2KZTB

Structure of the tandem ma-3 region of pdcd4
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed cell death protein 4
publication title Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 37
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kztB00
4B8CB 3JUIA 1N54A 1HU3A 4JHKA 2KZTA 2RG8A 2ZU6B 2I2OA 3L6AA 4B89A 4C9BB 2NSZA 3FEXA 1N52A 3EIJA 2HM8A 1H2TC 2KZTB 2GGFA 1H2VC 1PAQA 3FEYA 4GMJA 1H2UA 4GMLA 4B8AA 2FULA 5ANRA 3RK6A 2VSOE 2IOLA 3D3MA 2IOSA 4LUNU 4CEMA 4CT4A 1UG3A 4CRWA 1H6KA 4IULA 2IU1A 2IONA 4JHJA 2VSXE 1UW4B 3EIQC
chains in the Genus database with same CATH superfamily
4C48B 2XHEA 2R5SA 4C0MA 5KJKA 4FU3A 3W9FA 1H2TC 4QQIA 4J6IA 5B1BE 3EU5A 1PC2A 4BERA 2Y3AA 2X3MA 4YDOA 5M72A 4N2SA 2IFUA 3ZFWA 3EIQC 4KVOA 4BWRA 3IEGA 1DVPA 1IKND 1K1AA 3B7UX 3Q7AA 5ENTD 1TNOA 3CK9A 4DJAA 4I9EA 1BD8A 3CEQA 3CIAA 2MYOA 3S7FA 3TJPA 1BI8B 4IN3B 5AQ7A 2Y1LE 3JYSA 4J7WA 4FA6A 5KCMA 2QYUA 2WXLA 3Q79A 3CHOA 1OCZE 4I6GA 4PUCA 4P29A 3RRMB 4AP2A 4UI9C 1K3ZD 4LCTA 1WAO1 4B89A 2V0PA 3O4ZA 1MHQA 1SA5A 3L13A 1OY3D 2VGXA 3L82A 2L9BA 4URKA 3ENEA 2ZXWE 3C3RA 3WG7E 4XI0A 3SBSA 1Z6TA 1O5MA 4WNEA 4K0RA 3FUJA 3HRAA 4TUMA 4FLBA 3PZ4A 2FO1E 1N11A 2AVPA 3TWSA 3ZRHA 5G05C 2AXZA 3FWVA 5G04J 4MKTA 4HLEA 4E6HA 4NIKA 2KC7A 1YMPA 4AM9A 2R2LA 3ZYKA 4J8SA 3G2VA 4AEZC 3VTXA 4GAAA 3FTWA 3C3QA 4GCOA 3EHNA 4F7AA 3J5QB 2X6KA 3UT7A 2GRRB 4DK5A 2F8XK 3CVUA 3ML8A 2XS1A 2R59A 4J8DA 1OCCE 3IKOB 3HXCA 1NP7A 2VTBA 3CLJA 3UT4A 2J08A 1O1RA 3NZSA 2WPVA 3ZUVB 1KLXA 3ZXPA 5LCWJ 5KWDA 4A1GA 4ANVA 3X2QE 4JC8A 3CHSA 5BV1A 2LNIA 3KAEA 3LXUX 4KT6B 3U64A 1A5EA 5EIDA 3CVYA 3I4GA 1ELWA 3PUKA 1O1TA 4KVMA 3MKQB 2WMOA 5A7DB 1HS6A 4WWOA 3LY9A 3LVQE 3UXGA 3S7BA 2BEDA 4CZ2D 1QNFA 3EHRA 3TXNA 1X81A 3V79K 1SZ9A 2RKKA 2KXPC 3QJZA 3TWUA 2FO7A 4U0SA 4I1OB 2WQHA 4J8YA 4GTTA 2WXOA 2IQCA 3URZA 3D9HA 3D9IA 1X5BA 3AG2E 3BU8A 4A3VA 2X38A 2ZGDA 3GZSA 1GW6A 3FUHA 3HYMB 5JJ7A 3Q73A 1TNBA 4BT8A 3QARA 2C2LA 4Q96A 3Q47B 2BKGA 3S7JA 1BI7B 3P1UA 4GMJA 4ANXA 4LRZA 4FJZA 3LJNA 5EDSA 2J8SD 3UM3A 4TUUA 4X8QA 3N71A 4R7LA 4YNDA 4DI3A 4N3AA 3FUEA 4Q94A 2V5FA 4UWHA 5FQ8A 5BNWA 2F8YA 2PM7A 1KZPA 2R05A 3PH0C 1WY6A 1EF1C 1PY1A 4Y6WA 3APFA 3G2UA 3HXEA 2H6GA 2R03A 1SA4A 4BEPA 1MQSA 1SQMA 2CG3A 3ULYA 1G3NB 2P9NG 2CHXA 5BPPA 3AG4E 4F6RD 4L2LA 3RRUA 2ETBA 2J49A 1IHBA 4H7XA 1IHGA 3Q78A 1EYHA 1H6PA 5AAOA 2F37A 4ATZD 2IEJA 3FUDA 5EX0A 1UG3A 4MBGA 1MJ0A 3KEZA 3GZ1A 4XI9A 1Z5SC 4O60A 1DC2A 3EHMA 1RW2A 3IXEA 3SI5A 3CHMA 4DX5D 2KZTB 3NOGD 3TGOA 4N2QA 3T5XA 3NOCD 1HZ4A 3DSWA 5LOZA 4LNUD 3P2BA 4JZYA 4HS2A 2VGEA 5EIBE 3DBSA 4DX2A 4E85A 3HXFA 3DRAA 2V5QC 5ENNA 3CQCB 4B94A 4RLYA 2P9UG 3C5RA 3APCA 1Q2ZA 2IF4A 3OXGA 1JWFA 4M3OA 5FQ6A 4UI9J 3RSEG 3S7DA 2JLBA 1BLXB 3G2WA 3ASOE 2CG2A 2A5UA 1SW6A 2IJGX 3FTZA 5FTPA 4I6EA 3FDHA 3JCKC 2XENA 2IOSA 4EBAG 2QY7A 2OV8A 3FTSA 2LAIA 3MZLB 3D9KA 4GU5A 1Y8MA 3SF4A 2H6FA 4LG6A 1NFIE 2BTDA 5JJTA 2PQNA 3D9MA 4JVSA 2ZISA 3PZDA 4MLPA 3V31A 5CCLA 3PE4A 1MX4A 4GZCA 1WM5A 5G05J 4CDNA 1YYHA 4HORA 3L08A 1D9SA 1FCHA 4XZ4A 1TNZA 4GZDA 1ZBPA 4EQFA 4K5BA 5FT9A 4DX1A 3FUMA 3FTXA 4HLLA 3MKQA 3FU0A 3OXFA 2J4BA 1S0PA 3UI2A 5CBOA 5CRVA 2WQ6A 4FLHA 3QAQA 2XGOA 4PH4B 4WNFA 4V3IA 5ANRA 3QKYA 3OTNA 4DX6D 3DWLG 1UJJA 3SY2A 3E33A 4N39A 5BXOA 2KCLA 1H19A 1HFAA 1QYMA 4U07A 2DZNA 3QOUA 4BSZB 2I6HA 3W9GA 2KCKA 2P2CP 4HRMB 5CMYA 2C0MA 3VLFA 2OVBA 3UTMA 4GZ5A 4KXKB 3HHMA 4LUNU 4MS6A 1SZAA 3SFZA 5AQBA 5BUZA 1TN6A 2LAHA 2LUHA 2WXGA 3AS5A 3ESKA 1S70B 2WXHA 3QNKA 1D8DA 3FP3A 5EILA 3UKUG 5AIJA 3SQVA 3CQGB 4XX5A 4APFA 4YDEA 3CKCA 1ELRA 4KZCA 3AU5A 1OWLA 3ASFA 4AJWA 5ENQD 1E7VA 1KZOA 1JCRA 4BX8A 4BY6A 1N4QA 2ETCA 4YDYA 2OEWA 3VTYA 3I4RB 4BSXA 1PAQA 3FH5A 5KBAA 2X6IA 3K9IA 2E2EA 3LJ3A 2MRIA 1HH8A 4GTQA 3FTUA 1N4RA 3BQOA 1N0RA 2NC9A 5CEDB 1JPLA 2VSOE 2XEEA 2BKKB 4PDXA 4L9PA 1IXVA 2CFZA 3PZ3A 2DWZA 5AQAA 5FINA 4GMLA 3V2XA 4ANWA 3APDA 1H6OA 4LEUA 5ENPD 4GPMA 2KZTA 2RG8A 3UIOC 2WXMA 3TG4A 1E96B 2WXNA 3LKUA 4UQZA 4GA1A 2XQ0A 4I1MA 4BESA 3BG1B 3PZ2A 5KJLA 2B0OE 2IU1A 1E90A 2AJAA 4GTVA 3EUVA 4YVOA 4I17A 1HO8A 2VJ8A 3ASHA 4BFRA 4CDMA 2XPIA 3TWRA 1N4SA 3CV0A 4J8FA 2AXVA 1H2VC 2Q7FA 4W9RA 3HVEB 4OVUA 3FUFA 5AYWD 4FHKA 2YHEA 1INZA 3UKRG 4UWKA 3FH7A 4GYWA 5ARGA 3E30A 2Y4UA 3ULEG 3QDNA 3L17A 5JHAA 3T8MA 3QC1A 3ZYLA 3AS4A 3HXDA 3E4BA 3ULQA 3TWWA 2WXIA 3OXLA 5ENOD 1AP7A 2PL2A 3KD7A 2V4LA 1JUQA 5CBNA 4N3CA 1E8YA 3IHYA 3T5VA 2P9LG 3IV0A 3ZVVA 2HR2A 4Y6CA 3PDNA 3O48A 3JUEA 4O6FA 3Q4AB 2DVWA 1FT2A 1TN7A 3SO8A 3SFXA 3EHQA 1V54E 2XGSA 1LTXA 4HXIA 2XPYA 4G8LA 4ME2A 3ZW3A 3CVQA 5A6CA 2L6BA 1TN8A 3SGHA 1OCOE 3U9WA 1NI1A 2UWJG 2L0TB 3NB2A 4EHMA 5FZQA 2GW1A 4G26A 4AXHA 4N5QA 3FU6A 3LDZA 1N0QA 2WM9A 4CCAA 1ELKA 3TAXA 4HI8A 3MGBA 2VYIA 3TWQA 3DXKG 3QWPA 2DZOA 4L1BA 3SNXA 3MKRA 3HDXA 4DX7D 5HS0A 5T4YA 1N94A 4TXRA 2QFCA 4XE0A 3ABME 3NF1A 3NBNB 3RIBA 2FBNA 2OEVA 5FJYA 3RK6A 3D3MA 3PNLB 1MYOA 4HOQA 1Z3XA 3CVVA 4Q69A 3FTVA 4YDWA 2EIKE 3OAWA 3Q9NC 2DBAA 3SHFA 3MV2B 1NA0A 4JL0A 4B8AA 3AG1E 1HF8A 2GRPB 4JPSA 4U8HA 4CGVA 4KMOA 4WWPA 4PS8A 3L16A 3LVRE 3ZXSA 2UY1B 2WXKA 1E8ZA 5CCMA 2PQRA 3D9OA 1UOHA 1TJCA 4L23A 4I2ZA 3MX3A 2QYJA 4AOFA 4IULA 4A55A 4GMRA 3LYAA 2WXFA 5ENRD 5C1DA 1N9AA 4IRUA 5FZSA 3VLDA 2YQ8A 3DSXA 4FULA 3LY8A 1H2UA 2GRLA 1XGWA 4U8YD 1WDYA 1UN9A 4HBDA 4JHJA 4D10C 4EBAA 4U96D 1LD8A 3RO3A 3SFYA 1WG0A 4FJYA 2J09A 3BUAA 3C3OA 5EYPF 5JMND 4U0ZA 5BT1A 2X6JA 3PUJA 2CHZA 3CSTA 2MOWA 3QWVA 5CRUA 1UJKA 3GZ2A 3ZYMA 1OWNA 2FF4A 2VGYA 1MX2A 2WXPA 4ZFHA 2IONA 1V55E 4K5CA 4J8EA 4NACA 2XCBA 4L2YA 2JEKA 2XEVA 4UI9K 3AS8A 4RSYA 4NQ0A 3EU9A 3DSUA 3SD5A 5ANLA 1P5QA 5LFAA 3B7SA 5LCWC 3HVEA 2VSYA 2X6FA 2NYJA 4I9CA 5FQ7A 3UT8A 2NXPA 2Y4TA 3EJNA 4UUCA 4UWFA 2GRMA 4BT9A 3CVXA 4B8CB 3HG0D 3V2OA 4HOUA 4KBQA 4ILIA 1QBQA 1LF8A 5DIZA 1HG2A 1ZB1A 3PNTB 3L54A 4G25A 5LX8A 4F1SA 1DCQA 2P58C 2V8SE 3ONLA 3CKBA 4OVVA 3PVLA 2LSUA 2A4ZA 3L6AA 3D9NA 4BX9A 3JXJA 2WB2A 5BXUA 4GTSA 5AJDA 4GZ3A 4GYYA 5FIOA 5EN5D 4TRQA 1JCSA 2AWIA 3KSQA 1KPSB 3FUKA 4JB8P 3B13A 1UN8A 5T3RA 2KCVA 5KJMA 1OCRE 2AXUA 1VDYA 3C72A 5E76A 4I1AA 1H6KA 3HXBA 4PS7A 3FH8A 4UWLA 3DSSA 3SZ7A 1IQRA 2XGMA 1JCQA 2WVIA 4CT0A 3B7RL 1L5JA 3KS2A 1E8XA 2CHWA 1TEZA 2H6HA 5G2NA 4CDRA 4TV3A 1ZU2A 3PE3A 2XRZA 3R9AB 2B6CA 3ABLE 2VQ2A 4KZ0A 2C0LA 3ZU7B 3JUIA 5G55A 3EDTB 4DLOA 1NL4A 5B3SE 2QZAA 2NSZA 3GW4A 3Q5MA 1IYGA 4G23A 5AARA 1NA3A 2OOEA 3UPVA 4G11A 1HXIA 1QZ2A 4ZHBA 4F3VA 4FC8A 5EYLA 3VLEA 4B93B 2MHKA 1AWCB 4Z68A 3UM0A 2OVFA 4UQYA 1YCSB 4JEHA 2P9KG 4LNGA 2HYZA 3I3NA 3MV3B 3FHEA 2RD0A 4GZ6A 3R7RA 2KATA 3CVNA 2DCPA 4FADA 3ASGA 3L9TA 3MCXA 4F1PA 2UY1A 2EIME 1OWMA 3ASNE 3CR3A 1W3BA 3DPYA 3FTYA 1S63A 4KYOB 1N95A 2R17C 4HOTA 4G24A 5HRYA 1U3CA 4RQIA 2XZTG 5E75A 1OWOA 3DPDA 1OUVA 4N5CA 4G2VA 2BF0X 3F6QA 1HE8A 2KM4A 3UM2A 2L6JA 2IY0C 3T8KA 2HE0A 2H6IA 1OXJA 4JXTA 3JQ0A 2FI7A 4GYOA 2QC9A 1HX8A 2JABA 4YVQC 4OYSA 3E34A 4EECA 3CVLA 4BTBA 1TNUA 3CHQA 5IY5E 4NURA 2ZGGA 4NRHB 3R9MA 2CFUA 4WUYA 3PREA 3AAAC 3CVPA 4PS3A 3CHPA 3FU3A 2WXJA 2P9SG 2LSVA 4HRLA 4ILHB 3ABKE 3ZEFA 2ONDA 2HO1A 4ILGA 3JQ1A 4JD2G 3KSLA 2XPZA 4TXQA 4U04A 3TL5A 3TWXA 3FFLA 1FVHA 1K1BA 1OWPA 3UUXA 3QK0A 4CGWA 4JHKA 1YA0A 1TYQG 4ACLA 4I43A 2EILE 2WXQA 2YINA 1DNPA 2V4HC 5BV0A 2F0YA 2XEHA 1KT0A 5LP0A 3B95A 3LS8A 2IOLA 5DBKA 3MA5A 4CRWA 3FY4A 4DLQA 3ESLA 2I2OA 4WWNA 2XZDG 3FEXA 4GTPA 3RU0A 4O1OA 1O1SA 1B89A 3U4TA 4CT4A 2LXMA 4A63B 4GA0A 3CK7A 3IHVA 3ZHEB 4HQDA 3Q15A 2ZU6B 4JA9A 1K8KG 3L22A 3B7TA 4U95D 5H7PA 3DSVA 3E37A 3MYVA 4EZKA 2RFAA 4EPZA 2GRQB 3DXMG 3ZN3A 2XRYA 2VSXE 2LO6A 3BG0B 4AY5A 2WMNA 2A5EA 4DPRA 3AU4A 4J0UA 3FEYA 4O1PA 4U0UA 5D0OD 2OCCE 3PZ1A 3V30A 4HFGA 3G2SA 4LSZE 5EX3A 4JA7A 3UIPC 3Q7FA 3Q49B 3AJIA 5KNHD 3B7BA 2RFMA 3NAWA 4DI4A 4GCNA 1Y6IA 4OAUC 5CMWA 3I5PA 3J5PA 2LXLA 4XEIG 2Y69E 3ASDA 2IO3C 2BUGA 4IYPA 3ISMC 2ETAA 4B0ZA 4N3BA 2FULA 3D9PA 2I1KA 3QB2A 3PS6A 4MRUA 4EZJA 1IQUA 5JJ6A 3FUNA 4GTRA 2IO2C 4XIFA 5CEAA 3RO2A 3PEVB 2I1JA 4ABNA 2ILRA 3IBEA 4M7CA 3TWTA 1HG5A 2DYSE 4HNAD 5D0QD 3UINC 3LEWA 4AVXA 4JEUA 2VSNA 4LERA 4F53A 2M63A 5BW8C 4APOA 1OT8A 3UX4A 4WAFA 4DUIA 4K03A 1U3DA 5FWQA 5HQ8A 2EIJE 4G8KA 1NZNA 1RZ4A 2GROB 2KBXA 2AW6A 1KT1A 4GPKA 3DEOA 1SVXA 3PRZA 4GB9A 5KJNA 5J08A 5AENA 2P9PG 3T9KA 4L7TA 5FQ4A 5G04C 4C9BB 1TJFA 2PNNA 1A17A 3LPZA 4AY6A 3RAUA 3RKVA 4HB5A 3D9JA 3ZYQA 2VGXB 3LY7A 5A23A 4TXPA 2R02A 1HU3A 3TG5A 1N52A 3PEUB 3BEEA 2DYRE 2DIWA 4CYMD 1TR4A 4AV7A 2FEZA 3U66A 2Y0BG 2P9IG 4I2WA 1XNFA 2WXRA 4UQXA 5AJLA 5ITZF 4C0EA 4HOSA 1S64A 4ANUA 4HVBA 1BU9A 5C2YA 1JWGA 4HRNA 1E8WA 1MX6A 3E32A 3FUIA 4CEMA 4FP7A 1N4PA 1TNYA 1U2VG 4XKCA 1UW4B 4AIFA 4OAVB 5JHBA 3ZGQA 2L0IA 4JW1A 3KEAA 4G1TA 5D66A 2YNQA 3UQ3A 5HKPA 5HI7A 2ZIRA 5AN8A 1FT1A 5ARFA 4BETA 2VTBB 4BTAA 4UWGA 2WQ7A 4GTMA 4I6JA 3RJVA 5CECB 5CERB 1FVFA 3QWWA 3TXMA 3MEKA 4XKBA 2I9CA 3S2AA 1EDUA 3ZNGA 4RG9A 1Z3YA 4GTOA 3ZHEA 2XCCA 2J9QA 3UM1A 5AQ9A 2E0IA 3TWVA 3RRNB 3DEPA 4A1SA 5JA4D 3ONKA 1MZCA 5T8IA 4RVBA 4U8VD 1QQEA 3CSFA 5B1AE 3EIJA 3CK8A 1BPOA 4FHJA 1H0AA 5EKQD 3ZKJA 3AG3E 4QFVA 4WNDA 5KNGA 4A3TA 1N54A 2X6HA 3Q75A 2J4DA 1DCEA 2GGFA 2PM6A 5FZRA 3U3WA 3GYZA 5ENSD 3ZIMA 1E7UA 3CGHA 3JXIA 4U63A 4RG6A 4GA2A 3C98A 4ATGA 3CVWA 3Q9UC 4H7YA 1EPUA 3WXXA 4LNBA 2HM8A 2XS8A 4K5AB 3DSTA 4WNGA 1D8EA 3ML9A 4EZLA 3FU5A 4DRXE 3NZUA 2J07A 3NQPA 3MJWA 2GRNB 3SBTB 5CHEE 4ACKA 4U7EB 2EQXA 3D9LA 3FULA 5J90A 1LD7A 3ZPJA 2EINE 3LCAA 3G2TA 3HIZA 5D2MC 2PZIA 3CHRA 4HI9A 2YHCA 3UMVA 1FPPA 3R7QA 4JHRA
chains in the Genus database with same CATH topology
1Y8MA 3ESLA 2XHEA 3SF4A 3L16A 2I2OA 2R5SA 3LVRE 4C0MA 4WWNA 5KJKA 3FEXA 2BTDA 3RU0A 5JJTA 2PQNA 4FU3A 3ZXSA 1H2TC 2UY1B 2WXKA 1E8ZA 3D9MA 5CCMA 2PQRA 3D9OA 4JVSA 4J6IA 3PZDA 4MLPA 1TJCA 1B89A 5CCLA 1PC2A 3PE4A 4L23A 4I2ZA 3MX3A 4GZCA 1WM5A 3U4TA 5G05J 4CDNA 4CT4A 2Y3AA 2X3MA 5M72A 4HORA 4GA0A 4AOFA 3CK7A 4N2SA 4IULA 3L08A 4A55A 3IHVA 2IFUA 3ZFWA 1FCHA 3ZHEB 3LYAA 2WXFA 3EIQC 4XZ4A 3Q15A 4KVOA 4BWRA 2ZU6B 5C1DA 3IEGA 4GZDA 1DVPA 1ZBPA 4IRUA 3B7UX 5FZSA 3VLDA 4EQFA 2YQ8A 3CK9A 4DJAA 4I9EA 4JA9A 3CEQA 5FT9A 3CIAA 3S7FA 4FULA 3TJPA 3L22A 3B7TA 3FUMA 3LY8A 4IN3B 1H2UA 3MYVA 2GRLA 1XGWA 3FTXA 3JYSA 4EZKA 4FA6A 4EPZA 5KCMA 2WXLA 3MKQA 3ZN3A 3CHOA 2XRYA 4I6GA 1UN9A 3FU0A 2VSXE 4PUCA 2LO6A 3BG0B 3OXFA 4JHJA 4P29A 3RRMB 4AP2A 4AY5A 4D10C 4EBAA 4UI9C 2J4BA 4LCTA 3RO3A 1S0PA 2WMNA 1WAO1 4FJYA 2J09A 4B89A 4DPRA 2V0PA 2WQ6A 4FLHA 3AU4A 3O4ZA 4U0ZA 5BT1A 1MHQA 3L13A 3QAQA 2X6JA 3PUJA 2VGXA 2XGOA 4J0UA 2CHZA 3CSTA 3FEYA 4PH4B 4WNFA 2L9BA 2MOWA 3QWVA 4URKA 3ENEA 4V3IA 5ANRA 3QKYA 1UJKA 3GZ2A 3OTNA 4U0UA 4XI0A 3SBSA 3ZYMA 1OWNA 2FF4A 1UJJA 2VGYA 5D0OD 2WXPA 1Z6TA 2IONA 4N39A 2KCLA 4HFGA 4J8EA 3G2SA 1H19A 1HFAA 2XCBA 4NACA 4WNEA 4L2YA 4JA7A 5EX3A 4K0RA 4U07A 3FUJA 2JEKA 2XEVA 3Q49B 3QOUA 2I6HA 4UI9K 4FLBA 2KCKA 3AS8A 5CMYA 4RSYA 2C0MA 4NQ0A 3VLFA 2OVBA 4DI4A 4GZ5A 4KXKB 4GCNA 3HHMA 4LUNU 4MS6A 1Y6IA 1SZAA 3SFZA 5BUZA 5CMWA 2AVPA 3I5PA 2LAHA 3ZRHA 2WXGA 3AS5A 3ESKA 2AXZA 5G05C 3SD5A 2WXHA 3FWVA 3QNKA 3ASDA 5ANLA 5G04J 4MKTA 4HLEA 4E6HA 1P5QA 2BUGA 4IYPA 2KC7A 3B7SA 5LFAA 3FP3A 4AM9A 5LCWC 3HVEA 5AIJA 3ZYKA 2VSYA 3CQGB 2X6FA 4B0ZA 4XX5A 4J8SA 4APFA 3G2VA 4I9CA 4N3BA 3CKCA 5FQ7A 4AEZC 1ELRA 2FULA 3VTXA 4KZCA 3AU5A 4GAAA 3FTWA 3D9PA 4GCOA 1OWLA 3ASFA 3UT8A 2I1KA 3QB2A 3EHNA 4F7AA 3PS6A 4AJWA 4MRUA 2NXPA 4EZJA 2Y4TA 1IQUA 2X6KA 5JJ6A 3EJNA 3FUNA 4UWFA 2GRMA 4BT9A 1E7VA 4XIFA 3CVXA 4B8CB 3RO2A 4BX8A 3PEVB 4BY6A 2I1JA 3UT7A 4DK5A 4ABNA 2ILRA 3IBEA 3CVUA 3ML8A 4HOUA 2R59A 4J8DA 1HG5A 3VTYA 4KBQA 3I4RB 4ILIA 4BSXA 1PAQA 3FH5A 5D0QD 3IKOB 2X6IA 3K9IA 3LEWA 1LF8A 1NP7A 5DIZA 4JEUA 4AVXA 3CLJA 2E2EA 2VTBA 2VSNA 1HG2A 4LERA 4F53A 3LJ3A 3UT4A 3PNTB 2J08A 3L54A 2M63A 2WPVA 3NZSA 1KLXA 4G25A 5BW8C 4APOA 5LX8A 4F1SA 2P58C 3UX4A 2MRIA 2V8SE 4WAFA 5LCWJ 3ONLA 3CKBA 4OVVA 4A1GA 4ANVA 4K03A 1U3DA 3PVLA 1HH8A 2LSUA 2A4ZA 3L6AA 5FWQA 5HQ8A 3FTUA 4JC8A 2NC9A 1JPLA 1NZNA 3D9NA 4BX9A 2WB2A 3CHSA 5BV1A 2AW6A 1KT1A 2LNIA 3KAEA 3LXUX 5AJDA 4GPKA 4KT6B 4GZ3A 4GYYA 3PRZA 2VSOE 3U64A 4GB9A 4TRQA 5KJNA 5J08A 3CVYA 3I4GA 2AWIA 1ELWA 4PDXA 3PUKA 4KVMA 5AENA 2CFZA 4L7TA 3MKQB 3FUKA 5FQ4A 3B13A 5G04C 4C9BB 1UN8A 5T3RA 1TJFA 2WMOA 5A7DB 1HS6A 4WWOA 3LY9A 1A17A 2KCVA 3LPZA 3LVQE 5KJMA 2AXUA 1VDYA 4AY6A 3S7BA 4GMLA 3RKVA 3D9JA 5E76A 4ANWA 3APDA 3ZYQA 2VGXB 4I1AA 1QNFA 4LEUA 1H6KA 3LY7A 5A23A 4PS7A 3FH8A 4UWLA 3TXNA 3SZ7A 1IQRA 1HU3A 1SZ9A 2KZTA 2RG8A 2XGMA 3QJZA 3TG5A 2WVIA 2WXMA 2FO7A 4U0SA 3B7RL 4CT0A 3TG4A 1L5JA 3KS2A 4I1OB 1E96B 1N52A 1E8XA 3PEUB 2WXNA 2WQHA 2CHWA 3BEEA 2WXOA 2IQCA 3URZA 2DIWA 3LKUA 1TEZA 5G2NA 4UQZA 4CDRA 4GA1A 4TV3A 4AV7A 1ZU2A 2FEZA 3U66A 3D9IA 1X5BA 2XQ0A 4A3VA 4I1MA 3PE3A 2X38A 2XRZA 3BG1B 4I2WA 3GZSA 3R9AB 1GW6A 5KJLA 2IU1A 1XNFA 1E90A 2VQ2A 2WXRA 3FUHA 3HYMB 2C0LA 4KZ0A 4UQXA 3JUIA 5JJ7A 5G55A 3EDTB 5AJLA 4YVOA 4I17A 4C0EA 1HO8A 2VJ8A 4BT8A 3QARA 4DLOA 3ASHA 4BFRA 2C2LA 4HOSA 4CDMA 2NSZA 2XPIA 3Q47B 4Q96A 4ANUA 3GW4A 3Q5MA 3S7JA 1IYGA 4G23A 4HVBA 3CV0A 4J8FA 2AXVA 1NA3A 1H2VC 2OOEA 2Q7FA 4W9RA 4G11A 3P1UA 3HVEB 5C2YA 4GMJA 1JWGA 4OVUA 3UPVA 3FUFA 1E8WA 1HXIA 5AYWD 4ANXA 4FHKA 4LRZA 3FUIA 4FJZA 4CEMA 4FP7A 5EDSA 1QZ2A 2YHEA 4F3VA 4FC8A 1INZA 4TUUA 3VLEA 4UWKA 3FH7A 4XKCA 1UW4B 4GYWA 5ARGA 2MHKA 4AIFA 5JHBA 2Y4UA 3QDNA 3N71A 2OVFA 3L17A 4R7LA 4UQYA 4YNDA 4DI3A 4N3AA 3FUEA 4Q94A 5JHAA 4JEHA 2L0IA 4JW1A 3ZGQA 4G1TA 3T8MA 3QC1A 2YNQA 3UQ3A 3ZYLA 2V5FA 3AS4A 4UWHA 5FQ8A 2HYZA 3I3NA 3MV3B 3FHEA 5BNWA 3E4BA 2RD0A 3ULQA 2PM7A 4GZ6A 5HI7A 3R7RA 2KATA 3CVNA 2DCPA 5ARFA 4FADA 2WXIA 3PH0C 4BTAA 2VTBB 3ASGA 1WY6A 3OXLA 3MCXA 4UWGA 1EF1C 2PL2A 3KD7A 2WQ7A 2UY1A 2V4LA 1JUQA 1OWMA 1PY1A 4N3CA 4Y6WA 4I6JA 3CR3A 3RJVA 3APFA 1W3BA 3G2UA 1FVFA 1E8YA 3QWWA 3TXMA 3FTYA 3IHYA 3MEKA 3T5VA 4XKBA 3IV0A 2I9CA 3S2AA 3ZVVA 2HR2A 1EDUA 4Y6CA 4KYOB 4RG9A 1Z3YA 3PDNA 2R17C 4HOTA 1MQSA 1SQMA 4G24A 2CG3A 3O48A 3ZHEA 2XCCA 2J9QA 2CHXA 4O6FA 1U3CA 3Q4AB 5BPPA 5E75A 1OWOA 3DPDA 1OUVA 2E0IA 4L2LA 3RRNB 4A1SA 4N5CA 4G2VA 2BF0X 3ONKA 5T8IA 4RVBA 2XGSA 3RRUA 1HE8A 2J49A 2KM4A 3MZLB 1QQEA 3CSFA 2L6JA 4HXIA 4H7XA 1IHGA 3EIJA 2XPYA 4ME2A 3ZW3A 3CK8A 3CVQA 5A6CA 1EYHA 1BPOA 4JXTA 4FHJA 3SGHA 1H0AA 5EKQD 4QFVA 3JQ0A 2FI7A 4GYOA 3U9WA 4WNDA 3FUDA 5EX0A 1UG3A 4A3TA 1HX8A 3KEZA 3GZ1A 4YVQC 4OYSA 2UWJG 4XI9A 2L0TB 4EECA 1N54A 2X6HA 5FZQA 2GW1A 3CVLA 2J4DA 4G26A 4AXHA 3EHMA 3FU6A 3SI5A 3LDZA 4BTBA 3CHMA 2WM9A 3CHQA 2KZTB 2GGFA 4CCAA 2PM6A 3TGOA 5FZRA 3U3WA 4NURA 4N2QA 4NRHB 1ELKA 3T5XA 1HZ4A 3GYZA 2CFUA 4WUYA 3TAXA 5LOZA 3PREA 3ZIMA 3CVPA 3P2BA 1E7UA 3CGHA 4PS3A 4JZYA 4U63A 3MGBA 2VYIA 4HS2A 4RG6A 3CHPA 4GA2A 3C98A 4ATGA 3FU3A 3DBSA 3CVWA 2WXJA 3QWPA 4H7YA 4E85A 1EPUA 2LSVA 4L1BA 3SNXA 3WXXA 3MKRA 5ENNA 3CQCB 4B94A 3HDXA 5T4YA 4ILHB 2HM8A 3ZEFA 2QFCA 2ONDA 2HO1A 4ILGA 4XE0A 3JQ1A 3NF1A 3RIBA 2FBNA 3APCA 5FJYA 4WNGA 2XPZA 3RK6A 3D3MA 3ML9A 2IF4A 4EZLA 3PNLB 4U04A 3FU5A 3NZUA 3OXGA 3TL5A 1JWFA 4M3OA 5FQ6A 4HOQA 4UI9J 1Z3XA 2J07A 3NQPA 3MJWA 3FFLA 1FVHA 1OWPA 3CVVA 3S7DA 2JLBA 3UUXA 4Q69A 3QK0A 4CGWA 3FTVA 5CHEE 3SBTB 3G2WA 1YA0A 4JHKA 4ACKA 3OAWA 2EQXA 4ACLA 2CG2A 2A5UA 3D9LA 4I43A 2WXQA 3FULA 5J90A 2YINA 2IJGX 3FTZA 3ZPJA 2DBAA 3SHFA 3MV2B 1NA0A 4JL0A 3LCAA 5FTPA 1DNPA 3G2TA 3HIZA 4I6EA 2PZIA 4B8AA 3FDHA 3JCKC 3CHRA 5BV0A 5LP0A 1KT0A 1HF8A 2YHCA 3LS8A 2IOLA 4JPSA 2IOSA 4U8HA 3UMVA 5DBKA 3MA5A 4EBAG 4CRWA 2QY7A 2OV8A 3FTSA 4CGVA 3R7QA 4JHRA 4KMOA 3FY4A 4WWPA 4DLQA 2LAIA 3D9KA 4GU5A 4PS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B8C B;  3JUI A;  1N54 A;  1HU3 A;  4JHK A;  2KZT A;  2RG8 A;  2ZU6 B;  2I2O A;  3L6A A;  4B89 A;  4C9B B;  2NSZ A;  3FEX A;  1N52 A;  3EIJ A;  2HM8 A;  1H2T C;  2KZT B;  2GGF A;  1H2V C;  1PAQ A;  3FEY A;  4GMJ A;  1H2U A;  4GML A;  4B8A A;  2FUL A;  5ANR A;  3RK6 A;  2VSO E;  2IOL A;  3D3M A;  2IOS A;  4LUN U;  4CEM A;  4CT4 A;  1UG3 A;  4CRW A;  1H6K A;  4IUL A;  2IU1 A;  2ION A;  4JHJ A;  2VSX E;  1UW4 B;  3EIQ C; 
#chains in the Genus database with same CATH topology
 4C48 B;  2XHE A;  2R5S A;  4C0M A;  5KJK A;  4FU3 A;  3W9F A;  1H2T C;  4QQI A;  4J6I A;  5B1B E;  3EU5 A;  1PC2 A;  4BER A;  2Y3A A;  2X3M A;  4YDO A;  5M72 A;  4N2S A;  2IFU A;  3ZFW A;  3EIQ C;  4KVO A;  4BWR A;  3IEG A;  1DVP A;  1IKN D;  1K1A A;  3B7U X;  3Q7A A;  5ENT D;  1TNO A;  3CK9 A;  4DJA A;  4I9E A;  1BD8 A;  3CEQ A;  3CIA A;  2MYO A;  3S7F A;  3TJP A;  1BI8 B;  4IN3 B;  5AQ7 A;  2Y1L E;  3JYS A;  4J7W A;  4FA6 A;  5KCM A;  2QYU A;  2WXL A;  3Q79 A;  3CHO A;  1OCZ E;  4I6G A;  4PUC A;  4P29 A;  3RRM B;  4AP2 A;  4UI9 C;  1K3Z D;  4LCT A;  1WAO 1;  4B89 A;  2V0P A;  3O4Z A;  1MHQ A;  1SA5 A;  3L13 A;  1OY3 D;  2VGX A;  3L82 A;  2L9B A;  4URK A;  3ENE A;  2ZXW E;  3C3R A;  3WG7 E;  4XI0 A;  3SBS A;  1Z6T A;  1O5M A;  4WNE A;  4K0R A;  3FUJ A;  3HRA A;  4TUM A;  4FLB A;  3PZ4 A;  2FO1 E;  1N11 A;  2AVP A;  3TWS A;  3ZRH A;  5G05 C;  2AXZ A;  3FWV A;  5G04 J;  4MKT A;  4HLE A;  4E6H A;  4NIK A;  2KC7 A;  1YMP A;  4AM9 A;  2R2L A;  3ZYK A;  4J8S A;  3G2V A;  4AEZ C;  3VTX A;  4GAA A;  3FTW A;  3C3Q A;  4GCO A;  3EHN A;  4F7A A;  3J5Q B;  2X6K A;  3UT7 A;  2GRR B;  4DK5 A;  2F8X K;  3CVU A;  3ML8 A;  2XS1 A;  2R59 A;  4J8D A;  1OCC E;  3IKO B;  3HXC A;  1NP7 A;  2VTB A;  3CLJ A;  3UT4 A;  2J08 A;  1O1R A;  3NZS A;  2WPV A;  3ZUV B;  1KLX A;  3ZXP A;  5LCW J;  5KWD A;  4A1G A;  4ANV A;  3X2Q E;  4JC8 A;  3CHS A;  5BV1 A;  2LNI A;  3KAE A;  3LXU X;  4KT6 B;  3U64 A;  1A5E A;  5EID A;  3CVY A;  3I4G A;  1ELW A;  3PUK A;  1O1T A;  4KVM A;  3MKQ B;  2WMO A;  5A7D B;  1HS6 A;  4WWO A;  3LY9 A;  3LVQ E;  3UXG A;  3S7B A;  2BED A;  4CZ2 D;  1QNF A;  3EHR A;  3TXN A;  1X81 A;  3V79 K;  1SZ9 A;  2RKK A;  2KXP C;  3QJZ A;  3TWU A;  2FO7 A;  4U0S A;  4I1O B;  2WQH A;  4J8Y A;  4GTT A;  2WXO A;  2IQC A;  3URZ A;  3D9H A;  3D9I A;  1X5B A;  3AG2 E;  3BU8 A;  4A3V A;  2X38 A;  2ZGD A;  3GZS A;  1GW6 A;  3FUH A;  3HYM B;  5JJ7 A;  3Q73 A;  1TNB A;  4BT8 A;  3QAR A;  2C2L A;  4Q96 A;  3Q47 B;  2BKG A;  3S7J A;  1BI7 B;  3P1U A;  4GMJ A;  4ANX A;  4LRZ A;  4FJZ A;  3LJN A;  5EDS A;  2J8S D;  3UM3 A;  4TUU A;  4X8Q A;  3N71 A;  4R7L A;  4YND A;  4DI3 A;  4N3A A;  3FUE A;  4Q94 A;  2V5F A;  4UWH A;  5FQ8 A;  5BNW A;  2F8Y A;  2PM7 A;  1KZP A;  2R05 A;  3PH0 C;  1WY6 A;  1EF1 C;  1PY1 A;  4Y6W A;  3APF A;  3G2U A;  3HXE A;  2H6G A;  2R03 A;  1SA4 A;  4BEP A;  1MQS A;  1SQM A;  2CG3 A;  3ULY A;  1G3N B;  2P9N G;  2CHX A;  5BPP A;  3AG4 E;  4F6R D;  4L2L A;  3RRU A;  2ETB A;  2J49 A;  1IHB A;  4H7X A;  1IHG A;  3Q78 A;  1EYH A;  1H6P A;  5AAO A;  2F37 A;  4ATZ D;  2IEJ A;  3FUD A;  5EX0 A;  1UG3 A;  4MBG A;  1MJ0 A;  3KEZ A;  3GZ1 A;  4XI9 A;  1Z5S C;  4O60 A;  1DC2 A;  3EHM A;  1RW2 A;  3IXE A;  3SI5 A;  3CHM A;  4DX5 D;  2KZT B;  3NOG D;  3TGO A;  4N2Q A;  3T5X A;  3NOC D;  1HZ4 A;  3DSW A;  5LOZ A;  4LNU D;  3P2B A;  4JZY A;  4HS2 A;  2VGE A;  5EIB E;  3DBS A;  4DX2 A;  4E85 A;  3HXF A;  3DRA A;  2V5Q C;  5ENN A;  3CQC B;  4B94 A;  4RLY A;  2P9U G;  3C5R A;  3APC A;  1Q2Z A;  2IF4 A;  3OXG A;  1JWF A;  4M3O A;  5FQ6 A;  4UI9 J;  3RSE G;  3S7D A;  2JLB A;  1BLX B;  3G2W A;  3ASO E;  2CG2 A;  2A5U A;  1SW6 A;  2IJG X;  3FTZ A;  5FTP A;  4I6E A;  3FDH A;  3JCK C;  2XEN A;  2IOS A;  4EBA G;  2QY7 A;  2OV8 A;  3FTS A;  2LAI A;  3MZL B;  3D9K A;  4GU5 A;  1Y8M A;  3SF4 A;  2H6F A;  4LG6 A;  1NFI E;  2BTD A;  5JJT A;  2PQN A;  3D9M A;  4JVS A;  2ZIS A;  3PZD A;  4MLP A;  3V31 A;  5CCL A;  3PE4 A;  1MX4 A;  4GZC A;  1WM5 A;  5G05 J;  4CDN A;  1YYH A;  4HOR A;  3L08 A;  1D9S A;  1FCH A;  4XZ4 A;  1TNZ A;  4GZD A;  1ZBP A;  4EQF A;  4K5B A;  5FT9 A;  4DX1 A;  3FUM A;  3FTX A;  4HLL A;  3MKQ A;  3FU0 A;  3OXF A;  2J4B A;  1S0P A;  3UI2 A;  5CBO A;  5CRV A;  2WQ6 A;  4FLH A;  3QAQ A;  2XGO A;  4PH4 B;  4WNF A;  4V3I A;  5ANR A;  3QKY A;  3OTN A;  4DX6 D;  3DWL G;  1UJJ A;  3SY2 A;  3E33 A;  4N39 A;  5BXO A;  2KCL A;  1H19 A;  1HFA A;  1QYM A;  4U07 A;  2DZN A;  3QOU A;  4BSZ B;  2I6H A;  3W9G A;  2KCK A;  2P2C P;  4HRM B;  5CMY A;  2C0M A;  3VLF A;  2OVB A;  3UTM A;  4GZ5 A;  4KXK B;  3HHM A;  4LUN U;  4MS6 A;  1SZA A;  3SFZ A;  5AQB A;  5BUZ A;  1TN6 A;  2LAH A;  2LUH A;  2WXG A;  3AS5 A;  3ESK A;  1S70 B;  2WXH A;  3QNK A;  1D8D A;  3FP3 A;  5EIL A;  3UKU G;  5AIJ A;  3SQV A;  3CQG B;  4XX5 A;  4APF A;  4YDE A;  3CKC A;  1ELR A;  4KZC A;  3AU5 A;  1OWL A;  3ASF A;  4AJW A;  5ENQ D;  1E7V A;  1KZO A;  1JCR A;  4BX8 A;  4BY6 A;  1N4Q A;  2ETC A;  4YDY A;  2OEW A;  3VTY A;  3I4R B;  4BSX A;  1PAQ A;  3FH5 A;  5KBA A;  2X6I A;  3K9I A;  2E2E A;  3LJ3 A;  2MRI A;  1HH8 A;  4GTQ A;  3FTU A;  1N4R A;  3BQO A;  1N0R A;  2NC9 A;  5CED B;  1JPL A;  2VSO E;  2XEE A;  2BKK B;  4PDX A;  4L9P A;  1IXV A;  2CFZ A;  3PZ3 A;  2DWZ A;  5AQA A;  5FIN A;  4GML A;  3V2X A;  4ANW A;  3APD A;  1H6O A;  4LEU A;  5ENP D;  4GPM A;  2KZT A;  2RG8 A;  3UIO C;  2WXM A;  3TG4 A;  1E96 B;  2WXN A;  3LKU A;  4UQZ A;  4GA1 A;  2XQ0 A;  4I1M A;  4BES A;  3BG1 B;  3PZ2 A;  5KJL A;  2B0O E;  2IU1 A;  1E90 A;  2AJA A;  4GTV A;  3EUV A;  4YVO A;  4I17 A;  1HO8 A;  2VJ8 A;  3ASH A;  4BFR A;  4CDM A;  2XPI A;  3TWR A;  1N4S A;  3CV0 A;  4J8F A;  2AXV A;  1H2V C;  2Q7F A;  4W9R A;  3HVE B;  4OVU A;  3FUF A;  5AYW D;  4FHK A;  2YHE A;  1INZ A;  3UKR G;  4UWK A;  3FH7 A;  4GYW A;  5ARG A;  3E30 A;  2Y4U A;  3ULE G;  3QDN A;  3L17 A;  5JHA A;  3T8M A;  3QC1 A;  3ZYL A;  3AS4 A;  3HXD A;  3E4B A;  3ULQ A;  3TWW A;  2WXI A;  3OXL A;  5ENO D;  1AP7 A;  2PL2 A;  3KD7 A;  2V4L A;  1JUQ A;  5CBN A;  4N3C A;  1E8Y A;  3IHY A;  3T5V A;  2P9L G;  3IV0 A;  3ZVV A;  2HR2 A;  4Y6C A;  3PDN A;  3O48 A;  3JUE A;  4O6F A;  3Q4A B;  2DVW A;  1FT2 A;  1TN7 A;  3SO8 A;  3SFX A;  3EHQ A;  1V54 E;  2XGS A;  1LTX A;  4HXI A;  2XPY A;  4G8L A;  4ME2 A;  3ZW3 A;  3CVQ A;  5A6C A;  2L6B A;  1TN8 A;  3SGH A;  1OCO E;  3U9W A;  1NI1 A;  2UWJ G;  2L0T B;  3NB2 A;  4EHM A;  5FZQ A;  2GW1 A;  4G26 A;  4AXH A;  4N5Q A;  3FU6 A;  3LDZ A;  1N0Q A;  2WM9 A;  4CCA A;  1ELK A;  3TAX A;  4HI8 A;  3MGB A;  2VYI A;  3TWQ A;  3DXK G;  3QWP A;  2DZO A;  4L1B A;  3SNX A;  3MKR A;  3HDX A;  4DX7 D;  5HS0 A;  5T4Y A;  1N94 A;  4TXR A;  2QFC A;  4XE0 A;  3ABM E;  3NF1 A;  3NBN B;  3RIB A;  2FBN A;  2OEV A;  5FJY A;  3RK6 A;  3D3M A;  3PNL B;  1MYO A;  4HOQ A;  1Z3X A;  3CVV A;  4Q69 A;  3FTV A;  4YDW A;  2EIK E;  3OAW A;  3Q9N C;  2DBA A;  3SHF A;  3MV2 B;  1NA0 A;  4JL0 A;  4B8A A;  3AG1 E;  1HF8 A;  2GRP B;  4JPS A;  4U8H A;  4CGV A;  4KMO A;  4WWP A;  4PS8 A;  3L16 A;  3LVR E;  3ZXS A;  2UY1 B;  2WXK A;  1E8Z A;  5CCM A;  2PQR A;  3D9O A;  1UOH A;  1TJC A;  4L23 A;  4I2Z A;  3MX3 A;  2QYJ A;  4AOF A;  4IUL A;  4A55 A;  4GMR A;  3LYA A;  2WXF A;  5ENR D;  5C1D A;  1N9A A;  4IRU A;  5FZS A;  3VLD A;  2YQ8 A;  3DSX A;  4FUL A;  3LY8 A;  1H2U A;  2GRL A;  1XGW A;  4U8Y D;  1WDY A;  1UN9 A;  4HBD A;  4JHJ A;  4D10 C;  4EBA A;  4U96 D;  1LD8 A;  3RO3 A;  3SFY A;  1WG0 A;  4FJY A;  2J09 A;  3BUA A;  3C3O A;  5EYP F;  5JMN D;  4U0Z A;  5BT1 A;  2X6J A;  3PUJ A;  2CHZ A;  3CST A;  2MOW A;  3QWV A;  5CRU A;  1UJK A;  3GZ2 A;  3ZYM A;  1OWN A;  2FF4 A;  2VGY A;  1MX2 A;  2WXP A;  4ZFH A;  2ION A;  1V55 E;  4K5C A;  4J8E A;  4NAC A;  2XCB A;  4L2Y A;  2JEK A;  2XEV A;  4UI9 K;  3AS8 A;  4RSY A;  4NQ0 A;  3EU9 A;  3DSU A;  3SD5 A;  5ANL A;  1P5Q A;  5LFA A;  3B7S A;  5LCW C;  3HVE A;  2VSY A;  2X6F A;  2NYJ A;  4I9C A;  5FQ7 A;  3UT8 A;  2NXP A;  2Y4T A;  3EJN A;  4UUC A;  4UWF A;  2GRM A;  4BT9 A;  3CVX A;  4B8C B;  3HG0 D;  3V2O A;  4HOU A;  4KBQ A;  4ILI A;  1QBQ A;  1LF8 A;  5DIZ A;  1HG2 A;  1ZB1 A;  3PNT B;  3L54 A;  4G25 A;  5LX8 A;  4F1S A;  1DCQ A;  2P58 C;  2V8S E;  3ONL A;  3CKB A;  4OVV A;  3PVL A;  2LSU A;  2A4Z A;  3L6A A;  3D9N A;  4BX9 A;  3JXJ A;  2WB2 A;  5BXU A;  4GTS A;  5AJD A;  4GZ3 A;  4GYY A;  5FIO A;  5EN5 D;  4TRQ A;  1JCS A;  2AWI A;  3KSQ A;  1KPS B;  3FUK A;  4JB8 P;  3B13 A;  1UN8 A;  5T3R A;  2KCV A;  5KJM A;  1OCR E;  2AXU A;  1VDY A;  3C72 A;  5E76 A;  4I1A A;  1H6K A;  3HXB A;  4PS7 A;  3FH8 A;  4UWL A;  3DSS A;  3SZ7 A;  1IQR A;  2XGM A;  1JCQ A;  2WVI A;  4CT0 A;  3B7R L;  1L5J A;  3KS2 A;  1E8X A;  2CHW A;  1TEZ A;  2H6H A;  5G2N A;  4CDR A;  4TV3 A;  1ZU2 A;  3PE3 A;  2XRZ A;  3R9A B;  2B6C A;  3ABL E;  2VQ2 A;  4KZ0 A;  2C0L A;  3ZU7 B;  3JUI A;  5G55 A;  3EDT B;  4DLO A;  1NL4 A;  5B3S E;  2QZA A;  2NSZ A;  3GW4 A;  3Q5M A;  1IYG A;  4G23 A;  5AAR A;  1NA3 A;  2OOE A;  3UPV A;  4G11 A;  1HXI A;  1QZ2 A;  4ZHB A;  4F3V A;  4FC8 A;  5EYL A;  3VLE A;  4B93 B;  2MHK A;  1AWC B;  4Z68 A;  3UM0 A;  2OVF A;  4UQY A;  1YCS B;  4JEH A;  2P9K G;  4LNG A;  2HYZ A;  3I3N A;  3MV3 B;  3FHE A;  2RD0 A;  4GZ6 A;  3R7R A;  2KAT A;  3CVN A;  2DCP A;  4FAD A;  3ASG A;  3L9T A;  3MCX A;  4F1P A;  2UY1 A;  2EIM E;  1OWM A;  3ASN E;  3CR3 A;  1W3B A;  3DPY A;  3FTY A;  1S63 A;  4KYO B;  1N95 A;  2R17 C;  4HOT A;  4G24 A;  5HRY A;  1U3C A;  4RQI A;  2XZT G;  5E75 A;  1OWO A;  3DPD A;  1OUV A;  4N5C A;  4G2V A;  2BF0 X;  3F6Q A;  1HE8 A;  2KM4 A;  3UM2 A;  2L6J A;  2IY0 C;  3T8K A;  2HE0 A;  2H6I A;  1OXJ A;  4JXT A;  3JQ0 A;  2FI7 A;  4GYO A;  2QC9 A;  1HX8 A;  2JAB A;  4YVQ C;  4OYS A;  3E34 A;  4EEC A;  3CVL A;  4BTB A;  1TNU A;  3CHQ A;  5IY5 E;  4NUR A;  2ZGG A;  4NRH B;  3R9M A;  2CFU A;  4WUY A;  3PRE A;  3AAA C;  3CVP A;  4PS3 A;  3CHP A;  3FU3 A;  2WXJ A;  2P9S G;  2LSV A;  4HRL A;  4ILH B;  3ABK E;  3ZEF A;  2OND A;  2HO1 A;  4ILG A;  3JQ1 A;  4JD2 G;  3KSL A;  2XPZ A;  4TXQ A;  4U04 A;  3TL5 A;  3TWX A;  3FFL A;  1FVH A;  1K1B A;  1OWP A;  3UUX A;  3QK0 A;  4CGW A;  4JHK A;  1YA0 A;  1TYQ G;  4ACL A;  4I43 A;  2EIL E;  2WXQ A;  2YIN A;  1DNP A;  2V4H C;  5BV0 A;  2F0Y A;  2XEH A;  1KT0 A;  5LP0 A;  3B95 A;  3LS8 A;  2IOL A;  5DBK A;  3MA5 A;  4CRW A;  3FY4 A;  4DLQ A;  3ESL A;  2I2O A;  4WWN A;  2XZD G;  3FEX A;  4GTP A;  3RU0 A;  4O1O A;  1O1S A;  1B89 A;  3U4T A;  4CT4 A;  2LXM A;  4A63 B;  4GA0 A;  3CK7 A;  3IHV A;  3ZHE B;  4HQD A;  3Q15 A;  2ZU6 B;  4JA9 A;  1K8K G;  3L22 A;  3B7T A;  4U95 D;  5H7P A;  3DSV A;  3E37 A;  3MYV A;  4EZK A;  2RFA A;  4EPZ A;  2GRQ B;  3DXM G;  3ZN3 A;  2XRY A;  2VSX E;  2LO6 A;  3BG0 B;  4AY5 A;  2WMN A;  2A5E A;  4DPR A;  3AU4 A;  4J0U A;  3FEY A;  4O1P A;  4U0U A;  5D0O D;  2OCC E;  3PZ1 A;  3V30 A;  4HFG A;  3G2S A;  4LSZ E;  5EX3 A;  4JA7 A;  3UIP C;  3Q7F A;  3Q49 B;  3AJI A;  5KNH D;  3B7B A;  2RFM A;  3NAW A;  4DI4 A;  4GCN A;  1Y6I A;  4OAU C;  5CMW A;  3I5P A;  3J5P A;  2LXL A;  4XEI G;  2Y69 E;  3ASD A;  2IO3 C;  2BUG A;  4IYP A;  3ISM C;  2ETA A;  4B0Z A;  4N3B A;  2FUL A;  3D9P A;  2I1K A;  3QB2 A;  3PS6 A;  4MRU A;  4EZJ A;  1IQU A;  5JJ6 A;  3FUN A;  4GTR A;  2IO2 C;  4XIF A;  5CEA A;  3RO2 A;  3PEV B;  2I1J A;  4ABN A;  2ILR A;  3IBE A;  4M7C A;  3TWT A;  1HG5 A;  2DYS E;  4HNA D;  5D0Q D;  3UIN C;  3LEW A;  4AVX A;  4JEU A;  2VSN A;  4LER A;  4F53 A;  2M63 A;  5BW8 C;  4APO A;  1OT8 A;  3UX4 A;  4WAF A;  4DUI A;  4K03 A;  1U3D A;  5FWQ A;  5HQ8 A;  2EIJ E;  4G8K A;  1NZN A;  1RZ4 A;  2GRO B;  2KBX A;  2AW6 A;  1KT1 A;  4GPK A;  3DEO A;  1SVX A;  3PRZ A;  4GB9 A;  5KJN A;  5J08 A;  5AEN A;  2P9P G;  3T9K A;  4L7T A;  5FQ4 A;  5G04 C;  4C9B B;  1TJF A;  2PNN A;  1A17 A;  3LPZ A;  4AY6 A;  3RAU A;  3RKV A;  4HB5 A;  3D9J A;  3ZYQ A;  2VGX B;  3LY7 A;  5A23 A;  4TXP A;  2R02 A;  1HU3 A;  3TG5 A;  1N52 A;  3PEU B;  3BEE A;  2DYR E;  2DIW A;  4CYM D;  1TR4 A;  4AV7 A;  2FEZ A;  3U66 A;  2Y0B G;  2P9I G;  4I2W A;  1XNF A;  2WXR A;  4UQX A;  5AJL A;  5ITZ F;  4C0E A;  4HOS A;  1S64 A;  4ANU A;  4HVB A;  1BU9 A;  5C2Y A;  1JWG A;  4HRN A;  1E8W A;  1MX6 A;  3E32 A;  3FUI A;  4CEM A;  4FP7 A;  1N4P A;  1TNY A;  1U2V G;  4XKC A;  1UW4 B;  4AIF A;  4OAV B;  5JHB A;  3ZGQ A;  2L0I A;  4JW1 A;  3KEA A;  4G1T A;  5D66 A;  2YNQ A;  3UQ3 A;  5HKP A;  5HI7 A;  2ZIR A;  5AN8 A;  1FT1 A;  5ARF A;  4BET A;  2VTB B;  4BTA A;  4UWG A;  2WQ7 A;  4GTM A;  4I6J A;  3RJV A;  5CEC B;  5CER B;  1FVF A;  3QWW A;  3TXM A;  3MEK A;  4XKB A;  2I9C A;  3S2A A;  1EDU A;  3ZNG A;  4RG9 A;  1Z3Y A;  4GTO A;  3ZHE A;  2XCC A;  2J9Q A;  3UM1 A;  5AQ9 A;  2E0I A;  3TWV A;  3RRN B;  3DEP A;  4A1S A;  5JA4 D;  3ONK A;  1MZC A;  5T8I A;  4RVB A;  4U8V D;  1QQE A;  3CSF A;  5B1A E;  3EIJ A;  3CK8 A;  1BPO A;  4FHJ A;  1H0A A;  5EKQ D;  3ZKJ A;  3AG3 E;  4QFV A;  4WND A;  5KNG A;  4A3T A;  1N54 A;  2X6H A;  3Q75 A;  2J4D A;  1DCE A;  2GGF A;  2PM6 A;  5FZR A;  3U3W A;  3GYZ A;  5ENS D;  3ZIM A;  1E7U A;  3CGH A;  3JXI A;  4U63 A;  4RG6 A;  4GA2 A;  3C98 A;  4ATG A;  3CVW A;  3Q9U C;  4H7Y A;  1EPU A;  3WXX A;  4LNB A;  2HM8 A;  2XS8 A;  4K5A B;  3DST A;  4WNG A;  1D8E A;  3ML9 A;  4EZL A;  3FU5 A;  4DRX E;  3NZU A;  2J07 A;  3NQP A;  3MJW A;  2GRN B;  3SBT B;  5CHE E;  4ACK A;  4U7E B;  2EQX A;  3D9L A;  3FUL A;  5J90 A;  1LD7 A;  3ZPJ A;  2EIN E;  3LCA A;  3G2T A;  3HIZ A;  5D2M C;  2PZI A;  3CHR A;  4HI9 A;  2YHC A;  3UMV A;  1FPP A;  3R7Q A;  4JHR A; 
#chains in the Genus database with same CATH homology
 1Y8M A;  3ESL A;  2XHE A;  3SF4 A;  3L16 A;  2I2O A;  2R5S A;  3LVR E;  4C0M A;  4WWN A;  5KJK A;  3FEX A;  2BTD A;  3RU0 A;  5JJT A;  2PQN A;  4FU3 A;  3ZXS A;  1H2T C;  2UY1 B;  2WXK A;  1E8Z A;  3D9M A;  5CCM A;  2PQR A;  3D9O A;  4JVS A;  4J6I A;  3PZD A;  4MLP A;  1TJC A;  1B89 A;  5CCL A;  1PC2 A;  3PE4 A;  4L23 A;  4I2Z A;  3MX3 A;  4GZC A;  1WM5 A;  3U4T A;  5G05 J;  4CDN A;  4CT4 A;  2Y3A A;  2X3M A;  5M72 A;  4HOR A;  4GA0 A;  4AOF A;  3CK7 A;  4N2S A;  4IUL A;  3L08 A;  4A55 A;  3IHV A;  2IFU A;  3ZFW A;  1FCH A;  3ZHE B;  3LYA A;  2WXF A;  3EIQ C;  4XZ4 A;  3Q15 A;  4KVO A;  4BWR A;  2ZU6 B;  5C1D A;  3IEG A;  4GZD A;  1DVP A;  1ZBP A;  4IRU A;  3B7U X;  5FZS A;  3VLD A;  4EQF A;  2YQ8 A;  3CK9 A;  4DJA A;  4I9E A;  4JA9 A;  3CEQ A;  5FT9 A;  3CIA A;  3S7F A;  4FUL A;  3TJP A;  3L22 A;  3B7T A;  3FUM A;  3LY8 A;  4IN3 B;  1H2U A;  3MYV A;  2GRL A;  1XGW A;  3FTX A;  3JYS A;  4EZK A;  4FA6 A;  4EPZ A;  5KCM A;  2WXL A;  3MKQ A;  3ZN3 A;  3CHO A;  2XRY A;  4I6G A;  1UN9 A;  3FU0 A;  2VSX E;  4PUC A;  2LO6 A;  3BG0 B;  3OXF A;  4JHJ A;  4P29 A;  3RRM B;  4AP2 A;  4AY5 A;  4D10 C;  4EBA A;  4UI9 C;  2J4B A;  4LCT A;  3RO3 A;  1S0P A;  2WMN A;  1WAO 1;  4FJY A;  2J09 A;  4B89 A;  4DPR A;  2V0P A;  2WQ6 A;  4FLH A;  3AU4 A;  3O4Z A;  4U0Z A;  5BT1 A;  1MHQ A;  3L13 A;  3QAQ A;  2X6J A;  3PUJ A;  2VGX A;  2XGO A;  4J0U A;  2CHZ A;  3CST A;  3FEY A;  4PH4 B;  4WNF A;  2L9B A;  2MOW A;  3QWV A;  4URK A;  3ENE A;  4V3I A;  5ANR A;  3QKY A;  1UJK A;  3GZ2 A;  3OTN A;  4U0U A;  4XI0 A;  3SBS A;  3ZYM A;  1OWN A;  2FF4 A;  1UJJ A;  2VGY A;  5D0O D;  2WXP A;  1Z6T A;  2ION A;  4N39 A;  2KCL A;  4HFG A;  4J8E A;  3G2S A;  1H19 A;  1HFA A;  2XCB A;  4NAC A;  4WNE A;  4L2Y A;  4JA7 A;  5EX3 A;  4K0R A;  4U07 A;  3FUJ A;  2JEK A;  2XEV A;  3Q49 B;  3QOU A;  2I6H A;  4UI9 K;  4FLB A;  2KCK A;  3AS8 A;  5CMY A;  4RSY A;  2C0M A;  4NQ0 A;  3VLF A;  2OVB A;  4DI4 A;  4GZ5 A;  4KXK B;  4GCN A;  3HHM A;  4LUN U;  4MS6 A;  1Y6I A;  1SZA A;  3SFZ A;  5BUZ A;  5CMW A;  2AVP A;  3I5P A;  2LAH A;  3ZRH A;  2WXG A;  3AS5 A;  3ESK A;  2AXZ A;  5G05 C;  3SD5 A;  2WXH A;  3FWV A;  3QNK A;  3ASD A;  5ANL A;  5G04 J;  4MKT A;  4HLE A;  4E6H A;  1P5Q A;  2BUG A;  4IYP A;  2KC7 A;  3B7S A;  5LFA A;  3FP3 A;  4AM9 A;  5LCW C;  3HVE A;  5AIJ A;  3ZYK A;  2VSY A;  3CQG B;  2X6F A;  4B0Z A;  4XX5 A;  4J8S A;  4APF A;  3G2V A;  4I9C A;  4N3B A;  3CKC A;  5FQ7 A;  4AEZ C;  1ELR A;  2FUL A;  3VTX A;  4KZC A;  3AU5 A;  4GAA A;  3FTW A;  3D9P A;  4GCO A;  1OWL A;  3ASF A;  3UT8 A;  2I1K A;  3QB2 A;  3EHN A;  4F7A A;  3PS6 A;  4AJW A;  4MRU A;  2NXP A;  4EZJ A;  2Y4T A;  1IQU A;  2X6K A;  5JJ6 A;  3EJN A;  3FUN A;  4UWF A;  2GRM A;  4BT9 A;  1E7V A;  4XIF A;  3CVX A;  4B8C B;  3RO2 A;  4BX8 A;  3PEV B;  4BY6 A;  2I1J A;  3UT7 A;  4DK5 A;  4ABN A;  2ILR A;  3IBE A;  3CVU A;  3ML8 A;  4HOU A;  2R59 A;  4J8D A;  1HG5 A;  3VTY A;  4KBQ A;  3I4R B;  4ILI A;  4BSX A;  1PAQ A;  3FH5 A;  5D0Q D;  3IKO B;  2X6I A;  3K9I A;  3LEW A;  1LF8 A;  1NP7 A;  5DIZ A;  4JEU A;  4AVX A;  3CLJ A;  2E2E A;  2VTB A;  2VSN A;  1HG2 A;  4LER A;  4F53 A;  3LJ3 A;  3UT4 A;  3PNT B;  2J08 A;  3L54 A;  2M63 A;  2WPV A;  3NZS A;  1KLX A;  4G25 A;  5BW8 C;  4APO A;  5LX8 A;  4F1S A;  2P58 C;  3UX4 A;  2MRI A;  2V8S E;  4WAF A;  5LCW J;  3ONL A;  3CKB A;  4OVV A;  4A1G A;  4ANV A;  4K03 A;  1U3D A;  3PVL A;  1HH8 A;  2LSU A;  2A4Z A;  3L6A A;  5FWQ A;  5HQ8 A;  3FTU A;  4JC8 A;  2NC9 A;  1JPL A;  1NZN A;  3D9N A;  4BX9 A;  2WB2 A;  3CHS A;  5BV1 A;  2AW6 A;  1KT1 A;  2LNI A;  3KAE A;  3LXU X;  5AJD A;  4GPK A;  4KT6 B;  4GZ3 A;  4GYY A;  3PRZ A;  2VSO E;  3U64 A;  4GB9 A;  4TRQ A;  5KJN A;  5J08 A;  3CVY A;  3I4G A;  2AWI A;  1ELW A;  4PDX A;  3PUK A;  4KVM A;  5AEN A;  2CFZ A;  4L7T A;  3MKQ B;  3FUK A;  5FQ4 A;  3B13 A;  5G04 C;  4C9B B;  1UN8 A;  5T3R A;  1TJF A;  2WMO A;  5A7D B;  1HS6 A;  4WWO A;  3LY9 A;  1A17 A;  2KCV A;  3LPZ A;  3LVQ E;  5KJM A;  2AXU A;  1VDY A;  4AY6 A;  3S7B A;  4GML A;  3RKV A;  3D9J A;  5E76 A;  4ANW A;  3APD A;  3ZYQ A;  2VGX B;  4I1A A;  1QNF A;  4LEU A;  1H6K A;  3LY7 A;  5A23 A;  4PS7 A;  3FH8 A;  4UWL A;  3TXN A;  3SZ7 A;  1IQR A;  1HU3 A;  1SZ9 A;  2KZT A;  2RG8 A;  2XGM A;  3QJZ A;  3TG5 A;  2WVI A;  2WXM A;  2FO7 A;  4U0S A;  3B7R L;  4CT0 A;  3TG4 A;  1L5J A;  3KS2 A;  4I1O B;  1E96 B;  1N52 A;  1E8X A;  3PEU B;  2WXN A;  2WQH A;  2CHW A;  3BEE A;  2WXO A;  2IQC A;  3URZ A;  2DIW A;  3LKU A;  1TEZ A;  5G2N A;  4UQZ A;  4CDR A;  4GA1 A;  4TV3 A;  4AV7 A;  1ZU2 A;  2FEZ A;  3U66 A;  3D9I A;  1X5B A;  2XQ0 A;  4A3V A;  4I1M A;  3PE3 A;  2X38 A;  2XRZ A;  3BG1 B;  4I2W A;  3GZS A;  3R9A B;  1GW6 A;  5KJL A;  2IU1 A;  1XNF A;  1E90 A;  2VQ2 A;  2WXR A;  3FUH A;  3HYM B;  2C0L A;  4KZ0 A;  4UQX A;  3JUI A;  5JJ7 A;  5G55 A;  3EDT B;  5AJL A;  4YVO A;  4I17 A;  4C0E A;  1HO8 A;  2VJ8 A;  4BT8 A;  3QAR A;  4DLO A;  3ASH A;  4BFR A;  2C2L A;  4HOS A;  4CDM A;  2NSZ A;  2XPI A;  3Q47 B;  4Q96 A;  4ANU A;  3GW4 A;  3Q5M A;  3S7J A;  1IYG A;  4G23 A;  4HVB A;  3CV0 A;  4J8F A;  2AXV A;  1NA3 A;  1H2V C;  2OOE A;  2Q7F A;  4W9R A;  4G11 A;  3P1U A;  3HVE B;  5C2Y A;  4GMJ A;  1JWG A;  4OVU A;  3UPV A;  3FUF A;  1E8W A;  1HXI A;  5AYW D;  4ANX A;  4FHK A;  4LRZ A;  3FUI A;  4FJZ A;  4CEM A;  4FP7 A;  5EDS A;  1QZ2 A;  2YHE A;  4F3V A;  4FC8 A;  1INZ A;  4TUU A;  3VLE A;  4UWK A;  3FH7 A;  4XKC A;  1UW4 B;  4GYW A;  5ARG A;  2MHK A;  4AIF A;  5JHB A;  2Y4U A;  3QDN A;  3N71 A;  2OVF A;  3L17 A;  4R7L A;  4UQY A;  4YND A;  4DI3 A;  4N3A A;  3FUE A;  4Q94 A;  5JHA A;  4JEH A;  2L0I A;  4JW1 A;  3ZGQ A;  4G1T A;  3T8M A;  3QC1 A;  2YNQ A;  3UQ3 A;  3ZYL A;  2V5F A;  3AS4 A;  4UWH A;  5FQ8 A;  2HYZ A;  3I3N A;  3MV3 B;  3FHE A;  5BNW A;  3E4B A;  2RD0 A;  3ULQ A;  2PM7 A;  4GZ6 A;  5HI7 A;  3R7R A;  2KAT A;  3CVN A;  2DCP A;  5ARF A;  4FAD A;  2WXI A;  3PH0 C;  4BTA A;  2VTB B;  3ASG A;  1WY6 A;  3OXL A;  3MCX A;  4UWG A;  1EF1 C;  2PL2 A;  3KD7 A;  2WQ7 A;  2UY1 A;  2V4L A;  1JUQ A;  1OWM A;  1PY1 A;  4N3C A;  4Y6W A;  4I6J A;  3CR3 A;  3RJV A;  3APF A;  1W3B A;  3G2U A;  1FVF A;  1E8Y A;  3QWW A;  3TXM A;  3FTY A;  3IHY A;  3MEK A;  3T5V A;  4XKB A;  3IV0 A;  2I9C A;  3S2A A;  3ZVV A;  2HR2 A;  1EDU A;  4Y6C A;  4KYO B;  4RG9 A;  1Z3Y A;  3PDN A;  2R17 C;  4HOT A;  1MQS A;  1SQM A;  4G24 A;  2CG3 A;  3O48 A;  3ZHE A;  2XCC A;  2J9Q A;  2CHX A;  4O6F A;  1U3C A;  3Q4A B;  5BPP A;  5E75 A;  1OWO A;  3DPD A;  1OUV A;  2E0I A;  4L2L A;  3RRN B;  4A1S A;  4N5C A;  4G2V A;  2BF0 X;  3ONK A;  5T8I A;  4RVB A;  2XGS A;  3RRU A;  1HE8 A;  2J49 A;  2KM4 A;  3MZL B;  1QQE A;  3CSF A;  2L6J A;  4HXI A;  4H7X A;  1IHG A;  3EIJ A;  2XPY A;  4ME2 A;  3ZW3 A;  3CK8 A;  3CVQ A;  5A6C A;  1EYH A;  1BPO A;  4JXT A;  4FHJ A;  3SGH A;  1H0A A;  5EKQ D;  4QFV A;  3JQ0 A;  2FI7 A;  4GYO A;  3U9W A;  4WND A;  3FUD A;  5EX0 A;  1UG3 A;  4A3T A;  1HX8 A;  3KEZ A;  3GZ1 A;  4YVQ C;  4OYS A;  2UWJ G;  4XI9 A;  2L0T B;  4EEC A;  1N54 A;  2X6H A;  5FZQ A;  2GW1 A;  3CVL A;  2J4D A;  4G26 A;  4AXH A;  3EHM A;  3FU6 A;  3SI5 A;  3LDZ A;  4BTB A;  3CHM A;  2WM9 A;  3CHQ A;  2KZT B;  2GGF A;  4CCA A;  2PM6 A;  3TGO A;  5FZR A;  3U3W A;  4NUR A;  4N2Q A;  4NRH B;  1ELK A;  3T5X A;  1HZ4 A;  3GYZ A;  2CFU A;  4WUY A;  3TAX A;  5LOZ A;  3PRE A;  3ZIM A;  3CVP A;  3P2B A;  1E7U A;  3CGH A;  4PS3 A;  4JZY A;  4U63 A;  3MGB A;  2VYI A;  4HS2 A;  4RG6 A;  3CHP A;  4GA2 A;  3C98 A;  4ATG A;  3FU3 A;  3DBS A;  3CVW A;  2WXJ A;  3QWP A;  4H7Y A;  4E85 A;  1EPU A;  2LSV A;  4L1B A;  3SNX A;  3WXX A;  3MKR A;  5ENN A;  3CQC B;  4B94 A;  3HDX A;  5T4Y A;  4ILH B;  2HM8 A;  3ZEF A;  2QFC A;  2OND A;  2HO1 A;  4ILG A;  4XE0 A;  3JQ1 A;  3NF1 A;  3RIB A;  2FBN A;  3APC A;  5FJY A;  4WNG A;  2XPZ A;  3RK6 A;  3D3M A;  3ML9 A;  2IF4 A;  4EZL A;  3PNL B;  4U04 A;  3FU5 A;  3NZU A;  3OXG A;  3TL5 A;  1JWF A;  4M3O A;  5FQ6 A;  4HOQ A;  4UI9 J;  1Z3X A;  2J07 A;  3NQP A;  3MJW A;  3FFL A;  1FVH A;  1OWP A;  3CVV A;  3S7D A;  2JLB A;  3UUX A;  4Q69 A;  3QK0 A;  4CGW A;  3FTV A;  5CHE E;  3SBT B;  3G2W A;  1YA0 A;  4JHK A;  4ACK A;  3OAW A;  2EQX A;  4ACL A;  2CG2 A;  2A5U A;  3D9L A;  4I43 A;  2WXQ A;  3FUL A;  5J90 A;  2YIN A;  2IJG X;  3FTZ A;  3ZPJ A;  2DBA A;  3SHF A;  3MV2 B;  1NA0 A;  4JL0 A;  3LCA A;  5FTP A;  1DNP A;  3G2T A;  3HIZ A;  4I6E A;  2PZI A;  4B8A A;  3FDH A;  3JCK C;  3CHR A;  5BV0 A;  5LP0 A;  1KT0 A;  1HF8 A;  2YHC A;  3LS8 A;  2IOL A;  4JPS A;  2IOS A;  4U8H A;  3UMV A;  5DBK A;  3MA5 A;  4EBA G;  4CRW A;  2QY7 A;  2OV8 A;  3FTS A;  4CGV A;  3R7Q A;  4JHR A;  4KMO A;  3FY4 A;  4WWP A;  4DLQ A;  2LAI A;  3D9K A;  4GU5 A;  4PS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...