2IFTA 4LJ8A 4LYYA 2ZI6A 3S2ZA 3KEFA 2B20A 4BJ3A 1MF7A 1Q1ZA 4EB3A 5CMYA 4EFLA 5KHLB 1CP3A 2RARA 2AD1A 2O8NA 4LZLA 2ZSFA 3FPBA 3L8MA 2VUHB 3LBAA 3BXZA 3C1AA 1G5IA 3GN2A 5LQDA 4HAUA 2XT6A 2Q4OA 3LUCA 3H8WA 1MH9A 4J0UA 2IYPA 4RD6A 5KNCA 3FTPA 4D98A 1XRRA 4AVYA 3EGEA 3TXMA 4ZOQI 1QG4A 3SF8A 5JNTA 2JJ1A 3KALA 3M8KA 1E4VA 5I9TA 1QIGA 4OB6A 3CONA 1EFPA 3OLWA 2CE7A 3HS3A 1REQB 2CK3A 3E81A 3OLYA 4IICA 1X14A 1RYZA 3DHEA 4CE6A 4LEIA 1N3BA 1SIOA 5IAGA 1M83A 5AOAA 1GGVA 4OQYA 4YVQC 3NQ41 1X2EA 3QY9A 3ZE2B 5CAEA 4RZQA 3FI0A 1RMQA 1LQ2A 4C7XA 4BN5A 4EPXA 2W2KA 4G24A 3SE7A 3A2KA 1T4GA 3M9LA 1RFGE 3L7DA 3V5NA 1UZMA 2QVBA 5LP0A 4UHFA 3F7NA 4QQ8A 4MQFA 2R8XA 3GL9A 1OX5A 2VN8A 1KAOA 1QQEA 2GPYA 3SX4A 3INYA 4C6SA 2ILVA 4JN6B 3PJFA 3BD8A 4GBED 1YS4A 3NUGA 1M2JA 4BUCA 2ZJ7A 1NRJB 3IQHX 3ZHVA 4O1OA 4MR8A 1N0VC 3VNBA 1PV2A 3ADDA 2VTVA 4J0KA 3WOHA 4PC7A 1CDZA 4DAOA 4GOKA 3DLAA 3R76A 3HHMA 3WC4A 3I9V6 2M2IA 3GAMA 4L2LA 4M36A 3PI6A 3EIFA 4NENA 1F17A 2L6JA 1JFLA 1JV2B 5AIBA 5EP2A 2O50A 1JR2A 5IAJA 4L8VA 3ECSA 3RIYA 3NEYA 3FUWA 2FWMX 1LUAA 2GEUA 3AG2E 3ZV7A 3NBAA 2AN5A 4UNPA 2NPIA 4X1IB 3OOJA 3FDFA 2YJTD 4Z0PA 3W7BA 2Q4RA 2HSGA 2MHKA 3OXLA 4AS3A 2ORYA 2XEVA 3SFZA 5G0UA 4IPTA 5JC8A 3JQFC 4PC6A 5A5GA 3WGNA 5FBWB 4NP6A 4I1AA 1N6NA 1DT5A 5B7QA 2VBGA 3D0OA 2E5LB 2FMUA 2OD7A 5IM4A 1R9JA 3L6EA 3ZLVA 1E9VA 1GQSA 1R9NA 3GJ0A 2CXUA 4AZ3A 3LC0A 4RVCA 1AKTA 2VPZA 4EFKA 1L7NA 4IV5A 2H2FA 1Q3TA 4WZBB 2VQSA 1C0LA 4HPXB 2ZDHA 5AYVA 1NQOA 3WL8A 2FSSA 4NQZA 2H0AA 1ZG3A 2YXEA 4ARSA 3KX2A 2OA0A 2FW9A 2D74A 4RKWA 2HNKA 3K30A 5BUCA 3DAFA 3G5AA 4ALLA 2YHUA 1MEOA 4DWOA 1U1FA 4K6HA 4D8YA 3DPSA 1H0HA 4HDRA 3B7GA 4RCVA 5IF3A 4NU6A 1SHTX 5IKXA 4HS4A 4KUHA 1HL3A 4F38A 1SBQA 1GZ4A 4PBRA 2AX4A 4BJ1A 1GQOA 5TQ0A 4IL5A 1KKLA 2AG8A 1XMXA 4MQLA 2OECA 4G85A 4WECA 3DMTA 4PRYA 4UU0A 4E1BA 1FQKA 4RJIA 3FCYA 2ZAIA 4PIVA 1XCOA 3UPDA 2AZ4A 5CCEA 5EUMA 5TGDA 5HG0A 3I9LA 1GNSA 4G97A 4P5DA 1HQYE 4NS1A 3IHVA 1PGOA 2QW1A 4RTJA 1LWNA 5IH3A 3BK2A 1I14A 1W96A 2IK8A 1PAUA 3U44B 3CRVA 1KRXA 3SHWA 4NBVA 2IDZA 3HV0A 3EIUA 1HDEA 5I9BA 3VZSA 1INLA 2IW3A 2OHOA 2QBYB 1XC7A 4HXFB 1BVRA 1VFNA 4NBSA 4O8CA 2ZXUA 1SMKA 3SMQA 1E2UA 2R6AA 5K45A 4MUXA 1TK3A 3F73A 4TUUA 5BR7A 3PPYA 4FR0A 4Y6PA 5KNDD 1TR4A 4EITA 5BWBA 3PZ1A 5FWYB 3V55A 4QICA 3WLKX 3RSFA 4MULA 2YWBA 2A92A 1M6VA 3WL5A 2Q4TA 4MR7B 1L6RA 4AZVA 2O2DA 3R40A 2A4ZA 5KKCA 3DSVA 2VR1A 1C1HA 2ZT6A 2Q49A 3BG5A 1Z38A 2ZWAA 3TD9A 5IYZA 1X42A 1ZA2A 2Z56A 4I66A 3LHDA 2WDPA 3INRA 2O7VA 5JCZA 1KZPA 2NVBA 2IEGA 4JITA 4DW8A 2GFHA 3MCTA 1KZ7B 2X1VA 3R6LA 5IUKC 1TN8A 4ZJPA 4CPDA 4IWYA 2FGJA 4N54A 1LW6E 2J9ZB 2DUMA 3QF7A 3UHFA 3SDSA 2XECA 1KAGA 3OZVA 4YECA 4JSYA 3QMMA 5KTOA 2DU8A 3ZWVA 4D92A 1H5NA 1R6VA 4EHKA 5JJBA 3S8YA 1IKND 2PVPA 2XDQB 3VISA 4M55A 4NOJA 3HA2A 3AEUB 4GP6A 1MXHA 2TYSB 2H5EA 2PX5A 1BJRE 1SHLA 3KQVA 3AVWA 3ZH2A 1MU0A 3SNXA 2FBNA 5FQ8A 2V6GA 3SYRA 5CDHA 5F7JA 5BOSB 2BKEA 5FQ4A 2JFZA 4N5IX 3D9HA 3ET4A 5DLPA 1W4CA 3SG0A 3C6ZA 2GO7A 2MINA 3GLUA 3GHHA 4BNGA 2O7NA 4M76B 4FSHA 1XHFA 5YASA 2XGOA 2IU6A 2CCJA 3FNFA 4DDKA 1NMSA 1E5VA 3IOYA 3B6EA 2NSZA 3DO8A 3CW8X 3DXFA 4YJ2A 3FU5A 5AJHA 2MSKA 1LDYA 1K6IA 3SF4A 2A8YA 2CLOB 3JWEA 3AESB 3QPBA 4CI0B 2NZ8A 3P9XA 3F9CA 4DUIA 1DAGA 3BQ9A 3AF4A 5DHTA 3ZCSA 1GTRA 5EXXA 1MXFA 4O0LA 2DH5A 2YMQA 4BTVA 5B3JC 4JI4B 2OZEA 2MYTA 2Y1EA 3BTUA 4MPDA 4Q48A 4KZKA 4WAFA 3OZTA 4BNJA 2GMWA 5J23A 3G7SA 4U7FA 2DEUA 1MVLA 4D02A 3HO1A 1AKUA 3VR6H 5HKKA 3CKLA 5L7TA 4R1NA 5DV9A 4W5JA 1WABA 4B7ZA 3ZN3A 4Z4CA 3KSRA 1S9HA 4A16A 4Q3KA 3H0EA 5C5CA 2HGSA 4GKAA 2PBZA 2PRYA 3ZQUA 3LEWA 4DABA 1UXHA 5IZCA 1K7FB 1FJXA 1FUUA 4RCYA 4UZFA 1NN3A 2NV0A 1C1DB 3K4PA 2XI4A 2LCQA 4R0MA 5ALXA 4M38A 4EH1A 3U3WA 4QFVA 3BMNB 3IX7A 3OCWA 4Q7QA 3EMVA 3MEKA 3PQ8A 2QJOA 3VNVA 2GBGA 2VCYA 3U7HB 5KJ6A 2GZRA 1UFRA 2PZJA 3W3AD 5CDFE 3AUJB 4EO4A 1YT5A 2PFGA 1NSFA 3GLIA 4CKXA 3L8EA 5GP1A 1I6KA 4MV0A 4DA6A 4BNMA 5AENA 5A7HA 3RVBA 1WDMA 4CQMB 1YUMA 4NBKA 2D2EA 2RGBA 5K7SA 5C8ZA 1IUNA 2XRFA 2XUAA 2O8DB 5TQVA 2GHRA 3LCJA 4YMSA 2VLIA 3AG1E 1H85A 4BO4A 5EJ9A 4JB8P 3D9NA 2HIGA 1W48A 1ISFA 1IBCA 2XNDD 4RTPA 5DHFA 5JQGF 1RE0A 4DIOA 1B74A 5ANRA 1O6CA 3W9GA 4IDCA 2I2FA 2OCGA 2PUVA 4YXWA 1Y1RA 3EXHB 3H5WA 1U5BB 5BSFA 1NXQA 3JQRA 2P79A 1DCFA 5F4BA 5B1AE 3ZGYA 4TTIA 3JQ9C 5C51B 3RAFC 2AKAB 1LDBA 1A4IA 5BXOA 4BLRA 4JGIA 4DJFC 1MO4A 4ETMA 3TRJA 4LPSA 3AH8A 4RENA 3UN1A 3MD9A 4IULA 4X3CA 4D9IA 3W1EA 3HUEA 1NW3A 3IOBA 2DF8A 1GYRA 4S3MA 5I4BA 5J63A 1NZJA 1FXUA 3IT0A 3BWEA 4NCXA 3C15C 5I8ZA 4MBGA 1EFVB 4EQFA 2VJDA 1RQ2A 1QC5B 4AAYA 4I1MA 1YMUA 4BO7A 3QF4A 4PO9A 4C30A 2IEDA 1ZVJA 1E5TA 1U0TA 1MRZA 1RAIA 1U3VA 3IR6A 2OM6A 1YB7A 3CEQA 4X71A 5F98A 1U80A 1P31A 3QE3A 4CM8B 1O1YA 5IAEA 4MB6A 1SVSA 1QMGA 1Y3IA 1RJGA 2CSUA 5LZ9A 1B8NA 1E8ZA 2ZE6A 4GWGA 4R2XA 2O2ZA 1FSSA 1Y8MA 2Y1OA 2H29A 2QV7A 3AR2A 1ONNA 1IJKA 4CG2A 5FWNA 2UVPB 4M6WB 4ZN6A 3TBKA 1ZHOA 1NURA 1NMZA 2P78A 3WLHA 1N4PA 1BX1A 1T2FA 3LJ3A 4IX1A 1UMBB 2WTMA 5K8TA 3L46A 3B7TA 2ADOA 1V3QE 1OGIA 4I5IA 5KYYA 4K81B 1LTQA 3R0IA 1FUIA 1M2WA 1JFFA 3AFMA 3PFIA 2PSSA 3EGOA 4MKHA 2LO6A 1R3DA 2X6TA 2DHQA 4XX5A 3ZK7A 5F1YA 5CBPA 9LDBA 3KB2A 3ILXA 3LHKA 4LNUD 1GUFA 3K20A 1H9AA 4TT3D 4M60A 4OLBA 4UTOA 3ISMC 5EZYF 2UKDA 4GX0A 3BHIA 5DHPA 1B4DA 3LSYA 1Z0FA 3SBDA 4MAAA 1SIUA 1D5CA 2MHCA 3M3PA 1TX4B 1KI8A 5KTYA 1JE0A 2FB9A 4UHCA 4HN9A 3OQVA 4FGZA 1MJNA 3DXXA 4JI5B 2BFBA 2CDAA 1JRLA 1W88A 4ANXA 2A6PA 1JCRA 4JK3A 2DQ4A 3OAWA 5G40A 1HM5A 3O0DA 4EY4A 2GGFA 4YP5A 4F8EA 2MR6A 5T4YA 4L9WA 2PT6A 1E3WB 4CT4A 1Q2ZA 4HVLA 3QB2A 1VXRA 2IHUA 2HBRA 1A3CA 2JVIA 4FZ3A 2UXDB 1QZUA 2QTWB 2GAJA 5IX8A 1Y6FA 2FPIA 3EPPA 4NE9A 4LE1A 2ZZNA 4D44A 3GPDG 1PDVA 3W8FA 1J8MF 2RHGB 3ODPA 1HSOA 1BXRA 2IY8A 2V6BA 1M8KA 3QYPA 3HVJA 1LLDA 3H4VA 4E3WA 2G4CA 4TXMA 2ZAOA 4FB5A 1VBNA 4M0LA 3L4SO 2RGXA 5FUVA 3QWHA 3VKHA 3SY8A 4R05A 1NFIE 4MR9B 2V0CA 3P0HA 4CTMA 2FW7A 4ZQIA 2P2NA 2C77A 5ENNA 4RF5A 1A7KA 3KD3A 4Q3LA 3ROKA 3RJ9A 2VEOA 1R0LA 1QYMA 4GPEA 1DI0A 5ED0A 1F51E 3ZIUA 4K26A 3NBZC 3AM5A 5HRYA 3SI5A 5ES4B 4N0PA 2YWXA 3M81A 4MRMB 3I3OA 2HPHA 5FI3A 5CT4A 2ETCA 1G6KA 1LV8A 3ZWXA 5AQAA 1PZMA 3L6BA 4WWOA 1D04A 4V0MA 4A8HA 2J08A 3L41A 1JAZA 4RLQA 2C82A 5L4LA 3A6KA 4E5SA 2JVKA 3QM1A 1WZEA 3CSFA 2FQXA 4ER5A 2N46A 2NXEA 3RVLA 1TO2E 3HB0A 1F14A 3O03A 2R1VB 1CPYA 1U7DA 5BNTA 1EGQA 2IS4A 1MB0A 5JANA 1NXOA 2D4AA 3ZWYA 4FHJA 4TMVA 3ZU6A 4I5EA 4BVAA 5JO0A 2B25A 2XOKA 4OH7A 2QN9A 4PRKA 1SVIA 2VCEA 3ZLTA 3UK1A 2IOHA 2JKYA 1WB4A 2M6KA 5E0KB 5HCNA 1RP7A 5K3CA 1IULA 4A3VA 1FX1A 1LJUA 3TOXA 3HYRA 3O2NA 4U2BA 1KAHA 4DNFA 5F2KA 3RNLA 2FOLA 2OENG 3PNLB 2REQB 2G5TA 4GMRA 2WKRA 4YT5A 1TJCA 3ER6A 3Q4AB 2Q3JA 3EG5A 4DZTA 2OC4A 4FFSA 3GGSA 2P9YA 2Y2UA 4QDTA 4C04A 3M6LA 5IXSA 3HL0A 3E9YA 4V3BA 2YMMA 1C3EA 3ZGXA 8AT1A 2V97A 4B75A 2WV9A 1CDEA 1P0FA 2V7UA 3ZXUB 3NMUF 1J42A 3WZMA 3PTZA 5DASA 5JHBA 3RVDA 1KHHA 3Q3HA 4CL8A 4P3NA 2PLAA 2XF8A 1AUPA 4LDZA 4ZAZA 2VYIA 1H2WA 1QGUA 2PUDA 3WRWA 4EI7A 1P81A 4K8RB 4GP7A 3BF8A 5BN3A 4PAOA 4J0JA 2YXDA 2EYUA 3ZWDA 4K7JA 2HRQA 3HEMA 4OJMX 3FLBA 5CB4B 1VPEA 3F1KA 1A77A 1WEHA 3MYRA 4P82A 1HQDA 3ULKA 1AG9A 1JLHA 2ERXA 2PGJA 3L05A 1UXOA 1VLLA 1SWWA 2PT9A 4N03A 2E85A 5ECGC 2CFZA 2NOAA 3ER8A 4N41A 3JQ7B 2HT6A 3FTXA 3LX4A 1OVGA 1Y7PA 3DBOB 1ZSNA 3I12A 1VGRA 5TRTA 3NV9A 3B3GA 2BAGA 1PV1A 3E15A 4L5YA 2LGJA 1TVKA 3HY3A 2O6HA 5EKQD 4IDPA 1MVNA 3MGAA 5F1KA 3TUIC 2Y1WA 3RUHA 2BF4A 2IGTA 3W5BA 2QE7D 2IVZA 3WADA 1FYWA 3UT7A 1M2KA 3SHVA 1OX4B 3ZHQA 4NEHB 4GZDA 3A7EA 3NT4A 3QHQA 1S70B 3C6QA 3AXTA 4OA5A 3JQ6A 5E0OA 1AUXA 1N57A 2H7VA 5DDIP 5BNWA 5AI0A 3T1VA 3M9WA 2B9VA 2E5WA 3JAKB 3IEKA 4W8GA 2CEAA 3WAGA 3VR2D 4E0BA 3H17A 4WNAB 5E6UA 4OQPA 3BOSA 2VNIA 1O6ZA 4Q1DA 4XE5A 4LERA 2G63A 5ILQA 3DWGA 2FMTA 4KREA 4IJWA 3B60A 1I4WA 5I48A 3SVTA 3V1TC 3H3JA 4OXIA 3Q78A 3LYLA 4U7HA 2IPNA 4MVJD 3HYCA 1I80A 1DC7A 1YQGA 4RHTA 2Y3AA 1GNTA 1QNLA 2YZ7A 3I83A 3AVXA 3NM5A 2IONA 2QUHA 2NO5A 4CIVA 1QQAA 4Z53A 1FRFS 1QFZA 2VF5X 3LZCA 1Z08A 3MLEA 2VT3A 2WE8A 4OOFA 2IU3A 5DHQA 2C58A 2YVUA 2QM3A 2CLMB 1HE8B 3PUIA 2BFPA 4TWJA 1GFWA 4M21A 2XADA 3ABQB 4GRAA 5JQGA 3E9QA 3R5XA 3HU5A 1PVDA 3VNSA 3TS1A 4ZT7A 2X8LA 4IAOA 2Q5IA 1YJ8A 1O94C 3HLYA 1ZXXA 5DGCA 1G1AA 2G1KA 3MWJA 1NUTA 1E5DA 2VF4X 4K9NA 1P1FA 2QVZX 4DX5D 5AP9A 2PL9A 1Z36A 4J91A 2VWGA 3R9MA 4CUZA 2R7MA 3EU5A 3TM4A 2G40A 4ILEA 2JIDA 4HQLA 3E33A 2LSVA 1H2TC 2YYZA 1G3RA 4YBRA 1CDDA 4YAGA 5AJZA 4O2AF 2R97A 4U00A 2C7BA 3QEAZ 4CVNA 1RS0A 4JJ8A 3GJYA 1WDKA 4AB1A 4HOUA 2ZETA 2YV2A 2JZNA 3M6AA 1T2NA 2VWHA 4K9KA 2PKXA 4AJKA 1AKRA 3BSYA 4L2IA 5THXA 3S44A 2FEWB 4JA7A 1YKGA 4TV8F 4U0UA 1GZVA 3WIBA 2NUPA 3ZWQA 1E9CA 1EG7A 2VK2A 2XQKA 4WLUA 1GRRA 1WXGA 2ZIWB 2IOLA 3PT5A 1T0UA 4IWNA 3NWBA 2PUTA 5KS2A 2XXJA 2BMFA 2DSTA 2Y71A 3IV6A 4HY3A 4MGKR 2J9FB 1NA0A 3NNNA 1QDLB 5AW4A 5G0SA 4NABA 2AJLI 2EZ8A 1P62B 1I3OA 4MJXA 5AOBA 3EQ2A 2WSLA 2I1QA 4KVOA 4KXQA 3G2PA 3JVDA 4LOJA 1P0IA 1FFHA 2JJ2A 1QIKA 4RY8A 4JX8A 1A27A 1XT6A 3WXMA 5AH0A 1O6BA 1WCXA 3KQMA 3S68A 4XVUA 2GBCA 1E58A 5ULLA 1PZNA 4ERNA 5JCOC 4JP5A 2PX6A 4GKJB 3GDOA 3HA7A 1QORA 3I9JA 5K3EA 3TYXA 1Z3YA 4QOFA 3VBEA 3SOPA 1IN8A 3KYIB 4ATNA 1O8BA 3P9NA 4JQYA 1DTSA 1FDSA 3IS3A 3BIFA 3K4QA 3UJNA 1KZ6A 4NMMA 1A2QA 1IMJA 1UKVY 1KEPA 4G1FA 1LK0A 4WOPA 3ZI4A 2PD3A 2FR8C 1G6OA 3MWEB 2FN7A 2WFAA 2QD5A 1RWBA 3GJ8A 5BPFA 3GT3A 2P68A 1SQGA 3TLJA 4B8CB 4IEIA 1LA2A 1C0PA 1H22A 5FOXA 2GM9A 1IATA 3ES9A 1TAQA 1QHYA 1JHOA 3QXHA 2Q3LA 4WEOA 2WM9A 1RBQA 2FEPA 3ACDA 1NWHA 4ES6A 1YOVB 4G8KA 1N5RA 2WTUA 4L22A 3T94A 1R6BX 1JKMA 2YV4A 3EASA 1JSXA 1GUZA 2BCEA 3WQBA 1BAPA 1OZ0A 5K6TA 3OG9A 4E51A 2CXXA 4PPFA 4BWFB 4F45A 4LNUB 3LOUA 1T4CA 4NFSA 4D3YA 2X0IA 2FEOA 3ZLJA 1HG1A 4KQHA 1MIOA 2ZWOA 2QYJA 4JBHA 5M3BA 2PIDA 2O7SA 1BU8A 3MCAA 3EA5A 1JCQA 2ZJAA 2PT5A 3AUXA 4IUDS 3SK0A 1QG0A 3R5KA 4RA6A 4QUBA 3U1TA 3WGLA 2XOXA 1UZLA 3W8RA 2WVHA 2RHCA 2BPOA 3ND7A 2GZDA 3V8NA 2HCFA 3PIIA 2V4HC 4CODB 1WDLA 2POQX 4JUDX 2CNWD 5K8VA 1WCIA 1C4KA 3LD9A 4D3ZA 3TJPA 2O4CA 3R3WA 4FGLA 3AM1A 1U65A 3G1TA 1HURA 1KAEA 1ZD5A 4IQ0A 4QXRA 2A0YA 1ZS9A 4JD5A 5K0FA 3K70D 1SXJD 1XUOA 2JI6A 3NBMA 4EHHA 4JASB 1UMKA 5CLJA 5DLEA 4RHYA 2B37A 4BCBA 1WM1A 3EVGA 2JARA 3AUAA 3M1AA 1PV4A 1GPUA 2X42A 721PA 3FPFA 4NBNA 4KXFB 3QTLA 2CJYA 2J7PD 3DTVA 4KE8A 5EFZA 3UPVA 3PHLA 3V97A 4PLWA 3EEFA 4ARBA 1FLDA 3ABRB 4I9HA 3D7LA 1WBBA 2R6FA 4OUDB 3REGA 1BTOA 1QP4A 3T9CA 1YB6A 2O7QA 1N3LA 4IDGA 5AJYA 1ZJJA 2X5NA 2GDJA 3K9IA 4L7TA 2O7RA 3QDNA 4HGQA 1HDIA 2NQ8A 1BOOA 3L7JA 4YQYA 5ALSA 2A5EA 3A06A 5HJEA 4GTRA 2ZUBA 2EQBA 2QM7A 1Z18A 2BH2A 3UKJA 4DRXE 4CCSA 4Q9IA 2CZGA 4A3TA 5EMHA 5H0IA 3ZV3A 4YUWA 3VKUA 1KVTA 1AQUA 1VE3A 1ZUD1 1IBRA 4XD7D 4TMZA 1E92A 2AG5A 5GQSA 4G2NA 3CKBA 3NCTA 1S2OA 3OT5A 3BFVA 4A7PA 3CZAA 5IM4F 1E3EA 2PMFA 2YQ5A 3K9QO 4KDFA 2GTIA 4Q6WA 2F1KA 3UTMA 4N2QA 4I4TF 4H1WA 1SIWA 1R6DA 3CNQS 1OXBB 2HPVA 5A71A 3BEDA 2YV1A 1EVZA 2A88A 3L84A 4GYWA 1G2IA 1K8YB 4RZUA 4C76A 1UAAA 3KM0A 1DOHA 2HYDA 1W1WA 3I1IA 3SX2A 1OGJA 4AP5A 4HH1A 1QJ4A 4BETA 2OZLA 2QMEA 1WCWA 1MBZA 4B6OA 5FLXA 2GZSA 2E1PA 1ENOA 1JQBA 3NC0C 4HB0A 1PVOA 3T3MB 5JSUA 4H0FA 3SJZA 2BGWA 3CINA 5FBLB 1OZHA 5E4YA 3HXDA 4BFUA 1XXHE 2BUBA 1F06A 4EJSA 3TWXA 1Z6ZA 2QIOA 4ZGBA 2J7KA 2ZJ5A 5G1OA 2YKGA 2GM5A 4OKNA 2WJ6A 1CJBA 1INZA 3TW8B 3C7TA 4CEJA 4LGVA 2BJWA 3GVCA 5DM60 3EHMA 3H6HA 4M8KA 4KDEA 1X80A 1FJGB 3MERA 4BJ5A 1V1RA 5DGHA 4GI5A 2HOQA 4Q3CA 2VP5A 4BO5A 3WK6A 1KYIA 2AYYA 3TFOA 3GLFA 3ORFA 1OI4A 3H4IA 2LW7A 4INPA 5HX7A 2ZRCA 3ROEA 2XOEA 4EUSA 3HHEA 2CLHB 4HVTA 3H6GA 4P6VF 4TWZA 2J5BA 4BGVA 2DWQA 3RTEA 2YZMA 5ER9A 1E7WA 3ZDAA 2Q5LA 4MNTA 4K9DA 2R66A 3N5KA 4BNHA 3TG4A 2OCLA 2WJIA 1M1YE 3VPSA 1ZM2A 2NXNA 3R9AB 3BXEA 3K7EA 1W5AA 2CHWA 5KOJB 2GZMA 4LEUA 1JMVA 3VO9A 4C4RA 5M34A 1F8XA 2Q5CA 3IMGA 1NAHA 2Q1SA 3IUYA 3B38A 2FULA 1N32B 2YY6A 1QIIA 2LUOA 1TA0A 3HI6A 4FUQA 2ERYA 2B82A 3T3DA 4OMDA 4ZDIA 4HAVA 1Z07A 2R8YA 3CF0A 3ZDYB 2QTVA 3IDSA 1BH2A 4WKPA 1GSIA 2I1JA 1DVRA 2O59A 1ZH4A 1X2BA 1JQKA 3UX4A 3M7IA 3IV9A 3FB4A 3DV0A 3HBNA 4F3YA 1Y7HA 1B16A 3P19A 3OXGA 1XKXA 2SCUB 4R8MA 1O0CA 3N2GA 5CIQA 1E1CB 2Z8YM 3OPNA 4BV2A 3EZLA 1GYPA 1UJ2A 2IPOA 4FI3F 2QJTA 1WV1A 3MRVA 3KPUA 5EUCA 3DCYA 2G9UA 1PEYA 1H42A 1UBCA 5J5CA 1XMIA 3R4VA 5DGTA 3V4ZA 1ZSVA 3KOYA 4WZAA 2C57A 4O2AA 5DH9A 4F4HA 4JOQA 4NCKA 3OF3A 5BQ5A 2OQVA 3K6JA 4QUGA 4RQBA 1XZLA 2YRXA 3DUWA 2NZ2A 3HDVA 1EP9A 1BC5A 2J0EA 5IH7A 3U4GA 2K87A 2AXUA 1YCSB 2ZWIA 4TV8A 4YJ2F 2KI5A 5G3ZA 3ISVA 3BB1A 4Q1AA 1O5OA 4YDWA 2GN4A 2DQSA 5DSXA 2YNMD 1O6GA 2WMOA 2I2CA 3ZRHA 4Y6LA 4ID3A 4OHRA 5THKA 5FJJA 2CV0A 2E3JA 4M7PA 1RC1A 3TZ6A 2LXMA 1DJLA 2PXHA 1KJZA 1ML3A 4XVQA 1RT9A 1N5DA 3WLMA 3D5TA 2RGCA 1RQRA 5L45A 4NPAA 1QV7A 3M34A 3I04M 5D3KA 3PQ4A 3MCVA 2C9BA 3GN1A 1RHJA 3RSCA 3SOZA 1JU4A 3DKVA 2ZWMA 4ND6A 5LQJA 1UOOA 3TLXA 1DG9A 4B3IA 3UI2A 1IBLB 2FG7C 4ZIRA 2C00A 4GM0A 5BMVF 1QO0A 1YNOA 1IN6A 2OGZA 4J8PA 3C74A 1UDAA 1IPEA 3U1VA 1DIBA 3MKQA 3Q8KA 2AXZA 1Z5WA 5E9AA 4AKSA 2WSIA 4ENUA 2HDHA 3EPKA 1WMDA 2XQ0A 3RAGA 3PQ2A 2P9SG 3CKKA 4JI2B 2MT9A 5K6AA 4Q00A 4ED9A 2BHTA 1V95A 1JLLA 3UUGA 3C45A 2QLJA 1PFGA 1QBQA 3OA2A 5E9QA 4I1OA 3FULA 5IKMA 3FKQA 4WXHA 3MELA 4HNQA 2AMLA 2AK2A 4B6PA 4YDHB 2B1GA 1BMQA 4MWBA 5LIPA 3VU9A 2VAVA 4EYQA 2Q3BA 4FX5A 5CFQA 2XZDG 1M9NA 1IHYA 3C3OA 4IQGA 1XNGA 5MFPA 3DJFA 1YVUA 1QRTA 3A6PC 3WIEA 4X85A 2GRMA 2WJGA 3H5IA 1C3OA 1LBTA 3BG1B 4LBVA 3WMRA 2Z9CA 1R5NA 3TWUA 1T43A 3D0QA 4BGUA 3PGVA 2WKWA 2B99A 2ZBVA 5A6VA 2J32A 2IKQA 1D03A 2EJWA 3Q0IA 1Y1LA 1UC4B 1P7YA 3ZDCA 3OQNA 3I34X 2ZP1A 3TNLA 4XUGB 1GNQA 5A4JA 3HSYA 3LWZA 3EJ6A 3TJZA 1FC0A 2WMNB 2SKEA 1FTGA 1KVUA 2ETVA 3LBFA 2ZU0C 4C48B 3GA5A 1L3IA 2H2AA 3ZNNA 1HTBA 4OD0A 4QUEA 4WLNA 3MINA 4AIRA 2WWYA 1SD1A 1O96A 3U31A 4AMBA 1F2TB 4A9AA 1P0PA 1WKVA 1PCXA 4UTPA 3M49A 4J3FA 1H3FA 5FFNA 2D7CA 2FSPA 4NMXB 4S05A 2X0NA 2C1XA 3NXKA 4PINA 3QVWA 1U0NA 2R87A 4WLEA 4CCAA 3EWSA 5LA6F 3W2TA 3OLVA 3PTAA 3A3OA 2OZKA 1Z7GA 1LWOA 2FZGA 4CDMA 5CURA 4GTTA 4WCFB 1J2RA 4MV9A 1DIGA 3W6UA 3JR3A 1WVGA 4KLCA 2ZE5A 3G0BA 3AJIA 5KPDA 2P3OA 3PGMA 3EF3A 3F6PA 2CF6A 2ZUVA 2NZYA 2X0KA 2QPLA 3KHKA 4QJ3A 4MS1A 3F0TA 1J9EA 3MWYW 3RO3A 1PUIA 4FMCF 3EH1A 3LWNA 1U5AA 2XUDA 5IN4A 3KE9A 1W0KD 2W48A 1YA0A 1Z6XA 1Z0AA 2I8LA 4KRXA 1FMFA 3U81A 3W9BA 4H35A 3OQHA 1E2FA 3AEQB 2QNIA 3DHVA 2B8NA 4KBYA 2AUNA 5KWSA 3VC3A 1O97C 3PXAA 2R11A 4IKOA 5F76A 2PL5A 1NXVA 5A3RA 1JWGA 3PNSA 3MJWA 1M6NA 1NQTA 3THWA 1CUSA 1PY1A 3WI7A 3O3MB 1QYVA 3EZFA 3KAKA 2UYHA 4DVJA 4YGXB 3QC1A 2I6XA 4XFKA 1NVDA 1HTWA 4EGFA 5C81A 4A36A 4HNRA 3PXUA 1PR9A 3ZWBA 5DW0A 4B6JA 4O29A 2JGMA 1E8NA 2QJFA 4RHFA 5KX5F 4L8LA 4BFWA 2FRDA 1PBTA 4TQAA 3K70B 1SXJB 3FLMA 3V1LA 4M87A 1I1NA 4FT4A 4Y1FA 4QLAA 1K3FA 4R68A 3JQBC 3BMCA 3U5TA 1KAMA 4J0QA 3WP1B 5B1IA 4UM8B 5F2NA 2X8WA 3VNRA 4MV6A 5FINA 1TM5E 4JI6B 3VHQA 3Q7TA 3T4UA 1R10A 1W73A 1L5NA 3D1LA 1CY1A 4O1IA 2AL7A 1RKQA 4B3RB 4Y6WA 4OFWA 2BN4A 1E5XA 5KQSA 3C16C 1FUKA 2WYUA 2QDXA 2RI6A 1JAHA 4I4TA 4KQ6A 2GETA 5CVTA 2WICA 4KN9S 3H9QA 3RRJA 3QBJA 2YIDA 1JFVA 3ELYA 4PYQA 4FD3A 5JHGB 4F84A 3RUCA 3E05A 3QW2A 2YJZA 1YCFA 1P17A 2O8EB 3WK8A 4LJRA 4YMLA 2VBCA 3RIXA 2JK1A 1PEDA 1V43A 4LJ5A 3AVOA 5BSGA 3L82A 5K03A 3HCDA 2DWZA 3GLFE 3FW1A 1JIXA 3MB5A 5T4FA 3L49A 3U0VA 5AKJA 5FJYA 2V9PA 2IQIA 4O4IF 5JPCA 3UAGA 4LDNA 2AW6A 3PD7A 5IFLA 2BHRA 1JHQA 5ALKA 3UG7A 4S1OA 3B8EA 2BSXA 5DTJA 4EZLA 5HDQA 4UQLA 1FYEA 2J59A 4K0RA 3UMMA 2QP4A 3VOTA 2CF5A 1CQIA 1PHRA 2QFCA 1V1MB 5HDBB 4NEGA 3ZDZB 2AK3A 5T4BA 2QQFA 3EUVA 1NC3A 3KP1A 3RSQA 1V16B 3EXAA 1OY3D 3GGDA 4LWQA 1YJCA 1QYRA 4QRHA 1Z75A 4ODIA 2OKCA 3GUUA 3FSGD 3WYNA 2YMLA 3K0CC 1IAQA 2C59A 3A1TA 4PN7A 3KD7A 1TIKA 1F0KA 3O75A 1IXZA 5C46F 1UF9A 3ZDFA 2YWDA 3JARA 3AL0C 2YN0A 3IBSA 4ND8B 2OBFA 4EG4A 5JRZA 1ZA1A 4L78A 5T4EA 1T5BA 1PI3A 4KQCA 3ZWNA 3SBSA 2IHZA 3MNFA 1OXSC 1G98A 2WG2A 1QKJA 4JJIA 1CCWA 1KSFX 3MILA 1M34B 1TM2A 2J3KA 2ZR0A 3D43A 5DM2A 2G9QA 4W1SA 4H4CA 3HWSA 3GUVA 4JJZA 1P1RA 5CBNA 1C3LA 2GARA 2JFBA 4Z0TA 3DQQA 3UG6A 4E2YA 5EIDA 2OFWA 4U0JA 4EA7A 2KATA 1ODCA 3U9SA 3N0WA 1MPXA 3K5IA 2JFNA 1NUPA 5EKTA 2J0QA 1XROA 3KEOA 3ZS8A 2QRVB 2I78A 3MUFA 4BE9A 2KCLA 2XITA 5F78A 1NKSA 2VQDA 1F4VA 3FH8A 3CPSA 1C81A 1ND5A 3AERB 3OJLA 1WS6A 2GCNA 1Y9AA 2FZEA 1Q7EA 4GTQA 3UIOC 3P9KA 1TM3E 3UF0A 4HX2A 2DR2A 2X22A 3ETGA 5DN6D 1LCIA 1D6MA 1RWPA 3KTDA 2VZ8A 1L3BA 2AZTA 4HLUC 4ALNA 5EUBA 1AO0A 3P1UA 2PX2A 3TNYA 5EJEA 4Y9DA 3EZXA 2WD7B 3HZHA 2LIVA 3IHKA 1U8TA 1PFYA 1TW2A 1PFUA 1JILA 3AHJA 2C5FA 1MR3F 4BX9A 4DQ0A 2ZUWA 5JSYA 1NRXA 3QELA 5FL7D 3K6SA 3BIWA 1Y8RB 2XA1A 3JQDA 5HHTA 3MWFA 1FMTA 1W76A 1LKZA 3OBBA 2Z5GA 4BU1A 5SZJA 1XE3A 4L5JA 3ETDA 4RJKA 5I7SA 2AMVA 4ML3A 4FOPA 4PQFA 4LPKA 5KTKA 4ARZB 3DVAB 4XQ9A 1JZTA 2NMVA 3EU9A 4RZIA 4CLOB 2EKZA 2WWIA 5B64A 4MZDA 4FDMA 4J1NA 2DOKA 4XD2A 1HFEL 3PRKE 1HEUA 1YCDA 3E7FA 2RSLA 2V03A 1E1NA 1TC1A 3C8MA 4FPXA 5BMVA 1M76A 4XKCA 2VXYA 1OLXA 3VR5D 2X41A 3ZE7A 2F43B 3OCZA 1DWUA 1E9BA 4PXAA 2DQKA 3FUNA 1ZCJA 4KAFA 3HC7A 4K2HA 4AK9A 3PQFA 3HJBA 1ABFA 4KPFC 4NVRA 4DCSA 5BT9A 3A9TA 2EX0A 3IPAA 3LPCA 4QM7A 4KPYA 3EK2A 1XJ0A 1MJHA 4RLSA 1ZK4A 4HWPA 4TWBA 2XVAA 1T10A 2ET6A 5B3LA 3EQ6A 3IERA 3U6KA 2V0PA 2PJUA 1Q0TA 2QYUA 3ZU5A 1H8HD 3V4PB 2AFRA 2Y6VA 3W77A 4F97A 3T9DA 1Y9DA 5BQXA 2CDNA 2E87A 4R8VA 3AS4A 2CFOA 5GADl 1ZNXA 1YS6A 4BQOA 1XEXB 4XZ3A 1TK2A 2HPZA 3WMEA 1I36A 1CBUA 2CFRA 3NWPA 2XS1A 4D5EA 5KYKA 4R01A 4YUVA 3AC0A 3A1DA 1SG0A 1P2UA 4O2BB 2ZUSA 1ULSA 3CLTC 4YP6A 5TXGA 1YKSA 4GPAA 1UINA 4F4CA 5EQJB 1H8EA 2F64A 2OWDA 4HC4A 2JFGA 4B3MB 5J2UF 1A7AA 4HV4A 5PNTA 4POOA 3SHFA 5DF1A 2B5WA 1V71A 2DQZA 2PGOA 5A6SB 3KYDB 2WUDA 4LRUA 3CUUA 4JLDA 3DW3X 3I1FA 5H3HA 3OF5A 2H1VA 2WXHA 1A1VA 2EGUA 3ORHA 4H08A 4KR0A 1OT8A 2D6FA 5LA6A 4LOAA 4XEIG 5CJ2A 4XRRA 3NLLA 2ZOSA 1FQWA 3MAGA 4QAQA 3X44A 3GGPA 4ANWA 2FQ1A 2OKGA 3C5HA 3GBPA 4X8QA 4F6LA 2AWOA 3CZQA 1XPJA 3T38A 4P36A 3KTFA 2CHEA 2VT7A 3ITNA 2IYOA 2HF8A 1ZBDA 1DKPA 1UPBA 4ND4A 4U8YD 5FOTA 3AP3A 3UK0A 5L53A 4K9MA 3TEFA 1A8SA 4YJHA 4QG3A 4MW9A 1L5SA 2Y1KA 3H2YA 2EXXA 1B14A 1KFBB 5DX0A 1P1KA 2BGKA 4MV1A 1S9DA 1TLTA 3THRA 1ELRA 1AH2A 1FFXB 1NBHA 3EPHA 4F9GA 5KJLA 3ETHA 3KKNA 5CMLA 4AZSA 4P4LA 3NF1A 1U0EA 3EDOA 3F9RA 4Z0NA 2G70A 5FXMA 3PC3A 4RQIA 3JYNA 2E2EA 2IV2X 3CKYA 5HIMA 3K31A 4KZ0A 4EGSA 3P0IA 1AT1A 1TCCA 5AO9A 4MRSA 4GTMA 1TE2A 4US2R 1U3UA 3IEXA 3DE2X 4A55A 5EE5B 3OZBA 2NU7B 2JFFA 5ESWA 2AFHB 4E15A 1C9DB 3FMGA 2PJZA 2PNJA 5MDHA 5L9AA 1YZNA 5KX5A 3PFFA 4JU8A 3NBNB 4I5DA 5ALWA 4DIBA 3MXOA 1VPDA 2D06A 2ZQYA 1F8YA 5C4IA 2FZLA 3QMVA 2GXAA 1T9ZA 2O3QA 4WHMA 2F6RA 5K3AA 4YFYA 2FYTA 4BJ6A 4NZPA 4J07A 5BSHA 1F6BA 4EY6A 3HR8A 3O4JA 4TMKA 4WBNB 4BNZA 1ZISA 2QTAA 3D4IA 1OLUA 3DAOA 1T8SA 1SR8A 3AZQA 1TJNA 1TJYA 3I30X 2OBYA 3M1IA 1BI7B 3JRWA 1P9OA 1VLZA 2I1LA 3II6X 1P4RA 3ZYKA 4OXQA 2V7VA 3I2GA 5JYBA 2I6GA 5K0ZA 1Y3FE 4CLXA 4POAA 2VKTA 5KKAA 2V8OA 2ZUCA 4DC9A 2X2OA 3FH7A 5D87A 3WGZA 3VR6A 3U64A 3IEGA 3BHJA 3ZQ4A 2Q3HA 1DINA 4V3IA 4B74A 1ZH6A 2GT1A 2X6RA 4HOQA 2UZ0A 5C7IO 3GELA 5TY0A 2ASEA 4FFOA 3UPUA 4JFRA 2JJ8A 3WRXC 3CV3A 3PU6A 3WL4A 4LSMA 3NVKI 2O5EA 3RS5A 5M5BA 2H0RA 3CQ9A 3DBIA 3UB3A 1WLSA 4YK7A 4C4SA 4U2DA 1JEYB 4H7FA 4O4IA 3LS2A 4YV7A 4GSYA 1POWA 1SXGA 5D01A 3P2EA 1GAQA 3FX2A 4IF4A 4Z7JA 1S7CA 2QC9A 3FTUA 3GCWA 2XXAA 2I66A 1E1DA 5A2QA 2GK4A 4AULA 2YJ6A 4I4IA 3G9XA 1W47A 3PZ3A 4C08A 1TECE 1EK5A 2WAOA 3I6BA <