2KZTB

Structure of the tandem ma-3 region of pdcd4
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords Programmed cell death protein 4
publication title Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kztB00
4B8CB 2IOLA 4JHKA 2KZTB 2KZTA 2FULA 2NSZA 3FEYA 4B89A 2IOSA 2VSXE 4IULA 3EIJA 2HM8A 4CRWA 4LUNU 5ANRA 2IU1A 4B8AA 2ZU6B 4C9BB 3RK6A 1H2TC 3FEXA 2RG8A 4GMLA 4CT4A 1UG3A 3JUIA 1N52A 4GMJA 2GGFA 4CEMA 2VSOE 1UW4B 1N54A 3D3MA 4JHJA 1PAQA 1H2UA 2I2OA 2IONA 1H2VC 1H6KA 1HU3A 3EIQC 3L6AA
chains in the Genus database with same CATH superfamily
2LUHA 4IYPA 1ZB1A 4WNGA 1GW6A 5BW8C 1BI7B 4GZ3A 4PS3A 2RG8A 3LY9A 4TV3A 3S7FA 1BD8A 2OV8A 3UIOC 2OOEA 5KBAA 4I43A 2KM4A 2WQ6A 3ZHEB 3B7SA 4A1GA 3D9OA 3R9MA 3QB2A 1TN8A 2X6JA 3JUEA 3PEVB 2VSNA 3FWVA 2AWIA 3E30A 3OXLA 4GTSA 3DWLG 1YA0A 1KT1A 4HFGA 4RLYA 3FUKA 4BESA 1UG3A 2IJGX 1EDUA 5JHBA 3HXBA 3TG5A 2X6IA 1V54E 4U8HA 3ZFWA 4ME2A 4EBAG 3OXGA 3KSLA 2OVBA 1H6KA 3EHMA 5KJKA 2WXJA 2VJ8A 5EIDA 3ZNGA 2YNQA 5A7DB 2HO1A 3ZW3A 4L23A 3SNXA 4FLBA 4BTAA 2BTDA 3NF1A 3L54A 3L16A 3MEKA 2P9PG 2CFZA 2GROB 2IFUA 5AENA 4L7TA 5ENOD 4UQXA 1SW6A 4AP2A 2F8YA 4AEZC 4MS6A 1OCRE 3DEOA 3QNKA 4FJZA 3U64A 4APFA 4AIFA 3ZEFA 5CBOA 1UN8A 2HR2A 3S2AA 1A17A 1SZ9A 3U66A 3CVPA 3UIPC 1JWFA 3GZSA 3UMVA 3ABKE 2AJAA 4WNDA 2PNNA 2WXQA 2P9IG 2P9LG 3CKBA 4BX9A 1SVXA 2BEDA 5M72A 4DK5A 4GMRA 4UUCA 1JCSA 1U3DA 4IULA 4A63B 5HS0A 4FHKA 3CGHA 4Q94A 1WDYA 3FTVA 3ONKA 2OEVA 1N4QA 1MYOA 1S63A 5EX3A 4IRUA 4AY5A 1FT1A 3T5XA 3FULA 1H2TC 3FH7A 4HRLA 3PEUB 3SZ7A 5AIJA 1YCSB 3IBEA 1RW2A 3CV0A 2H6IA 4HORA 3CVUA 2VSOE 3BG0B 3ULEG 3B7TA 2Y1LE 4F1PA 5KNGA 2A5EA 3B95A 4ACLA 1E8YA 3N71A 3EHRA 1IQRA 4EZLA 3HHMA 4WNEA 1MX2A 1NA0A 3CR3A 3MV2B 2X6HA 1KPSB 3ZYMA 3ZN3A 4TXPA 5EYPF 3PNTB 5BV1A 3U3WA 3JQ0A 3PREA 2KXPC 5FT9A 2KATA 4N5CA 2NSZA 2B6CA 1PY1A 1W3BA 5JJTA 2I9CA 2WXGA 4XKCA 3F6QA 3FTXA 3TWVA 4PS8A 3V79K 4AM9A 2M63A 4JC8A 3Q5MA 3RAUA 2XHEA 2GRRB 4YDYA 2VGXA 1OY3D 2VYIA 5KNHD 5G05C 4ANVA 1HZ4A 3ML9A 4J0UA 5AQAA 4UI9J 1N9AA 3D9IA 4CGWA 4K5BA 4KBQA 3MKQA 3QJZA 4DX2A 2KBXA 1Z3XA 4LSZE 4UQYA 1TNZA 2GRMA 3AU5A 3FTYA 3FY4A 3T8MA 2X6FA 3ABME 2I1KA 5G04J 2GW1A 3AS4A 3TL5A 2DZNA 2EQXA 4GA1A 3UPVA 4O1PA 4R7LA 2GRQB 3T5VA 3CQGB 4GU5A 3PVLA 1B89A 1O1RA 4CDNA 4FA6A 1DNPA 2IEJA 3KAEA 4L2YA 4O60A 1IKND 5B3SE 3CEQA 2JEKA 3I5PA 5FIOA 3LXUX 1OCCE 4URKA 3LKUA 3ASGA 2ZXWE 1DC2A 2LXLA 3TWRA 2WXPA 2DIWA 4ATZD 5FTPA 3UT8A 4HXIA 1NP7A 4YNDA 5D66A 3BQOA 1FCHA 3CHOA 3ZYLA 3U9WA 4ANWA 1FVHA 1WG0A 4V3IA 4N3AA 5KJLA 4M3OA 3OXFA 3IEGA 4KT6B 4CGVA 2Y4UA 1L5JA 1MQSA 3APFA 4FULA 3HXFA 3LYAA 4BETA 1ELKA 4G26A 3FDHA 3FUMA 3FUFA 1PC2A 2LSVA 5ITZF 4BERA 3RSEG 3FUJA 1NZNA 4W9RA 1OCOE 4PDXA 4AV7A 3RO2A 2CHWA 1TR4A 1X81A 4DI3A 2ZISA 3ASFA 3MA5A 4K5AB 4LEUA 1OWNA 4G23A 4J6IA 2WQHA 4WWPA 4C0EA 3LDZA 4KVOA 3FU0A 1SA5A 3QWPA 3ASNE 4DI4A 4J8FA 2YQ8A 4J8DA 4CT0A 4OVVA 3L22A 4OVUA 4PUCA 3GZ2A 1KLXA 2IOSA 2LXMA 3Q15A 4N2QA 5JJ7A 3SF4A 3J5PA 4XI0A 4XKBA 1JPLA 3MJWA 2HE0A 2H6FA 1E96B 5IY5E 4J8YA 3URZA 1TEZA 2R03A 2QYJA 1N4SA 4JL0A 1QNFA 3E37A 3CHQA 1E90A 3HXDA 3S7DA 3E4BA 3RU0A 4BX8A 2IO2C 1YMPA 2DWZA 2A4ZA 4U8YD 3FU6A 1NFIE 2WXNA 2XEVA 2GRPB 2V4HC 3NQPA 5EN5D 1P5QA 5AQ7A 4G1TA 4TXRA 4F6RD 2R02A 4JHJA 4H7YA 4U63A 3G2SA 2WQ7A 5CERB 2IOLA 2XZTG 4I6JA 1KT0A 3U4TA 2J4BA 4Y6CA 5CECB 3UQ3A 3ZUVB 3HVEA 3UM1A 1IXVA 2XCBA 3P1UA 3VLDA 3ZPJA 4GPKA 1MZCA 4ZHBA 5D2MC 5CEDB 1K3ZD 2L0TB 2Y3AA 4G8LA 2WB2A 1H6PA 2DYRE 4GZ6A 3JCKC 3SFZA 4J8SA 4HI8A 4J8EA 3JXIA 2DCPA 4FLHA 4GMJA 1A5EA 4QFVA 3ZVVA 3FP3A 2I1JA 5AYWD 2BF0X 2PQRA 4L2LA 5C2YA 3AS5A 4JD2G 3HXEA 5BT1A 4XE0A 2OCCE 4AY6A 4GZDA 5HKPA 4GYYA 4H7XA 3ZXPA 5CMWA 2YHEA 4G24A 4DLOA 1HXIA 5H7PA 3I4RB 3UXGA 4GA2A 5EYLA 4GTOA 4C9BB 3CIAA 3QDNA 2WXFA 4MRUA 3PZ3A 1HS6A 4P29A 1QZ2A 4GA0A 4HOUA 2VQ2A 4ILGA 4DPRA 3IKOB 3UM2A 3DSUA 4G25A 1AWCB 2ETCA 5LCWJ 1HX8A 4YDEA 2DBAA 5ARFA 2WMOA 2VGXB 4JHKA 3LCAA 4N3BA 1LD8A 1E7UA 2KC7A 4KMOA 4GTRA 3ZYKA 1V55E 3FU3A 3AG3E 2R05A 2XEHA 3MKQB 2WXMA 2PQNA 4GB9A 2FEZA 4L1BA 1HO8A 1MX4A 4UWGA 4I1OB 1ZBPA 2CFUA 3RRUA 5JMND 3QOUA 2MHKA 5CRVA 4EZKA 2P2CP 2PZIA 5JJ6A 2WM9A 5LP0A 3UINC 4BT9A 4NURA 4RG6A 5EIBE 4HOQA 2KCLA 1MJ0A 2QFCA 3ZYQA 5G2NA 5BXUA 2R59A 4FU3A 1MHQA 3PUJA 2WXRA 5LX8A 4NIKA 3TWXA 2B0OE 5KJMA 2XCCA 3FFLA 3Q49B 3FUNA 4U95D 1FPPA 3NBNB 3QAQA 1O1SA 2I2OA 2X38A 2JLBA 4OAUC 3MYVA 3I3NA 3ONLA 3PDNA 4HOTA 5FQ4A 4AVXA 4LNUD 4NACA 1RZ4A 4KYOB 2R5SA 3MV3B 4FJYA 3QKYA 1EYHA 4EHMA 3V30A 3UI2A 4WAFA 1K8KG 3RRNB 5FQ6A 4JXTA 1Z6TA 3RIBA 4EECA 2VGEA 3FUIA 2Q7FA 1EF1C 1H0AA 3PUKA 1OWPA 3FUDA 4LCTA 4UI9K 4NRHB 3AG1E 3TWTA 2I6HA 5AQ9A 3CVYA 3L17A 4U0UA 1Q2ZA 3LY8A 4BSXA 4FHJA 5T3RA 4JA9A 4YVOA 2RFMA 1S64A 4TUUA 3DPDA 4HRNA 1NL4A 1HG5A 5CCMA 3EDTB 2AVPA 1DCEA 3NOCD 3D9LA 3S7JA 2C2LA 1TYQG 3VTYA 4HVBA 1N54A 3ESLA 1OXJA 4JA7A 2XPIA 3FTWA 2WXKA 4Q96A 4B89A 2PM6A 3CLJA 4ACKA 4GTQA 3AS8A 3HDXA 3MCXA 3TJPA 3AG4E 2UY1B 3R7RA 4O6FA 3D3MA 3ZKJA 4A3TA 3ZU7B 5BV0A 2KZTB 4HI9A 5C1DA 3PZDA 4HS2A 4GTTA 3EUVA 4GZCA 3CHMA 3NOGD 3QWVA 3FTZA 3EHNA 4MLPA 3B7RL 2QZAA 3ZHEA 3HXCA 3PNLB 3CK9A 5CCLA 3QARA 1TNYA 2CHXA 2VGYA 4AXHA 3HVEB 4U04A 1WM5A 5BNWA 3SFYA 2QYUA 4C0MA 3D9HA 5KJNA 5ENRD 4G11A 4J7WA 3MKRA 2F8XK 1H2VC 2J8SD 1E8XA 5T4YA 4BT8A 4K5CA 4CDMA 4XZ4A 2YHCA 1TNUA 3BUAA 3RK6A 3UKRG 4DRXE 3FU5A 1AP7A 4CYMD 3IHYA 3RKVA 1UJJA 3EU9A 2IQCA 1S70B 5CHEE 4HLLA 1EPUA 2IF4A 3PS6A 2J08A 4FP7A 1UOHA 2QC9A 4JPSA 3VTXA 5AARA 3SQVA 4B0ZA 2X6KA 4UWKA 3DSTA 2PL2A 2P9NG 4ZFHA 5FQ8A 1KZOA 1TNOA 1VDYA 3LVQE 4DUIA 1X5BA 2X3MA 1NI1A 1DVPA 2J4DA 5KWDA 2Y69E 5G05J 5AN8A 2XGMA 4N2SA 2P9SG 4GCNA 1HF8A 1LD7A 1K1BA 1KZPA 3UTMA 4CDRA 1XNFA 3MX3A 4XIFA 4F1SA 3C3RA 3EU5A 4BTBA 5FZQA 3JUIA 4I17A 2FF4A 4WUYA 3KEAA 3SBTB 3W9GA 4AOFA 4RQIA 2ETBA 4ILHB 4LUNU 3FTSA 4KXKB 3KEZA 3TG4A 2BUGA 1U2VG 3Q7FA 4XI9A 3D9JA 1ZU2A 4N5QA 3Q47B 4K03A 2LAIA 2VTBA 3L6AA 4N3CA 3GYZA 3DEPA 4HLEA 4JVSA 3FEXA 3AJIA 4I2WA 5A6CA 2GRNB 3AAAC 3ZXSA 3CVXA 4I9CA 1UN9A 3MZLB 2RFAA 1Y8MA 3BU8A 3APCA 3Q75A 3CHPA 2FULA 2ILRA 2MOWA 1INZA 3PRZA 3VLEA 5T8IA 4B8AA 2V8SE 2LSUA 4GYOA 5CEAA 3HG0D 1S0PA 1OWMA 4DX7D 4WWOA 2NXPA 4I1MA 3C3OA 3CQCB 3D9PA 3OAWA 5FQ7A 4APOA 5HQ8A 2HM8A 3CVNA 2YINA 3JXJA 3SD5A 3Q78A 2J9QA 3OTNA 4BFRA 1BLXB 2CG2A 3LPZA 3NAWA 1LF8A 3FH5A 3AG2E 3TGOA 2KCVA 3QK0A 1IHBA 3WG7E 4A1SA 5ENNA 5G55A 2ZGGA 4RVBA 3TWWA 1N52A 5FJYA 1BU9A 4U96D 1UW4B 2V5FA 1G3NB 3S7BA 5KCMA 1D8EA 5AAOA 2WXOA 3G2WA 3KD7A 1SA4A 2R2LA 3SGHA 5ENPD 2V0PA 2VSXE 3EIJA 3R7QA 5BPPA 3PE3A 3ZRHA 5E76A 2XPZA 4I6GA 3ASOE 3ULQA 2C0LA 1FVFA 4JB8P 5HI7A 1JWGA 3HIZA 3UKUG 4LRZA 2NC9A 1U3CA 4B93B 3T9KA 4KZCA 1OWOA 1OT8A 1D8DA 1N95A 4U0SA 5AJDA 5EDSA 4L9PA 5D0OD 3CK8A 4QQIA 1Z5SC 3C5RA 4F3VA 3AU4A 4EPZA 3EJNA 1E7VA 1Y6IA 3BEEA 4JHRA 4YDWA 1SQMA 4XEIG 3APDA 3ISMC 2VSYA 4AJWA 2RKKA 4WWNA 3QWWA 4HRMB 2V4LA 2H6GA 4DX1A 4A3VA 1HG2A 4ILIA 2R17C 4GYWA 2PM7A 2EIKE 3KS2A 5CMYA 1XGWA 5ANRA 3DXKG 3IHVA 1LTXA 3L82A 4GTMA 3RRMB 2WPVA 3E34A 4XX5A 4Z68A 3E32A 2AXUA 2OVFA 3W9FA 4LNBA 2E0IA 3FTUA 2HYZA 3SO8A 1E8ZA 4DLQA 3C98A 3J5QB 3Q9UC 4DX6D 2WXHA 4D10C 2GRLA 3GW4A 5FZSA 4UWLA 1QQEA 2IO3C 3P2BA 4JZYA 4OAVB 4GZ5A 3NZUA 1H19A 3CKCA 3RJVA 2P58C 3MGBA 2IU1A 3B7BA 4I1AA 5D0QD 3LEWA 2AXZA 4E6HA 3FUHA 1TNBA 1YYHA 2XENA 2XS8A 1TJCA 4B8CB 5ENQD 4BWRA 4DX5D 3BG1B 4UI9C 3DSXA 3C3QA 1OWLA 4GCOA 3ASHA 4Y6WA 4E85A 1QYMA 4MKTA 2J07A 3Q73A 3SBSA 3LJ3A 5DBKA 3SFXA 4LG6A 1N0RA 2V5QC 2ONDA 5E75A 5G04C 4EQFA 5BXOA 3LJNA 3L08A 3FH8A 3G2UA 5AJLA 3T8KA 3CVVA 5EKQD 1FT2A 3DXMG 3UM0A 2VTBB 2XQ0A 1OCZE 5B1BE 4MBGA 3SI5A 5JA4D 4YDOA 3NZSA 5AQBA 1TN7A 2DYSE 1IHGA 5EX0A 4A55A 4EBAA 2MYOA 3Q9NC 5JHAA 2AW6A 4JEHA 5LOZA 4CRWA 1IQUA 1N94A 3ULYA 2XZDG 3CVLA 2J09A 5CRUA 3Q79A 4JW1A 3UT4A 4U7EB 3CK7A 2DZOA 1QBQA 3ZIMA 3R9AB 5A23A 3B13A 3ENEA 3L9TA 5BUZA 3ZGQA 3TAXA 2ZIRA 3CSTA 1O1TA 4UWFA 4G2VA 1ELWA 3UM3A 1SZAA 3QC1A 3Q7AA 2BKKB 2H6HA 4GPMA 2P9UG 4U0ZA 4U07A 5DIZA 4DJAA 3X2QE 4OYSA 3D9KA 2QY7A 2Y0BG 1OUVA 1JCQA 3I4GA 2LO6A 2NYJA 2A5UA 3DSVA 2XGSA 2MRIA 3PZ2A 3E33A 1BI8B 3KSQA 1JUQA 2GGFA 2C0MA 2LNIA 3K9IA 4F53A 5B1AE 5J90A 2DVWA 1HU3A 5ENTD 3NB2A 4I6EA 2FBNA 4PH4B 2E2EA 4CZ2D 4B94A 3FUEA 3V2XA 2WXIA 4CEMA 3TXMA 3PZ4A 4HNAD 3JYSA 2OEWA 3LY7A 1E8WA 2Y4TA 3WXXA 2AXVA 3L13A 2ZU6B 3PE4A 2XRZA 3EHQA 3RO3A 2CHZA 4N39A 1MX6A 4Q69A 1Z3YA 2P9KG 5EILA 5ANLA 1WY6A 5ENSD 4LERA 1N11A 4ANUA 4F7AA 2L9BA 3DPYA 2FO1E 4CT4A 4C48B 2XRYA 3G2TA 4I9EA 3D9NA 4ATGA 1TN6A 1H2UA 2RD0A 2EINE 1N4PA 4LNGA 3O48A 3DSWA 4K0RA 3V2OA 4BSZB 2L6BA 4ANXA 2EILE 2J49A 4RG9A 2CG3A 1O5MA 4GAAA 1JCRA 5FZRA 2F37A 3TXNA 2LAHA 3PZ1A 3B7UX 3IXEA 3ABLE 4KZ0A 4X8QA 1WAO1 2FO7A 1D9SA 4TXQA 4UQZA 3TWSA 3DBSA 3LS8A 5HRYA 1K1AA 4HOSA 3SY2A 3CHRA 4HBDA 3CSFA 2XGOA 4JEUA 2EIJE 4TUMA 4BY6A 4FC8A 2IONA 2L6JA 5FWQA 2UWJG 1N4RA 3HRAA 1HE8A 4GMLA 3VLFA 2BKGA 2UY1A 1N0QA 1H6OA 2ETAA 3HYMB 5LFAA 4NQ0A 3FHEA 5CBNA 2KZTA 3CVWA 3G2VA 3DSSA 3UT7A 3ML8A 4CCAA 2F0YA 3ASDA 2FI7A 5LCWC 4KVMA 2ZGDA 2EIME 3UX4A 1IYGA 3EIQC 1NA3A 4EZJA 2KCKA 3CVQA 3IV0A 4RSYA 3ESKA 4ABNA 3TWUA 4HB5A 2IY0C 3SHFA 4GTVA 4HQDA 3TWQA 3PH0C 4O1OA 3C72A 4PS7A 4WNFA 3D9MA 3JQ1A 2WMNA 2WXLA 1ELRA 4YVQC 3CHSA 4UWHA 3V31A 2XS1A 2WVIA 2XPYA 1UJKA 5ARGA 1TJFA 1DCQA 3Q4AB 4M7CA 4GTPA 2JABA 1PAQA 3DRAA 1HH8A 3FEYA 3GZ1A 4IN3B 4U8VD 5FINA 5J08A 4BEPA 2XEEA 4G8KA 4I2ZA 3LVRE 3UUXA 4FADA 1HFAA 4TRQA 3O4ZA 1BPOA 2L0IA
chains in the Genus database with same CATH topology
4B8CB 4BWRA 1E8XA 5T4YA 4BT8A 4IYPA 4CDMA 3BG1B 4UI9C 2YHCA 4WNGA 4XZ4A 4JL0A 1GW6A 1QNFA 5BW8C 3CHQA 1E90A 1OWLA 4GCOA 3RK6A 3ASHA 4Y6WA 3S7DA 4E85A 4GZ3A 3E4BA 2RG8A 4PS3A 3RU0A 3LY9A 3FU5A 4BX8A 4TV3A 3S7FA 2OV8A 4MKTA 2OOEA 3IHYA 2J07A 3RKVA 1UJJA 4I43A 3SBSA 2IQCA 3LJ3A 5DBKA 2KM4A 2A4ZA 2WQ6A 3ZHEB 3B7SA 4A1GA 5CHEE 3D9OA 3QB2A 2X6JA 1EPUA 2IF4A 3FU6A 3PEVB 2VSNA 3FWVA 2ONDA 2AWIA 2WXNA 3PS6A 3OXLA 5E75A 5G04C 4EQFA 1YA0A 2J08A 2XEVA 1KT1A 4FP7A 4HFGA 3NQPA 4JPSA 1P5QA 3VTXA 3FUKA 4B0ZA 1UG3A 2IJGX 1EDUA 3L08A 5JHBA 4G1TA 3FH8A 3TG5A 3G2UA 2X6KA 4UWKA 5AJLA 2X6IA 3CVVA 5EKQD 4U8HA 3ZFWA 4ME2A 4EBAG 4JHJA 2PL2A 3OXGA 2VTBB 4H7YA 2OVBA 5FQ8A 2XQ0A 3G2SA 4U63A 3LVQE 1VDYA 1H6KA 2WQ7A 1X5BA 3EHMA 2IOLA 2X3MA 5KJKA 4I6JA 1KT0A 2WXJA 2VJ8A 1DVPA 2J4DA 3SI5A 3U4TA 2J4BA 2YNQA 5A7DB 4Y6CA 5G05J 2HO1A 3UQ3A 3ZW3A 3NZSA 2XGMA 4N2SA 3HVEA 4L23A 4GCNA 3SNXA 4FLBA 3P1UA 2XCBA 4HOSA 3VLDA 4BTAA 1HF8A 3ZPJA 4GPKA 2BTDA 2Y3AA 2L0TB 2WB2A 3NF1A 1IHGA 5EX0A 4CDRA 3L54A 4A55A 4EBAA 3L16A 3MEKA 4GZ6A 1XNFA 3MX3A 5JHAA 2CFZA 4XIFA 2AW6A 4JEHA 5LOZA 3JCKC 4F1SA 3SFZA 4CRWA 1IQUA 4J8SA 3CVLA 2J09A 3UT4A 2IFUA 4JW1A 4J8EA 5AENA 3CK7A 4BTBA 5FZQA 4L7TA 3JUIA 2DCPA 4I17A 3ZIMA 2FF4A 4FLHA 3R9AB 4GMJA 4WUYA 5A23A 3B13A 4UQXA 3ENEA 4AP2A 5BUZA 4QFVA 3SBTB 3ZGQA 4AEZC 4MS6A 3FP3A 3ZVVA 2I1JA 3TAXA 5AYWD 2BF0X 3QNKA 3CSTA 4FJZA 3U64A 4APFA 4AIFA 2PQRA 3ZEFA 4L2LA 5C2YA 4AOFA 3AS5A 4UWFA 1UN8A 5BT1A 2HR2A 3S2AA 4XE0A 4G2VA 1ELWA 1SZAA 3QC1A 1A17A 1SZ9A 4ILHB 4LUNU 4AY6A 4GZDA 3FTSA 3U66A 4KXKB 4GYYA 3KEZA 4H7XA 3TG4A 5CMWA 2YHEA 2BUGA 3CVPA 4U0ZA 4U07A 4G24A 5DIZA 4DLOA 4DJAA 1HXIA 1JWFA 3GZSA 3UMVA 4OYSA 4XI9A 3D9JA 3D9KA 3I4RB 4WNDA 1ZU2A 2QY7A 2WXQA 4GA2A 3Q47B 4C9BB 3CIAA 4K03A 2LAIA 2VTBA 3L6AA 3CKBA 2WXFA 3GYZA 3QDNA 4N3CA 4BX9A 1OUVA 4MRUA 4HLEA 5M72A 3I4GA 4DK5A 2LO6A 1U3DA 4IULA 4JVSA 2A5UA 2XGSA 2MRIA 1HS6A 4FHKA 3CGHA 4P29A 4Q94A 3FEXA 1QZ2A 4GA0A 4HOUA 3FTVA 3ONKA 4I2WA 5A6CA 2VQ2A 1JUQA 4ILGA 3ZXSA 3CVXA 4DPRA 3IKOB 4I9CA 1UN9A 2GGFA 4G25A 2C0MA 2LNIA 3K9IA 3MZLB 5EX3A 4F53A 4IRUA 5LCWJ 1HX8A 4AY5A 1Y8MA 5J90A 2DBAA 3APCA 1HU3A 5ARFA 2WMOA 2VGXB 3CHPA 4JHKA 3LCAA 4N3BA 2FULA 2ILRA 2MOWA 4I6EA 2FBNA 1E7UA 1INZA 2KC7A 4PH4B 3PRZA 2E2EA 3T5XA 4KMOA 5T8IA 3VLEA 3ZYKA 3FULA 4B8AA 4B94A 1H2TC 3FU3A 2V8SE 3FH7A 3FUEA 3MKQB 2LSUA 2WXMA 2PQNA 3PEUB 4GYOA 3SZ7A 4GB9A 2FEZA 5AIJA 4L1BA 1HO8A 3IBEA 4UWGA 2WXIA 1S0PA 3CV0A 1OWMA 4CEMA 2VSOE 3BG0B 3CVUA 4HORA 3B7TA 4I1OB 4WWOA 2NXPA 3TXMA 1ZBPA 4I1MA 2CFUA 3RRUA 3QOUA 2MHKA 3JYSA 3CQCB 3D9PA 4ACLA 1E8YA 4EZKA 3OAWA 3N71A 5FQ7A 4APOA 2PZIA 1E8WA 2Y4TA 3LY7A 5HQ8A 5JJ6A 3WXXA 2WM9A 5LP0A 2AXVA 2HM8A 3L13A 4BT9A 1IQRA 4NURA 3CVNA 3HHMA 2YINA 2ZU6B 4RG6A 4WNEA 3SD5A 4EZLA 1NA0A 3CR3A 3MV2B 2J9QA 3OTNA 2X6HA 4BFRA 3PE4A 2CG2A 3LPZA 2XRZA 4HOQA 2KCLA 3ZYMA 1LF8A 2QFCA 3RO3A 3ZN3A 3ZYQA 3FH5A 2CHZA 4N39A 3TGOA 2KCVA 4Q69A 3QK0A 5G2NA 3PNTB 5BV1A 4A1SA 3U3WA 3JQ0A 3PREA 1Z3YA 5ENNA 2R59A 5ANLA 5FT9A 2KATA 4FU3A 4N5CA 2NSZA 1MHQA 1WY6A 1PY1A 3PUJA 5G55A 1W3BA 4LERA 2WXRA 4ANUA 4F7AA 5LX8A 2L9BA 5JJTA 2I9CA 2WXGA 4RVBA 4XKCA 4CT4A 1N52A 5FJYA 3FTXA 5KJMA 2XCCA 3FFLA 3Q49B 3FUNA 2XRYA 3G2TA 4I9EA 3D9NA 1UW4B 4PS8A 4AM9A 2V5FA 4ATGA 2M63A 3QAQA 2RD0A 1H2UA 2I2OA 3Q5MA 4JC8A 2X38A 2JLBA 2XHEA 3S7BA 5KCMA 3MYVA 3I3NA 2WXOA 3G2WA 2VGXA 3KD7A 3ONLA 3PDNA 3SGHA 2VYIA 2V0PA 2VSXE 3EIJA 5G05C 3R7QA 4ANVA 3O48A 5BPPA 1HZ4A 3ML9A 3PE3A 4J0UA 4UI9J 4HOTA 4K0RA 3D9IA 5FQ4A 3ZRHA 4CGWA 4ANXA 4AVXA 4KBQA 5E76A 3MKQA 4NACA 2XPZA 4KYOB 4I6GA 3QJZA 2J49A 1Z3XA 4RG9A 4UQYA 2CG3A 2R5SA 3MV3B 4FJYA 3ULQA 4GAAA 3QKYA 5FZRA 3TXNA 2LAHA 1EYHA 2C0LA 2GRMA 1FVFA 3AU5A 3B7UX 3FTYA 3FY4A 4KZ0A 1WAO1 2FO7A 4WAFA 5HI7A 3T8MA 3RRNB 2X6FA 5G04J 2I1KA 2GW1A 4UQZA 3AS4A 1JWGA 3DBSA 3LS8A 5FQ6A 2EQXA 3TL5A 3HIZA 4JXTA 1Z6TA 2NC9A 1U3CA 4LRZA 3RIBA 3CHRA 4GA1A 3CSFA 4EECA 3UPVA 2XGOA 3FUIA 4JEUA 4R7LA 3T5VA 4KZCA 4BY6A 3CQGB 4GU5A 2Q7FA 3PVLA 1B89A 1EF1C 1H0AA 4FC8A 1OWOA 4CDNA 4FA6A 1DNPA 2IONA 2L6JA 5FWQA 3PUKA 2UWJG 1OWPA 3FUDA 3KAEA 4L2YA 4LCTA 4UI9K 4NRHB 3CEQA 4U0SA 2JEKA 3I5PA 5AJDA 5EDSA 2I6HA 1HE8A 5D0OD 3LXUX 3CK8A 4URKA 3LKUA 3ASGA 3CVYA 4GMLA 3L17A 3VLFA 4F3VA 3AU4A 4U0UA 4EPZA 2WXPA 3LY8A 2DIWA 2UY1A 3EJNA 4BSXA 4FHJA 5FTPA 5T3RA 3UT8A 4JA9A 4YVOA 3HYMB 5LFAA 1E7VA 4HXIA 1Y6IA 3BEEA 1NP7A 4JHRA 3FHEA 4NQ0A 4YNDA 1SQMA 1FCHA 3CHOA 3ZYLA 3U9WA 4TUUA 4ANWA 1FVHA 3APDA 3DPDA 2KZTA 4V3IA 2VSYA 4N3AA 4AJWA 3CVWA 1HG5A 3G2VA 5CCMA 5KJLA 3EDTB 4M3OA 2AVPA 3UT7A 3ML8A 3OXFA 4WWNA 3IEGA 4KT6B 4CGVA 4CCAA 3QWWA 2Y4UA 1L5JA 1MQSA 3APFA 4FULA 3D9LA 3S7JA 3ASDA 2FI7A 2C2LA 2V4LA 3VTYA 4HVBA 5LCWC 1N54A 3LYAA 3ESLA 4KVMA 3UX4A 4JA7A 2XPIA 1ELKA 1HG2A 4A3VA 4G26A 3FTWA 1IYGA 4ILIA 3EIQC 2R17C 3FDHA 4GYWA 1NA3A 3FUMA 4EZJA 2PM7A 2WXKA 3FUFA 1PC2A 2KCKA 3KS2A 4Q96A 4B89A 5CMYA 2PM6A 2LSVA 3CVQA 1XGWA 3CLJA 3IV0A 4ACKA 4RSYA 3ESKA 5ANRA 4ABNA 3IHVA 3FUJA 3AS8A 3HDXA 3MCXA 1NZNA 4W9RA 3TJPA 4PDXA 3RRMB 2WPVA 2UY1B 3SHFA 4AV7A 3RO2A 3R7RA 4XX5A 2AXUA 2CHWA 3PH0C 4O6FA 3D3MA 2OVFA 4DI3A 4PS7A 4WNFA 3D9MA 2E0IA 3JQ1A 2WMNA 2WXLA 4A3TA 3FTUA 2HYZA 5BV0A 3ASFA 3MA5A 1E8ZA 2KZTB 1ELRA 4LEUA 4YVQC 4DLQA 3C98A 5C1DA 1OWNA 2WXHA 3PZDA 3CHSA 4UWHA 4G23A 4HS2A 4GZCA 4D10C 4J6IA 2WVIA 2XPYA 2GRLA 2WQHA 1UJKA 5ARGA 4WWPA 4C0EA 3GW4A 3LDZA 4KVOA 3FU0A 5FZSA 3CHMA 1TJFA 4UWLA 3QWVA 3Q4AB 3QWPA 1QQEA 4DI4A 3P2BA 4J8FA 2YQ8A 3FTZA 3EHNA 4MLPA 3B7RL 4JZYA 1PAQA 4J8DA 4CT0A 3ZHEA 4GZ5A 4OVVA 3PNLB 1HH8A 3CK9A 3L22A 5CCLA 3NZUA 4PUCA 3GZ2A 4OVUA 1H19A 1KLXA 3FEYA 3QARA 2IOSA 3Q15A 3CKCA 3GZ1A 4N2QA 3RJVA 2CHXA 5JJ7A 2P58C 2VGYA 4IN3B 3MGBA 2IU1A 4AXHA 5J08A 3SF4A 3HVEB 4U04A 1WM5A 5BNWA 4XI0A 4I1AA 4XKBA 5D0QD 1JPLA 3LEWA 4C0MA 2AXZA 4E6HA 4I2ZA 3LVRE 3UUXA 3MJWA 4FADA 5KJNA 3FUHA 1HFAA 4TRQA 1E96B 4G11A 3O4ZA 3MKRA 3URZA 1BPOA 1TJCA 1TEZA 2L0IA 1H2VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B8C B;  2IOL A;  4JHK A;  2KZT B;  2KZT A;  2FUL A;  2NSZ A;  3FEY A;  4B89 A;  2IOS A;  2VSX E;  4IUL A;  3EIJ A;  2HM8 A;  4CRW A;  4LUN U;  5ANR A;  2IU1 A;  4B8A A;  2ZU6 B;  4C9B B;  3RK6 A;  1H2T C;  3FEX A;  2RG8 A;  4GML A;  4CT4 A;  1UG3 A;  3JUI A;  1N52 A;  4GMJ A;  2GGF A;  4CEM A;  2VSO E;  1UW4 B;  1N54 A;  3D3M A;  4JHJ A;  1PAQ A;  1H2U A;  2I2O A;  2ION A;  1H2V C;  1H6K A;  1HU3 A;  3EIQ C;  3L6A A; 
#chains in the Genus database with same CATH topology
 2LUH A;  4IYP A;  1ZB1 A;  4WNG A;  1GW6 A;  5BW8 C;  1BI7 B;  4GZ3 A;  4PS3 A;  2RG8 A;  3LY9 A;  4TV3 A;  3S7F A;  1BD8 A;  2OV8 A;  3UIO C;  2OOE A;  5KBA A;  4I43 A;  2KM4 A;  2WQ6 A;  3ZHE B;  3B7S A;  4A1G A;  3D9O A;  3R9M A;  3QB2 A;  1TN8 A;  2X6J A;  3JUE A;  3PEV B;  2VSN A;  3FWV A;  2AWI A;  3E30 A;  3OXL A;  4GTS A;  3DWL G;  1YA0 A;  1KT1 A;  4HFG A;  4RLY A;  3FUK A;  4BES A;  1UG3 A;  2IJG X;  1EDU A;  5JHB A;  3HXB A;  3TG5 A;  2X6I A;  1V54 E;  4U8H A;  3ZFW A;  4ME2 A;  4EBA G;  3OXG A;  3KSL A;  2OVB A;  1H6K A;  3EHM A;  5KJK A;  2WXJ A;  2VJ8 A;  5EID A;  3ZNG A;  2YNQ A;  5A7D B;  2HO1 A;  3ZW3 A;  4L23 A;  3SNX A;  4FLB A;  4BTA A;  2BTD A;  3NF1 A;  3L54 A;  3L16 A;  3MEK A;  2P9P G;  2CFZ A;  2GRO B;  2IFU A;  5AEN A;  4L7T A;  5ENO D;  4UQX A;  1SW6 A;  4AP2 A;  2F8Y A;  4AEZ C;  4MS6 A;  1OCR E;  3DEO A;  3QNK A;  4FJZ A;  3U64 A;  4APF A;  4AIF A;  3ZEF A;  5CBO A;  1UN8 A;  2HR2 A;  3S2A A;  1A17 A;  1SZ9 A;  3U66 A;  3CVP A;  3UIP C;  1JWF A;  3GZS A;  3UMV A;  3ABK E;  2AJA A;  4WND A;  2PNN A;  2WXQ A;  2P9I G;  2P9L G;  3CKB A;  4BX9 A;  1SVX A;  2BED A;  5M72 A;  4DK5 A;  4GMR A;  4UUC A;  1JCS A;  1U3D A;  4IUL A;  4A63 B;  5HS0 A;  4FHK A;  3CGH A;  4Q94 A;  1WDY A;  3FTV A;  3ONK A;  2OEV A;  1N4Q A;  1MYO A;  1S63 A;  5EX3 A;  4IRU A;  4AY5 A;  1FT1 A;  3T5X A;  3FUL A;  1H2T C;  3FH7 A;  4HRL A;  3PEU B;  3SZ7 A;  5AIJ A;  1YCS B;  3IBE A;  1RW2 A;  3CV0 A;  2H6I A;  4HOR A;  3CVU A;  2VSO E;  3BG0 B;  3ULE G;  3B7T A;  2Y1L E;  4F1P A;  5KNG A;  2A5E A;  3B95 A;  4ACL A;  1E8Y A;  3N71 A;  3EHR A;  1IQR A;  4EZL A;  3HHM A;  4WNE A;  1MX2 A;  1NA0 A;  3CR3 A;  3MV2 B;  2X6H A;  1KPS B;  3ZYM A;  3ZN3 A;  4TXP A;  5EYP F;  3PNT B;  5BV1 A;  3U3W A;  3JQ0 A;  3PRE A;  2KXP C;  5FT9 A;  2KAT A;  4N5C A;  2NSZ A;  2B6C A;  1PY1 A;  1W3B A;  5JJT A;  2I9C A;  2WXG A;  4XKC A;  3F6Q A;  3FTX A;  3TWV A;  4PS8 A;  3V79 K;  4AM9 A;  2M63 A;  4JC8 A;  3Q5M A;  3RAU A;  2XHE A;  2GRR B;  4YDY A;  2VGX A;  1OY3 D;  2VYI A;  5KNH D;  5G05 C;  4ANV A;  1HZ4 A;  3ML9 A;  4J0U A;  5AQA A;  4UI9 J;  1N9A A;  3D9I A;  4CGW A;  4K5B A;  4KBQ A;  3MKQ A;  3QJZ A;  4DX2 A;  2KBX A;  1Z3X A;  4LSZ E;  4UQY A;  1TNZ A;  2GRM A;  3AU5 A;  3FTY A;  3FY4 A;  3T8M A;  2X6F A;  3ABM E;  2I1K A;  5G04 J;  2GW1 A;  3AS4 A;  3TL5 A;  2DZN A;  2EQX A;  4GA1 A;  3UPV A;  4O1P A;  4R7L A;  2GRQ B;  3T5V A;  3CQG B;  4GU5 A;  3PVL A;  1B89 A;  1O1R A;  4CDN A;  4FA6 A;  1DNP A;  2IEJ A;  3KAE A;  4L2Y A;  4O60 A;  1IKN D;  5B3S E;  3CEQ A;  2JEK A;  3I5P A;  5FIO A;  3LXU X;  1OCC E;  4URK A;  3LKU A;  3ASG A;  2ZXW E;  1DC2 A;  2LXL A;  3TWR A;  2WXP A;  2DIW A;  4ATZ D;  5FTP A;  3UT8 A;  4HXI A;  1NP7 A;  4YND A;  5D66 A;  3BQO A;  1FCH A;  3CHO A;  3ZYL A;  3U9W A;  4ANW A;  1FVH A;  1WG0 A;  4V3I A;  4N3A A;  5KJL A;  4M3O A;  3OXF A;  3IEG A;  4KT6 B;  4CGV A;  2Y4U A;  1L5J A;  1MQS A;  3APF A;  4FUL A;  3HXF A;  3LYA A;  4BET A;  1ELK A;  4G26 A;  3FDH A;  3FUM A;  3FUF A;  1PC2 A;  2LSV A;  5ITZ F;  4BER A;  3RSE G;  3FUJ A;  1NZN A;  4W9R A;  1OCO E;  4PDX A;  4AV7 A;  3RO2 A;  2CHW A;  1TR4 A;  1X81 A;  4DI3 A;  2ZIS A;  3ASF A;  3MA5 A;  4K5A B;  4LEU A;  1OWN A;  4G23 A;  4J6I A;  2WQH A;  4WWP A;  4C0E A;  3LDZ A;  4KVO A;  3FU0 A;  1SA5 A;  3QWP A;  3ASN E;  4DI4 A;  4J8F A;  2YQ8 A;  4J8D A;  4CT0 A;  4OVV A;  3L22 A;  4OVU A;  4PUC A;  3GZ2 A;  1KLX A;  2IOS A;  2LXM A;  3Q15 A;  4N2Q A;  5JJ7 A;  3SF4 A;  3J5P A;  4XI0 A;  4XKB A;  1JPL A;  3MJW A;  2HE0 A;  2H6F A;  1E96 B;  5IY5 E;  4J8Y A;  3URZ A;  1TEZ A;  2R03 A;  2QYJ A;  1N4S A;  4JL0 A;  1QNF A;  3E37 A;  3CHQ A;  1E90 A;  3HXD A;  3S7D A;  3E4B A;  3RU0 A;  4BX8 A;  2IO2 C;  1YMP A;  2DWZ A;  2A4Z A;  4U8Y D;  3FU6 A;  1NFI E;  2WXN A;  2XEV A;  2GRP B;  2V4H C;  3NQP A;  5EN5 D;  1P5Q A;  5AQ7 A;  4G1T A;  4TXR A;  4F6R D;  2R02 A;  4JHJ A;  4H7Y A;  4U63 A;  3G2S A;  2WQ7 A;  5CER B;  2IOL A;  2XZT G;  4I6J A;  1KT0 A;  3U4T A;  2J4B A;  4Y6C A;  5CEC B;  3UQ3 A;  3ZUV B;  3HVE A;  3UM1 A;  1IXV A;  2XCB A;  3P1U A;  3VLD A;  3ZPJ A;  4GPK A;  1MZC A;  4ZHB A;  5D2M C;  5CED B;  1K3Z D;  2L0T B;  2Y3A A;  4G8L A;  2WB2 A;  1H6P A;  2DYR E;  4GZ6 A;  3JCK C;  3SFZ A;  4J8S A;  4HI8 A;  4J8E A;  3JXI A;  2DCP A;  4FLH A;  4GMJ A;  1A5E A;  4QFV A;  3ZVV A;  3FP3 A;  2I1J A;  5AYW D;  2BF0 X;  2PQR A;  4L2L A;  5C2Y A;  3AS5 A;  4JD2 G;  3HXE A;  5BT1 A;  4XE0 A;  2OCC E;  4AY6 A;  4GZD A;  5HKP A;  4GYY A;  4H7X A;  3ZXP A;  5CMW A;  2YHE A;  4G24 A;  4DLO A;  1HXI A;  5H7P A;  3I4R B;  3UXG A;  4GA2 A;  5EYL A;  4GTO A;  4C9B B;  3CIA A;  3QDN A;  2WXF A;  4MRU A;  3PZ3 A;  1HS6 A;  4P29 A;  1QZ2 A;  4GA0 A;  4HOU A;  2VQ2 A;  4ILG A;  4DPR A;  3IKO B;  3UM2 A;  3DSU A;  4G25 A;  1AWC B;  2ETC A;  5LCW J;  1HX8 A;  4YDE A;  2DBA A;  5ARF A;  2WMO A;  2VGX B;  4JHK A;  3LCA A;  4N3B A;  1LD8 A;  1E7U A;  2KC7 A;  4KMO A;  4GTR A;  3ZYK A;  1V55 E;  3FU3 A;  3AG3 E;  2R05 A;  2XEH A;  3MKQ B;  2WXM A;  2PQN A;  4GB9 A;  2FEZ A;  4L1B A;  1HO8 A;  1MX4 A;  4UWG A;  4I1O B;  1ZBP A;  2CFU A;  3RRU A;  5JMN D;  3QOU A;  2MHK A;  5CRV A;  4EZK A;  2P2C P;  2PZI A;  5JJ6 A;  2WM9 A;  5LP0 A;  3UIN C;  4BT9 A;  4NUR A;  4RG6 A;  5EIB E;  4HOQ A;  2KCL A;  1MJ0 A;  2QFC A;  3ZYQ A;  5G2N A;  5BXU A;  2R59 A;  4FU3 A;  1MHQ A;  3PUJ A;  2WXR A;  5LX8 A;  4NIK A;  3TWX A;  2B0O E;  5KJM A;  2XCC A;  3FFL A;  3Q49 B;  3FUN A;  4U95 D;  1FPP A;  3NBN B;  3QAQ A;  1O1S A;  2I2O A;  2X38 A;  2JLB A;  4OAU C;  3MYV A;  3I3N A;  3ONL A;  3PDN A;  4HOT A;  5FQ4 A;  4AVX A;  4LNU D;  4NAC A;  1RZ4 A;  4KYO B;  2R5S A;  3MV3 B;  4FJY A;  3QKY A;  1EYH A;  4EHM A;  3V30 A;  3UI2 A;  4WAF A;  1K8K G;  3RRN B;  5FQ6 A;  4JXT A;  1Z6T A;  3RIB A;  4EEC A;  2VGE A;  3FUI A;  2Q7F A;  1EF1 C;  1H0A A;  3PUK A;  1OWP A;  3FUD A;  4LCT A;  4UI9 K;  4NRH B;  3AG1 E;  3TWT A;  2I6H A;  5AQ9 A;  3CVY A;  3L17 A;  4U0U A;  1Q2Z A;  3LY8 A;  4BSX A;  4FHJ A;  5T3R A;  4JA9 A;  4YVO A;  2RFM A;  1S64 A;  4TUU A;  3DPD A;  4HRN A;  1NL4 A;  1HG5 A;  5CCM A;  3EDT B;  2AVP A;  1DCE A;  3NOC D;  3D9L A;  3S7J A;  2C2L A;  1TYQ G;  3VTY A;  4HVB A;  1N54 A;  3ESL A;  1OXJ A;  4JA7 A;  2XPI A;  3FTW A;  2WXK A;  4Q96 A;  4B89 A;  2PM6 A;  3CLJ A;  4ACK A;  4GTQ A;  3AS8 A;  3HDX A;  3MCX A;  3TJP A;  3AG4 E;  2UY1 B;  3R7R A;  4O6F A;  3D3M A;  3ZKJ A;  4A3T A;  3ZU7 B;  5BV0 A;  2KZT B;  4HI9 A;  5C1D A;  3PZD A;  4HS2 A;  4GTT A;  3EUV A;  4GZC A;  3CHM A;  3NOG D;  3QWV A;  3FTZ A;  3EHN A;  4MLP A;  3B7R L;  2QZA A;  3ZHE A;  3HXC A;  3PNL B;  3CK9 A;  5CCL A;  3QAR A;  1TNY A;  2CHX A;  2VGY A;  4AXH A;  3HVE B;  4U04 A;  1WM5 A;  5BNW A;  3SFY A;  2QYU A;  4C0M A;  3D9H A;  5KJN A;  5ENR D;  4G11 A;  4J7W A;  3MKR A;  2F8X K;  1H2V C;  2J8S D;  1E8X A;  5T4Y A;  4BT8 A;  4K5C A;  4CDM A;  4XZ4 A;  2YHC A;  1TNU A;  3BUA A;  3RK6 A;  3UKR G;  4DRX E;  3FU5 A;  1AP7 A;  4CYM D;  3IHY A;  3RKV A;  1UJJ A;  3EU9 A;  2IQC A;  1S70 B;  5CHE E;  4HLL A;  1EPU A;  2IF4 A;  3PS6 A;  2J08 A;  4FP7 A;  1UOH A;  2QC9 A;  4JPS A;  3VTX A;  5AAR A;  3SQV A;  4B0Z A;  2X6K A;  4UWK A;  3DST A;  2PL2 A;  2P9N G;  4ZFH A;  5FQ8 A;  1KZO A;  1TNO A;  1VDY A;  3LVQ E;  4DUI A;  1X5B A;  2X3M A;  1NI1 A;  1DVP A;  2J4D A;  5KWD A;  2Y69 E;  5G05 J;  5AN8 A;  2XGM A;  4N2S A;  2P9S G;  4GCN A;  1HF8 A;  1LD7 A;  1K1B A;  1KZP A;  3UTM A;  4CDR A;  1XNF A;  3MX3 A;  4XIF A;  4F1S A;  3C3R A;  3EU5 A;  4BTB A;  5FZQ A;  3JUI A;  4I17 A;  2FF4 A;  4WUY A;  3KEA A;  3SBT B;  3W9G A;  4AOF A;  4RQI A;  2ETB A;  4ILH B;  4LUN U;  3FTS A;  4KXK B;  3KEZ A;  3TG4 A;  2BUG A;  1U2V G;  3Q7F A;  4XI9 A;  3D9J A;  1ZU2 A;  4N5Q A;  3Q47 B;  4K03 A;  2LAI A;  2VTB A;  3L6A A;  4N3C A;  3GYZ A;  3DEP A;  4HLE A;  4JVS A;  3FEX A;  3AJI A;  4I2W A;  5A6C A;  2GRN B;  3AAA C;  3ZXS A;  3CVX A;  4I9C A;  1UN9 A;  3MZL B;  2RFA A;  1Y8M A;  3BU8 A;  3APC A;  3Q75 A;  3CHP A;  2FUL A;  2ILR A;  2MOW A;  1INZ A;  3PRZ A;  3VLE A;  5T8I A;  4B8A A;  2V8S E;  2LSU A;  4GYO A;  5CEA A;  3HG0 D;  1S0P A;  1OWM A;  4DX7 D;  4WWO A;  2NXP A;  4I1M A;  3C3O A;  3CQC B;  3D9P A;  3OAW A;  5FQ7 A;  4APO A;  5HQ8 A;  2HM8 A;  3CVN A;  2YIN A;  3JXJ A;  3SD5 A;  3Q78 A;  2J9Q A;  3OTN A;  4BFR A;  1BLX B;  2CG2 A;  3LPZ A;  3NAW A;  1LF8 A;  3FH5 A;  3AG2 E;  3TGO A;  2KCV A;  3QK0 A;  1IHB A;  3WG7 E;  4A1S A;  5ENN A;  5G55 A;  2ZGG A;  4RVB A;  3TWW A;  1N52 A;  5FJY A;  1BU9 A;  4U96 D;  1UW4 B;  2V5F A;  1G3N B;  3S7B A;  5KCM A;  1D8E A;  5AAO A;  2WXO A;  3G2W A;  3KD7 A;  1SA4 A;  2R2L A;  3SGH A;  5ENP D;  2V0P A;  2VSX E;  3EIJ A;  3R7Q A;  5BPP A;  3PE3 A;  3ZRH A;  5E76 A;  2XPZ A;  4I6G A;  3ASO E;  3ULQ A;  2C0L A;  1FVF A;  4JB8 P;  5HI7 A;  1JWG A;  3HIZ A;  3UKU G;  4LRZ A;  2NC9 A;  1U3C A;  4B93 B;  3T9K A;  4KZC A;  1OWO A;  1OT8 A;  1D8D A;  1N95 A;  4U0S A;  5AJD A;  5EDS A;  4L9P A;  5D0O D;  3CK8 A;  4QQI A;  1Z5S C;  3C5R A;  4F3V A;  3AU4 A;  4EPZ A;  3EJN A;  1E7V A;  1Y6I A;  3BEE A;  4JHR A;  4YDW A;  1SQM A;  4XEI G;  3APD A;  3ISM C;  2VSY A;  4AJW A;  2RKK A;  4WWN A;  3QWW A;  4HRM B;  2V4L A;  2H6G A;  4DX1 A;  4A3V A;  1HG2 A;  4ILI A;  2R17 C;  4GYW A;  2PM7 A;  2EIK E;  3KS2 A;  5CMY A;  1XGW A;  5ANR A;  3DXK G;  3IHV A;  1LTX A;  3L82 A;  4GTM A;  3RRM B;  2WPV A;  3E34 A;  4XX5 A;  4Z68 A;  3E32 A;  2AXU A;  2OVF A;  3W9F A;  4LNB A;  2E0I A;  3FTU A;  2HYZ A;  3SO8 A;  1E8Z A;  4DLQ A;  3C98 A;  3J5Q B;  3Q9U C;  4DX6 D;  2WXH A;  4D10 C;  2GRL A;  3GW4 A;  5FZS A;  4UWL A;  1QQE A;  2IO3 C;  3P2B A;  4JZY A;  4OAV B;  4GZ5 A;  3NZU A;  1H19 A;  3CKC A;  3RJV A;  2P58 C;  3MGB A;  2IU1 A;  3B7B A;  4I1A A;  5D0Q D;  3LEW A;  2AXZ A;  4E6H A;  3FUH A;  1TNB A;  1YYH A;  2XEN A;  2XS8 A;  1TJC A;  4B8C B;  5ENQ D;  4BWR A;  4DX5 D;  3BG1 B;  4UI9 C;  3DSX A;  3C3Q A;  1OWL A;  4GCO A;  3ASH A;  4Y6W A;  4E85 A;  1QYM A;  4MKT A;  2J07 A;  3Q73 A;  3SBS A;  3LJ3 A;  5DBK A;  3SFX A;  4LG6 A;  1N0R A;  2V5Q C;  2OND A;  5E75 A;  5G04 C;  4EQF A;  5BXO A;  3LJN A;  3L08 A;  3FH8 A;  3G2U A;  5AJL A;  3T8K A;  3CVV A;  5EKQ D;  1FT2 A;  3DXM G;  3UM0 A;  2VTB B;  2XQ0 A;  1OCZ E;  5B1B E;  4MBG A;  3SI5 A;  5JA4 D;  4YDO A;  3NZS A;  5AQB A;  1TN7 A;  2DYS E;  1IHG A;  5EX0 A;  4A55 A;  4EBA A;  2MYO A;  3Q9N C;  5JHA A;  2AW6 A;  4JEH A;  5LOZ A;  4CRW A;  1IQU A;  1N94 A;  3ULY A;  2XZD G;  3CVL A;  2J09 A;  5CRU A;  3Q79 A;  4JW1 A;  3UT4 A;  4U7E B;  3CK7 A;  2DZO A;  1QBQ A;  3ZIM A;  3R9A B;  5A23 A;  3B13 A;  3ENE A;  3L9T A;  5BUZ A;  3ZGQ A;  3TAX A;  2ZIR A;  3CST A;  1O1T A;  4UWF A;  4G2V A;  1ELW A;  3UM3 A;  1SZA A;  3QC1 A;  3Q7A A;  2BKK B;  2H6H A;  4GPM A;  2P9U G;  4U0Z A;  4U07 A;  5DIZ A;  4DJA A;  3X2Q E;  4OYS A;  3D9K A;  2QY7 A;  2Y0B G;  1OUV A;  1JCQ A;  3I4G A;  2LO6 A;  2NYJ A;  2A5U A;  3DSV A;  2XGS A;  2MRI A;  3PZ2 A;  3E33 A;  1BI8 B;  3KSQ A;  1JUQ A;  2GGF A;  2C0M A;  2LNI A;  3K9I A;  4F53 A;  5B1A E;  5J90 A;  2DVW A;  1HU3 A;  5ENT D;  3NB2 A;  4I6E A;  2FBN A;  4PH4 B;  2E2E A;  4CZ2 D;  4B94 A;  3FUE A;  3V2X A;  2WXI A;  4CEM A;  3TXM A;  3PZ4 A;  4HNA D;  3JYS A;  2OEW A;  3LY7 A;  1E8W A;  2Y4T A;  3WXX A;  2AXV A;  3L13 A;  2ZU6 B;  3PE4 A;  2XRZ A;  3EHQ A;  3RO3 A;  2CHZ A;  4N39 A;  1MX6 A;  4Q69 A;  1Z3Y A;  2P9K G;  5EIL A;  5ANL A;  1WY6 A;  5ENS D;  4LER A;  1N11 A;  4ANU A;  4F7A A;  2L9B A;  3DPY A;  2FO1 E;  4CT4 A;  4C48 B;  2XRY A;  3G2T A;  4I9E A;  3D9N A;  4ATG A;  1TN6 A;  1H2U A;  2RD0 A;  2EIN E;  1N4P A;  4LNG A;  3O48 A;  3DSW A;  4K0R A;  3V2O A;  4BSZ B;  2L6B A;  4ANX A;  2EIL E;  2J49 A;  4RG9 A;  2CG3 A;  1O5M A;  4GAA A;  1JCR A;  5FZR A;  2F37 A;  3TXN A;  2LAH A;  3PZ1 A;  3B7U X;  3IXE A;  3ABL E;  4KZ0 A;  4X8Q A;  1WAO 1;  2FO7 A;  1D9S A;  4TXQ A;  4UQZ A;  3TWS A;  3DBS A;  3LS8 A;  5HRY A;  1K1A A;  4HOS A;  3SY2 A;  3CHR A;  4HBD A;  3CSF A;  2XGO A;  4JEU A;  2EIJ E;  4TUM A;  4BY6 A;  4FC8 A;  2ION A;  2L6J A;  5FWQ A;  2UWJ G;  1N4R A;  3HRA A;  1HE8 A;  4GML A;  3VLF A;  2BKG A;  2UY1 A;  1N0Q A;  1H6O A;  2ETA A;  3HYM B;  5LFA A;  4NQ0 A;  3FHE A;  5CBN A;  2KZT A;  3CVW A;  3G2V A;  3DSS A;  3UT7 A;  3ML8 A;  4CCA A;  2F0Y A;  3ASD A;  2FI7 A;  5LCW C;  4KVM A;  2ZGD A;  2EIM E;  3UX4 A;  1IYG A;  3EIQ C;  1NA3 A;  4EZJ A;  2KCK A;  3CVQ A;  3IV0 A;  4RSY A;  3ESK A;  4ABN A;  3TWU A;  4HB5 A;  2IY0 C;  3SHF A;  4GTV A;  4HQD A;  3TWQ A;  3PH0 C;  4O1O A;  3C72 A;  4PS7 A;  4WNF A;  3D9M A;  3JQ1 A;  2WMN A;  2WXL A;  1ELR A;  4YVQ C;  3CHS A;  4UWH A;  3V31 A;  2XS1 A;  2WVI A;  2XPY A;  1UJK A;  5ARG A;  1TJF A;  1DCQ A;  3Q4A B;  4M7C A;  4GTP A;  2JAB A;  1PAQ A;  3DRA A;  1HH8 A;  3FEY A;  3GZ1 A;  4IN3 B;  4U8V D;  5FIN A;  5J08 A;  4BEP A;  2XEE A;  4G8K A;  4I2Z A;  3LVR E;  3UUX A;  4FAD A;  1HFA A;  4TRQ A;  3O4Z A;  1BPO A;  2L0I A; 
#chains in the Genus database with same CATH homology
 4B8C B;  4BWR A;  1E8X A;  5T4Y A;  4BT8 A;  4IYP A;  4CDM A;  3BG1 B;  4UI9 C;  2YHC A;  4WNG A;  4XZ4 A;  4JL0 A;  1GW6 A;  1QNF A;  5BW8 C;  3CHQ A;  1E90 A;  1OWL A;  4GCO A;  3RK6 A;  3ASH A;  4Y6W A;  3S7D A;  4E85 A;  4GZ3 A;  3E4B A;  2RG8 A;  4PS3 A;  3RU0 A;  3LY9 A;  3FU5 A;  4BX8 A;  4TV3 A;  3S7F A;  2OV8 A;  4MKT A;  2OOE A;  3IHY A;  2J07 A;  3RKV A;  1UJJ A;  4I43 A;  3SBS A;  2IQC A;  3LJ3 A;  5DBK A;  2KM4 A;  2A4Z A;  2WQ6 A;  3ZHE B;  3B7S A;  4A1G A;  5CHE E;  3D9O A;  3QB2 A;  2X6J A;  1EPU A;  2IF4 A;  3FU6 A;  3PEV B;  2VSN A;  3FWV A;  2OND A;  2AWI A;  2WXN A;  3PS6 A;  3OXL A;  5E75 A;  5G04 C;  4EQF A;  1YA0 A;  2J08 A;  2XEV A;  1KT1 A;  4FP7 A;  4HFG A;  3NQP A;  4JPS A;  1P5Q A;  3VTX A;  3FUK A;  4B0Z A;  1UG3 A;  2IJG X;  1EDU A;  3L08 A;  5JHB A;  4G1T A;  3FH8 A;  3TG5 A;  3G2U A;  2X6K A;  4UWK A;  5AJL A;  2X6I A;  3CVV A;  5EKQ D;  4U8H A;  3ZFW A;  4ME2 A;  4EBA G;  4JHJ A;  2PL2 A;  3OXG A;  2VTB B;  4H7Y A;  2OVB A;  5FQ8 A;  2XQ0 A;  3G2S A;  4U63 A;  3LVQ E;  1VDY A;  1H6K A;  2WQ7 A;  1X5B A;  3EHM A;  2IOL A;  2X3M A;  5KJK A;  4I6J A;  1KT0 A;  2WXJ A;  2VJ8 A;  1DVP A;  2J4D A;  3SI5 A;  3U4T A;  2J4B A;  2YNQ A;  5A7D B;  4Y6C A;  5G05 J;  2HO1 A;  3UQ3 A;  3ZW3 A;  3NZS A;  2XGM A;  4N2S A;  3HVE A;  4L23 A;  4GCN A;  3SNX A;  4FLB A;  3P1U A;  2XCB A;  4HOS A;  3VLD A;  4BTA A;  1HF8 A;  3ZPJ A;  4GPK A;  2BTD A;  2Y3A A;  2L0T B;  2WB2 A;  3NF1 A;  1IHG A;  5EX0 A;  4CDR A;  3L54 A;  4A55 A;  4EBA A;  3L16 A;  3MEK A;  4GZ6 A;  1XNF A;  3MX3 A;  5JHA A;  2CFZ A;  4XIF A;  2AW6 A;  4JEH A;  5LOZ A;  3JCK C;  4F1S A;  3SFZ A;  4CRW A;  1IQU A;  4J8S A;  3CVL A;  2J09 A;  3UT4 A;  2IFU A;  4JW1 A;  4J8E A;  5AEN A;  3CK7 A;  4BTB A;  5FZQ A;  4L7T A;  3JUI A;  2DCP A;  4I17 A;  3ZIM A;  2FF4 A;  4FLH A;  3R9A B;  4GMJ A;  4WUY A;  5A23 A;  3B13 A;  4UQX A;  3ENE A;  4AP2 A;  5BUZ A;  4QFV A;  3SBT B;  3ZGQ A;  4AEZ C;  4MS6 A;  3FP3 A;  3ZVV A;  2I1J A;  3TAX A;  5AYW D;  2BF0 X;  3QNK A;  3CST A;  4FJZ A;  3U64 A;  4APF A;  4AIF A;  2PQR A;  3ZEF A;  4L2L A;  5C2Y A;  4AOF A;  3AS5 A;  4UWF A;  1UN8 A;  5BT1 A;  2HR2 A;  3S2A A;  4XE0 A;  4G2V A;  1ELW A;  1SZA A;  3QC1 A;  1A17 A;  1SZ9 A;  4ILH B;  4LUN U;  4AY6 A;  4GZD A;  3FTS A;  3U66 A;  4KXK B;  4GYY A;  3KEZ A;  4H7X A;  3TG4 A;  5CMW A;  2YHE A;  2BUG A;  3CVP A;  4U0Z A;  4U07 A;  4G24 A;  5DIZ A;  4DLO A;  4DJA A;  1HXI A;  1JWF A;  3GZS A;  3UMV A;  4OYS A;  4XI9 A;  3D9J A;  3D9K A;  3I4R B;  4WND A;  1ZU2 A;  2QY7 A;  2WXQ A;  4GA2 A;  3Q47 B;  4C9B B;  3CIA A;  4K03 A;  2LAI A;  2VTB A;  3L6A A;  3CKB A;  2WXF A;  3GYZ A;  3QDN A;  4N3C A;  4BX9 A;  1OUV A;  4MRU A;  4HLE A;  5M72 A;  3I4G A;  4DK5 A;  2LO6 A;  1U3D A;  4IUL A;  4JVS A;  2A5U A;  2XGS A;  2MRI A;  1HS6 A;  4FHK A;  3CGH A;  4P29 A;  4Q94 A;  3FEX A;  1QZ2 A;  4GA0 A;  4HOU A;  3FTV A;  3ONK A;  4I2W A;  5A6C A;  2VQ2 A;  1JUQ A;  4ILG A;  3ZXS A;  3CVX A;  4DPR A;  3IKO B;  4I9C A;  1UN9 A;  2GGF A;  4G25 A;  2C0M A;  2LNI A;  3K9I A;  3MZL B;  5EX3 A;  4F53 A;  4IRU A;  5LCW J;  1HX8 A;  4AY5 A;  1Y8M A;  5J90 A;  2DBA A;  3APC A;  1HU3 A;  5ARF A;  2WMO A;  2VGX B;  3CHP A;  4JHK A;  3LCA A;  4N3B A;  2FUL A;  2ILR A;  2MOW A;  4I6E A;  2FBN A;  1E7U A;  1INZ A;  2KC7 A;  4PH4 B;  3PRZ A;  2E2E A;  3T5X A;  4KMO A;  5T8I A;  3VLE A;  3ZYK A;  3FUL A;  4B8A A;  4B94 A;  1H2T C;  3FU3 A;  2V8S E;  3FH7 A;  3FUE A;  3MKQ B;  2LSU A;  2WXM A;  2PQN A;  3PEU B;  4GYO A;  3SZ7 A;  4GB9 A;  2FEZ A;  5AIJ A;  4L1B A;  1HO8 A;  3IBE A;  4UWG A;  2WXI A;  1S0P A;  3CV0 A;  1OWM A;  4CEM A;  2VSO E;  3BG0 B;  3CVU A;  4HOR A;  3B7T A;  4I1O B;  4WWO A;  2NXP A;  3TXM A;  1ZBP A;  4I1M A;  2CFU A;  3RRU A;  3QOU A;  2MHK A;  3JYS A;  3CQC B;  3D9P A;  4ACL A;  1E8Y A;  4EZK A;  3OAW A;  3N71 A;  5FQ7 A;  4APO A;  2PZI A;  1E8W A;  2Y4T A;  3LY7 A;  5HQ8 A;  5JJ6 A;  3WXX A;  2WM9 A;  5LP0 A;  2AXV A;  2HM8 A;  3L13 A;  4BT9 A;  1IQR A;  4NUR A;  3CVN A;  3HHM A;  2YIN A;  2ZU6 B;  4RG6 A;  4WNE A;  3SD5 A;  4EZL A;  1NA0 A;  3CR3 A;  3MV2 B;  2J9Q A;  3OTN A;  2X6H A;  4BFR A;  3PE4 A;  2CG2 A;  3LPZ A;  2XRZ A;  4HOQ A;  2KCL A;  3ZYM A;  1LF8 A;  2QFC A;  3RO3 A;  3ZN3 A;  3ZYQ A;  3FH5 A;  2CHZ A;  4N39 A;  3TGO A;  2KCV A;  4Q69 A;  3QK0 A;  5G2N A;  3PNT B;  5BV1 A;  4A1S A;  3U3W A;  3JQ0 A;  3PRE A;  1Z3Y A;  5ENN A;  2R59 A;  5ANL A;  5FT9 A;  2KAT A;  4FU3 A;  4N5C A;  2NSZ A;  1MHQ A;  1WY6 A;  1PY1 A;  3PUJ A;  5G55 A;  1W3B A;  4LER A;  2WXR A;  4ANU A;  4F7A A;  5LX8 A;  2L9B A;  5JJT A;  2I9C A;  2WXG A;  4RVB A;  4XKC A;  4CT4 A;  1N52 A;  5FJY A;  3FTX A;  5KJM A;  2XCC A;  3FFL A;  3Q49 B;  3FUN A;  2XRY A;  3G2T A;  4I9E A;  3D9N A;  1UW4 B;  4PS8 A;  4AM9 A;  2V5F A;  4ATG A;  2M63 A;  3QAQ A;  2RD0 A;  1H2U A;  2I2O A;  3Q5M A;  4JC8 A;  2X38 A;  2JLB A;  2XHE A;  3S7B A;  5KCM A;  3MYV A;  3I3N A;  2WXO A;  3G2W A;  2VGX A;  3KD7 A;  3ONL A;  3PDN A;  3SGH A;  2VYI A;  2V0P A;  2VSX E;  3EIJ A;  5G05 C;  3R7Q A;  4ANV A;  3O48 A;  5BPP A;  1HZ4 A;  3ML9 A;  3PE3 A;  4J0U A;  4UI9 J;  4HOT A;  4K0R A;  3D9I A;  5FQ4 A;  3ZRH A;  4CGW A;  4ANX A;  4AVX A;  4KBQ A;  5E76 A;  3MKQ A;  4NAC A;  2XPZ A;  4KYO B;  4I6G A;  3QJZ A;  2J49 A;  1Z3X A;  4RG9 A;  4UQY A;  2CG3 A;  2R5S A;  3MV3 B;  4FJY A;  3ULQ A;  4GAA A;  3QKY A;  5FZR A;  3TXN A;  2LAH A;  1EYH A;  2C0L A;  2GRM A;  1FVF A;  3AU5 A;  3B7U X;  3FTY A;  3FY4 A;  4KZ0 A;  1WAO 1;  2FO7 A;  4WAF A;  5HI7 A;  3T8M A;  3RRN B;  2X6F A;  5G04 J;  2I1K A;  2GW1 A;  4UQZ A;  3AS4 A;  1JWG A;  3DBS A;  3LS8 A;  5FQ6 A;  2EQX A;  3TL5 A;  3HIZ A;  4JXT A;  1Z6T A;  2NC9 A;  1U3C A;  4LRZ A;  3RIB A;  3CHR A;  4GA1 A;  3CSF A;  4EEC A;  3UPV A;  2XGO A;  3FUI A;  4JEU A;  4R7L A;  3T5V A;  4KZC A;  4BY6 A;  3CQG B;  4GU5 A;  2Q7F A;  3PVL A;  1B89 A;  1EF1 C;  1H0A A;  4FC8 A;  1OWO A;  4CDN A;  4FA6 A;  1DNP A;  2ION A;  2L6J A;  5FWQ A;  3PUK A;  2UWJ G;  1OWP A;  3FUD A;  3KAE A;  4L2Y A;  4LCT A;  4UI9 K;  4NRH B;  3CEQ A;  4U0S A;  2JEK A;  3I5P A;  5AJD A;  5EDS A;  2I6H A;  1HE8 A;  5D0O D;  3LXU X;  3CK8 A;  4URK A;  3LKU A;  3ASG A;  3CVY A;  4GML A;  3L17 A;  3VLF A;  4F3V A;  3AU4 A;  4U0U A;  4EPZ A;  2WXP A;  3LY8 A;  2DIW A;  2UY1 A;  3EJN A;  4BSX A;  4FHJ A;  5FTP A;  5T3R A;  3UT8 A;  4JA9 A;  4YVO A;  3HYM B;  5LFA A;  1E7V A;  4HXI A;  1Y6I A;  3BEE A;  1NP7 A;  4JHR A;  3FHE A;  4NQ0 A;  4YND A;  1SQM A;  1FCH A;  3CHO A;  3ZYL A;  3U9W A;  4TUU A;  4ANW A;  1FVH A;  3APD A;  3DPD A;  2KZT A;  4V3I A;  2VSY A;  4N3A A;  4AJW A;  3CVW A;  1HG5 A;  3G2V A;  5CCM A;  5KJL A;  3EDT B;  4M3O A;  2AVP A;  3UT7 A;  3ML8 A;  3OXF A;  4WWN A;  3IEG A;  4KT6 B;  4CGV A;  4CCA A;  3QWW A;  2Y4U A;  1L5J A;  1MQS A;  3APF A;  4FUL A;  3D9L A;  3S7J A;  3ASD A;  2FI7 A;  2C2L A;  2V4L A;  3VTY A;  4HVB A;  5LCW C;  1N54 A;  3LYA A;  3ESL A;  4KVM A;  3UX4 A;  4JA7 A;  2XPI A;  1ELK A;  1HG2 A;  4A3V A;  4G26 A;  3FTW A;  1IYG A;  4ILI A;  3EIQ C;  2R17 C;  3FDH A;  4GYW A;  1NA3 A;  3FUM A;  4EZJ A;  2PM7 A;  2WXK A;  3FUF A;  1PC2 A;  2KCK A;  3KS2 A;  4Q96 A;  4B89 A;  5CMY A;  2PM6 A;  2LSV A;  3CVQ A;  1XGW A;  3CLJ A;  3IV0 A;  4ACK A;  4RSY A;  3ESK A;  5ANR A;  4ABN A;  3IHV A;  3FUJ A;  3AS8 A;  3HDX A;  3MCX A;  1NZN A;  4W9R A;  3TJP A;  4PDX A;  3RRM B;  2WPV A;  2UY1 B;  3SHF A;  4AV7 A;  3RO2 A;  3R7R A;  4XX5 A;  2AXU A;  2CHW A;  3PH0 C;  4O6F A;  3D3M A;  2OVF A;  4DI3 A;  4PS7 A;  4WNF A;  3D9M A;  2E0I A;  3JQ1 A;  2WMN A;  2WXL A;  4A3T A;  3FTU A;  2HYZ A;  5BV0 A;  3ASF A;  3MA5 A;  1E8Z A;  2KZT B;  1ELR A;  4LEU A;  4YVQ C;  4DLQ A;  3C98 A;  5C1D A;  1OWN A;  2WXH A;  3PZD A;  3CHS A;  4UWH A;  4G23 A;  4HS2 A;  4GZC A;  4D10 C;  4J6I A;  2WVI A;  2XPY A;  2GRL A;  2WQH A;  1UJK A;  5ARG A;  4WWP A;  4C0E A;  3GW4 A;  3LDZ A;  4KVO A;  3FU0 A;  5FZS A;  3CHM A;  1TJF A;  4UWL A;  3QWV A;  3Q4A B;  3QWP A;  1QQE A;  4DI4 A;  3P2B A;  4J8F A;  2YQ8 A;  3FTZ A;  3EHN A;  4MLP A;  3B7R L;  4JZY A;  1PAQ A;  4J8D A;  4CT0 A;  3ZHE A;  4GZ5 A;  4OVV A;  3PNL B;  1HH8 A;  3CK9 A;  3L22 A;  5CCL A;  3NZU A;  4PUC A;  3GZ2 A;  4OVU A;  1H19 A;  1KLX A;  3FEY A;  3QAR A;  2IOS A;  3Q15 A;  3CKC A;  3GZ1 A;  4N2Q A;  3RJV A;  2CHX A;  5JJ7 A;  2P58 C;  2VGY A;  4IN3 B;  3MGB A;  2IU1 A;  4AXH A;  5J08 A;  3SF4 A;  3HVE B;  4U04 A;  1WM5 A;  5BNW A;  4XI0 A;  4I1A A;  4XKB A;  5D0Q D;  1JPL A;  3LEW A;  4C0M A;  2AXZ A;  4E6H A;  4I2Z A;  3LVR E;  3UUX A;  3MJW A;  4FAD A;  5KJN A;  3FUH A;  1HFA A;  4TRQ A;  1E96 B;  4G11 A;  3O4Z A;  3MKR A;  3URZ A;  1BPO A;  1TJC A;  1TEZ A;  2L0I A;  1H2V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...