4I6EA

A vertebrate cryptochrome
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
490
structure length
471
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQEDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKANANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-2
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 156
structure length 471
sequence length 490
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6eA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6eA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6eA01
1MB2A 2JANA 5J5AA 4G5YA 4EG7A 3HZRA 3ZJUA 1M8KA 4P2BA 4Q16A 1EFPA 1PFYA 4TS1A 1QJCA 3H9CA 1KP3A 1EE1A 4MW5A 4E1AA 1QU2A 2E18A 1JIKA 2HZ7A 4ZCTA 3P0IA 1O94D 2J07A 1VLHA 3CVUA 1J1ZA 1QRSA 4MWBA 1ZH6A 1K97A 4X0EA 5H7XA 4F3RA 1WQ4A 3KT3A 3G59A 1V47A 1TYDE 1PFVA 4ZT3A 1K4MA 3UK2A 3AL0C 1GPMA 1OWMA 1WXIA 1T6XA 1JMVA 3FOCA 2PZ8A 4MVWA 1F4LA 4YP7A 1N77A 3ZXIA 3TS1A 1N2EA 2JA2A 4NAUA 4ND7A 1G8FA 1KH2A 3D6VA 2A1TS 4ARCA 4QRDA 4H3SA 3KFLA 1IHOA 1MB9A 4MWCA 1JGTA 3ZUGA 3I05A 4MAFA 3P0JA 2GM3A 3SYTA 5TGTA 4KR9A 2YY5A 1QRTA 1O6BA 1PG2A 1KR2A 1I6LA 1GN8A 2A4MA 1Y42X 3OP1A 4JFAA 4ZCRA 3RK1A 2CUZA 1O96B 3AG6A 3RFFA 4G6ZA 2YWBA 2TS1A 3G6KA 4ZCPA 1KQNA 4I6JA 2CYBA 4EG4A 1QRUA 4KR6A 2QJOA 4QBTA 4JXZA 3NBKA 2WQ6A 4MULA 1RQGA 1T9GR 3H05A 1JIJA 4MVCA 5DASA 2A1UA 1M8GA 1EUQA 1P7PA 1N2HA 1YULA 1IQRA 3X1MA 3H9BA 1XNGA 4DE5A 2E89A 1N1DA 1FYDA 2QUIA 4Q93A 1M8PA 2A86A 2NZ2A 5LLTA 3IMGA 1J21A 2J4DA 1ZUNA 1WY5A 1A8HA 3QE4A 3IVCA 1G59A 3CLUC 3UMVA 1O94C 1ULHA 4YMIA 2CYAA 2XRYA 4J75A 3CVXA 3AFHA 1IH8A 2WB2A 5TS2A 1GAXA 3FI0A 3IOBA 1V8FA 1J09A 4ZT5A 4J76A 3ZJVA 2IELA 3INNA 2D13A 2PZAA 3IMCA 3KT0A 4HK4A 4WSOA 1LI5A 2OQ2A 3FH0A 3SDBA 1COZA 4S1OA 1PFWA 5DEOA 2YXNA 4DDMA 2J09A 2EL7A 5DB4A 1NYLA 4GRIA 4MWDA 4EG1A 3S3TA 3IOCA 2O8VA 1YIAA 3ELBA 1O0CA 2DLCX 4CQNA 2AG6A 2VXOA 4DNXA 1U3DA 1U3CA 4MVYA 2XRZA 2WSIA 1WXFA 1O0BA 1KH1A 3FG9A 1WZ2A 2H29A 1I6KA 3DV2A 1EFVA 1N2GA 3IVGA 2A84A 1MC1A 3CLTD 2QTMA 3N2YA 4MUHA 4ZCSA 3UC5A 3N9IA 3IUEA 1IQ0A 5TEWA 2E21A 3L92A 1CT9A 1KAMA 4ZCQA 1X8XA 4BWVA 1GZUA 4MUGA 3FIUA 3FWKA 1HYBA 1T6YA 4OUDA 3P0HA 1MAUA 1YUMA 1KQOA 4I6EA 1JIIA 4PBRA 3MLAA 3FHJA 4GU5A 3IOEA 3P52A 2Z08A 3M5WA 1S4MA 3JXEA 1WXEA 3UOWA 1R6UA 2CFOA 3MXTA 4UZFA 1I6MA 2Z3VA 1G8GA 1U7DA 4F4HA 2CV2A 4FZJA 4MW4A 3COYA 3LE8A 1H3EA 1O95D 1OWNA 4YP6A 4MW2A 1TEZA 1K92A 3F3MA 1B6TA 2HMAA 3A04A 4EGAA 4XSVA 2C5SA 1JEEA 3H97A 3TZLA 5LM3A 4PBSA 5KHAA 4ARIA 1R6TA 4EG8A 1O97D 2PXHA 1IFXA 4KPUB 3NBAA 2VTBB 3VGJA 2QTRA 4EG6A 1LW7A 1U7XA 3HL4A 1XJQA 5J59A 3HFJA 1YUNA 2GKSA 3KT6A 4RUKA 1OBHA 3X1JA 1KAQA 1WKBA 5KCMA 1KQPA 2X3FA 2CV0A 2OV4A 3CLSD 3IUBA 2BYTA 1WQ3A 1EUYA 3G5AA 1VL2A 1F9AA 2GOYA 2R5WA 3TZEA 1JEDA 2BTEA 4MUJA 1MAWA 2DUMA 3SP1A 3E27A 3MLBA 1LI7A 2DPLA 1N75A 3H99A 1YI8A 4EFKA 4L2IB 2J5BA 3IDFA 2DETA 2IP1A 2PIDA 3SEZA 4A91A 4MUNA 4MUEA 2CV1A 2QJFA 1TQ8A 1IVSA 4NZPA 3PNYA 3RHSA 4JZYA 4HPWA 3IVXA 3N05A 2DERA 4MVXA 5FNZA 2QUJA 5HUJA 1N2OA 2NSYA 1MRZA 4DDKA 1OWOA 3ZJTA 4DJAA 1NUQA 2JAXA 1U0BB 1M83A 1NP7A 3FNRA 1EJ2A 3CLRD 1VBKA 4PY2A 1I2DA 3ND5A 5BNZA 3OTWA 3SZGA 1O97C 1WXGA 2QUKA 3CA8A 4MWEA 3X1KA 4KR7A 1QU3A 3FY4A 4CT0A 1QQTA 2PZBA 1F7UA 2A88A 1Q77A 1WJGA 3ND7A 2EJCA 3SEQA 3K32A 1WXHA 1NURA 1SURA 1FFYA 1WOYA 5LFAA 3CR8A 3SZ3A 5DK4A 3CLSC 4AQ7A 3N8HA 1TFUA 3A05A 4QREA 2Z09A 3CVVA 2D5BA 2I1LA 1ILEA 5EKDA 2DXIA 3AKZA 1GLNA 3K9WA 1OD6A 4DLPA 5IHXA 5K0SA 3LCJA 4ND6A 1EFPB 4JYZA 4U7JA 1IRXA 3HV0A 2AKEA 1PFUA 3ZIUA 1NZJA 3VU8A 2WQ7A 2V0CA 5HUHA 2YWCA 3ND6A 3RBAA 3GLVA 3Q12A 1R6XA 3QTBA 1TYCA 3FETA 4XFDA 3Q10A 2ZUFA 1Q19A 4ZT4A 1UFVA 3HGMA 5K0TA 1M8JA 4MUIA 4ZT2A 1H1TA 2V0GA 5FO1A 1X6VA 2G36A 3BL5A 2X0KA 4NAHA 4MW1A 3PNVA 1QTQA 1TYBE 5H16A 3CVWA 1F7VA 1K4KA 1M1ZA 4MUFA 3D6UA 3UY4A 2AZXA 3CLUD 5IJXA 3ZGZA 2PFSA 4YP5A 4HJXA 1JHDA 5FO0A 4R2MA 3TQOA 3CLRC 2CSXA 2RD2A 3KT8A 3DLAA 1KP2A 4MW7A 4U8HA 1M8FA 3C8ZA 4NATA 4EF6A 1T9GS 3MUEA 4MLPA 2H2AA 4UZEA 2RE8A 1JILA 2A7XA 2J08A 3ZXSA 2O5RA 2ZUEA 3COZA 1T6ZA 1G8HA 1NI5A 4KPUA 3RK0A 2VTBA 3CLTC 4JXXA 1KH3A 3IODA 4MW9A 4I6GA 1BS2A 1XNJA 3GUZA 4HJRA 3VRHA 4XFJA 2A1UB 1TYAE 3U1VA 1KORA 4EG3A 1H3FA 4CDNA 2X1LA 1JZQA 1J1UA 5J58A 1MJHA 1O96A 5F23A 3DPIA 4OJMX 2A1TR 1VBNA 2HGZA 2QJTA 5KWVA 3TNJA 1H3NA 2B7LA 3GMIA 1ZJWA 2DEUA 1DNPA 2D54A 4DDHA 2QUHA 1EXDA 2CYCA 4MW6A 4MW0A 2IJGX 3QTTA 4K0RA 3NV7A 3FDXA 3Q4GA 3RJZA 4U63A 1GTRA 1PG0A 3CVYA 1O95C 1NSYA 4K03A 1J70A 4L2IA 1JZSA 4AS1A 1Q15A 1VBMA 3AG5A 4MQ6A 3IMEA 1NUTA 4KKVA 1IQUA 2CT8A 1MBZA 1GTSA 1QNFA 4NDAA 1ZH0A 2DR2A 1N2IA 3COWA 4R2LA 3TQIA 4EG5A 5JBNA 3DO8A 4CDMA 3COVA 5AHWA 3LOQA 4ZT6A 1N3LA 1EFVB 4NX2A 4WNYA 1Q11A 1OWLA 4MUKA 3PXUA 4R0NA 5TEVA 1N2JA 1O5TA 1NUSA 1NUUA 3AIIA 3A2KA 3A4IA 4YBRA 2E0IA 1D2RA 3MMXA 2QTNA 3IH5A 1N2BA 4OUDB 3PNBA 1KKUA 4G5FA 4RPIA 3HMQA 1XNHA 3ISJA 1J20A 2ZP1A 1NUPA 4PBTA 2X1MA 1OBCA 1YIDA 3L93A 4ZT7A 1N78A 3ILVA 1JECA 1MOPA 5HG0A 2PG3A 1OWPA 3PRHA
chains in the Genus database with same CATH superfamily
4A7PA 1IOWA 1A96A 1W76A 1H4QA 3P7MA 5B7NA 2RC6A 5AKHA 1A97A 1YS6A 2DRIA 3RBXA 4FYWA 1VLHA 2QGNA 3I83A 1YRAA 2X1VA 4PSAA 2QXYA 3PE6A 1J7KA 2IKQA 4L6AA 3VR5H 5K2MA 3TLGA 1HBJA 1Y6FA 4CGWA 4CEMA 4MQUA 3C2QA 4ZZ3A 2H11A 5CG1A 2A4MA 1K88A 2ABWA 1XNRB 2QVGA 1Z6PA 4RIFA 2WHPA 2AQKA 1IWOA 2BR4A 1EJBA 4AJIA 3GLUA 3VBCA 1WM1A 5K3FA 2H18A 1AUPA 3PR2B 3VV3A 3DLCA 3WLPA 1H0SA 3W5BA 4LOJA 2K7FA 1PBNA 2C04A 3L04A 5LDGA 10MHA 3WXBA 3W90A 3RI3A 1H5QA 4GDFA 3DL4A 5ES3A 2OO5A 4V0SA 4Q37A 3WNZA 3NANA 5I6DA 1VIDA 2FAXA 2ZJ3A 1TPYA 1E6KA 2NNWB 1LPPA 5G40A 1XJ0A 3E15A 5GONF 5CDFE 1ZR4A 1ZICA 2I1JA 4IY1A 5K1ZA 3ESCA 1A27A 2A9KA 1CR0A 2GDJA 4RZUA 1KK2A 1ULZA 2GTPA 3DFUA 3K9BA 1V3VA 4MCIA 2DBVO 1SKYB 1PEDA 4QU0A 3A04A 5AQBA 2QN1A 3N7UA 1DCTA 3T3OA 1GQQA 4RS4A 3K8QA 3PIRA 4YP0A 4INAA 1QHYA 3S2SA 1Z2PX 4GKKB 4GX2A 1UPCA 3ANSA 4EOGA 2EWMA 4A2QA 4P7BA 4LSMA 3HS3A 1H4SA 4TRQA 4R8SA 1K0UA 2AEMA 3UHPA 1RYZA 1X9HA 3MEQA 2GO1A 4LJ4A 2ZJ6A 4L2IB 4QBGB 4IFTA 4PDXA 1HRDA 4AKHA 1XZ8A 2VF8A 4FSHA 2RGYA 4X1KB 1NP7A 2ILRA 2O3JA 5CDTA 5SYAA 4JBNA 4F2GA 2BEUB 5C8DA 4C88A 4BCBA 1F7UA 5JSYA 3ZYKA 1DIBA 5AKLA 1WXXA 1CBUA 3NC0C 3CY6A 1ODSA 2QD4A 3H13A 1IHXA 2Z09A 1B0UA 2J8ZA 3Q3VA 5B37A 2IHBA 4DILA 2P4EA 3BZBA 3IL2A 4ZU1X 4WBSA 1E96A 4GZ3A 5HYVA 2N42A 5FO1A 4NULA 3ZGZA 2PFSA 1EYHA 2AFVA 1X5BA 2A0WA 2Y69E 1AHHA 5HF6A 1KP2A 3OO0A 1ULAA 3AP1A 1XAHA 4X8MA 1OXTA 1AN9A 2CHZA 5K8IA 4D4MA 1GPKA 3GUZA 4DQDA 5AVVA 1J1UA 2F1HA 4PPYA 4PTLA 4RD1A 2ZRCA 1ZUNB 5C8YB 1PNRA 1Y7PA 1VLZA 1X92A 3JZDA 2GJ9A 4QD3A 2YIVX 1G5RA 2ADFA 3IKJA 4D42A 3R20A 2OEVA 3GRRA 4BC0A 3G2WA 1WVMA 4WIAA 3JQ9A 1HYHA 5E7QA 3SLGA 1NRWA 3TO5A 1N3LA 2GEFA 2AOVA 2EOAA 3MGCA 3A2KA 2EKPA 4EHHA 1JTFA 2QC9A 4FULA 3KL4A 4UD2A 3JRNA 2EKQA 3L93A 3WB1A 4I1AA 3PUZA 1JKJB 4D56A 3HVRA 2FSPA 1T0BA 4CQMB 5CCXA 1ESDA 3GGGA 2Q5HA 2UUPA 3D1JA 2EG9A 2O20A 2VBFA 4Q3OA 1DC3A 4DLYA 5DEIA 2C97A 3DBHB 1T3TA 1EX6A 3F74A 3W6ZA 2Q1TA 2BMWA 3T12A 3FB1A 4DM3A 2N3ZA 1BQEA 3RRXA 4HB4A 3KUDA 1Y81A 4FDUA 4ARCA 1G5TA 2PMWB 3ICVA 1T8YA 2QAIA 3IIJA 4U2FA 5CA0F 4JVOA 4J2HA 4CIDA 2Y2VA 3OICA 4FJ2A 3QPUA 4CR8A 1LC3A 4REOA 1XIVA 2P0YA 5AVZA 1CD5A 1IULA 2XNKA 4CBVA 2OEPA 2CLMB 1AO3A 3D3NA 3F9IA 3W77A 2VHXA 4NZYA 2OOSA 3DXXA 4G0XA 5J63A 1XEXB 4QTZA 1C41A 5DBEX 2QJWA 2IOFA 3IV9A 3ICPA 4RX1A 2GERA 1R15A 4GYWA 5C52B 2ZB2A 1OJLA 1W4AA 1X19A 1XCGB 4YJFB 5HDBB 5AOCA 1E2GA 1RM4A 1TC1A 3I01A 3PQEA 4PXSA 2GCOA 2O8DA 1Y3HA 2N9UA 1IKND 3K92A 2VT7A 3I61A 1IONA 3H8SA 1SXQA 3DEPA 2ZB4A 2QRMA 2VHQA 3H9EO 1TW2A 4DC9A 3LX4A 2Q4DA 3NBQA 1SELA 2NUPB 3UHJA 4DMFA 4BFUA 2J1LA 5HK9A 3KKLA 4UEOA 1IM2A 4O2BB 4XPIA 4XR9A 3FFWA 3DBVO 1G2IA 2JIDA 3EG5A 2BFPA 4OM7A 2W83A 4EDFA 4F4DA 3D2AA 1U2VG 3PGA1 1KPGA 4PF1A 1ADBA 2FDXA 2XDQB 1M3SA 3AG2E 2QQFA 2Z9DA 3CGGA 5KPJA 5KOIA 3DMYA 4TGLA 3JQAA 3SJCA 3A2LA 4IIBA 1MT3A 4DA4A 1IB0A 4HPJB 3JQAD 3C5RA 1ZRSA 3AF2A 3M83A 3QVOA 1TU3A 4DA7A 5B3LA 2C03A 1XHLA 4O02B 4G8BA 4OHRA 4AO8A 2C9ZA 4HNGA 1TTQB 1MQ9A 2Y1OA 3RYCB 2GW1A 1UK9A 3LD9A 3UAZA 4TZKA 3B6JA 2WJJA 2WXGA 5C4MA 2NU6A 4JJ6A 3CLSC 4YWJA 3M34A 2B25A 4HOTA 2NXJA 4XDHA 3FCOA 2ORED 3KO8A 1Q50A 4CIXA 1LDGA 3KUKA 2JKYA 3TTVA 2KXPC 4JWKA 2WJGA 2RHTA 1LFDB 3HM2A 3EGIA 4F2WA 1ZN9A 3D6HA 3E9YA 1U2ZA 1MENA 1V54E 4RV9A 1ISFA 3ESLA 2IK8A 5DNDA 2XYQA 2H31A 3U31A 2W6JA 2K6GA 2ODPA 2ZU0C 3UO8B 3B1VA 2O0KA 1LF0A 4QU5A 2J3MA 3ZD6A 2VJMB 1X1TA 1FPPA 2M6RA 1L5SA 1L4YA 4ZC1A 4AIIA 4D9KA 1QQAA 2Z0MA 3CKMA 3U7HB 2YZNA 3WLFA 4C4AA 3B7WA 2E4YA 2NO9A 5KQGA 1FMTA 3GZTB 5KJ1A 1LD3A 3TQRA 2G1KA 4CKEB 2JD2A 1I3LA 2Q5FA 5IDXA 1ZNYA 2QW0X 1G2OA 5L95A 1QCDA 2Y1EA 4FMBB 1FEZA 2GEVA 1USVA 3SC3A 1N5OX 1QV7A 4AP9A 1Z3IX 2YW2A 1VI5A 5IWCA 4RMHA 3TRJA 1TRKA 3HACA 4XCQA 4ACAA 3R40A 4HWSA 1UK7A 3GG9A 1JWLA 3HP1A 1TU4A 1NA5A 1OAKA 4ZFNA 1ZD4A 3DDHA 1H1LB 4YJKA 3UFBA 1FTQA 4UUNA 2YV1A 3NHPA 1BQ3A 4LNUA 4JEHA 1GARA 3CB2A 1I4TD 4I50B 1JVSA 2AA3A 1JIKA 2HZ7A 3Q6IA 3B13A 2J07A 3CO0S 4LNUD 3OFND 4KXFB 1P2VA 2DPMA 4Q1VA 1I3OA 5AFSA 2XTNA 3C0KA 3ZCQA 2Z2JA 3LL7A 2I2DA 3W9UA 4RZSA 1YBFA 3IHTA 4LN1A 1GQ2A 2X1HA 2IO2C 5ENOD 1EGVB 1V2GA 3IEMA 4UBOA 4JI0B 2G1PA 1NMYA 3QH4A 4IDBA 4MVJF 4FHKA 4IDFA 3HBAA 3A6ZA 4I1OA 4JJAA 2B69A 1SC4A 2YC2C 5EKXA 4GMGA 2QUBA 1JCQA 2QE7D 4D9IA 5EJ4A 1FTWA 2J5KA 3CO5A 3SDBA 3THOA 5CXUA 3O4IA 1C2TA 1TQ4A 1FYEA 4MLCA 5CFRA 3MINB 1ELOA 2AN4A 1GV0A 1GZ7A 4AX8A 4C7JA 1UDXA 2I7XA 5F3WB 3VJKA 2Z3ZA 2QP3A 4V3IA 4QJ5A 4MV9A 1S4MA 5KNLA 3AONB 3ZV7A 4FGSA 5AWFC 1R6UA 4EEKA 4BNWA 2F3PA 2ZUDA 1EUDA 4PSKA 3ZDXB 1YVRA 5CHEA 3NGMA 4IN3B 5TPZA 4UAVA 4XDYA 4A6PA 4B6EA 3L02A 4NOKA 2IEBA 1GCIA 4R1UA 3DZBA 3U62A 1DJOA 5TPZD 3ULKA 4IXMA 2DQZA 3EAQA 4IJWA 5J59A 3OTIA 2X42A 4KLZA 4ZZ2A 2ZISA 2POCA 3KCNA 3CM0A 1JW9B 1UBKS 4B32A 4FKZA 3W8FA 5C4GB 3EW9A 3U48A 3R5SA 2ZBQA 1NVTA 3LQYA 2DT5A 4CG3A 4PM4A 2CXOA 2I76A 2HL6A 1N75A 3FMIA 2GZ2A 2GCGA 3RS7A 4Z2YA 2WMNA 4FXOA 5C8ZA 1AQYA 3L8DA 2QXTA 3R3WA 4KYVA 3FTWA 1BNCA 2X8WA 1L1FA 1G8AA 3N74A 3ZU2A 4PICA 4C48B 2C3YA 1FRQA 2R2GA 2MIIA 4YAEA 3A31A 4N76A 1ISSA 3A1EA 5K01A 5BMVF 1WZUA 3GRFA 3N8IA 3L43A 4R1OA 3T9FA 4GW3A 5GM2A 4C29A 4GMLA 3F6EX 4KZPA 3L7NA 1HZZA 1QSGA 3D2LA 2GZRA 4KIUA 3KKEA 3TBFA 4FT2A 1QOQB 1BVHA 4PWZA 1JU9A 2AKEA 2WHRA 2VZ8A 3R74A 1YV9A 5EP3A 3DVAA 4TLBA 1Q19A 2WTBA 2XW6A 3G79A 1IEVA 1WXQA 2BBOA 4ZT2A 2RSLA 2G1AA 2FPIA 1S2MA 4MGIR 3VZCA 1T8TA 3ZHTA 5DYGA 4YCAA 1EWVA 4L4YA 4B31A 4UQZA 1QGED 4UNRA 4OB7A 1JAXA 4V02A 5E9JA 2QLTA 1OREA 4J90A 3LLUA 5JXIA 2Z8XA 5E2IA 4AF6A 3QEOA 5HE9A 4TL7A 1GM5A 3L9XA 4GM0A 3ZKAA 1AA9A 3IE2A 3KTAB 4IHKA 4OCZA 3JYQA 1H3NA 1PI3A 1V1MA 4JD5A 3L49A 1NJSA 1YR6A 2UY1B 4KBYA 5DXAA 2F90A 3TSCA 1GCGA 1W49A 4UE3S 1VG9B 4ZOLA 2PJUA 5AXAA 2B7BA 1IG3A 3G0DA 1YB6A 1XRQA 3RPEA 1P5HA 4G3XA 1OA1A 4TVBA 4I5GA 1DVRA 1PGNA 2G1JA 4NDAA 2XF2A 2CBGA 3C7TA 3HDTA 4YRDA 3HYMB 1JDZA 5L3QA 4S1WA 1HC7A 3SZUA 5T64A 1FFGA 1L1QA 2P6RA 1QO0D 5EYPB 4O6FA 2I99A 1KWKA 4J29A 4DUZB 2JGJA 1IHPA 3PUKA 3J81k 4RZXA 2A14A 3BD7A 3ADOA 4B87A 4RDCA 4R6XA 2Q7XA 1S2GA 5D1HA 2PN1A 4KLRA 1MX1A 1E62A 2VATA 3VOSA 1QJCA 1U63A 1OLOA 3L84A 1A2OA 2UZAA 1RAEA 2L69A 1D1PA 5CEDB 5J5CA 3UJ6A 4DCSA 4L7QA 1GU7A 2VNIA 3WTBA 1QDLB 3NWEA 2R6ZA 3G5UA 3D0OA 3EZ2A 2P7HA 2B9EA 2O0LA 1MLDA 4XX0A 1MUUA 4J2TA 3DBRB 4PX3A 4EG4A 5F2NA 4KR6A 4I1IA 2JD1A 2A1UA 2W4IA 2JJ8A 4IJQA 5AK5A 3S5JA 2FGJA 3ODPA 2IEDA 4GZ5A 3F2VA 3LO5A 3NPMA 2W71A 1GAXA 3WGIA 3CEMA 1XL1A 4V2UA 3DHWC 2L0XA 2AXQA 2EBUA 1BCRA 4D5EA 5JEEA 4UI9K 1VGVA 3HEBA 4MPDA 3STUA 4EELA 1QUFA 1YHZA 3L7AA 3WBJA 1RWQA 4M0UA 3UFXA 1R4NA 4DBLC 1LPSA 3PDWA 4H7DA 3LKBA 3GLGE 5BVGA 5F2EA 4Q3DA 1H9BA 5J4HA 5KMGA 2ZBGA 5IH7A 5BV2P 4BWVA 3QC1A 1DAPA 5CNJA 2J5XA 4B89A 4RHEA 2L18A 3CC8A 4MYTA 4XQ9A 3H9QA 2ZOSA 4ZVQA 5CIYA 3AI7A 2Y77A 3CNEA 1W85A 1R0SA 3V8EA 4LKOA 5CCEA 3GP8A 1YDHA 4OHBA 2X9GA 2C2WA 2J59A 1SB9A 4DLSA 2WWYA 3P26A 3UVEA 1JV2B 4CM7A 2BTEA 4MIKA 1HLPA 1MEJA 4ASUA 1F0YA 1PV1A 3EIFA 1ZEJA 4XJSA 5KDLA 3L7KA 2N0SA 1N5IA 5FYDA 2R1TB 2IU1A 3R0VA 4ASUD 3RYFA 3BDAA 3CZMA 4Z3OA 5DHFA 4N7RA 1PZEA 2OBNA 4ARVA 3IAEA 3SYMA 4KE6A 1BGWA 3E32A 5AW3A 2P9LG 1D9SA 2H54A 3W0LB 4X64B 3FY4A 4BFTA 1HURA 5EIEA 2W2QA 4O4JA 1NVBA 1SEPA 2DOKA 3MTEA 4G1BA 5B36A 1WMBA 1XQYA 3I34X 1GVNB 4EJSC 2O8FA 1EFPB 3Q7EA 3I1JA 4OVVA 2IUFA 3R3YA 1S2NA 2QTWB 1I9CA 3RBAA 3MGKA 2ZYAA 3SE0A 2Q9BA 2GSDA 4Y1RB 4H17A 3PXDA 3HI4A 4F3YA 5A5DA 5IJXA 2DHEA 3TUIC 5GOTA 1Z0SA 1VFPA 4CM8B 3OG9A 3ZCTA 3JR7A 4RJ2A 5EMKA 4JROA 5SV2A 1XK7A 1CEEA 3R7RA 3RHTA 3JQ7A 4NENA 4C30A 4CXMA 1EYZA 1HDOA 1XNJA 3RKRA 2R8EA 2VZEA 4KN5A 1HEIA 2EFCB 1OCCE 1E4EB 4ERNA 4FU3A 3IV7A 3JAWA 3PDIB 1CUYA 2AWOA 3FKSA 1ZD5A 3LQ1A 4LZJA 1QO7A 3NOQA 1F4VA 3HGTA 3HJFA 5CDSA 3FKSD 2JGKA 3QLVA 5EJFA 1B4DA 2QMOA 3CGWA 4RC9A 4HLUC 1QAQA 5EXEA 1KP9A 4Y7CA 3VV2A 3W3ZB 3H9JA 4BO0A 5NULA 3ILSA 4MKGA 4O4IB 5M3BA 2Y4NA 4YR9A 1KC3A 1YRYE 3PC3A 1Q14A 3MMPA 1VYVA 5DN6A 2FB9A 4QGBA 2IYXA 2EARA 5DN6D 4RAQA 4BMCA 1TXGA 4DCJA 1M0SA 3AR7A 2NX2A 3ZHEA 3DTVA 1QU2A 3SZLA 2H6GA 2O7RA 3PH0C 5LUBA 1P6QA 3PX2A 4J7CA 4BGVA 1GR0A 3DTVD 3WYEA 4F3RA 4OFXA 3OEHA 4KQMA 4KI7A 2ETCA 1T5BA 2CXUA 2C4VA 3OEHD 2AVPA 1L1RA 3T5MA 4YMUA 2PM6A 3KQWA 3PGXA 1L4UA 4LHSA 1HUQA 3RD5A 3BE6A 3NIDB 4BB5A 4PSVA 4IMJB 1CYEA 3DZCA 4X1YA 4C3VA 3L8GA 3ZDBA 4F4IA 1L2TA 2H92A 4GPTA 1EFLA 5LLTA 4HDNB 5AJTA 1EDUA 3FI0A 1BYUA 5BPFA 5AW9A 1E5QA 4PXAA 5LYJA 2PWAA 1JLKA 3BAZA 2EIXA 2ACEA 2D7DA 1IJFA 1GCUA 5ICCA 3VPGA 3H3FA 2NVUA 4ARZA 3Q11A 3MCXA 1UBRS 3UAWA 4ZMRA 1FU8A 3VA7A 3UQ3A 1XELA 4CM3A 2YVKA 4RANA 3JD0A 4XZ4A 1RC0A 2VQ2A 4FD3A 3EGCA 1AB5A 2R11A 2F1KA 1D03A 3V7UA 1M2OB 1G5FA 5AM3A 4EJ0A 4JJIA 4BETA 1WXWA 4KWEA 1T5SA 1LA2A 3OPVA 4R2JA 3CLKA 2AFIB 5JUWA 4IV8A 1E79A 4C5BA 3CZ4A 1M1NA 2YRXA 2VPZA 3TW4A 1OCRE 4KPUB 1QFSA 3CLHA 3D4LA 1XXHA 1OXSC 1E79D 1YDEA 3DGFC 1KQPA 4LBZA 2YJZA 3LM8A 2O19A 1RWXA 3QBTA 3ED5A 1CJSA 1NXXA 5HS0A 1UM8A 3IE0A 4F12A 5FNVB 5CFNA 5LZ8A 2ZRJA 2B8EA 3BQOA 4E7PA 2GA9A 4WKCA 5I3ZA 4UDYX 4TVOA 2JZOA 5TF0A 3WRYA 4EZIA 4WKNA 4G8LA 1NUQA 3B38A 2WAAA 1T0PA 1YZGA 3UOGA 4UNIA 3HZZA 5KQLA 3A70A 4UTPA 1EGQA 3D3MA 4QJ3A 3CT6A 3LL4A 1M0EA 2HIMA 5BWNA 3I76A 1SRQA 2DXIA 3H1BA 1A2BA 5LA6A 1JEOA 1IRXA 2BDUA 4EZLA 1DOHA 4BMVA 2ZUFA 2EQXA 1JEYB 4BNMA 3LUKA 3FCSB 3RS4A 1P9LA 5TGDA 1SWWA 4R1QA 3SD7A 3I9OA 2XVXA 2H1VA 2FLWA 3I2FA 4HUQA 1RW2A 4IIUA 4MYUA 2H07A 5KOJB 4F45A 3A6JA 4PLVA 1Z4QA 1A2KC 2QL7A 4YDWA 4JR1A 2WPVA 3LUFA 4PYQA 1JTEA 4D3FA 4OJKA 4PAOA 4BJHB 3SR0A 2BP7B 5AM5A 1XMPA 4AS2A 1G3QA 1SQSA 4KGVA 4CMIA 5FH9A 4KITB 4BUZA 4UM9B 3QWFA 2RGRA 3Q85A 4Q69A 1F0PA 3ZHYA 4YCMA 3BPSA 5JTUA 2BMJA 4NI5A 1QX4A 3NYIA 3NH6A 5F64A 3HRHA 3NETA 1TTTA 1SKYE 1ELWA 5FRDA 3LXRA 2J6IA 3DE2X 3IUSA 2H5JA 1WCXA 1I8TA 4OG2A 2Q3EA 4YJ2A 2JASA 2BKLA 3NORA 3CZ9A 2XZTG 4P82A 4FZRA 2FJUA 4BZZA 2E18A 2O0MA 1XZMA 1Y9ZA 4ZCTA 4E85A 3V6MA 1Y5NA 2QEQA 5CT9A 1PFVA 2GBFA 2OM2A 4B33A 4UPEA 4KQEA 2HBQA 3BB4A 3RUPA 3N39C 2OQVA 3B5JA 1E5TA 2ZSDA 1PE0A 2IYUA 4TTAA 1W4CA 5LN1A 1QS0B 2ZJAA 1DKLA 2ACWA 4Z4QA 1RHJA 1PG2A 5ITZF 1Y42X 4U8GA 3DWIA 2PXXA 3D6TB 2ZT6A 1QH8A 3IKTA 4URVR 4CEHA 1ST3A 3RS3A 4JI1B 3HXTA 4JJKA 1T3LA 3HXCA 4OJQA 2J4DA 1TW3A 3OTQA 4QARA 1U2GA 4GZCA 1LRKA 2QT1A 3LPDA 5L3SA 1ZW1A 2AOXA 4MTCA 1CK4A 3HRAA 1W48A 5LQRA 1DXHA 1EQAA 2BMDA 1NZFA 1TJPB 3KB6A 2ZJ1A 1L3BA 2CLHB 4NYIR 3BVPA 1Z82A 1U1EA 2ZDQA 3PZDA 2CJWA 3VSDA 4GBED 3D9OA 3QXHA 2O8CA 3GRCA 3BXZA 3W79A 5DLEA 3FDHA 3AFNA 4DSNA 2NO4A 1GRNA 2H2HA 2BZ1A 3CPJB 1KHTA 5CVEA 5E38A 3NS7A 3HABA 4ITRC 4UAJA 5BV1A 1U7DA 1QNLA 3FJOA 4RF4A 3TL2A 1P7WA 1NONA 3HWWA 2L0TB 4ARIA 2ZULA 4DI3A 1SU4A 2QSYA 2VHYA 4ESHA 4BNLA 4I9HA 1CUAA 4HMPA 2OILA 2AOWA 3HG0D 4CEIA 3LYAA 2J5RA 4WKBA 3PNLA 4EBBA 3UPDA 4APOA 4BE9A 1GKUB 2B30A 4MUJA 1LH0A 3B2EA 4ZTBA 3VU1A 5DTIA 5H02A 4X8QA 4KQGA 4P4NA 4ZEOA 4L76A 2EJVA 3UMFA 3OPYI 2ZIXB 3RCBA 5BMVB 3RRMB 1QGAA 1J39A 3OX4A 4G4GA 2GRNB 1Z7BA 7MHTA 1R0YA 1H22A 4DEXA 1NSTA 2Y68A 3JASA 3WGMA 2FZLA 1OVGA 5ICFA 3L7IA 4QDUA 1UAGA 2DU8A 4KXUA 2C5HA 3T0IA 1TNBA 3SZ3A 4GVLA 3WICA 4KQ9A 1HORA 4G85A 4LJLA 5AUNB 5EIWA 4I4IA 5BSEA 5AJXA 4LYDA 4K8RB 3CZAA 4IDCA 4B2PA 5EZ6B 5FHRA 1J9EA 4IW3B 3DHVA 2I4NA 2ZZKA 4DLBA 3GLHA 2PS3A 1ZY2A 2G36A 5FWYB 3UMJA 1K4KA 2XNHA 4Q4HA 3X2EA 1P8AA 5AARA 3WNVA 1JPLA 1PNQA 1PNOA 2YYYA 3U16A 3BA1A 4MS6A 3KTDA 1TYQG 3SF8A 4F1KA 3WISA 3E3AA 5JHHB 5CURA 2QN8A 3COZA 1KH3A 4YGYA 1M2FA 4D0RA 4L5AA 3EPPA 4AG6A 4LX8A 3D3WA 3AESA 1WKVA 3UJ8A 3OZFA 2OFPA 2D1TA 1KFJB 1YQGA 3NV7A 4H0CA 3U3JA 2HU8A 3WKAA 3FPBA 2RCNA 1DKUA 2CNOA 3DVQX 4C4RA 1N5DA 1TK9A 1MV8A 3WMEA 1VMIA 1T0JB 5FOVA 3FEYA 3OUTA 1KVSA 2ZYHA 1YU9A 1SXPA 3L07A 2AD1A 5BSHA 3PUJA 1RYMA 2WAYA 3NBXX 2XXJA 4PLZA 4P53A 2FZVA 5DT2A 1LDNA 1KKUA 2JGRA 5K6AA 2H5EA 5THKA 1TGVA 1C7RA 1Q1AA 1G5QA 5KYKA 4F3VA 4D79A 2OPBA 3OP4A 1NN5A 1NAIA 3WQQA 2CCKA 4AJEA 1T4GA 4LHYA 3VYRB 1EFRA 3F7NA 5BOSB 3E2PA 4KB5A 4JP8A 1J0BA 2F43B 2ZETA 1YZFA 5SY6A 1YQQA 1G21A 1RJ9B 1EFRD 4MWBA 1TA9A 2UXBB 3QJZA 3GQBA 2D2FA 1IN6A 4O4HF 4UNPA 5FPYA 1PK8A 2GAFA 5FBWB 3OAAA 2C9MA 1V8ZA 1HL7A 1GL9B 1JSZA 4BVHA 2A67A 3VM6A 2XGOA 1HKHA 4YUVA 2OBBA 3KSDO 3MCVA 2FEXA 3H2HA 3KC2A 3DPSA 3KR0A 3U4QB 1F2TB 2UKDA 1AH2A 4X85A 4TV8B 1HX7A 5MFPA 4G8CA 1OX4B 4PHCA 1ZRMA 1GNVA 5IKXA 1HRKA 1X1DA 3LQ4A 1HSOA 3BDVA 5HRYA 3IERA 2IELA 3D7RA 2KCVA 2P40A 3OC0A 4J8PA 4DR3B 1VJGA 1K4YA 1BA3A 4QWWA 4A2WA 1DQRA 3GEBA 2R4QA 1W19A 1XX6A 4GIBA 3P2IA 3A8TA 1G7CA 5IKPA 1KMHA 5H81A 1VIAA 2HO1A 1R4ZA 2XE6A 1ECGA 3T9BA 1KI8A 1UK8A 2H48A 3LUHA 3AEQA 1X86B 4G89A 2QI9C 3O38A 4AJKA 1CB0A 4HWGA 5F52A 3UJ9A 4F97A 1MPXA 4OM8A 2JPDA 1I13A 1J8MF 1OZFA 4AKEA 3AEXA 1T34A 3GA7A 3ENKA 4QGFA 5A3JA 2YZ7A 4E22A 1RM0A 1D0SA 4WUVA 3H97A 2W6ZA 4JCOA 4JHJA 3CWQA 1BJRE 4PG8A 1VE5A 1I0ZA 3O83A 1SKUA 2BHTA 1XJQA 3G2OA 1U28A 4WBNA 5FV4A 5EUMA 4UI9C 1R0ZA 8GPBA 4ZVNA 3FZYA 2XF8A 2IXTA 2NZYA 1K9SA 3GUUA 5LYYA 2OPHA 5IS2A 3I39X 5CD9A 4TLAA 1DAFA 4AT1A 2QRKA 3M5CA 4J0FA 4X7MA 5FT9A 4FDAA 1EGMB 3ITEA 4ID9A 3T5TA 1K8XB 1E20A 2QM3A 3GLQA 1W52X 1GZVA 4BX8A 3AJIA 1DAHA 4URKA 2Q9CA 1CUJA 3QUAA 5IBCA 1QHHB 3QKYA 3UT8A 1BE8A 1QU3A 4WK6A 3ZWPA 1W2WB 1NXWA 3JYSA 4L1BA 2WBLC 4WJKB 2QLJA 5F1KA 2DTXA 4HQFA 1J0DA 1EI9A 1NW3A 2R3SA 4QYIB 4BZQA 1NUHA 4RHYA 1ZK3A 4LSWA 3HYNA 5K9ZA 2HDOA 1JXQA 2J4CA 2IDKA 3PNVA 1NR1A 4YXWD 5JTTA 9MHTA 4HTAA 2RONA 5GJBA 4UFPA 5G4KB 2QN3A 4P22A 4ZAVA 4BJ3A 1Z7GA 4EUEA 3RRNA 4YCNA 4JP5A 3WHLA 4W7IA 3U3DA 3D7MA 5MN4A 3KHUA 1C4WA 5JALA 4CW7A 4XYBA 2HGZA 2RH4A 3FPGA 2B7LA 4QQNA 4V0LA 4K5BA 4OGWA 3K1ZA 2W42A 1TNZA 1HE2A 4AXHA 4MA5A 2XMZA 1IBMB 5FA6A 1XMIA 1SCJA 2H7VA 3KALA 1QZ3A 4PSCA 5B3AA 5C5EA 4BB6A 2Z1NA 2MSLA 4EG5A 2D5AA 1GUBA 3EH1A 1IZ9A 1XCPA 4IDGA 2P9KG 5EILA 2ACVA 2ZANA 3EMBA 1X9GA 4QQFA 3G0GA 2AC4A 5AW6A 2RI0A 3ZGOA 2W93A 1HT2E 4FYXA 3N3AC 4W82A 2VFAA 5IRCD 1ENOA 3DMGA 1JJVA 3VC3A 1YB7A 2Q1WA 2AXEA 2R86A 3OD5A 4GZLA 3L0IB 3WSWA 2A0KA 1M72A 1S7CA 3RYHA 3P9QA 1H4TA 1SZDA 4EJ2A 4G09A 4Q1AA 2CXNA 3TXXA 2CEKA 5LKRA 3SE7A 1EG7A 3C3DA 1EKXA 3NZUA 5CX1A 3MXOA 1OWMA 1ZVKA 5AVJA 3ZNQA 4OBEA 2ETBA 3BDIA 1Y9AA 1YA8A 2K87A 1MB3A 1VPLA 2XR1A 1H6KA 1SCAA 4AB1A 1TGYA 8LDHA 1DBWA 3UWKA 3U61B 3KU1A 3IAXA 2X22A 2Q2QA 4NHEA 3ES9A 1D2GA 5CECB 1F14A 3QOWA 2ORYA 4YRNA 1R7RA 1GG9A 5ENNA 2VUTA 3QYAA 1HX8A 3PQ4A 2HU5A 3WE7A 3PC2A 1MCZA 2WYIA 3TQFA 1FP4B 2V0NA 3EXEA 2GHQA 5FULA 1UBSB 5G0VA 5EDSA 4J8YA 4DKJA 2FPGB 1COZA 3GDHA 3FUUA 1VCMA 4MVJH 2XZOA 2G88A 3S29A 3ANNA 4J1QA 5EZSA 3CRQA 5AYVA 3PL1A 1QYRA 3ADKA 2AOTB 3KS2A 1X8XA 2H85A 3GIDA 1E9DA 5JIBA 4EQZA 2J6CA 4DCTA 1V96A 3VJRA 3Q78A 1JP7A 1UM9B 1JMKC 4JLAA 3X2SA 4EHKA 3H11A 4BQQA 3VGPA 4C1NA 5EWMA 3EG9B 3A37A 4OHFA 3BD8A 5I9LA 1QZUA 5KNDD 1G4AE 1WDKA 4RTRA 2HLNA 4YJGB 5KZMB 4KXNA 3GLSA 1VSBA 2AMFA 5GTDA 4Y9TA 4DIUA 4Q9HA 2NZJA 3FNBA 2JGDA 5BR4A 3IAUA 2HMWA 2JCGA 3GGOA 3LGSA 2AC2A 5KNCA 3NB2A 4K8OA 3UXYA 1PUXA 4Z1OA 1N34B 3DQPA 4MQMA 5KNCD 1H6OA 4FEEA 4RLQA 2JAHA 4TM8A 1YJAA 1M6EX 4ETIA 5G2OA 2IPMA 4U0JA 4XM2A 4DLAA 2XWBF 5DBIA 4TYNA 2YXLA 2PZBA 3K0KA 3LKUA 2ZAGA 1GTMA 4UMFA 4ZGBA 1JCSA 2XVZA 3RQSA 1T35A 3DNPA 3LK6A 2QZAA 1A9XB 4K6GA 2H1SA 2H8GA 4U7JA 4N7MA 2FHSA 2I9CA 3WMWA 2R84A 4A55A 4JCCA 2J32A 2NVBA 3ZXYA 3BKXA 4D3DA 2BR5A 4RABA 1C4KA 4GLFA 1PJAA 1KS2A 2BGNA 1OYVA 2TRSB 2WT9A 2AXUA 4OAPA 2DFPA 3WNDA 2W90A 4QELA 5PGMA 3KCQA 1KYYA 4OOEA 5AVSA 2AYZA 1CHDA 4TWZA 4HF7A 1P60A 2VTBA 1I4OA 4JBYA 1MO4A 1E3LA 2P65A 3GA0A 1S02A 2XTAA 3T7KA 1X7ZA 4RTMA 1ZCFA 3R9IA 2LDXA 5DBFA 3UCEA 2HU7A 1J24A 2UYQA 2IJGX 1AWCB 1O1SA 4KYUA 2OO3A 4L4ZA 4ZV4A 1N54A 1WUTA 3PUIA 3ZGYA 2R6DA 4WH0A 3WK6A 1XTKA 3ZWQA 1AKRA 2NT4A 1IQUA 1DARA 4D4JA 2BHLA 3EGOA 3I4RB 4L1KA 4LJ6A 4K6OA 1XHFA 4ZT6A 4IZ6A 4MLDA 1PO7A 1RBZA 2DSNA 1Y0BA 3HU1A 4IO1A 3N2NA 2BGKA 1NF3A 2D2IA 5KJCA 4G5FA 4ZXFA 3CVQA 3L7JA 3DZDA 4EATA 1EESA 2FRVA 3K4PA 1DAEA 3HV2A 1L1EA 2R4TA 2QMYA 5JDCC 3O7WA 2C2KA 1G7RA 1YZ3A 2WXFA 3VOAA 1HA3A 3UG6A 1GXSA 2BL4A 2VLBA 3ZHXA 5A2GA 4UVDA 4J1TC 1W2HA 4DOMA 4JKIA 1EUCB 2GWHA 3ZV4A 4HI9A 1MF7A 2O2IA 1II0A 4GAEA 2W48A 3E61A 4AC9A 2BPOA 1YJ8A 3WFIA 5TPWB 4FOLA 3NQ41 2C8LA 4RXTA 1RMYA 1RJDA 4RZQA 3NOXA 1RQGA 1G8JA 1ADYA 1KJYA 3QOFA 2BOVA 1E2EA 3GUHA 2FFRA 1IH8A 4GDMA 1SVLA 6LDHA 3C8DA 2HMSA 1JYFA 2HMTA 4M0MA 2QVBA 3L6OO 4R2HA 1ZL0A 2CZQA 3VAAA 4DVGA 4ABNA 3CX3A 1E1RA 5D3QA 1U2SA 2LCFA 3A6DA 2XZPA 4I1SA 1Y5MA 1E1RD 4BC1A 4MGYR 2I6FA 3GJZA 5LQCA 3T3IA 1DQZA 1OAOC 3IT3A 3M1IA 3WGUA 4ISCA 1EMDA 2H3HA 4JU8A 4XD7A 2ONJA 2FUKA 2OO7A 4XD7D 4H6PA 1ZB1A 1YJCA 4MH0R 2OBYA 3V4OA 1B6RA 4KUEA 2F3UA 3RUEA 4LPSA 3FF1A 4PQFA 2PXHA 3VPDA 2G5CA 3BJMA 3ITKA 4E3WA 2JEZA 3GMTA 4QUJA 2X4LA 1M10A 1HXIA 1IEQA 4CJXA 3Q15A 2Q49A 4QUGA 4UQLA 4C4PA 5A4KA 3BB3A 3IBCA 4JT9A 4O25A 3RVMA 1J56A 5BVHB 1LF8A 2IOYA 1OPXA 4IPTA 3ILYA 5LQSA 3ONWA 4U7PB 3YASA 1E4YA 2P4HX 1Q1EA 5CLFA 2BE7A 3UHOA 2XDYA 4LOLA 1PIWA 1PW7A 4BQSA 2I2BA 2Q9AA 1FFDA 5E2AA 1I2DA 3EWIA 4I1UA 4PLYA 3HEAA 4WHMA 2H0RA 3RM3A 4EDHA 4BRSA 4AROA 1FFYA 4RMNA 2QTLA 2DFTA 3TDMA 3V2IA 4D7AA 3I9LA 4C7VA 5JHGB 3RF7A 2KYRA 2C5BA 4MNTA 1ZLXA 5FQ6A 1RD4A 4N5CA 1R4MB 2P3LA 3OFNA 1J97A 1M73E 1DO2A 4B9AA 2EYUA 4NV0A 3ZY5A 4F1PA 2WJWA 2J7PA 3M1YA 2X2PA 1JDJA 2KE5A 3V5NA 3OF5A 4AN4A 4IKOA 2C99A 4BLWA 2J7PD 2GBLA 2RE8A 1JUDA 1O6CA 4GSLA 1CE8A 2PL2A 1B93A 3W6NA 2HA3A 4Q7EA 1Q3TA 2V3CC 2AOUB 3IODA 4AP6A 2V7BA 3UANA 2AXVA 3OZIA 1DUVG 1M34B 3RKVA 2HGSA 1SZ9A 4YWHA 3KETA 5C4IA 4V0OA 2GSWA 1OZAA 5FPKA 3W3AA 2V0PA 2XQ0A 2YV5A 1O08A 2G6TA 1SO8A 3U26A 4ZQFA 4XAQA 3UH1A 3ZRHA 3G49A 2G67A 1KA9H 2XT6A 4MQ6A 3W3AD 4FOSA 4H7XA 2QE7A 1ODFA 4OP2A 1CZKA 2VDJA 3NGXA 1Y8QB 4I4TF 1FL9A 1T6BY 3TOXA 1KVQA 4K9SA 4Z0HO 3ASGA 3VR6H 2AFIE 3N2KA 3QVUA 2IPXA 3K0BA 1UBFA 1R6VA 4DS3A 4XUCA 2BTQB 2C7BA 3S7TA 2QX8A 1HTTA 3H6GA 3KZNA 4GR4A 2JH8A 1M5TA 1IXKA 2NYAA 1R18A 2XCRB 4NCNA 2EAUA 2GUGA 4MICA 3PEYA 5BV8A 2ZYIA 4D4LA 4U0SA 5IAEA 4O5OA 1Z15A 3JS5A 3TW0A 3HXOA 3D6FA 3WBBA 2PKCA 1DXOA 3DH0A 1VDMA 1XWIA 4ETNA 3PGKA 3BRWD 3K53A 1WR8A 4FOTA 3TAUA 2UXCB 4CV0A 1GNRA 3U17A 3I4GA 4RHCA 4BAUA 3DEIA 4U5QA 2OCYC 5HXAA 1JH9A 1OW3B 5G3ZA 2WXHA 4WBXC 4UKDA 3RTDA 2B2CA 3WR5A 5BQXA 2Y67A 4FPXA 2VGXB 4W1QA 4QM6A 1Y6QA 3RS8A 2B4YA 1RWBA 2A4KA 3K09C 4R8KA 4JLWA 1H2HA 2WKWA 1RLJA 1DWQA 1UP6A 2X3UA 3CR3A 2DHCA 3PEVA 4FFBA 3BK7A 1Q1NA 3PENA 4LVUA 1DJPA 3P9SA 4G86A 1XCBA 3N28A 5KC9A 3ZHQA 1V4NA 4E15A 3V7YA 3DC2A 3ETCA 1GN9A 4ND4A 1NPDA 1TT5A 1IC6A 1UEIA 2Z3VA 4N0DA 1JSLA 2LUOA 1YBHA 1S8NA 4I81A 3S2YA 2LPMA 4L95C 3DSVA 5KJFA 2PGOA 4W5JA 3AZQA 4MR8A 1Z2AA 2ODEA 1OASA 4ZQHA 3JY6A 4GKJB 1BDJA 2FPSA 1OMOA 4JQZA 3TOSA 5TLSA 3CHQA 5EWLA 3VXKA 4REQA 4YUZA 3OIUA 7REQB 2QV0A 1CNEA 3HVHA 4U3JB 5BW8C 4XASA 3ZPJA 3SC6A 3VKGA 5FF9A 1YZVA 3EZ7A 5EL0A 3FFXA 4D43A 2MSNA 3QVMA 4EX7A 1TMYA 2FZEA 4R98A 3QAQA 1I32A 2JI6A 4PGGA 1S3SA 1PDVA 1JR4A 5DPMA 1S2LA 2V4MA 1FE8A 2AJBA 1JT2A 3LTEA 1M74A 1Y3FE 2WDPA 1QTIA 3RU9A 3OU7A 2ZR8A 3CHPA 1E9FA 2BGIA 4RLHA 1U4SA 3HVEB 2J30A 1SM4A 1QO0A 3OEED 2B4QA 3U7GA 5JRJA 4LRSB 3SQLA 1TFUA 4MA0A 1P1FA 4PNZA 4L07A 1I2CA 4EKNB 4RDIA 4JHKA 1Q7EA 3UI2A 5TQ0A 5T3RA 1WE2A 3NT5A 5IKMA 1ABBA 4EI7A 3Q10A 4PSUA 3RYTC 3U37A 2VHZA 3OQPA 4JUAA 2ZJ5A 5D1NA 1VLQA 4YJ3F 3MVEA 5LLDA 2TMDA 4M1YA 2AZXA 4UPVA 3B36A 3D4IA 5D5PA 5KIAA 4M21A 2EILE 2P8JA 3OTHA 1Y5IA 4BV8A 3LLVA 4KR3A 2VYFA 2R59A 4I43A 3QXCA 3L8MA 4IHJF 3U60B 4MWSA 2AK2A 1Y8AA 2GPJA 4AG3A 1SOWA 1YMPA 1EVKA 4M1KA 4QULA 3GJTA 1T5LA 4DXAA 2NXCA 5LWHA 4IEFB 5IEBA 1PTKA 3NVAA 4MRVA 2ON6A 5BN5A 1F60A 1NJFA 3VYTB 4UHFA 3C74A 3ZWDA 3DHYA 3WLNA 3UPUA 3KQQA 4BGEA 1H8EA 2X7XA 3BU8A 2VF4X 4TXPA 3IMEA 2H0AA 4S12A 4DV0B 4H1HA 1QNFA 3QWPA 2R8ZA 1H8ED 4BZWA 2BF7A 4DY6A 4DDWA 5JBNA 4ZVMA 4ZA2A 1TZKA 2P6MA 2IX9A 1WMAA 4M9UA 3OCXA 4JIGA 1U8XX 3LCAA 1ZHHA 1KNQA 3S40A 4AZWA 3HUUA 5GONB 1WQ1R 3JWEA 4M1OA 1V4BA 3BK2A 4JOSA 5L3RA 2MYOA 1F8UA 5BQ5A 4DMUB 4X3PA 1FS6A 1A50B 3IPYA 2WG0A 1NI1A 4UC0A 2RGNC 2WJAA 1M2GA 4HX5A 5HS6A 2HNAA 3VKVA 3OUZA 3K1AB 4WK0B 2E82A 2OMKA 3PHBE 4TX1A 1NVEA 5D86A 2C7VA 1D09A 4IG9A 5I9NA 5CEAA 5E6SA 2B3DA 2QT9A 3G2QA 1TM2A 3P2MA 3HXKA 2IV7A 3DW1X 5C8XA 3G89A 2QL9A 3PXXA 3AI3A 4D0SA 2BF4A 3DSRA 2IRWA 1YE5A 2XOKA 3FYUB 2CUZA 5D5HA 3FB4A 2H51A 2RJOA 3MAGA 2XOKD 4RK7A 4Q3BA 4IQGA 1UDBA 3ET5A 4O3MA 3PE4A 2PXCA 1FDTA 5KNBH 3E8MA 3R76A 3CLUC 5FLEX 5D00A 3QRWA 2D3TA 2CMKA 5CD1A 1O7JA 3FAZA 2WF9A 2WXPA 2WINI 3A6LA 3E7PA 1SEVA 3DE5X 1XQ6A 1H2XA 2MINA 4GPEA 3P2JA 3FH0A 4MHOA 1TN8A 3NPAA 3EA4A 4ID3A 3GWGA 4OHVA 4L02A 2LTAA 3CZCA 3DZFA 1T8PA 3FTDA 2H29A 2WNIA 3K8OE 2LNIA 1ZNWA 3ZZ1A 5JCOA 4MUGA 5ILGA 3RJ5A 2GN6A 5BSFA 3R3JA 3RO7A 2X6IA 4X6YA 2P2YA 4PCAA 1NMEA 3A0UA 1T4DA 3H5AA 3HH8A 4PINA 4KV9A 4AY4A 5I45A 3T5VA 2HIHA 5DNEA 3OQIA 1QG2A 3A1SA 3IVRA 4ABTA 1E3DA 2JCSA 1L7OA 3OPQA 3E22B 3S68A 1IOZA 3DM9B 1QH9A 1UPBA 4MKFA 1G1MA 4AAYA 2HA4A 1DUSA 3BWVA 2ATXA 3DMFA 4IJ5A 3BGIA 2C5EA 3QB2A 5COBA 2BKXA 2NVWA 4I5DA 5B64A 4QFVA 1THGA 3F46A 4ZZIA 4U2KA 3VTKA 1DIHA 4QGAA 1F2DA 3TF5A 1FFEA 4YH1A 3ZQJA 2L6JA 3DM5A 1U0JA 2Q2OA 4RFSA 4NZ9A 5FNZA 4HZUA 1GRQA 2XBMA 1FS5A 3TCXB 2ZI3A 3QQ5A 3FNRA 1Q74A 2MSWA 5T4YA 2VAWA 2QF7A 2PD6A 4KR7A 1CR2A 1VCNA 2BSXA 4ZK2A 1VMDA 3OOWA 3AW9A 3LA6A 1D2EA 1JQLB 2JVJA 2P9JA 3FHOA 3FBTA 1YAHA 2IX3A 4RENA 3B2NA 2VK1A 2XA1A 3R24A 4S1VA 5KVAA 2KQUA 1N36B 2JIOA 1JQ5A 2AN3A 3ESXA 1VL8A 4YLEA 4LXYA 3R8FA 2I0FA 3SFVA 5F9MA 2VUUA 3WA6A 4KACA 5KYWA 1BMTA 1QR6A 4Q12A 4YQFA 2JVKA 2PRIA 2ZDGA 2FEOA 2AK3A 3QY9A 5K4HA 4F3NA 1Q0UA 2EF1A 5DGIA 3D8NA 5CA0B 3BCUA 2G83A 2BELA 4Y6RA 2R5FA 1JQKA 4TTJA 1DSSG 4JXKA 5K3SA 1IUOA 3ULEG 5KWVA 2ZCUA 1I1NA 4WGGA 1JNYA 5D8DA 1PTJA 5CLJA 4FDTA 4RGQA 5HIMA 4RDXA 4TT3A 1IG0A 3ZN2A 1RR6A 3ABKE 4TWIA 4JIMA 3ONFA 2J9XB 3G7UA 5CB4A 3K6KA 5I7OA 4TT3D 3K73O 4MUAA 3F98A 1FC0A 4RH3A 2WYOA 5EWJB 1WHTB 1MNAA 5TQ2A 3A6KA 2E4VA 1W75A 1OLXB 4I1YA 2PJZA 2OORC 2GEDA 4L23A 3DFKA 5B1DA 4MUKA 1N2JA 3AIIA 2XRFA 2HUPA 2FE1A 1ABEA 2PZKA 1XLVA 1JB1A 1SBIA 5GQSA 2BKGA 3PQ5A 3AVUA 2PCJA 3P94A 4ICIA 5ALSA 2O3RA 4D9NA 4R40A 4M7RA 3OF3A 3CS3A 1I94B 3IFSA 1FNDA 1GZSA 4E1AA 5AH0A 3R5HA 1W4BA 4BT8A 2WXOA 2OY0A 3PIDA 4II2A 5H8WA 3E9DA 4DCUA 3ZS8A 1RWNA 2RI1A 4OQYA 5A7HA 1Y1RA 4Z2AA 4M0KA 5AICA 5DBHX 5B57C 2E2EA 3UMYA 2V4UA 3R9MA 1B15A 3TIVA 2X5XA 1N6IA 2DZDA 3GLRA 3TSOA 3DMPA 4W7SA 6NULA 4TYQA 1R8JA 1C9KA 4V0NA 3AG6A 4TKLA 1BMFA 6REQB 1ODTC 1AZSC 3U4DA 5HFAA 2VJBA 1BMFD 3CQ9A 4O2AA 2HCTA 1NBAA 1GKIA 2HJVA 1XP8A 1R16A 3IA2A 2ZTSA 4AF8A 3HUEA 4Y6QA 4FFWA 3DE0X 1R5BA 2W2KB 2FJ0A 5CCBA 4OBWA 4M76B 2P0AA 2WD7B 1XU4A 4UM7A 2WJ4A 3RRYA 5DEOA 5AKJA 4X93A 1N8SA 1N33B 5AVUA 4DARA 5B1SA 1YIAA 1XF1A 4PS7A 2ZTLA 3P45A 3ZZ0A 1WNTA 5CTAA 2BEVA 3X2QE 5TVKA 5TQVA 1T6YA 1SWVA 2V74B 1VOTA 2PXAA 3N53A 5DNWA 3LCVB 3FBWA 4BTEA 2B99A 3MOSA 4FM9A 5D6OA 3SR3A 4EFDA 3KZVA 1MAHA 4C06A 4MW4A 4LWOA 1H3EA 4DSZA 2HEGA 1ORHA 2QY6A 3Q2IA 4N1AA 3IQEA 1IFXA 2QAGA 2W2NA 4UHDA 3MT0A 5H80A 1UXJA 4MS3A 1X2EA 4HVLA 3AJ8A 2DUNA 2QVLA 2BYTA 1OH8A 1EUYA 5CBOA 3RARA 2BD0A 2Q3DA 1QC5B 1EVJA 1HLGA 5ENTD 4DZTA 3LAWA 4O33A 3T1VA 1B14A 3WL7A 3MJWA 2VDNB 2PEZA 3IXQA 3I53A 5U4QA 2L42A 3UK1A 3TW8A 3VO8A 3FTEA 3IV0A 1T8SA 4UREA 2C9DA 1CZHA 2SECE 2OKCA 3OIVA 5TMPA 3RAEC 2QNRA 3DOUA 2CLCX 2IS6A 5DTJA 1QQTA 4XCVA 3C4VA 3CISA 5JD3A 4EUNA 2C92A 2G9NA 2G0TA 1J8FA 2QMZA 4UEQA 2C58A 4OHOA 2PX8A 3V31A 4MPRA 2GBGA 3QELB 5H3CA 2HK7A 1NYQA 2WY2D 3FUVA 3DXKG 5KKCA 4Z0NA 3ACBA 5LXTA 3JARB 3C5HA 1TCCA 3BXPA 1XT6A 4AU1A 2Q8PA 2OECA 4MCHA 4MEAA 5LB2A 1MB4A 2JBHA 8ADHA 3KOXA 2FW9A 3HADA 2IXGA 4QPDA 2FPXA 1GJRA 3P27A 4DPMA 4MQFA 1RJGA 1A7UA 2XT0A 1AZLA 3UWDA 4RK6A 2J9GA 1RIFA 5F23A 5HOEA 5A5FA 5J4YA 4GMHA 4GGPA 3IS3A 2DEUA 5I47A 1S64A 1DBPA 3IBTA 3L79A 4JQSA 2G70A 3D1LA 2FQ1A 2D0PB 1PFKA 4BBJA 4C0AC 3JAMA 1D2HA 1GTRA 4WERA 1R0LA 4U7WA 5ICMA 4K03A 2GLTA 2NZXA 4PQGA 4RTJA 4MKHA 1U8EA 5EJ5A 3Q72A 4JT8A 5E6RA 3O4HA 1VL5A 3KKZA 3CUEF 1SQFA 4QTTB 4M1MA 2WAMA 4FCTA 2DH6A 4QC2A 4JYBA 1N6HA 3WLHA 1XR3A 1EIZA 4A1SA 3ROPA 1W5EA 2Q4EA 2V5QC 2JIPA 4Q15A 1TZ2A 5ALDA 3HMQA 1CVRA 4JLJA 5E1MA 5KJKA 4B17A 1MVNA 5EJEA 1WSBA 3RBZA 4AXBA 3WQRA 4BEJA 2DFLA 1U94A 2J31A 2WG2A 2BEWB 1LNQA 4OI2A 4JP2A 4YC7A 3Q7RA 1E5VA 3CRW1 1THMA 3GZNA 1GAWA 1US8B 4PTZA 4V0MA 3ZCPA 4LVNA 2QW1A 1EHCA 3LZDA 3KDPA 2VWQA 3JQFA 4C76A 1WUJS 3NEAA 1E2BA 1IHOA 3OF2A 4CIYA 1JGTA 3FWNA 1R0CA 2QTBA 1XD8A 2BKUA 2WAOA 4XB6B 5TJ9A 1LPOA 4FFLA 5ARDA 1XTJA 4JXZA 3LBFA 1KY3A 5CFOA 1PT8A 2E89A 1YVDA 1HU3A 3T5GA 3IMGA 4IX9A 1DJNA 2LCIA 3G2IA 3N2IA 2BJHA 3WRVA 1BMQA 2G0NA 4WXEA 3PTAA 3QLUC 3DYBA 3FH8A 5DNVA 4IJMA 5EIBD 4LMPA 3A6FA 4H3HB 4IYJA 3AERB 1X7YA 3W7BA 2PQ0A 1TJ4A 3IB3A 4XKCA 3PFWO 2R47A 4L08A 1G0OA 1TCAA 3U9TA 1ECPA 4EGSA 4HDAA 5AHXA 3AEUB 5E7MA 5IAAA 5A5EA 3ZHSA 3DAPA 4BERA 4HADA 1OFTA 3M6AA 1T5IA 4G8KA 2ES4A 1XZDA 4V0QA 3GCDA 4P4SB 1A8QA 3WYCA 3MMZA 3ETLA 3FDIA 3GLFB 3HJAA 3OXGA 4Z9XA 1G5HA 7GPBA 1H6PA 2Q3BA 2DKOA 1YB4A 3R9XB 4QIHA 1NMSA 3DUFB 1E7MA 1V5FA 1NKTA 5EIDA 1XMVA 4X63A 1PD0A 3IP1A 2RCYA 3JYLA 2RK3A 4Q3KA 2WWVD 4Q4JB 1JR2A 4NH4A 1IIRA 3AVPA 4C4TA 3AZPA 2ZT5A 1A71A 1NJ2A 4RE6A 3NBAA 4WOCA 3WMRA 4JI4B 4JQOA 4EG6A 2XS8A 3DSTA 4LNBA 5M2QA 1NFIE 4NK5A 1UJMA 4HAWA 5CT8A 1NQ5A 2RHOA 2V3WA 3PJDA 3SQMA 1P45A 3Q47B 1NW6A 3JV7A 721PA 3NQPA 3L7YA 1ZMRA 1K3FA 3GJYA 3VYUB 5CPFA 4YRQA 1TO6A 3GPBA 4J1NA 3H2GA 5HUJA 2GRPB 4F5WA 1W87A 1IU9A 1ZJZA 4MV8A 2XUIA 2CLFB 1OX5A 3GK3A 4RV5A 4GH5A 2APJA 4Z4FA 4O59O 5K0BA 3CR8A 3WI7A 5DK4A 3T8YA 1KJNA 1VL6A 5J43A 5HF9A 1Z0DA 4C0LA 3L0PA 3AVQA 2M63A 2CFCA 4PNEA 2RHRA 5A0VA 1R6XA 4B1FA 2PRZA 3WBFA 4G2VA 2QD5A 5HI7A 3ZHZA 2GRAA 4HH3C 5DNUA 5FJIA 1C3EA 4Q03A 3D6UA 4N5NA 3H1PA 1V6SA 2OBMA 3M3DA 1RPNA 1PR1A 1G4UR 3LY5A 4ESVA 1E1NA 1ZK0A 3Q7TA 2FR8C 2VHTA 2FX2A 1DJQA 3PHGA 4DZZA 1Z68A 1NU8A 2D7CA 3I2IA 3BHJA 4BEBA 1YQ9A 4LNAA 3O75A 4WUTA 2GETA 4LWQA 1UANA 4KLNA 3HO6A 3AVYA 2YRFA 4G0UA 1RP7A 5COAA 2QUHA 4UHCA 3LF1A 2WSYB 3W04A 4HN4B 3FYTA 3MAAC 3KEAA 1IK6A 1UBHS 4RYLA 2R66A 3OMLA 3IAFA 5F1OA 4G37A 1X87A 3TQIA 4IMPA 1Z73A 1HYGA 2VNKA 4HS2A 4QPNA 3IXLA 3S2FA 1UFKA 4GXTA 3UT5B 1AKTA 1BCSA 2O07A 3U4MA 4NBSA 3H5RA 1GGVA 4B71A 4GI7A 2FUNB 1OI3A 1OXXK 3CX7A 1PQ4A 1IL0A 4S0ZA 3REQA 1KWGA 4H31A 2J3HA 3AVOA 2JKZA 2WU1A 4HNAB 1XRSB 3AJAA 1FDRA 3E9RA 4RY2A 2XKJE 3OLWA 4UQYA 4P3KA 3I9NA 2VQFB 1C3JA 1G8FA 4WXMA 3NC1C 4Q3NA 1Z6YA 3O8OA 3O1IC 1M2KA 3CUVA 4KG7A 4KR2A 3F7MA 4YUAA 1L5KA 2CGEA 3DXYA 2ISSD 2PNFA 5IBQA 2O59A 2IOQA 4DY4A 3O9MA 4MV3A 2WQ6A 4LHEA 2YHCA 5MDHA 5CCDA 5DWDA 1X13A 3IBSA 3ZYLA 3L8HA 3CV3A 4H59A 1JL3A 5AP9A 4JP3A 4K9LA 1TCBA 4I2NA 2HTEA 4IG4A 1THTA 1V8PA 3AOGA 1CR1A 2PWBA 4M60A 5KTOA 3ZE2B 3SNHA 2CXXA 3LKZA 5IN4A 4TKUA 2CUTA 3EXHA 3KAQA 2D2XA 1V1RA 1LTHR 3UWPA 4QGHA 2WJHA 4QUBA 2A84A 2NAPA 3AMVA 1DFIA 2X8JB 1LSUA 1ZL2A 3EWAA 1GG2A 5CBPB 1ZLYA 2YS6A 4IYPA 2C2XA 3AEYA 1E98A 4HOQA 3PB3A 1JXOA 4XLTA 1HYEA 4U7DA 4YXWA 5A5GA 2XUKA 4I46A 3OC6A 3I0MA 1M34E 4AP2A 3AR5A 3I64A 5KDOA 1ZOSA 1GFWA 4ZV7A 1TRHA 1MABB 3ZDDA 2NU9A 3DEKA 4A5SA 2VYNA 3KT6A 1CX9B 4KX3A 2VYND 2AJLI 2IIQA 1U8TA 3IA7A 3T9EA 4FSXA 3CJQA 1CQPA 1MC5A 2DHRA 2QTCA 3VQTA 4TOIA 4GMJA 4L6IA 4L9AA 4TXQA 1LKZA 4ENQA 1X7WB 1N4QA 4BKOA 4NEHB 1PZGA 3ZU4A 3PRKE 4LDJA 4KSYA 3UGKA 2CXTA 3EWSA 1A5ZA 1VIYA 5ECDA 1QF6A 4EHMA 3LA8A 3L41A 3GNTA 4PGMA 4BTVA 2Q0HA 5IYZF 5IF3A 2FSVA 5MF6A 4XYEA 4FJZA 5AK4A 3C3RA 4GTSA 4UQXA 1DIGA 5BQFA 1HFAA 2HT6A 1GITA 1U2RA 2PRKA 3NTOA 1LK5A 1DXQA 3TWQA 4OA8A 2X9LA 1LBQA 2VTKA 2XY4A 4EZBA 1DKRA 1O4WA 2HCJB 2W6MA 2B4RO 3C24A 1P4GA 3EULA 3BHNA 4N40A 3FIJA 1VQ1A 2QRZA 1DKMA 2YNMC 3NLLA 1FQWA 2EQAA 4AMBA 1NQUA 3ZH9B 2R60A 1HYQA 1Z9BA 1W5SA 5LMCA 1COWA 1G64A 5C1IA 2ASEA 2WXNA 3MWKA 3VKUA 1JNXX 3PTLA 1VJ1A 1COWD 5FPQA 3W05A 2D1FA 3MUOA 1N2CA 3DP9A 4M4SA 1ZONA 5CH8A 2WA1A 4PPQA 1UDWA 2QNIA 3BCRA 1JHZA 1U6IA 1JJFA 1KEPA 4A73A 5H83A 4TXHA 3AILA 2VKTA 5G55A 1LPMA 4NL4H 5DM0A 3DO8A 3EDRA 1ZI6A 2FUCA 3OTGA 2RG8A 4G5RA 2RHMA 2GO7A 1EFKA 1YE3A 1I7PA 4MMYB 3Q9NA 3TAXA 3I2YX 2PUDA 1QV9A 3T3DA 4B76A 1TQ6A 1V3QE 1YQXA 4F46A 1N95A 4NBUA 1B6GA 2JJMA 5THXA 5BW6B 4PZ0A 1O94A 2NUAA 4ZI7A 4BNKA 3HU2A 3ZH2A 4E09A 1E32A 1O94D 4GTMA 1EP9A 2XXAA 3IMFA 2R17C 3ECCA 4X84A 1SBCA 3CX4A 4IJVA 5EXDA 1Z08A 3ZXIA 5KNDA 4KYIB 4DLXA 2YR0A 1H2BA 3MUNA 2QBYB 2ZVDA 3KFLA 3RGGA 1UKYA 1CUWA 1AF4A 4EJ6A 1CZRA 3C7KA 3LQFA 3U44A 5WRFA 5CFZA 4MULA 4IUYA 3AUKA 3T0GA 1EFCA 3K9NA 3D3JA 2YHSA 1SXGA 3ZDEA 1JEJA 2A58A 2GVNA 2ZUTA 1M66A 4LSGA 2GASA 5LYJF 2FQWA 4CNBA 4N12A 1G9SA 4Q5IA 3RNOA 4D4KA 1N4AA 2D5CA 4DMLA 4JL6A 2A57A 4DR4B 2O8VA 1KYTA 1PT5A 4HYTA 4JEIA 1ND6A 4PYMA 4KDEA 2ZYGA 1PJZA 2AWIA 1FRFS 4GBMA 3RFCA 2ZRGA 1N5RA 5HSGA 3QEJA 2JJ1D 4R9RA 1HE8A 1H2ZA 5AVXA 1RZRA 3LHDA 1JFFB 4CUJA 1FXWA 4JELA 1WCIB 4QZVA 1V16A 1RZRD 3C5EA 3VTAA 3WFJA 1RFGE 1JR3E 4XRGA 2QU8A 1PSDA 4NQ0A 2YJGA 1J2UA 3K20A 2CWWA 4DHWA 5YASA 2C0PA 4FYYA 4B6GA 5IULC 5IZCA 1L4HA 2ZE6A 3ZGLA 2Q5JA 1X1AA 5SY9A 3FUWA 4E1BA 3PXAA 3NZSA 1DPGA 4ZOQI 3H1EA 3U4AA 2O8BA 5FAXA 3SY8A 1QUEA 1QK5A 4NONA 4LYEA 5ESDA 1W25A 1BH2A 4FR0A 2AHOA 4B45A 5LBIA 1NGSA 4ZO9A 1RYFA 3R7NA 4YCCA 1H2YA 2PL3A 1ZGGA 5DM70 3B6EA 4JZYA 3E70C 3CKBA 4MROA 2ZIAA 1NVWQ 2O05A 4DDKA 1DT3A 1CUBA 3D6AA 3GQVA 6ABPA 1PR4A 3AVWA 2V6FA 1JQAA 3STVA 4AWXA 4RWZA 1ZO8A 1B3BA 2ZPUA 2OZKA 3CQCB 4ZRNA 1SK9A 2Q45A 3M9WA 4YDQA 4F4FA 1OI7A 2G72A 3UKOA 5G0TA 4A0GA 1L5HA 1ZWKA 2W2PA 5I4BA 3AEZA 3AOEC 5BT9A 4G5QA 3KB1A 2COEA 3SDZA 1NVMB 4LZPA 1XTVA 2BRUC 4LYJA 1UC8A 2IYFA 2IYPA 1OX6A 4MKRA 3TLCA 1UL1X 4W5OA 4PC6A 3TQOA 2B1GA 3P1UA 5M7EA 2JFZA 1J2TA 4AJLA 2JATA 2A8YA 5ITZB 4BDSA 1N0UA 3B82A 3LQ2A 4DB2A 1QLJA 3E1GA 1WNFA 1OFUA 1X80A 1N57A 2VTDA 1RP1A 1BKSB 3TSZA 1ISHA 2A5EA 2WUFA 3EJWA 5CRIA 4F0JA 4NHOA 4GTQA 3KQOA 2KCKA 1SVKA 4FUTA 1CJMA 4ACKA 3P2BA 4F1JA 2Y0BG 2VDPB 2IXAA 3RNLA 3WIBA 4NBLA 2WWFA 1Z4LA 3V32A 4KBGA 1MBZA 3K31A 1DAOA 4QJ4A 2CK3D 1B89A 5T4FA 2PA0A 4XB1A 4TLCA 3WKCA 4KQKA 2VRNA 3RWMB 1NUSA 4KQ2A 2VNJA 3GAZA 2FFQA 3H1TA 3SO8A 2AG0A 1HE1C 1NA3A 2X14A 4YJ2F 2F00A 1B76A 3EIQC 4WADA 4NYJQ 2QMUA 3LRPA 4CMEA 4IDQA 3AAAC 2FCRA 4WINA 2E4UA 4PFQA 5BO5A 5B3SE 1IN5A 2ATCA 1SHLA 1ZGHA 4L4XA 4KWCA 4MKZA 4NOLA 3PHIA 3KAPA 3HN7A 3E9MA 2P62A 1DUIA 1GAJA 1JMVA 4PW0A 3HNOA 1J5EB 4M22A 3ENNA 1CQXA 2YV3A 3GAMA 2FRDA 2VCYA 2V7UA 4B84A 4LCJA 1ZZEA 2P3SA 2QYJA 5CW2A 2ZU6A 4PVCA 4RGBA 4RVCA 3D43A 2WMOA 2I6XA 3PFNA 4DV6B 1I9GA 4ALLA 1FJHA 3PEWA 3HDGA 3JQBA 2CYAA 1J0EA 3NEPX 3FTZA 3IOBA 1CP2A 1HDZA 3QEMB 2P9IG 3R0JA 3ENVA 1WTAA 3PKJA 4JHXA 1DQNA 1N5KA 2PO7A 5DB4A 4RK4A 4WACA 4CQNA 4PAGA 1ZI9A 2HA6A 5A6CA 4AK9A 1U3GA 2JKVA 5DTEA 3BH7A 3ROKA 3TIGA 1F2UA 3OY7A 3BXGA 1K8ZB 2AG8A 4YFVA 4NACA 1XTZA 4DG8A 2DULA 1KR5A 3KSRA 1W5FA 5JAUA 4WN9A 4OMDA 1X3SA 1JQ3A 3EIOA 4MJLA 2WM8A 1T5HX 3KKOA 3OJ0A 4EG8A 2OG1A 5CEEA 3NUZA 1NI4B 2CV0A 1JG3A 3I9V1 2O1EA 3TQQA 2QUZA 1QYDA 2JI8A 3ZQ4A 4EIWA 3WP1B 4BU1A 621PA 4UWKA 4MQEA 4TVSA 2ZSKA 4RNCA 5HQ3B 3EYWA 1GZ4A 2R7AA 6GPBA 2MTBA 5ALKA 2BFAA 2P3OA 2VQ6A 4BRWA 1VBKA 4AY6A 3LP8A 4DTCA 4MVJP 2GCIA 2PM7A 2XE8A 3KLPX 3BMOA 4JT2A 1V7ZA 1SURA 2VZ0A 1RHUA 3LUAA 4BE7B 3WY9A 1PT7A 1FFBA 2ZSHA 3PNSA 5EKDA 4IMRA 2WFLB 4ZEMA 1NY5A 2GN8A 1ZK1A 3EEBA 4TV9F 3REFA 3O9VA 4QVKA 3JZFA 1XYYA 2FPPA 5HUHA 5T3UA 5HJ2A 5IKEA 3T6KA 1CRPA 2E85A 4WESA 1ZCJA 3TW6A 4KXLA 3EC7A 3GVCA 1RXCA 3WLJA 1AV6A 3MWLA 2IYTA 4FX5A 3BF7A 1Y34E 3E3MA 5AR1A 4RIIA 4O4HB 4IH4A 3R0ZA 1CYDA 3I8SA 4ZQBA 5LQKA 1FYXA 2C8JA 1KFBB 1W30A 2QTVB 4XRRA 3RHZA 1WBJB 3BRWA 2FKAA 2PNNA 1C29B 2NZWA 2ZRMA 3AYZB 4XFJA 5KKAA 4LJRA 5HVNA 1F8GA 4RACA 3VX4A 5AW0A 3QFRA 3EXAA 2CF5A 2CYCA 2ZTUA 3WAJA 5ABPA 2Q5LA 3Q4GA 2Q4RA 4U63A 3PS6A 5MN6A 3GCZA 5A3RA 3C6QA 3PYXA 3BT7A 1Q15A 2FY8A 1AKYA 3NYQA 5DYYA 4GYOA 5K05A 5FZRA 1HGXA 4C08A 4LMBA 1UMKA 2FZGA 1OLUB 2FMUA 3OIYA 1MZPA 1NE2A 3AVXA 3H4IA 3OE5A 2GTIA 3FW1A 1M2VB 1CPYA 1OFVA 4CMCA 2R00A 1JWGA 4I3GA 2FMKA 2L9BA 3PU6A 4MWOA 5JSKA 3OEWA 1F0NA 1N9AA 2YVAA 5HRAA 4C6TA 3TTUA 2JRLA 5DHSA 2B5VA 4KAXA 4EQ6B 4ARSA 1P1JA 1ZOIA 1G6OA 2R8OA 1KZYC 3LT4A 3OZSA 3QGMA 1WHSA 4XPZA 3AUYA 2FDCA 1VDYA 1FRNA 2O3UA 2N75A 3A36A 1FDIA 3EU5A 4NE9A 5KYUA 1C7EA 1SXJB 4NDZA 3REGA 1PT6A 1W7AA 1EUQA 4BO1A 3B6IA 3N1UA 5LZ2A 2WILA 1M7HA 5EE0A 2Q1XA 2NP7A 2J9ZB 3USZA 1SOUA 3O3MB 2VYVA 3F8TA 5BYBA 2AUTA 4YGXB 4BNDB 1NT4A 4N6OA 2VYVD 3FNGA 2YY7A 3OEEA 2GBCA 3TJMA 1KVRA 1S63A 5ESWA 5JMOA 2OV3A 4FW8A 1WZ2A 3LS2A 3M6IA 1ZCZA 1XRPA 2ZJ0A 1P0PA 1KFKB 2ZVQX 5KUTA 1PZHA 3P0HA 4M8LA 4RKEA 2AZ4A 4HEQA 3DKIA 4N01A 1YD7A 2Y1CA 1JN0A 2OQIA 2XCIA 4YRFA 4CM1A 3BRSA 1L5ZA 1CR6A 3E3NA 1U6KA 1U7WA 4XYMA 4G84A 4MVJE 4QRIA 2ZWPA 4HDKA 3V2XA 4F85A 3UBTA 1A7KA 4U2GA 4JMPA 1Q84A 4QYMA 5AOAA 2JL1A 5L4NA 2XODA 1Y8ZA 3ML1A 4HDMA 2NZ8A 2I2AA 1RYEA 4BNZA 4TWRA 5KPDA 4B3GA 4CQLB 2DGDA 2X3FA 3A4YA 4DM4A 3TH5A 4RULA 4CF6A 3EF3A 5LOVA 4GC9A 1VXRA 1QHFA 1IM8A 1E18A 5KTMA 4UATA 5JQWA 4F6LA 2QLNA 5J4LA 1Z5NA 1H85A 3ZKWB 4LXXA 5JVDF 3DKKA 3GAFA 1PZMA 1TTHA 4XE5A 3LHSA 1EHYA 3OO1A 5IT0A 4DCCA 5KOYA 5JJTA 3UAGA 1EJ0A 4KE8A 5IYZB 2ADMA 2NO5A 2AYYA 3GPLA 2VGEA 4GR9A 4H3KB 2JZCA 4QOIA 4LSZE 1P0FA 4TUUA 4H7PA 4PHHA 5AQ1A 2KI5A 5HILA 2YWCA 4RJJA 4A0HA 3V1NA 5CGQB 3QPWA 1MW8X 3LS8A 2J0VA 1E0JA 1JQDA 3W9FA 3E5MA 4MI9A 2MYTA 3AM5A 5KTNA 3GGSA 4TTTS 1JQEA 4NOJA 2G09A 4MWZA 1EA7A 4G63A 4LRZA 1FYFA 3HR8A 5EUBA 2JD0A 4NU6A 2BF0X 2DBAA 5AQ9A 3NT2A 4HJRA 5ER9A 4ALIA 1TYAE 4GYKA 8OHMA 4CDNA 1AP7A 1BTOA 1JZQA 3KR2A 4F3CA 3OIFA 1F2VA 4L3OA 4WMLA 1S6YA 3L8YA 2DTEA 4IVQA 4QXQA 4BS9A 3RJ9A 2H65A 4WZ6A 2NO0A 3CW9A 4F93B 3NNNA 2QVXX 5B1BE 3GLFE 3SSNA 4FILA 4EITA 5EE1A 1QH1A 4P8RA 2HQOA 4CLHA 4WOPA 4F9EA 3FRHA 3NIGB 2ODTX 1IQPA 3UENA 4NZOA 1V35A 1H05A 1Z5ZA 1JHUA 2IYQA 3U09A 1K9VF 4WA8A 1U31A 1CVIA 3WLKX 4OQZA 1I3MA 2AYXA 2EJUA 4P3NA 3URKA 3RU3A 5A9SB 1AO0A 1LLCA 3VDRA 2V7VA 1PZXA 3LX6A 2HQBA 1T9BA 2GBIA 4FGJA 4G5XA 1ISPA 3IPLA 2PS9A 4L0CA 3TS1A 4KDRA 1EXMA 3L13A 1FOEB 2SKCA 1NP6A 4L7VA 5ALMA 5DCUA 2C3MA 3OPYA 5CK4A 1RYNA 2QTAA 5LP0A 4PX5A 3FGPA 3DDCA 2YY5A 4BNGA 4EKGA 3Q75A 2BFBA 1PUIA 4PNPA 1NBOA 2O8NA 2HPVA 2HHCA 1RFLA 4FFPA 1XTBA 3EVBA 5HIAA 4KZKA 1M8PA 2YNQA 3FMGA 1SZAA 3BHMA 1KOJA 4LQ4A 4LIPD 4E70A 2OKGA 3K05A 2R02A 1X7GA 5DV9A 4D82A 5JQGA 5JS1A 4CTJA 3IUPA 4MOWA 1W2GA 5FUMA 2WM9B 1BD3A 1XF9A 1KDPA 3O47A 3CW2A 2GAOA 3R44A 3B70A 5GIPE 4Q02A 3HIZA 1XRRA 2KZTA 2NWQA 1ZMTA 3V55A 3KKNA 1E5XA 4HL6A 4RHUA 3DEZA 1RMTA 1IQ0A 3JW8A 3L92A 4RLSA 1HYBA 4FGLA 5IXYA 2ZBDA 4OHWA 5ALRA 5FUXA 2OFOA 1U65A 4BBZA 4E5SA 4PZDA 4B3XA 1QE5A 1KT1A 2F1IA 3C72A 2RGEA 5FBZA 5A6SB 2DLDA 4F4HA 4Y6WA 3HKDA 4D92A 1K3TA 3ZGQA 1LFAA 4EGAA 2IY8A 4QQKA 2I7VA 2ZI5A 3M5PA 1PK9A 1Y98A 2FZ4A 3GJ6A 2N1MA 4YRJA 2PQMA 1WO8A 1L8AA 4UJ3A 2GTHA 4HGNA 1D0IA 3CKLA 1NNEA 4ARAA 2VUIB 3DTNA 1QIEA 2G9VA 4PSDA 4LWPA 1QCZA 3JWGA 2AMJA 1BXRB 4ZPJA 3SEZA 4JA0A 4WPGA 2EZTA 3O1LA 1JIUA 4L9PA 3JUIA 1E7YA 4EBAG 1YGYA 1A9QA 3ICCA 4UBJA 3TKYA 4FNAA 3TZ6A 3K6JA 2YWXA 5BNZA 1UXOA 1XPJA 3DL0A 2V96A 4CWAA 2W9XA 3OURA 1HG0A 4YMWA 2O8EA 1CUSA 1FT2A 1E1CA 2XCUA 3WJAA 2FDRA 2ZW9A 5HW0A 3CJTA 4ND6A 3K2EA 1SNYA 2X15A 4C4XA 1VZ2A 3X1YA 3MOGA 4E4YA 4U9HS 2VWPA 4ABYA 4BJ5A 4EAAA 4OX9Y 1BEEA 4RH1A 1Z17A 3WV4A 5TS3A 3FMVA 1F12A 1M0WA 1RXSA 1KSGA 2CFZA 4C4OA 1HNWB 4LA4A 3SJUA 1O57A 5BR7A 4MLPA 1NFRA 1A76A 5G1NA 3DZGA 5KWIA 4CIAA 3ROEA 1NVUQ 2OMEA 2P75A 3K5PA 3IX7A 2C2OA 1ULTA 5FL7D 5AJUA 4JVSA 5JDIC 4NQZA 2JI9A 5E2BA 4MV4A 3H8WA 3TX2A 3DAOA 1M7GA 3I32A 2IQIA 3WVNA 4WEQA 1RABA 1J25A 3QE3A 2DY1A 4GCNA 1ZNZA 1Q7TA 3KOUA 1YRWA 1ORTA 2BV3A 1U9IC 1U3UA 2HMUA 4JLPA 4CKBB 5EHZA 2EFJA 3NRCA 1RE1A 1QBQA 5IVHA 1NVVQ 2IYZA 4D9CA 1L8LA 5AKGA 4NX2A 3WLQA 1S8FA 2AZMA 4LGVA 4MLZA 4NARA 3C1AA 4G1MB 2KHZA 1NW8A 3PLNA 2YYSA 5JPCA 1QZ2A 3E7FA 3FFTA 2RC5A 1H5UA 1BRTA 3G9XA 3ZBUA 2CDAA 4XW2A 2ZXEA 4CKWA 4Q01A 5C0OE