2KZTB

Structure of the tandem ma-3 region of pdcd4
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Programmed cell death protein 4
total genus 37
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kztB00
1H2VC 2IOSA 4B89A 4CRWA 4B8CB 1UG3A 3FEXA 1H2UA 4LUNU 2NSZA 2ZU6B 4CEMA 1H2TC 1N52A 1HU3A 4GMLA 2I2OA 3EIJA 4JHKA 5ANRA 3D3MA 4C9BB 3EIQC 3FEYA 2GGFA 2VSXE 4JHJA 4CT4A 3L6AA 2IONA 1N54A 2IU1A 2KZTB 1H6KA 2HM8A 1PAQA 2IOLA 2FULA 2RG8A 4B8AA 2KZTA 2VSOE 4IULA 1UW4B 4GMJA 3JUIA 3RK6A
chains in the Genus database with same CATH superfamily
4BFRA 2WXMA 3HVEB 5C2YA 3BU8A 3CK9A 3T8KA 3CKCA 3C5RA 4ANXA 3FTSA 5AQ7A 4G8LA 1ELRA 2GRNB 1S0PA 3CHOA 1V54E 3CVQA 3V31A 1OT8A 1SZAA 2ETCA 3FUHA 4B0ZA 3ASHA 2Y3AA 1OCCE 3JYSA 3FUKA 3UPVA 5KNGA 4UQZA 3T9KA 3MX3A 2XEEA 5JJ6A 3E30A 2FULA 3D9LA 4N5QA 4J8FA 4G11A 1FCHA 4AM9A 3L08A 1EPUA 2AXUA 1N0RA 3NBNB 4JC8A 2OCCE 3S2AA 4BERA 2BTDA 3W9FA 2A5EA 3QNKA 4CDNA 4OVVA 2Y1LE 3ENEA 2NXPA 3B13A 2KCLA 4L9PA 4Q94A 3LY8A 2J4DA 2MRIA 1Q2ZA 3Q4AB 4MRUA 5JHAA 1NP7A 5HI7A 3CKBA 3ML9A 1TNOA 2J08A 1P5QA 1Z5SC 2LXLA 4ANUA 1HG5A 1OWNA 1EF1C 4U0SA 2L6JA 4G1TA 3NZUA 5AQ9A 4K5CA 4I9EA 2AVPA 4UQXA 5ANRA 5G05J 5H7PA 1MQSA 3EIQC 2F37A 2WM9A 4AEZC 4K5BA 3SFYA 3CQCB 3DXMG 3GYZA 3SFXA 5ENPD 5AQAA 4HFGA 2XZTG 4RLYA 1AP7A 5FIOA 3FH5A 1IHGA 3ISMC 5AENA 3UMVA 4J8YA 2J09A 5FQ8A 1OCZE 3C98A 4UI9C 5BXUA 1WG0A 2IO3C 3R7QA 4GTOA 3UKUG 3QDNA 3PZ4A 2P9UG 5G04J 2F8YA 3ULQA 3SNXA 3UT4A 5JMND 4G25A 5M72A 2LAIA 2V8SE 2E0IA 2PM6A 3RKVA 4AP2A 3AS4A 3FU0A 1MYOA 4A1GA 4JL0A 2WXPA 4FULA 4JPSA 2HE0A 4ME2A 5D0QD 4NQ0A 4LG6A 3WXXA 2P9SG 3JCKC 1H19A 5D2MC 4I2ZA 3SD5A 4HQDA 4WWNA 1MZCA 2F8XK 1HO8A 2C0MA 3HDXA 5C1DA 5DIZA 2A5UA 5BUZA 1OY3D 3PS6A 2WQHA 3HXBA 1JUQA 4BESA 3TWRA 1IYGA 5LX8A 2LNIA 4MS6A 3ESKA 2H6HA 2HM8A 4G23A 4F1PA 2PZIA 3PEUB 3UM2A 2BUGA 4NRHB 1NFIE 2WXLA 2KM4A 2IO2C 1D9SA 2I1KA 2V4LA 3G2TA 3ZXPA 4GA0A 5ENRD 5FTPA 3FTVA 4JHJA 5JHBA 3ZIMA 1YMPA 4ACKA 3D9NA 1TNBA 4G8KA 3PREA 2FI7A 3FUJA 3W9GA 5BV0A 2IQCA 2LSUA 3L17A 2WXRA 4M3OA 2HYZA 3B7TA 4DI3A 4WNGA 3T8MA 1E8YA 1N0QA 1BI8B 4GB9A 5BNWA 2CG3A 2X38A 3TWVA 4N39A 4WAFA 4TXPA 1TN6A 3Q73A 1DVPA 3I3NA 4FA6A 2I2OA 1OCOE 3AU4A 1UJKA 1FVHA 1EYHA 4BT9A 3ZGQA 3U66A 4ACLA 1H6KA 3D9MA 2WXIA 2FO7A 3PH0C 3UM0A 3OXGA 2Y69E 2GRQB 4CDMA 4I1AA 3X2QE 4E85A 1DNPA 1FT1A 4EZKA 1IQUA 2XQ0A 3RU0A 1IXVA 4HRNA 1QQEA 3K9IA 3TWUA 5AIJA 3MV2B 5FQ4A 4O1PA 4C0EA 3JQ1A 4JA9A 3TWXA 3CHPA 4ANWA 5E76A 2WXGA 3UIOC 4UUCA 3ZXSA 1MX4A 2H6GA 3FUMA 1JWFA 2EIME 2IONA 4NURA 3SF4A 4UI9K 4I6GA 2L6BA 4RG6A 3UI2A 3G2WA 3ZHEB 4CRWA 3DEOA 3FEXA 2XGOA 4P29A 2WMNA 4C9BB 2Y4TA 3V2XA 3L82A 1YA0A 4U07A 1OXJA 2XRZA 4AJWA 3MEKA 2QFCA 3FTUA 4XX5A 3R9MA 5CECB 4XKCA 2M63A 5BV1A 4JEUA 3Q78A 3ZYKA 2WMOA 1SA4A 5B1AE 3Q15A 3MJWA 5CMWA 3MCXA 5KWDA 2AXZA 3Q9NC 4HOTA 2OEVA 2L9BA 5B1BE 3CVXA 2GRLA 2FF4A 2C2LA 2YHCA 1ELKA 4BWRA 1HZ4A 2B0OE 3HXDA 3HHMA 4ABNA 1OCRE 4KXKB 5EIDA 5ENNA 2R5SA 3PE3A 4KMOA 4JHKA 3DEPA 3PZ2A 1Z6TA 4HI8A 2Q7FA 4I1MA 3OXLA 2YNQA 3CHSA 3APCA 4I6EA 1A5EA 1INZA 2V5FA 1HH8A 4GYYA 4YDYA 2VYIA 4BX8A 3CV0A 3FUNA 3C3RA 4ATGA 3UIPC 2DBAA 1N94A 4U0ZA 3LS8A 3RAUA 5AN8A 2GRRB 2KCKA 4YDOA 3SZ7A 2RD0A 2VSOE 4FLHA 4MKTA 1SZ9A 2DCPA 2VJ8A 4C0MA 1QZ2A 2VSYA 3CEQA 2EIKE 2XPIA 4ILIA 3QKYA 1OWPA 2AJAA 2GRPB 3ASOE 4HBDA 1HS6A 5FZSA 4YNDA 2DZOA 4CYMD 4GCNA 4GMJA 3UQ3A 4GA1A 4CT0A 4JD2G 1Z3YA 1LD8A 4DJAA 2J07A 3TJPA 5CBNA 3PZDA 3NQPA 1WAO1 3RRMB 3L6AA 2LAHA 3EU9A 3LY9A 2V4HC 2GRMA 1WM5A 4EBAA 2VGEA 1Y8MA 4JVSA 3MZLB 3P1UA 1TR4A 3D9PA 5LP0A 3AG1E 1OWLA 4FLBA 3TAXA 4W9RA 1IQRA 3G2VA 5FINA 4ILGA 4B89A 3T5VA 1YCSB 4DLOA 4LNGA 4MBGA 5FWQA 2QYUA 2FEZA 1LF8A 3TXNA 4AVXA 2R03A 2XZDG 3EDTB 2VTBB 3ESLA 3QARA 4GTTA 4APFA 1SQMA 2R17C 1G3NB 3EHQA 4GAAA 3Q49B 3ULYA 4KZ0A 2EINE 1X5BA 1E7UA 4CZ2D 2ZGGA 3FTWA 1K1AA 3L54A 3E33A 2RFAA 2P9LG 5HQ8A 2I9CA 3ZRHA 4OAVB 3TG4A 4UI9J 1N4SA 3TL5A 5JJTA 3G2SA 4CT4A 3CVVA 2IY0C 4GZ5A 1E8WA 1E96B 4WWOA 5EILA 4UWLA 3O48A 2NYJA 2CHXA 3NAWA 4RSYA 3FFLA 3KSQA 1Y6IA 2X3MA 5KBAA 3UT7A 3R7RA 2IF4A 4HVBA 4PS7A 3MKQA 2X6IA 2WQ6A 4J8EA 5EDSA 2PQNA 3FU5A 3FTYA 4GZ3A 4J8DA 5LFAA 2XPYA 5ARFA 4EHMA 3KAEA 4GZ6A 3DSXA 1UOHA 4N3BA 4BTAA 3GZSA 3CSFA 3ML8A 4KYOB 3ONLA 2YHEA 1ZBPA 3DSTA 1TEZA 2VSNA 3DPYA 2QZAA 5CEDB 3IXEA 3ZUVB 3J5PA 1HU3A 4F53A 4UWGA 4GMRA 1N54A 4LSZE 4HB5A 1E90A 4Q96A 4FHKA 1PC2A 3PNLB 5ITZF 1HXIA 3FU3A 4KZCA 2OVBA 1Z3XA 2DWZA 2J49A 4E6HA 1NZNA 4LCTA 2H6IA 2I6HA 3RO3A 3RJVA 1BI7B 3PEVB 4TRQA 1TNUA 3EHNA 2OEWA 4H7YA 2XCBA 3CGHA 2WVIA 5HS0A 4D10C 4XKBA 5AQBA 2HR2A 3T5XA 1TYQG 1JCRA 1DC2A 3TWTA 2E2EA 2LSVA 2WB2A 1H2TC 3D3MA 2P58C 4APOA 4YDWA 4IRUA 3LYAA 2PM7A 4GU5A 3DWLG 3FDHA 3LVRE 3NOGD 3V79K 4O1OA 2P9NG 1S70B 2CG2A 3IHVA 4OAUC 4TUUA 1N52A 5G2NA 1L5JA 4GMLA 4L23A 3UX4A 2MOWA 3BG0B 3VTXA 4PS3A 1HX8A 2BKKB 2FO1E 3HXEA 4BX9A 2J4BA 4K5AB 5CERB 2IOSA 4NACA 3AG3E 1H2UA 5LCWC 4I6JA 3D9JA 3UKRG 1OWOA 3AG2E 5A6CA 3G2UA 3OXFA 4WWPA 2MYOA 5EN5D 1PAQA 3CVYA 3FP3A 2WXJA 3LPZA 1OUVA 3ZYQA 4KBQA 3B7BA 3DSSA 2I1JA 3KD7A 3LJ3A 2KCVA 1N11A 2DZNA 1JPLA 4TXRA 1HFAA 3NZSA 4DI4A 1WDYA 2L0IA 3FUDA 3Q7FA 5AJLA 2L0TB 3JXJA 4A63B 4WNFA 4GTQA 1NL4A 5T4YA 1O1SA 4Y6WA 4BETA 1YYHA 5ANLA 2VGXB 1TJFA 3FUFA 5ENQD 2EILE 1KT0A 3CQGB 3QAQA 2XEVA 3MYVA 4EZJA 4HRLA 3DSVA 1LTXA 1ZB1A 5EX3A 3UT8A 3Q47B 4XIFA 3FTXA 2ZISA 2AWIA 1ELWA 5BPPA 4N2SA 2IOLA 4G26A 3I5PA 3JQ0A 4LRZA 1JWGA 4H7XA 4I2WA 1UG3A 4LUNU 3CIAA 4EQFA 3L9TA 4EZLA 3QWVA 4DK5A 3QOUA 5EKQD 2P9IG 2V0PA 4I43A 4DPRA 3EJNA 2XCCA 3AAAC 3CK7A 1UW4B 1IHBA 4HLEA 2OOEA 1LD7A 4CDRA 4QQIA 2QY7A 4F6RD 4WNEA 3B7RL 3MGBA 1EDUA 3QWPA 1V55E 3BEEA 5KJMA 4UWFA 4WNDA 4U95D 3AS8A 4EPZA 4G2VA 4FP7A 5FQ6A 3D9OA 2XPZA 4RG9A 5LCWJ 3QK0A 2J9QA 2ETBA 2ZIRA 5A23A 4CCAA 2WXFA 3S7DA 2IU1A 4BT8A 4RVBA 2XS8A 2JLBA 3FU6A 3JXIA 1UJJA 4U96D 2EIJE 1TNZA 1FPPA 1U3DA 2B6CA 4CGVA 1X81A 2JEKA 3GZ2A 4AIFA 3TWSA 5G55A 1H0AA 3FH8A 4GTPA 4N2QA 3UXGA 4AXHA 5J08A 3UTMA 3SI5A 5KJNA 2XGSA 2XGMA 3UUXA 4B8AA 1XGWA 4DUIA 2R02A 2X6FA 3FTZA 1FT2A 4TXQA 1E8ZA 3HVEA 4XE0A 3E4BA 2IEJA 3RO2A 2BKGA 2ZXWE 4DX7D 5KNHD 1HF8A 4PH4B 4JZYA 3RK6A 3FUEA 5JJ7A 3I4GA 4XZ4A 2RKKA 3SFZA 1D8DA 3Q7AA 3ZNGA 3VLDA 3IHYA 4J6IA 2QC9A 4O6FA 4DX5D 3ZHEA 4U8YD 1DCQA 4DLQA 3WG7E 1A17A 3SBTB 5AAOA 3E37A 3U4TA 2ZU6B 4CEMA 3I4RB 4GZDA 1O1RA 5G05C 3FEYA 4O60A 2KXPC 1PY1A 3PE4A 3PUKA 4J8SA 3HIZA 3KEZA 3CLJA 3LXUX 4R7LA 3L22A 4PUCA 3B7UX 4U8VD 3AG4E 4U7EB 2GROB 3CHMA 2CHWA 2BEDA 3IKOB 4BY6A 5G04C 2BF0X 4BTBA 3E34A 3R9AB 4A3TA 4HS2A 3SGHA 3ZVVA 1E7VA 4HORA 3TWWA 2DYSE 3VLFA 3MKQB 4I17A 1BD8A 3L13A 3PDNA 2PQRA 3CVNA 4DX1A 1UN9A 3LJNA 5A7DB 4K03A 3CVPA 3LCAA 2OV8A 1MX6A 5IY5E 3DSWA 2VSXE 2UY1A 3QWWA 1MHQA 5BXOA 2WXNA 4LERA 5FZRA 4JW1A 3Q9UC 4ANVA 2Y0BG 3GZ1A 3S7BA 4UQYA 2EQXA 2NSZA 2PNNA 4Y6CA 3PUJA 2MHKA 3ONKA 3ASGA 1NA3A 2VQ2A 5CCMA 3JUEA 2UY1B 2FBNA 5BW8C 4YDEA 1U3CA 3JUIA 1FVFA 4ZHBA 1H2VC 3B7SA 3HXFA 3E32A 5ENSD 4URKA 3P2BA 3Q79A 3FH7A 5AYWD 4XEIG 3MKRA 4I1OB 1DCEA 3ASFA 4GA2A 3AS5A 3URZA 4DRXE 4AY6A 3SO8A 1QYMA 1TN8A 3F6QA 4B93B 3APFA 3ZPJA 2QYJA 1QNFA 3PRZA 4U63A 4LNUD 2VTBA 1KZPA 4FJZA 3LDZA 2AW6A 1SVXA 3EHRA 3KSLA 4ZFHA 4JB8P 3RSEG 3FY4A 3AU5A 3NF1A 1SA5A 2P9KG 5T8IA 5CMYA 3HG0D 4V3IA 3U64A 3D9HA 5CRUA 4DX2A 3IEGA 1NA0A 2YQ8A 2PL2A 3AJIA 5KJLA 1KT1A 2UWJG 4ILHB 1O1TA 1VDYA 3PVLA 2CFZA 4FU3A 3FULA 3GW4A 2AXVA 4C48B 2WXHA 2OVFA 4FJYA 2C0LA 4HNAD 2GGFA 3ZYMA 2KZTB 3ASNE 3LY7A 4PS8A 3LEWA 1N4RA 1N9AA 4EECA 2Y4UA 3LKUA 4JHRA 4L7TA 1KPSB 1IKND 4A55A 3ABLE 3QB2A 5FJYA 3PZ1A 2ETAA 4G24A 3D9IA 3ABKE 5BT1A 1B89A 3DRAA 3S7JA 3N71A 3TG5A 4N5CA 3SBSA 4Z68A 4N3CA 2HO1A 4B8CB 4U8HA 2XEHA 4Q69A 1BPOA 1TNYA 2LUHA 4X8QA 1TJCA 3CK8A 1K1BA 3C72A 3VTYA 5D0OD 4CGWA 1N4QA 3RIBA 5CEAA 3RRNB 3L16A 3HXCA 5EX0A 2CHZA 2WQ7A 3BUAA 2IFUA 5EYPF 2IJGX 3EUVA 1K3ZD 2YINA 2ONDA 1ZU2A 5DBKA 4AY5A 4GYWA 1E8XA 1O5MA 2VGXA 2R05A 5EYLA 3BG1B 3UM3A 2X6KA 5HKPA 5CHEE 1GW6A 5CBOA 4GYOA 3CHQA 2DYRE 1N95A 4TV3A 5ENTD 4J7WA 1U2VG 1H6OA 1RW2A 2R2LA 3ZU7B 4KVOA 4UWKA 3OAWA 1JCQA 4GTRA 5KCMA 3TWQA 5LOZA 5HRYA 2ZGDA 4GPMA 4TUMA 3IV0A 1UN8A 4GCOA 3SY2A 3ULEG 3TGOA 2GW1A 3SHFA 1H6PA 4UWHA 3OTNA 3ZFWA 4AV7A 2KZTA 3DSUA 3U3WA 4BEPA 2XHEA 4XI0A 3S7FA 5EIBE 4U0UA 3V30A 3ABME 2XS1A 4J0UA 4KVMA 4LNBA 2LO6A 1OWMA 4QFVA 5FQ7A 4K0RA 5E75A 3MA5A 5KJKA 2DIWA 3IBEA 4U04A 3ZN3A 2H6FA 4YVOA 3EIJA 4JA7A 4LEUA 4OVUA 3U9WA 4BSZB 1BLXB 5CRVA 2KATA 2P2CP 1QBQA 2RG8A 4WUYA 3J5QB 2ILRA 3DPDA 4M7CA 4FADA 1TN7A 3QC1A 3Q5MA 5CCLA 3CVLA 2F0YA 2WPVA 1N4PA 3APDA 3ZEFA 1XNFA 2XENA 2R59A 4GTSA 3CR3A 4MLPA 3HYMB 4F3VA 4EBAG 2WXOA 3D9KA 1S63A 4PDXA 1BU9A 1SW6A 2NC9A 2V5QC 4HOQA 5AARA 4GZCA 4IYPA 3KEAA 3Q75A 2A4ZA 3VLEA 2KBXA 4L1BA 3DXKG 1WY6A 4HOUA 1HG2A 2KC7A 3CVWA 3HRAA 4HLLA 3EHMA 3KS2A 4YVQC 4DX6D 2WXQA 4HXIA 2DVWA 2VGYA 1W3BA 4OYSA 4NIKA 2JABA 1K8KG 4ATZD 1KZOA 3ZYLA 3C3OA 1RZ4A 4JXTA 3MV3B 4IN3B 4L2YA 3QJZA 3NB2A 3CVUA 1MJ0A 5JA4D 5J90A 3PZ3A 2CFUA 5D66A 1D8EA 3CSTA 3CHRA 3FHEA 3B95A 4B94A 1JCSA 5T3RA 2P9PG 2XRYA 3BQOA 2X6JA 1KLXA 2J8SD 4FC8A 1S64A 4BSXA 3ZKJA 5B3SE 4N3AA 4FHJA 5ARGA 4L2LA 2WXKA 2LXMA 3ASDA 3FUIA 3UINC 5AJDA 3NOCD 3TXMA 4JEHA 1AWCB 4XI9A 4A3VA 3EU5A 4GTMA 3RRUA 3LVQE 3SQVA 4GTVA 3FWVA 3UM1A 1NI1A 2X6HA 3PNTB 4HOSA 3DBSA 2RFMA 4HI9A 3V2OA 5FT9A 4F7AA 1HE8A 3ZW3A 4F1SA 4KT6B 4HRMB 4I9CA 4AOFA 4RQIA 3O4ZA 3C3QA 4A1SA 5ENOD 4GPKA 4IULA 5FZQA 1MX2A
chains in the Genus database with same CATH topology
2IOSA 3AU5A 4BFRA 2WXMA 3HVEB 1H2UA 4NACA 3NF1A 4I6JA 5C2YA 5LCWC 5T8IA 3D9JA 2M63A 5BV1A 3CK9A 5CMYA 4JEUA 1OWOA 3ZYKA 4V3IA 2WMOA 3CKCA 5A6CA 3G2UA 3U64A 3OXFA 4WWPA 4ANXA 3IEGA 1NA0A 3FTSA 2YQ8A 2PL2A 3Q15A 1PAQA 5KJLA 1KT1A 1ELRA 3CVYA 3MJWA 2UWJG 5CMWA 4ILHB 3MCXA 1S0PA 3FP3A 2AXZA 2WXJA 3LPZA 1OUVA 1VDYA 3CHOA 3ZYQA 4HOTA 4KBQA 3CVQA 2CFZA 2L9BA 3PVLA 4FU3A 2I1JA 3FULA 3KD7A 3GW4A 3LJ3A 2AXVA 2KCVA 1SZAA 3CVXA 2WXHA 3FUHA 4B0ZA 3ASHA 2OVFA 2Y3AA 3JYSA 3UPVA 1JPLA 3FUKA 4FJYA 1HFAA 2C0LA 2GRLA 4UQZA 3NZSA 2GGFA 3ZYMA 3MX3A 4DI4A 2FF4A 2C2LA 2L0IA 2KZTB 2YHCA 3FUDA 1ELKA 4BWRA 4PS8A 3LY7A 1HZ4A 5AJLA 5JJ6A 3LEWA 2FULA 3D9LA 4J8FA 4G11A 1FCHA 4AM9A 3L08A 1EPUA 3HHMA 2L0TB 4EECA 2Y4UA 2AXUA 3LKUA 4JHRA 4ABNA 4KXKB 5ENNA 2R5SA 4L7TA 4JC8A 4A55A 3S2AA 3QB2A 4WNFA 5FJYA 2BTDA 5T4YA 3PE3A 4KMOA 4JHKA 4G24A 3D9IA 5BT1A 4Y6WA 1B89A 3S7JA 1Z6TA 3N71A 3QNKA 4CDNA 2Q7FA 4OVVA 4I1MA 3OXLA 3ENEA 5ANLA 2VGXB 2YNQA 3CHSA 1TJFA 3FUFA 3APCA 4I6EA 2NXPA 1KT0A 3TG5A 1INZA 3CQGB 4N5CA 3SBSA 3B13A 3QAQA 2KCLA 2V5FA 1HH8A 4N3CA 2HO1A 4Q94A 2XEVA 3LY8A 3MYVA 4B8CB 4GYYA 4EZJA 4U8HA 2J4DA 2MRIA 2VYIA 3Q4AB 4MRUA 4BX8A 4Q69A 3CV0A 5EX3A 3UT8A 3Q47B 3FUNA 5JHAA 4XIFA 1NP7A 5HI7A 3FTXA 4ATGA 2DBAA 3CKBA 1BPOA 3ML9A 4U0ZA 3LS8A 2J08A 1P5QA 1TJCA 2AWIA 3CK8A 1ELWA 2KCKA 3SZ7A 4ANUA 5BPPA 3VTYA 5D0OD 4CGWA 4N2SA 2IOLA 1HG5A 4G26A 3I5PA 2RD0A 1OWNA 3JQ0A 2VSOE 4LRZA 3RIBA 4FLHA 1EF1C 1JWGA 3L16A 4H7XA 4U0SA 3RRNB 2L6JA 4G1TA 5EX0A 2CHZA 3NZUA 4MKTA 4I2WA 1UG3A 2WQ7A 1SZ9A 2DCPA 2VJ8A 4LUNU 2IFUA 3CIAA 4C0MA 1QZ2A 2VSYA 4EQFA 3CEQA 2IJGX 4I9EA 2AVPA 4UQXA 5ANRA 2XPIA 4EZLA 4ILIA 5G05J 1MQSA 3QKYA 3EIQC 3QWVA 4DK5A 2YINA 2ONDA 3QOUA 1OWPA 5EKQD 2WM9A 1ZU2A 4AEZC 5DBKA 4AY5A 4GYWA 1E8XA 2V0PA 1HS6A 5FZSA 3CQCB 2VGXA 4I43A 4YNDA 4DPRA 3EJNA 2XCCA 3GYZA 3BG1B 3CK7A 1UW4B 4GCNA 4GMJA 3UQ3A 4GA1A 4HLEA 2OOEA 4CDRA 4HFGA 2X6KA 4CT0A 2QY7A 5CHEE 1GW6A 1Z3YA 4GYOA 3FH5A 3CHQA 3B7RL 4WNEA 4DJAA 1IHGA 2J07A 4TV3A 3TJPA 5AENA 3MGBA 3UMVA 3PZDA 3NQPA 1WAO1 3RRMB 2J09A 5FQ8A 3L6AA 2LAHA 3C98A 1EDUA 3QWPA 3LY9A 2GRMA 3BEEA 5KJMA 1WM5A 4EBAA 4UWFA 4WNDA 3AS8A 4UI9C 4EPZA 4G2VA 1Y8MA 4FP7A 4KVOA 4JVSA 4UWKA 3OAWA 5FQ6A 5KCMA 5LOZA 3D9OA 2XPZA 3MZLB 3P1UA 3R7QA 3D9PA 4RG9A 5LCWJ 3QK0A 3QDNA 3IV0A 5G04J 1UN8A 2J9QA 4GCOA 5LP0A 3ULQA 3TGOA 2GW1A 3SHFA 5A23A 3SNXA 1OWLA 3UT4A 4FLBA 4CCAA 2WXFA 3S7DA 4UWHA 3OTNA 2IU1A 4BT8A 3TAXA 4G25A 4RVBA 3ZFWA 4W9RA 2JLBA 5M72A 3FU6A 4AV7A 2LAIA 1IQRA 2V8SE 1UJJA 2KZTA 3G2VA 5BNWA 4ILGA 4B89A 3T5VA 3U3WA 1U3DA 4DLOA 2E0IA 2PM6A 4CGVA 2XHEA 2JEKA 3GZ2A 3RKVA 4AP2A 4XI0A 3S7FA 5FWQA 4AIFA 3AS4A 3FU0A 5G55A 2FEZA 4U0UA 1LF8A 3TXNA 4AVXA 1H0AA 4JL0A 4A1GA 3FH8A 4N2QA 2WXPA 4AXHA 4J0UA 4KVMA 5J08A 3EDTB 4FULA 2VTBB 2LO6A 1OWMA 3ESLA 3SI5A 4JPSA 5KJNA 2XGSA 2XGMA 4ME2A 4QFVA 3QARA 5FQ7A 5D0QD 4K0RA 3UUXA 4NQ0A 5E75A 4B8AA 3WXXA 4APFA 3MA5A 3JCKC 1H19A 1SQMA 1XGWA 5KJKA 2DIWA 3IBEA 2R17C 2X6FA 4U04A 3ZN3A 3FTZA 4I2ZA 3SD5A 4WWNA 4YVOA 1E8ZA 1HO8A 3EIJA 4JA7A 4LEUA 4OVUA 4GAAA 3HVEA 2C0MA 3Q49B 4XE0A 3U9WA 4KZ0A 3E4BA 1X5BA 1E7UA 3HDXA 3FTWA 5C1DA 5DIZA 3RO2A 2KATA 2A5UA 5BUZA 3L54A 2RG8A 3PS6A 2WQHA 1HF8A 4WUYA 4PH4B 4JZYA 1JUQA 2ILRA 5HQ8A 3RK6A 2I9CA 3DPDA 3FUEA 3ZRHA 5JJ7A 3I4GA 4FADA 3QC1A 3TG4A 3Q5MA 1IYGA 5CCLA 4UI9J 3TL5A 4XZ4A 5JJTA 3CVLA 3SFZA 5LX8A 2LNIA 4MS6A 2WPVA 3G2SA 4CT4A 3VLDA 3ESKA 3CVVA 3APDA 3IHYA 1XNFA 4J6IA 3ZEFA 2R59A 4GZ5A 2HM8A 1E8WA 3CR3A 4G23A 1E96B 4O6FA 4WWOA 4MLPA 2PZIA 3HYMB 3PEUB 4EBAG 4F3VA 2WXOA 3ZHEA 2BUGA 3D9KA 4PDXA 4NRHB 2NC9A 4DLQA 2WXLA 2KM4A 1A17A 4HOQA 3SBTB 4GZCA 4IYPA 4UWLA 3O48A 2I1KA 3U4TA 2ZU6B 4CEMA 2CHXA 3I4RB 2V4LA 3G2TA 4GZDA 2A4ZA 4RSYA 3FFLA 1Y6IA 4GA0A 2X3MA 3VLEA 4L1BA 5FTPA 3FTVA 5G05C 3FEYA 4JHJA 5JHBA 1WY6A 4HOUA 3R7RA 3UT7A 1HG2A 1PY1A 2KC7A 2IF4A 3PE4A 3ZIMA 3CVWA 4ACKA 3D9NA 3PUKA 4J8SA 4PS7A 3EHMA 4HVBA 3KS2A 4YVQC 3HIZA 3KEZA 3MKQA 2X6IA 3CLJA 2WXQA 4HXIA 2WQ6A 3LXUX 4J8EA 5EDSA 2VGYA 3PREA 2FI7A 2PQNA 3FU5A 4R7LA 3L22A 3FUJA 4PUCA 3B7UX 1W3BA 3FTYA 4OYSA 5BV0A 2IQCA 2LSUA 3L17A 3CHMA 4GZ3A 4J8DA 2CHWA 3IKOB 2WXRA 4M3OA 5LFAA 2HYZA 2XPYA 3B7TA 5ARFA 4BY6A 5G04C 4DI3A 2BF0X 4WNGA 3KAEA 3T8MA 4GZ6A 3ZYLA 4BTBA 1E8YA 4N3BA 3R9AB 4A3TA 4HS2A 4BTAA 3SGHA 3ZVVA 4JXTA 4GB9A 3GZSA 2CG3A 3CSFA 1E7VA 3MV3B 2X38A 3ML8A 4IN3B 4L2YA 3VLFA 3MKQB 4HORA 4I17A 3QJZA 4KYOB 4N39A 3ONLA 4WAFA 3L13A 3PDNA 2PQRA 3CVUA 2YHEA 1ZBPA 3CVNA 1TEZA 5J90A 1DVPA 2VSNA 3I3NA 1UN9A 5A7DB 4K03A 3CVPA 4F53A 1HU3A 4UWGA 4FA6A 2I2OA 3LCAA 2OV8A 2CFUA 3AU4A 1UJKA 1FVHA 1EYHA 2VSXE 2UY1A 4BT9A 3QWWA 1MHQA 1N54A 3ZGQA 3CSTA 3U66A 3CHRA 4ACLA 1H6KA 3FHEA 4B94A 1E90A 3D9MA 2WXIA 2WXNA 4FHKA 4Q96A 2FO7A 3PH0C 5T3RA 1PC2A 2XRYA 2X6JA 3PNLB 1KLXA 1HXIA 3OXGA 4LERA 4JW1A 5FZRA 4ANVA 4FC8A 3FU3A 4BSXA 4KZCA 2OVBA 4CDMA 1Z3XA 2J49A 3GZ1A 3S7BA 4I1AA 4UQYA 4E6HA 1NZNA 2EQXA 2NSZA 4Y6CA 4E85A 3PUJA 1DNPA 2MHKA 3ONKA 4LCTA 4EZKA 4N3AA 2I6HA 3ASGA 3RO3A 1NA3A 2VQ2A 4FHJA 5CCMA 1IQUA 2XQ0A 3RU0A 3RJVA 2UY1B 2FBNA 1QQEA 5ARGA 5BW8C 3K9IA 3PEVB 4L2LA 2WXKA 5AIJA 4TRQA 3ASDA 3EHNA 3MV2B 4H7YA 5FQ4A 2XCBA 3CGHA 2WVIA 4C0EA 3JQ1A 3FUIA 1U3CA 4JA9A 4D10C 4XKBA 5AJDA 3CHPA 2HR2A 3JUIA 1FVFA 3TXMA 4JEHA 3T5XA 1H2VC 3B7SA 4ANWA 4XI9A 4A3VA 5E76A 2WXGA 2E2EA 2LSVA 3ZXSA 4URKA 3RRUA 2WB2A 1H2TC 3LVQE 3P2BA 3FH7A 5AYWD 3D3MA 3MKRA 2P58C 4APOA 4I1OB 3FUMA 1JWFA 3ASFA 3FWVA 2IONA 4GA2A 4NURA 3AS5A 4IRUA 3LYAA 2PM7A 4GU5A 3URZA 3SF4A 4UI9K 4AY6A 2X6HA 3PNTB 4I6GA 4HOSA 3FDHA 4RG6A 3DBSA 3LVRE 5FT9A 4F7AA 3G2WA 3ZHEB 3APFA 3ZPJA 2CG2A 4CRWA 1HE8A 3FEXA 3ZW3A 2XGOA 3IHVA 4P29A 1QNFA 4F1SA 3PRZA 4KT6B 4TUUA 1N52A 5G2NA 1L5JA 2WMNA 4GMLA 4C9BB 4I9CA 4L23A 2Y4TA 4U63A 3UX4A 4AOFA 2MOWA 3O4ZA 3BG0B 2VTBA 1YA0A 4FJZA 3VTXA 4U07A 3LDZA 4PS3A 2AW6A 1HX8A 2XRZA 4A1SA 4AJWA 3MEKA 2QFCA 3FTUA 4XX5A 4GPKA 4BX9A 2J4BA 4IULA 5FZQA 3FY4A 4XKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2V C;  2IOS A;  4B89 A;  4CRW A;  4B8C B;  1UG3 A;  3FEX A;  1H2U A;  4LUN U;  2NSZ A;  2ZU6 B;  4CEM A;  1H2T C;  1N52 A;  1HU3 A;  4GML A;  2I2O A;  3EIJ A;  4JHK A;  5ANR A;  3D3M A;  4C9B B;  3EIQ C;  3FEY A;  2GGF A;  2VSX E;  4JHJ A;  4CT4 A;  3L6A A;  2ION A;  1N54 A;  2IU1 A;  2KZT B;  1H6K A;  2HM8 A;  1PAQ A;  2IOL A;  2FUL A;  2RG8 A;  4B8A A;  2KZT A;  2VSO E;  4IUL A;  1UW4 B;  4GMJ A;  3JUI A;  3RK6 A; 
#chains in the Genus database with same CATH topology
 4BFR A;  2WXM A;  3HVE B;  5C2Y A;  3BU8 A;  3CK9 A;  3T8K A;  3CKC A;  3C5R A;  4ANX A;  3FTS A;  5AQ7 A;  4G8L A;  1ELR A;  2GRN B;  1S0P A;  3CHO A;  1V54 E;  3CVQ A;  3V31 A;  1OT8 A;  1SZA A;  2ETC A;  3FUH A;  4B0Z A;  3ASH A;  2Y3A A;  1OCC E;  3JYS A;  3FUK A;  3UPV A;  5KNG A;  4UQZ A;  3T9K A;  3MX3 A;  2XEE A;  5JJ6 A;  3E30 A;  2FUL A;  3D9L A;  4N5Q A;  4J8F A;  4G11 A;  1FCH A;  4AM9 A;  3L08 A;  1EPU A;  2AXU A;  1N0R A;  3NBN B;  4JC8 A;  2OCC E;  3S2A A;  4BER A;  2BTD A;  3W9F A;  2A5E A;  3QNK A;  4CDN A;  4OVV A;  2Y1L E;  3ENE A;  2NXP A;  3B13 A;  2KCL A;  4L9P A;  4Q94 A;  3LY8 A;  2J4D A;  2MRI A;  1Q2Z A;  3Q4A B;  4MRU A;  5JHA A;  1NP7 A;  5HI7 A;  3CKB A;  3ML9 A;  1TNO A;  2J08 A;  1P5Q A;  1Z5S C;  2LXL A;  4ANU A;  1HG5 A;  1OWN A;  1EF1 C;  4U0S A;  2L6J A;  4G1T A;  3NZU A;  5AQ9 A;  4K5C A;  4I9E A;  2AVP A;  4UQX A;  5ANR A;  5G05 J;  5H7P A;  1MQS A;  3EIQ C;  2F37 A;  2WM9 A;  4AEZ C;  4K5B A;  3SFY A;  3CQC B;  3DXM G;  3GYZ A;  3SFX A;  5ENP D;  5AQA A;  4HFG A;  2XZT G;  4RLY A;  1AP7 A;  5FIO A;  3FH5 A;  1IHG A;  3ISM C;  5AEN A;  3UMV A;  4J8Y A;  2J09 A;  5FQ8 A;  1OCZ E;  3C98 A;  4UI9 C;  5BXU A;  1WG0 A;  2IO3 C;  3R7Q A;  4GTO A;  3UKU G;  3QDN A;  3PZ4 A;  2P9U G;  5G04 J;  2F8Y A;  3ULQ A;  3SNX A;  3UT4 A;  5JMN D;  4G25 A;  5M72 A;  2LAI A;  2V8S E;  2E0I A;  2PM6 A;  3RKV A;  4AP2 A;  3AS4 A;  3FU0 A;  1MYO A;  4A1G A;  4JL0 A;  2WXP A;  4FUL A;  4JPS A;  2HE0 A;  4ME2 A;  5D0Q D;  4NQ0 A;  4LG6 A;  3WXX A;  2P9S G;  3JCK C;  1H19 A;  5D2M C;  4I2Z A;  3SD5 A;  4HQD A;  4WWN A;  1MZC A;  2F8X K;  1HO8 A;  2C0M A;  3HDX A;  5C1D A;  5DIZ A;  2A5U A;  5BUZ A;  1OY3 D;  3PS6 A;  2WQH A;  3HXB A;  1JUQ A;  4BES A;  3TWR A;  1IYG A;  5LX8 A;  2LNI A;  4MS6 A;  3ESK A;  2H6H A;  2HM8 A;  4G23 A;  4F1P A;  2PZI A;  3PEU B;  3UM2 A;  2BUG A;  4NRH B;  1NFI E;  2WXL A;  2KM4 A;  2IO2 C;  1D9S A;  2I1K A;  2V4L A;  3G2T A;  3ZXP A;  4GA0 A;  5ENR D;  5FTP A;  3FTV A;  4JHJ A;  5JHB A;  3ZIM A;  1YMP A;  4ACK A;  3D9N A;  1TNB A;  4G8K A;  3PRE A;  2FI7 A;  3FUJ A;  3W9G A;  5BV0 A;  2IQC A;  2LSU A;  3L17 A;  2WXR A;  4M3O A;  2HYZ A;  3B7T A;  4DI3 A;  4WNG A;  3T8M A;  1E8Y A;  1N0Q A;  1BI8 B;  4GB9 A;  5BNW A;  2CG3 A;  2X38 A;  3TWV A;  4N39 A;  4WAF A;  4TXP A;  1TN6 A;  3Q73 A;  1DVP A;  3I3N A;  4FA6 A;  2I2O A;  1OCO E;  3AU4 A;  1UJK A;  1FVH A;  1EYH A;  4BT9 A;  3ZGQ A;  3U66 A;  4ACL A;  1H6K A;  3D9M A;  2WXI A;  2FO7 A;  3PH0 C;  3UM0 A;  3OXG A;  2Y69 E;  2GRQ B;  4CDM A;  4I1A A;  3X2Q E;  4E85 A;  1DNP A;  1FT1 A;  4EZK A;  1IQU A;  2XQ0 A;  3RU0 A;  1IXV A;  4HRN A;  1QQE A;  3K9I A;  3TWU A;  5AIJ A;  3MV2 B;  5FQ4 A;  4O1P A;  4C0E A;  3JQ1 A;  4JA9 A;  3TWX A;  3CHP A;  4ANW A;  5E76 A;  2WXG A;  3UIO C;  4UUC A;  3ZXS A;  1MX4 A;  2H6G A;  3FUM A;  1JWF A;  2EIM E;  2ION A;  4NUR A;  3SF4 A;  4UI9 K;  4I6G A;  2L6B A;  4RG6 A;  3UI2 A;  3G2W A;  3ZHE B;  4CRW A;  3DEO A;  3FEX A;  2XGO A;  4P29 A;  2WMN A;  4C9B B;  2Y4T A;  3V2X A;  3L82 A;  1YA0 A;  4U07 A;  1OXJ A;  2XRZ A;  4AJW A;  3MEK A;  2QFC A;  3FTU A;  4XX5 A;  3R9M A;  5CEC B;  4XKC A;  2M63 A;  5BV1 A;  4JEU A;  3Q78 A;  3ZYK A;  2WMO A;  1SA4 A;  5B1A E;  3Q15 A;  3MJW A;  5CMW A;  3MCX A;  5KWD A;  2AXZ A;  3Q9N C;  4HOT A;  2OEV A;  2L9B A;  5B1B E;  3CVX A;  2GRL A;  2FF4 A;  2C2L A;  2YHC A;  1ELK A;  4BWR A;  1HZ4 A;  2B0O E;  3HXD A;  3HHM A;  4ABN A;  1OCR E;  4KXK B;  5EID A;  5ENN A;  2R5S A;  3PE3 A;  4KMO A;  4JHK A;  3DEP A;  3PZ2 A;  1Z6T A;  4HI8 A;  2Q7F A;  4I1M A;  3OXL A;  2YNQ A;  3CHS A;  3APC A;  4I6E A;  1A5E A;  1INZ A;  2V5F A;  1HH8 A;  4GYY A;  4YDY A;  2VYI A;  4BX8 A;  3CV0 A;  3FUN A;  3C3R A;  4ATG A;  3UIP C;  2DBA A;  1N94 A;  4U0Z A;  3LS8 A;  3RAU A;  5AN8 A;  2GRR B;  2KCK A;  4YDO A;  3SZ7 A;  2RD0 A;  2VSO E;  4FLH A;  4MKT A;  1SZ9 A;  2DCP A;  2VJ8 A;  4C0M A;  1QZ2 A;  2VSY A;  3CEQ A;  2EIK E;  2XPI A;  4ILI A;  3QKY A;  1OWP A;  2AJA A;  2GRP B;  3ASO E;  4HBD A;  1HS6 A;  5FZS A;  4YND A;  2DZO A;  4CYM D;  4GCN A;  4GMJ A;  3UQ3 A;  4GA1 A;  4CT0 A;  4JD2 G;  1Z3Y A;  1LD8 A;  4DJA A;  2J07 A;  3TJP A;  5CBN A;  3PZD A;  3NQP A;  1WAO 1;  3RRM B;  3L6A A;  2LAH A;  3EU9 A;  3LY9 A;  2V4H C;  2GRM A;  1WM5 A;  4EBA A;  2VGE A;  1Y8M A;  4JVS A;  3MZL B;  3P1U A;  1TR4 A;  3D9P A;  5LP0 A;  3AG1 E;  1OWL A;  4FLB A;  3TAX A;  4W9R A;  1IQR A;  3G2V A;  5FIN A;  4ILG A;  4B89 A;  3T5V A;  1YCS B;  4DLO A;  4LNG A;  4MBG A;  5FWQ A;  2QYU A;  2FEZ A;  1LF8 A;  3TXN A;  4AVX A;  2R03 A;  2XZD G;  3EDT B;  2VTB B;  3ESL A;  3QAR A;  4GTT A;  4APF A;  1SQM A;  2R17 C;  1G3N B;  3EHQ A;  4GAA A;  3Q49 B;  3ULY A;  4KZ0 A;  2EIN E;  1X5B A;  1E7U A;  4CZ2 D;  2ZGG A;  3FTW A;  1K1A A;  3L54 A;  3E33 A;  2RFA A;  2P9L G;  5HQ8 A;  2I9C A;  3ZRH A;  4OAV B;  3TG4 A;  4UI9 J;  1N4S A;  3TL5 A;  5JJT A;  3G2S A;  4CT4 A;  3CVV A;  2IY0 C;  4GZ5 A;  1E8W A;  1E96 B;  4WWO A;  5EIL A;  4UWL A;  3O48 A;  2NYJ A;  2CHX A;  3NAW A;  4RSY A;  3FFL A;  3KSQ A;  1Y6I A;  2X3M A;  5KBA A;  3UT7 A;  3R7R A;  2IF4 A;  4HVB A;  4PS7 A;  3MKQ A;  2X6I A;  2WQ6 A;  4J8E A;  5EDS A;  2PQN A;  3FU5 A;  3FTY A;  4GZ3 A;  4J8D A;  5LFA A;  2XPY A;  5ARF A;  4EHM A;  3KAE A;  4GZ6 A;  3DSX A;  1UOH A;  4N3B A;  4BTA A;  3GZS A;  3CSF A;  3ML8 A;  4KYO B;  3ONL A;  2YHE A;  1ZBP A;  3DST A;  1TEZ A;  2VSN A;  3DPY A;  2QZA A;  5CED B;  3IXE A;  3ZUV B;  3J5P A;  1HU3 A;  4F53 A;  4UWG A;  4GMR A;  1N54 A;  4LSZ E;  4HB5 A;  1E90 A;  4Q96 A;  4FHK A;  1PC2 A;  3PNL B;  5ITZ F;  1HXI A;  3FU3 A;  4KZC A;  2OVB A;  1Z3X A;  2DWZ A;  2J49 A;  4E6H A;  1NZN A;  4LCT A;  2H6I A;  2I6H A;  3RO3 A;  3RJV A;  1BI7 B;  3PEV B;  4TRQ A;  1TNU A;  3EHN A;  2OEW A;  4H7Y A;  2XCB A;  3CGH A;  2WVI A;  5HS0 A;  4D10 C;  4XKB A;  5AQB A;  2HR2 A;  3T5X A;  1TYQ G;  1JCR A;  1DC2 A;  3TWT A;  2E2E A;  2LSV A;  2WB2 A;  1H2T C;  3D3M A;  2P58 C;  4APO A;  4YDW A;  4IRU A;  3LYA A;  2PM7 A;  4GU5 A;  3DWL G;  3FDH A;  3LVR E;  3NOG D;  3V79 K;  4O1O A;  2P9N G;  1S70 B;  2CG2 A;  3IHV A;  4OAU C;  4TUU A;  1N52 A;  5G2N A;  1L5J A;  4GML A;  4L23 A;  3UX4 A;  2MOW A;  3BG0 B;  3VTX A;  4PS3 A;  1HX8 A;  2BKK B;  2FO1 E;  3HXE A;  4BX9 A;  2J4B A;  4K5A B;  5CER B;  2IOS A;  4NAC A;  3AG3 E;  1H2U A;  5LCW C;  4I6J A;  3D9J A;  3UKR G;  1OWO A;  3AG2 E;  5A6C A;  3G2U A;  3OXF A;  4WWP A;  2MYO A;  5EN5 D;  1PAQ A;  3CVY A;  3FP3 A;  2WXJ A;  3LPZ A;  1OUV A;  3ZYQ A;  4KBQ A;  3B7B A;  3DSS A;  2I1J A;  3KD7 A;  3LJ3 A;  2KCV A;  1N11 A;  2DZN A;  1JPL A;  4TXR A;  1HFA A;  3NZS A;  4DI4 A;  1WDY A;  2L0I A;  3FUD A;  3Q7F A;  5AJL A;  2L0T B;  3JXJ A;  4A63 B;  4WNF A;  4GTQ A;  1NL4 A;  5T4Y A;  1O1S A;  4Y6W A;  4BET A;  1YYH A;  5ANL A;  2VGX B;  1TJF A;  3FUF A;  5ENQ D;  2EIL E;  1KT0 A;  3CQG B;  3QAQ A;  2XEV A;  3MYV A;  4EZJ A;  4HRL A;  3DSV A;  1LTX A;  1ZB1 A;  5EX3 A;  3UT8 A;  3Q47 B;  4XIF A;  3FTX A;  2ZIS A;  2AWI A;  1ELW A;  5BPP A;  4N2S A;  2IOL A;  4G26 A;  3I5P A;  3JQ0 A;  4LRZ A;  1JWG A;  4H7X A;  4I2W A;  1UG3 A;  4LUN U;  3CIA A;  4EQF A;  3L9T A;  4EZL A;  3QWV A;  4DK5 A;  3QOU A;  5EKQ D;  2P9I G;  2V0P A;  4I43 A;  4DPR A;  3EJN A;  2XCC A;  3AAA C;  3CK7 A;  1UW4 B;  1IHB A;  4HLE A;  2OOE A;  1LD7 A;  4CDR A;  4QQI A;  2QY7 A;  4F6R D;  4WNE A;  3B7R L;  3MGB A;  1EDU A;  3QWP A;  1V55 E;  3BEE A;  5KJM A;  4UWF A;  4WND A;  4U95 D;  3AS8 A;  4EPZ A;  4G2V A;  4FP7 A;  5FQ6 A;  3D9O A;  2XPZ A;  4RG9 A;  5LCW J;  3QK0 A;  2J9Q A;  2ETB A;  2ZIR A;  5A23 A;  4CCA A;  2WXF A;  3S7D A;  2IU1 A;  4BT8 A;  4RVB A;  2XS8 A;  2JLB A;  3FU6 A;  3JXI A;  1UJJ A;  4U96 D;  2EIJ E;  1TNZ A;  1FPP A;  1U3D A;  2B6C A;  4CGV A;  1X81 A;  2JEK A;  3GZ2 A;  4AIF A;  3TWS A;  5G55 A;  1H0A A;  3FH8 A;  4GTP A;  4N2Q A;  3UXG A;  4AXH A;  5J08 A;  3UTM A;  3SI5 A;  5KJN A;  2XGS A;  2XGM A;  3UUX A;  4B8A A;  1XGW A;  4DUI A;  2R02 A;  2X6F A;  3FTZ A;  1FT2 A;  4TXQ A;  1E8Z A;  3HVE A;  4XE0 A;  3E4B A;  2IEJ A;  3RO2 A;  2BKG A;  2ZXW E;  4DX7 D;  5KNH D;  1HF8 A;  4PH4 B;  4JZY A;  3RK6 A;  3FUE A;  5JJ7 A;  3I4G A;  4XZ4 A;  2RKK A;  3SFZ A;  1D8D A;  3Q7A A;  3ZNG A;  3VLD A;  3IHY A;  4J6I A;  2QC9 A;  4O6F A;  4DX5 D;  3ZHE A;  4U8Y D;  1DCQ A;  4DLQ A;  3WG7 E;  1A17 A;  3SBT B;  5AAO A;  3E37 A;  3U4T A;  2ZU6 B;  4CEM A;  3I4R B;  4GZD A;  1O1R A;  5G05 C;  3FEY A;  4O60 A;  2KXP C;  1PY1 A;  3PE4 A;  3PUK A;  4J8S A;  3HIZ A;  3KEZ A;  3CLJ A;  3LXU X;  4R7L A;  3L22 A;  4PUC A;  3B7U X;  4U8V D;  3AG4 E;  4U7E B;  2GRO B;  3CHM A;  2CHW A;  2BED A;  3IKO B;  4BY6 A;  5G04 C;  2BF0 X;  4BTB A;  3E34 A;  3R9A B;  4A3T A;  4HS2 A;  3SGH A;  3ZVV A;  1E7V A;  4HOR A;  3TWW A;  2DYS E;  3VLF A;  3MKQ B;  4I17 A;  1BD8 A;  3L13 A;  3PDN A;  2PQR A;  3CVN A;  4DX1 A;  1UN9 A;  3LJN A;  5A7D B;  4K03 A;  3CVP A;  3LCA A;  2OV8 A;  1MX6 A;  5IY5 E;  3DSW A;  2VSX E;  2UY1 A;  3QWW A;  1MHQ A;  5BXO A;  2WXN A;  4LER A;  5FZR A;  4JW1 A;  3Q9U C;  4ANV A;  2Y0B G;  3GZ1 A;  3S7B A;  4UQY A;  2EQX A;  2NSZ A;  2PNN A;  4Y6C A;  3PUJ A;  2MHK A;  3ONK A;  3ASG A;  1NA3 A;  2VQ2 A;  5CCM A;  3JUE A;  2UY1 B;  2FBN A;  5BW8 C;  4YDE A;  1U3C A;  3JUI A;  1FVF A;  4ZHB A;  1H2V C;  3B7S A;  3HXF A;  3E32 A;  5ENS D;  4URK A;  3P2B A;  3Q79 A;  3FH7 A;  5AYW D;  4XEI G;  3MKR A;  4I1O B;  1DCE A;  3ASF A;  4GA2 A;  3AS5 A;  3URZ A;  4DRX E;  4AY6 A;  3SO8 A;  1QYM A;  1TN8 A;  3F6Q A;  4B93 B;  3APF A;  3ZPJ A;  2QYJ A;  1QNF A;  3PRZ A;  4U63 A;  4LNU D;  2VTB A;  1KZP A;  4FJZ A;  3LDZ A;  2AW6 A;  1SVX A;  3EHR A;  3KSL A;  4ZFH A;  4JB8 P;  3RSE G;  3FY4 A;  3AU5 A;  3NF1 A;  1SA5 A;  2P9K G;  5T8I A;  5CMY A;  3HG0 D;  4V3I A;  3U64 A;  3D9H A;  5CRU A;  4DX2 A;  3IEG A;  1NA0 A;  2YQ8 A;  2PL2 A;  3AJI A;  5KJL A;  1KT1 A;  2UWJ G;  4ILH B;  1O1T A;  1VDY A;  3PVL A;  2CFZ A;  4FU3 A;  3FUL A;  3GW4 A;  2AXV A;  4C48 B;  2WXH A;  2OVF A;  4FJY A;  2C0L A;  4HNA D;  2GGF A;  3ZYM A;  2KZT B;  3ASN E;  3LY7 A;  4PS8 A;  3LEW A;  1N4R A;  1N9A A;  4EEC A;  2Y4U A;  3LKU A;  4JHR A;  4L7T A;  1KPS B;  1IKN D;  4A55 A;  3ABL E;  3QB2 A;  5FJY A;  3PZ1 A;  2ETA A;  4G24 A;  3D9I A;  3ABK E;  5BT1 A;  1B89 A;  3DRA A;  3S7J A;  3N71 A;  3TG5 A;  4N5C A;  3SBS A;  4Z68 A;  4N3C A;  2HO1 A;  4B8C B;  4U8H A;  2XEH A;  4Q69 A;  1BPO A;  1TNY A;  2LUH A;  4X8Q A;  1TJC A;  3CK8 A;  1K1B A;  3C72 A;  3VTY A;  5D0O D;  4CGW A;  1N4Q A;  3RIB A;  5CEA A;  3RRN B;  3L16 A;  3HXC A;  5EX0 A;  2CHZ A;  2WQ7 A;  3BUA A;  2IFU A;  5EYP F;  2IJG X;  3EUV A;  1K3Z D;  2YIN A;  2OND A;  1ZU2 A;  5DBK A;  4AY5 A;  4GYW A;  1E8X A;  1O5M A;  2VGX A;  2R05 A;  5EYL A;  3BG1 B;  3UM3 A;  2X6K A;  5HKP A;  5CHE E;  1GW6 A;  5CBO A;  4GYO A;  3CHQ A;  2DYR E;  1N95 A;  4TV3 A;  5ENT D;  4J7W A;  1U2V G;  1H6O A;  1RW2 A;  2R2L A;  3ZU7 B;  4KVO A;  4UWK A;  3OAW A;  1JCQ A;  4GTR A;  5KCM A;  3TWQ A;  5LOZ A;  5HRY A;  2ZGD A;  4GPM A;  4TUM A;  3IV0 A;  1UN8 A;  4GCO A;  3SY2 A;  3ULE G;  3TGO A;  2GW1 A;  3SHF A;  1H6P A;  4UWH A;  3OTN A;  3ZFW A;  4AV7 A;  2KZT A;  3DSU A;  3U3W A;  4BEP A;  2XHE A;  4XI0 A;  3S7F A;  5EIB E;  4U0U A;  3V30 A;  3ABM E;  2XS1 A;  4J0U A;  4KVM A;  4LNB A;  2LO6 A;  1OWM A;  4QFV A;  5FQ7 A;  4K0R A;  5E75 A;  3MA5 A;  5KJK A;  2DIW A;  3IBE A;  4U04 A;  3ZN3 A;  2H6F A;  4YVO A;  3EIJ A;  4JA7 A;  4LEU A;  4OVU A;  3U9W A;  4BSZ B;  1BLX B;  5CRV A;  2KAT A;  2P2C P;  1QBQ A;  2RG8 A;  4WUY A;  3J5Q B;  2ILR A;  3DPD A;  4M7C A;  4FAD A;  1TN7 A;  3QC1 A;  3Q5M A;  5CCL A;  3CVL A;  2F0Y A;  2WPV A;  1N4P A;  3APD A;  3ZEF A;  1XNF A;  2XEN A;  2R59 A;  4GTS A;  3CR3 A;  4MLP A;  3HYM B;  4F3V A;  4EBA G;  2WXO A;  3D9K A;  1S63 A;  4PDX A;  1BU9 A;  1SW6 A;  2NC9 A;  2V5Q C;  4HOQ A;  5AAR A;  4GZC A;  4IYP A;  3KEA A;  3Q75 A;  2A4Z A;  3VLE A;  2KBX A;  4L1B A;  3DXK G;  1WY6 A;  4HOU A;  1HG2 A;  2KC7 A;  3CVW A;  3HRA A;  4HLL A;  3EHM A;  3KS2 A;  4YVQ C;  4DX6 D;  2WXQ A;  4HXI A;  2DVW A;  2VGY A;  1W3B A;  4OYS A;  4NIK A;  2JAB A;  1K8K G;  4ATZ D;  1KZO A;  3ZYL A;  3C3O A;  1RZ4 A;  4JXT A;  3MV3 B;  4IN3 B;  4L2Y A;  3QJZ A;  3NB2 A;  3CVU A;  1MJ0 A;  5JA4 D;  5J90 A;  3PZ3 A;  2CFU A;  5D66 A;  1D8E A;  3CST A;  3CHR A;  3FHE A;  3B95 A;  4B94 A;  1JCS A;  5T3R A;  2P9P G;  2XRY A;  3BQO A;  2X6J A;  1KLX A;  2J8S D;  4FC8 A;  1S64 A;  4BSX A;  3ZKJ A;  5B3S E;  4N3A A;  4FHJ A;  5ARG A;  4L2L A;  2WXK A;  2LXM A;  3ASD A;  3FUI A;  3UIN C;  5AJD A;  3NOC D;  3TXM A;  4JEH A;  1AWC B;  4XI9 A;  4A3V A;  3EU5 A;  4GTM A;  3RRU A;  3LVQ E;  3SQV A;  4GTV A;  3FWV A;  3UM1 A;  1NI1 A;  2X6H A;  3PNT B;  4HOS A;  3DBS A;  2RFM A;  4HI9 A;  3V2O A;  5FT9 A;  4F7A A;  1HE8 A;  3ZW3 A;  4F1S A;  4KT6 B;  4HRM B;  4I9C A;  4AOF A;  4RQI A;  3O4Z A;  3C3Q A;  4A1S A;  5ENO D;  4GPK A;  4IUL A;  5FZQ A;  1MX2 A; 
#chains in the Genus database with same CATH homology
 2IOS A;  3AU5 A;  4BFR A;  2WXM A;  3HVE B;  1H2U A;  4NAC A;  3NF1 A;  4I6J A;  5C2Y A;  5LCW C;  5T8I A;  3D9J A;  2M63 A;  5BV1 A;  3CK9 A;  5CMY A;  4JEU A;  1OWO A;  3ZYK A;  4V3I A;  2WMO A;  3CKC A;  5A6C A;  3G2U A;  3U64 A;  3OXF A;  4WWP A;  4ANX A;  3IEG A;  1NA0 A;  3FTS A;  2YQ8 A;  2PL2 A;  3Q15 A;  1PAQ A;  5KJL A;  1KT1 A;  1ELR A;  3CVY A;  3MJW A;  2UWJ G;  5CMW A;  4ILH B;  3MCX A;  1S0P A;  3FP3 A;  2AXZ A;  2WXJ A;  3LPZ A;  1OUV A;  1VDY A;  3CHO A;  3ZYQ A;  4HOT A;  4KBQ A;  3CVQ A;  2CFZ A;  2L9B A;  3PVL A;  4FU3 A;  2I1J A;  3FUL A;  3KD7 A;  3GW4 A;  3LJ3 A;  2AXV A;  2KCV A;  1SZA A;  3CVX A;  2WXH A;  3FUH A;  4B0Z A;  3ASH A;  2OVF A;  2Y3A A;  3JYS A;  3UPV A;  1JPL A;  3FUK A;  4FJY A;  1HFA A;  2C0L A;  2GRL A;  4UQZ A;  3NZS A;  2GGF A;  3ZYM A;  3MX3 A;  4DI4 A;  2FF4 A;  2C2L A;  2L0I A;  2KZT B;  2YHC A;  3FUD A;  1ELK A;  4BWR A;  4PS8 A;  3LY7 A;  1HZ4 A;  5AJL A;  5JJ6 A;  3LEW A;  2FUL A;  3D9L A;  4J8F A;  4G11 A;  1FCH A;  4AM9 A;  3L08 A;  1EPU A;  3HHM A;  2L0T B;  4EEC A;  2Y4U A;  2AXU A;  3LKU A;  4JHR A;  4ABN A;  4KXK B;  5ENN A;  2R5S A;  4L7T A;  4JC8 A;  4A55 A;  3S2A A;  3QB2 A;  4WNF A;  5FJY A;  2BTD A;  5T4Y A;  3PE3 A;  4KMO A;  4JHK A;  4G24 A;  3D9I A;  5BT1 A;  4Y6W A;  1B89 A;  3S7J A;  1Z6T A;  3N71 A;  3QNK A;  4CDN A;  2Q7F A;  4OVV A;  4I1M A;  3OXL A;  3ENE A;  5ANL A;  2VGX B;  2YNQ A;  3CHS A;  1TJF A;  3FUF A;  3APC A;  4I6E A;  2NXP A;  1KT0 A;  3TG5 A;  1INZ A;  3CQG B;  4N5C A;  3SBS A;  3B13 A;  3QAQ A;  2KCL A;  2V5F A;  1HH8 A;  4N3C A;  2HO1 A;  4Q94 A;  2XEV A;  3LY8 A;  3MYV A;  4B8C B;  4GYY A;  4EZJ A;  4U8H A;  2J4D A;  2MRI A;  2VYI A;  3Q4A B;  4MRU A;  4BX8 A;  4Q69 A;  3CV0 A;  5EX3 A;  3UT8 A;  3Q47 B;  3FUN A;  5JHA A;  4XIF A;  1NP7 A;  5HI7 A;  3FTX A;  4ATG A;  2DBA A;  3CKB A;  1BPO A;  3ML9 A;  4U0Z A;  3LS8 A;  2J08 A;  1P5Q A;  1TJC A;  2AWI A;  3CK8 A;  1ELW A;  2KCK A;  3SZ7 A;  4ANU A;  5BPP A;  3VTY A;  5D0O D;  4CGW A;  4N2S A;  2IOL A;  1HG5 A;  4G26 A;  3I5P A;  2RD0 A;  1OWN A;  3JQ0 A;  2VSO E;  4LRZ A;  3RIB A;  4FLH A;  1EF1 C;  1JWG A;  3L16 A;  4H7X A;  4U0S A;  3RRN B;  2L6J A;  4G1T A;  5EX0 A;  2CHZ A;  3NZU A;  4MKT A;  4I2W A;  1UG3 A;  2WQ7 A;  1SZ9 A;  2DCP A;  2VJ8 A;  4LUN U;  2IFU A;  3CIA A;  4C0M A;  1QZ2 A;  2VSY A;  4EQF A;  3CEQ A;  2IJG X;  4I9E A;  2AVP A;  4UQX A;  5ANR A;  2XPI A;  4EZL A;  4ILI A;  5G05 J;  1MQS A;  3QKY A;  3EIQ C;  3QWV A;  4DK5 A;  2YIN A;  2OND A;  3QOU A;  1OWP A;  5EKQ D;  2WM9 A;  1ZU2 A;  4AEZ C;  5DBK A;  4AY5 A;  4GYW A;  1E8X A;  2V0P A;  1HS6 A;  5FZS A;  3CQC B;  2VGX A;  4I43 A;  4YND A;  4DPR A;  3EJN A;  2XCC A;  3GYZ A;  3BG1 B;  3CK7 A;  1UW4 B;  4GCN A;  4GMJ A;  3UQ3 A;  4GA1 A;  4HLE A;  2OOE A;  4CDR A;  4HFG A;  2X6K A;  4CT0 A;  2QY7 A;  5CHE E;  1GW6 A;  1Z3Y A;  4GYO A;  3FH5 A;  3CHQ A;  3B7R L;  4WNE A;  4DJA A;  1IHG A;  2J07 A;  4TV3 A;  3TJP A;  5AEN A;  3MGB A;  3UMV A;  3PZD A;  3NQP A;  1WAO 1;  3RRM B;  2J09 A;  5FQ8 A;  3L6A A;  2LAH A;  3C98 A;  1EDU A;  3QWP A;  3LY9 A;  2GRM A;  3BEE A;  5KJM A;  1WM5 A;  4EBA A;  4UWF A;  4WND A;  3AS8 A;  4UI9 C;  4EPZ A;  4G2V A;  1Y8M A;  4FP7 A;  4KVO A;  4JVS A;  4UWK A;  3OAW A;  5FQ6 A;  5KCM A;  5LOZ A;  3D9O A;  2XPZ A;  3MZL B;  3P1U A;  3R7Q A;  3D9P A;  4RG9 A;  5LCW J;  3QK0 A;  3QDN A;  3IV0 A;  5G04 J;  1UN8 A;  2J9Q A;  4GCO A;  5LP0 A;  3ULQ A;  3TGO A;  2GW1 A;  3SHF A;  5A23 A;  3SNX A;  1OWL A;  3UT4 A;  4FLB A;  4CCA A;  2WXF A;  3S7D A;  4UWH A;  3OTN A;  2IU1 A;  4BT8 A;  3TAX A;  4G25 A;  4RVB A;  3ZFW A;  4W9R A;  2JLB A;  5M72 A;  3FU6 A;  4AV7 A;  2LAI A;  1IQR A;  2V8S E;  1UJJ A;  2KZT A;  3G2V A;  5BNW A;  4ILG A;  4B89 A;  3T5V A;  3U3W A;  1U3D A;  4DLO A;  2E0I A;  2PM6 A;  4CGV A;  2XHE A;  2JEK A;  3GZ2 A;  3RKV A;  4AP2 A;  4XI0 A;  3S7F A;  5FWQ A;  4AIF A;  3AS4 A;  3FU0 A;  5G55 A;  2FEZ A;  4U0U A;  1LF8 A;  3TXN A;  4AVX A;  1H0A A;  4JL0 A;  4A1G A;  3FH8 A;  4N2Q A;  2WXP A;  4AXH A;  4J0U A;  4KVM A;  5J08 A;  3EDT B;  4FUL A;  2VTB B;  2LO6 A;  1OWM A;  3ESL A;  3SI5 A;  4JPS A;  5KJN A;  2XGS A;  2XGM A;  4ME2 A;  4QFV A;  3QAR A;  5FQ7 A;  5D0Q D;  4K0R A;  3UUX A;  4NQ0 A;  5E75 A;  4B8A A;  3WXX A;  4APF A;  3MA5 A;  3JCK C;  1H19 A;  1SQM A;  1XGW A;  5KJK A;  2DIW A;  3IBE A;  2R17 C;  2X6F A;  4U04 A;  3ZN3 A;  3FTZ A;  4I2Z A;  3SD5 A;  4WWN A;  4YVO A;  1E8Z A;  1HO8 A;  3EIJ A;  4JA7 A;  4LEU A;  4OVU A;  4GAA A;  3HVE A;  2C0M A;  3Q49 B;  4XE0 A;  3U9W A;  4KZ0 A;  3E4B A;  1X5B A;  1E7U A;  3HDX A;  3FTW A;  5C1D A;  5DIZ A;  3RO2 A;  2KAT A;  2A5U A;  5BUZ A;  3L54 A;  2RG8 A;  3PS6 A;  2WQH A;  1HF8 A;  4WUY A;  4PH4 B;  4JZY A;  1JUQ A;  2ILR A;  5HQ8 A;  3RK6 A;  2I9C A;  3DPD A;  3FUE A;  3ZRH A;  5JJ7 A;  3I4G A;  4FAD A;  3QC1 A;  3TG4 A;  3Q5M A;  1IYG A;  5CCL A;  4UI9 J;  3TL5 A;  4XZ4 A;  5JJT A;  3CVL A;  3SFZ A;  5LX8 A;  2LNI A;  4MS6 A;  2WPV A;  3G2S A;  4CT4 A;  3VLD A;  3ESK A;  3CVV A;  3APD A;  3IHY A;  1XNF A;  4J6I A;  3ZEF A;  2R59 A;  4GZ5 A;  2HM8 A;  1E8W A;  3CR3 A;  4G23 A;  1E96 B;  4O6F A;  4WWO A;  4MLP A;  2PZI A;  3HYM B;  3PEU B;  4EBA G;  4F3V A;  2WXO A;  3ZHE A;  2BUG A;  3D9K A;  4PDX A;  4NRH B;  2NC9 A;  4DLQ A;  2WXL A;  2KM4 A;  1A17 A;  4HOQ A;  3SBT B;  4GZC A;  4IYP A;  4UWL A;  3O48 A;  2I1K A;  3U4T A;  2ZU6 B;  4CEM A;  2CHX A;  3I4R B;  2V4L A;  3G2T A;  4GZD A;  2A4Z A;  4RSY A;  3FFL A;  1Y6I A;  4GA0 A;  2X3M A;  3VLE A;  4L1B A;  5FTP A;  3FTV A;  5G05 C;  3FEY A;  4JHJ A;  5JHB A;  1WY6 A;  4HOU A;  3R7R A;  3UT7 A;  1HG2 A;  1PY1 A;  2KC7 A;  2IF4 A;  3PE4 A;  3ZIM A;  3CVW A;  4ACK A;  3D9N A;  3PUK A;  4J8S A;  4PS7 A;  3EHM A;  4HVB A;  3KS2 A;  4YVQ C;  3HIZ A;  3KEZ A;  3MKQ A;  2X6I A;  3CLJ A;  2WXQ A;  4HXI A;  2WQ6 A;  3LXU X;  4J8E A;  5EDS A;  2VGY A;  3PRE A;  2FI7 A;  2PQN A;  3FU5 A;  4R7L A;  3L22 A;  3FUJ A;  4PUC A;  3B7U X;  1W3B A;  3FTY A;  4OYS A;  5BV0 A;  2IQC A;  2LSU A;  3L17 A;  3CHM A;  4GZ3 A;  4J8D A;  2CHW A;  3IKO B;  2WXR A;  4M3O A;  5LFA A;  2HYZ A;  2XPY A;  3B7T A;  5ARF A;  4BY6 A;  5G04 C;  4DI3 A;  2BF0 X;  4WNG A;  3KAE A;  3T8M A;  4GZ6 A;  3ZYL A;  4BTB A;  1E8Y A;  4N3B A;  3R9A B;  4A3T A;  4HS2 A;  4BTA A;  3SGH A;  3ZVV A;  4JXT A;  4GB9 A;  3GZS A;  2CG3 A;  3CSF A;  1E7V A;  3MV3 B;  2X38 A;  3ML8 A;  4IN3 B;  4L2Y A;  3VLF A;  3MKQ B;  4HOR A;  4I17 A;  3QJZ A;  4KYO B;  4N39 A;  3ONL A;  4WAF A;  3L13 A;  3PDN A;  2PQR A;  3CVU A;  2YHE A;  1ZBP A;  3CVN A;  1TEZ A;  5J90 A;  1DVP A;  2VSN A;  3I3N A;  1UN9 A;  5A7D B;  4K03 A;  3CVP A;  4F53 A;  1HU3 A;  4UWG A;  4FA6 A;  2I2O A;  3LCA A;  2OV8 A;  2CFU A;  3AU4 A;  1UJK A;  1FVH A;  1EYH A;  2VSX E;  2UY1 A;  4BT9 A;  3QWW A;  1MHQ A;  1N54 A;  3ZGQ A;  3CST A;  3U66 A;  3CHR A;  4ACL A;  1H6K A;  3FHE A;  4B94 A;  1E90 A;  3D9M A;  2WXI A;  2WXN A;  4FHK A;  4Q96 A;  2FO7 A;  3PH0 C;  5T3R A;  1PC2 A;  2XRY A;  2X6J A;  3PNL B;  1KLX A;  1HXI A;  3OXG A;  4LER A;  4JW1 A;  5FZR A;  4ANV A;  4FC8 A;  3FU3 A;  4BSX A;  4KZC A;  2OVB A;  4CDM A;  1Z3X A;  2J49 A;  3GZ1 A;  3S7B A;  4I1A A;  4UQY A;  4E6H A;  1NZN A;  2EQX A;  2NSZ A;  4Y6C A;  4E85 A;  3PUJ A;  1DNP A;  2MHK A;  3ONK A;  4LCT A;  4EZK A;  4N3A A;  2I6H A;  3ASG A;  3RO3 A;  1NA3 A;  2VQ2 A;  4FHJ A;  5CCM A;  1IQU A;  2XQ0 A;  3RU0 A;  3RJV A;  2UY1 B;  2FBN A;  1QQE A;  5ARG A;  5BW8 C;  3K9I A;  3PEV B;  4L2L A;  2WXK A;  5AIJ A;  4TRQ A;  3ASD A;  3EHN A;  3MV2 B;  4H7Y A;  5FQ4 A;  2XCB A;  3CGH A;  2WVI A;  4C0E A;  3JQ1 A;  3FUI A;  1U3C A;  4JA9 A;  4D10 C;  4XKB A;  5AJD A;  3CHP A;  2HR2 A;  3JUI A;  1FVF A;  3TXM A;  4JEH A;  3T5X A;  1H2V C;  3B7S A;  4ANW A;  4XI9 A;  4A3V A;  5E76 A;  2WXG A;  2E2E A;  2LSV A;  3ZXS A;  4URK A;  3RRU A;  2WB2 A;  1H2T C;  3LVQ E;  3P2B A;  3FH7 A;  5AYW D;  3D3M A;  3MKR A;  2P58 C;  4APO A;  4I1O B;  3FUM A;  1JWF A;  3ASF A;  3FWV A;  2ION A;  4GA2 A;  4NUR A;  3AS5 A;  4IRU A;  3LYA A;  2PM7 A;  4GU5 A;  3URZ A;  3SF4 A;  4UI9 K;  4AY6 A;  2X6H A;  3PNT B;  4I6G A;  4HOS A;  3FDH A;  4RG6 A;  3DBS A;  3LVR E;  5FT9 A;  4F7A A;  3G2W A;  3ZHE B;  3APF A;  3ZPJ A;  2CG2 A;  4CRW A;  1HE8 A;  3FEX A;  3ZW3 A;  2XGO A;  3IHV A;  4P29 A;  1QNF A;  4F1S A;  3PRZ A;  4KT6 B;  4TUU A;  1N52 A;  5G2N A;  1L5J A;  2WMN A;  4GML A;  4C9B B;  4I9C A;  4L23 A;  2Y4T A;  4U63 A;  3UX4 A;  4AOF A;  2MOW A;  3O4Z A;  3BG0 B;  2VTB A;  1YA0 A;  4FJZ A;  3VTX A;  4U07 A;  3LDZ A;  4PS3 A;  2AW6 A;  1HX8 A;  2XRZ A;  4A1S A;  4AJW A;  3MEK A;  2QFC A;  3FTU A;  4XX5 A;  4GPK A;  4BX9 A;  2J4B A;  4IUL A;  5FZQ A;  3FY4 A;  4XKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...