4I6EA

A vertebrate cryptochrome
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
490
structure length
471
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQEDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKANANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Cryptochrome-2
total genus 156
structure length 471
sequence length 490
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6eA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6eA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6eA01
3IVGA 4MUNA 1EJ2A 4RPIA 3K9WA 2NSYA 2QUIA 2R5WA 1LI7A 1TFUA 3TNJA 2QUKA 3TZEA 1VBMA 1Q77A 3CLRC 5TEWA 3HFJA 4OUDB 4GU5A 1PFYA 1TYAE 1WKBA 1VBNA 5J58A 2X1MA 5IJXA 1KH1A 4MUFA 4MWBA 1T9GS 5TEVA 1DNPA 3LOQA 3MUEA 2YWBA 3FH0A 2IELA 1V47A 3U1VA 4WNYA 3RJZA 4Q16A 1J09A 4OUDA 1ULHA 2PXHA 3CLSC 1JZQA 3ZXIA 4MWEA 1FFYA 1GZUA 3CR8A 2CYBA 2D54A 2ZP1A 4NAHA 5FO1A 4I6EA 2WQ6A 1N1DA 2I1LA 2AKEA 1NUTA 2E0IA 1IH8A 2PZBA 4MW0A 1ZH0A 3A4IA 4MW7A 1KAMA 1MC1A 3CLSD 1JIJA 3DO8A 1H3EA 3TQIA 1N77A 2CV2A 2X3FA 3UOWA 2C5SA 1QJCA 1GTSA 1Y42X 1I2DA 1YI8A 4MW4A 1IQ0A 1JIIA 1N78A 1RQGA 3FNRA 4MW5A 3IMCA 3PNBA 4TS1A 4HJRA 3RK1A 3AKZA 2X0KA 1IFXA 4MUHA 1KKUA 3CLRD 1KP2A 1TQ8A 4QBTA 1IVSA 2PIDA 3CVYA 1O0BA 1J20A 4WSOA 2J08A 3Q12A 2J09A 1WXGA 2QTNA 4DJAA 1MOPA 2DERA 1ZH6A 4ZCSA 1T6XA 2CYAA 3P0JA 5BNZA 4GRIA 1JIKA 1Q19A 4DNXA 3DLAA 3FG9A 4MUJA 2GOYA 1F9AA 3BL5A 3GMIA 1OWMA 5H7XA 1U7XA 2HZ7A 2A7XA 2BYTA 1ZJWA 3G5AA 4MULA 3RBAA 5K0SA 3MLAA 2VTBA 4EG6A 4JZYA 1TEZA 1O0CA 2RD2A 3JXEA 3TZLA 2PG3A 3AIIA 1G8FA 3AG5A 4MVWA 3VRHA 1NZJA 3VU8A 3KT3A 3Q4GA 3ZUGA 1D2RA 4NAUA 1H1TA 1COZA 3FHJA 1B6TA 3P52A 4ZT2A 2IP1A 3HZRA 1XNGA 4G6ZA 2CUZA 4ZT3A 4H3SA 4HK4A 3K32A 3KT8A 1O94D 1OBHA 3COWA 3M5WA 4X0EA 5KWVA 1ILEA 1N75A 3N2YA 2A1UB 2QTMA 2AG6A 1QTQA 3GLVA 5DK4A 1NUUA 3DV2A 1EFPB 5K0TA 1K4KA 4QREA 4L2IB 1EUQA 2CSXA 2PZAA 2WQ7A 2WB2A 3IOEA 2EL7A 4MUIA 1Q15A 3KFLA 2TS1A 3A05A 4ZT7A 4PBTA 2D5BA 3ISJA 1U7DA 4NZPA 2A1TR 1KQOA 4CDMA 2Z3VA 3TS1A 3X1JA 1R6UA 3IVXA 4YBRA 2PFSA 3CA8A 1KR2A 4ZT6A 1GAXA 5LFAA 1VLHA 3IUEA 4XFDA 3IOCA 3DPIA 1YIAA 4JFAA 5H16A 3N8HA 4DLPA 4BWVA 1M1ZA 4EG7A 1NI5A 3CLUC 3IOBA 3HMQA 1T9GR 2IJGX 2XRYA 1LI5A 4J76A 1QU3A 1O95C 1G8HA 1X8XA 1MB9A 1NUQA 5J5AA 4U63A 1N3LA 4YMIA 2E21A 1EUYA 1IQRA 1O96B 1EE1A 1PFWA 2Z09A 1JGTA 4I6JA 1J21A 4PBRA 1WXEA 5HUHA 4OJMX 1GPMA 5FNZA 3SEZA 2CFOA 4G5FA 1J1UA 3CVUA 3KT0A 3COZA 1MAWA 1MB2A 2B7LA 2V0GA 5AHWA 3IODA 3H05A 2QJOA 1U0BB 1OBCA 3PXUA 4YP6A 3L92A 2A1UA 4MW1A 4KR7A 2A84A 3S3TA 3IH5A 2ZUFA 4MUGA 3FI0A 3SZGA 2YXNA 2QJTA 4DDKA 4EGAA 3UC5A 1O6BA 1YUNA 2JANA 1NP7A 1FYDA 1QNFA 3VGJA 2YY5A 4E1AA 1R6TA 5F23A 3I05A 2A1TS 3LE8A 4CQNA 2GM3A 5EKDA 1HYBA 1OWNA 1YIDA 2VXOA 4MWCA 4F3RA 1O5TA 1M8KA 4ZT4A 5DASA 1N2BA 4KPUA 4EG5A 1JMVA 3Q10A 1JEDA 4EG4A 3NV7A 3ZJVA 1H3FA 3P0IA 2D13A 3AFHA 4KR6A 1JECA 1NURA 1MAUA 5LM3A 1R6XA 1NUPA 1XJQA 1XNJA 2WSIA 3X1KA 1WJGA 1IHOA 3FDXA 3L93A 4K03A 4XFJA 1IRXA 1WXHA 1JHDA 1M8FA 5TS2A 2NZ2A 3LCJA 4U8HA 4MWDA 1G8GA 2DLCX 1A8HA 4MVCA 2CT8A 4G5YA 2QTRA 1N2OA 4MLPA 1QRSA 4ARIA 3COYA 5LLTA 2DPLA 4ND6A 3AG6A 2Z08A 2DETA 2J4DA 3ZJUA 1GLNA 4PBSA 3PNVA 4S1OA 3SDBA 1WQ4A 2A88A 4HJXA 1PG2A 4R2MA 3IMGA 1F7VA 4MVYA 3SP1A 3PRHA 3HGMA 4EF6A 1KORA 2GKSA 2JA2A 3CVWA 3H9CA 5IHXA 4J75A 3SEQA 4MW9A 3ELBA 3INNA 3CVVA 4KKVA 3TQOA 3NBAA 4NATA 1TYDE 3ZGZA 3QTBA 2DEUA 3ZXSA 1YULA 2PZ8A 1OWLA 1WZ2A 1PFVA 3C8ZA 1K4MA 4KR9A 2CV0A 4MW6A 1N2HA 1M8PA 1NYLA 4F4HA 4MW2A 3FY4A 1OWOA 4K0RA 1XNHA 3MXTA 1U3CA 2O8VA 2X1LA 4AQ7A 2BTEA 4RUKA 1P7PA 1J1ZA 1VBKA 3H9BA 1N2GA 3FOCA 3GUZA 5FO0A 3UY4A 1CT9A 4QRDA 3SYTA 3CLUD 2XRZA 3OTWA 4R0NA 4R2LA 4PY2A 2OQ2A 4ND7A 3PNYA 1O95D 1VL2A 1I6KA 3F3MA 3NBKA 3ZIUA 3P0HA 5DB4A 1EXDA 3COVA 4MVXA 4FZJA 2OV4A 4DDMA 1MJHA 5DEOA 3A04A 3ND7A 3A2KA 4MUEA 3KT6A 1T6ZA 1O94C 3HL4A 3SZ3A 3HV0A 4JXXA 1GN8A 1OD6A 5J59A 3N9IA 1GTRA 5JBNA 1EFVB 3H97A 5TGTA 4HPWA 3IUBA 1JZSA 4NX2A 4CDNA 2H29A 3IMEA 2JAXA 3D6VA 3G6KA 2DUMA 1M8JA 2YWCA 3RFFA 3MMXA 1TYBE 4ARCA 1G59A 4UZEA 4ZCTA 1YUMA 3E27A 2E89A 2J5BA 2HMAA 1WXIA 2ZUEA 4ZT5A 1OWPA 1WOYA 1EFPA 2O5RA 3ZJTA 1H3NA 2CV1A 2HGZA 1I6LA 3FETA 4YP5A 1ZUNA 4EG1A 1QRUA 3G59A 1QQTA 1K97A 1KQNA 4P2BA 1BS2A 4EG8A 2QJFA 4ZCRA 1MBZA 1M83A 3IDFA 1N2IA 1F7UA 1KAQA 4AS1A 1O97C 1PFUA 4XSVA 3X1MA 1I6MA 4MQ6A 4JXZA 1K92A 5HG0A 4JYZA 3AL0C 3MLBA 2AZXA 3ILVA 1JILA 4ZCPA 3FWKA 4EG3A 1N2EA 3IVCA 1T6YA 4DDHA 2VTBB 2A4MA 1S4MA 4MUKA 3ND5A 1JEEA 1SURA 1UFVA 1O97D 1O96A 4ZCQA 2QUHA 4Q93A 3QTTA 1TYCA 3H99A 2J07A 1NSYA 3RHSA 1NUSA 1M8GA 2EJCA 1X6VA 2V0CA 1LW7A 4CT0A 4EFKA 4YP7A 4U7JA 1IQUA 3CLTC 3UMVA 2E18A 5KCMA 1KH2A 5HUJA 5KHAA 1PG0A 4I6GA 1Q11A 1WY5A 3ND6A 1KQPA 2DR2A 1J70A 3N05A 4DE5A 1WXFA 3QE4A 1QRTA 1KP3A 3CLTD 3CVXA 1EFVA 4UZFA 2A86A 3OP1A 4A91A 1F4LA 3FIUA 1QU2A 1WQ3A 2G36A 2CYCA 1U3DA 2H2AA 2DXIA 4KPUB 2RE8A 1N2JA 3UK2A 4NDAA 3RK0A 4L2IA 3D6UA 1MRZA 1KH3A 2QUJA 1V8FA 4MAFA
chains in the Genus database with same CATH superfamily
5EQFA 1KK1A 4JT9A 2OC4A 1TJ5A 5IAJA 3LLMA 2F62A 5EX3A 1M34E 1Y9DA 8GPBA 3R7RA 1R12A 4AAYA 3M2PA 5G05J 4YMWA 4I19A 4HUQB 3A4MA 1O89A 7AT1A 3VV2A 3A6LA 4TN5A 1HDCA 4PRKA 5DSTA 3WGKA 2WK1A 3FCAA 4IGAA 4PXAA 5CFOA 2A6PA 4KKXB 4RHXA 4LVNA 2AVNA 4ZOLF 4YRZA 4R8LA 4BSXA 1NG9A 1LXCA 4MGIR 4F5EA 2C0MA 1V1RB 1OZHA 1PD1A 3QEJA 3VR6A 3FJYA 3G0DA 4EQ6A 4LUNU 3ENEA 2BH9A 4MQFB 4TQGA 3Q7PA 1L8XA 1Z06A 3PE6A 1ENZA 1R5BA 2OOKA 2IELA 3EIQA 1LBEA 3RI3A 3L9TA 3FAKA 5DSZA 2XQJA 3INRA 5TQ2B 1IOZA 3ZD8A 1SA0A 3ZWDA 2Z4TA 1IHDA 1ZP6A 4G4SO 3N8KA 1OF1A 3ROEA 3FRJA 5A0TA 1IY9A 1LEHA 1CR2A 1J1IA 3PL1A 4LYHA 1FBNA 3R7NA 4I6EA 5JAMA 2WQ6A 3FFXA 3V31A 1EFDN 1YI0A 3MELA 1AA6A 3NC4A 4EJSB 3ZHCA 4FUTA 1M2NA 2JKVA 3OPVA 5HMLA 2X3MA 2IEJA 2ZBRA 3CF6R 1ZVQA 4HQNA 3TLBA 4ECEA 4HLNA 1ISMA 1XF1A 4KP7A 3GW4A 2JGDA 3SNKA 3IEMA 3ABKE 4EJSC 1ZW6A 1TE2A 4IKPA 2ZI6A 1QQ6A 2I6TA 2LCFA 3HNPA 3P19A 4TWIA 5CFMA 4LZOA 1Y42X 3I9V6 1L5VA 3H9GA 3K2BA 5JI2E 3BQOA 4UTRA 2VDJA 3A8TA 3RH0A 2HDNB 1U2VG 4MW5A 4LGYA 3OTQA 4MDHA 5AJWA 3L04A 3PS9A 3TNDA 4BB0A 2O2YA 3C3YA 1GAJA 2HHJA 2P1DA 3QBJA 3VQTA 4AKTA 5HS4A 3S2YA 3TPZA 1KKUA 3VJKA 2ESRA 2ODWA 1CDDA 1V54E 2GHQA 4D96A 5HF6A 1J0AA 3HWX1 3SJCA 3MCWA 2GPSA 4PZYA 3WG7E 3GUUA 1SN7A 2GGSA 1ZH6A 1WW8A 4TKMA 4OP3A 5FJYA 1EFCA 3LZCA 3ZY6A 5T3YA 1A2OA 1VGRA 5IANA 4KLAA 1CYEA 2QORA 4W7HA 1EFRD 1CVIA 1F9AA 4R2JA 4I1AA 4DB4A 4JV5B 1AMNA 4Y9RA 1WA5A 3C3MA 4G1CA 5JSYA 2Q1YA 1H65A 3BMNA 2R4TA 3KOMA 2GWRA 3LY8A 4MPRA 5EUCA 1XTTA 5GZ6A 2JFBA 4YDQA 2C8JA 2XWSA 4ZYZA 5ALVA 3LQQA 3DL4A 5L51A 4U00A 1AD2A 1MG5A 1C3OB 2VO1A 2PRZA 1EVQA 2OCXA 1CIVA 4ITUA 1ZGZA 4QU0A 3T5BA 3O8DA 1U4OA 4CMKA 3IESA 4FMDF 3STVA 3ZLVA 1DSSG 1VHTA 2PG3A 1SXHA 2XB4A 3UJCA 4OHUA 2EF1A 2NQ8A 3PNLA 4KRXA 2MDTA 4LS3A 1SAYA 4KQFA 3MWKA 2HWYA 3AUFA 5EKTA 4D9GA 2CVZA 4TYQA 1ZEJA 5EIXA 3LPDA 4LQLA 5B55A 2ID8A 2IYLD 1UR5A 3UT5A 1TYZA 1KFCB 5A5EA 2PUBA 4RADA 3H3XA 5H02A 1MNAA 4X64B 4YJHB 1CVRA 3Q3GE 1SOMA 1IG3A 2ID9A 3AHJA 2HLPA 4Y2SA 5EWLA 5LQRA 1DCTA 2XEXA 3DAPA 3OQNA 5EKUA 4YREA 3UAZA 1DJQA 1Z7EA 2Y1LE 3O0TA 1GPH1 2I3GA 2AOTB 4NPAA 4QREA 3D3NA 1Y0BA 3WYEA 1X1TA 2E4XA 4AB1A 2WQ7A 3EHMA 1T2AA 2D7JA 2PMBA 4EBFA 2PD6A 2PL3A 2YQZA 1DAFA 3CNLA 1B8OA 1Z39A 2QNRA 4XSGA 3REFA 3ZIDA 5IAAA 3CLJA 3TLXA 4IEFB 3JALA 4AICA 1XXHE 2I3AA 2YR0A 2W2NA 4BESA 1P6XA 1WV0A 3GJRA 3T7AA 4F53A 3K0CA 1S89A 1GSHA 3IMKA 3SLKA 2OC9A 4HQFA 4EGQA 5I8WA 3W5CA 4B2IA 2CZQA 4ZPXA 3NUGA 5JI3E 5K4AA 1SKQA 2ZR8A 3LOUA 3SGHA 2NZUG 4NESA 1T1RA 3K0FB 3IBGA 3MCVA 3QWIA 1NW9B 4HEJA 3VUEA 4B7UA 1DHTA 4M46A 1YIAA 2JFUA 3ECSA 4OHPA 3C70A 5KOHB 1AS2A 4UQOA 3P96A 3OC0A 3NTLA 1UL1X 1EWVA 5ITWA 2IGTA 4C20A 1UODA 1T9GR 4HQKA 2OO7A 2Q62A 2OBMA 1T1IA 4GCOA 3KKPA 4HVTA 4RL6A 4EAAA 5TPWB 1IL0A 4RVSA 4KO1S 4M8LA 1UT8A 3D8BA 5U4QA 3ZW7A 1EFAA 1HGXA 2JLUA 1E3SA 3K9CA 4K9OA 4MUBA 4WESA 2IEZA 1W30A 2Q3BA 2YWFA 4GMLA 5CFQA 4OQEA 3CXUA 1C2YA 1R4AA 1IZ0A 2YH2A 1FCHA 5K4HA 2VG8A 2IPXA 3JQDA 1OGIA 1BCRB 2G0NA 2V7EA 5IT9A 1R6BX 3K1TA 2VDKB 1PK7A 2LDBA 5CPFA 3UMBA 3ZVNA 3RS5A 1VIMA 5AKHA 1TAQA 4NJMB 3PXGA 4AP9A 4B81A 3AG4E 1D6JA 4O8ZA 3P0FA 5FV7A 3E8MA 4CM1A 4LJ4A 3HB1A 3LCMA 4MV1A 3AVWA 5EESA 3R2JA 4XX5A 1BS1A 1P91A 1XJCA 3IH5A 5AJYA 2P4EA 4WLFA 3CNEA 4BX2A 3IVMA 4NV0A 4JLOA 3KG2A 3A1FA 5KTTA 5IUKC 3UFBA 2IOFK 5E9WA 2DU8A 1SUSA 1JDSA 4L0CA 2JJ2A 4MI3A 1W6UA 3W7AA 3B7UX 3D4LA 2BTOA 2OBNA 4KH1A 4YJ3A 3HWWA 3P0RA 1YUNA 1M54A 1U99A 3HDVA 1TGYA 5ALOA 4X20B 2FPMA 3FIJA 5FA6A 5DGIA 1Y8QA 2O3TA 2ZQYA 3L4EA 2WJ4A 4E5KA 3C3QA 1QIHA 2VOJA 2BM1A 3U7HB 4UQPA 2YYZA 4DIFA 4KVMA 1H42A 2H2DA 3DMGA 3CBGA 3KQPA 1Z34A 2DHRA 2OV1A 2Y3AA 2CNLA 2VDMB 4WOJA 4V0QA 4A8PA 1RWVA 5BN3B 1CWUA 2FQ1A 3KOOA 4UAGA 2IUTA 2OQVA 1OCOE 3DEFA 3NGLA 1PE0A 1QONA 1F3OA 2DX7A 4KXYA 4GNRA 4C2TA 4NMHA 5GJVC 3ELDA 2R7NA 3GNTA 3PGA1 1LJLA 4D9JA 2GRMA 4BP9A 5FUBA 3F5SA 2BHLA 4WXHA 3CG0A 4CQJA 5DHSA 1J8FA 5DH9A 4OYHA 3D9OA 4B0OA 5DN9A 4HGPA 2AKYA 2WAMA 4OHCA 2K87A 5EWJB 1QAQA 5CIQA 5AXDA 3SPXA 1LFDB 2G70A 5A3JA 1HYGA 2PN1A 1JIVA 1N6LA 4LSZE 1XCPA 5EUQB 3AJIA 3S2FA 4MX8A 4IR7A 2G5TA 2BDTA 4D9HA 1IN4A 3MT8A 1YJCA 2D2IA 2XIQA 5DNWA 4A2CA 2MSDB 2ZIGA 3IBSA 4KHZA 3D3KA 2F2TA 2ZU6A 5DN6D 2ZSBA 1KQFA 1PKEA 4TXNA 1PT6A 1YZ3A 3DHVA 5FJJA 1AK9A 1J2JA 4KRGA 1EK1A 2M1XA 4QSHA 2JGLA 4YRTA 5EWJA 2L6JA 5IK2D 4U7EB 1C1YA 2DIWA 4R3UC 4QHYA 3E70C 4ZTUB 4PINA 3CS3A 1SKUA 3NRCA 3BH0A 3DL0A 1WNFA 4RKFA 4F1JA 3ADDA 2BF4A 3CVNA 3COSA 5J2UF 4E09A 4D26A 2YJ6A 3T5CA 5JV5A 1KDYA 2BKGA 3HR7A 5CITA 5L53A 3SX2A 1KORA 2F64A 1NN1A 3H5TA 4HT3B 5AM3A 6Q21A 5I3ZA 4NZOA 4G0UA 4I0WB 4XE5A 5EA2A 3SE0A 1AGYA 2Q2NA 3EH1A 1NW6A 3HC7A 3MTEA 4JL6A 4Z5XA 2FX3A 2HMSA 3DBOB 3DE1X 4G0PA 5CB8A 4R31A 5H1YA 1K1AA 1WB5A 4IDAA 3ZKWB 3OZCA 2BHNA 3TQOA 3M4XA 3C3EA 3PXBA 4NATA 3FZNA 3T52A 2WF8A 1Y8ZA 5JMWA 3TOZA 1FJ2A 1JLLA 1VIYA 4PLCA 4YRLA 2NU8B 3T7JA 2DR3A 2R87A 1DEAA 4CLOA 3GLKA 2AUMA 2WP0A 5F2NA 5HNKA 4BFWA 4NOKA 3NIGB 2JGNA 2NPIA 4ZVQA 4KR9A 3T0IA 3DBIA 4MVJM 4PU0A 3OFJA 4PX3A 1OA0A 2UVQA 2FBNA 1CQZA 1Z74A 1EM8B 2FA9A 2WUEA 3MXTA 1JEYA 1OAOA 4PLTA 2I8LA 3AEQA 2H4FA 3EBPA 3H4IA 5AW5A 3E3NA 3UCXA 1H6KA 1HTWA 1NMSA 2BEWA 2CZGA 4PYIA 4D9IA 1TKBA 4DMCA 4P3XA 4IH4A 3TKAA 1EINA 1Z5PA 4KWIA 1KDZA 1X1AA 3FI9A 4HRXA 1BCRA 4OFWA 4MA0A 4E46A 2XRZA 1W9HA 1QYVA 2BF7A 1CEQA 1UOEA 2GYWA 2P35A 2R84A 1RWOA 2YUTA 3CMMA 3PGLA 4MUMA 3WTCA 5C8DA 1O08A 3RASA 1W2HA 4KDRA 3TNLA 2W4IA 5FWXB 4DA6A 5FLEX 9ABPA 2ZJ2A 1TLTA 2BZGA 2FX5A 3P0HA 2ZRGA 4EKGA 1Y7PA 3OMLA 2XXJA 4PEVA 2AOUB 3COVA 5TPWA 5DIFA 4ARVA 1F5NA 4F1KA 4LVCA 1SCJA 4ZA2A 2C3OA 2OM6A 1V6CA 3J7AC 1GGKA 3BWYA 1GAQA 1Z8HA 4MQEA 4MUEA 4AKEA 4BRUA 1NFQA 3LX5A 1M74A 4RMHA 3ITKA 5H68A 4MKFA 3R74A 4RGBA 1HL3A 1YRAA 2PO7A 2FP4A 5DT9A 3VO1A 3ZU3A 3SKXA 3UAOA 5AVXA 1H2YA 4TYYA 1ZGCA 1FDWA 4LN1A 2B4QA 3DGFC 1U11A 3I9OA 1RKVA 3IPYA 5ESWA 1KJYA 2VRBA 3HDJA 4K1XA 2WJGA 3IXQA 3VFDA 3WL4A 5BOSB 2IH5A 2WWHA 5AD1A 3O2QB 4PR0A 5FWXA 3FUEA 4MR8B 4FYYA 3HCBA 4I8IA 5CJJA 3DYVA 4UWLA 7MDHA 1P6QA 5IVIA 3PDNA 2OAGA 4ZVVA 3DMTA 3T7TA 1H2TC 3A9CA 1BS9A 3F6YA 2JIZD 4TMWA 1VDZA 2G6BA 5G0WA 5KYUB 4O4LA 4QQKA 2OGWA 3BJEA 2E89A 2PBRA 2Y0CA 2HR2A 2V5VA 2WDZA 1KU6A 2WT9A 4JT8A 3S99A 1ZH2A 5EIHA 4DJTA 5JAIA 5DZSA 3U4IA 5FPQA 2ZYIA 3EDTB 1BGWA 1L7MA 4EPTA 4YCLA 4LZJA 3BH7A 5TV2A 3OSUA 2AE1A 1RVDA 2XV1A 2H2HA 1Q95A 3VPDA 1GA4A 5LYJB 4GC9A 3ZE7A 2CV1A 3FBGA 4L51A 2YXEA 2BHRA 2WPDD 1F2DA 2Z5GA 4XRGA 5DXAA 4BO0A 4FMPA 4XB6B 2QRMA 3NAMA 4B32A 1XXLA 1K97A 4UM9B 3ZEFA 1XGKA 1YDHA 2F8LA 3AF1A 1YZTA 4KQIA 4EG8A 2QZAA 4CZ2A 1K7XB 1KMIY 4CKEB 2EQAA 3CX7A 1MBZA 1R15A 3EBLA 3ZPJA 3TKYA 4IF6A 3UT5B 5IBQA 3AOGA 4OSPA 3CX6A 1AY0A 2IIBA 5EKQD 1G8AA 1JA9A 4UVEA 2UVPA 5G02A 4OAQA 4OK3A 4QWMA 4X6YA 3UAGA 1Z8NA 2IIPA 1BI7B 4WGGA 3PEYA 1ESMA 2QN9A 1D6SA 2RJNA 4B3HA 4DADA 1KYYA 2HO4A 3CLVA 3X3HA 3W5AA 4X94A 1DLJA 3QMVA 1OIVA 4NBNA 4RK7A 4ZCLA 2O0HA 1YT5A 1Y1QA 3ROZA 1Y1TA 1V7PC 8ADHA 4C9BB 3ICWA 1PV4A 1PI3A 2CUTA 3RC1A 1PR3A 4QPJC 1IYGA 2SBTA 4F97A 3DAGA 1S4MA 3M1LA 4PLZA 4U3JA 2FK8A 4YWHA 2W4MA 3DDOA 1EUCA 3KJIA 3I4CA 4F4IA 4D79A 3WYGA 4CT5A 3KQKA 2D62A 3K9BA 4UTVA 3LQRA 1P61B 1YCFA 4JDUA 4CKXA 2XUDA 4IIUA 4YRQA 3VJMA 2CCGA 3FBTA 2G9QA 1XQXA 4HTAA 4L5AA 5B64A 5CMYA 3M4NA 5LDGA 1WPQA 3E8SA 4IXMA 4MZXA 3RPEA 4JU8A 4DZTA 5CDTA 3EGOA 2YZMA 3CLTC 1ZMTA 4Q1FA 1UOPA 1LZLA 3UMVA 4WLEA 4A16A 4EB0A 2Z4SA 4BC1A 5DKFA 2I6QA 1JR3E 2VQDA 5F33A 3VV3A 2AC7A 1KWKA 1E3WB 5GGXA 1QYMA 3N8GA 4B48A 2HQBA 5IUNC 5IXSA 3D0KA 3B7WA 4F1PA 1UG3A 2Y1FA 3HLKA 3NWPA 4BC0A 3A1SA 4I9CA 3LZDA 5GQSA 5A5FA 5KSZA 2WT4A 1II9A 4YDHB 4ZEMA 4N5QA 2X5OA 1LV7A 4IEEA 4N2QA 1KP3A 3W9GA 5DW3A 2ZDQA 2WEKA 3UQYS 1EFVA 1YZUA 1B74A 3KVYA 4XD7D 4FTWA 5A4DA 4PCLA 3SF0A 3LNTA 2DYKA 3O1HB 2E49A 4Q7LA 3HM9A 2FAXA 4KDFA 3P9QA 1W44A 4RIEA 3KQWA 4KC0A 1G38A 4PHHA 2O1XA 4DA8A 2ZSHA 2ZS9A 1MRZA 3U9WA 1SZPA 2X1HA 5E7MA 4C87A 4BAGA 5SYNA 4F7DA 5LYYA 4UNIA 3GLIE 2PKCA 5IARA 1MT3A 1V8FA 2E4VA 2ZDGA 3L02A 2GTIA 4CMJA 5CRUA 1PQUA 1XZQA 2HPAA 2Y1XA 2OP1A 1W0JA 2JDID 3G02A 2Y05A 1EJ2A 3KALA 3ORFA 1W94A 1DG9A 4TT3A 1PKXA 2F6RA 1YK0A 2C2BA 2XOKA 1LI7A 4KQMA 2K5UA 1U7TA 2H4HA 3H4TA 3HFJA 5J08A 1V5EA 4UWHA 4DM7A 2PRYA 3A4NA 3ZJ4A 4CR6A 4EY5A 2Y0DA 4BCDA 4JXKA 1PFGA 1UBTS 2D1SA 2GVNA 3LC7O 3NC0C 4GI5A 3ZUPA 1QHNA 3C4VA 4MQFA 1KOFA 2HMUA 3PD7A 3Q0EA 4BU1A 1V1RA 1DNPA 1DXQA 4QUIA 1OMOA 4TOIA 1H94A 1LSSA 1PL7A 5HDQA 2EWMA 1AUPA 2ZIXA 4D8TA 4LFBB 4BWGA 4UM9D 4U5XA 3V9PA 1X1BA 3EXHA 5F7JA 3RRNB 1W88A 2M63A 4Q16A 3C3PA 3ZV6A 1J90A 1Z6ZA 2IS6A 1XHFA 1OREA 3CLSC 3ZQUA 3RU9A 2AVDA 3UTDA 3VTZA 4E4RA 4MDFA 2X41A 2F17A 1U2GA 1VOTA 4US2R 4HNGA 5J4KA 1PT7A 3JQ6A 4LERA 3VZSA 5I7SA 3O9ZA 4DZZA 2ZIUB 4LXQA 3EZ6A 4NG4A 3ZS8A 4PYRA 3U1BA 5CA1F 2IEGA 5J23A 5DI9A 4QIHA 1CJVC 1FFXA 3L1HA 4QOGA 5LYJF 2J87A 3NVKI 3PDHA 3NR2A 1Z0JA 4MW7A 4V0RA 1JUQA 1FRFS 3IV9A 4G8CA 4DQVA 5I9LA 2CUNA 4YRNA 3HI4A 3O21A 4RJKA 3Q7QA 1AO0A 4IVNA 1HG1A 3MRTA 1VG8A 4YO8A 5AW0A 5JNLA 2GRRB 4G1MB 4CMHA 2AJLI 3PUIA 5REQB 1CDOA 3NBMA 4TS1A 1I4TD 4IOLA 3YASA 3L0ZA 2V3WA 5CA1B 3TLYA 5D3ZA 1N5RA 4WNCA 4AVXA 2VPYA 1OGJA 3GZ4A 3ZU4A 3GLQA 1QYRA 1N7GA 2BOVA 3EVAA 4WL0A 4IOMA 3U48A 1KNQA 3OZRA 1YS2X 4E22A 4F9GA 5ARCA 4AZ3B 3U4HA 2J09A 1QS0B 1W1UA 2EATA 3KKKA 5G41A 3UAVA 4DA7A 1H0AA 2P1ZA 4YPOA 4YT4A 3LVQE 1P75A 2P4HX 1N6HA 2YVAA 2NM0A 5FOUA 3PGJA 5E4FA 2COKA 1Z6XA 1EMDA 2IU4A 1RFGE 4Y2TA 5C5EA 3I37X 4ATNA 1BN6A 1YKFA 4R2WA 1XN4A 2BELA 4CI9A 3RGGA 5B7NA 1QRRA 4EHLA 3ZVKA 4KRYA 3BDAA 3HCNA 4H7FA 1Y7IA 2B4KA 4V0ME 1U7XA 3DZJA 2Z6UA 2NMVA 2EQBA 1E1NA 2XPCA 4V3CA 5GTDA 2BYTA 1N5MA 2P9BA 4MWGA 2J7KA 1CUDA 2X6HA 1EUCB 4PLYA 5TGDA 4OLAA 3LG2A 2F9LA 1XU4A 3IQEA 2G1AA 1QFXA 1XHEA 1NXXA 1ZN8A 5CYOA 1DC7A 4C0AC 1A3CA 5CVEA 3TW8A 1Y3AA 3BBPA 3HU1A 3A3OA 4LWPA 1I3OA 4M0LA 4N8EA 4JWKA 3CVQA 1ODTC 3WLJA 4FJZA 4KO2S 2EX0A 3RAUA 3VC2A 3VU9A 2M9MA 3IKOB 1BO6A 1RI4A 1ONNA 3GGSA 3VRHA 4U04A 3ZUGA 4HTFA 4JR0A 2PU5A 3L0SA 2VBIA 1OBFO 3RRMB 4BJ6A 4N82A 3WDKA 4EAQA 5JVDF 1Y4ZA 3QOXA 4ATZD 4FWBA 4JELA 4B4UA 4CBVA 2KHZA 3WLNA 1RWNA 3OU7A 1SZ9A 1RIIA 3H6HA 4N6OA 2R5NA 1XOIA 3CEQA 2XHZA 1MX9A 3CH7A 3E7PA 3QXSA 3I32A 4PX2A 3OEYA 5FNVF 3MERA 4X0EA 2KSQA 2VQ3A 3RFCA 3TN7A 4X7MA 2JLBA 5AAOA 5L7YA 2G17A 2QD2A 5FCDA 2O7SA 2A3NA 3KNZA 4OSOA 3OM8A 4YMGA 3ASUA 4PC7A 3QX8A 1Y5MA 3SLGA 2CXNA 5LWHA 1E7UA 2HRDA 3KKOA 3FH5A 2ZTVA 1EFPB 1WKCA 2ZANA 4R8KA 5K0TA 3DULA 1PW7A 1UDRA 1UBGA 1Q0RA 2UYQA 3RSFA 2ZYDA 5T6MA 1ZQ1A 1TO6A 5B7GA 2VUTA 1OLUB 3ANNA 4F2HA 5CB4F 5F5NA 4EVQA 4KHPB 3LJNA 3N0WA 5D3KA 3ADBA 5LIPA 3EXEA 4I55B 2FO1E 4FDAA 4FQ5A 1HZ4A 1A7AA 3WHLA 2ZI4A 2ETBA 3HCOA 4EZBA 1E8YA 1QR2A 2A5GA 4Z4HA 3IXMA 1SWVA 4KV7A 3UKRG 4RG6A 2V0NA 2WSMA 3FMIA 3UJBA 4Q02A 4B3IA 3ZVMA 2DZNA 4FB5A 4LE1A 3GT7A 1GOTA 1W4LA 2Z04A 5E2AA 1D2MA 2GXQA 4AP2A 2PX2A 2ZYRA 4DY4A 4S3MA 3ED5A 1CJKC 1EP1B 4IFEA 4F5WA 3G0BA 1GZ7A 2VSFA 5ULLA 1IYZA 1JFVA 1HQCA 3WJ7A 1S96A 1LI5A 4MYRA 4WZAA 1O95C 2D2EA 2QY9A 2CHZA 3TOSA 3KUDA 3JYQA 4HFMA 3COPA 2BI8A 4CL0A 3Q3VA 3I83A 3CZ9A 1HNWB 4XKJA 4FR0A 1IQRA 1O96B 3Q6IA 1Q0QA 3UJPA 4BQFA 4FX2A 5HJEA 2Z6AA 4EHJA 4HXIA 2EC5A 1NASA 3ENWA 1SQSA 4PPFA 4KUEA 1KT0A 5CXUA 1I10A 1GPMA 1B26A 3EXG1 4I9FA 4JLKA 2GTHA 4LWOA 2JZNA 4JBYA 1SNYA 4OB8A 1W0JD 2JDIA 3NMUF 1B15A 5BR8B 5L4SA 3LL4A 2C83A 1IZ9A 1SRRA 4ALIA 2CFTA 5JFOA 4FXPA 4J7AA 3WA7A 1OH8A 5JJTA 2WQZA 4XX0A 4JI2B 3GDWA 3H05A 3OKPA 1NC3A 3C8HA 3PNPA 1T24A 2XUQA 4G67A 4CMEC 4V1CA 3K0HA 4FULA 3L92A 4MVJA 3KL2A 3E58A 5ALJA 4JASB 2C7PA 1U8TA 5KI6A 4V0NA 3MJTA 3WQQA 1TIPA 3F9RA 4CLXA 2P9SG 2BEKA 2MU1A 3JAMA 1XQ6A 1WF3A 4ND1A 1OXVA 1ZRMA 2W71A 1ZNXA 5D86A 3UAXA 1RW4A 3I73A 4U9IS 2JANA 4PYKA 1Q1ZA 3INYA 2V65A 5K3BA 2KATA 2Z3WA 3FOWA 4RS3A 1W49A 4RAQA 4R1MA 2E1RA 3WWOA 2HK6A 3RCBA 4J2TA 2UZ3A 3SO8A 2B4TO 1C7EA 3G89A 1OXTA 4QHTA 3E9RA 4GP9A 5EKDA 1G5FA 3FWYA 3VO9A 3TAXA 1LLQA 5HM6A 5IFKA 1WTAA 2X8JB 2ZUTA 3HJUA 3HVIA 3NT2A 1BWRA 3BGSA 4I1RA 4HNAD 5FADA 2Y4TA 4IULA 3PRYA 1F48A 1TA4A 4G5HA 3PZ4A 4A4DA 1IHBA 1HF3A 3PUZA 5ABPA 3EQ9A 1C8KA 2Q29A 2IYRA 1DI0A 2F1RA 2ZYGA 3QKUA 4E08A 1NDHA 3IDOA 1P4HA 4JSYA 3RYFA 3D2AA 2R68A 3V79K 1P80A 1GL9B 1E8XA 1I8TA 1MAVA 4NENB 2AZ4A 3V2OA 3FDXA 3B5IA 3TOXA 2OKGA 3T12A 4Y2QA 2FFQA 1M8FA 2IPNA 3H17A 5TS2A 5BWNA 3AL3A 1QZZA 2I87A 1TCBA 4JD5A 5DHUA 1TJCA 4YUAA 4GKKB 4WBSA 4H4DA 5CNMA 2DHQA 3UKDA 4KXUA 1QGED 3CR3A 3A7DA 5KHLB 1FJXA 4UQZA 3HB4X 3U19A 3PD1A 1CNMA 5IH7A 4NV3A 4U8GA 3EFBA 1ORVA 3TX6A 1NYQA 2V8BA 2WAOA 3ZHEB 1LDGA 4UAUA 1J06A 1SUAA 3HIZA 3LXRA 3VHLB 2CNKA 3IKJA 3PNVA 4J7UA 1ZI9A 2H51A 1MB0A 4X24A 4BLSA 1ZCBA 1PIWA 4M22A 4N01A 4BVLA 2IUSA 3GLHA 3QEKA 3TD6A 1YTLA 2AEJA 4RGYA 5D00A 5FFMA 2WSBA 5LP6F 3RSSA 3ZN2A 2RH9B 3QITA 2FPLA 2VS1A 4J75A 4Z68A 4WINA 4EELA 1HZZA 1Q6ZA 2OL4A 1WQ1R 3O94A 4G0QA 3LSYA 2JHPA 2HWWA 1Z45A 2UY1A 1ZL2A 3OLWA 4FHEA 3CVVA 4PZZA 5ERXA 1D2EA 1LJUA 1SHKA 2QY6A 5D0OD 3JQ7B 3ZHZA 3IEUA 3IMFA 3N0RA 4JLAA 2F3PA 4YJ3B 3S2IA 3MGBA 3TGWA 3MSCA 4BFRA 1PX0A 2ZT5A 1NY6A 2ZRIA 5A2GA 3FH8A 4HGOA 3TR6A 1G8YA 1MAAA 2LRHA 3L1IA 3AHIA 3QXJA 5JWOA 2CCJA 3IPCA 3ZEAA 2Q99A 1MEJA 3BE6A 3D9KA 2KLBA 3GUHA 3PFKA 4W4TA 4UWKA 5JG7A 2CK3A 3UIOC 5CD9A 2QR3A 3ELUA 3WMFA 1L5KA 5F5LA 4IJWA 3OAWA 2PUWA 3SZUA 1LDYA 1LPPA 3UAYA 3CRMA 1ELKA 3WQHA 4I4CA 2C8LA 4H08A 1ELWA 1YBAA 2QGFA 5J47A 2XWBF 2Q9AA 3R0XA 4KYUA 4BNFA 1XTRA 1Y6GA 3Q0IA 3QKSA 4COKA 4L8VA 5K0BA 5G40A 5AQBA 4KOEC 4J9VA 1M0TA 3KJNA 3IAS1 1WUHS 1T0JB 2PNJA 2FEWB 4QODA 5G4LA 3GMSA 3WBBA 2X14A 2H8KA 5A4FS 2XBLA 2XVZA 3A1UA 3LM8A 4DC9A 3OO0A 2WIBA 3ZGVA 1O54A 4CPDA 5BV2P 3RVQA 3BE8A 1MRNA 4GMGA 5ENVA 1E1KA 3A9UA 4KN9S 4MB0A 3WMEA 4EEXA 1LWOA 3QQPA 1LQUA 3NDIA 2J1LA 2PGLA 1CUJA 1MJHA 3QXXA 1EDOA 1F8YA 1S2GA 3RC9A 2AD5A 4ZO8A 5KVSA 1PGOA 3LGSA 3CB4A 4HDMA 1B0AA 3PQ4A 1X13A 4LRQA 1JKFA 1OI4A 4X92A 4K5AB 2RGDA 3FFTA 3HV0A 3JWIA 2PR7A 4IF4A 2QMOA 4LCEA 2XQGA 3B2EA 3K5IA 3M6LA 1O2DA 4ZYYA 4TMXA 2CWWA 3PX3A 4DAEA 1F2TA 3DBRB 1Y8RA 3PNMA 1YJ5A 3U7QA 3DDCA 2QYHA 3RV3A 1G21E 1AQYA 2VYIA 2GN2A 3O83A 4IQ8A 2QAGA 4RV9A 3VC1A 4R1OA 4U96D 1Z56C 4OM8A 4OQDA 2AQ8A 2C7VA 2NZYA 3DGEC 4TS9A 4ALNA 4TSRA 1MV8A 4W7IA 4XQ9A 2ADFA 1A8SA 4ARCA 3FUXA 1GA6A 4CMIB 4DEXA 3UX4A 5AYWD 3BQMB 4JNCA 4L8GA 2N47A 4MRUA 1ZM7A 1R0WA 1VSQA 4XR4A 3GPLA 2J5BA 4N5MA 4ZYVA 3DZCA 3HQ4O 2XECA 2HHAA 1C1XB 2JJ8A 2Z83A 1ZITA 5EWLB 4D74A 2O5RA 4J16C 4CU2A 1ZJ5A 3O90A 2FSFA 4FILA 2EZ8A 2IL1A 4US1R 5LLDA 4LV6A 3KKQA 4D25A 1NC1A 1QQTA 4UMFA 2FZWA 3VAAA 3C6KA 5HIAA 3M82A 2FUG1 3NKFA 3MJEA 1DOHA 2XCQA 2C88A 3QLTA 1MC4A 3A06A 4KUHA 5CNIA 3U3MA 4UMVA 1SB8A 3LHDA 3IV7A 2L6BA 1MA0A 4BFTA 2AI3A 2NAPA 4ZYUA 2X4IA 3IT0A 5DM1A 4B09A 3JYOA 5DBKA 3S55A 4CM8A 4BNWA 4Q4LA 3B7BA 2C0CA 1ILWA 4FYPA 1RWWA 1XTZA 4B4DA 2KBEA 2W5UA 3GUCA 4QHSA 1ATZA 2O2DA 2JJ2D 3D9LA 1IK6A 3LVFO 3FWKA 4I7EA 2IY8A 2AW3A 2DF8A 1EF1C 4Y6QA 3EWNA 2GARA 4DZRA 1KI1A 4MS6A 4M1EA 2CJWA 4RM2A 1LPSA 1U2RA 4JOSA 2AZMA 1C3OA 2JFFA 1SHTX 2YN2A 3BEOA 1THZA 1FYFA 2DKNA 3E8XA 4JLJA 2RG7A 5GVRA 3KZVA 4PR3A 4F84A 2L69A 2VDUE 5LX8A 3RTGA 4F71A 3A3PA 3LHKA 1Z2NX 1E6CA 2VK4A 4NQ0A 2Z1NA 3LUCA 2IZ0A 4ZZ2A 2P79A 1QQEA 4O3MA 4P8RA 2B3TA 1DP4A 4HBZA 2EFYA 4OQ4A 4S0ZA 2ZBQA 5IS2A 4CWAA 1S9DA 1KJJA 3HRKA 5KJ1A 1HE4A 1MTOA 2GN8A 2E18A 4M38A 1QIDA 3N6VA 5HIKA 1DVRA 5FULA 4FSXA 4II2A 2VJ8A 2L19A 3P7MA 1MJFA 2EBFX 3L7MA 5CVVA 3D4BA 3QM1A 4A23A 2P9HA 5G55A 2F8MA 3LW8A 3OJCA 1Z08A 4M0CA 3AC0A 4CI0B 2Q5EA 3TR5A 4YR7A 1ZCAA 2VDOB 2I2DA 1VKNA 1JG7A 2JS7A 2VJLA 1Y82A 4G36A 4ZIRA 4YIHA 2LXMA 2F67A 3AR2A 2PRKA 1JXOA 3P5BA 1F60A 1VJRA 3P71T 5JUWA 3QKYA 3M8KA 3LUHA 4GQIA 3CUKA 2GROB 4FLEA 3AU4A 1Y6FA 3S7FA 2I3ZA 1V26A 1KE1A 3SR3A 1A5EA 2IK8A 2IVZA 3N3BC 2DXIA 1PGPA 4ID3A 3KJHA 3UK2A 5FNVB 4NDAA 3RRJA 2F3UA 3AV0B 4LNAA 5TY0A 1HXIA 2W00A 1CZLA 1Y6JA 3W5UA 1MKYA 3UGJA 4CIVA 1QG2A 4ZAXA 3L7DA 3RSHA 3QF4B 1T10A 4IGKA 4Q9IA 1FSGA 3SNXA 1S5PA 3KJEA 4LY9A 4BUJA 3BE5A 1U90A 3EEYA 3OPYI 4MUNA 1U98A 3VU1A 5CBKA 1XA3A 5BT8A 2VHCA 2EZTA 1EGMB 4KQHA 1ZN7A 4OVKA 2OHIA 4FW9A 4Y2HA 1Z5ZA 2HV8A 1T25A 2NSYA 2R5WA 2Q3HA 2L18A 3O48A 821PA 2R5SA 2R4QA 2ZM6B 1SXJB 4OQLA 2RSLA 5AI9A 2R7AA 1SXGA 1T5BA 2FXIA 1J7KA 4X95A 4BBAA 4D82A 4FCVA 4YAFA 1UF9A 4DCNA 1RXVA 1HSOA 5JOQA 3SJZA 2J46A 1HFJA 5EINA 1WX1A 1GDHA 4KAAA 4LXGA 4PAWA 4MUFA 3TTXA 1LD7A 2PVSA 3CUEF 1ABFA 4L4SA 4LGCA 1JVBA 3MINA 2W2KB 5DVZA 4XJTA 5K05A 2XHEA 4I1MA 3T9KA 4QOHA 2FFAA 3PGKA 2O4CA 3DQZA 4W6QA 2FGKA 1G9TA 3KK0A 4RSGA 1T4DA 3MB5A 4QLBA 1ULHA 3KBOA 3CR7A 2PXHA 2X86A 2Q49A 2GCNA 4PO3X 3W3AD 5AW8A 1GARA 2A5DA 4NBLA 2DG2A 1R64A 2YOGA 1KTIA 2D5CA 1HKHA 4JMPA 5B2ZA 2YXPX 3STUA 4NAHA 2D54A 1OCZE 1OJLA 3HY6A 3UQ3A 2CLOB 4J7WA 2QSUA 1JHPA 2QBYA 1JF8A 3Q41A 1F0PA 1EBBA 1MVLA 1ETUA 3AX6A 1MX4A 3QVWA 3BORA 3R09A 1K66A 3ND8A 2O1SA 2P9KG 4NFYA 3TRHA 4PH4B 4Y0VA 5F4ZA 1QGUA 1UMBA 2Q6KA 1JIJA 5JO0A 1H3EA 1N77A 3OUTA 4N0QA 4TUMA 3THOA 3A9WA 5SY6A 1IPEA 3B3FA 4EARA 1SIBE 2UZ0A 1EPUA 1RQGA 2PR2A 2DTDA 5JAUA 4JJAA 2X0KA 2WSSA 2J6BA 5A7DB 2XWPA 1ZD4A 4H18A 4ZQHA 3HXBA 2VXCA 3CLRD 1QMPA 4FB4A 4YQFA 4O60A 1HOXA 3NANA 4DAOA 2ZRMA 1BMFD 2OHFA 3DBLB 5D5HA 1DRJA 5DPMA 3UGKA 4HRYA 2QX8A 1R27A 2DFLA 4PPGA 4K3VA 5CLHA 3WYCA 4BEBA 3P0JA 5HWSA 2C9YA 1NMYA 2NUTB 2HSDA 3KAEA 1HDRA 1JZTA 1NN5A 1VI5A 3AETB 3DOOA 3KTOA 5CDHA 1DX9A 3BL5A 1FLNA 3BA6A 3JQGB 3BCUA 1Z38A 4GA1A 1AB5A 1ORDA 1QFJA 1VB5A 3LOPA 4ID9A 2RGNA 2FG6C 5ALSA 3TSYA 3VR2D 2PZIA 2H1CA 3FTQA 4KOAA 3W2IA 4Q4HA 2A5JA 3KHTA 4IP0A 2E85A 2O2SA 3S2UA 4BNXA 3I6QA 4OIMA 2QN6A 3EF0A 1ONBA 5EJMA 4LW8A 3GRFA 1DRKA 2YZNA 4QU5A 5GY7A 1PSWA 4EYKA 5KOJB 1XRLA 1Z9BA 3U0BA 3F97A 2WWGA 3ICQB 4P4SB 2GD2A 3WK5A 1RJDA 2I3BA 1MD9A 2QTWB 2GM4A 3EOBI 3MWDB 3DBSA 3D1VA 2AJTA 3K9GA 4Y98A 2ONZA 5ALYA 5C8YB 4MS3A 4ENTA 2WJVA 3S44A 3ZBPA 2IP1A 1CFZA 5ALEA 1NAIA 1EA7A 3ZI7A 4KYTA 4KJZA 1K6IA 4TMKA 1LX6A 5DYIA 4E5SA 5KWVA 2NXNA 1Z83A 1W6RA 1P62B 4Y0NA 1ILEA 2VSYA 1W5AA 1ZJYA 2AEEA 2EW1A 5GOTA 3VKFA 3AS4A 4AZ0B 2SKCA 3WK4A 2Z98A 4DJEC 1P4JA 3H2KA 4ZYXA 2R79A 2AG6A 2PJUA 4JJGA 2Y92A 3N75A 4W5NA 3ZY3A 5C8YF 4QJ5A 3H0CA 4GXNA 5BYAA 5KTKA 4RVBA 1EJ6A 2GWHA 4K40A 4L3VA 2FZ4A 3F5QA 4L2IB 4Q1AA 1Z88A 4J8YA 2QVXX 3GF4A 1SQ6A 2FRDA 5DDIP 1LDNA 5DCUA 5EKXA 3M3DA 1UPCA 3U3JA 5CG2A 3HHPA 4EHKA 4E12A 2V9CA 4DLYA 3A11A 3KP1A 4ZWNA 1G1MA 1PBNA 4LCJA 1N54A 3W8DA 2ZLBA 2VCEA 5E8JA 3ZNOA 2GI4A 3Q85A 1D2AA 4NZPA 1HFEL 2JEYA 2VJPA 1UBOS 1JE0A 1F0NA 1QHIA 2AV6A 3KPYA 1PEAA 4TTAA 3FZEA 4LFCB 2Z56A 3PREA 4DNPA 1XGWA 2JIMA 4GM1A 4TM8A 5IDWA 4EH1A 3QUQA 1D03A 3I4FA 3AFNA 3NBNB 1B43A 5HGXA 1KZGB 4LWZA 1JJ7A 3BMOB 3H5LA 2NVUA 1NR1A 4DBLE 2Z6QA 1D04A 4OK6A 1DAHA 2HC9A 3HJBA 4R9SA 4YN3A 1GSAA 5LXTB 2ZJBA 3G2IA 5AJDA 3PCTA 2IOQA 2N46A 3N07A 3KFVA 2WW8A 1M1ZA 4DPLA 2P9LG 3DAYA 2AS0A 1ZC4A 5ALRA 3ES9A 1OLUA 3ZNQA 2R1VB 4CUJA 1J2EA 5AVOA 1JQ5A 3H1TA 4NBTA 3NHJA 2P41A 3ESYA 2HB6A 4I5EA 3UAWA 1NVVQ 2JK0A 4H7IA 4BV8A 1N3LA 2NU9A 4HLUC 2WUDA 4OATA 1OIXA 4CETA 3BWXA 3BUAA 1HYHA 3HO6A 1JGTA 3LDHA 5FUMA 3KO8A 3SAJA 4IFBA 3C7AA 1NNUA 3GYBA 2FPSA 5C7IO 1IBLB 2VKQA 3IBEA 4A9AA 3NHAA 3DL2A 3HYNA 2WMOB 1QJ4A 2Y71A 2ZG6A 2BI7A 2AZDA 3IRVA 1UWCA 1VE9A 3MPOA 3FUHA 3DMHA 1VKOA 2PSFA 2PQ2A 3H18A 4H6XA 4O4LF 2O2ZA 3RRMA 2VP4A 3V97A 2ZWMA 3ND9A 4ZQBA 4OQMA 3TBFA 4C88A 3APFA 2WA2A 2WUVA 5KKNB 4JSRA 3PXUA 1OTYA 3H5NA 3R3XA 5T6BA 4AUEA 2CLFB 3EAQA 3FSGD 1XPRA 3WNDA 2YCBA 3CIAA 4QOSA 1BD8A 3TTYA 4LE0A 3MJFA 5IC6A 3W8FA 3IELA 3LH5A 1EXVA 4RD3A 4HEHA 3ASOE 3NTQA 4LF5B 3F96A 3SD5A 3NH9A 4DRXB 1FTYA 4NZNA 3DVLA 1OBOA 2A9JA 4KFTA 2P9NG 3PZBA 2POQX 3WB0A 1EYZA 1WDLA 2WZQA 3BFJA 5IC4A 2BE7A 4QD3A 4IXDA 5KVAA 3W6UA 3DNFA 3BG0B 1YIDA 3S70A 4MRNA 2C3MA 3LX6A 3QE2A 5FI3A 4FHGA 2W6JA 3FKJA 4NCNA 1QF6A 2I3DA 4TS4A 4YMTA 1VJDA 2OCKA 2V4UA 3NV7A 3SFYA 4Q69A 4Y2PA 1L3IA 5CEJA 4YJDA 4J0KA 3MIZA 3ISMC 1MAUA 3QTLA 4BQIA 1NUPA 4QBKA 4N9WA 4NDZA 4OMFG 4CFZA 3F4KA 5A02A 1ZWKA 2GZHA 4KRFA 1L5QA 3TMKA 4IYPA 4AIRA 1WSBA 5ITSA 2WWXA 3SVTA 4K26A 4G23A 2G8NA 5F98A 4CLRA 1IEXA 4GBGA 5D8DA 2GA9A 5I01A 1FZTA 4K88A 1W2WB 1NJ2A 3H2BA 3CE6A 3FNHA 2EBHX 3ODGA 5KWJA 3L05A 1VLJA 2C54A 2RI1A 1TTTA 4CW7A 2Q5OA 4BIMA 4XKCA 1A97A 1XQVA 5F9MA 1HYEA 2JCSA 2ZAGA 5TDHA 3T3DA 5COQA 3H5AA 3WGHA 2C5FA 2IODA 2IYTA 3KSUA 4PGAA 4EG0A 3MOSA 5JJ5A 2X9LA 1DV2A 3NOXA 4Q9LA 1RZVA 1Y1KE 2NVWA 3F7MA 4NCHA 3K6SA 4KWCA 2QYUA 5EDSA 3FGPA 1ZJZA 4OH1A 1YXMA 2VT7A 1N5DA 1Q1EA 4XWAA 3MWYW 3O3OB 1X1CA 2MSKA 5IM5A 2V4ZA 2VIIA 2P6OA 2P67A 4RQIA 5BNIA 3GCXA 3R3JA 1ECJA 2X6JA 1RP1A 3MAAC 2IYYA 3WQRA 3QXHA 5LMNB 3MN1A 2ZRKA 4NARA 4OD0A 1G6KA 2YMLA 5FI0B 5C31A 3B78A 1Z2DA 3CEJA 1T36B 3BMCB 3H9CA 1FYXA 2BFFA 3WK9A 4FYWA 3WRXC 3DOHA 2C8KA 3K4PA 3Q79A 1VG1A 2SKDA 1CRZA 1F3LA 1Z37A 3LT0A 1XQWA 5DO9A 4AXHA 1Q50A 3V1KA 4AP5A 3W04A 3I2HA 1PR6A 3FHCB 4YCDA 5GVSA 1XNQB 4ZO6A 1CRLA 3REQB 3Q75A 1T1JA 3TSCA 4MYDA 2A2ZA 5ELLA 1CQXA 4V0KA 5GOZA 3DLBA 4QOEA 2HA3A 1QHYA 1AKEA 1YULA 2AFHA 3GFTA 2AW6A 5DBOA 5FD8A 1R0RE 4F38A 4F86A 5K0CA 2MINB 1QZ3A 4F2WA 5JROA 4W1RA 1QFYA 1YJQA 2GKGA 5BNFA 4S1VA 1QP4A 3ANTA 4NEHB 1WIWA 4X41A 2D8MA 1OLOA 1CUAA 4NE9A 5BXQC 1EQ2A 3NTOA 1XZDA 2RAFA 1NGSA 1RLMA 2XMCA 3KQOA 1GXSB 1I13A 1Q5PA 4XX1A 4UXHA 1TTQB 1I0IA 4RZSA 1CYDA 1QH9A 2Q27A 4CHGA 4Y1RA 1FT2A 1ZY2A 1UJCA 2BGLA 3L07A 4CF3A 1X92A 3ZDCA 4RDXA 2WXNA 2ZPTX 1EVLA 1HFAA 4HS2A 1C4OA 1P33A 3QKTA 3GDGA 3C8UA 3UUEA 2P5SA 1JDBC 2IBSA 3A9TA 1CY4A 1L5JA 4G89A 4AKSA 1TT7A 4HNAB 4B31A 4Z1OA 4GL4A 1F2UA 1BLXB 2QVYX 4JB8A 3FYCA 4ALMA 4PAGA 4NICA 4DX2A 2EJUA 2UYYA 4XPZA 2D1FA 1WCV1 3WFJA 5EJ8A 2O5EA 2AN9A 1DQRA 1CE8A 3CSTA 1HT1E 2QI9F 5CD1A 4OFXA 1E3WA 4R51A 1WMDA 5CW2A 3MXOA 3RADC 3UIEA 1UXJA 4F3CA 1E2NA 1VZ3A 1GG9A 1L3CA 3F9CA 1VRWA 4HAUA 4MHSA 4DCJA 4ENRA 2GHRA 2QRUA 4JOQA 4TVOA 5FI1B 5H80A 3KUXA 4MITA 5AKKA 4BMYA 3WSVA 2GFQA 1QQ5A 1TDJA 3H97A 4BECA 2I4MA 3H2JA 1ORTA 2KXPC 5EMMA 3P9KA 4A0RA 3DKIA 3EDYA 1TT5B 4CDNA 3MVEA 3OD5A 1L5SA 5L95A 5IEBA 3UYLA 1ZQ9A 4R7ZA 4HGZA 1BCSA 3R20A 4UHDA 5ALTA 2FSGA 4DBVO 2EW8A 4L4XA 3HDYA 2PGIA 1DOAA 2JH3A 2YJZA 4CKBA 3PJRA 1Y1SA 3GJXC 2LUOA 5KYTA 1K5DA 3ETDA 4JXTA 1A7UA 3CE9A 2DQKA 3VC7A 4LSZA 1L9XA 4QT0A 2NP6A 4HDRA 3HXQA 1E5TA 1KZYC 5DGCA 1WBDA 3MZ0A 1MOZA 3I52A 3QAQA 4JITA 4K8RB 5BN4B 3RRYA 3WZ2A 3DO5A 1JDPA 3VHQA 4QRHA 3GX1A 3LBIA 3T7CA 3WKDA 2WLSA 3F3SA 5IY5E 2BGIA 2P69A 4M9ZA 5A6SB 3K5WA 1KO5A 4C1BA 4UTPA 3D4OA 4WNEA 3ZJTA 1GUYA 3K16A 1DAKA 3MCZA 5TJHA 4G5QA 3UBTA 2QT9A 1YVDA 4YV0A 1IHGA 4XYLA 2REXB 4WFJA 4CTKA 5THXA 3KFXA 4KQ6A 4D9FA 1M10A 3WX0A 2IOYA 2CEKA 1XRRA 1YR6A 5D7NA 1KQNA 4E21A 3PZDA 3PVLA 2QJFA 2XMGA 3BFKA 1YA4A 4D1YA 4DLVA 1JHAA 4ONEA 3DEIA 1X7GA 2WVAA 3ADCA 4ER0A 4HOTA 2QSYA 5AW3A 4I5FA 5C35A 4C0QC 3ONKA 3HBLA 4TZKA 2NSZA 1AE1A 5JO9A 1K98A 2O8CB 2FPXA 1M9NA 3LBAA 2H0RA 3EB9A 3W9YA 4DQLA 4MKTA 4OI2A 4N3AA 5ALZA 4UKDA 1KE2A 5JZSA 3APCA 1J8MF 2DBZA 3WGJA 1N1GA 5BURA 3ACDA 1VCNA 3KUCA 3RSOA 1RXUA 2P0AA 3BILA 3UGTA 2Y6VA 2LV8A 1TMYA 3STWA 4DY6A 1FUKA 1XCLA 4QEZA 1NZFA 3CJTA 5DTRA 1A9QA 1IHXA 2FEKA 3OZVA 4UCQA 3P4UA 1H6AA 4XIIA 1RWKA 4DXDA 1FB5A 3NETA 2BBWA 4CN8A 4C5AA 1TPZA 1TYCA 4JR2A 1VGQA 4GI1A 4PICA 1L4EA 3E53A 3UMJA 4IN3B 1EI9A 2BHTA 1CR1A 3A9SA 5B4UA 4KFCA 1CCWA 4DLRA 1G3UA 3OJEA 4URUR 3QEBZ 1D3AA 3C3RA 4LV8B 2NV6A 2HBZA 4HDNB 1DRUA 1KJWA 1PR0A 3R5KA 2ECKA 4XLLA 2VVTA 1ZN9A 2QWXA 5HUJA 5TMBA 4XVRA 2PUTA 3R3YA 4R2IA 1XDZA 2AOUA 3VX4A 1II8B 2HA6A 4D4LA 4I50F 5F52A 1TK3A 3E18A 4K6CA 2CLMB 4PGMA 2XJ4A 5DEIA 1J70A 1V16B 4D8XA 2X6TA 2Y68A 1YL6A 5FBZA 1W581 4HV4A 5LQDA 3L2OB 3QPAA 2HQ1A 1PDOA 4YIKA 3SNHA 5L3QA 2B0OE 4EYEA 1IMJA 3B3GA 2FQWA 1Q7RA 3MBOA 3OFVA 2ZXFA 3KCQA 4IHAA 2GZRA 4JC4A 2ZJZA 3CO0S 4W8OA 3FVQA 1XC7A 4L22A 3QHAA 4W1SA 4DR1B 4OOEA 1SCAA 1E20A 2VUHB 3ZGNA 2D2VA 4LJRA 5PGMA 4LDNA 4JT2A 4GUDA 4AM8A 3ICPA 2A1IA 1CPYA 5GADl 2R6GA 2QLJA 2V1UA 4P34A 1EQUA 3NCTA 5BYJA 3AFOA 4BYMA 4F93B 1AV7A 2BCEA 2DT5A 2EWWA 1LFAA 2R25B 4M1YA 4UNPA 2DPMA 1F2UB 4E5NA 3EX7C 4JL5A 3ZD6A 5K6TA 5E3HA 2QTZA 1S70B 1P2FA 3WWPA 1QPBA 1VE3A 2G5PA 3PEUA 9GPBA 5E4TA 1PJSA 4B3GA 4Y2UA 4C4PA 1EZ1A 1DKNA 3ABME 4R69A 4Z3DA 1G9XA 3Q7EA 1TGVA 3DKPA 3H1EA 4JS0A 4ADSG 3TKLA 4E30A 4DJDC 1JWGA 4YRCA 3LBYA 4GU5A 5IBRA 2HF7A 3M2TA 3TLMA 3ZCUA 3CW2A 1U1IA 3L8YA 1G55A 2HPVA 1RIFA 1IUPA 2X1MA 1O58A 3DT8A 1UT6A 1ID1A 3Q9LA 4Q3BA 5EP3A 2GH1A 3VSAA 4CXMA 4ZU3A 2PJDA 1XTVA 1MXHA 1O8CA 4DMKA 4WN9A 4ENSA 1KO1A 3ULYA 4O0LA 2IU1A 1XU9A 2FPOA 5AM2A 3BMQA 4RHUA 4TV8F 4EZIA 3TWWA 1GZUA 4PAQA 5IKPA 2JIZA 3CKBA 1WB9A 2CYBA 4L08A 1JQ3A 1YCHA 2I65A 3KPVA 1YHZA 3ABSB 1WD7A 3I6ZA 2J3JA 1K8QA 1MQ8B 2RARA 4JCCA 2GO7A 4HD8A 4L27A 3P97A 2C8VA 3NHFA 4XYMA 4XZ3A 3E4DA 4Y9SA 5G3ZA 4WBNF 4U7HA 2OD9A 1YFJA 1PS0A 1E3IA 2CXUA 1G64A 2FW7A 2NO9A 4C04A 1JHUA 3K70C 1SBYA 3IV0A 1PQPA 2CD7A 5JPDA 4MPTA 3T6KA 3GLFB 2PWZA 5G0TA 4KW7A 1OHHA 4QGSA 2WOOA 3FLAA 2LWIA 4IBOA 4FFBA 1N78A 5DT2A 2OYRA 2X40A 1BSVA 3BIFA 4U6QA 3OUUA 5K99A 1Y7HA 2GQ0A 3EXIA 3OXGA 1SKAA 3TB4A 3I01A 4HX2A 1HLGA 2D7DA 1H2BA 3KU1A 1RYDA 2NZXA 2O7VA 1FPQA 1WG0A 2LSVA 3BHJA 1PSDA 3PDCA 4NHEA 1M73E 1GG8A 4OKIA 4ZOLA 3SXJA 1W59A 4HDNA 1GW6A 3AKCA 3HXTA 3PIDA 4HGQA 4B0ZA 3D6JA 2ZE5A 3TB6A 3TM5A 4YQYA 5JWRA 4AKIA 1LPNA 5F3DA 4BVJA 1H9CA 2CFSA 4ZU1X 4ZOCA 1VJTA 4MQUA 3EIEA 3MWGA 1J22A 3X2EA 2H00A 2HWKA 3NZUA 3S2GA 4GVLA 3V8RA 3KS2A 2JL1A 3LUDA 3ANMA 4QTYA 3HJFA 1OY3D 3QJZA 3OLVA 2OBXA 4G8KA 4DV6B 2K6GA 5JJ7A 2HQRA 3EN0A 5BW8A 5KQLA 3QVKA 4F0JA 1CRPA 3OAAA 4DLSA 4QXMA 3LWZA 1GPAA 1YQGA 2G09A 3WLHA 1YU6A 2RD2A 3ETLA 1EAMA 2L17A 2DWOA 1ENOA 1HNNA 2YXLA 2D59A 2WUWE 1AGRA 4W5OA 4A15A 3QIVA 4MS4B 1E2BA 3KXPA 3U3OA 2PQ6A 3O31A 3VOAA 4JP2A 1CUHA 3T1VA 4GBMA 2JEOA 3KQSA 3CZRA 1FMCA 3FOBA 4FOTA 4NJMA 2XADA 2J3KA 5L8VA 5AWFC 1MOSA 4WOPA 3RUDA 2CUZA 4PYJA 1NDQA 5A3QA 2QTTA 1JJVA 1KY3A 2JW5A 2OZLB 4KI0A 2WJ3A 4AG3A 4BRZA 1KSJA 3VTAA 1VXOA 4LBVA 4JC8A 1ZFNA 2GNOA 3LAWA 4GPBA 4IOKA 4B2PA 1I7PA 5C5IA 3OWHA 2HSWA 2W6QA 3DXZA 2NXWA 3LYLA 4XCQA 5LDDC 4MB2A 1UEJA 2GN9A 3N2YA 4N76A 2FO7A 3DXXA 2VH1A 3CTMA 3KLNA 4Y2VA 4A8JB 1WG8A 4EB3A 3O8OB 2O3SA 4NMMA 1CRQA 1OE0A 5JQWA 1N8KA 2X6KA 1VMAA 4YRSA 2D8AA 4FE4A 4D0NA 2NP7A 3ZCVA 2XKBA 1L5HA 5KNCH 4JD2G 3DUFA 4MGZR 4W1QA 4IVQA 2PLFA 4ZQIA 1B0UA 3QEOA 4RMGA 4H0CA 2Q5HA 4AL4A 2ZTMA 2CXOA 2JVKA 1ZGAA 2VA9A 4WJLA 2AHRA 4L1KA 3M70A 2C96A 3OM0A 4FKBA 3IQDB 4LHXA 2GUWA 3K0FA 2J9XB 3CA8A 3BERA 4GI3A 2OT3B 3MC1A 4XUCA 2EFGA 2WUGA 2C2HA 3KD7A 3QKRA 3WK7A 5LFAA 2O0KA 1NRIA 2ZBFA 3MS7A 1DFGA 4TROA 4BJHB 1Z6AA 1Z2AA 3ZD9A 5IJ9A 2QROA 4FJ2A 4A63B 2DECA 4YMVA 2RHHA 1F5SA 1DTSA 5EGNA 4OHFA 1I1OA 4K2AA 4KO8A 4YRRA 1X80A 3NWEA 5JHAA 2UYOA 3OQHA 4BHTA 3EGDA 1NI5A 3ONWA 3CHOA 1P72A 4A6DA 3HMQA 4LOHA 1NIPA 4NJEB 1DDOA 4TV8A 5KJ6A 1T9DA 4LPKA 1DXOA 1GPKA 1IMOA 5KNGA 4XA8A 5EMJA 1MB9A 1J4AA 5KUTA 2QYJA 4UU8A 3Q47B 4X6LA 1KIFA 3QUSA 3LFTA 3LIPA 7MHTA 3PQ5A 3AEXA 1DG3A 4BRSA 2BGUA 2E48A 3O8QB 1ZONA 2PUAA 2EKQA 3LP8A 3PRJA 4B74A 1V48A 2CJFA 1EVZA 2Q1UA 1DGQA 3F6QA 4B89A 4I6JA 1PBTA 4J0IA 4YWJA 5FUVA 3V8VA 2FFHA 1D1TA 3N3AC 2VDWB 4QYIB 5FNZA 2PWPA 3I6IA 4ND2A 2GRQB 3NV9A 1SCDA 2Y0BA 1WPRA 1IY1A 3AKDA 5GONB 1F8GA 3CZMA 1DG1G 2D74A 3QKSB 1RBMA 4EVIA 1KHHA 2Q8PA 3CNOA 1FSPA 4IXNA 1ZGGA 1RJ9A 1WCYA 1C9NA 5H81A 3M6XA 4D44A 5AVWA 1B76A 1E3QA 1MENA 2ZR7A 4NQZA 2ZJ6A 4YDRA 5TQJA 4YP6A 5BSTA 4KR7A 2J41A 3T7EA 5A9SB 2I71A 3D64A 2ZUFA 3JR3A 5A1TA 1L4UA 3JASB 3SZGA 2V4LA 5ALKA 5BT9A 5BWMA 1EWQA 1KXJA 2YWEA 4BEJA 3RVDA 1IN6A 4FZVA 4EECA 1U2EA 5AIBA 5TNXA 3KZNA 3RHTA 4ZV4A 1PEYA 2GASA 5CEEA 3RTCA 5KOYA 4GM4A 3VGJA 4Z4IA 2Y1KA 3ZHOA 4H7EA 4OHVA 1QH1A 3EMVA 4GTOA 1ADFA 1ZVMA 3ABZA 4URFA 4YDSA 4I1PA 4MV0A 2QRVA 3V8PA 3SYLA 3VH3A 5KJMA 3URKA 2WD9A 1QLHA 1E6UA 2CXSA 1B8VA 4GLBA 1YZNA 3C1UA 2G9VA 2OXTA 1PJZA 1JDBB 3EIHA 5SV2A 4ZZ0A 3LLCA 1HE3A 1L5YA 3BIXA 3QWWA 2A35A 3I34X 3LUBA 3Q10A 3RSGA 5AT1A 4JUCA 4DSUA 1UFQA 2IHKA 3DE7X 1AU9A 2ZCUA 3HABA 4MS1A 5BV1A 2YHEA 3WGGA 3CSSA 1AVTA 4M0EA 3UG7A 1XWWA 4C01A 4BGDA 1V5GA 1JG3A 2AR0A 3G8CA 1HA3A 1ADGA 1CUGA 4X9XA 3G8BA 2FJUA 4RZXA 4NAVA 3VR0A 1N0IA 3GRPA 1TU0A 4KH0A 3UCEA 5JXIA 3THYB 4QU8A 1PGQA 3W7BA 2ODAA 4U8HA 1RT9A 2NTNA 2ZT7A 3UJ9A 4AZTA 2CNNA 3GFFA 1H93A 3LD9A 3WGOA 2B4RO 1FC0A 2E4YA 4HMPA 4EKYA 1NP6A 1ZSYA 4UHFA 4EFLA 4EM6A 4MI9A 3SOZA 1K5GA 4M1OA 3TVDA 3GH3A 3IP3A 3BS4A 3TSOA 4MMZB 3LX4A 3O8LA 2OECA 4QFVA 2CXRA 4IJUA 4RFSB 3FZGA 5CAEA 1G4AE 5M3BA 1QMGA 1COWA 4KE9A 5EX0A 2G6TA 3LK6A 5TVKA 2WJWA 4BNVA 3L1JA 2FPPB 2IHUA 2H85A 2QAIA 4KODA 4QNNA 5TR9A 1W76A 1RHMA 3EA4A 3NPMA 4WNAB 1OCRE 3AERA 2XGSA 3EFOA 4MVYA 3TRJA 3QMMA 4BMDA 4EF6A 4UVDA 1OT3A 3PFHA 2D3TA 2JA2A 1GEEA 1SVIA 4RPGA 2V7QA 2I4TA 4KITB 2FR0A 1TD1A 1KEEA 5HDBB 4XIFA 3EVDA 5H0IA 1V5IA 3I61A 4NIKA 4X3OA 1FY2A 3B95A 5DF1A 4QM7A 4UU1A 3W2GA 3EW7A 3C72A 4KLCA 1PJLA 1WU8A 2V54A 2A3RA 3NNNA 5BN5B 2HHHB 4WCFC 4HB0A 1VSUA 1YFKA 4Q3OA 1CF4A 1UJBA 2F55A 1BHO1 2H7CA 4DB2A 3KSLA 4W9RA 4R16A 3EAGA 4X1YA 3PHJA 5CP8A 5FEUA 1CV2A 1NJFA 4JEMA 2HLDD 2HIHA 1DT5A 3NORA 2JIPA 1OWLA 2B25A 3R0JA 4R8MA 1YD7A 3RSEG 1VCHA 3E1KA 3HCEA 4B3FX 2KCVA 5IKMA 3KL4A 3PG5A 3SY2A 2XQ0A 2DH5A 2PYZA 3KKNA 1LF5A 4MVJG 2HJWA 2P3QA 4MW6A 5AJHA 1Z22A 2B92A 3MS4A 4F4HA 4XIYA 3Q78A 5D6OA 5CFZA 4EPXA 4YJFB 4W8GA 5IULC 5HRCA 1U28C 2NO7A 1I7QB 1WOMA 4I9NA 5B7PA 3G23A 1ZD8A 1BPOA 1OOEA 4OHXA 3B48A 4QBIA 4QQRA 1PNVA 1J1ZA 4KN5A 3C4QA 3ZZ1A 1HTBA 2HMTA 2WMOA 1KZ7B 4OM7A 2I2OA 3D4NA 1P1BA 3NUZA 1KC1A 4PYLA 2XCLA 4EJFA 2GETA 2DMRA 2MSEB 3U3KA 2IDJA 3BZWA 4HZGA 4MDYA 3VPFA 1XAHA 1GGFA 4LTNA 5DBHX 1VA5A 1O95A 1XMQB 4LJKA 1ZB1A 1OKKA 1I6KA 3UWOA 1Y37A 4E31A 10MHA 5DB4A 2VA8A 5AM1A 1QC5B 3ZU5A 3NJ8A 4EYSA 1QVVA 3L8MA 3NWOA 4QQ8A 1ZR2A 2MYTA 3O92A 1Q7CA 4CKWB 4UE3S 5ALQA 2DUJA 3C45A 4MPJA 2XZTG 1TQ6A 3A04A 3FRHA 2ONKA 5AW2A 2R6DA 4WKNA 4XOUA 3TG2A 3TL3A 1AOXA 1EXMA 2HIGA 1ZCJA 1GN8A 4LJ6A 1FLVA 3N9IA 4ZRNA 4KXKB 4B82A 5JBNA 2FCRA 1IBCA 2CLCX 3RRFA 3TECE 4MZDA 3THYA 1EDBA 3IUBA 5M7EA 3G2TA 1IONA 2QW0X 2X5XA 2Y1EA 3C14C 2RGXA 4OCZA 1XQ1A 2RHGB 1XKQA 2XNDD 1E0KA 1H8ED 3PF8A 3S5JA 4EQZA 2A94A 3AJAA 3LWBA 3ZXUB 4BT8A 3EUFA 1E8NA 1ZRHA 4IMPA 4J0GA 2P9YA 3L7BA 4M36A 5C1PA 4F11A 3ASNE 1MUUA 1MQSA 3B6MA 3DM5A 2CL7X 2GCGA 3E23A 3QVSA 2ZYHA 5E1BA 4ER7A 4Q9AA 5BMVB 1YDWA 3R5HA 2DZDA 2ZUEA 2GEDA 1KAEA 3X1ZA 4C0WA 4QGFA 1EIWA 1HU3A 1YH3A 2B0CA 3OX2A 3QLVA 4GR9A 3DE0X 3KSAC 2ONJA 4C03A 2ZRAA 3VDRA 4WZBA 4NEQA 2HFJA 4D9BA 1NQVA 2WUFA 1GRVA 2GXSA 2I4LA 1GRCA 3OQBA 4UATA 1FP1D 2H1VA 1EDEA 3L0IB 3ZU2A 4N5CA 4AZ0A 4QDTA 5EZ6B 3MT0A 3WOVA 1TQDA 3VLDA 1YZVA 3JQFC 1GCIA 4D7AA 2FFBA 4HQ0A 5AKZA 1CW2B 4P86A 2Z2IA 1PYOA 3UFXA 3JTEA 4YALA 3UK0A 3GA5A 4H7XA 4EMTA 4PS3A 4MS3B 2KWIA 4AS1A 1Z2EA 2R11A 1CB0A 3EXFA 1Z5SC 2AWOA 2QD4A 5FPTA 3IUPA 2YL2A 3W06A 1RJ9B 1I4WA 1N95A 3SIRA 4L8YA 4JVSA 1OT5A 1KYVA 6LDHA 1D8TA 5BXYA 1JILA 2HLDA 2WE8A 2GLTA 3HKDB 3N2KA 5EIBC 3ZV4A 4AD8A 4BY9E 1K1BA 4KQ2A 2ZM5A 3NZSA 4CF6A 2ZIVB 3OMWA 1SG6A 2P4UA 3RVMA 1NYTA 3LO5A 4DYHA 3FCEA 2Z9CA 1E2UA 3MIIA 4QYIA 1RXYA 5CCBA 3AHGA 3Q3IA 4QUBA 4XWWA 1S0UA 2RFMA 2CLEB 3N87A 4LJ9A 3H2HA 4UEWA 1NW3A 4TXLA 1PR9A 2J30A 4EHIA 7REQB 4R2XA 3CGHA 4YVFA 3ILHA 4E51A 5J2TB 4I9EA 2FN3A 4WJKB 4R1SA 4AK9A 3VJLA 1A9XA 4F9EA 4KXFB 2DE0X 3A2LA 4O2AA 4B3SB 1PNOA 4EUKA 2WKWA 4OG2A 2ACEA 3FFBA 3C5EA 1TJ4A 3PWSA 1OAAA 3VU3A 4W9NA 3L8ZA 2QKYA 3EG9B 3W2EA 4BYGA 1QQBA 1QS0A 4Q7MB 1HLPA 3PFIA 3FGZA 3PVCA 2XOEA 2EZUA 1WY5A 3PVZA 2FI7A 3JQAD 1Y48E 2E5FA 3OTGA 4BJ1A 2PSSA 2C4KA 1Y8RB 1ULUA 2AOVA 4RA6B 2VZLA 1DRVA 1SVUA 2F48A 2CF5A 3AF3A 4QUJA 1GZ3A 4QC2A 4PG4A 3FE2A 4C5BA 3RAFC 3TFOA 4KE7A 5J2UA 1E2IA 5JDIA 1JMYA 2R03A 1RAGA 4HDMB 2G36A 2F3QA 5HJ5A 2C59A 3CHMA 2V7GA 3F7NA 2DBYA 1U5BB 5F2EA 4C2UA 3DKVA 3RIXA 1ZOLA 5AW7A 2B69A 1N2JA 4GAAA 2FWIA 1NJGA 4AC9A 3OMXA 1WKVA 1K9VF 4UNSA 4LRZA 5B6JA 3AXTA 2R1ZA 4D4GA 1E2QA 2O52A 1DDIA 2PCJA 3LXXA 3RKRA 4BQQA 2VBCA 7YASA 2I6XA 3WSTA 4HZIA 4ZO4A 1ZLYA 2JA1A 5JNUA 5K09A 3SHFA 4A8JA 4ROTA 1U1FA 3KPWA 5I4BA 1B6GA 4RY0A 4E5UA 1KOGA 1OFUX 2HXSA 1WF6A 2J6CA 1NFIE 3C1OA 3DEHA 4DMRA 4EO7A 2FMUA 3TZEA 5F23A 2AXUA 3PZRA 3EVZA 3RBXA 4URZR 3KHKA 4R7LA 2NXPA 4UOEA 1M1YE 1JRLA 1T9ZA 1OLSA 5FA8A 1JWBB 4NBUA 2QLNA 5MFPA 2PQMA 4C0BA 3HYRA 2HR1A 1PJ3A 2HN9A 2XW6A 2ZIXB 5LZ2A 3FU0A 5GINE 4DR7B 1OR8A 3MGGA 4IRXA 3T3OA 5CEAA 3R5TA 4GMXA 4P33A 4BKPA 1UBCA 4CF4A 3KKMA 3IIMA 3TLGA 1UBKS 2PMWB 4RNDB 3ZGOA 4DX6D 4XM1A 2Y66A 4PW0A 3RSCA 1JR2A 1XXHA 3LKZA 3TDMA 3ZGYA 4YRIA 1FFYA 5CMWA 4P84A 4FOPA 1SVOA 3DTTA 3JD4A 3OTIA 4IJVA 5ENZA 5DNYB 5MGBA 4RPLA 2VZ9A 1JKJA 3B7SA 1FUEA 2E0IA 4V38A 4D3XA 1U9ZA 2EBUA 1EE2A 1YI1A 3A37A 1M6YA 3I2GA 2IYAA 4X61A 4UD6A 5IZCC 2P9FA 1NBAA 2ICAA 3CZQA 1BXGB 1SFRA 1PZGA 3F6PA 1KI8A 3SF8A 3TIVA 3I9LA 2C5SA 1N6NA 1VDMA 2ACWA 2O7QA 3WGYA 4CM5A 1GTSA 1YB6A 2ZPUA 5KJLA 1YI8A 3BGVA 5AVYA 1BROA 3CZ5A 1UJKA 1SBCA 5AVSA 2PAAA 4GL2A 5LC1A 1ZOOA 2DFPA 3AKZA 2H2GA 2IHYA 3I39X 1H2ZA 2WYOA 2VR1A 3ZHEA 1CKEA 3K5HA 3KVNA 1WDMA 4F6RB 1IVSA 1W5EA 3QW4B 3IR6A 2EILE 2B1JA 1P7ZA 2QF7A 4YRAA 1C7RA 2J08A 1FK8A 2G9ZA 5LL6P 2VPZA 2VHZA 2WHRA 1VSTA 3QLEA 3S8MA 3L8GA 5CXSA 2GBCA 4Q1BA 1A9ZA 4QWWA 2JGRA 5BNZA 4BNLA 1OX6A 2AD1A 4IVPA 3IEXA 4JI8B 4ABNA 4ZCMA 2PL9A 5IMSA 2WSSD 2JCXA 1O6CA 2P9QA 1BDBA 1BEZA 4QE3A 3BGWA 3K0BA 3LK7A 3LLVA 3W05A 3Q8LA 1QSGA 3CXRA 5DGDA 3LLUA 3SBSA 2UZ4A 3RC8A 2OHXA 4WZBE 5G4KA 4BNMA 3OX3A 4NTZA 1A8IA 2HQOA 5T7BA 1R0XA 4GX5A 3G5AA 4FHJA 4N48A 3HXLA 4P5PA 2FEOA 3JQEA 4Q00A 4X7BA 6GPBA 3PIIA 1BU5A 2XNSA 4ESOA 3TLKA 5CIYA 2ZRFA 2GBGA 1ZIDA 5FTPA 4LJ7A 2WU4A 4MXDA 3ZPXA 2EEZA 4ME6A 1LLDA 1R6VA 2M6LA 4X62B 4MVWA 3DLTA 4LNGA 1U8UA 2AXPA 2DPGA 2NYJA 2JGJA 3B60A 1CR0A 2I8CA 2WTMA 3GIWA 4FFSA 3UJ7A 5AH0A 2NSHA 4BBZA 5EIOA 5HF9A 3E3LA 4LYYA 3SIPA 4Q9DA 3FMVA 5FBVB 1OXBB 1FQJA 3F0TA 3ZZTA 3NHKA 1SKYB 1TUIA 2OP0A 4J0UA 1CRWG 2BY4A 2Q6LA 4LZZA 4Q3NA 3CVLA 4LVUA 3MMZA 5FL7D 5KYVA 2QRGA 1ORIA 3DDNA 4FOSA 3VR5H 4QA9A 2O8EB 3A36A 3FTSA 3PL5A 5HRUA 2WMDA 4ZC8A 4FGLA 1TAUA 2CBZA 1Q2ZA 3X2SA 4F5ZA 3QLVC 1ZGHA 2ZB8A 4R41A 2FN4A 3DHEA 3EQ6A 3ST7A 4C43A 1DO8A 3DZGA 4LXUA 4LMRA 3O8QA 1UKEA 3R5SA 5IKEA 3VAZA 2G9UA 3W6NA 4IDGA 1ECLA 3DZKA 2X0EA 1NXOA 1V7ZA 1ZVKA 3HV2A 4NY1A 2CSXA 1MV5A 1ZW1A 2YHIB 4C7OA 2BDUA 3TWVA 1G4UR 4NJEA 1GTL1 1YZYA 5FAKA 4PZLA 3MWFA 3RS4A 2IUYA 1F51E 3AVPA 3RU7A 3VVBA 3SC2A 1TB4A 2QG4A 3ECAA 4O4LB 4FNMA 5KYUA 2V7BA 2IXEA 1VE5A 3IBYA 1DKPA 1B89A 1USVA 2HJ9A 4GVXA 4O1IA 4KFUA 4GF5A 4RA6A 5DX8A 3ZNGA 3DFFA 2ZJYA 3Q40A 3ZY2A 5JTUA 3QEAZ 1N4QA 3UW1A 3DEKA 1EDUA 4ZT6A 5G1PA 5IM4F 5C52B 4WT7A 1MW9X 3P2KA 1V16A 3FKSA 4P58A 1MX2A 4AUMA 4C3OB 3UN1A 4DDVA 3KIPA 4BAZA 3DPIA 4AYXA 3ILSA 5B58C 1DHRA 3V7YA 1JYFA 4F4JA 3BICA 4H35A 1A96A 1C4WA 1FNDA 2VAVA 5LJIA 4G0YA 3A1NA 1KZPA 2OCPA 4E3ZA 1C7ZA 3KSMA 4QASA 3SBOA 2OFOA 2XEHA 4FCWA 3S0JA 2APJA 4GQAA 7REQA 1RHJA 2BBTA 5JRZA 3EFEA 1U80A 3DP7A 3PB3A 2PUDA 3IO5A 5EE3A 1RVV1 1Z4NA 3MTQA 4U63A 1Q74A 3OLYA 4TTIA 1KO8A 1A0OA 1SB9A 3O8OA 3NHSA 4UHJA 1PFWA 3PTAA 4HYYA 3J81k 3HJHA 4X66B 1HH8A 3LC0A 2CWDA 4NK4A 4NU0A 4UDXX 3L6CA 4BNUA 1C50A 4GZ3A 2VWQA 4PBRA 2QRPA 2I4IA 2V4HC 1Q3HA 1W96A 1XVIA 4DLNA 1BXRB 1SCBA 4BZPA 4BMZA 2AKAB 1KBZA 4LEIA 1DIHA 2EJVA 4XJVA 1C1DA 1JSXA 3MW8A 1P17A 2VYVD 4FMCB 1YMQA 5EAIA 1T9HA 3FTXA 1EHYA 2YC4C 3DE4X 3EXFB 4OBWA 4RA9B 3AW9A 3TZQA 1Z2OX 3CNHA 1SD5A 1KFJB 2Z2JA 4RTSA 4FNAA 4MVJD 3CF4G 4WD3A 2PMFA 4Y2GA 1PC2A 1DZ3A 2YMMA 3PXDA 1PG5A 4FEYA 4MS4A 4MW1A 1VDYA 1QIEA 1V11B 5KNLA 2NZWA 3FUDA 3KTDA 3NX4A 5GJBA 1IATA 2WJ6A 1E9FA 5BQ5A 4E07A 3HZOA 3L17A 4KE8A 1Q7TA 1O6BA 4J2OA 4NABA 4OQQA 4CLOB 2PSDA 3NBYC 1X0XA 2IZZA 4RD2A 1MRSA 1XDUA 3VOBA 2JAOA 1C30A 1XTIA 3P9RA 4G8LA 2ZSDA 3DPUA 3P9NA 4CEJA 1G8SA 3UANA 1QYIA 4X54A 4DV2B 1U7WA 4A92A 4HTFB 3U2QA 1ZH8A 2GF9A 4XARA 4JI0B 5DGXA