4I6EA

A vertebrate cryptochrome
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
490
structure length
471
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQEDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKANANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Cryptochrome-2
total genus 156
structure length 471
sequence length 490
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6eA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6eA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6eA01
1U3CA 1IQ0A 3A05A 4DDMA 2Z3VA 3CR8A 3SEQA 3LOQA 1EXDA 1TEZA 2BTEA 3H05A 1ZJWA 1HYBA 4XFJA 2VXOA 3CLRD 5TS2A 2H29A 2QTRA 2PG3A 3GMIA 2A86A 3N8HA 4XFDA 2BYTA 3DV2A 1M83A 3CVXA 2ZUFA 1TYDE 2QUIA 3H97A 1JHDA 1XNJA 3TS1A 3PNVA 1QRTA 1M8PA 3JXEA 4MUFA 1KQPA 1NUTA 1O96A 1T6ZA 2R5WA 1K92A 1S4MA 3FH0A 1WJGA 1XJQA 5LFAA 3FDXA 4MUIA 1U3DA 4KKVA 3TZEA 3VRHA 1O6BA 3CVVA 3IMGA 1LW7A 3SYTA 3VGJA 3FIUA 2DPLA 2A1UB 1F4LA 3MLAA 4BWVA 3IODA 3A2KA 4L2IA 1YULA 1M8GA 1YUMA 1ULHA 1QNFA 3CVWA 4ZT6A 4EG4A 2CYAA 2DUMA 3IH5A 1MBZA 2D54A 3A04A 1EE1A 3HFJA 4NZPA 4F3RA 4U7JA 4L2IB 1UFVA 1QJCA 1WQ3A 2CV2A 1IHOA 3PNYA 1LI7A 1T6XA 3AKZA 1ZH0A 4CDNA 3BL5A 3MLBA 3RFFA 2DETA 2JANA 4G5YA 1N2OA 1PG2A 4PBSA 1JIJA 3FWKA 3HZRA 2AZXA 1NZJA 4MAFA 1WXEA 3C8ZA 4R0NA 1O94D 4ZT4A 1R6TA 4QREA 3ELBA 4J75A 1JZQA 3CLSD 2XRYA 3ZJTA 3AG5A 4ZT5A 1PFVA 1TQ8A 1U7DA 3RHSA 3COYA 2CT8A 2RD2A 5LM3A 2ZUEA 2A1TR 1N78A 4RUKA 4ZT3A 3RK0A 4NATA 1YI8A 2D5BA 4TS1A 4MW0A 4EFKA 2CV0A 1JGTA 1D2RA 1F9AA 3LE8A 1KP3A 1T6YA 3P0JA 5DEOA 1MAWA 1N2EA 2VTBA 4JXZA 2WSIA 4MUJA 4AS1A 3CVUA 3KT6A 1WKBA 4KR9A 1JEEA 3G5AA 4Q93A 4ZCTA 4KR6A 1G59A 4YP5A 2A7XA 5EKDA 3PXUA 1QU3A 3FNRA 3Q10A 4R2MA 1JZSA 1NURA 1J20A 1J1ZA 4HK4A 2AG6A 3P0IA 4YMIA 2RE8A 1TYAE 4DLPA 3G59A 2X1LA 2WQ7A 4MW7A 3UK2A 5JBNA 3ZGZA 5DB4A 3AFHA 5F23A 3KFLA 2DLCX 1MJHA 1JECA 1O97D 1KR2A 1I6LA 1PFUA 1G8GA 2B7LA 1PFYA 3I05A 1T9GR 4YBRA 4QBTA 2V0GA 2A88A 4GU5A 3TNJA 3CLTD 4DE5A 3H9BA 2O5RA 3FOCA 1NUPA 4KPUA 1F7VA 3K9WA 4ZCSA 3RJZA 1OBCA 4F4HA 1M8FA 3U1VA 1V47A 1GTSA 2E89A 1H1TA 1OWNA 2CV1A 4EG7A 3QTBA 2QUJA 1M8JA 1DNPA 3FHJA 2PIDA 2CUZA 4JYZA 1R6XA 4MLPA 2E18A 3COVA 5HUHA 3ND5A 1QRSA 1N3LA 4DNXA 1JILA 2PZBA 3UC5A 4MQ6A 1KQOA 2EJCA 3IVGA 1KH1A 3NV7A 1R6UA 2XRZA 1NUSA 2WB2A 4NAUA 5TGTA 2I1LA 3KT0A 5KCMA 2A1TS 2YXNA 1I2DA 4ND7A 4ZT2A 3SZ3A 1LI5A 2HZ7A 1Q15A 3TQOA 1IFXA 2E21A 5FO0A 1J21A 1KH2A 4PBTA 1O95D 4NDAA 5KHAA 2J08A 2YWBA 1I6KA 3D6VA 3D6UA 1XNGA 2QJFA 4DDHA 2J07A 3IOBA 3VU8A 4EG8A 2QJTA 3RBAA 1CT9A 4DDKA 1I6MA 4MVCA 1RQGA 5DK4A 3ZJUA 4PBRA 4OUDB 3RK1A 1GLNA 1KQNA 1H3FA 3X1JA 1KAMA 3ZXIA 2ZP1A 4WSOA 1NI5A 1NYLA 3N2YA 3ND6A 2X3FA 4P2BA 2IP1A 3IOCA 1IQRA 3P0HA 1N77A 2J4DA 2YWCA 1MOPA 2CFOA 3INNA 4ND6A 5HG0A 3DLAA 3PRHA 2QTMA 4XSVA 2J09A 3CLRC 4K03A 4OUDA 1QQTA 2DEUA 5IHXA 1PG0A 5J59A 3IVXA 4PY2A 1Q11A 3TQIA 4YP7A 1VBMA 4ZCRA 4AQ7A 1QU2A 3S3TA 4ARCA 4MW5A 1T9GS 1O95C 4A91A 2Z09A 1NUQA 1G8FA 4I6GA 1M8KA 1ZUNA 3MUEA 1O5TA 5BNZA 3Q4GA 1YIDA 3TZLA 1N2BA 3AL0C 3AG6A 4MW2A 1XNHA 4MULA 5K0TA 4G5FA 1TYBE 1WXFA 5LLTA 2QTNA 3ZUGA 3GLVA 4CDMA 3L92A 2EL7A 1EFVA 1GZUA 1TYCA 1OWPA 3ND7A 1IH8A 1MB2A 1O0CA 4HJXA 4ARIA 3X1MA 2PFSA 1TFUA 1MAUA 2QUKA 4HPWA 4MW1A 3IOEA 5K0SA 4MUHA 1VL2A 1K4KA 2E0IA 5TEWA 4JZYA 3SZGA 2CYBA 3CVYA 2OQ2A 3QE4A 3ZXSA 2H2AA 2JA2A 1KAQA 3SEZA 2X0KA 1P7PA 3HMQA 3HV0A 2NSYA 3AIIA 3SP1A 4MWBA 3SDBA 4EG3A 1X8XA 4MUNA 4ZCQA 2DR2A 1O97C 2C5SA 1EUYA 1WZ2A 2GKSA 2CSXA 2A1UA 2PZAA 3IUBA 2V0CA 2YY5A 5KWVA 4MW6A 1OWMA 1OD6A 4MWCA 4K0RA 5HUJA 1FFYA 1JIKA 3UY4A 1QRUA 2PXHA 2IJGX 1WOYA 3ISJA 1KH3A 4ZCPA 1ILEA 3KT8A 1Q77A 3HGMA 3ILVA 4MWEA 3FETA 5DASA 4EG5A 4GRIA 4YP6A 5IJXA 1IVSA 1FYDA 4U8HA 4QRDA 4ZT7A 1VBNA 1K97A 3KT3A 1V8FA 4U63A 2AKEA 3QTTA 4OJMX 1BS2A 2DERA 1A8HA 1N2GA 1JMVA 1GPMA 1JEDA 5J58A 1M1ZA 3H99A 4UZFA 1VBKA 1WXIA 3IMEA 4EG1A 1N2IA 4MW4A 1J09A 1WY5A 1NUUA 1YIAA 3A4IA 4EGAA 3GUZA 4I6JA 4I6EA 4X0EA 2QJOA 5J5AA 1NSYA 3IUEA 2VTBB 4WNYA 1KORA 4FZJA 4EG6A 3N9IA 4UZEA 1OWLA 4E1AA 1YUNA 1MB9A 3G6KA 1K4MA 1WQ4A 3Q12A 3CA8A 3H9CA 4G6ZA 4Q16A 2X1MA 3MXTA 1GN8A 4H3SA 4MVXA 1OBHA 4HJRA 4MVYA 4R2LA 3COWA 3FI0A 1Y42X 3CLSC 3NBAA 1PFWA 5H7XA 3CLUD 1H3EA 2J5BA 4CQNA 1J1UA 2HMAA 3NBKA 1X6VA 5FNZA 1JIIA 2QUHA 4NX2A 1NP7A 3L93A 2D13A 5H16A 1U0BB 2WQ6A 1EFPB 1KP2A 4MWDA 2A84A 5TEVA 3UMVA 2GOYA 1B6TA 2TS1A 3FG9A 1U7XA 1WXGA 3IMCA 3CLUC 1IQUA 2O8VA 3HL4A 4MUKA 4DJAA 3OP1A 4JXXA 4RPIA 1MRZA 3M5WA 2NZ2A 3K32A 1N2JA 3PNBA 2PZ8A 1GTRA 2DXIA 3UOWA 1WXHA 1EFPA 1N1DA 4MUGA 1O94C 3DPIA 4EF6A 1F7UA 1SURA 1H3NA 3OTWA 4KPUB 2CYCA 3N05A 3IVCA 2Z08A 3E27A 3X1KA 1O96B 1IRXA 1N75A 1OWOA 4CT0A 2IELA 3MMXA 3COZA 3FY4A 2JAXA 1ZH6A 3P52A 4JFAA 1EJ2A 5AHWA 4NAHA 1Q19A 3DO8A 4J76A 3CLTC 4MW9A 3F3MA 1J70A 4MVWA 2G36A 4KR7A 1QTQA 1N2HA 5FO1A 1G8HA 2A4MA 2OV4A 2GM3A 1GAXA 4S1OA 1KKUA 4MUEA 1COZA 2HGZA 3LCJA 3ZJVA 3IDFA 1O0BA 1EFVB 3ZIUA 1EUQA 1VLHA 1MC1A
chains in the Genus database with same CATH superfamily
4ETMA 1H4SA 1IQ0A 3LCMA 3FOAA 2GBGA 3TKYA 1UC8A 2BRUA 4Y2XA 1O1TA 4RHFA 2XNDD 3CRW1 3SJAA 3UICA 3T7JA 3N0RA 1ZW6A 5T64A 1QP8A 1KS9A 1XMIA 2JGMA 2XYPA 3IUSA 3L6UA 4OTZA 4BO5A 5A5GA 2Y6VA 1H1LA 2WSSD 3ACBA 3VH1A 5KSOA 5SZIA 3VTYA 1TN6A 1X3SA 2WU8A 1U5CA 2Q9BA 521PA 4YAIA 2V5QC 2H29A 1T4GA 2QD4A 4V0RA 2AMFA 2UVDA 3BXXA 3VSAA 1YGYA 2OZEA 1O7JA 1IZ9A 4NYIR 2PLWA 5EGSA 1OLSB 2IZ1A 1QV7A 3N8HA 3Q0IA 5EPUA 2JIRA 2Q4EA 3DV2A 4KWEA 3TXNA 3MIZA 3K0CC 1WMBA 3BDIA 3O91A 3PA8A 3T5MA 2DY0A 4JYMA 2VJ8A 3BZUA 4D8WA 3N3BC 2ZUUA 3STHA 3OD1A 4FGJA 1IZ0A 4F4JA 2P5SA 3AH8A 2H7XA 3S1LA 4C21A 1FU7A 2M2IA 4DWVA 2OV8A 2QMUA 1RI1A 3Q5GA 1X80B 4LOKA 721PA 1IN5A 3FHEA 2BGTA 1E5LA 2QPOA 1WY6A 1PS8A 1ZH8A 3D8RA 3UK0A 3KUUA 4CDGA 3CG0A 2OBMA 2AC2A 3GZNB 2A1UB 2JCVA 3EWIA 1E4EB 2CL0X 1N9KA 2C0QA 2HC9A 2PSDA 2VK1A 4JNKA 2E55A 2QT9A 3IBCA 4KMSA 1FFEA 3SQMA 5CLLA 1IAVA 4QOFA 2DR3A 1HZJA 4DHEA 3CHOA 4GI1A 1YCGA 2C3MA 4NOMA 4AKTA 5L4LA 1EGAA 3EASA 5JSFA 4NV3A 3KPUA 4GA1A 2QMOA 3G8CA 2Q0XA 3CQ9A 3L7YA 4RJ2A 5CH8A 5AJTA 5DI3A 3EVTA 7GPBA 3HZHA 4LZZA 4PRLA 3RU3A 1E2IA 4EHKA 5FUVA 3RWBA 4PSVA 5K2OA 2D0DA 3HU2A 3PEUB 3CPJB 3IHLA 1R0ZA 1IKND 5JPIA 5IWCA 1U3FA 1ECJA 1LLDA 4FBMA 1RW4A 1UQTA 2ADMA 3ZXYA 2VDKB 2Q45A 4QRIA 3AKZA 2D1RA 2VPTA 5ICMA 1VPDA 1QX4A 1EE2A 2Z6UA 3IDQA 4IULA 2E2EA 4G1CA 1KKLA 4TV9F 3TLBA 4OI1A 2PD6A 1SHKA 2XV1A 4MGYR 1X87A 2YBEA 3PWTA 2C5LA 2H3EA 1BJKA 4UTXA 1RZ4A 2NAFA 4TLCA 1XEWX 3ELBA 2GN4A 3E0XA 5KOYA 5FAXA 3P4UA 2C4UA 2XRYA 4CKWB 3VLDA 1SHTX 1UPTA 3M4XA 1O08A 4JWTA 4P22A 4QWWA 1GSOA 4WL0A 3RJ5A 3ZD9A 1TQ8A 1JXAA 3DYIA 3MA5A 4BRWA 1BMTA 4GPBA 6GPBA 3NT4A 2VBCA 3GY0A 3MJTA 1UOHA 3N8KA 3TE7A 2QUAA 1X7DA 1LQ2A 4ATNA 1D2EA 2V4LA 2ZANA 5KQLA 2FUNB 4KO1S 4NEQA 4ZIRA 1PJQA 3O8BA 3WYAA 2HIMA 2DBVO 2JBAA 2ZU6A 1N6RA 2EHJA 5H9VA 1AUQA 2HSDA 2J9GA 3PFWO 4TTTS 1XZHA 4RV9A 1R5OA 3HY6A 2GMWA 3CH5A 1GT6A 3VMFA 2CV0A 2GEFA 2PS1A 1GUDA 4F1JA 1DCMA 3GCWA 1D2RA 3PGA1 4IXNA 2ZSDA 3ZWPA 4HWPA 3GZ4A 3ZE6A 4MIEA 5THXA 4ENSA 5LVAA 3BSWA 1CDOA 3NHZA 1SRQA 2Y0BG 1RZUA 4DQ0A 1N2EA 1M6YA 4YLEA 3DZHA 3KQWA 2GM4A 1J8DA 2ZYIA 2UU9B 3L0PA 5SYAA 1LBHA 4A1SA 1S01A 3F78A 3PR1A 4HN2A 1H8HD 4R9VA 4RFSA 4RJJA 4UTRA 2WUVA 5JZBA 4HVAA 3IPXA 4ZEMA 4KR6A 1DTEA 1PV1A 3L0IB 4UQZA 5A6SA 4G8CA 5EKDA 2QBYA 2H6EA 1KVUA 3PZ1A 4RV4A 4UEOA 3ZTWA 4RULA 3ER6A 1AS0A 3ABIA 4ER7A 2O5EA 4C04A 1J20A 1E8XA 2RCYA 3PR2B 1L7NA 1O5MA 4NAVA 3KKQA 4PLCA 1JAHA 4L0MA 2CJFA 3GEHA 4OU4A 4U7TB 4E30A 2RE8A 3JQFC 5IYZA 3PUHA 1S8FA 2BMEA 3R0JA 3BD8A 2PUAA 4YDEA 3ZGZA 3MGKA 3X1ZA 5JU6A 2I9KA 4GBED 1RXVA 1G20A 3N2GB 5ES3A 4BQEA 1B6RA 3Q8LA 4XIYA 3AIKA 1SELA 4F1KA 3CX8A 4KJZA 1N54A 3WAGA 4YRBA 2HO4A 2LRHA 4EKNB 1RPZA 2XUJA 2I91A 4ME6A 5FZQA 1T2DA 1RT9A 2XY4A 4JP8A 3C4VA 3HM2A 4Q05A 4DE5A 4NBTA 6YASA 5ITSA 5C1BA 2VJCA 3PENA 4JD5A 3ZDYB 1IY8A 4DBZA 1V2HE 2XA2A 1KEKA 3UXYA 1WVIA 2EAUA 3NS7A 1C9EA 1T4CB 3QX3A 3N0TA 1G4UR 1KU0A 1IY0A 2VDRB 2VEOA 2R79A 2FFAA 2FWIA 3CRZA 3QBTA 4CM6A 4MH0R 3TW8B 2WJVA 2VTEA 1MO3A 3B52X 1U0GA 3DDSA 3NBUA 2QLMA 1LSUA 3LQQA 3ZWVA 3A4LA 1E9FA 1U1GA 1Z45A 4FSHA 3CR3A 3AR7A 5HJ2A 3JCKC 1KBQA 1OGJA 2X38A 5JHGB 5C8YA 1E2HA 3SDZA 1IPHA 3SICE 2Y4OA 4CT4A 4MLPA 2IYUA 2QZAA 2Q4OA 1OKKD 4KR0A 2IYSA 1RABA 3HYCA 4ZI2A 1WF3A 1ETUA 3HYNA 3ZXXA 5E2BA 2B8EA 4GVXA 4O2AF 1NNEA 3HVUA 4JHXA 1EUDA 1BEZA 3VDQA 5FQ6A 5I4KA 4RJTA 2C00A 1NUSA 1UWLA 1UKVY 5BSFA 5LPNA 1BJRE 1SZAA 1EU1A 1Z7GA 2JJ2D 2QRHA 4NYJR 4KVAA 5TGTA 3WGVA 4NVRA 3UG6A 3E53A 3G2KA 2HWKA 2H3HA 1GQYA 4I2NA 4IS3A 4QXQA 1N4DA 5IAEA 2ZXUA 3PJRA 5LLDA 4IVQA 4DLVA 1KDRA 2R8PA 2VP0A 3BMNB 4FE4A 4ZAGA 2VBIA 3FJ1A 1RAEA 1N9ZA 5K7SA 1O95D 4DARA 2OA0A 4ACKA 1Z5ZA 2GRNB 3PXAA 3K4QA 3HP4A 1F12A 2JGDB 1DJLA 3E8SA 1WA5A 3ANLA 5JMND 1XNGA 2O7QA 4GGOA 5D00A 1M75A 3HK2A 1IZ7A 4ZV9A 1NYQA 4C0XA 1SUPA 2RHOA 1X2BA 4JA9A 1RAAA 2ZE5A 3SVTA 4KIJA 1XAIA 4TUYF 2ZSEA 3W7VA 3HI6A 2O1EA 4PTLA 1XTJA 3JX9A 3UUXA 5AESA 4HOSA 1Z28A 4Q24A 5CVUA 3KQOA 1YQXA 3AG2E 2LKCA 4IDCA 4E5UA 1MQSA 4J9VA 4WI1A 3AR4A 3CO0S 1TJNA 3AR6A 1XZQA 3FTXA 2QZJA 4U9HS 4MHTA 3V8QA 2BMDA 4N0MA 4N40A 1JYFA 1YJXA 4INZA 5KCZA 5BW5A 3J5PA 3KELA 1Q0LA 1EUCB 1QHIA 2E82A 4OL9A 2PVPA 1XAGA 3MJEA 5CDGA 2R2AA 2BGLA 1CVIA 2HTFA 2RGNA 4LMRA 4MR7B 2P9YA 4BAUA 4YV7A 5I9BA 5CA0B 1INLA 2I7TA 4BO8A 5J58A 1ABEA 2ODAA 2CBZA 4TVOA 3N1UA 5FINA 3T7EA 4M0UA 4GX0A 4NS4A 5I9TA 3WBJA 4LRQA 4RSGA 3ER9A 2SCUA 4A9AA 1OXXK 4TVSA 3FOBA 3RYCA 2CLLB 4Z2YA 4F9TA 2RHRA 3ZHBA 5BMVA 3LK6A 4CM9D 2J09A 2HF9A 5FT9A 3GWZA 1ENOA 3TFOA 4TXPA 3T3PB 4N5CA 3W05A 3OY7A 4M98A 2F3SA 2N46A 1QCZA 2KJQA 5BYBA 4KHZA 3HO8A 3NEJA 4D0SA 1UN9A 3S3TA 4ARCA 5JH7A 2QAJA 5BMVB 2BI8A 3ENVA 2QR2A 2PE5A 2NO6A 1UANA 2DBZA 3JD3A 1EDDA 4XUCA 1T3HA 1HQDA 1SCIA 1GPYA 3L1UA 3MJFA 1QHHB 1ISGA 1RMQA 3MUEA 1VECA 5GWXA 3UATA 3W0LB 4WGGA 1DL5A 4GHWA 2CCGA 4YAUA 3SFXA 1GUFA 2OFXA 4B0OA 2DAPA 3QVMA 4IXDA 2QRZA 2LBPA 2P2DA 1XGWA 2R3SA 3G23A 4L4YA 4MULA 4MR7A 3CNHA 3TTXA 1BXRA 1GUZA 1ATIA 1ELWA 4CDMA 1WZCA 2ZBUA 2XDWA 2P75A 2PN1A 3MPUA 1YF3A 5FPHA 4JUCA 4IIEA 4UDOA 5FUQA 2EG9A 2JGFA 2AX3A 3KP1A 1ADGA 4HX9A 2NXCA 4GQIA 4ZVRA 5J2UF 5TPWA 1O0CA 4PZDA 3QBJA 3EXEB 2Q3JA 3ZKWB 3GUYA 5B4UA 3PHIA 4YGYA 2OCLA 5HFNA 2HDHA 2Y1EA 1C1DA 3Q85A 4I2VA 4LHWA 1FMFA 1W36C 1ULZA 3FXAA 1YVPA 3EQ8A 5BWOA 5MF6A 1U5BB 2ZS7A 5FBRB 1G55A 5M04A 1P62B 3GOHA 3ZYZA 5CHEE 5LCWJ 4MUHA 4PHFA 1PF7E 2YHIB 2WFZA 1H5NA 3KKOA 1RRMA 2BKXA 4I5EA 5JQGB 3JQ7A 4UNSA 3DE4X 2PEZA 3ICPA 3SZGA 1IMOA 4OFZA 4K3UA 1YE5A 4DJDC 1K8QA 5HCUA 3SZRA 1H2VC 5JWHA 4IM7A 4BMNA 3MJSA 5LU8A 2LW7A 2HBYA 2PX0A 2V59A 3HMQA 1B26A 3FE2A 5GGYA 2MSNA 1T9DA 1X80A 2ZSFA 3CBGA 4L50A 2EZUA 4HG2A 3CH4B 4GWGA 3RTAA 4L1KA 1JHXA 3WOHA 3CE9A 4F56A 5DSTA 1Z73A 3PPWA 1LK7A 1AKMA 1EXVA 3GLIE 2PWPA 4O4JF 4F6RB 3ZDAA 4ISBA 5KWVA 2R68A 3R7RA 3EVEA 5FAKA 1OWMA 1E8NA 5UKDA 4YMHA 4K05A 4LOHA 3WL5A 4IBOA 5HUJA 5ELXA 1AE1A 3MMPA 5D86A 3ZQUA 2IVZA 2VL7A 3KR0A 2RFMA 2QSUA 2XB6A 4BMPB 3K0AB 4D1YA 3I0MA 2J3JA 3NRCA 2OZVA 4FGKA 1FDSA 3ISVA 5BXQC 2QR5A 4CMIB 2V03A 3KT8A 1IBSA 1D9SA 1PDOA 3FMVA 2AOWA 2H1HA 3R6DA 2TRSB 3AF2A 3ETHA 3GJ3A 4N5IX 4RKEA 1Q95A 3KAKA 5IDWA 4RTRA 1JR3E 3L49A 3Q2KA 2WJ6A 5IJXA 2FN7A 2GO1A 3MYYA 1XMJA 2I54A 3M6UA 3NUGA 4FX5A 1T0JB 4MRAA 4UTVA 4BGEA 1T3LA 4CIBA 2FPWA 5KX5B 4E6EA 4CGZA 2WJGA 4FMCB 4FIDA 4BV9A 1BXKA 3C7KA 5AM2A 1W36B 4O1HA 3LY8A 2B35A 1GTVA 1SUEA 1M7HA 2JFYA 4LWOA 4O25A 3H1AA 2NWQA 4ZPJA 4AKGA 3K4HA 4J0JA 5BP7A 4RIIA 3KLOA 4F3TA 2QA5A 2CF5A 3D9MA 4BZWA 5G0TA 5B57C 4PXYA 5ARFA 3BQMB 4WECA 1Y7LA 3G2MA 2OXCA 1LK5A 2Q5FA 3HVIA 4DG5A 4FJZA 1ZK1A 5J5AA 1B6SA 3PFCA 4KO8A 3IUEA 3MWDA 1M74A 4PZZA 1UDBA 4ZVQA 1RWXA 1YMQA 2FX3A 3E35A 4C0QC 1HPLA 8LDHA 2XS1A 5HZMA 2FEXA 4K6CA 3O4JA 4QDXA 3T4PA 4AEZC 2O0MA 2CLDX 3LY7A 3RIBA 1K4MA 1A8UA 1WQ4A 3K4PA 4OXYA 5DBIA 1NJ5A 3ME5A 4BPRA 3OFKA 3B82A 2IDZA 3MWKA 3SEAA 1DQSA 1YB4A 1ZN8A 2M6SA 3QB2A 3RU7A 1OCEA 1FRZA 2QTZA 3Q6NA 4CKBA 1TUIA 5LP6F 4JMLA 1RQLA 2FE4A 3FI0A 1IK6A 4GG1A 4LNUD 4YCLA 5IDXA 1PFWA 1CYDA 2AUTA 2CMDA 1ISMA 2F2TA 3BB4A 3E9CA 5FJJA 4C7VA 3RO7A 2XRMA 2FW1A 1M72A 3CSSA 3MWFA 1ESDA 4LYHA 5EERA 1F06A 1T5SA 3NXKA 1MN6A 1PV2A 2HX1A 3NTVA 3NVMB 4MRUA 4WMLA 1D7AA 4D2IA 2C0CA 4O29A 1XCLA 3O4GA 3OI7A 2D13A 2EP5A 4REMA 2ZUDA 3I4LA 3L0BA 2FPXA 3CE6A 3USZA 5M7EA 4B6QA 1XL1A 4EGCB 1QP0A 2MWMA 2VPWA 3AUAA 4TQGA 4DV2B 4FJ0A 4N03A 2GXAA 2B8WA 2H4XA 3PWZA 3DO5A 2WXOA 1VCMA 1Y7HA 1CEQA 1R0XA 1T1SA 1G3RA 1TYQG 1QGZA 2XZDG 2RB4A 3DMHA 3FWYA 4G4IA 1N4RA 3HKEA 4X6XA 1P61B 2J4CA 5C4MA 1QDUA 5JNSA 3HL4A 1LC0A 2FDRA 3K0KA 3WYCA 3O2NA 5LYJF 3M2TA 4ZIRB 5AVVA 5E7MA 5E2AA 4BNJA 1J49A 3MSXA 3VC7A 1KO1A 1IOLA 3NGXA 2W2LD 5AFSA 3FMGA 3KOMA 2WTBA 1WUKS 3DD5A 4TSRA 2OEWA 3ZU5A 1W8DA 1CU1A 3I2HA 2REQA 3H1FA 3ILSA 4XW2A 2FWPA 1EMDA 2OGUA 1UT6A 2XMDA 4Q7KA 2F3UA 4TMFA 5I48A 1H0HA 3CKLA 1LBEA 1YACA 1HFWA 4WOCA 1UKCA 2CMFA 1QGUB 2OHGA 2OK7A 3A6DA 5DWQA 2B36A 4UWGA 1Y9AA 2B6HA 4Q9IA 5DTRA 2X22A 5AKGA 3FNBA 2CHVA 5K03A 5G2NA 3MMXA 4HRMB 2HV8A 2WBLC 3EXIB 4IGEA 4XXHA 3EZ9A 3TWUA 1MGOA 1K8YB 2ZWVA 4FJ1A 4TXQA 1NZNA 1Y6QA 4IPTA 4OKSA 3CTMA 1QHNA 3SYLA 1RYDA 3KX2A 4L75A 1TCCA 4LJ4A 2D1FA 2B1IA 4AOFA 3DPDA 1JKFA 1QYCA 1K7EB 3F5MA 3HUEA 1UM8A 3MINA 2P9CA 2ONDA 1VZ3A 4YRNA 1TR4A 3MYVA 1UJMA 4TMZA 2XCRB 3HGTA 2Q5JA 2ATEA 2CW5A 3CINA 1KRHA 1FLNA 2EKBA 1PX0A 2FUCA 1YIOA 1DJPA 1KK0A 2AI2A 4OH7A 3WRWA 3KXDA 3KXLA 2WE8A 2FF7A 4HDQB 3FNEA 4RXUA 1AK2A 4DWOA 5KNGA 4CF5A 3ZWOA 1COZA 2AR7A 3R3XA 1ENYA 4GLBA 5IWAB 4KPGA 5B1BE 5I7AA 3PD7A 3EPRA 1ETHA 2I7XA 2NO7A 5ECDA 1OH7A 4BX2A 2NUPA 1TNYA 1G8MA 2PUJA 3DSRA 4EJFA 1E2GA 4LRTB 1Z29A 1IN4A 1EGVB 5DGIA 1N0IA 1L5HA 3VNAA 4TKZA 1BE1A 1X15A 2HRRA 4QYXA 2I1QA 2I71A 4G4SP 1Z0DA 3ZY2A 2O5CA 1CUGA 5CK4A 1TM2A 4JEIA 3WKCA 3EODA 2Y27A 4B6RA 4KZCA 3SFZA 1DB3A 2GVDC 2W58A 3QG1A 1G9XA 1L5RA 1NXWA 1P9NA 3KLNA 3E33A 4JQYA 4NF2A 1QP7A 1EINA 1PTJA 1BU9A 5HMLA 3EZNA 1Y8QA 3QJZA 1E9RA 5D5HA 5A2QA 1Y9DA 1MB4A 2FG5A 4IIJB 2JPDA 2BYTA 3BGWA 4A0SA 1H6CA 1M83A 2XUPA 3TAXA 1GN9A 1C29B 1NTOA 1VJ5A 3K1ZA 4LTMA 2VCHA 1SWWA 2OC9A 4HI0E 1KLXA 4JCOA 4CVNA 4CMIA 4EDFA 4UAJA 3TIIA 1JFSA 1B0AA 4B3CA 2FW8A 5B1HA 4OI2A 4C7BA 3ZBTA 2RFLA 4HNHA 3P71T 3GCGA 2C0PA 4O4LF 1U3DA 3UHOA 4UVEA 4QGBA 4BKUA 1CJVC 1QFJA 2HU5A 2G77B 3DZCA 5IT4A 3KYCA 3AF0A 2OOSA 5AKZA 3WK7A 1O6BA 5JSKA 3ETJA 4C5CA 1T2CA 3QZUA 4BNDB 3CR3C 1K9SA 3OZSA 4QTUB 4R1UA 3SX0A 3M7IA 2FFJA 2EDCA 3U64A 1OC2A 3Q73A 2WI8A 1ZD9A 3OEEA 4IIGA 1F7UA 1OFUA 2VK8A 1LLUA 5AVJA 2JA1A 3IQEA 3RTDA 3RW9A 1SUCA 5ERXA 1L7XA 2YDXA 1FYXA 1HTTA 4MDYA 1Q6YA 2G0NA 2ZE7A 1K8ZB 2HJVA 4DCUA 1GU0A 1VKJA 2GN0A 1G2PA 2V7TA 5KSYA 1KDZA 4DMMA 2UWJG 3B13A 2IYQA 1WQ3A 3F6BX 2CV2A 3CSDA 1SVSA 4TV9A 4EZBA 2YQ4A 4C9BA 5LCXA 5KU1A 1DBSA 1JFFA 2G8NA 1LXCA 3IRUA 5C2JB 1JSRA 5AW8A 4YDQA 2WFMA 1R8QA 5CCEA 3PEYA 3GH1A 5LQMA 1MJ0A 5LMUB 2JLAA 2BF4A 2VJAA 4L2YA 1QCYA 1ITZA 2DTEA 4GPMA 3GLKA 3HCNA 4Q1EA 4AG3A 1H9BA 4BBPA 1BCRB 1YQEA 2WMYA 4PF1A 4DSNA 3KQNA 4RDCA 4AXBA 2FPOA 2LUHA 2HQSA 4JB3A 5B7NA 1ZM4A 5C1OA 2XDQA 5I7WA 3QVGB 3J81A 2IF0A 2HRZA 1BA3A 2NYRA 2OILA 4FFSA 1WU7A 3QW4B 1D4OA 5I5EA 4DJ5X 1YBHA 5DX1A 4KFRA 2OZKA 3MUOA 1HO8A 2AFIA 3T0GA 1LWOA 2X9GA 3IAM1 3W5AA 4P98A 4AMYA 2YVKA 3ANNA 4IY1A 4ZXFA 1EFUA 3O7WA 2B94A 1GA4A 3NV9A 2QL7A 3G8AA 4NBWA 4XGRA 3SS8A 1YB1A 1GL9B 4I1AA 3SGHA 3AI3A 3FUXA 3K2BA 4NU5A 3FYHA 1ZW1A 1WOMA 4L28A 3F98A 1WM1A 3FCSB 4GZ3A 1MJ5A 3QXCA 3STYA 1Y8RB 2DVMA 2GEKA 2ZTLA 5EEGA 5I9SA 3K9FC 1LF5A 4NJEB 2HWUA 4EI7A 1YCSB 3GRYA 4UWHA 1T6YA 5EIDA 2XLBA 4O0LA 4RXMA 3TTVA 4C6SA 3KYJB 2HA0A 1GKIA 3QFSA 1Q3KA 4EGJA 2JAWA 2OP0A 2ZM5A 1Q0SA 1KJQA 2VYFA 5G53C 3U3MA 1ZU2A 5FQ8A 3BH0A 5FA6A 2JGAA 4K2AA 1LF8A 1KERA 2QOEA 1CRZA 2AW6A 1SA0B 1X1AA 1OT8A 3L22A 2BR3A 4QYWA 1EDZA 3ISTA 3SKXA 4QPNA 1DU4A 5CLGA 2JLSA 2JIDA 2Z2IA 5A7DB 1SKYB 4PLTA 4G11A 4GSKA 1U4OA 3X3HA 1SO8A 4OQQA 4UNRA 4LCBA 3T1HB 4XGIA 4E09A 2ZBDA 4IDQA 4P53A 1GFZA 4ZCIA 1YAJA 3KHSA 3LFUA 1EI9A 2ZXWE 1NBHA 1E5VA 2PX8A 2RI6A 1TYAE 3NEPX 5LQCA 2VP5A 4G81A 1AKVA 2IEDA 4RVHA 1HYQA 5IUNC 4P93A 5IM5A 3IQIX 5IUJC 3ABOB 1I3CA 3KFLA 4KQJA 5IARA 4OO3A 4TT3D 3UXGA 4WBNB 4DMLA 3NI2A 3LUFA 4ITVA 4DCCA 1T9GR 2GPNA 4FDUA 1C14A 1Y8QB 2ZJ6A 2PLRA 4C0KA 3PKJA 5HUQA 3Q98A 4MEBA 2XPZA 1AKQA 3I0NA 5EZYA 3A7DA 4IZHA 1BE8A 4KT6B 3JZMA 3M83A 1IXRC 4IDFA 4OA8A 2M6LA 5AXCA 5JZMA 1NNSA 3R3SA 3ASNE 1M2KA 4RH1A 3U1VA 2VAPA 1DMSA 4HEJA 3DXZA 3R7FA 2Q0SA 4QGGA 3DFIA 4BB9A 3L9TA 1CB7A 1N92A 1K3ZD 3AW8A 3NHRA 2FP4B 2VDWB 2WPDD 5CX1A 1XQYA 5K8JB 2IV7A 3F7OA 5GONA 4DTCA 4R81A 3UKRG 4B0ZA 4OP2A 3MCUA 1M0EA 2PR7A 1PX2A 1VLMA 3LVFO 3C70A 3QYAA 4TXRA 3GRFA 4WASA 4XGQA 3P2OA 3HNPA 3O8QA 4ODIA 1KJZA 1JQKA 3IQFA 3UCXA 3OAAA 3DOOA 4ARZA 1EF1C 2ZTUA 1W44A 4EB6B 1D6NA 4KUEA 2VPQA 1D7OA 4XQCA 1F14A 1MX1A 2V58A 1D4AA 4NYJQ 5K8UA 3DBHB 4GO1A 2WU4A 1CUAA 4HRYA 2DHRA 2DB3A 1N3YA 2JHAA 3G7UA 3JY6A 3JATB 3JWPA 4NTZA 4AO7A 3S2FA 2VHCA 3AHDA 1J21A 3HEMA 3ONNA 4W1SA 1CIPA 1L5SA 1QGUA 2YWBA 2ZT8A 4WD3A 1G5IA 1N2CA 2FMUA 2XUFA 4FGLA 4QDOA 3DZJA 4M7PA 3F46A 4S0XA 1Z2OX 2J07A 5JJTA 1YKGA 2EILE 5IJAA 2ENWA 3M3DA 3KLMX 5FWQA 1YZ3A 4ZVPA 5F7XA 1UBSB 1UK7A 1HT1E 1IN1A 4DA8A 3JYHA 4M8IA 5DSZA 3ZWAA 2YJ4A 4HNAB 1EG7A 1VYVA 1Z07A 2I78A 3QOXA 2BW0A 5KYXA 3ZJUA 2YIJA 3FRIA 2XBMA 4URHA 1JW9B 3MWDB 3N74A 4HLCA 4RNDB 4BO9A 3KOUA 4ZZIA 3K72B 2Q6TA 9MHTA 1G16A 5JDCC 1GILA 4ZVKA 3ROZA 3MHTA 1FYVA 1KA9H 2YJ3A 2C8LA 2F8TA 5A0FA 5A4IS 1S2IA 1S8OA 4QVGA 4YFYA 1GZ5A 3L0ZA 4N0QA 4QYIA 1PL0A 3B3AA 4HQ6A 5AI0A 4ZICA 1MVNA 1XPUA 3UAXA 2NPFA 1R4NB 3AEQB 2YWCA 4OJTA 4QU0A 1SK9A 4ZRDA 5A3SA 5K3BA 1ZD3A 1A9SA 3PEFA 1CUFA 2ZVPX 1XVUA 1NVMB 3INNA 3WIDA 1GTMA 4QFDA 1DAIA 1JKIA 2JS7A 2R0QC 1S6YA 4GXTA 3NR2A 4OVUA 2RHMA 4RF3A 3WKDA 1SU8A 4QUJA 4RVSA 5GINE 3GARA 1NW8A 1QTRA 1R15A 3A9CA 4LYFA 1WUTA 4U3JA 4YRJA 2X5JO 3NTLA 2Q46A 4HNRA 1Q7CA 4OUDA 2VQFB 1VM6A 4QUIA 5LDDC 3LXRA 1N3IA 1I3OA 3FUTA 2IS1A 1M76A 2F9MA 4OHBA 4TYQA 3EG5A 3TQIA 2BSQA 1CNMA 2NSDA 5AI8A 1BHQ1 3KQUA 4I1UA 1ODSA 5CYPA 1S1MA 3EC7A 3MWGA 2H1FA 2P9UG 1CZKA 4ACLA 3E7FA 5HK9A 3VLEA 4ZZ2A 4F6RA 3CURA 4QJ5A 3PT5A 5B7GA 4U5QA 1E59A 1UH5A 3R8XA 2PJUA 3LY5A 4G1MB 4Y98A 4N5LA 3ASGA 3D6MA 4X8LA 4FINA 4GE3A 4UMFA 2HCJB 1JJBA 1NLMA 4JVSB 4YN3A 3OVMA 3V4OA 1E6KA 1TJ5A 1YDWA 4N8EA 4OA5A 4R4JA 2YJTD 1YZGA 3LYUA 1XQVA 3SCZA 1Q84A 4D44A 4KFCA 2A33A 4ZEWA 5AKHA 3LA8A 4ARIA 1QYIA 3OD5A 1FQWA 4BJ5A 1Y81A 2H5LA 4EY6A 3CS3A 3U44A 3HWX1 5EXXA 3A6EA 5BWBA 3NTRA 4NEGA 1PAUA 3FEXA 2HCRA 4ZI7F 3GCZA 1XU4A 1MOSA 2IYYA 3DQPA 2EQAA 3EDQA 1DQZA 3FPLA 3LW8A 4TV8A 2CFRA 3SE0A 4BRUA 5KX5A 3B3QA 5FBWB 4ON9A 2ZTSA 3G5TA 1KO7A 1NF8A 5SZJA 2QQ0A 2X0KA 4CL3A 2O8DA 2N3ZA 3W9FA 3T7DA 2JG3A 4EW3A 1KTVA 5KYUA 4O4HB 3UAGA 3UMGA 3RS2A 2C29D 1VIMA 4AD8A 4TN5A 5C34B 4QLOA 1OE0A 3SE7A 5K05A 2IFTA 2AUMA 2JH3A 3OJ0A 3PKIA 2IPOA 2C9MA 2P62A 2ZVQX 2Q7DA 2PT6A 1ZCZA 1S70B 1ZHOA 1JDSA 2V0CA 3P9IA 1BMDA 2P4HX 2Q1XA 3MK31 3VPGA 4CI0B 1ZIPA 3GDFA 5GMOA 5LXTA 3MD9A 1JR3D 3NDPA 3N5KA 1E8MA 4PLVA 4RKQA 3UY4A 5COAA 4W7IA 1R4MA 1TM7E 1JKMA 2G88A 3DA8A 2AFIE 3HKBA 1NN5A 1FU8A 3JQBC 4YT5A 4ZI5A 4A0HA 3FFLA 2CXOA 1CUSA 4H08A 2VUTA 4BTLA 3GJ0A 5DYYA 1XP8A 2P5UA 4MWEA 4QAQA 1W4RA 1BXGA 1ZA2A 3IV9A 2OAQ1 2MSWA 5E8JA 1Q3HA 5F35A 2EOAA 5IAGA 4C7MA 3THYA 1CBUA 1NJ8A 1VSQA 1G8YA 2DJIA 2GDZA 4Y6PA 4V0LA 1VSBA 4R8LA 2FPSA 3TXAA 4AF8A 5CIYA 3QXSA 4X91A 2FZLA 4AP9A 4BNVA 1UJBA 3UMYA 2DF8A 5AICA 4KI0A 5FLXA 3GAMA 2NUTA 1TVKB 2XECA 2JFUA 1GGEA 3DSWA 2YCLA 3FRHA 4FNMA 4YJDA 1NQAO 1U28C 2ZU0C 3WA6A 3WL3A 3IT1A 1PTKA 4W82A 1K8KG 5EX0A 2QJOA 2QZZA 2ILRA 2VSQA 2VUSA 1L7OA 2AMLA 2E3JA 3KXIA 1YTLA 2DWPA 3QWHA 5FUWA 4FMCF 4X45A 1ZN7A 1OWLA 4M22A 3QKYA 3LLUA 3GMTA 3TDNA 4DRXB 2BFBB 3C4QA 4EJSA 4A0RA 2EIME 2E6KA 2XNCA 1KC3A 1OXMA 2XUHA 5J4KA 4TTSA 4Q4DA 4MYHA 4QUEA 3UHJA 2C8KA 4BAZA 5AARA 2V7XA 2ILTA 3BMQA 1V5WA 3ZCPA 5BSGA 3K9BA 4ND8B 2DUUA 5JCPA 4JELA 1KY2A 3S8YA 4G24A 4YJGB 2BI4A 5T6MA 4XKCA 3VNRA 2C2KA 5CM8B 1A2OA 1CQPA 4FI3C 3BMNA 2EARA 1UXGA 3NBAA 1W88B 3G8DA 3CEHA 5JWOA 3AXSA 4RK4A 2PY6A 4RWEA 1VIYA 1U8EA 2O5VA 1PZFA 4J90A 4JYPA 5FOUA 4ID9A 3AR8A 1UT8A 1D4FA 4KRXA 4Z68A 2W93A 4CWAA 4CEMA 1EQAA 2HM7A 3IHVA 4KFTA 5CXXA 1YDFA 4CKXA 2XT9A 1LB1B 6Q21A 3LGXA 3PQ5A 4IX1A 1PO7A 5JMPA 2GPYA 4DDVA 3AVPA 1QH9A 1ZD8A 3C0KA 1EUDB 1KP2A 4DX7D 3PRYA 1UEXC 1WL8A 1EK5A 4YY3B 4CBVA 2VH5R 3UJCA 2R5SA 4CYMD 2W8BA 1C7IA 2Q4TA 2SNIE 3DV0A 3B3GA 3QUCA 3QHPA 4EPVA 1QMPA 2AS0A 2P8JA 1SUAA 2CZGA 3C3YA 4J6FA 2R00A 2DGDA 2AHRA 3ECAA 4Z7JA 1LBSA 3AHJA 4J0GA 4NXNB 3MM4A 1Z0UA 2R4TA 1QLJA 1UOQA 3OP1A 4IO0A 4Q3AA 5ARDA 4FD3A 2VJMA 2BM9A 3PEVA 4HH4A 1CD5A 5FBHA 1TEVA 3QEKA 3ZYKA 2AG5A 1GG9A 1D03A 3I2IA 1V37A 3P45A 3LLVA 3DEFA 2J32A 3ONVA 4G63A 4U7PB 3V42A 1FZTA 3DTYA 3AKCA 4X1KA 5EZSA 4H7HA 2IPNA 3LCVB 1H3NA 1SA4A 2BZ1A 2Q5EA 4MIOA 1WPXA 3E4CA 3M4YA 5G1PA 3RUHA 2UZIR 3ULQA 2X14A 4IH9A 4U1RA 2I99A 1M67A 1TM4E 1QRAA 5CVEA 3N8DA 4CRWA 1EDOA 1ES9A 1II0A 3CZPA 3E27A 4MP3A 4BC1A 5FOXA 1V8PA 3EA5A 5J4HA 4NH0A 5EWJA 2QI9F 2VZ0A 2P2NA 3L8YA 1GAEO 1JMYA 4B3DA 3PLRA 4CIWA 3PQDA 2RK4A 1FMJA 4L08A 4MWOA 3IQWA 1P0QA 5HE8A 5C4GB 2VUHB 4UI9J 1I3MA 3L07A 4RHTA 4AWAA 1K27A 4RDHA 5IJ0B 4NOLA 1RFGE 4DABA 4RK5A 1MPTA 3TSAA 4LBZA 4M6WA 1P72A 3HFRA 4KN5A 2CFZA 1KNQA 3C6BA 1XZJA 5JZ9A 3NEAA 2P7IA 2EVWX 1NA0A 1T3GA 1X94A 2W2LA 3V4ZA 1H69A 2W43A 3IE2A 4PGFA 1C1XB 1LDEA 2C4NA 4BT8A 3OBBA 4BQRA 3AKDA 2VNIA 5AJXA 3IEPA 4B82A 1XA0A 1AXGA 1JIUA 5D84A 3WLOA 2FN9A 5K3FB 3FTQA 3INYA 5K45A 3OPMA 4JL6A 2H51A 3ILYA 3WX0A 4Z99A 3DJFA 1CQJB 1B14A 3A05A 3PF8A 4KACA 4LJ9A 1DV1A 2NZ8A 4NPAA 4RZXA 4CKCA 5KVVA 4G01B 3TUIC 3GRKA 2XEVA 2YOFA 3EBPA 1XEAA 1KGDA 3HB5X 3I1YA 3T9DA 3ZN2A 2HYZA 1KJYA 3HB4X 2ZR9A 3KQVA 5DWDA 3R7AA 3VU1A 4OH1A 2VVTA 1VTKA 5DXFA 4F7WA 3TW0A 5BSEA 2B30A 3ZU7B 3PC3A 3GGCA 1K3FA 3K2IA 3MW8A 4U0JA 4Y8VA 5JNRA 1EESA 3PQ6A 2MMGA 2QPTA 1MUUA 2FTKE 3ZCXA 2HDOA 4V1CI 1ICIA 3QVWA 5FI0B 4D4JA 1CJTC 1AK9A 5EPEA 4YRRA 3J81k 4XYEA 3IUQA 1S3GA 2HEGA 3TW6A 5E9WA 1N5MA 4LKRA 4HDNA 2XQ0A 4WK0B 2AC7A 2WYOA 3URKA 3U4QB 5L8VA 1KQPA 2YN4A 3KUXA 3QH4A 2OC4A 5BY2A 2BD0A 3QMVA 4O4HF 4MUIA 2JHGA 4N7MA 1W19A 1ZK3A 4RD3A 3CO5A 1DFGA 3EDCA 3IQXA 3ZZTA 4NENB 2PL5A 5CNMA 4TT3A 3TYXA 1MX9A 4H3KB 3ZU3A 4EELA 5ITWA 1IUKA 3LXUX 5DRTA 1G21A 1RM4A 2ALJA 5K1ZA 1U6KA 4INAA 3VDNB 4BU1A 4F4DA 4XB6B 3ZCUA 3H4TA 4FFDA 4HH1A 1G8KA 5CG1A 3QKSB 2V65A 2NSZA 2GAJA 2WLSA 1ESNA 2AQIA 2QM3A 4RVOA 5HKAA 7AT1A 1A77A 1SMKA 1JJVA 3OIUA 1ULHA 3EPPA 4O3MA 2QG9A 1P45A 4FWTA 3ZI0A 2DUMA 1GTZA 4RL4A 4MKGA 1VPTA 3A9SA 4EX6A 1WDLA 2PBFA 2ZIGA 3GU3A 2GF2A 4UU8A 5DNAA 1DARA 1HE5A 1SJ9A 3ODPA 4FN4A 4OHMA 4BN5A 4OHYA 1U28A 5AIJA 1AKTA 1N5KA 1UFVA 2XZTG 1Z0FA 1HORA 2RGGA 3KAJA 3KU1A 3NVAA 3PZRA 1TUGA 2BTDA 3THYB 4P4SB 4JU9A 3TTWA 1XWIA 3SBTB 4DXDA 4JASB 3DBLB 3RFFA 3D9HA 4N3AA 3AERA 2TMDA 3D1LA 2A30A 4F2WA 3D1VA 3Q9SA 4Q1AA 3HH8A 5AW1A 2J0UB 4QO7A 2IY9A 4DVGA 1YFJA 3C8ZA 3EIJA 3M0EA 3RSZA 1KYWA 2RIPA 3OC0A 5JDIA 1RXUA 2AZDA 2JJMA 3JZFA 3U0BA 4OHXA 4GTOA 1EZ1A 3EIUA 1LBQA 2XTNA 4QM7A 1AJEA 4MK4A 3H1PA 2RI1A 4XTCS 4CLOA 4MDEA 3LCRA 3IPLA 4KIUA 4E51A 3IAUA 1NG9A 2QX4A 4LXTA 5LM3A 5IC6A 1E3QA 2JABA 3D5EA 4YECA 4BU0A 2ODEA 4U7EB 4JX9A 5EHNA 3UAVA 2BM8A 4C05A 4E4RA 4YRIA 4TZ6A 4PAGA 3TNLA 2VZEA 2W2TA 5TR9A 1K5DA 3BE8A 3I0ZA 3D3EA 3LDFA 4V03A 2FLKA 3WLRA 1E6MA 1IIBA 3PEUA 1AKYA 3QWIA 1REQA 3NWJA 2N75A 2PGLA 1U7ZA 4MW0A 4UVIA 1C3EA 4XB2A 2R25B 4GL4A 3ZIDA 2A58A 4FQ5A 2WILA 5JROA 3JYOA 2AL7A 4G23A 3I12A 4QT4A 3BT7A 4UM5A 4DANA 1MAWA 1FT2A 3HU3A 4TMWA 2P69A 2WSIA 1II8A 2E4UA 1ZGBA 5HKLA 1QE0A 1TTQB 1ISIA 1EFTA 1T8PA 1YONA 3A9WA 3ICVA 4PO9A 3QG5A 4RS3A 3DNPA 5TX7A 4M0FA 1TL7C 3CGGA 2YFQA 3FU3A 4TXJA 5CUQA 5L3VA 1AHNA 1TNDA 2HW8A 1L8LA 2FJUA 4IZIA 1P33A 4G26A 2IBTA 1XDZA 1V7CA 1JV2B 3C3RA 2EKLA 2IPAB 1CHNA 2YV1A 4GLFA 1JLKA 2C58A 4ITUA 1QP4A 1JTVA 3I9V6 4WKNA 3ZJ5A 1U2TA 4OPMA 3OWOA 5PGMA 4TM7A 3PD0A 4JJ6A 1W49A 1HT3A 5FRDA 3SF0A 5BMVF 2X1LA 1A4XA 5ICFA 3WR5A 1UK8A 3SIWA 1RE1A 2XYVA 3L4BA 5KMGB 2VXBA 3CVJA 5IBPA 5I7FA 1Y98A 1T6BY 1PFUA 3L01A 3O75A 4YBRA 1ODTC 3O7MA 4E5VA 4EL0A 4JI1B 4UE2A 3ZJ4A 1TE2A 2A0XA 3CUEF 1DI0A 2CFCA 1R5JA 1F7VA 1Z5WA 3LKVA 5GJVC 3SN6A 3QVGA 4LV6A 2NXPA 1QFZA 1QG6A 4GM1A 4Z9XA 3URZA 3AEKA 4JKOA 4Q4CA 3A4TA 3NOXA 2LE0A 3VV3A 2NC9A 1LVHA 1T2VA 1I1HA 2CN1A 2OHXA 2Q0HA 3ED1A 5I9IA 2G6TA 1QVVA 3UMSA 1F1BA 4ZZ0A 1C1XA 3BVPA 3BDAA 4EG7A 1MO4A 1UMDB 3AOEA 3N58A 1M8JA 1KOGA 3K20A 3D54D 4YJ2B 2H2IA 2AEMA 1EVEA 2R48A 2ILVA 2RGYA 5JQGF 4LFBB 5C1DA 3FHOA 2P67A 5FFMA 1NA5A 4UM8B 3T1YB 1DAMA 4D9KA 3ZV4A 3UH1A 1BWRA 3HHEA 2AJBA 3U7QB 2W48A 2KX7A 5GQSA 4UAVA 1OI3A 1GL6A 4JB8A 3CT4A 4OMDA 4V1CB 1CEXA 2VXCA 1SNYA 3MWYW 3R3UA 3WNVA 4EITA 3D4PA 1JR4A 3NV7A 4Z0NA 4CU2A 4NAUA 4ZEXA 1KI2A 1ZUIA 2O8BA 1Y0BA 4ETWA 1NR1A 5IMSA 4ZT2A 3OFNA 2VJQA 1ODKA 1TKRA 1SKBA 4ZI7A 4OLAA 3RRJA 4GLLA 4BLSA 4C20A 3S27A 4OY3A 3E5HA 1QHFA 2ZATA 2GRJA 5EIBE 3K6KA 4Y6CA 4GMGA 4JLAA 3E30A 4J03A 4O2AA 1M2FA 1UZAA 5AOVA 5ARBA 4LG6A 5H4GA 2FUEA 4Q47A 4TSKA 3V7FA 2FO7A 4J16C 2IUTA 2FY8A 2Q49A 1GP2A 3EUEA 1GTG1 4FT2A 4L51A 5P21A 2VJMB 1MX2A 3OLCX 1LD8A 1ZK2A 3UMMA 3DLHA 2ONJA 1BRMA 1H2TC 1YRWA 2YYSA 4Q03A 4YIKA 1MT0A 2BBOA 2EQ5A 2Y9MB 3T3GA 2AR9A 3P9QA 4LISA 3PIDA 1LJ8A 2AXZA 4AVXA 3WIOA 1SFRA 1CRQA 3EWAA 3FYSA 4IYJA 4M76B 4DX5D 1H2AS 1A5EA 1IHPA 3ICEA 2ZJ8A 4FFBA 2GD0A 2WM8A 3T4XA 1VG8A 2WXGA 2O20A 3RROA 4B5KA 1JU3A 4DIFA 1UDXA 5A4AA 2XVZA 3KS9A 4P7BA 4P2BA 1C0IA 2A14A 1NMXA 3L41A 4JYZA 4CV3A 3Q6MA 3TJMA 5FQ4A 1GZSA 2BLLA 4EEZA 3JQ1A 1NIPA 2GN1A 3HCRA 3RAEC 4P5DA 3AG4E 2M6RA 4MKRA 4RAQA 4LNHA 4A1GA 1GAQA 1VG0B 5HKKA 2VAWA 2UYQA 5KNBD 4I55F 4S1TA 3Q7FA 3IQZA 3UXHA 2QTMA 2H8GA 1YXMA 2XMPA 3CLRC 1XTPA 4NDNE 3WIVA 2E4ZA 4JLUA 4GZ5A 3GJQA 3UT5A 1LTHR 5BNTA 1F5NA 1TTHA 3HHPA 2H54A 2Y2UA 4OK5A 4RETA 3WLEA 5BSHA 1TK9A 2BHRA 2YXPX 4PAWA 4HBZA 3JW8A 1PS9A 4HO1X 5KOHB 3W90A 5AYVA 2GXQA 4AMUA 1NVTA 2NU8B 3C3EA 4E4TA 1M6WA 4JLNA 2HDNB 2QTHA 2R751 1CZUA 1W5SA 2OUKA 4B4DA 1JLLA 2VJKA 5BNZA 3ER8A 2ONCA 4D74A 4Y1EA 4OXNA 2FWNA 1G17A 2J9QA 1MRSA 1RWMA 3WXXA 3EXHC 3P9ZA 5LLTA 2QX8A 3TSCA 1GUBA 5DU2A 4O2LA 3H2HA 1R1DA 1ZGAA 3G2LA 4R40A 3RASA 4TLDA 3WLTA 3WJ1A 4D9CA 4M9UA 4DBLC 3D7RA 4DKXA 5HBRA 2VYQA 2H6HA 4PCVA 5E3IA 1PR6A 3CPHA 2FO1E 4OCZA 2PFSA 1WVMA 5K6RA 2XEEA 4PX5A 3EIQC 2BLNA 3V8MA 4DI3A 1AQNA 4M1OA 1XNQB 4W8GA 2IKSA 3UGTA 5A4JA 4MW1A 3IKVA 5K0SA 3DEYX 3M9XA 2VF2A 3MTJA 3WLSA 4IUBS 5TNXA 3UMBA 1QFXA 1Y5NA 4S12A 3BMOB 2X0JA 2HL6A 4GB9A 4LJAA 3HFSA 4UVGA 4Y2UA 1VJDA 1H6OA 4NMMA 1UUFA 1YRHA 1Z0AA 5CCLA 3ZXSA 1TF5A 2YHAA 3KZ1E 4QOSA 3TO5A 4AIIA 4BX3A 4PCUA 3V8VA 5B5SA 3LYHA 2C07A 1B74A 5CB4A 2NTYC 3AETA 1X8XA 3HR4A 1D8TA 4RLFA 3WQBA 2RG1A 1H65A 5AK4A 2XYHA 5CJJA 4BFZA 2QNBA 1C0PA 2GKSA 2FRDA 2BGUA 3EZYA 1VRCA 2WFAA 4PFJA 4QNRA 4GI5A 9LDBA 2V4UA 3HZZA 4B4KA 3I73A 5B12A 3A4YA 1PVVA 10MHA 2PTHA 1W4ZA 1EGMB 2YQ8A 2ZRDA 5A9SB 3HG0D 3B95A 3Q41A 5BW4A 2RHDA 2VUUA 3U3KA 3IE1A 5REQA 4ZVMA 3RFCA 1MQ9A 5IEJA 1RS0A 4PO8A 2ZJBA 1OH8A 1WOYA 3JRWA 4P82A 3U37A 1ZI6A 2ZSHA 4F72A 2X9NA 4P5EA 5EZ5A 1FVOA 1VQ1A 1E96B 1OV6A 4Q34A 1LFDB 1XCPA 1RTTA 2GD2A 3L7MA 4IIUA 4QRDA 1NVVQ 2EP8A 3NBZC 3DS8A 5FL7D 4B75A 1X13A 2AKEA 3UB3A 3VI4B 5IBRA 2CNDA 2COEA 2FFQA 4Q1DA 2JATA 4R5MA 5FWYA 1CIJA 2VKTA 2WIGA 3OM8A 3VH4A 4HHEA 4JWKA 1PW7A 1TA9A 3KZOA 5MFZA 4JJZA 4AF6A 1OLUA 2FI7A 2RDMA 3A6KA 4EL5A 3GVIA 5BR8B 2D1SA 1KYZA 4KXNA 5I8WA 2FW6A 3HA7A 2FG7C 5LQJA 1NUUA 4LOLA 2O0HA 1DAHA 4UWLA 1ORWA 1N11A 3SHOA 4LOIA 1F8YA 1LVUA 1ZG3A 2QVZX 3B36A 4K3VA 3W4JA 3W3ZB 1KORA 2O1WA 3ESXA 3AL3A 3EVAA 3L8FA 5JD3A 4DMFA 5LJLA 2Z0MA 1GA1A 1FT1A 1DINA 1LRLA 1TC2A 2ZS9A 3SNXA 1MLDA 5T8KC 4EGSA 4DR4B 4J1QA 3CIFA 5HZKA 1RAGA 1IDOA 1NSFA 4QBHA 3K8OE 1O8CA 1CUEA 2F17A 3H84A 1EBFA 4PO3X 2PPLA 2ZYHA 4GFDA 4P4UA 2E85A 5FPQA 3DBRB 1EVJA 3I45A 5IN5A 4BMXA 4ZCMA 1LTKA 4ARVA 1EXMA 3O8OB 1X92A 3I04M 4TOIA 4D4IA 2BMFA 1XQWA 2O2EA 3AFOA 4N18A 2WY2D 1E62A 4XVQA 1N7GA 4YVFA 5LB4A 4JHLA 2WV9A 1SB8A 5L3SA 3NBMA 1WTCA 1CR0A 2YTZA 4XIJA 1J5EB 2AEEA 2X5OA 4I5FA 3Q9UC 4N65A 4P4GA 1J97A 1JIIA 4U7FA 4WLFA 4CUZA 2CNNA 5K6AA 2PD4A 4NX2A 3O95A 3KLBA 1FVFA 4OGFA 4G1EB 3ROTA 3WICA 1BWPA 4ESOA 4WZAE 1VIVA 1AGRA 2UY1A 2Q2QA 2VH2A 4JJ4A 4EHHA 3SQWA 4E07A 1J56A 5K4HA 1N36B 3DBIA 3UMVA 1PR3A 3I52A 3ORFA 4MR8B 4UJ5A 4GYYA 2NUPB 3L84A 1YJ8A 1JI3A 2KHZA 2TS1A 3AERB 3ZGLA 1DELA 4BMOB 5EMLA 1O9BA 1YS1X 1Z4LA 3BAFA 3EBLA 3UWMA 3HDQA 4YRFA 1W0KD 3THWA 4ER3A 4MUKA 4BFXA 1PT5A 1HSZA 4WFKA 4F38A 1EDBA 1TU4A 3PHLA 1YB2A 2GJAA 3E7DA 3PFBA 2GEBA 4A2QA 1PJLA 1FB5A 4JUIA 2A4ZA 1D2AA 2IHKA 1UBEA 2CHEA 3VZQA 1N2CB 4UD6A 1HDGO 1GQ2A 4DSOA 4F0JA 3MCVA 4JJKA 4A2PA 3TL5A 3V4SA 5ALLA 4PO1A 4EF6A 2LR0A 1YA8A 3DMRA 2CHFA 2XYRA 4RVDA 3OTWA 3S68A 3VH2A 1UJ2A 1YDHA 3DFMA 1O89A 3NPMA 2GGSA 4TLLB 5BQPA 4EB8A 1I4EB 1R27A 3DHNA 4J07A 2NPOA 3FWVA 2NZYA 1XDDA 2ZGDA 5EOVA 3RUDA 3B9BA 3DHEA 1E2JA 1JDBC 4AVYA 4J2HA 4IRMA 4B71A 5CA0F 4RZSA 2Y66A 1YQUA 2HAEA 4XJSA 3Q1LA 2JI9A 3L4BC 1ZVJA 3S7FA 5IASA 2DTDA 1XRQA 3OSZA 4D25A 4IRUA 3MF4A 4ZC8A 4C7KA 1A5AB 3G49A 3CRRA 5CB0A 2X40A 1G18A 3REQB 3U4QA 3BXZA 4PFKA 2CJXA 2IF2A 1Z5VA 4ALMA 3PJGA 3CVOA 1U2DA 3L6OO 2I2OA 5KOIA 1VJCA 3PCXA 1Z3IX 1CS0B 5AUQA 3P1JA 3ONLA 2WFLB 3BERA 1QO0A 5DJ5A 1UJKA 2PZLA 3IILA 4P0TA 3RQIA 3HA2A 2PK3A 2QUZA 4C2UA 1E3JA 4D56A 1UDCA 2J59A 4MGZR 4OXKA 1I5RA 1IPEA 3RV3A 2LNIA 3U1TA 4DJTA 4NJMA 4W8HA 5BSKA 3WRYA 1OBVA 1VGRA 2P9IG 2D0OB 4OXIA 3UCFA 3ZIUA 1HL3A 4XX1A 4LZOA 4BP1A 2IOFA 1NIJA 3IIEA 4CUKA 1ZU4A 5I51A 5IRCD 1FS4A 2VRCA 3CR8A 3HKDB 5IPFA 3W4IA 1VIDA 2EZ9A 5AVRA 1U8XX 5JAUA 2WW8A 1YL7A 3OOEA 3T7IA 1BMQA 1OFHA 3CISA 4MUAA 4TRNA 3W8EA 2IHNA 3DE2X 1CJSA 1JDVA 3A4VA 3P0EA 2DUJA 2OORA 2VNKA 4RK0A 4ZEVA 3RC8A 5DW3A 1RI3A 2DFDA 2VLBA 2YKGA 1A69A 2PG3A 1WSWA 2VSOE 1BA2A 1J42A 2W6CX 3MT7A 4IJMA 1F48A 4I66A 2QTAA 2ORIA 4H3VA 1FIUA 2JZOA 2IEIA 1ID1A 1VL1A 5FADA 3TLKA 3TXYA 5CGQB 5H70A 3PTAA 3ROMA 1VRVA 4BETA 3SIPA 3PNVA 3EH2A 4KBYA 1P74A 3S40A 2B4YA 3IBGA 4OB6A 3EF0A 4L6CA 5F98A 1T34A 3BL6A 4I08A 1FDWA 2WR8A 4AF7A 2O2ZA 1OH5A 1WJGA 2OHHA 2XMZA 2ZZKA 1JDPA 5HF9A 3T12A 4C43A 1YV9A 2Q4DA 1VLJA 4DMUB 3OKPA 1JHOA 3ENZA 4DEVA 3CVPA 2AFHE 5KPDA 2AG8A 3TCXB 5JS6A 4A3VA 5HIKA 3K5PA 5AQEA 5ALKA 2W5UA 4AURA 3D8TA 3DZKA 3D9LA 1XTBA 5F52A 1CRPA 3CYFA 1NJ6A 2FEOA 1F3OA 3ZLVA 1PGQA 1YUMA 3NOQA 3T9KA 3HQ4O 1J24A 3EU5A 3KK0A 4HSGA 2IYFA 2R6AA 5LSAA 2QP9X 5TMEA 1Q91A 2O2SA 5JC8A 2D54A 4Q5IA 2VT3A 1OBOA 3A04A 4LJ5A 3HVJA 4NZPA 2WT8A 2AXVA 4C14A 4R1PA 2H4JA 1OGYA 1NI3A 1UFRA 4XIFA 2WWIA 3C8DA 3QNUA 1U2EA 2V7WA 3GZ1A 4GDMA 2KXPC 1NM5A 2A9JA 4POAA 3AINA 4Y9TA 2YV5A 3HSSA 5CCDA 3EB9A 3VU9B 4BB0A 4PTZA 3NBYC 4BS9A 4Z3OA 4NP6A 4EYGA 4KE6A 2EIKE 4B45A 2NP7A 3FN4A 2HA3A 1ONSA 5TJ9A 1W3BA 2J45A 4DIOA 3FUHA 2AV6A 5D3ZA 3KSLA 4WINA 3ZY3A 3HSKA 3PQ3A 2ZI9A 1Y4DE 4NOJA 5IDQA 1JIJA 3HZRA 4NE9A 4NCBA 4JBYA 4LSWA 4LTDA 5ALQA 3D9NA 2CB9A 3SZLA 2BGWA 1DVRA 1TTTA 3JQ8B 4X63A 5LYJA 1Z5OA 1XZKA 4BGIA 3PXCX 1DKUA 5BUQA 1P9LA 2C03A 2XWQA 4AJEA 4LRZA 3X1WA 4YNBA 3AG5A 2O3JA 1W9MA 2ZIZA 1KY5A 4JJFA 4MEJA 1Z88A 2B3DA 3LDZA 4NOKA 4Y6SA 1PSZA 3W2EA 2DR0A 5CAEA 5CLFA 2IZZA 4UTZA 4MS3B 4XKJA 3NLLA 3P27A 3NBQA 5J9FA 3IBEA 3KYDA 1A9ZA 1OYYA 1BEEA 5DHAA 4HNVA 4KHPB 1VMAA 4NPHA 5HJ5A 1GNLA 4K9LA 1U2GC 3GPCA 3FUNA 3GV0A 3QUSA 1RIIA 2NPIA 4B17A 3RVRA 1QYRA 3T95A 1I51A 3E32A 3PTLA 3ZWDA 1ZAYA 5E6RA 1O4VA 5EP1A 2JCYA 3N76A 3OZTA 3I04A 3K70C 3PVCA 2PMBA 1JVBA 2IPMA 4H4CA 4Q0MA 5ER6A 4H16A 4JHKA 1OF1A 4EOGA 3VR5A 3QJ5A 3EPLA 3OFVA 3FHTA 2AIRA 1GARA 1SXJA 3NBXX 3TOVA 1FFCA 1RHRA 2CVPA 2ST1A 4WZ6A 2QW1A 4F6LA 2ZVDA 1UBHS 4F4FA 3FNRA 3EGVA 2R8RA 4R2MA 4S0ZA 4YQFA 1NNLA 2R6GA 5E3HA 4LNUB 1JZSA 3ZS8A 2JFGA 1XVAA 5ENQD 3CSUA 2PFKA 2D2EA 3F7MA 2WUGA 4G1UC 4P9NA 2D8AA 3M2PA 3NVKI 4GMHA 1UKEA 3WGLA 2D1QA 3N87A 3I9NA 5JFTA 3RRMB 2WQ7A 3FHCB 4DA4A 3B1YA 4CG3A 5DGXA 3ZCTA 2AD1A 2JFQA 1MJHA 2HSJA 3Q3GE 2Y05A 4BFLA 4F97A 5AJDA 4EENA 1TLFA 1I6LA 2PHZA 1KTIA 4X61A 3ES9A 1EP1B 2FR8A 5BRJA 3U9WA 4WNFA 2HA7A 3F74A 4AWBA 3Q7RA 4TYNA 3ZGYA 4WJLA 2HH9A 1Y4SA 2XR1A 3FRJA 3WB0A 2Q0QA 3ACCA 2OUIA 1I01A 4H7EA 1LZKA 2ZJ2A 4A55A 2HJWA 4IDDA 5KHOC 2G0TA 3GK3A 4GZDA 4QJ4A 3VTKA 1NXSA 3DZBA 4Z5XA 1GTSA 3IGFA 4HWSA 4Q15A 2QM8A 5AVSA 1NFRA 5IVDA 3BKWA 1K75A 4KXXA 3KVVA 1ZY2A 2SKCA 4DQUA 1ZRNA 1FMCA 3CX6A 4MOWA 2FEWB 3R7WA 3FHLA 3PYXA 1P9WA 3ZWMA 1Q0UA 1IY2A 1GG8A 3E9NA 4D0GA 3R3HA 5IVPA 2ID4A 5FTJA 2RKWA 3C8MA 1QRSA 3OEWA 3AS5A 4M7CA 3AI7A 1JQBA 3VJRA 3AJIA 1ZESA 4UI9K 4MTLA 2BKEA 5JS2A 4PLZA 5CFLA 4OQYA 1PWEA 4MQ6A 2RHCA 5HQJA 2XIQA 2Y0CA 2XF8A 1YS4A 4R5HA 1CQWA 1E77A 3MMNA 3AV3A 1EJ0A 2MDTA 2LSVA 2OO5A 3OC6A 5KAMA 3REQA 1X38A 1Z2EA 1NQXA 1PT8A 3I9JA 4D9GA 3R24A 4IGFA 1E66A 2JGDA 1Y5RA 5CW2A 4GS5A 5HK8A 4B2YA 2ATVA 4II3A 1X14A 3UJ9A 1NF9A 4YUVA 1NX9A 4H9GA 1BVYF 4DEXA 4JODA 1MV5A 1J0AA 2A7QA 3L5KA 4J16A 1IE3A 4LGCA 3T06B 3LT5A 2DSNA 3HGQA 3V7NA 3DSUA 2I2DA 1CZRA 2HPZA 2P7HA 5J2TF 2H6GA 3D59A 2QRKA 3KZCA 4Q19A 2PX6A 3O73A 5AKLA 4LSMA 5IAOA 4RWZA 3TL2A 4LVNA 3W5IA 3K6SB 3NHSA 2P2SA 4LWZA 5LKRA 2NO0A 4IQ0A 3WBBA 3ZE9A 3WIEA 1PEAA 4N7RA 4G5GA 2UVQA 4WN9B 5BQ3A 1H2HA 3R20A 4I55B 4RZHA 3KO8A 4S1PA 2XGOA 4OUDB 1JDNA 2FSSA 1DX6A 3K1AA 3ICQB 1V45E 3ICCA 5JJ6A 4QC2A 3AM3A 2XS8A 5DLDA 1YJQA 3F4KA 5DTEA 4YJ2F 1X74A 1XEFA 1KR5A 4M7OA 5DNUA 4KYOB 5E76A 1CVRA 4RHCA 1VOTA 2Y1LE 4PNZA 3GLGE 2HA4A 4FX2A 4X7BA 5BV2P 3DVQX 3MTBA 1WMAA 2OQVA 4EMBA 4NG5A 4PC1A 5JSHA 4PDXA 3VPDA 2C99A 4BQOA 5HX7A 2UY1B 2CFOA 1FXUA 4KDFA 4LY6A 4RJIA 4HV4A 5KB3A 3W2TA 1NA3A 4UEJA 4G67A 3RT7A 1KZ7B 4YRGA 4ND6A 4WPGA 3WB2A 3WMGA 3U19A 1NRXA 1T4DA 2Z58A 4JCCA 5TE9A 3V7UA 4B46A 1MD9A 3OTHA 1G5TA 2A5JA 5T4YA 3B85A 1UKAA 4K03A 3U3WA 1BTOA 1Y33E 2YXDA 3EN0A 2BF7A 1P6XA 2G0AA 2NIPA 4K9QA 4GH5A 3TQHA 2JLZA 1PRYA 1KRXA 3ZHOA 4PRZA 2R84A 1KJ8A 2OV6A 4V24A 5C31A 5T8KA 4JBLA 5F9HA 2PBZA 2PRKA 1A5ZA 1HE4A 4M9ZA 4J8SA 2BEWA 1ZI9A 1GGFA 3GZJA 4LBWA 2O4CA 4ZYUA 4UWFA 3ICWA 2PXCA 1ZJ5A 1XALA 4YAJA 4LY3A 1LVGA 5EAIA 1R0YA 5EVCA 1T1RA 1X1QA 2PMDA 4OQ4A 3RKRA 4O1OA 2AZMA 1SAYA 5DCWA 4L2LA 3QEBZ 3SQXA 1YS6A 3UANA 4HZUA 4QQRA 3P9YA 3HXCA 1UXOA 2QTNA 3ZUGA 2GN9A 1AS2A 5A3RA 3TKAA 2I4IA 3DD1A 3H0CA 4IVPA 3NHFA 5I5GA 3UQYS 2O52A 1JIQA 2QYTA 3WGOA 2C04A 2SKDA 1ZEMA 4M3NA 3WGTA 2BCGY 3QDNA 2C5BA 2R6ZA 3LGSA 3ND7A 3QWFA 1ZJZA 2YZGA 4QXMA 4UHJA 1X7XA 1PVDA 1YDEA 2Z5VA 1WAMA 1SPXA 3P0RA 1EFLA 1YRQA 1UK6A 4BO0A 4D3ZA 4NK4A 3EGDB 4XJXA 5I3CA 4URUR 5E7JA 3NZSA 2PU7A 5ALTA 4LRSB 5T67A 1FSGA 4EW2A 3PCTA 2RK6A 3TD9A 4K0KB 5FJYA 1GKYA 1JBKA 1K6IA 3GLHE 4DIKA 5TEWA 1IY1A 5FBQB 3ZHCA 4B4UA 5JBIA 1T1EA 2OQ2A 3WL6A 5EJ6A 4G2VA 1FCJA 1P0PA 3I2KA 3K96A 4BMYA 2E1PA 3P4YA 1P7PA 3JQAD 4LVUA 2NZWA 4UU1A 1T24A 5C32A 2I80A 2J9FB 4KOAA 3GJ5A 1I2BA 2BZGA 1WG8A 4FDTA 4COOA 1NXOA 1AZTA 2MSKA 3D43A 3OBIA 1TT5B 4PLWA 4MJ7A 1RJ9A 1OUVA 3VPSA 2B82A 1R10A 4RA9B 1W581 1W4AA 3R6LA 3WK6A 3GNQA 1RU3A 1PEYA 1XVVA 3LP8A 1PR4A 3IP3A 1UIRA 4IMPA 2GYWA 4P4SA 2XCSB 2FYTA 1ZYUA 1ZUHA 4P8RA 1G7CA 2IJGX 1C3OA 3MHPA 4FMBB 1V25A 2ZZNA 1VL8A 1ILEA 1PR2A 3JQ7B 4UPEA 2KCLA 2VHYA 3PHGA 1E4VA 4IP0A 2G7MC 4FN5A 4LNUA 4EI9A 5ALUA 4DNFA 2WDZA 5CJ2A 3LPZA 1VKNA 4ND1A 3VO2A 4QQNA 1EWQA 2XCCA 3RWOA 1T13A 3AUTA 3KSRA 3Q1KA 5AHXA 3HJBA 3WGHA 3UWSA 4EGFA 4F2HA 1DWPA 1BS2A 3JXIA 1FFXB 3H42B 1JMVA 2QUBA 4MCJA 4OREX 1V5GA 2OLKA 1Y6JA 4S24A 5ADHA 2MYPA 3Q8WA 3QELA 5IMBA 2Z5LA 3HS3A 5JRZA 2GPSA 4B83A 3USCS 3VTFA 1JR6A 4RADA 2VF8A 5EFZA 4L4RA 1W0CA 1DKOA 4FFOA 1PR9A 1R6AA 3SR3A 2IZ5A 4HXGA 1M6NA 1MPXA 1ISFA 5FBLB 4P0QB 1NSYA 2P6NA 4K5QA 1RXYA 5DMHA 4HAIA 5L7YA 3C3OA 1Q0TA 3HI4A 3RF7A 1XA3A 1FJXA 3T3HA 3M1LA 1NQUA 2HXGA 4NS1A 3IAEA 1YUNA 5AJZA 5JSZA 4BNKA 1I3KA 2PGIA 1S7CA 2OCPA 1EE9A 4GYWA 4U9IS 3R8FA 3QU9A 2GPAA 1GN8A 5EWLA 4HB5A 3KZXA 4QQIA 2DHDA 3KQSA 3TJRA 3QEAZ 2JJ2A 3I3OA 4FLBA 2I3AA 3VZRA 1FYWA 4MVJH 4US1R 4TS9A 2PYZA 4JROA 5IKXA 2QAGA 3KDSE 1K5GA 4AYXA 1Y8CA 3QXHA 1HX7A 1P81A 1C3OB 3SHFA 1HMPA 3JQGB 1AQJA 2QW8A 1IU9A 3F8SA 5LIRA 2J5BA 3F47A 5K0FA 1Z7EA 4Z6KA 3S1SA 1RM3A 3OZWA 3SI7A 3E61A 2WHPA 3LL4A 2RHWA 3DMTA 1HDCA 3DDUA 4TQAA 1CR2A 1IEQA 3PPVA 2RJNA 3J80A 5HRYA 3IUYA 4MB0A 4O4HA 1L9KA 621PA 1Z82A 1U0BB 1YOBA 2R85A 1GXSA 4KNWA 1XP5A 1YU9A 4JR0A 3T99A 3U39A 3MTGA 3QNMA 4PEVA 2A84A 4KFUA 3ND8A 3M81A 4FEYA 4L3VA 5M2QA 5K51A 2ZYRA 3AF1A 2DPGA 3Q7PA 2X42A 3I4RB 3QX7A 4NI5A 4BWFB 2AJ8A 5U4XA 4DMKA 2I29A 3QV2A 4P6VF 1IG0A 2Q4BA 3C24A 3CLJA 4PQGA 3VR5H 5EA2A 3MT0A 4XZ3A 3GH3A 4UEKA 1ORHA 3OG9A 2H17A 4YUXA 4JBXA 3W3AH 1TDJA 5KJEA 4RH3A 4L5AA 3GGJA 4JLJA 2XJ4A 4H31A 4YB8A 1Y9ZA 3DPIA 3CPEA 3QI2A 2I9CA 1NVVR 3KPWA 3ZPJA 3LVBA 5FHRA 1IZZA 4K9PA 4MQEB 4URZR 3SVZA 1I2MA 2KE5A 2C3UA 4R7ZA 5BRNA 4F2PA 2OKCA 4DDTA 3X1KA 2NN3C 4JBNA 4PW0A 1IM8A 1Q1ZA 3SKVA 4D97A 2FGJA 2IELA 4LK2A 4J4BA 4HVTA 4K6GA 4ZXPA 3ZDZB 2FLVA 3WYGA 3LPNA 3D9OA 2GLTA 1C4KA 1EZZA 2HO5A 4S2UA 5EYPB 3FSJX 2JHPA 5LYYA 1QZXA 3BWEA 4KWTA 2PWBA 4L4SA 1XTTA 2XEDA 4J76A 3MTIA 4NESA 4L9SA 5AVQA 1U0HC 1A8PA 4A82A 4K1LA 3OFJA 4MVWA 2RJOA 3IBYA 3I62A 3PC8C 1Z75A 5H68A 3T3EA 3TZBA 3EXHB 1G8HA 3A58B 3LBFA 1J1IA 4HQDA 1GYPA 1NHWA 4CTOA 4ENUA 1NW3A 4XAQA 5EUMA 4XJTA 2CXUA 1XYGA 1PTJC 1YC5A 4FDLA 5DMXA 4EMUA 3JZIA 2EW2A 3NTQA 5KSPA 4E3WA 1GADO 1VCIA 2N1BA 2AJCA 3ADOA 3I2GA 3OWXA 1GIAA 5G4KB 4RMGA 1QBGA 1EFVB 3K0SA 2P3SA 2GA9A 2P9TA 3E2IA 3II6X 1SZPA 4I7EA 1WY7A 3LXXA 2B34A 8ATCA 5AAOA 4FI3F 3EAFA 1AP7A 1BVRA 4PX9A 1AKEA 3W1VA 2NU6B 3IQDB 3ZU2A 2LV8A 1GXSB 2BEUA 3BGSA 3D02A 3V6LA 2G1KA 5JMTA 1ZUNB 3D3KA 5HQ3A 3AHEA 3PPYA 1NOIA 3JXJA 1GO2A 1EVZA 2DP4E 4ZC1A 1HE8B 3HNRA 5GV7A 3AU4A 2V7BA 1N5OX 4UVHA 3ZHRA 5ALFA 3U1BA 3GLIA 4HXEB 1QH8A 1IONA 4OHWA 3C1OA 4QDZA 2XUDA 1MAHA 3PXDA 4YJHB 4E0BA 3RSQA 5IYZB 1VI6A 1WPQA 4ZQBA 3A7EA 4FW8A 4MV3A 1OCCE 4C0EA 4QRHA 2XGSA 2BEVB 5DYTA 3REGA 3AY0A 4G0ZA 5A02A 1G3IA 5MDHA 2VJYA 2AJDA 2IQIA 2VJOA 3LCAA 1T15A 1XKXA 4G41A 3ABKE 2BFBA 4OK3A 1BQ3A 1XNJA 2XUAA 3IO3A 3BC1A 3TS1A 2ZCJA 1B42A 1FFBA 2F37A 3CX4A 2ZULA 3R9IA 4MUFA 3RTGA 1GD1O 1MX6A 1CZLA 1BYIA 1P3DA 1TTPB 4YHBA 4RABA 5AIAA 4BLUA 1JWLA 2YMLA 2JLCA 4RFSB 3RPEA 4FDVA 4B8CB 4AV7A 4II2A 1DJNA 1FXWA 3KOOA 1QK5A 2OORC 1DG9A 3PH0C 1JTEA 4HLUC 4RK1A 1F8FA 3B7UX 1HWYA 2I5PO 4PFSA 4EPYA 3DPSA 5JSQA 3IA7A 3AVQA 5B6IA 3AR3A 3UKDA 4BVJA 1C81A 3PHJA 3NTOA 1PWZA 1Z4KA 5EE9A 3QVXA 4BNNA 4DBVO 2OCYC 4BFSA 3DSSA 1GGKA 2AOVA 1BAPA 2MSLA 5DNWA 2C7PA 5DHFA 2Q2VA 5E9AA 4ZYLA 2HBRA 1BROA 2ZU6B 2WXJA 2JBAB 5B6JA 1R0SA 1CUIA 1SBQA 2VRWA 4X84A 3FM9A 3QYFA 5MN6A 3ZD7A 1L7RA 2P91A 4U7JA 4Y30A 3WK8A 2VLIA 4D57A 3IKTA 4RVUA 2HJGA 1TM1E 3EWNA 3MWEA 2AK2A 5AWFC 3LS8A 5ENVA 3PNYA 3GEGA 2P9FA 1CP2A 3NJ8A 4UD2A 1TZJA 4WZBE 3I6BA 1TC1A 1V71A 2LDBA 1FTNA 3AF4A 3QQ5A 2BGNA 3KC2A 3U13A 5JPCA 4ALIA 4JLWA 4DV0B 5SICE 2WKWA 4G4JA 3QC1A 4K9SA 3FWKA 5E1DA 4WIAA 3NGMA 5DI9A 1SUIA 3KB1A 2XHZA 1AMUA 4ZT4A 3RSFA 2YICA 2O05A 2WJIA 4ZMSA 1GPKA 3D4IA 2V9CA 3MG9A 1SULA 2LVBA 1UMCA 2PRYA 1GRCA 4P32A 4XASA 3WZLA 4YT4A 1FX1A 2X1HA 3HBFA 3BIWA 2XVYA 4FZVA 1TT5A 4EYQA 2VFAA 4BN4A 3PNTB 1XXHA 2FW9A 3MFYA 1W85A 3D9PA 3GG9A 3UGQA 1N4QA 3K35A 3H9GA 2JGEA 4KE7A 5EJMA 4ZT3A 3PHHA 2XNKA 4RENA 2CLHB 1YI8A 2VQDA 3JVUA 4I81A 1DTWA 1KARA 3RRMA 3VZSA 5HYVA 2YHBA 3B1WA 3VPFA 4N49A 2HHLA 3EAQA 1JWGA 5MN5A 3UA3A 4BP3A 2R9VA 3A9VA 5ECWA 1F9AA 4JFRA 1HETA 2MR5A 2AKYA 3AUSA 4TTQA 2GHIA 3AUFA 4EB3A 2IIVA 5AYWD 2L18A 2HB6A 3BOSA 4Y6GB 4QLBA 4BATA 1QCCA 3I8SA 4AS1A 3CVUA 2VSXA 4ZQFA 4A3SA 1M3SA 4WE3A 1W34A 2L42A 4EY4A 4BXOA 1MEEA 4ONEA 3WY9A 2NVWA 4YRZA 3TRKA 3DMPA 3LOUA 1E96A 5EJGA 5BR4A 4CF4A 4ROSA 2V5FA 1K63A 1L4KA 1L8XA 2BMVA 4FJYA 2DZDA 2AG6A 5GZ6A 2XAAA 1YCFA 4PE5B 3VJLA 1ODCA 1OVGA 2NX2A 3DRAA 4FOSA 5AI6A 2RBKA 2YMQA 5L3RA 4I5GA 1JWAB 1MEOA 3U66A 4D8TA 1N7JA 1X42A 2Y69E 1A04A 4C88A 5IK2A 3OOHA 2JAQA 3AR5A 1ECFA 2W00A 1HE8A 2D7CA 3NCHA 1TUEA 2RGXA 2DJ5A 3ORYA 1HQKA 1EM8A 4WK2B 3NETA 2VDJA 4WK6A 1YZHA 1KI6A 2Z8YA 2BGRA 2QEQA 1TJCA 1ONBA 1UOOA 1ZC3A 2OFPA 3AFGA 2XVXA 4IFEA 4JBHA 4BIMA 1BCRA 4CKZA 4MV5A 1QBQA 2AX4A 5CERB 1P4HA 2LO6A 3GZSA 1KYTA 2B2XA 2V1XA 2J31A 3CH6A 3OZIA 3QEOA 1TUBA 2BUBA 1ZIYA 2CGEA 3NTXA 4EHBA 3OOSA 2ATXA 4ZCSA 3V8PA 1LPNA 3WLQA 2GXUA 4F4HA 1KMCA 2R17C 1UWCA 1V47A 1ADBA 2I4NA 5AVOA 4PPYA 1O6GA 1H5UA 1MJNA 1NWHA 2Z6AA 3LUBA 3HJGA 5BSWA 3CZMA 5LLSA 2XRFA 1DNPA 2ETVA 2ODNA 2PIDA 2V9PA 4C30A 3N3AC 2CZQA 5FV7A 5FPKA 1SBIA 1KZGB 4ADSG 2HRDA 3Q3CA 3L6BA 5CT5A 2W6PA 1GEGA 3QYPA 2BP7A 4MMYB 3R74A 3TEJA 3A1NA 4NCHA 2P11A 1R9NA 2B61A 2D4HA 4KXVA 2GSDA 3V1NA 3RTCA 3BM5A 3FYUA 2JIQA 1GFSA 4HYEA 1JG6A 4Y9UA 4E7PA 4RQIA 1JQDA 5CA1B 5T7BA 1NMSA 1DIBA 2GZ3A 2H06A 2ZK7A 3QMPA 1C8BA 1E3SA 1JH8A 1PJ3A 1BDHA 3LVQE