4I6EA

A vertebrate cryptochrome
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
490
structure length
471
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQEDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKANANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Cryptochrome-2
total genus 156
structure length 471
sequence length 490
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6eA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6eA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6eA01
1O95C 4ZCTA 1R6TA 1J70A 1XNGA 1LW7A 2A86A 1M8GA 1JIIA 5DB4A 1TQ8A 5H7XA 3ND7A 3OP1A 1EFVA 2BTEA 1EXDA 1YUNA 3UOWA 1H3NA 4DNXA 2QJTA 3L92A 1U3CA 4YP7A 3N2YA 5FNZA 4ND7A 1K97A 1QNFA 4HK4A 3TZLA 1H3EA 2VTBA 4Q93A 4EG6A 1F9AA 2CSXA 1U7XA 1GLNA 3Q12A 2CV0A 1NUUA 1QJCA 4MUJA 2O8VA 2A1TR 4U7JA 1YI8A 4G6ZA 2JANA 4PY2A 3ZJVA 4EG5A 3VRHA 1QRUA 1PFYA 1OBHA 4QBTA 4ZT5A 3CLUD 4MULA 1IVSA 1X8XA 4DJAA 1NI5A 3HL4A 2QJOA 1MRZA 2V0CA 3SZGA 3UC5A 2RE8A 2CUZA 4MW1A 4PBSA 3SP1A 3TNJA 1J1UA 1M83A 3RK1A 1WJGA 2QJFA 4QRDA 4FZJA 1I6LA 3NBAA 3GMIA 4MLPA 3CVWA 2J09A 3HV0A 1COZA 3G6KA 2CYCA 2QTRA 3IVXA 4OUDA 4WNYA 4I6JA 4ZT3A 3ND6A 3NV7A 2CV2A 4KPUA 4F4HA 2JAXA 1I6KA 1NUTA 1M1ZA 3TZEA 1N2GA 1Q19A 2V0GA 4MUEA 3TQOA 1O96A 1N2HA 3TS1A 1KQPA 2PZ8A 4DDKA 1JEEA 3FIUA 4CDNA 1V8FA 5J59A 4JYZA 3A05A 3P52A 1IH8A 3IH5A 3M5WA 3KFLA 1LI7A 1WXEA 1P7PA 4ARCA 4KR7A 1V47A 3H99A 2PXHA 3COZA 2E21A 1ZJWA 1WXGA 3CLSC 1EFPA 4MWEA 3FDXA 3AIIA 4UZFA 4XFJA 2DXIA 5DASA 4R2MA 2DEUA 3U1VA 1KORA 1WXFA 3NBKA 4BWVA 2OV4A 2QTMA 3QTTA 3VU8A 3A2KA 2A1UA 3DLAA 1ILEA 1ZH6A 3IMGA 1KH1A 4GU5A 2D54A 3IOEA 3ND5A 4EG4A 1TFUA 3N9IA 3CLTC 4Q16A 3K9WA 1G8GA 3IDFA 3FOCA 1BS2A 1M8PA 1N3LA 1WZ2A 4JFAA 3CLSD 1OBCA 3A4IA 3AG6A 4MVYA 1S4MA 3ELBA 1JZSA 1ZH0A 4F3RA 2EJCA 1LI5A 3SDBA 5J5AA 4JZYA 2IP1A 3FHJA 1JIKA 1KH3A 3GLVA 1EJ2A 2AKEA 3IODA 2QUKA 2CT8A 3H9BA 4NX2A 3UY4A 1N2OA 3FWKA 1IFXA 1N2EA 3AFHA 4MW9A 4MW4A 3RBAA 1NUQA 4RPIA 1MAUA 4MUIA 4AQ7A 3MXTA 1MJHA 4CT0A 2WQ7A 4MVXA 1TYCA 1A8HA 4DDMA 3C8ZA 4EG1A 4YP5A 1N75A 1MC1A 2DLCX 1WQ4A 4CDMA 1PFUA 4DLPA 5AHWA 2E89A 4EF6A 2WB2A 1JEDA 5IJXA 3COYA 4KPUB 4CQNA 1NSYA 1QRTA 2VXOA 5TGTA 2RD2A 1Q11A 3Q4GA 1M8KA 1N2JA 2ZUFA 4HJRA 3AKZA 1EUYA 1OD6A 1ZUNA 1NURA 4MUKA 1U3DA 1EFVB 1KR2A 1WQ3A 5HG0A 4TS1A 3CLRD 3FY4A 3P0HA 3X1MA 2A7XA 3HMQA 1KP3A 2YY5A 3E27A 4G5FA 5FO1A 5LM3A 2XRZA 2EL7A 1T6YA 3Q10A 3CVVA 2X1LA 3L93A 1SURA 1OWPA 1F4LA 2X1MA 3D6VA 3H05A 1K92A 1R6XA 4YBRA 4NAUA 1N78A 4MW6A 1EE1A 4AS1A 3BL5A 3PRHA 1Q77A 5J58A 2GKSA 4OUDB 1O97D 3KT0A 2DERA 1VL2A 4MUFA 4YMIA 4R2LA 2NSYA 3CLRC 3PNBA 1T9GR 2C5SA 5EKDA 3KT3A 1MB9A 1J09A 1O96B 1YIAA 1M8JA 3CLTD 2A88A 4K03A 3X1KA 2A1TS 3IVCA 1U0BB 3PNVA 1IQUA 3GUZA 1OWOA 2WSIA 1FFYA 3IUBA 1N1DA 4JXZA 4XFDA 1G8HA 4H3SA 1O94D 3DPIA 4MWBA 3G5AA 4MUNA 1D2RA 2G36A 4X0EA 1O97C 3OTWA 1MAWA 1PFWA 5LFAA 3SYTA 2CYBA 4HJXA 1RQGA 3LCJA 4RUKA 1G8FA 4HPWA 1KAQA 3HGMA 1G59A 1PG2A 1OWNA 3IOBA 4EGAA 3MLBA 3VGJA 4MW0A 4DDHA 1KAMA 1N2BA 1M8FA 1T6ZA 5TEWA 3FETA 1I6MA 4NATA 3UK2A 2D13A 3AG5A 2DUMA 1K4MA 2I1LA 1QTQA 2XRYA 3MUEA 3ZGZA 2PIDA 5DEOA 4ZT2A 1QU2A 3HZRA 4EFKA 4MWDA 2PFSA 3X1JA 1NZJA 5F23A 1MB2A 4UZEA 2O5RA 3ZIUA 3IVGA 1GTRA 4WSOA 4E1AA 1KH2A 3LOQA 4ZT7A 4ZCRA 2ZP1A 3IMCA 1Q15A 5TS2A 3S3TA 2B7LA 2Z08A 4JXXA 1T6XA 2A1UB 1NP7A 4KKVA 1NYLA 1R6UA 1TYBE 1U7DA 1NUSA 2HMAA 2DETA 1O0BA 4U8HA 1PFVA 1X6VA 2GM3A 5TEVA 3FH0A 4G5YA 1IHOA 1MOPA 1JGTA 2H2AA 3CVYA 3N8HA 1JZQA 1EFPB 1WXIA 5JBNA 4ZT4A 4KR6A 3KT8A 4DE5A 2H29A 1T9GS 2NZ2A 2YWCA 2PZBA 4MUGA 3INNA 2IJGX 2A84A 4R0NA 1OWMA 1WOYA 2GOYA 1WKBA 1TYDE 1MBZA 5HUHA 1K4KA 4MUHA 1VBNA 3RHSA 3SEZA 1GAXA 4I6GA 3QTBA 2X3FA 2JA2A 1H3FA 4GRIA 1O5TA 2PG3A 5BNZA 2VTBB 2TS1A 1QRSA 1GZUA 3CLUC 3KT6A 2X0KA 5KCMA 1QU3A 4MW7A 1VBKA 1J21A 2QUIA 4ZT6A 1FYDA 1YUMA 1JHDA 1O95D 1GTSA 4MVWA 3LE8A 2R5WA 2WQ6A 3PXUA 4EG8A 1IQRA 2D5BA 3MLAA 3PNYA 4S1OA 3CVUA 3I05A 3FG9A 5K0TA 1PG0A 2QUHA 3CA8A 3MMXA 4K0RA 3IMEA 4J76A 5K0SA 2BYTA 4P2BA 1KKUA 5H16A 2CFOA 1KQNA 1JMVA 4J75A 2Z3VA 4ND6A 3ZJUA 5IHXA 1F7UA 1EUQA 1I2DA 1QQTA 5KHAA 2QUJA 2J07A 3ZXIA 3JXEA 1F7VA 2A4MA 1JILA 2AG6A 2ZUEA 1GPMA 2Z09A 3COWA 5DK4A 3A04A 2IELA 1OWLA 2J5BA 4OJMX 3ILVA 5FO0A 3ZUGA 1VBMA 1DNPA 1KQOA 3CVXA 4XSVA 4YP6A 3FNRA 4EG7A 4ZCQA 1YIDA 3ZXSA 3HFJA 2E0IA 4KR9A 4U63A 1UFVA 1O0CA 1HYBA 1NUPA 3P0IA 3SZ3A 2DR2A 2OQ2A 1N77A 3IOCA 5KWVA 4NZPA 1ULHA 3UMVA 3D6UA 4I6EA 3CR8A 1IRXA 4EG3A 1TEZA 4L2IB 3RFFA 2PZAA 3H9CA 1N2IA 1JIJA 3TQIA 1O6BA 1H1TA 3N05A 4NAHA 3RK0A 3ZJTA 2J4DA 1J20A 4MWCA 1CT9A 2AZXA 1GN8A 3AL0C 4A91A 3P0JA 1KP2A 1IQ0A 5HUJA 1XNJA 4MAFA 3K32A 1YULA 3SEQA 1XNHA 1VLHA 2J08A 1WXHA 2YXNA 3FI0A 4L2IA 2CV1A 2E18A 2CYAA 4MQ6A 3DV2A 4MW2A 2QTNA 3DO8A 3IUEA 3H97A 3RJZA 1B6TA 1J1ZA 1XJQA 1JECA 4QREA 2DPLA 4ZCPA 1Y42X 1WY5A 3COVA 3F3MA 3ISJA 4ARIA 1TYAE 3G59A 5LLTA 2HGZA 2YWBA 3QE4A 2HZ7A 1O94C 4ZCSA 4MW5A 4NDAA 4PBTA 4PBRA 4MVCA
chains in the Genus database with same CATH superfamily
3WLLA 1XZQA 3ECCA 1P29A 5FUXA 2DFVA 4ZCTA 3NP7A 2XHEA 3RRZA 4XR4A 2YQ5A 1E5TA 2O4UX 1X2BA 2ZBDA 2JRLA 4TSFD 2AI3A 1TQ8A 3UH0A 1OXKB 5BV1A 3J5QB 1CQIB 3OP1A 3ZWBA 2ZI4A 1U0HC 4IVQA 3GQBA 3DDOA 5A02A 1P0IA 1EXDA 6YASA 3BMNB 5MF6A 4BXOA 1NRXA 1J0BA 4R2WA 1Y9EA 4F8JA 1X39A 4LQCA 3EDCA 1X1TA 1AMUA 4F3TA 4QOJA 3HR4A 4LXHA 5HMLA 4B4UA 2ZYWX 4QUDA 4DXHA 3HB7A 2QSZA 4LY9A 1SOUA 4X95A 4YONB 3CVOA 3QYFA 2IPLA 2AVPA 3PDIB 2VTBA 4QFCA 4Y2VA 1PR2A 1KI8A 4FD2A 1XBTA 5DVZA 5FLYA 3FPLA 4IH1A 4E13A 3OQHA 2B78A 2FOLA 4UU0A 5ALLA 3MTJA 4F8EA 1JEAA 4UHFA 4DI3A 4CN9A 5BW8A 2O8VA 1CVRA 5EWJA 3GFRA 2QZ4A 4D25A 4IQ0A 1B00A 4KO2S 4AURA 1UMCA 2FUG6 3N2EA 3VUEA 4C6TA 4WN3A 3O9ZA 5K6RA 4EG5A 2IS6A 5A05A 2XUPA 1L8QA 2Q6TA 3E22A 2Y1KA 3IC5A 4FGKA 4YRNA 1Z2EA 4IEEA 1JUDA 2PGIA 3KD3A 4K26A 4QJ5A 1F38A 4DIUA 3C4QA 2YINC 1GR0A 5FTWA 3EQ8A 1USGA 3E37A 2II6A 4HQLA 4LHVA 1N36B 4KQMA 2PGDA 3C3MA 1DDOA 5EXPA 4C88A 2NQ2C 5GPBA 4JI8B 5DULA 1J00A 1VJ0A 2BSXA 4MP3A 3DTVB 2HN9A 4MWGA 4EENA 2R8EA 1E79D 5B1BE 1Y3CE 1RLMA 4C14A 1XG5A 4NFSA 5EC8A 5TARA 5IM4F 3AINA 3BXEA 3C8HA 3D02A 5DHRA 2A2ZA 3G68A 1WUKS 3DFMA 4Y1RA 4QTYA 4Q3BA 3NEYA 1ZNZA 2QTRA 3ZU5A 5T4HA 1P4HA 4ALIA 5AKJA 4WNYA 5TQ0A 1UEIA 2V3VA 2JGIA 4FZ3A 2MYTA 3UJPA 2I8LA 4UEJA 5EJ6A 1HT0A 2JBWA 1E5LA 2PRSA 1DGQA 4POAA 1EVYA 2WXLA 1Y3AA 2ZJOA 4OQQA 2WLSA 4JOBA 2C3UA 3WBBA 4IDAA 1I30A 3CQCB 4GE3A 2DT5A 4QUJA 3LZCA 2EV9A 3VUFA 4X85A 4NACA 1FVFA 1XUOA 2HRCA 3H6GA 3WWCA 4RTLA 5CLJA 3DWIA 2OV8A 2CW5A 3FYUC 2Y92A 1OBVA 3MWYW 4O4HB 1MNAA 3SQNA 1GFSA 1XU7A 3UA4A 3ZTTA 5I4IA 3IPYA 1DIGA 3BXZA 3WFZA 1N6KA 4QYIB 1E1CA 1WMDA 2OO5C 1ZH4A 4DQXA 3P52A 4ERXA 3IAS6 1NFQA 5LQNA 4RXUA 4YDSA 4B4KA 1YRBA 5JBQA 4BLUA 3J7AC 2GUWA 3D7LA 2EAUA 4L8FA 1JHXA 3IAM1 5L45A 5FOQA 4NCXA 1FVXA 1MXHA 4E5MA 1S9HA 4PHFA 3W9GA 2HOQA 1QOZA 4B87A 2BGJA 2Z6VA 2YNQA 1HDYA 3EVCA 1Z15A 3JD3A 4C7MA 1M54A 3UKRG 3PNMA 1YA0A 1U9YA 3AW8A 5CGQB 4DK5A 5DIFA 2ALJA 4CEIB 4YQFA 3R8XA 1OCEA 1T2AA 5ALJA 3KB8A 2DEUA 3IL2A 5IM5A 1IBMB 1O03A 1U65A 3FHCB 3LQ2A 4IIJB 3SR3A 2O9JA 3ZHQA 3VZQA 4DLSA 3DZJA 4ES6A 5A0VA 2J5XA 3B48A 3QKRB 4IDCA 1PK9A 4BDTA 3D7KA 4INZA 1YRQA 4NU0A 1L5RA 1E60A 1AH2A 2C95A 3EOAI 5ICSA 1G7SA 3JQAD 1YQEA 3F9IA 3GCZA 3E9QA 4Q6BA 1BHQ1 1XZJA 4ETIA 2QP9X 5DK6A 2R9VA 1M34B 1IAQA 4WBSA 3EWIA 2BTDA 1G3IA 4KI0A 3U3MA 4C20A 1E1RA 4EITA 3ZDRA 2PV7A 6Q21A 3I5YA 2VYIA 1OLUB 5HW0A 2IOLA 1RRPA 4XPZA 5EA2A 3UM9A 4AAYA 1VKRA 3V8RA 1B23P 1GIAA 2JI6A 5FZSA 1X1SA 3GGCA 2DE0X 2W6CX 4URZR 6REQA 3KXDA 4FLEA 5JAPA 2I1VB 1ZU5A 3CZ4A 1W36D 3DXZA 2R8PA 3IUQA 5KVSA 4BNIA 3QFTA 3I72A 3O95A 4RORA 1TI7A 2V7PA 4EPVA 5ENRD 4C5CA 3ICPA 2JARA 1P7YA 1KO8A 4I2ZA 4S1NA 5FOXA 1N2EA 4F06A 5AESA 5JASA 3U7HB 3DP7A 2ZBVA 3TKLA 2ZISA 1TT7A 2YUIA 3MNFA 4DUYB 2OO5A 4KXWA 1HLFA 2AYZA 4HEJA 3JQ1A 3WQBA 2JLAA 1NTOA 3LA8A 1MJHA 2VRNA 3C7TA 2AR9A 1RABA 2BFPA 2F59A 3JWHA 3ZVLA 4ZQIA 1NA3A 1X3SA 3COSA 2GRQB 4K3UA 4KDCA 5K2MA 3RJ5A 1QS0B 4DCCA 4ZVMA 2A5GA 2C5BA 2FSIA 4CDMA 3ASGA 2H8GA 3D8RA 4BNUA 2PMEA 1WABA 1TQ6A 2WINI 4MPRA 5F21A 4PWYA 4ZVUA 2NZXA 1P72A 3G5MA 4YAUA 4QAQA 2WB2A 3BX1A 3S5JA 3MMSA 3TZBA 1TAQA 5JD4A 4LC0A 5ANRA 4ED9A 5CT4A 2P62A 1AOXA 4UUAA 3ZLVA 2HHLA 5JSUA 1SXJC 3HA7A 4BS9A 4BFTA 1V9SA 2XBLA 3PUVA 4Q7MB 2C84A 1PRYA 4XIGS 3EXFB 1WV0A 5ECGC 1PYOA 2QTVA 4P29A 2PLAA 3I8OA 3ELWA 4J6FA 1Y7IA 2UY1B 3EU9A 1RPAA 4HOYA 5CYPA 4FR0A 5U9CA 4YY3B 3G8CA 4D6YA 4CCSA 1QGZA 1KI7A 1LRKA 3BPSA 4OHKA 1XKTA 4MV5A 3A1EA 4V1CI 5L6LB 2ZBGA 1XTBA 1PSWA 1VL1A 4GD3Q 4IOJA 4MB0A 2Z4RA 1G0OA 3G9QA 4XVRA 3S55A 5AVSA 1QTRA 5K09A 2C0MA 4GX5A 3ABME 1A27A 2IEZA 3U13A 5CCBA 3HRKA 2XGJA 3EFHA 5G1PA 5FUQA 1QLWA 2DPMA 4O6VA 2ID9A 2CD9A 2FW1A 4XX5A 1U28C 1O5IA 3N8NA 3RVKA 3ZU2A 4ER6A 4P4SA 4IMJB 2NXWA 1DJMA 4MLDA 2EZ8A 4OHVA 5AHKA 3GU3A 4J1TC 4AYWA 1TCUA 3OHPA 3GC6A 3VYUB 1Z4NA 3VXKA 4B4VA 3FMVA 7YASA 1Z0AA 3V1NA 1UAGA 2ZLBA 1DO8A 3LOUA 4CU5A 1C1XB 1UZLA 1UMBA 4OY3A 2Y3AA 3KB2A 4TRJA 3DOJA 3STTA 2ZRIA 4DIKA 3HJFA 4IH4A 3ZE9A 1TAUA 3WMXA 2OFWA 4OHWA 1XTSA 3DBOB 4DL9A 4OAUC 3K73O 2BZ0A 1H93A 1MB9A 5DFAA 3VR6D 4TLDA 2FW7A 5AM1A 4HH4A 4IJMA 3QVWA 5CDSA 1GPKA 2IFUA 4OI0A 5TMPA 4DLYA 4H15A 1JB9A 1GZVA 2ETVA 3IVAA 4XGRA 5LDDC 1M2KA 5J3JA 3OM0A 2PCLA 2VSQA 2QLLA 3PYLA 3U5TA 4E6EA 1NV8A 4D74A 1U0SY 1NRWA 5KTOA 4JQSA 3QWWA 1OLSA 1U1DA 2I7CA 2PKCA 3ZJ4A 4C89A 3HCBA 3GWGA 4X92A 5HR5A 5JNTA 5HWSA 4CLRA 1XMJA 3UKJA 1NR7A 4KMMA 4RVDA 4TS9A 2QE7A 2MMCA 1MB0A 4P08A 1QG6A 3QHAA 4JI5B 4RAQA 5L7TA 2F1KA 5LWQA 3S6JA 3WWYA 1SWVA 1P3Y1 1HRDA 2HU8A 2ZU0C 3IQIX 4A10A 1AGXA 1G41A 1TC1A 1FJXA 2CB9A 1UT8A 3HXCA 2V96A 4AP9A 4F5DA 4IUYA 1H2AS 2C4HA 1FL9A 1Z0DA 4X7RA 4O4HF 2F00A 4ITUA 5TVGA 3D9KA 1MR3F 5FPQA 4AN0A 1Z26A 4X8OA 5ENDA 4YACA 1MMFB 1B74A 1K8XB 1QIFA 2JB9A 1KFBB 4JWKA 4MTCA 2XYPA 1U7OA 5MFZA 2ZUDA 2AXEA 3EZ6A 3KJIA 3QFRA 2OFFA 1VIDA 3N0RA 4CUZA 1QGYA 1V39A 3BL8A 3F7OA 4R1MA 5C5DA 1BA2A 2D0IA 3QWAA 1SBHA 1UC4B 1NY5A 5AHOA 4C0LA 2CCKA 4UTRA 4DCUA 1W35A 2ZROA 2YCBA 3ZQ6A 4UNSA 4NURA 3DVSX 4LOHA 2PYIA 2XIQA 1W5TA 3E84A 4C4XA 1KTVA 2O0JA 3ZWAA 2Q0SA 2FCRA 3H5NA 4MQEB 4OGFA 5KMGA 3N2LA 3EX7C 5I51A 2VCEA 5EHQA 2WXPA 5D1NA 3R8FA 2HJHA 5E1BA 1Q7TA 2D5CA 3S40A 2OBXA 1CWUA 5AOAA 4CM4A 3WQSB 2FEPA 3UW1A 3GRVA 1RWNA 4KC0A 5DKFA 2WTBA 4A26A 3JD2A 1B2LA 1XZEA 1XQVA 3QF7A 1BTOA 4BCCA 3KE8A 4P4LA 5EMKA 4LK2A 5CXUA 4N8DA 1A9XA 4E33A 2Q5QA 1P9LA 4HFMA 4KR6A 4FYMA 4ZQBA 1JJAA 1U3UA 2H29A 5JS7A 3D9HA 1E90A 3ZYKA 2CVQA 3F7MA 1KFEB 4KYVA 5JI3E 3EIXA 3G2JA 4NYIR 1AK2A 2OCDA 2RHGB 3DMGA 3SNHA 2PZIA 1OWMA 3OMWA 1NW9B 1XPUA 1L3BA 4MS6A 3FUVA 3WMEA 1NT4A 2Q2NA 4H3HB 2V3CC 2GEJA 3PPYA 4JKIA 1GAXA 2PMCA 2Y69E 2EX0A 4G1TA 3KDPA 3UM0A 2FSUA 2GFIA 5AVQA 3KM0A 4PSUA 4G67A 1YR6A 3OCXA 3V1LA 2H6IA 1ILWA 5CYFA 1JEOA 5WRFA 2XNSA 2FZEA 1SQ5A 3W5UA 1UT6A 1QU3A 5BYAA 2SCUA 2OMKA 2IGBA 4MUMA 5FP0A 4NIMA 3TOVA 4QJ3A 4ZYVA 1C3JA 2IP4A 1TUBA 3EHQA 1F1JA 2YFQA 4XCVA 4M9XA 5F5XA 5BWBA 1ID8A 1O95D 4XSHA 3BMCB 1XVTA 4W5QA 5LZ8A 2QL6A 2CFZA 2R8BA 4BTLA 3CLHA 2XUOA 4KPGA 4D8WA 4Z4IA 2CLEB 1P0FA 2J3LA 5C8YA 3VISA 3GA7A 4IRUB 1Q0UA 2WZCA 2C9MA 5A7DB 1OAOA 2O2IA 4ML3A 2A4ZA 1AG9A 2HSWA 1GSHA 2QRUA 4F7DA 3ULEG 1BCRB 3JATB 4YRSA 1TKRA 1VJTA 3GGGA 1Y9JA 4O2LA 1M2VB 3FE2A 1IYZA 4BFWA 4UQPA 3ONWA 3OIVA 1CUFA 3VZDA 3AX6A 3Q8MA 4XDGA 4UQZA 1PLJA 3W9FA 2WE8A 2YNMA 4OMCA 1RZ3A 1U2DA 1WX1A 4GYYA 2QN1A 3PF9A 4XUGB 3RUHA 2PWPA 3WGVA 4IX9A 2BELA 2NVWA 4TTRA 4OVUA 2W2XA 3VTKA 4QHSA 3LCAA 5CXQA 2GRPB 2B6NA 2NTJA 5J63A 4YFYA 4GCNA 4NJEB 3DSVA 1CY8A 3HBJA 3ORYA 4HDCA 1P77A 2YFKA 4CGVA 3CHOA 1XTKA 1WXXA 2Z09A 3KWFA 1T29A 3A04A 1C50A 1LDMA 4IFIA 4Q96A 2JLQA 2ZI3A 5AKEA 5JJCA 2I5PO 1ZO8A 4MRRA 3E8MA 3L0CA 1T3HA 5JANA 3L7KA 4JN6B 3U37A 5I9IA 1W1UA 1WKCA 2C2LA 2BONA 1ZMBA 2GLXA 3G8AA 3FZEA 3R77A 4HMOA 3OZIA 2W2KA 4YX9A 1RZRA 5B6JA 1DV2A 3ER8A 3AU5A 2X4IA 2YNMD 3FWHA 4BTEA 4O1HA 5AKXA 1AQYA 1Q1ZA 4UEWA 3SR4A 4E0BA 2W6ID 4UD2A 4BMVA 4EHBA 1O0CA 2E4UA 2GBCA 1E2GA 4R1OA 4EJSA 5I7FA 1YI0A 3OIYA 2XEEA 1RXUA 1QJ4A 1Z2CA 3CG4A 3I2IA 2Q5EA 5F4BA 3WOVA 4B6SA 1H1DA 5FAKA 3M9LA 4YXWA 5KUTA 4C7OB 4UEQA 2O8BA 4URYR 2PZGA 5BT1A 4B48A 1BWPA 2KBFA 4OU4A 2KI5A 4QYIA 3RV4A 2OMEA 4B35A 1AGYA 3M3HA 3VJLA 2WVIA 2AOXA 4JX9A 4MVJF 3LVQE 1OXUA 1SB9A 4M6WB 4P3PA 1Z7EA 2IS1A 3OU7A 1H05A 4KX3A 3RVRA 3K30A 1PWEA 2XDAA 1VCHA 3UVEA 3TWXA 1W76A 4AXXA 3O4FA 2A35A 4L5IA 2O7QA 5FWYB 3UJNA 1JEJA 1XI2A 3LUFA 3G0BA 3ZDAA 1NW6A 2OK7A 3FFWA 3SPXA 1G8PA 3PG5A 3H5AA 4G4GA 4JXJA 1DAGA 1P2TA 2HHJA 3O2JA 4NJMB 3TOCA 3AYZB 1SFRA 4YWHA 4Y2YA 3KCNA 1KY4A 1WXHA 2R6CA 1F1BA 1K4YA 5DHTA 1N5JA 1HLPA 2K6GA 3ENZA 4PHGA 1UPAA 1DKPA 3W6NA 2DVWA 3NBUA 4L50A 1DAIA 4C30A 3V2IA 2YWEA 2AFIB 2NAPA 3AFOA 3B6JA 3DAHA 3I28A 1G8KA 1WWKA 2ECKA 3IAEA 2FAXA 3V30A 4KAFA 3TRKA 3U17A 5EIWA 4DVGA 3DGEC 1H4QA 1GUAA 4NSNA 2CL0X 1PFGA 1MPXA 4BC1A 4EM6A 4URWR 6AT1A 3QUAA 2RHDA 4HPXB 3RTDA 2IXFA 1OLXB 2NTEA 1C4KA 1G0NA 1SUBA 3LC2O 4N39A 4ZDKA 4IUDS 3R6DA 3SD7A 1S3FA 1NLFA 1QKJA 3DO6A 3ANYB 4B8YA 4DA0A 2EZTA 3HJHA 1K2WA 4EHMA 1YNSA 2C54A 3OC0A 2IA5A 3CS3A 5HM8A 2AJAA 1CNFA 1I1NA 1PZHA 1RXSA 5BSWA 1FS5A 3ZI7A 1T0UA 2H06A 3SO8A 1DIBA 4OI2A 4U8VD 3GBPA 3MIZA 3I64A 3BZUA 2ZBEA 2FP4A 1P4SA 4OOFA 5CA0A 4XUCA 4IH9A 4ILEA 2PTGA 3ZZMA 4C0JA 4F21A 2DBAA 4R8SA 4ASUD 3TSAA 4Q3AA 5J5CA 3SS9X 1X3LA 1Z4LA 4L08A 4XZ3A 4E4RA 4AJ4A 4UFPA 4F3KA 3UBTA 4YPVA 2EZUA 2H51A 5L3RA 3UWKA 2CFUA 2ZI7A 3P8ZA 1AKRA 1Y8AA 4JBLA 1VL6A 3ZY6A 1SA5A 3PZDA 5ENOD 4DRXE 2OV3A 2XTNA 2YV2A 3KYCB 3NONA 2J4FA 3HY3A 3O5AA 4LECA 3TQTA 4EA7A 4YPFA 3H16A 4FWIB 4KP7A 4QE3A 5BPPA 1SU6A 2FQYA 3FZGA 5EQDA 5K51A 2JANA 1CF2O 1OZHA 1ZR4A 3D9PA 4CMEC 1P6QA 4C05A 1RIFA 4ITVA 4XWOA 1RCUA 4JI4B 4NK5A 8LDHA 1T34A 4QBTA 5HJ7A 2GEKA 5BWLA 5AIAA 2X22A 4AJ2A 1A8IA 4L5CA 1IVSA 1R0XA 1H1LB 2IIVA 3KJNA 1NI5A 4EQ6B 2G0NA 3HYLA 1DBIA 1TIPA 3W2FA 1ZA1A 1U8UA 1MRZA 3LDAA 1Y3HA 2GBLA 4J94A 2CE2X 2Q50A 1XZAA 1Q7EA 5LA6F 3RC1A 3SP1A 1TM1E 2QTCA 1SVXA 4RVGA 1Y8CA 1YS6A 1Q50A 2C82A 2O2HA 3AXTA 3FLMA 3RC2A 4NBNA 2FZCA 2BBWA 4Y2JA 1SU4A 1U2TA 1PT8A 2FEWB 3OE7D 4U2CA 5LBTA 5FJIA 5B1HA 5BPFA 2CMDA 1VFPA 4EPXA 2W4MA 1HURA 1AN9A 1L4KA 3TLGB 5JYDA 4HTFA 5L3QB 4NAVA 1W7AA 1GPLA 3N2KA 3LCMA 4I7EA 1XN4A 2IXTA 2CV2A 1PBTA 4GM1A 3B2EA 1T0PA 2BL4A 1NUTA 2Y0PA 4O3FA 3EBOA 5FB3A 2GASA 3MWGA 2QN8A 1WB5A 3OX2A 3K6SB 3K0SA 2JFFA 1WPGA 3VYVA 2JCXA 5CLFA 1F8UA 3TS1A 4LMRA 3EOBI 4Y1EA 3ZHBA 3TSYA 1QYRA 3RVPA 3H2GA 3N7AA 2OGWA 4I14A 2AFRA 4EJ2A 4MPPA 1XU4A 1XAHA 4S3MA 3IURA 3SI7A 1H6OA 2L6BA 4J1TA 4RG6A 3GJYA 2FFAA 3G2KA 3X43A 4HQDA 2NU9B 1J39A 1M6WA 1QCZA 3KZ1E 3N2KB 1Y34E 4L3WA 4OYHA 3WLRA 4B3FX 3F8WA 1YZ3A 3JQ7A 4G4SO 1U7ZA 4HGZA 2B9VA 3X1ZA 1GGMA 3RANA 4LEIA 2UZ1B 3LBFA 4XQGA 3O4GA 1SQFA 3NHFA 1DOHA 1JNXX 2PRZA 3P4YA 4WZBA 2A0KA 4L8GA 1U3WA 3ZCSA 4DLOA 2Y27A 2D2IA 3VPBA 5F51A 3W1EA 4M0PA 3QSYA 5ICFA 4YCAA 3LIPA 5ETJA 5TQ2B 3ZGLA 5BV8A 1DC7A 1U2DC 2EG9A 1M9NA 2IPOA 1Z2PX 1FUYB 1N6IA 2VOEA 4MUBA 2X5NA 1S96A 2ZJBA 2R05A 4TSFA 3NHMA 3KSMA 4C5BA 2ZE6A 1MZCA 4L2YA 4LRUA 2HJ9A 1L4HA 3NR2A 2J4BA 3CURA 4A92A 2PYDA 3KJFA 1DCQA 4KHZA 3T34A 3WYBA 4EPRA 1YL6A 2WHEA 3GRPA 1KBQA 4KIJA 1MN6A 1Y8RA 5DXAA 4MKIA 1NZDA 2LRHA 1FFAA 3PH0C 3TL6A 3KOMA 5L6MB 1G8SA 4RTOA 4JUFA 5BRNA 2O05A 4IYJA 3G2UA 5E6SA 2R00A 1QF9A 4GX1A 4HUQA 4BX9A 1G8GA 1VJ1A 3GFVA 5BXYA 1EI9A 3GO4A 3HYNA 5DYTA 4BMNA 1WZ2A 2XZTG 3CINA 4GP7A 2BFBB 4W5WA 3H9UA 1W85B 3ZQKA 1R15A 3GDWA 5BNIA 4KITB 4N9QA 3KSAC 1G66A 4ARBA 1WB6A 2QENA 5BN5B 2C29D 1XCJA 3UMBA 5JAOA 4KXFB 4ZMSA 2F7SA 2AHRA 2MIIA 2G67A 4G97A 1IXVA 1BMQA 4IIDA 3EZGA 1LLQA 3H3FA 3PS9A 3TRHA 1XWWA 3PEVB 1FMTA 1JR3D 3VYTB 1OH5A 3IEXA 1Z0IA 4LFBB 3C3CA 4ZO9A 3EPPA 5CDFA 4CMGA 2IP1A 3BWXA 1ZGZA 4KRYA 4CMHA 4RVNA 4B89A 1USWA 3IODA 1Z2OX 2EP8A 4DXAA 2WMNA 3WIUA 2IOFK 4JMPA 1XU9A 3HYMB 4W1QA 3GP8A 4QOSA 4LNHA 4MW9A 3LDZA 4KQCA 1N4AA 5KWIA 2A59A 3KHSA 2G9ZA 3ND9A 1FFSA 3D3WA 4HLCA 3QF4A 1KDPA 1MX6A 1CUGA 3BU8A 1NNLA 2A5JA 3A1VA 2IVZA 4KTVE 4XEHA 2O2SA 1PR9A 4DEVA 1CJSA 3H18A 2BLNA 4PAGA 2JLBA 2E4WA 1E6WA 3CKYA 4BY6A 4S1WA 1J2TA 2IL1A 4IOKA 4I1IA 1XMIA 4X24A 5JH7F 1FRQA 3GFBA 3TSWA 4JDPA 4EY7A 2PQ6A 4PQFA 5IJXA 4YMTA 4NCIA 1D2AA 3QVVA 3GJ8A 3VPXA 5JJBA 4PXYA 5A06A 1CYEA 2LSVA 3AXSA 3I1YA 1N9KA 3M4JA 3O47A 4JLAA 3P9KA 2VJYA 5KYXA 2YXEA 3GNTA 3UHJA 4KLCA 5IWCA 3VHXA 2J45A 3WRXC 5KKCA 3HYRA 1B43A 1GTL1 3C39A 3KRTA 4UNPA 3ZTWA 2FMHA 2R2AA 2A7XA 2GF0A 3TBKA 3DVLA 3QLJA 1TU0A 5L8VA 1DFHA 2V74B 1ZI9A 2YY5A 3E27A 5D87A 1CY0A 2GN0A 1FVHA 2JEKA 1OV6A 1RR6A 3S7DA 1PKEA 1YAJA 2ZQZA 2ZSJA 1CF4A 1AU9A 1VMDA 1K88A 1YKFA 3R0VA 4OHOA 4BQFA 2X1LA 2F2TA 1S0UA 3V4VB 3ADCA 5CIQA 2VSOE 3FH5A 1PR0A 2CFTA 3LA6A 4RXTA 1XMPA 5E6SB 3R9KA 3RVLA 2B3TA 3MHTA 3AOEA 4LF8B 4JUCA 4P98A 5BORA 3SX4A 1TJFA 1SBTA 2GHRA 4CDRA 1VIYA 4WKGA 5G1NA 2IEDA 4K87A 4ZIRB 4PO1A 3FXAA 2BBOA 4RVHA 3KBOA 2C5AA 3PA6A 4PPGA 4V0LA 4GQBA 4DR4B 4QQFA 5KWDA 4RY2A 1T1GA 2QSJA 3EH1A 5FBRB 3ZDZB 4CKWB 4IP0A 1XFAA 3KOXA 4HAIA 1NIPA 2XD9A 4S1VA 5DSZA 5ER6A 1MPTA 4UNRA 2M63A 1YBFA 1T9BA 4KMSA 5H70A 2OXTA 1NVTA 3CCCA 4N5MA 4UHDA 2CHXA 1U2VG 4B3TB 1V3VA 4DY4A 1T9GR 1F3LA 1ZAKA 1MF7A 1TNDA 1UZUA 1YA4A 2OCIA 2PLFA 2X1VA 1O96B 5FI0B 1AC5A 2IHBA 2G1JA 3TJRA 3A1FA 3HR8A 2A1TS 1KI3A 1ZM7A 4HGRA 4HXFB 1GGNA 5BRJA 1WXDA 2H5IA 1GZ7A 4IZIA 2X0DA 4CM9D 2XT9A 5LA6B 1YZQA 3EEQA 1KDOA 1YA8A 3PDCA 3TIIA 1P1CA 1XLVA 1SVMA 2P79A 1G8HA 2I3GA 5K6TA 4J4BA 3O73A 4ZTUB 2WFLA 3KEAA 1YKSA 1T25A 4I4TA 1U7UA 3DPIA 3QWIA 4YFVA 2RC6A 5AW9A 3QXJA 1AHHA 5T8IA 2QTGA 4G89A 4J0QA 1BE1A 3FPCA 1TMYA 4HEA1 2C07A 3GIDA 5J1TB 1WM5A 2EDCA 1UM9B 4OSPA 2C20A 1O9HA 1RVDA 4EB6A 1PT5A 2G76A 4N76A 3NVKI 2CL7X 3TLAA 2X5OA 3S7BA 3P27A 1Z0KA 2XMSA 4RTMA 2XE4A 2D62A 5HZMA 4AIIA 3C6BA 4A8JB 1T2CA 2I6HA 3LFHA 4ZI2A 4X54A 1Y80A 1E1CB 1XEXA 4LZOA 4UCQA 3OZCA 4C1BA 1HC7A 1VA4A 1BS1A 3I4GA 3KOWA 4UD6A 3M70A 2BM8A 1D4OA 2OGSA 5CD1A 1NXTA 1KY2A 5G0WA 3TRIA 2I1LA 4UDYX 4URVR 2RHCA 2WNHA 4ND8A 4RWEA 3USES 5ALDA 3T1OA 1O1SA 4HGOA 1M1UA 4FX2A 4I46A 4ZT2A 4GZDA 4WAUA 4UDXX 2I2XB 3L6DA 1T0HB 2P5YA 2OHIA 1HBJA 1Z63A 5E38A 3ON5A 4UZEA 4EW6A 1WRBA 2IK8A 1DC8A 2VOJA 3TOXA 3K72B 3ZIUA 5LLDA 2VPPA 2CJFA 1UINA 4KR3A 4PXAA 4ZCRA 6GPBA 2ZP1A 1DXOA 1S89A 3GELA 1VCOA 3HJRA 2P9PG 4KRGA 5HBGA 5EJAA 4WNAB 1IE3A 5BT8A 3KDAA 4ZC8A 3PGXA 2VLBA 1A96A 3AUKA 4RD1A 2F4NA 1NJSA 3WL3A 4EHJA 1G5QA 4MK4A 4DWJA 3I0MA 2HMAA 1UT5A 4K88A 3OCVA 1DXQA 3GAMA 1II0A 1D5CA 1O0BA 3ZDQA 2DBRA 3SICE 4ZAXA 4KSBA 4DCOA 3HKBA 3CHQA 4E6PA 3UTDA 1JZQA 1YZHA 2EQBA 3P9SA 3WYCA 4DZZA 1Z7GA 3BDAA 3S1AB 4E46A 4G65A 1KFJB 5IY5E 3WC4A 4ZZ1A 2XB2A 2R8XA 1JWGA 5HVNA 4X66B 1DS6A 1SCNE 5EJMA 2JIMA 3ZUVB 4UQXA 3FH8A 2QXUA 4K9DA 3G2OA 4ABNA 3D3JA 3LL4A 1ORRA 1SZDA 3TH5A 3ZKWA 3QPBA 1BJRE 3VVMA 4QM6A 2ZB4A 3RSSA 3FUJA 2JFZA 4OP3A 3QTBA 4XLLA 3WL8A 5KX5F 1UBNA 4G0WA 3PK0A 3R8CA 5LMNB 3C5CA 2VTBB 4JELA 3B70A 3BMOA 3MX3A 1D2NA 2Y77A 2NXNA 3IP5A 3E53A 4KXNA 2V7EA 4OGGA 1JKJB 3T9EA 3UT6A 4ENUA 5LZ2A 5E75A 3I4LA 1L4UA 4IIXA 3RIYA 2FMFA 4BRSA 1ABEA 1HE3A 2O52A 2QZ9A 4HGYA 3S7TA 3ISTA 5GQSA 5JD3A 2C92A 3NTUA 1TYZA 1OGYA 2H9AA 2BFEA 3T3IA 2ZYAA 2H2FA 4ODIA 3IR6A 5FPHA 1EU1A 1GU7A 5EJ5A 3ESQA 1NYQA 5UKDA 1NVBA 1GTSA 1NRJB 3UXEA 1ZOPA 5DBOA 2WQ6A 2PX4A 3PXUA 2RARA 4FFRA 4OKIA 4YHBA 5LYJA 4YDWA 1S8NA 2JGNA 5IFKA 5AVWA 2IQCA 1VE9A 3I05A 3HIZA 2YHAA 5BY2A 1UQUA 1LZLA 4YDEA 3C3WA 1J8VA 1OR8A 2I71A 2LWIA 2YR0A 2A9QA 4WY2A 1FLNA 2BF4A 5K8JB 3FTYA 1U1GA 2HI0A 3GGJA 4UXJA 5KOHB 3E7WA 4JT4A 4MJXA 4WLEA 5IYZB 4FFBA 2BKKB 3C6YA 3FTCA 1E2KA 1G20E 5C31A 4KXUA 1QYWA 1CUEA 3BHMA 3H8SA 3PWSA 4XE0A 4FCVA 5FPPA 1NJFA 2DBQA 3SMVA 2NIPA 1SU7A 1GGKA 3CXRA 2WHQA 221PA 3HJAA 2H7XA 5LB2A 4M6WA 1DO0A 2PRKA 2GJKA 5CDHA 3Q5GA 4B3JA 3F5MA 3QZUA 3MGAA 5T64A 1UBUS 1UXJA 1ZM4A 3QVXA 4RDCA 3DNMA 1TNYA 5BQXA 2B21A 2QX6A 1TUGA 2DWZA 4U3JA 4DV0B 2V5FA 2A0YA 2WXNA 4B6RA 1VBMA 4K86A 1X80B 3FWZA 3R3SA 4FE3A 4D3SA 1OJLA 3BJRA 2IZOA 1QFXA 2CNKA 2PUHA 5HIIA 1ZGHA 4CKXA 5C5CA 2AVDA 3HXTA 4IN3B 3QQ5A 3SF4A 2NV2B 4A82A 1RWVA 3ZXSA 4EZLA 1DC5A 5P8WA 4DADA 5JTUA 3FFLA 4CM8A 4WOPA 3PL5A 2DFKB 4KNVA 2BKVA 2AG0A 4JT2A 1KAOA 3EVAA 5FULA 1NT2A 3WADA 2AUMA 3F9RA 3S68A 1E7QA 1N1EA 5DHQA 1Z29A 4TMZA 5AMXA 2AJLI 4Q3DA 4UU7A 5KS2A 2IS2A 5IRCD 1SZJG 3I1FA 5DLEA 3PYXA 3Q98A 2Q9CA 2VYQA 3D6UA 4OP1A 4XPIA 2WLTA 5A5EA 1IRXA 3UIPC 4M9UA 4ZO7A 2IYVA 4RIFA 4X6UA 4Y1GA 2XQVA 1VDYA 2PZAA 2GTPA 1US8B 1X7ZA 2BI7A 1YVDA 5M5BA 4KWHA 3LZ6A 4L4SA 4ME6A 1NJ2A 3N5CA 3N05A 3RNLA 4C4OA 2IBTA 2N46A 2EBHX 4QLOA 4JU8A 4QKQA 3WGJA 3ZJTA 1A04A 2OE2A 1PL0A 3U0VA 4GZMA 4A0FA 2EKQA 3CRW1 3A6KA 2WIDA 2Q45A 3ZWOA 2ZJ3A 4XWAA 3SI5A 3L7DA 4R2IA 4WA7A 2SCUB 4JBGA 4GP9A 1Q0LA 2NACA 3QE2A 4EW1A 2BN4A 5F1YA 4A2QA 1J07A 2H00A 2JCYA 4AJJA 4HAYA 2QNRA 3E3LA 2FP3A 4DZRA 2PLNA 3PA8A 4TYQA 3ST7A 5HE9A 3BXXA 2QB5A 3OJEA 4UNNA 4LWOA 2XCRB 1LQ2A 1JI3A 3VMMA 3WTCA 4QREA 5HKKA 4ETMA 3BSFA 4QAJA 621PA 2BKUA 5JNVA 4EW3A 2ZCUA 3O8QA 1E3WB 2MSWA 4FUQA 1AKTA 2A33A 5B4TA 1RFLA 2XXAA 1UBOS 4HQOA 1M0EA 1F8XA 2Q7FA 3MYVA 4AY5A 4R1LA 3ZD9A 5FPSA 3APFA 1ZCFA 2VYVD 3OZEA 2Q3HA 3D3KA 2SICE 1V45E 1AO3A 2FWJA 4YT2A 4Q82A 2XTJA 1FYEA 5DW3A 3ZPXA 4ATGA 2W98A 3F78A 1GARA 4B6OA 2PWYA 4RLSA 3VZBA 1M6HA 1C9NA 4RPJA 1VP9A 3ZN3A 3DEOA 3SLGA 1L7PA 2PQMA 3IBEA 1PG5A 1XTVA 2R5NA 2TMDA 4HLDA 4ZEMA 1YS9A 3OEHD 2JNWA 3WNZA 1Y5RA 2ORWA 3VLFA 3H1AA 3UK6A 5IBQA 4BJ3A 4A1SA 1MC5A 3BH0A 1N32B 2I1JA 1EYHA 2YDXA 3ZDEA 2ZRPA 1W48A 3IAHA 3STVA 3TNFA 3RSFA 1NA0A 2QTLA 2FULA 2H2DA 4DNOA 1M72A 1Q3KA 1QO0A 3DKIA 2QS9A 4XA8A 2CV0A 1D2GA 2D6FA 2XEDA 2BGIA 4EJSB 4HPJB 1F5SA 3ZQUA 4QD3A 3QVOA 4AY6A 2MOWA 4JIGA 3STUA 3JZDA 2JGRA 3I9V1 1MGOA 4BFRA 2H6GA 1YE3A 2F9FA 2W90A 1QRUA 5BW6B 5IC4A 4RDHA 5JZOA 2FPRA 4YMGA 1F0NA 3A6EA 2HM7A 2BEDA 2Q07A 3DOOA 1EDOA 4FYVA 3EGVA 3ZHSA 3AESA 3KPWA 3UIEA 2OHJA 5DRTA 5KX5B 3VHXB 1HQDA 3D0RA 1Q2UA 4P1ZA 2YC4C 5KSYA 3W05A 1YQXA 2P9GA 4I4CA 1HG0A 1JFFA 1CHDA 3ANLA 5A6SA 5BVGA 3DBSA 1AHIA 1Q83A 2O6HA 2O7VA 2O8DB 1QE3A 1CK4A 1ULZA 4LRYA 4AUNA 3HV0A 1NJ1A 1MKYA 3WYDA 2YS6A 4JJAA 3HVUA 4IIJF 2X38A 2NZVG 4LYDA 1H9CA 2A9FA 1N7GA 2IGTA 4I9FA 1Y8ZA 3FSEA 2WY2D 2JAXA 1WZEA 3E81A 4HMPA 4M1TA 2Z2YA 2NSZA 5AQ9A 1OX4B 4AVXA 1MVNA 4LBWA 3UXYA 1PWYE 1U2PA 1S5PA 1RJWA 3GBVA 3GZTB 3LBNA 3OXLA 1SC9A 4X45A 5J59A 1XYYA 4GI1A 1DVPA 2GTHA 2X7XA 3GJSA 3A05A 4X6XA 4PO3X 5T57A 3Q7SA 2QK4A 3P2KA 2ZAOA 4PH4B 2BKXA 3BGIA 4DSTA 1IIRA 2ZB2A 1K0FA 1L5ZA 2C42A 2PFKA 3M2TA 4DYVA 1A71A 4ARCA 4MDHA 1NMQA 3S2IA 3KQNA 1DJPA 1EE2A 1EYZA 4LCTA 5AOBA 3F71A 3U64A 3L8HA 3NTOA 4ABTA 1U0EA 4ZD6A 4MWEA 3NOCD 1P9WA 2C4VA 2OOEA 4DA4A 1IK4A 1P33A 3PRYA 2YX1A 2WU1A 3PZ4A 1Y1PA 1ES9A 4JBXA 1TPYA 4IMIB 1UK7A 3AU9A 1UMBB 4MR9B 1CR6A 5KYWB 1AA9A 4KJZA 4LF4B 3OUUA 4EX7A 3X2SA 2IITA 4UFNA 4WNAA 3ZHUA 4JYAB 4C2UA 3MJWA 2PWAA 3AF5A 3FCCA 3EXG2 1NMZA 4GRDA 4RL6A 5H0IA 3BBPA 3W0LB 5HX7A 3AFGA 3IBCA 3GJQA 1IPFA 1MEJA 3IEMA 4D4GA 1AA6A 4RLYA 2DHQA 4RESA 1ICIA 2GK6A 2V7WA 3LBHA 4CEMA 4GOJA 4HQ0A 5B1IA 3G2NA 1QQBA 2EF1A 2J3HA 1Z75A 3GLIA 2FPMA 3HSKA 3KO8A 1HT3A 2C1ZA 3RRJA 4D0LB 3TLZA 2J1LA 4JASB 2WM9B 3B6ZA 4P22A 5SZIA 1ELOA 4E32A 1MNQA 1ADYA 1ZIDA 2DYKA 4FNMA 4F3RA 3FWPA 4N6OA 5AVXA 1MG5A 2EERA 2GVDC 3BMXA 3PUZA 4RF4A 5B30A 1NVEA 1YHYA 4UVEA 4YAJA 5FCDA 1ZUNB 4BKUA 1T8WA 1F2TB 3QXHA 1W46A 1KT0A 2ZJYA 3FHJA 1W0KD 2BMWA 2VK4A 3OQ6A 1E7SA 1M6YA 2GX6A 3AS5A 1MHTA 1F06A 1NOIA 2B7BA 4L8VA 3RUPA 1E63A 3V4RA 4GKJB 1YMUA 1LLDA 1KJIA 2ZPTX 3C3AA 4K40A 4YP1A 3U3RA 1NUQA 3U9LA 4EUNA 4L4ZA 1MJFA 1VJGA 4JA2A 1H2XA 4Q1BA 3DR5A 1ZM9A 2Z5VA 4MIOA 4CWAA 1GU1A 2IZ6A 2WJ4A 3NCTA 1CJVC 1E2PA 3C8ZA 2G6BA 2IYWA 3HJBA 1CQPA 1E6UA 1QB8A 2IHTA 2NN3C 1FNMA 3NOVA 2IWRA 4AUKA 4AZ0A 2FZGA 2ARKA 3U4QA 1KRWA 2P9IG 3LQ4A 1R5JA 3B1XA 4H35A 4HZIA 2XE7A 4NMMA 4EPTA 2OHGA 2X5JO 3DPSA 1XOIA 4KI7A 1A1VA 4NMWA 2QP4A 4U7GA 1U7WA 4US1R 3V3TA 3N28A 4HLQB 1MC4A 3NBQA 3QV1A 4R3WA 4MPTA 5DYYA 4O2RA 5FTMA 3K2EA 4FFSA 4QUAA 5A9TA 2HW8A 3ONKA 2JL1A 3LOPA 3M6AA 4UE6A 1QZXA 3IUYA 3WYNA 3ZWDA 4ME2A 4WDRA 5C34B 1KC1A 1P74A 1XLTA 3ZU7B 1CDDA 3TBFA 5A4KA 2OHVA 4KQKA 2R6AA 1WETA 2E85A 1M8KA 4D42A 2H1HA 4RA6A 3MA5A 1CB7A 3CZMA 3VHQA 4DANA 5BWMA 4Q3OA 4Z1MD 4Z3DA 4XB6B 3GD5A 1FF9A 3A3PA 3DULA 3GEPA 5IABA 4OD0A 3TEMA 4P4GA 2B1GA 1P3DA 1V3UA 1TLTA 4UATA 1NGSA 2P6NA 4G5FA 1CDEA 2ZKLA 2R62A 1VYVA 3F6CA 3HZHA 1UQRA 3W5JA 1YQDA 3WJ7A 4R71A 3GN2A 1X1RA 1Z6AA 4O5AA 5FA8A 3H2IA 3X3HA 3SX2A 1OWPA 1U0LA 3D6VA 4MS4A 2YQ4A 1ODTC 4W1PA 5F33A 1VB3A 1EWRA 2FR8A 3BK2A 1E4EB 3SYKA 3FUNA 1LV7A 1XKQA 1N78A 3S70A 2YVAA 3RAFC 4D4KA 1BYUA 4BEJA 1E1RD 2EXXA 2GZMA 5DNEA 5K4GA 1PFKA 2BE7A 2P9EA 3ADOA 3KYIB 2EHJA 4FLMA 1L1FA 1U98A 4TRNA 1NE7A 1JQ5A 2C9ZA 2QLFA 2YV5A 4P33A 4Q9DA 5T4YA 2PRJA 5M3BA 5LMZA 2LR0A 3BWEA 4MQUA 1FXUA 2H07A 4FZ5A 2HIGA 3W9UA 2JKVA 2GA8A 2QW1A 1DAKA 3I61A 4I2VA 1BI7B 1Y81A 1SC6A 1Y98A 3PFWO 3WRWA 1ZMRA 2P8SA 2PX8A 3CLTD 4U00A 2A88A 3H9EO 4DV5B 2I9KA 4OB8A 5IT0A 1Q0QA 4YAEA 1OWOA 4EYEA 1A4RA 2DWPA 1D07A 2C99A 4JC0A 4JXZA 4MMYB 4AIFA 1Q57A 3NVAA 1SUCA 1KAHA 1M66A 1Z6PA 3HA2A 4PLPA 4QWMA 1KYXA 3KYBA 3GJ5A 3K6RA 4MWBA 3EK2A 1E1LA 4UREA 1UFKA 5B1YA 4MUNA 2VQ6A 5DBKA 4OH7A 4ENTA 3QF4B 3QMWA 1V7PC 2QUBA 2IUSA 2PUAA 4A16A 4UOQA 5T3RA 3DEZA 3KS9A 4KRXA 4HN2A 2CWDA 3FAKA 2HMSA 4UWHA 1DE0A 3IE0A 3QUBA 5AR1A 2HYIC 1JDPA 2B34A 2IT1A 5KJ1A 3ZH9B 4EATA 3W5BA 3GAAA 3SC4A 2VQ2A 1HL3A 1THZA 2NVBA 2XHZA 5SV2A 3PHIA 3VNSA 3ZC3A 5IUJC 3CW8X 2XUKA 2EC5A 5ANLA 3FETA 4RKWA 3VM6A 4HNTA 4JJFA 1NLZA 2D13A 3MN1A 3OMXA 1QYXA 3FMIA 3SXPA 1OT8A 2KW5A 2VIIA 2CUKA 3ECSA 3HCPA 4G8CA 3NPAA 4PW0A 2EARA 1R3UA 3EVDA 2Q29A 3HL0A 3ZGZA 4DX1A 1U31A 3IERA 4JQOA 2I2FA 4AC9A 1B8NA 1CIPA 4E11A 5BW4A 3UXHA 2CXTA 1M1YA 2XQ0A 4KDEA 2QYUA 3X1JA 4LBVA 1KK3A 3RIEA 2BDEA 4QSMA 1IIBA 5K3FB 1MG0A 4MUXA 1P80A 4WXYB 1XMOB 3FWNA 4EJ6A 1JH9A 2I34A 1RQLA 3D0KA 1QPZA 3LS8A 5BR7A 2VJAA 3UMYA 3E5RA 2H8KA 4Y0AA 1MZVA 2DY0A 3FGOA 4KIWA 1V6CA 3PVZA 3LQYA 5IDQA 4LF9B 2O4CA 1GG5A 1NUSA 1TJ5A 3PRJA 4LZNA 2DETA 5JJLA 1A9YA 2V3WA 2ZJ4A 1K7SN 1LKZA 3GEMA 4B9AA 2GAJA 4V0OA 1XD2A 1MO5A 4ZA2A 1A8QA 1E5DA 2EZ4A 4YRMA 1JAIA 3ENVA 1JQKA 4ZT4A 1EFDN 4OBXA 1IBRA 1NAIA 2Z8XA 5BMVA 2DQYA 2CC2A 1VLLA 3HO6A 4D6PA 1SVIA 2O50A 1RAHA 1Z4QA 3DB2A 4PGAA 1L4GA 1W1IA 4TKMA 2PKYX 4L6CA 2YQ8A 1AKEA 1TYDE 2PSFA 3EEBA 1UXGA 1P45A 3I6BA 5EI5A 1KWGA 1ZINA 3DL2A 3DEFA 3VVBA 3W3ZB 3EN0A 1LNQA 3FDZB 3K7EA 4ESHA 3PDHA 4HXGA 1G8MA 4QPDA 1QRSA 4C4YA 2O07A 2WICA 5J4HA 1W1WA 3M49A 4PLFA 3MAGA 3W6PA 2NVUB 3RVSA 4BX2A 3DPUA 3MQ2A 2ZPUA 3FLEA 3OZDA 3M2PA 4G4SP 1U1EA 5EUCA 4B33A 5KSZA 4RTRA 3R3XA 2VSOA 1N5KA 4EY8A 1IG0A 1F9EA 4MGIR 1II8A 3DBIA 4UC0A 1LPAB 4RJIA 4PQEA 3RQSA 4B7XA 2HB6A 3M81A 3JQDA 1MZPA 3NAWA 2O5VA 2WWWA 4KBFA 2F8LA 2A9KA 3K15A 5EGNA 1VJRA 3KWLA 4G84A 4HAWA 4ZCMA 4WY8A 4LIPD 1FP7A 3I3NA 2HR2A 4TM7A 4G41A 2IONA 4LXXA 2ATXA 4MKFA 4RACA 3SD5A 4RKYA 3LEWA 5EXDA 1Y1KE 1N7IA 3EEIA 2VPIA 2YZGA 4RO0A 4D9CA 2PVSA 4M1OA 1KVUA 4H6WA 2VHVA 1OOEA 3AOGA 2RHBA 3EF0A 4UARA 4ZARA 1TO6A 3PEEA 2P0AA 1KQNA 4EWLA 3JU3A 3P0FA 2HRBA 2CDBA 4Q4AB 4R51A 1H0HA 5EE5B 3GPIA 5HZHA 1SW6A 4X5OA 2ODAA 1WXQA 2FRVA 4ZEOA 1XLUA 3T5DA 1KOJA 1XRLA 1W87A 2K87A 4N5HX 3R7WB 5IHXA 1F7UA 1P8AA 2CXXA 2PV0A 4I1OB 4DDVA 3JXEA 4EI9A 2H2GA 1J49A 3GPDG 4LDJA 4E5SA 2XCOA 3ZNOA 4IJQA 1J06A 4QU0A 3A14A 4E2ZA 4FX5A 5BSHA 3OBBA 4TTAA 4KLNA 3FUMA 4AZSA 4OAOA 4X3CA 2EHDA 3WTBA 3W5VA 1WMBA 1ZBQA 2ZYDA 5HFAA 4CPDA 4F5EA 1W52X 4RNDB 1HTWA 5DYNA 3WNDA 3DLBA 1C9DB 1DNPA 4QWWA 3K4HA 4A23A 1NVVQ 4J49A 4YMWA 2FXIA 2UUAB 4QDOA 4DT1A 1T6NA 3Q5EA 2BGTA 1LW6E 5IBRA 4AKGA 3LU1A 2RG7A 1CUXA 4RXMA 3REQB 1EK0A 5HKKD 3QY0A 4H16A 3AHGA 4B84A 1DIHA 4DBZA 5J2UF 1XC7A 1C9MA 4L3OA 3QX3A 3RVDA 3TQQA 4ZYUA 1L7NA 1OFVA 2O0LA 2PLRA 2PD4A 1N57A 1DX4A 1XVVA 1L7OA 3ICOA 3MRSA 2ZR8A 4D41A 4JU9A 5F2KA 3FYUB 4K46A 2QXTA 5LQUA 1NW7A 1TEZA 2PGXA 2VRCA 4S0XA 1K1AA 2J3JA 5K4AA 5ADHA 3RVQA 1KYZA 4FLFA 5KU1A 1V11A 2GK3A 1IL0A 5KIAA 2QRLA 4WKPA 1C4WA 5JNUA 3PX2A 3RCBA 3VI3B 1P5ZB 2G9NA 4W7SA 1BE0A 4BB5A 2WJ3A 4OA8A 2A92A 2VI5A 3RO3A 4HX9A 1AXRA 3EGIA 4XD2A 4UU1A 1JKXA 2GSWA 2V4ZA 3K32A 5A7FA 1A5ZA 1Z88A 3E0XA 2XQGA 4DMMA 3PNOA 5JD6A 1CY7A 1E7UA 1L4NA 2JVJA 1W49A 5DCLA 5EHIA 4DIDA 2YXNA 4HNAB 2BEUB 1UP4A 4NOJA 2D8AA 3G3EA 3DO8A 4TQUS 4LF7B 4WXEA 1YA6A 3U9SA 1V5FA 3AU8A 3L13A 3T9AA 1OXBB 2KBXA 3K5HA 2HYDA 3ASNE 2PU7A 2O1SA 5DXJA 4TWIA 1FFXB 1JSZA 2UV8A 3NZUA 3LNCA 2Y8EA 3TQHA 3EULA 4DQLA 5C18A 3TRDA 2YWBA 3UK7A 2F43A 5TQ2A 5AW1A 2E4ZA 1CUAA 4PIPA 3MGCA 4OKNA 1EM6A 4F2PA 1C4XA 1BU5A 2XUZA 3IJEB 3ETEA 3JAWB 4PBRA 1NSTA 3WY9A 3G0IA 1CVIA 4MEBA 4DCVA 4JXKA 2X0JA 4QDUA 1URPA 1BYIA 3WBFA 3WO1A 2BT4A 2AUTA 5FBKA 2L69A 1U1FA 2I6UA 3R41A 1AJEA 2E4AA 1OCZE 1V8PA 4QVGA 2R85A 1QHSA 3QB2A 5JH7A 1Z8HA 3ZYMA 5I9BA 5B7QA 3B5JA 2HMVA 1EK6A 1G3RA 1SA4A 5TDHA 4EHIA 5L4NA 2Y67A 4ESEA 2ZAGA 4I50A 1NG1A 3FR7A 5KQMA 1RYBA 1UJBA 2QJTA 3SQVA 3CT4A 3HWWA 1Y7TA 2XENA 5EE3A 4HXYA 3UBMA 1O9GA 4EBFA 4KG7A 4XWWA 3FGZA 1K97A 1PI3A 4F1KA 5ELXA 2XNKA 4NRHB 4Q93A 3HG0D 4XYMA 4U2GA 4MAMA 4URFA 4MR8B 4X1YB 5B53A 3Q0EA 2Z58A 5JRDS 1IPEA 1OFUX 1J4AA 1PZXA 3NORA 3Q12A 4YJHB 4D3YA 5DXFA 1ULUA 5J2TB 4BKPA 2UVPA 4BBJA 3D8HA 3K70D 5TV2A 2WJIA 4CNQA 5SICE 1FCHA 3BWVA 4HWSA 4WE3A 4NBLA 2IW1A 3RIMA 4A0SA 3L82A 3Q7TA 4NCJA 1EGMB 1G4HA 2V5UA 1OBHA 2V7QD 3KX2A 4P9NA 3VO8A 1RYYA 2H57A 5FYDA 3W6OA 4Z49A 2VT7A 2OZPA 4YRLA 9LDTA 1QFJA 1KWKA 2J0VA 2GZHA 1WG8A 3UPUA 1W47A 3EIWA 4EEKA 3DTTA 4PHTA 2FPOA 2OKGA 2WSLA 3GFOA 5CCMA 1V35A 4JP2A 1SR8A 3UAVA 3VYRB 3Q0IA 4C7BA 3AR5A 1XMSA 3LY7A 2QYSA 3E9CA 4NU5A 5C8YB 1WSAA 1S7CA 2H4HA 1ZKMA 4I81A 1PQPA 4CKCB 3NC0C 1KJJA 3HBAA 3LUHA 5FQ7A 2O2XA 1YHNA 3JRNA 3SR0A 1MX1A 3EUAA 2DX7A 1PE0A 2GD6A 2HRDA 1Z37A 2YJ5A 1ONNA 2QNIA 2RGBA 3HFRA 4R1QA 1JDBB 4D9KA 4ENVA 5KWSA 1XMVA 4Q9KA 3PFNA 3V46A 4UBJA 3E9NA 5DHSA 1UP7A 3SHTA 5DU2A 1DMSA 4X7PA 4XIFA 1O95A 3EXHB 5J4VA 2D7DA 1Z8FA 1AURA 5HOEA 1SG9A 2PUJA 2CLLB 3MD0A 4ZOEA 3CZAA 2HMUA 2BM1A 1VSUA 2YNMC 2LKCA 1PGNA 4E5UA 1CRQA 1BC5A 1TADA 2FI1A 4EUKA 1KQPA 1TIBA 4EHKA 3ZVVA 1GGJA 2WPNA 4RD0A 4PCVA 5SZHB 3UAXA 3MKQB 3DUWA 3OZWA 4TL6A 5JFTA 2ABWA 3GOHA 3IXLA 4RJJA 3S27A 2OENG 3ZDFA 1GGFA 2ILRA 4GDFA 1V1JA 1IH8A 2Q3BA 1BDBA 2XYRA 2PZLA 4L8YA 1T8TA 5CYOA 4ZAVA 3LXRA 1PJ3A 1HG2A 2XCCA 4B5KA 5IASA 4AG5A 4Y6GB 3ICQB 1DWPA 5KNGA 1EFCA 4HOSA 4ZGWA 1WVGA 2NU6A 4B4WA 2IUYA 1O6CA 3TUJC 4EO4A 1KMMA 7REQB 1KL7A 2BHLA 3EHDA 5GJCA 4AYTA 3LX5A 1K5PA 3AWIA 4I50F 4JW1A 1JEYB 3UGKA 4QT4A 5BN3B 2NP7A 4NJOA 3K1JA 3CO0S 4OB6A 4UBOA 1KORA 1Z07A 4GEKA 4WESA 4BQNA 1F8FA 4Y6PA 3QVTA 4BIIA 5AJDA 4AOFA 2X6QA 1UKAA 3BWCA 2YWXA 3D4LA 4WWHA 5LX8A 4I5DA 3WGTA 5INTA 3ZX5A 1NVDA 4EVRA 4GU5A 2GEVA 3T7JA 1FBNA 4CV3A 5CDUA 3DHWC 3R2JA 3TAXA 4GI2A 3ZFWA 1YZNA 2PUCA 2IDMA 2VDNB 3UJCA 5F3WB 2BEVB 2VF8A 4DR7B 3MS4A 2UVPB 5CT8A 1XGWA 3HB1A 4EJFA 5JH7B 3FOCA 3O21A 1UXKA 4I1AA 2CXQA 2ZYVX 4LHWA 4EUFA 3KTOA 4BN4A 3CLSD 1OBCA 1MO6A 2B2CA 5HDQA 3UHFA 3N59A 2B37A 4GM4A 1JA0A 5TGZA 4RSHA 4EGQA 5IKPA 1KYQA 2R87A 2NYJA 4MS3A 3I62A 5A4DA 1QANA 2K2QB 3UIOC 2CK3A 3I6MA 1ZMTA 3LMKA 1GZSA 3LIIA 1JWBB 1E4VA 2JJ2D 2FWPA 3D1JA 2FHSA 3MJEA 5L9AA 3GLVA 2EYQA 4IFEA 5KTRA 2UYCA 4R1SA 2QUKA 3MXOA 1GDHA 2E4XA 2ZWOA 4IX1A 1FQWA 2VSNA 4M8NE 3MF4A 1D7OA 1Q1NA 4NV3A 3N8GA 4QQKA 1BGWA 1S7GA 3AEZA 3W1WA 4M98A 4WHMA 4RK1A 5C37A 3BFJA 1DB3A 4BUZA 5JECA 2F64A 5TIIA 1PCXA 2QJRA 3A9SA 3K6KA 5SZJA 3EGDA 5CB0A 1GM5A 4LNUD 5IN4A 3JVUA 5KAMA 2B4RO 1EM8B 4OF4A 2HREA 1NI1A 1P7WA 2XAUA 2YN2A 2CFRA 4YP5A 3VZPA 2YV1A 3ZY2A 5CJJA 1JALA 2HO4A 1KARA 5LVAA 2ZETA 3ILHA 2P9LG 3ZRHA 1QXSA 4F72A 1QPBA 3Q79A 1T91A 5C1PA 5AHWA 2XZDG 5CRUA 2O0KA 2VYFA 1KIMA 5KYUB 1JA1A 4F7AA 3RIBA 3COYA 4N0QA 4TXLA 4DDWA 2XADA 4CQNA 1NSYA 4BKRA 3K9QO 1FTGA 2YBEA 3HDXA 3Q7EA 4BZZA 4J8YA 1VCMA 1COWA 1WCYA 3AKZA 1MA3A 3OU2A 2VQEB 4C48B 3MJRA 4MUKA 4G8KA 1M3SA 1MJNA 1S1CA 1SHZA 1NMXA 5EZ5A 3VU9B 2BDUA 4ZYTA 2GWRA 5K7SA 2JBAB 1Z3CA 1V9LA 4WI1A 2Q1YA 4IMRA 4IDBA 4BMOB 5B36A 2K4MA 2P9ZA 2V7XA 4Z7JA 1ZCZA 1GVHA 5LM3A 3SLKA 1NWHA 4OQPA 1YSCA 3FB1A 3FTNA 4ZMRA 3CXUA 1GY8A 1NBHA 3PKJA 3P9PA 3Q10A 4N8SA 2FYTA 4XDHA 5THXA 1Y4UA 4RSRA 3WIOA 2ZB3A 4F9GA 1YV9A 4JSYA 4HN9A 4LMBA 5H8WA 1RWMA 1EDBA 1LRJA 1ZC4A 3F3SA 2R02A 3TEJA 5EFOA 1WF6A 5J2TF 4QYMA 3KQHA 1RJ9A 3GRZA 4MJ7A 4PC2A 4HQRA 5JFOA 4D10C 3B3GA 1NVUQ 3LVFO 4GYKA 4TUUA 4DPRA 4RK4A 1K27A 3C7CB 1IJFA 2FRXA 4NQ0A 2NSYA 3WLEA 1NQOA 4M7CA 2PA0A 4ON9A 5IZCA 3Q78A 4O4LA 2G9VA 5FBQB 1ZPDA 1H4TA 1N6LA 2OLJA 3ITNA 3HE3A 3EEFA 4HN4B 3ZJ5A 1XRNA 3FMGA 1AHNA 2V6MA 3KQLA 1NXPA 2V7TA 1M8JA 3IKMB 4NYJR 4ID9A 3TFOA 2ZTSA 5EZSA 2IYQA 2JFXA 5JC8A 2IDZA 1KPHA 3IVCA 3QV2A 3TLJA 3RG8A 1ENOA 1BH6A 2W2LD 3ODGA 3RVOA 3TE6A 1SKYB 4M1MA 4D9JA 3PXBA 3CR7A 4RDIA 1DJQA 1G5FA 2LUOA 3HN2A 4IV0A 2XA1A 1SIOA 4ITRC 2HPHA 1U8AA 5THKA 4BX3A 2SKDA 3HCEA 5ALZA 1WMAA 3EZXA 4I1UA 1U8XX 3C5VA 4QEZA 5G41A 5ICEA 4XTRA 4FMDF 1TU4A 2G36A 2SECE 1J5PA 3PFGA 3PHLA 1MAWA 1GTG1 2IDKA 1JCQA 1KERA 4Y67A 4HJXA 5U4QA 1AT1A 3ZV3A 1FS6A 1V7QA 1FX1A 2BKAA 2P65A 3HYTA 4LBYA 5AXBA 3U40A 1YDHA 2JGKA 3UGJA 1E96B 4TXPA 2DSTA 4XGIA 1VRVA 4IWXA 3KKKA 4CTJA 1K89A 5IZ4A 5LPNA 3LQFA 4CODB 2ON6A 2I9PA 1IWOA 1H8EA 4XWYA 2QLBA 4RCVA 1BDMA 1J8YF 3MIIA 4G9EA 4RANA 3KEMA 1MQ9A 1KZ4A 2IOYA 1MFZA 2P3SA 2WBLC 1XE3A 3BA1A 3DZHA 3T4PA 3TNLA 1K98A 1Q17A 1HV8A 2OILA 2VYVA 3ASYA 3ONVA 2PKQO 3I53A 2J31A 3LCRA 4FNGA 4BP3A 2GJAA 1KNQA 3Q88A 3SIRA 4NONA 2FR0A 3BAZA 2OUKA 5LLSA 1C0KA 4H60A 2CVZA 4YJHA 5ES3A 1HQKA 1M0SA 3EIQC 5JJ6A 1M34A 2H4XA 2GN1A 3KPYA 3M6VA 3NT5A 5LQJA 2KZTA 5IJ9A 3QFCA 3SYLA 5IVDA 5ALWA 2NVUA 1WBBA 4Z9YA 5FIUA 2XOXA 2BBSA 1N11A 2AG1A 1P19A 2WF8A 1QR2A 3T3EA 3EGOA 1VB5A 3FNGA 3ORSA 5B55A 4BB6A 3EBLA 1QQAA 3SBOA 1Q15A 4ACBA 2YHUA 3BRCA 3NBNB 1QGOA 2IPMA 4JXXA 4JJIA 1NQTA 4BETA 2TSYB 4IVRA 4KKVA 4ECEA 1Y5LA 1R6UA 3EZ9A 4MB2A 4R8MA 2IY9A 2BR5A 4B6GA 5IDWA 4IGAA 1H4SA 1CUDA 3CHYA 3B38A 1YZVA 2HJVA 3PE3A 5FOWA 3FUEA 5JCOC 4GKKB 1S2OA 3U7QA 2XPIA 3I9V6 1AWCB 5KHLB 2O3QA 4DAEA 1FPMA 2PAFA 2W71A 2FPGA 1D1TA 4QYWA 4B40A 1E99A 1SEPA 2JIPA 1SOAA 5BUZA 2AF3C 2H3EA 1GLVA 2O1XA 4QNNA 3S2SA 4R4JA 3ANTA 4B6QA 2MHKA 4DSAA 2F43B 3O84A 4M7WA 1AUPA 3TN7A 2AOUB 3LFUA 1JBKA 4R0NA 1GTZA 3GF4A 3I37X 2GOYA 1ZSVA 3FTSA 3OZRA 4B4DA 3SQWA 1F6BA 2X3FA 4QTUB 4BERA 3AKCA 1FDOA 1V25A 2CZCA 2FSFA 2HHCA 4HAZA 5HRUA 4UCXA 3DTYA 3NP9A 3HU3A 2B8NA 4F53A 2JC3A 4WXPA 3C5RA 3GDFA 2ONJA 4ANFA 3TJPA 2FPPA 2SKEA 2VLIA 4MX8A 5A4AA 2GROB 1U8ZA 2JGJA 1E8NA 3UAOA 3EISA 5E7MA 2DR0A 2X0KA 1S9DA 3SJZA 4QU8A 1EAYA 4UTOA 3T1YB 1FP6A 3AEKA 1FPQA 5PGMA 3H1GA 1X1AA 1FYDA 1YUMA 4FSXA 3JSXA 5CCLA 1TQHA 3B82A 1YT5A 3AJDA 3HDQA 3L8YA 1VI2A 1XCPA 1LPPA 1Z6YA 4G07A 4QT0A 5JMPA 5KVQA 1V5IA 4EFDA 1ZC3A 4OQXA 5EAIA 3MK31 3IFSA 4DLUA 4WLNA 2N42A 1NM5A 4AF7A 4BUJA 1PS0A 4S1OA 1MABB 3VC1A 2BHSA 2Q4RA 4J4HA 3KETA 4GKBA 3GIWA 1IY1A 1TL7C 3GD7A 3U3OA 1FFCA 2B92A 5TF4A 5BV2P 5G40A 3COPA 1GRRA 1NYRA 2JJMA 1JDTA 1UKYA 13PKA 2W22A 2WOOA 2J0UB 3HB9A 3MINA 2CFOA 1CE8A 5DTIA 3CK7A 2GI4A 1KDZA 4FR5A 2ZM5A 2Z3VA 1L5QA 1YMVA 2FTKE 3M83A 1PDOA 3WWPA 1Q0SA 1QLJA 4UWGA 2AE1A 5FF9A 4FOPA 3ZHZA 3NNDA 4B71A 2FI7A 1WDYA 3NYIA 4R2KA 3I45A 3OCYA 3NFRA 4C6HA 3AHIA 3CVPA 1IWPB 1U02A 4HNSA 1RLTA 4RKQA 1UJMA 3GCWA 3GJ7A 1C29B 1UR5A 2V4HC 4N7JA 4PLYA 5ALRA 4YGXB 3ZIAA 5EN4A 1A9QA 2G9UA 4Q9AA 1IY8A 2FPIA 2QD5A 1HNZB 1AXGA 4OJMX 3BXFA 1Z28A 1DQSA 1P0MA 1T0JB 4Z4GA 4Q00A 2PNNA 1N9ZA 1NLUA 1WW2A 1IK6A 3Q3HA 3W7VA 5FTKA 2A57A 1XCBA 4LAFA 2V55B 1KO7A 3DV0B 1CBUA 1MEEA 2W2QA 3P9YA 3PPIA 4ZCQA 1DLJA 2NVOA 2XXJA 4LOAA 1TJYA 2V65A 2HZBA 1MCZA 3HO8A 2Q1TA 3RC3A 4AB1A 4NHOA 4FB5A 1UFVA 3OOEA 4L4YA 4KZKA 1KY3A 3JALB 1RI5A 3ESAA 4Q7EA 1TW3A 3H5RA 3IIMA 3HXDA 1DPFA 2O3TA 3O1LA 1E0AA 3CRQA 3MBKA 1ULHA 2IYSA 3KVNA 4PQGA 2D2VA 4XJTA 4JQYA 10MHA 4ND5A 1RLJA 3LPNA 3L8CA 2DQ4A 2YH2A 3K92A 5IT4A 4PS1A 4Q69A 1N6RA 4FXPA 4GNKA 4Z9FA 2QLJA 3BIXA 5K0JA 4FCCA 1WY7A 4YRFA 2RGRA 3KQPA 3WISA 3RT9A 4APFA 1W44A 2FA9A 3GJRA 3RC8A 1Z62A 2IEIA 2VJNA 4IZHA 3C43A 4UUPA 1I3LA 1YVPA 1XTJA 2JAOA 3BICA 1OILA 4F4UA 1DIOB 4J0IA 2V7UA 1TB4A 1YJQA 3L4EA 2IV3A 4Z9BA 3E35A 1PNRA 3KUCA 1DU4A 3BQOA 2G4VA 1KP2A 2JIZD 3AFNA 3NTLA 3WGUA 3NHWA 1DL5A 4YDOA 3AUSA 3NTRA 4PZUA 4UTZA 1GPH1 2ZIRA 2H52A 1AS2A 3QKIA 4JR0A 1RWXA 4FMDB 1I3NA 2IHUA 2AHOA 2ONZA 4GMXA 5CJ2A 5L95A 5LJIA 5AM5A 1VOTA 3MCXA 2XVZA 4DSZA 1TW2A 5CG1A 3FLAA 4GLFA 3UB3A 3U9TA 3KSBC 3GZNA 3W7AA 5EKSA 2PQ0A 4ARUA 4MHSA 1Q6ZA 1JECA 3CE6A 3L7YA 1ZFNA 5DN6A 1I33A 3ICVA 4JH0A 4MMXB 4NL4H 4M46A 3RUAA 3T1HB 5EJ8A 4JLVA 1ZUWA 4LV5B 4W6QA 4ETNA 4CLOB 4XVCA 3GT4A 5D0QD 1KBOA 1XTUA 4YI5A 1R8QA 4CIWA 3AF6A 1XD2B 3QVSA 3EMDA 2VGXA 3OD5A 1FMCA 1SUFA 2V45A 2ZBPA 3G7SA 1E2FA 3G49A 1L7EA 3B8HA 5DBGA 3WLPA 1HMYA 1Q1QA 3L16A 2HRRA 2XDQB 1JIIA 3NM4A 1ADCA 1NBME 2XAAA 4CR6A 1X0XA 2WIFA 1I5EA 2W48A 4KAJA 5ARGA 2OCLA 4JB2A 4JLUA 1DZIA 1N2CB 4M36A 2QXYA 2CMKA 1JYEA 4RS3A 4XJXA 3AWDA 3T9KA 4H4EA 4P0QB 4K6OA 1BMFD 3RTGA 4GXTA 3NBMA 4DNXA 3NVDA 4HBDA 2IHJA 1DIRA 1W75A 1K1EA 2V5VA 2PSEA 3V55A 4ECAA 1H3EA 2ZE8A 1M7GA 3RRYA 2WMYA 1Q91A 1QYDA 5J40A 2WU0A 4ZEXA 2I80A 4RSGA 5ESDA 4DN6A 1GU0A 1A17A 1GLNA 1EFUA 1Y6JA 5K0ZA 4LJYA 4OXQA 3L84A 1RTKA 3UAWA 2EOAA 4LYJA 1VHJA 3DMTC 3K6JA 2ZPAA 1BLXB 3R6TA 4D02A 3UN1A 4R7LA 1CTQA 5FV7A 3ZE6A 4BO0A 1IJEA 1V48A 2RB5A 1KJ8A 1U4SA 4XKCA 1BQEA 2FW6A 3HXFA 3VRHA 1YRWA 1X1QA 4BZQA 2GS9A 3IP8A 1LDGA 4MGZR 5TX7A 4AP6A 1KAGA 1P1JA 1TZCA 3NVMB 2OHFA 1A76A 3TTYA 1I4LD 2VQSA 5C51B 4W1RA 5ALOA 2VPYA 3VTZA 2KM1A 3ORQA 4BBPA 1WHTB 3CZ9A 5BSMA 1SUIA 3R7QA 1JRLA 2QJOA 4PXSA 1ZRHA 3HRIA 2RGAA 1AKMA 1EXNA 2E87A 3CX4A 4PV7A 1SHJA 4U8GA 3X1XA 4JD5A 2I91A 3E15A 2DY1A 3K0AA 4MBGA 1WPXA 4MLPA 3CVWA 4MV6A 4Y18A 5LZ5A 3WGHA 2MMGA 4EI7A 4PYRA 1W0JD 3DDSA 4M9ZA 3TZCA 2A3NA 2OXFA 1FLAA 4HFNA 4R54A 3WL6A 4BNDB 2H4JA 3LUGA 4WCFA 2NC9A 3NDIA 4YJFB 4XQ9A 4KPUA 1T2NA 4UBKA 1I4WA 4LJAA 4M0KA 3MHPA 2X6HA 3N58A 3SFZA 1WNTA 1FDTA 2ATVA 2GRAA 4NDZA 4PR3A 4EA9A 4L9WA 4DMRA 1QP7A 4OFWA 4E51A 2IY8A 3T1NA 3KPUA 2IIPA 3CO5A 3Q87B 1V37A 2L42A 4ENSA 5DI3A 4U2DA 3T8YA 3EWAA 4BRUA 1N54A 2X40A 5FWNA 2WU3A 2NADA 4HRVA 2EQAA 1X1BA 4YRQA 1BXKA 4A9AA 3AESB 5FWQA 1U2RA 2NNWB 5B3JA 2MYUA 4R8VA 3KFLA 1ISGA 4O6FA 1EX1A 5DBFA 1THTA 1D03A 3HZOA 1MDFA 3FGNA 1EFRA 2WJJA 3PSAA 4YDRA 5IJ0A 1S0PA 1MD9A 5LSAA 2XE8A 4MS4B 5HQ3B 1RAEA 3MTAA 4MLCA 1ZD2P 2BMEA 2VHEA 3L7IA 4JVOA 4E5DA 4IF4A 3ESLA 3NIFB 4Y2UA 3DFIA 3P45A 4UZFA 5I47A 3VKVA 5IJ9B 2C88A 4KEAA 1PHRA 3O92A 4JAVC 3DZCA 4JR2A 2BHNA 4LISA 4OAQA 5BXQC 2YWJA 1G17A 2QTMA 1RNLA 1PJ2A 3OJ0A 3QYPA 3Q7AA 3I04A 1KHTA 1AS0A 3ITKA 3SBDA 3T52A 4F3CA 3K0FB 4OTZA 3DNFA 5CVVA 4ZVNA 3E23A 1R0CA 1ZCBA 5EXEA 1L6IA 3X1DA 3B78A 5FBWB 1Q22A 5AKHA 5CK4A 3VKUA 5IANA 4K6HA 1CF9A 1KZ1A 1M1YE 1C30B 2CEKA 3E9RA 3PUWA 2FE4A 4IOMA 5AJTA 3T7CA 3TW6A 4CKYA 1DG3A 1GUBA 3G0CA 1XJ0A 4HB0A 1P4RA 3NKLA 4GOLD 4KVFA 5JPCA 1YVEI 3VR3A 1NQAO 2G1UA 2MTBA 1NULA 3PJRA 3HLYA 2EL9A 4RQIA 4FU0A 3CCBA 4IIEA 1S4MA 5KINB 3GDOA 1A2OA 1K6JA 2JDID 3AY0A 2GMWA 2CCJA 3SGHA 4B8CB 3UO8B 3W3AD 5I9TA 5HUQA 2IBMA 4YAOA 1CDOA 2QVZX 2LSUA 4XQ0A 5EWMB 4JVLA 1GT6A 1OJ7A 2V4UA 1PQ4A 4XEIG 4COOA 1WB9A 3GLGA 4IICA 4WVFA 4Z99A 1ABFA 3CHRA 3E2MA 3HKDB 3L4BC 1O87A 1UP6A 4PZAA 2PBZA 1SRRA 2IV7A 1K06A 3MB8A 2VP0A 2RH9B 1AF7A 3IS3A 2ZSHA 2PD6A 8GPBA 2VP9A 3UC9A 1HDCA 2RONA 3DHVA 4RPIA 4HQ6A 3OZVA 3NDPA 1MAUA 4D4MA 4OQYA 1ATZA 3EJNA 4L73A 2NQTA 4IFTA 1A8HA 4ZZIA 5HQJA 1H8ED 1BRMA 1W9MA 2JFWA 3QWPA 3BIOA 3RRMA 1YKGA 1F2TA 3CEPB 3GEIA 4CUKA 1UFRA 3KELA 2B5VA 2HCFA 1RJ9B 3G5LA 4EHLA 5JATA 1Q12A 2E7ZA 5ALMA 4AV7A 1WZIA 1L5LA 5A1TA 1G16A 1G9XA 2RCNA 3DT6A 5TC4A 2HF9A 1SOMA 2X8JA 4KPUB 5F7JA 4DKJA 1G6OA 3A1DA 3PSHA 4K7JA 1V3QE 4QASA 2QMZA 1QIDA 1BW9A 3LT4A 4JITA 5KQLA 4AJHA 3LXUX 4XUEA 4HJRA 1ARZA 2W7TA 1TCAA 2WUGA 4QA9A 1KMHB 4ZDWA 1N25A 2V7VA 2R6R1 3NIGB 2Q7OE 2E1RA 3GBSA 3TXAA 3TWWA 1W30A 3G2QA 3ROZA 4FGJA 3O82A 1M34E 5I8PA 1O4VA 5K3FA 4WKOA 3LKVA 4BKMA 1E9CA 2AOWA 2QJWA 1UEXC 2YJGA 3CGWA 3G2MA 2AXPA 3HMQA 4FYYA 1M1NB 4LMPA 1JPJA 2OXEA 1E1QA 3CNEA 2DWUA 1XCOA 2B1JA 4BT9A 2VS1A 1RZUA 2AN3A 2H5EA 3EXIB 3I83A 3I9NA 5IW8A 4QDJA 1HFAA 1RI4A 4PG4A 2CDCA 4ZJUA 3N86A 2JVKA 2LCIA 3CVVA 4RAOA 5ECWA 5KYKA 1WKVA 4IJKA 2WVGA 3KQUA 3L9TA 3P9XA 1Q1BA 3OSZA 3RROA 1J9ZA 1X7WB 3EPRA 5AJWA 3TL3A 4ENQA 2JLZA 1P62B 5JXGA 2PE5A 3PJGA 5B3KA 4LA4A 1OI7A 4GM0A 3BL5A 3AVTA 2OBFA 1EWQA 4GPIB 3DDWA 1Q77A 4Q66C 3MA0A 5D00A 5DHFA 2FZVA 5F35A 4BNTA 3Q47B 2QUZA 1NXWA 3WG7E 3TAUA 5DGHA 2A94A 2ZUWA 1I7PA 3T41A 3L07A 3THYB 4B3BA 5D84A 4Z4FA 3ANNA 3PNBA 1QHFA 1Z0JA 4OGWA 3IIKA 1XK6A 4B0PA 4C0KA 4DSNA 4K9MA 2LAHA 5LBIA 3GFFA 2ASEA 3DS8A 2Y0CA 1Y5NA 3G0OA 4LI3X 2Z8ZA 3DEHA