2KZTB

Structure of the tandem ma-3 region of pdcd4
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Programmed cell death protein 4
total genus 37
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kztB00
3D3MA 2RG8A 2I2OA 3JUIA 2FULA 2IOLA 4C9BB 4LUNU 4B8CB 1H2UA 4IULA 5ANRA 4JHJA 1HU3A 4GMLA 2KZTA 2ZU6B 4B89A 4B8AA 1N54A 4CEMA 3L6AA 4CT4A 4GMJA 2KZTB 2NSZA 4CRWA 2IONA 1UG3A 1PAQA 1H6KA 2HM8A 3EIJA 1N52A 2GGFA 2VSXE 2IU1A 3FEXA 2VSOE 1H2VC 4JHKA 3EIQC 1UW4B 2IOSA 1H2TC 3FEYA 3RK6A
chains in the Genus database with same CATH superfamily
4AOFA 2QY7A 3EHNA 3MA5A 2J4BA 2AJAA 5DBKA 2GROB 2F37A 2PNNA 4EZKA 2KZTA 5AQBA 2L0TB 1AP7A 4CT0A 3DSVA 4UI9J 5KNGA 4LNUD 4J8SA 1OWOA 1MQSA 1ZB1A 4OYSA 5BV1A 1SVXA 2Q7FA 3VTYA 4FJYA 4GTTA 5G55A 1TN6A 1UJKA 4I2ZA 1N4PA 2J9QA 4DX2A 2X6KA 1UN8A 4X8QA 2XHEA 3DPYA 5BXUA 3F6QA 5AENA 3O4ZA 3QWVA 1JCRA 2RD0A 2XGMA 3GYZA 1SQMA 4DLOA 3HXCA 4ME2A 3SQVA 1Q2ZA 4GTSA 4HOQA 5FINA 2VGYA 3CQCB 3FUMA 3CR3A 1UOHA 4L2LA 3LKUA 3CVQA 3B7RL 3ZXPA 3ZHEB 1Y8MA 4ABNA 3BEEA 4N3CA 4BERA 3NF1A 4HXIA 3MJWA 2V8SE 3LS8A 4UQXA 2IY0C 2JLBA 4BSXA 4HRNA 4N5QA 5T8IA 2XRZA 4BESA 5H7PA 3OXGA 2AXUA 2WXIA 2C2LA 2ETAA 3DEOA 3QNKA 1OWNA 2EIJE 2HO1A 3PRZA 1LTXA 4U8YD 1OUVA 2WXNA 3TXNA 2CG3A 4G8LA 2P9SG 5FZRA 2H6IA 2P9UG 2IONA 4GZ6A 3FH8A 4PS8A 4KXKB 2Y4UA 3TWWA 3EHQA 3MEKA 1NZNA 2FO1E 4UWGA 4LEUA 4URKA 3B7BA 4HLLA 1TNYA 1WM5A 1AWCB 4GTRA 3CGHA 3Q7FA 3UM3A 5T3RA 3U3WA 5CECB 3MKRA 3SGHA 4ILIA 3JXJA 4FHKA 2LSUA 1N4RA 2F8XK 3TWUA 5EIBE 3KEAA 3UI2A 3AJIA 2CFZA 2MOWA 5E75A 3HRAA 3LEWA 4AV7A 4PUCA 3CKCA 3UQ3A 2ZIRA 5ENNA 5EN5D 1TR4A 4ILGA 3FWVA 2I1JA 4GTMA 3U4TA 1JCQA 3ZGQA 4DLQA 5AYWD 3C3OA 2WQHA 2VGXB 3GZ1A 3FUHA 3ASDA 4JZYA 4A3VA 1VDYA 3CHRA 4HVBA 4BT8A 3IHYA 4KVMA 4J8FA 3HDXA 3ZEFA 2L6JA 4Q94A 4UQZA 3LCAA 3UKRG 1IQRA 4ZFHA 3CVUA 3ML8A 4XX5A 2GGFA 3CVWA 3CVPA 3NQPA 4O1PA 3PVLA 3EUVA 1QBQA 5BW8C 4FLBA 4B8CB 3NZSA 2PZIA 2LUHA 5ENPD 3B95A 4UI9K 5LCWC 1DCEA 2AVPA 3ENEA 1HS6A 3EJNA 3QWWA 4KZ0A 3BG0B 2R17C 5G2NA 4OVVA 5AARA 3CK7A 1N0RA 5HI7A 4E6HA 5B3SE 4CGVA 4DX6D 5ENOD 1PC2A 1TN8A 5LOZA 3CLJA 3KSLA 4F53A 2A5EA 3UTMA 4UWHA 1E7UA 3L16A 4AP2A 2WMNA 3FUFA 4FADA 3ABME 3UXGA 4WNEA 3Q75A 3EHMA 2RKKA 5D2MC 4F7AA 3I4RB 2H6GA 3S7JA 1BU9A 3FTUA 3HXEA 3CVYA 2IFUA 3TWXA 4AM9A 2RFAA 2E0IA 5BUZA 5FQ6A 2GRQB 3X2QE 5A7DB 3UMVA 4HI9A 1TNBA 2I6HA 4GCNA 2IEJA 4WWOA 1UJJA 2PQNA 3ZVVA 3RKVA 1L5JA 3AS8A 1E8WA 3D9PA 1QZ2A 4OAUC 2CFUA 3AS4A 5KNHD 2R59A 3UT7A 3QJZA 4C9BB 3D9NA 4DI3A 2F0YA 4HOUA 3RO3A 3HG0D 3FY4A 3QK0A 3UKUG 4BWRA 1JPLA 3D9OA 3C5RA 2EINE 2HR2A 4GPKA 4HI8A 5JA4D 2IOSA 2DVWA 5HS0A 4GYWA 3LY7A 4I6JA 2UY1B 4HORA 4A63B 4BEPA 4FA6A 1WDYA 3FH5A 3PEVB 3AAAC 4GYYA 4EZJA 4GZ5A 3FU5A 4U0UA 3CSFA 1OCCE 1BI8B 2Y69E 3FTVA 2B6CA 4TV3A 3VTXA 5CHEE 1KT1A 3D9MA 3CSTA 3PZ1A 2V5FA 3IXEA 3LVQE 2OEVA 2V5QC 3FTSA 3ASFA 3G2TA 3S2AA 4KBQA 5EYPF 2MHKA 3RAUA 4JA9A 4BTAA 2C0MA 1IHBA 4WWPA 3KEZA 4W9RA 3K9IA 4DPRA 5JHAA 2MRIA 5KJKA 1E90A 3APCA 4AVXA 5FQ4A 1MX6A 1U3CA 1OCRE 3UM0A 4GA2A 3ZIMA 2VTBA 2CHZA 3UM1A 3D9KA 2WXMA 2BF0X 1KZPA 2LAHA 5KJLA 1FT2A 3QARA 4B0ZA 5CBOA 4UUCA 4WNGA 4HLEA 3NAWA 2WVIA 4UI9C 4HQDA 2OOEA 2WXPA 4NURA 4N3AA 1D8EA 5ENSD 4DX7D 3PZ4A 4IULA 5D0OD 4CGWA 4C0EA 1XGWA 4V3IA 1N94A 1IQUA 2OV8A 2XRYA 4E85A 5JMND 1NL4A 1HXIA 1YCSB 5ENQD 2XPIA 4XE0A 3PREA 2E2EA 2WXFA 4PDXA 3CIAA 2PM6A 2EIKE 1Z6TA 1MJ0A 5CMYA 3U9WA 3Q9NC 1B89A 2DYSE 3CHOA 1E96B 4ANXA 4O6FA 2V0PA 3FEYA 4CDNA 3MX3A 2OCCE 1HH8A 2DBAA 4DUIA 4DRXE 2MYOA 2CHWA 3ZYQA 4LCTA 4APOA 2VGEA 1U3DA 3DSXA 3ZYLA 1N95A 2UWJG 1U2VG 4L1BA 2NYJA 4A55A 1HU3A 4XEIG 3JYSA 3Q49B 3NOGD 2GRPB 2B0OE 4CZ2D 4AY6A 5FQ7A 1A5EA 3ZKJA 1JCSA 2UY1A 1MHQA 3RRMB 4XZ4A 2DZOA 3WG7E 4EQFA 3ZYMA 3HIZA 5G05C 2X6IA 2XS8A 4CCAA 1YMPA 4GTPA 2WXOA 3SNXA 1LF8A 3ULYA 4O60A 3ZN3A 4J6IA 4K5BA 3B13A 1ELWA 1BPOA 3AG4E 4IRUA 3TWTA 4A1SA 1DNPA 4EBAA 1N11A 2XQ0A 3L13A 3ESKA 3FEXA 2P58C 1E8XA 3RK6A 5E76A 3SF4A 2XS1A 3KS2A 4JEHA 2J8SD 4F3VA 1TJFA 1OWLA 4CDMA 2ETBA 1HF8A 2FO7A 4GMJA 2X6FA 1KT0A 5LX8A 5D66A 2EQXA 5JJTA 3HXBA 4O1OA 3V2XA 3JUEA 5FZSA 4J8EA 1N0QA 5AIJA 3FU6A 4G26A 5KJMA 2XEHA 2WQ7A 1SW6A 3E37A 1FT1A 3L9TA 3FTYA 5FWQA 4JL0A 4RSYA 3E4BA 2WPVA 2GRMA 1X5BA 5EIDA 1IXVA 4D10C 2ZGDA 4YVOA 4N2QA 4XKBA 2V4HC 1K1BA 2IO3C 3APFA 3PE3A 3HVEB 3E33A 4J0UA 4K5AB 3HVEA 3CVNA 4G23A 3ONLA 2OVFA 5CCLA 4UWLA 1JWGA 4I17A 4GMLA 5FIOA 3DSTA 3TWRA 4WUYA 3L54A 3QDNA 2R05A 1NFIE 2P9IG 3FHEA 3C3QA 1KPSB 3SO8A 4YVQC 2DYRE 1HE8A 4FC8A 4XI0A 4GTQA 2XZTG 3PDNA 3V2OA 5BV0A 1S63A 3D9LA 4HNAD 1S70B 4KVOA 3SD5A 2ZU6B 3FP3A 3C72A 3NB2A 5M72A 3L82A 4XIFA 1RZ4A 2NXPA 4HS2A 3Q4AB 4LG6A 3TJPA 5CMWA 2H6FA 3JUIA 3ZXSA 3DXKG 5D0QD 4Q96A 2YNQA 3MV3B 4GYOA 3HYMB 4RG9A 3DSSA 2ZISA 4HB5A 3FTWA 3ZNGA 4NRHB 2EILE 1LD8A 3ZYKA 2VSXE 4BETA 2IJGX 3FH7A 4Q69A 3P1UA 3EHRA 2IOLA 3UPVA 5ENTD 3C98A 1LD7A 2DIWA 4K03A 4G1TA 5AN8A 5HRYA 1O1SA 4WNFA 1H6PA 2WXRA 3U64A 2VYIA 4Y6CA 2RFMA 3DRAA 4XKCA 2XZDG 2Y1LE 4BY6A 3S7BA 3HXDA 3B7UX 5FQ8A 3B7TA 2AWIA 1V54E 1KLXA 4I9CA 4L2YA 4KZCA 5EX3A 1KZOA 4GA1A 4FLHA 2CG2A 2BTDA 2BKGA 4KMOA 4ANVA 1NI1A 4JA7A 3L08A 3SY2A 2P9LG 3UIPC 3OTNA 3S7FA 1FVHA 4BX8A 3E32A 1NP7A 3SHFA 5DIZA 2WXHA 3O48A 3RJVA 1Y6IA 2QC9A 4B89A 3LJ3A 4U7EB 3BUAA 3LY8A 3HHMA 3QWPA 2EIME 4J8YA 1W3BA 2YQ8A 3FFLA 3E34A 2IU1A 1S64A 1O1RA 4ATGA 5LP0A 2I2OA 4CYMD 3SFXA 2GRNB 3KSQA 3FU3A 5C1DA 4JPSA 2LO6A 4NACA 1DC2A 4DJAA 4TXPA 2AXVA 4MBGA 5CRUA 3ISMC 3LVRE 4CDRA 1D8DA 4B93B 3LY9A 4JEUA 2J08A 4FHJA 4U96D 1G3NB 3UM2A 1N54A 3JQ1A 4U07A 2QYUA 4A3TA 4J7WA 2H6HA 1HO8A 5FTPA 5ANLA 2GW1A 3D9JA 4JHJA 5AJLA 2X6HA 3PS6A 4PS3A 4F1SA 2LAIA 1IYGA 4FJZA 4K0RA 1MX2A 1H6KA 4YNDA 1E8ZA 3PZDA 5CRVA 4G8KA 4TRQA 1TNOA 4EPZA 4LUNU 2WQ6A 1TYQG 1OXJA 3OAWA 2KC7A 3J5PA 2WM9A 1YA0A 4I6EA 1JUQA 2OVBA 3URZA 1HX8A 5JJ6A 3CV0A 4WAFA 3EIQC 4GZCA 2XCBA 2R2LA 1EF1C 4JD2G 3ASOE 2KM4A 3QC1A 4ATZD 3AG1E 1MYOA 1ZU2A 5AAOA 3LJNA 4AEZC 1P5QA 3VLEA 2VSNA 3CEQA 5AQ7A 3JXIA 2GRRB 2IF4A 4MS6A 3PNTB 2FULA 4RQIA 3CHMA 3LYAA 4RLYA 4LSZE 1WY6A 4U0SA 5AQ9A 4CRWA 3DXMG 1SA4A 1N52A 1TNUA 4G25A 4HRMB 5A6CA 1H6OA 2VSYA 4I9EA 3ULEG 4MLPA 4DK5A 3I4GA 4EBAG 3TL5A 1OY3D 4GCOA 5FJYA 3R9MA 5HQ8A 3IEGA 4F6RD 4I2WA 1N9AA 3J5QB 1O1TA 4PS7A 1ZBPA 1Z5SC 3AU4A 1MX4A 2LNIA 5CEDB 5ANRA 2FI7A 4FP7A 4RVBA 4U04A 2L0IA 1ELRA 4BT9A 2BUGA 3DPDA 3RIBA 3FUDA 1RW2A 1DVPA 3C3RA 1Z3XA 3I5PA 2YHEA 5FT9A 3MYVA 4M7CA 1SZ9A 4TXRA 2QYJA 4BTBA 5CERB 2L6BA 4B8AA 5KCMA 4P29A 3SFYA 3MGBA 4IN3B 3WXXA 3CQGB 4IYPA 1GW6A 4YDWA 3NBNB 4GMRA 4KT6B 4GZDA 5J90A 2FEZA 3ABKE 4UWFA 3PUJA 2XGOA 3AU5A 2P9KG 3IKOB 4A1GA 4UQYA 1QNFA 3Q5MA 3OXLA 2JEKA 1UW4B 3VLFA 3D9HA 3ZPJA 5CCMA 3D3MA 3V30A 2LXMA 2LXLA 4WWNA 4EECA 5BNWA 3FUKA 4LNGA 4LERA 4BSZB 4L9PA 1E8YA 3NOCD 4N2SA 1N4SA 3V31A 2R02A 3DWLG 4FULA 3TWQA 1HG5A 3RSEG 2GRLA 2YHCA 3ZU7B 3ULQA 2J09A 4XI9A 4JW1A 4AJWA 2X3MA 3SBSA 5KJNA 5B1AE 1FCHA 1ELKA 4DI4A 3S7DA 3ASHA 1NA0A 3ABLE 5G05J 1PY1A 3UIOC 1OWMA 1TJCA 2AW6A 3DBSA 2C0LA 2DZNA 4ACKA 4G24A 3TWSA 4U63A 2VTBB 5B1BE 4G2VA 3LDZA 4YDEA 3CHQA 5EX0A 2PQRA 2AXZA 1BLXB 2A5UA 1DCQA 4G11A 5KWDA 1O5MA 3HXFA 3QKYA 3DSWA 4H7XA 4MKTA 4ILHB 2BKKB 2R03A 3ESLA 2ZGGA 4GU5A 2KATA 2BEDA 3Q9UC 1D9SA 2ONDA 3UT4A 4J8DA 3ZHEA 1WG0A 1QYMA 4APFA 5BXOA 3TGOA 3G2WA 1H19A 1H2UA 3L17A 3MKQA 4DX5D 3T8KA 2I1KA 2P9PG 2X6JA 4L23A 4M3OA 1INZA 2WXJA 1SZAA 3AS5A 4ACLA 5ITZF 2FBNA 2XEEA 3EIJA 2I9CA 3Q78A 5G04C 3APDA 5JHBA 1K3ZD 1MZCA 3JCKC 1XNFA 4HOTA 4I1OB 3TG4A 1K8KG 3BU8A 2IO2C 4GZ3A 5EYLA 2WXLA 4QFVA 5ARFA 1H2VC 5C2YA 2ZXWE 3T5VA 3GZ2A 1NA3A 4U8HA 3Q7AA 3IV0A 2OEWA 4L7TA 3SI5A 4C0MA 3TG5A 1S0PA 2Y3AA 1E7VA 3EDTB 3Q73A 5EDSA 1N4QA 2J4DA 3R7RA 3KD7A 5CBNA 3TAXA 2XGSA 3NZUA 3SZ7A 2DWZA 2QFCA 1HG2A 5HKPA 3TXMA 4U8VD 4N39A 5BPPA 4OVUA 2KZTB 2NSZA 4GB9A 2IQCA 1TEZA 4N5CA 3LPZA 2WB2A 2XPYA 3T9KA 3EU9A 3PUKA 3PE4A 4EZLA 4JB8P 2LSVA 3ZUVB 4JC8A 3FTZA 2P2CP 4UWKA 4WNDA 1FPPA 3FULA 4AXHA 5CEAA 3R7QA 1UG3A 3AG3E 1EDUA 5ENRD 3CK8A 4R7LA 5FZQA 2R5SA 4QQIA 3ZW3A 2J07A 1V55E 4HRLA 3EU5A 3CHPA 3PZ2A 1YYHA 2YINA 4HFGA 2Y4TA 4TUUA 3PEUB 2ETCA 5KBAA 3VLDA 3RRNB 1OCOE 2VSOE 4MRUA 2CHXA 3ONKA 4BFRA 5G04J 4I43A 4HBDA 3IHVA 4YDOA 2KCKA 2V4LA 3ZFWA 4LRZA 1A17A 1H0AA 3L6AA 5T4YA 3FU0A 4KYOB 2WXQA 4K5CA 2ILRA 3R9AB 3FDHA 4JHKA 3B7SA 2M63A 3UINC 3T5XA 3FTXA 4NQ0A 5IY5E 3JQ0A 3GW4A 3TWVA 3PZ3A 1OWPA 4N3BA 3Q47B 5JJ7A 1QQEA 3UT8A 4JXTA 3MKQB 3G2SA 1JWFA 3AG2E 4TUMA 1SA5A 2QZAA 4EHMA 2KBXA 1X81A 3V79K 2X38A 1HFAA 3DEPA 4JVSA 3QOUA 2RG8A 3MV2B 5BT1A 1TNZA 3UUXA 3CVLA 2KCVA 2XCCA 4PH4B 4I6GA 1TN7A 3ASGA 3MCXA 3Q79A 4I1MA 1IKND 1FVFA 4B94A 3QB2A 4AIFA 3RU0A 3L22A 3ZRHA 4GAAA 4FU3A 4F1PA 2WMOA 4LNBA 1UN9A 5A23A 4AY5A 4GPMA 3ML9A 1OCZE 3FUIA 1H2TC 3ASNE 2KXPC 4H7YA 3G2VA 4I1AA 4TXQA 3KAEA 2J49A 4ANUA 2HE0A 4C48B 4OAVB 5EKQD 3CK9A 3FUNA 1EYHA 2JABA 3Q15A 5LFAA 3RRUA 3N71A 4GTVA 3CHSA 2XENA 2Y0BG 2WXKA 4ZHBA 4ANWA 4Z68A 3PNLB 1BI7B 3U66A 1HZ4A 2F8YA 2VQ2A 2HYZA 2VJ8A 3QAQA 3CVVA 3SFZA 2VGXA 1PAQA 2XEVA 4RG6A 3T8MA 5AJDA 1EPUA 3UX4A 4NIKA 2DCPA 4YDYA 2P9NG 1IHGA 5AQAA 3SBTB 3LXUX 3BG1B 3BQOA 3FUEA 4CT4A 1K1AA 4GTOA 3W9FA 2HM8A 3OXFA 4BX9A 3CKBA 2FF4A 3I3NA 2PM7A 3P2BA 5EILA 2WXGA 5ARGA 2XPZA 3W9GA 2A4ZA 1BD8A 4U0ZA 4GA0A 3RO2A 2L9BA 4JHRA 1Z3YA 1OT8A 3DSUA 3D9IA 1WAO1 5J08A 4DX1A 4CEMA 3FUJA 5LCWJ 4Y6WA 2NC9A 2PL2A 3G2UA 3PH0C 3E30A 2KCLA 3CVXA 4U95D 3GZSA 4HOSA 3IBEA 3MZLB
chains in the Genus database with same CATH topology
2A5UA 3D9MA 4AOFA 2QY7A 4XKCA 3CSTA 3EHNA 4G11A 3QKYA 2V5FA 3MA5A 2J4BA 4H7XA 4MKTA 3LVQE 4ILHB 5DBKA 4BY6A 4EZKA 2KZTA 3ESLA 3S7BA 2L0TB 3B7UX 5FQ8A 3B7TA 3FTSA 3ASFA 4CT0A 3G2TA 4UI9J 4GU5A 2AWIA 3S2AA 4KBQA 1KLXA 4J8SA 2MHKA 4JA9A 2KATA 2ONDA 4I9CA 1OWOA 2C0MA 4KZCA 4L2YA 4WWPA 3UT4A 5EX3A 3KEZA 1MQSA 4J8DA 4OYSA 3ZHEA 5BV1A 4W9RA 4APFA 4GA1A 3TGOA 4FLHA 3G2WA 2CG2A 3K9IA 2BTDA 1H19A 4DPRA 1H2UA 3L17A 3MKQA 2Q7FA 3VTYA 4FJYA 4KMOA 5JHAA 4ANVA 5G55A 2I1KA 2MRIA 4JA7A 5KJKA 1E90A 3APCA 1UJKA 3L08A 4I2ZA 4AVXA 5FQ4A 2X6JA 2J9QA 3OTNA 4L23A 2X6KA 4M3OA 1UN8A 1INZA 2WXJA 3S7FA 1SZAA 1U3CA 1FVHA 3AS5A 2XHEA 4ACLA 2FBNA 4GA2A 3ZIMA 4BX8A 2VTBA 3EIJA 2CHZA 3D9KA 2WXMA 1NP7A 2BF0X 5AENA 3O4ZA 2LAHA 2I9CA 5KJLA 3QWVA 3SHFA 3QARA 5G04C 2RD0A 2XGMA 3APDA 4B0ZA 3GYZA 1SQMA 5DIZA 4DLOA 5JHBA 4ME2A 3JCKC 2WXHA 3O48A 3RJVA 4WNGA 4HLEA 1XNFA 4HOTA 4HOQA 1Y6IA 4I1OB 2VGYA 3CQCB 4EZJA 3TG4A 3FUMA 3CR3A 4B89A 3LJ3A 3LY8A 3HHMA 4L2LA 2WVIA 3LKUA 3CVQA 4GZ3A 4UI9C 3QWPA 3B7RL 2WXLA 1W3BA 2YQ8A 2OOEA 2WXPA 4QFVA 3ZHEB 3FFLA 4NURA 2IU1A 5ARFA 1H2VC 1Y8MA 4ABNA 5C2YA 4N3AA 3T5VA 3GZ2A 4ATGA 2I2OA 5LP0A 3BEEA 4N3CA 1NA3A 3NF1A 4HXIA 3MJWA 4U8HA 2V8SE 3IV0A 3FU3A 3LS8A 4IULA 5D0OD 4CGWA 5C1DA 4JPSA 4UQXA 1XGWA 4L7TA 2JLBA 3SI5A 4C0EA 4BSXA 4C0MA 3TG5A 2LO6A 4NACA 1S0PA 4V3IA 1IQUA 2Y3AA 1E7VA 3EDTB 5T8IA 4DJAA 2XRZA 2OV8A 2XRYA 5EDSA 4E85A 3OXGA 1HXIA 2AXUA 2J4DA 3R7RA 2AXVA 2WXIA 3KD7A 2C2LA 3TAXA 2XPIA 2XGSA 3NZUA 3PREA 3QNKA 4XE0A 3SZ7A 1OWNA 3LVRE 4CDRA 2QFCA 2HO1A 3PRZA 1HG2A 3TXMA 2E2EA 2WXFA 4PDXA 1OUVA 2WXNA 3CIAA 3LY9A 3TXNA 2PM6A 2CG3A 4JEUA 4N39A 1Z6TA 2J08A 4FHJA 5FZRA 5BPPA 4OVUA 1N54A 3JQ1A 4U07A 5CMYA 2KZTB 2NSZA 2IONA 3U9WA 1B89A 2IQCA 4GB9A 4A3TA 3CHOA 1TEZA 4N5CA 4GZ6A 3LPZA 1E96B 3FH8A 1HO8A 4ANXA 2XPYA 4PS8A 2WB2A 4KXKB 4O6FA 2Y4UA 5FTPA 2V0PA 5ANLA 3FEYA 4CDNA 3PUKA 4BTAA 2GW1A 3MEKA 3PE4A 1NZNA 3MX3A 4EZLA 4UWGA 2LSVA 3D9JA 4JHJA 5AJLA 2X6HA 3PS6A 4JC8A 3FTZA 2LAIA 4PS3A 4F1SA 4LEUA 4URKA 1HH8A 2DBAA 1IYGA 4UWKA 4FJZA 4WNDA 4K0RA 3FULA 4AXHA 2CHWA 3ZYQA 3R7QA 4LCTA 1UG3A 1WM5A 4APOA 1H6KA 3CGHA 1EDUA 4YNDA 5FZQA 3CK8A 4R7LA 1U3DA 2R5SA 3ZYLA 1E8ZA 2UWJG 3PZDA 5T3RA 3ZW3A 2J07A 4TRQA 3U3WA 4EPZA 3CHPA 3MKRA 3SGHA 4LUNU 4L1BA 4ILIA 2YINA 4HFGA 2WQ6A 2Y4TA 4FHKA 2LSUA 4A55A 4TUUA 3PEUB 1HU3A 3OAWA 2KC7A 3VLDA 2WM9A 1YA0A 3JYSA 4I6EA 3Q49B 1JUQA 3RRNB 2CFZA 2MOWA 2OVBA 5E75A 3URZA 1HX8A 4AY6A 3LEWA 5JJ6A 3CV0A 4AV7A 2VSOE 4WAFA 4MRUA 3EIQC 4PUCA 2CHXA 5FQ7A 3CKCA 4GZCA 3ONKA 4BFRA 3UQ3A 5G04J 2UY1A 2XCBA 5ENNA 1MHQA 3RRMB 4I43A 1EF1C 4XZ4A 3IHVA 4ILGA 3FWVA 2KM4A 3QC1A 4EQFA 1ZU2A 2I1JA 3HIZA 2KCKA 5G05C 2V4LA 3ZYMA 3ZFWA 4LRZA 2X6IA 1A17A 3U4TA 1H0AA 3L6AA 5T4YA 4CCAA 3ZGQA 4AEZC 3FU0A 4DLQA 1P5QA 2WXQA 2VSNA 2WQHA 4KYOB 2VGXB 5AYWD 3VLEA 3CEQA 3GZ1A 3FUHA 2ILRA 3ASDA 3R9AB 3FDHA 2IF4A 4JZYA 4A3VA 1VDYA 4JHKA 4MS6A 3CHRA 3PNTB 3B7SA 4HVBA 2WXOA 2M63A 2FULA 4BT8A 3SNXA 3T5XA 1LF8A 3IHYA 4KVMA 3FTXA 4J8FA 4NQ0A 3JQ0A 3ZN3A 3CHMA 3HDXA 3GW4A 3LYAA 4J6IA 3B13A 3ZEFA 1ELWA 2L6JA 1WY6A 4U0SA 1BPOA 4Q94A 4CRWA 4UQZA 3LCAA 1OWPA 4IRUA 4A1SA 1DNPA 1IQRA 4N3BA 3CVUA 3Q47B 4EBAA 5JJ7A 3ML8A 4XX5A 1N52A 2GGFA 2XQ0A 1QQEA 3CVWA 3L13A 3ESKA 3FEXA 2P58C 3CVPA 3UT8A 1E8XA 4G25A 4JXTA 3RK6A 3NQPA 5E76A 3MKQB 3SF4A 5A6CA 2VSYA 3G2SA 3PVLA 1JWFA 4I9EA 3KS2A 5BW8C 4FLBA 4B8CB 4JEHA 4F3VA 1TJFA 4MLPA 1OWLA 4CDMA 3NZSA 4DK5A 3I4GA 1HF8A 4EBAG 2FO7A 4GMJA 2X6FA 3TL5A 2PZIA 1KT0A 5LX8A 4GCOA 5FJYA 2EQXA 3IEGA 5HQ8A 2X38A 1HFAA 4I2WA 4UI9K 5LCWC 2AVPA 3ENEA 1HS6A 3EJNA 4PS7A 1ZBPA 4JVSA 3QOUA 5JJTA 2RG8A 3QWWA 5FZSA 3AU4A 3BG0B 4KZ0A 2LNIA 3MV2B 4J8EA 2R17C 5BT1A 5ANRA 5G2NA 4OVVA 5AIJA 3UUXA 3FU6A 3CK7A 4G26A 2FI7A 5HI7A 5KJMA 3CVLA 4FP7A 4RVBA 4E6HA 4CGVA 2KCVA 2XCCA 4PH4B 4I6GA 4U04A 2L0IA 1ELRA 3ASGA 1PC2A 3MCXA 5LOZA 2WQ7A 3CLJA 3FTYA 4BT9A 5FWQA 2BUGA 3DPDA 4JL0A 3RIBA 4I1MA 4RSYA 4F53A 1FVFA 3E4BA 3FUDA 4UWHA 2WPVA 4B94A 1DVPA 1Z3XA 3I5PA 2YHEA 2GRMA 5FT9A 3MYVA 3QB2A 1X5BA 4AIFA 1E7UA 3RU0A 3L16A 3L22A 4AP2A 3ZRHA 2WMNA 1SZ9A 4D10C 3FUFA 4FADA 4YVOA 4GAAA 4FU3A 2WMOA 4BTBA 4WNEA 4N2QA 4XKBA 4B8AA 3EHMA 5KCMA 1UN9A 4P29A 4AY5A 5A23A 3MGBA 3ML9A 4F7AA 4IN3B 3APFA 3I4RB 3PE3A 3WXXA 3HVEB 3CQGB 3S7JA 4J0UA 4IYPA 1GW6A 3FTUA 3CVYA 3HVEA 3CVNA 3FUIA 1H2TC 4G23A 3ONLA 2OVFA 4KT6B 2IFUA 4H7YA 4GZDA 4AM9A 3G2VA 2E0IA 5J90A 5BUZA 4I1AA 5FQ6A 4UWLA 5CCLA 2FEZA 3KAEA 2J49A 1JWGA 4UWFA 4I17A 3PUJA 4GMLA 2XGOA 4ANUA 5A7DB 4WUYA 3UMVA 5EKQD 3AU5A 3CK9A 3FUNA 3IKOB 3L54A 2I6HA 3QDNA 1EYHA 3Q15A 5LFAA 3FHEA 3RRUA 4A1GA 4UQYA 3N71A 4GCNA 1QNFA 4YVQC 3Q5MA 1HE8A 4WWOA 3OXLA 2JEKA 4FC8A 1UW4B 3VLFA 3CHSA 3ZPJA 4XI0A 5CCMA 1UJJA 3D3MA 2PQNA 3ZVVA 2WXKA 4ANWA 3PDNA 3PNLB 4WWNA 4EECA 5BNWA 3RKVA 3FUKA 5BV0A 3U66A 1L5JA 3D9LA 4KVOA 1HZ4A 3AS8A 1E8WA 3D9PA 4LERA 3SD5A 1QZ2A 2VQ2A 2ZU6B 1E8YA 2HYZA 2VJ8A 3FP3A 3QAQA 4N2SA 3CVVA 3SFZA 5M72A 2VGXA 1PAQA 2XEVA 4RG6A 4FULA 2CFUA 1HG5A 3AS4A 3T8MA 4XIFA 1EPUA 5AJDA 2R59A 3UT7A 3UX4A 3QJZA 2GRLA 4C9BB 2NXPA 3D9NA 2YHCA 3Q4AB 2DCPA 4HS2A 3TJPA 4DI3A 5CMWA 3JUIA 3ZXSA 1IHGA 3SBTB 3LXUX 5D0QD 4Q96A 3ULQA 2YNQA 2J09A 3BG1B 4XI9A 4HOUA 4JW1A 4AJWA 3MV3B 3RO3A 2X3MA 4GYOA 3FUEA 3FY4A 3SBSA 4CT4A 5KJNA 3QK0A 3HYMB 4BWRA 4RG9A 1JPLA 3FTWA 1FCHA 2HM8A 1ELKA 3OXFA 4DI4A 4BX9A 4NRHB 3CKBA 3D9OA 2FF4A 3ASHA 3I3NA 3S7DA 2PM7A 3P2BA 2HR2A 3ZYKA 4GPKA 1NA0A 2VSXE 2WXGA 5G05J 1PY1A 2IOSA 2IJGX 3FH7A 5ARGA 2XPZA 2A4ZA 4Q69A 1OWMA 3P1UA 4U0ZA 4GA0A 3RO2A 1TJCA 2IOLA 2AW6A 2L9BA 4GYWA 3LY7A 3UPVA 4I6JA 4JHRA 2UY1B 1Z3YA 3C98A 3DBSA 2C0LA 4HORA 2DIWA 3D9IA 4K03A 1WAO1 4G1TA 5J08A 4FA6A 4CEMA 3PEVB 3FH5A 3FUJA 5LCWJ 4ACKA 4G24A 4GYYA 2NC9A 2PL2A 4GZ5A 4U63A 3G2UA 2WXRA 3FU5A 3PH0C 4WNFA 4Y6WA 4U0UA 3CSFA 2KCLA 3U64A 2VTBB 3CVXA 2VYIA 4G2VA 3LDZA 3CHQA 3GZSA 4HOSA 3FTVA 5EX0A 2PQRA 4Y6CA 2AXZA 3IBEA 4TV3A 3VTXA 5CHEE 1KT1A 3MZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3M A;  2RG8 A;  2I2O A;  3JUI A;  2FUL A;  2IOL A;  4C9B B;  4LUN U;  4B8C B;  1H2U A;  4IUL A;  5ANR A;  4JHJ A;  1HU3 A;  4GML A;  2KZT A;  2ZU6 B;  4B89 A;  4B8A A;  1N54 A;  4CEM A;  3L6A A;  4CT4 A;  4GMJ A;  2KZT B;  2NSZ A;  4CRW A;  2ION A;  1UG3 A;  1PAQ A;  1H6K A;  2HM8 A;  3EIJ A;  1N52 A;  2GGF A;  2VSX E;  2IU1 A;  3FEX A;  2VSO E;  1H2V C;  4JHK A;  3EIQ C;  1UW4 B;  2IOS A;  1H2T C;  3FEY A;  3RK6 A; 
#chains in the Genus database with same CATH topology
 4AOF A;  2QY7 A;  3EHN A;  3MA5 A;  2J4B A;  2AJA A;  5DBK A;  2GRO B;  2F37 A;  2PNN A;  4EZK A;  2KZT A;  5AQB A;  2L0T B;  1AP7 A;  4CT0 A;  3DSV A;  4UI9 J;  5KNG A;  4LNU D;  4J8S A;  1OWO A;  1MQS A;  1ZB1 A;  4OYS A;  5BV1 A;  1SVX A;  2Q7F A;  3VTY A;  4FJY A;  4GTT A;  5G55 A;  1TN6 A;  1UJK A;  4I2Z A;  1N4P A;  2J9Q A;  4DX2 A;  2X6K A;  1UN8 A;  4X8Q A;  2XHE A;  3DPY A;  5BXU A;  3F6Q A;  5AEN A;  3O4Z A;  3QWV A;  1JCR A;  2RD0 A;  2XGM A;  3GYZ A;  1SQM A;  4DLO A;  3HXC A;  4ME2 A;  3SQV A;  1Q2Z A;  4GTS A;  4HOQ A;  5FIN A;  2VGY A;  3CQC B;  3FUM A;  3CR3 A;  1UOH A;  4L2L A;  3LKU A;  3CVQ A;  3B7R L;  3ZXP A;  3ZHE B;  1Y8M A;  4ABN A;  3BEE A;  4N3C A;  4BER A;  3NF1 A;  4HXI A;  3MJW A;  2V8S E;  3LS8 A;  4UQX A;  2IY0 C;  2JLB A;  4BSX A;  4HRN A;  4N5Q A;  5T8I A;  2XRZ A;  4BES A;  5H7P A;  3OXG A;  2AXU A;  2WXI A;  2C2L A;  2ETA A;  3DEO A;  3QNK A;  1OWN A;  2EIJ E;  2HO1 A;  3PRZ A;  1LTX A;  4U8Y D;  1OUV A;  2WXN A;  3TXN A;  2CG3 A;  4G8L A;  2P9S G;  5FZR A;  2H6I A;  2P9U G;  2ION A;  4GZ6 A;  3FH8 A;  4PS8 A;  4KXK B;  2Y4U A;  3TWW A;  3EHQ A;  3MEK A;  1NZN A;  2FO1 E;  4UWG A;  4LEU A;  4URK A;  3B7B A;  4HLL A;  1TNY A;  1WM5 A;  1AWC B;  4GTR A;  3CGH A;  3Q7F A;  3UM3 A;  5T3R A;  3U3W A;  5CEC B;  3MKR A;  3SGH A;  4ILI A;  3JXJ A;  4FHK A;  2LSU A;  1N4R A;  2F8X K;  3TWU A;  5EIB E;  3KEA A;  3UI2 A;  3AJI A;  2CFZ A;  2MOW A;  5E75 A;  3HRA A;  3LEW A;  4AV7 A;  4PUC A;  3CKC A;  3UQ3 A;  2ZIR A;  5ENN A;  5EN5 D;  1TR4 A;  4ILG A;  3FWV A;  2I1J A;  4GTM A;  3U4T A;  1JCQ A;  3ZGQ A;  4DLQ A;  5AYW D;  3C3O A;  2WQH A;  2VGX B;  3GZ1 A;  3FUH A;  3ASD A;  4JZY A;  4A3V A;  1VDY A;  3CHR A;  4HVB A;  4BT8 A;  3IHY A;  4KVM A;  4J8F A;  3HDX A;  3ZEF A;  2L6J A;  4Q94 A;  4UQZ A;  3LCA A;  3UKR G;  1IQR A;  4ZFH A;  3CVU A;  3ML8 A;  4XX5 A;  2GGF A;  3CVW A;  3CVP A;  3NQP A;  4O1P A;  3PVL A;  3EUV A;  1QBQ A;  5BW8 C;  4FLB A;  4B8C B;  3NZS A;  2PZI A;  2LUH A;  5ENP D;  3B95 A;  4UI9 K;  5LCW C;  1DCE A;  2AVP A;  3ENE A;  1HS6 A;  3EJN A;  3QWW A;  4KZ0 A;  3BG0 B;  2R17 C;  5G2N A;  4OVV A;  5AAR A;  3CK7 A;  1N0R A;  5HI7 A;  4E6H A;  5B3S E;  4CGV A;  4DX6 D;  5ENO D;  1PC2 A;  1TN8 A;  5LOZ A;  3CLJ A;  3KSL A;  4F53 A;  2A5E A;  3UTM A;  4UWH A;  1E7U A;  3L16 A;  4AP2 A;  2WMN A;  3FUF A;  4FAD A;  3ABM E;  3UXG A;  4WNE A;  3Q75 A;  3EHM A;  2RKK A;  5D2M C;  4F7A A;  3I4R B;  2H6G A;  3S7J A;  1BU9 A;  3FTU A;  3HXE A;  3CVY A;  2IFU A;  3TWX A;  4AM9 A;  2RFA A;  2E0I A;  5BUZ A;  5FQ6 A;  2GRQ B;  3X2Q E;  5A7D B;  3UMV A;  4HI9 A;  1TNB A;  2I6H A;  4GCN A;  2IEJ A;  4WWO A;  1UJJ A;  2PQN A;  3ZVV A;  3RKV A;  1L5J A;  3AS8 A;  1E8W A;  3D9P A;  1QZ2 A;  4OAU C;  2CFU A;  3AS4 A;  5KNH D;  2R59 A;  3UT7 A;  3QJZ A;  4C9B B;  3D9N A;  4DI3 A;  2F0Y A;  4HOU A;  3RO3 A;  3HG0 D;  3FY4 A;  3QK0 A;  3UKU G;  4BWR A;  1JPL A;  3D9O A;  3C5R A;  2EIN E;  2HR2 A;  4GPK A;  4HI8 A;  5JA4 D;  2IOS A;  2DVW A;  5HS0 A;  4GYW A;  3LY7 A;  4I6J A;  2UY1 B;  4HOR A;  4A63 B;  4BEP A;  4FA6 A;  1WDY A;  3FH5 A;  3PEV B;  3AAA C;  4GYY A;  4EZJ A;  4GZ5 A;  3FU5 A;  4U0U A;  3CSF A;  1OCC E;  1BI8 B;  2Y69 E;  3FTV A;  2B6C A;  4TV3 A;  3VTX A;  5CHE E;  1KT1 A;  3D9M A;  3CST A;  3PZ1 A;  2V5F A;  3IXE A;  3LVQ E;  2OEV A;  2V5Q C;  3FTS A;  3ASF A;  3G2T A;  3S2A A;  4KBQ A;  5EYP F;  2MHK A;  3RAU A;  4JA9 A;  4BTA A;  2C0M A;  1IHB A;  4WWP A;  3KEZ A;  4W9R A;  3K9I A;  4DPR A;  5JHA A;  2MRI A;  5KJK A;  1E90 A;  3APC A;  4AVX A;  5FQ4 A;  1MX6 A;  1U3C A;  1OCR E;  3UM0 A;  4GA2 A;  3ZIM A;  2VTB A;  2CHZ A;  3UM1 A;  3D9K A;  2WXM A;  2BF0 X;  1KZP A;  2LAH A;  5KJL A;  1FT2 A;  3QAR A;  4B0Z A;  5CBO A;  4UUC A;  4WNG A;  4HLE A;  3NAW A;  2WVI A;  4UI9 C;  4HQD A;  2OOE A;  2WXP A;  4NUR A;  4N3A A;  1D8E A;  5ENS D;  4DX7 D;  3PZ4 A;  4IUL A;  5D0O D;  4CGW A;  4C0E A;  1XGW A;  4V3I A;  1N94 A;  1IQU A;  2OV8 A;  2XRY A;  4E85 A;  5JMN D;  1NL4 A;  1HXI A;  1YCS B;  5ENQ D;  2XPI A;  4XE0 A;  3PRE A;  2E2E A;  2WXF A;  4PDX A;  3CIA A;  2PM6 A;  2EIK E;  1Z6T A;  1MJ0 A;  5CMY A;  3U9W A;  3Q9N C;  1B89 A;  2DYS E;  3CHO A;  1E96 B;  4ANX A;  4O6F A;  2V0P A;  3FEY A;  4CDN A;  3MX3 A;  2OCC E;  1HH8 A;  2DBA A;  4DUI A;  4DRX E;  2MYO A;  2CHW A;  3ZYQ A;  4LCT A;  4APO A;  2VGE A;  1U3D A;  3DSX A;  3ZYL A;  1N95 A;  2UWJ G;  1U2V G;  4L1B A;  2NYJ A;  4A55 A;  1HU3 A;  4XEI G;  3JYS A;  3Q49 B;  3NOG D;  2GRP B;  2B0O E;  4CZ2 D;  4AY6 A;  5FQ7 A;  1A5E A;  3ZKJ A;  1JCS A;  2UY1 A;  1MHQ A;  3RRM B;  4XZ4 A;  2DZO A;  3WG7 E;  4EQF A;  3ZYM A;  3HIZ A;  5G05 C;  2X6I A;  2XS8 A;  4CCA A;  1YMP A;  4GTP A;  2WXO A;  3SNX A;  1LF8 A;  3ULY A;  4O60 A;  3ZN3 A;  4J6I A;  4K5B A;  3B13 A;  1ELW A;  1BPO A;  3AG4 E;  4IRU A;  3TWT A;  4A1S A;  1DNP A;  4EBA A;  1N11 A;  2XQ0 A;  3L13 A;  3ESK A;  3FEX A;  2P58 C;  1E8X A;  3RK6 A;  5E76 A;  3SF4 A;  2XS1 A;  3KS2 A;  4JEH A;  2J8S D;  4F3V A;  1TJF A;  1OWL A;  4CDM A;  2ETB A;  1HF8 A;  2FO7 A;  4GMJ A;  2X6F A;  1KT0 A;  5LX8 A;  5D66 A;  2EQX A;  5JJT A;  3HXB A;  4O1O A;  3V2X A;  3JUE A;  5FZS A;  4J8E A;  1N0Q A;  5AIJ A;  3FU6 A;  4G26 A;  5KJM A;  2XEH A;  2WQ7 A;  1SW6 A;  3E37 A;  1FT1 A;  3L9T A;  3FTY A;  5FWQ A;  4JL0 A;  4RSY A;  3E4B A;  2WPV A;  2GRM A;  1X5B A;  5EID A;  1IXV A;  4D10 C;  2ZGD A;  4YVO A;  4N2Q A;  4XKB A;  2V4H C;  1K1B A;  2IO3 C;  3APF A;  3PE3 A;  3HVE B;  3E33 A;  4J0U A;  4K5A B;  3HVE A;  3CVN A;  4G23 A;  3ONL A;  2OVF A;  5CCL A;  4UWL A;  1JWG A;  4I17 A;  4GML A;  5FIO A;  3DST A;  3TWR A;  4WUY A;  3L54 A;  3QDN A;  2R05 A;  1NFI E;  2P9I G;  3FHE A;  3C3Q A;  1KPS B;  3SO8 A;  4YVQ C;  2DYR E;  1HE8 A;  4FC8 A;  4XI0 A;  4GTQ A;  2XZT G;  3PDN A;  3V2O A;  5BV0 A;  1S63 A;  3D9L A;  4HNA D;  1S70 B;  4KVO A;  3SD5 A;  2ZU6 B;  3FP3 A;  3C72 A;  3NB2 A;  5M72 A;  3L82 A;  4XIF A;  1RZ4 A;  2NXP A;  4HS2 A;  3Q4A B;  4LG6 A;  3TJP A;  5CMW A;  2H6F A;  3JUI A;  3ZXS A;  3DXK G;  5D0Q D;  4Q96 A;  2YNQ A;  3MV3 B;  4GYO A;  3HYM B;  4RG9 A;  3DSS A;  2ZIS A;  4HB5 A;  3FTW A;  3ZNG A;  4NRH B;  2EIL E;  1LD8 A;  3ZYK A;  2VSX E;  4BET A;  2IJG X;  3FH7 A;  4Q69 A;  3P1U A;  3EHR A;  2IOL A;  3UPV A;  5ENT D;  3C98 A;  1LD7 A;  2DIW A;  4K03 A;  4G1T A;  5AN8 A;  5HRY A;  1O1S A;  4WNF A;  1H6P A;  2WXR A;  3U64 A;  2VYI A;  4Y6C A;  2RFM A;  3DRA A;  4XKC A;  2XZD G;  2Y1L E;  4BY6 A;  3S7B A;  3HXD A;  3B7U X;  5FQ8 A;  3B7T A;  2AWI A;  1V54 E;  1KLX A;  4I9C A;  4L2Y A;  4KZC A;  5EX3 A;  1KZO A;  4GA1 A;  4FLH A;  2CG2 A;  2BTD A;  2BKG A;  4KMO A;  4ANV A;  1NI1 A;  4JA7 A;  3L08 A;  3SY2 A;  2P9L G;  3UIP C;  3OTN A;  3S7F A;  1FVH A;  4BX8 A;  3E32 A;  1NP7 A;  3SHF A;  5DIZ A;  2WXH A;  3O48 A;  3RJV A;  1Y6I A;  2QC9 A;  4B89 A;  3LJ3 A;  4U7E B;  3BUA A;  3LY8 A;  3HHM A;  3QWP A;  2EIM E;  4J8Y A;  1W3B A;  2YQ8 A;  3FFL A;  3E34 A;  2IU1 A;  1S64 A;  1O1R A;  4ATG A;  5LP0 A;  2I2O A;  4CYM D;  3SFX A;  2GRN B;  3KSQ A;  3FU3 A;  5C1D A;  4JPS A;  2LO6 A;  4NAC A;  1DC2 A;  4DJA A;  4TXP A;  2AXV A;  4MBG A;  5CRU A;  3ISM C;  3LVR E;  4CDR A;  1D8D A;  4B93 B;  3LY9 A;  4JEU A;  2J08 A;  4FHJ A;  4U96 D;  1G3N B;  3UM2 A;  1N54 A;  3JQ1 A;  4U07 A;  2QYU A;  4A3T A;  4J7W A;  2H6H A;  1HO8 A;  5FTP A;  5ANL A;  2GW1 A;  3D9J A;  4JHJ A;  5AJL A;  2X6H A;  3PS6 A;  4PS3 A;  4F1S A;  2LAI A;  1IYG A;  4FJZ A;  4K0R A;  1MX2 A;  1H6K A;  4YND A;  1E8Z A;  3PZD A;  5CRV A;  4G8K A;  4TRQ A;  1TNO A;  4EPZ A;  4LUN U;  2WQ6 A;  1TYQ G;  1OXJ A;  3OAW A;  2KC7 A;  3J5P A;  2WM9 A;  1YA0 A;  4I6E A;  1JUQ A;  2OVB A;  3URZ A;  1HX8 A;  5JJ6 A;  3CV0 A;  4WAF A;  3EIQ C;  4GZC A;  2XCB A;  2R2L A;  1EF1 C;  4JD2 G;  3ASO E;  2KM4 A;  3QC1 A;  4ATZ D;  3AG1 E;  1MYO A;  1ZU2 A;  5AAO A;  3LJN A;  4AEZ C;  1P5Q A;  3VLE A;  2VSN A;  3CEQ A;  5AQ7 A;  3JXI A;  2GRR B;  2IF4 A;  4MS6 A;  3PNT B;  2FUL A;  4RQI A;  3CHM A;  3LYA A;  4RLY A;  4LSZ E;  1WY6 A;  4U0S A;  5AQ9 A;  4CRW A;  3DXM G;  1SA4 A;  1N52 A;  1TNU A;  4G25 A;  4HRM B;  5A6C A;  1H6O A;  2VSY A;  4I9E A;  3ULE G;  4MLP A;  4DK5 A;  3I4G A;  4EBA G;  3TL5 A;  1OY3 D;  4GCO A;  5FJY A;  3R9M A;  5HQ8 A;  3IEG A;  4F6R D;  4I2W A;  1N9A A;  3J5Q B;  1O1T A;  4PS7 A;  1ZBP A;  1Z5S C;  3AU4 A;  1MX4 A;  2LNI A;  5CED B;  5ANR A;  2FI7 A;  4FP7 A;  4RVB A;  4U04 A;  2L0I A;  1ELR A;  4BT9 A;  2BUG A;  3DPD A;  3RIB A;  3FUD A;  1RW2 A;  1DVP A;  3C3R A;  1Z3X A;  3I5P A;  2YHE A;  5FT9 A;  3MYV A;  4M7C A;  1SZ9 A;  4TXR A;  2QYJ A;  4BTB A;  5CER B;  2L6B A;  4B8A A;  5KCM A;  4P29 A;  3SFY A;  3MGB A;  4IN3 B;  3WXX A;  3CQG B;  4IYP A;  1GW6 A;  4YDW A;  3NBN B;  4GMR A;  4KT6 B;  4GZD A;  5J90 A;  2FEZ A;  3ABK E;  4UWF A;  3PUJ A;  2XGO A;  3AU5 A;  2P9K G;  3IKO B;  4A1G A;  4UQY A;  1QNF A;  3Q5M A;  3OXL A;  2JEK A;  1UW4 B;  3VLF A;  3D9H A;  3ZPJ A;  5CCM A;  3D3M A;  3V30 A;  2LXM A;  2LXL A;  4WWN A;  4EEC A;  5BNW A;  3FUK A;  4LNG A;  4LER A;  4BSZ B;  4L9P A;  1E8Y A;  3NOC D;  4N2S A;  1N4S A;  3V31 A;  2R02 A;  3DWL G;  4FUL A;  3TWQ A;  1HG5 A;  3RSE G;  2GRL A;  2YHC A;  3ZU7 B;  3ULQ A;  2J09 A;  4XI9 A;  4JW1 A;  4AJW A;  2X3M A;  3SBS A;  5KJN A;  5B1A E;  1FCH A;  1ELK A;  4DI4 A;  3S7D A;  3ASH A;  1NA0 A;  3ABL E;  5G05 J;  1PY1 A;  3UIO C;  1OWM A;  1TJC A;  2AW6 A;  3DBS A;  2C0L A;  2DZN A;  4ACK A;  4G24 A;  3TWS A;  4U63 A;  2VTB B;  5B1B E;  4G2V A;  3LDZ A;  4YDE A;  3CHQ A;  5EX0 A;  2PQR A;  2AXZ A;  1BLX B;  2A5U A;  1DCQ A;  4G11 A;  5KWD A;  1O5M A;  3HXF A;  3QKY A;  3DSW A;  4H7X A;  4MKT A;  4ILH B;  2BKK B;  2R03 A;  3ESL A;  2ZGG A;  4GU5 A;  2KAT A;  2BED A;  3Q9U C;  1D9S A;  2OND A;  3UT4 A;  4J8D A;  3ZHE A;  1WG0 A;  1QYM A;  4APF A;  5BXO A;  3TGO A;  3G2W A;  1H19 A;  1H2U A;  3L17 A;  3MKQ A;  4DX5 D;  3T8K A;  2I1K A;  2P9P G;  2X6J A;  4L23 A;  4M3O A;  1INZ A;  2WXJ A;  1SZA A;  3AS5 A;  4ACL A;  5ITZ F;  2FBN A;  2XEE A;  3EIJ A;  2I9C A;  3Q78 A;  5G04 C;  3APD A;  5JHB A;  1K3Z D;  1MZC A;  3JCK C;  1XNF A;  4HOT A;  4I1O B;  3TG4 A;  1K8K G;  3BU8 A;  2IO2 C;  4GZ3 A;  5EYL A;  2WXL A;  4QFV A;  5ARF A;  1H2V C;  5C2Y A;  2ZXW E;  3T5V A;  3GZ2 A;  1NA3 A;  4U8H A;  3Q7A A;  3IV0 A;  2OEW A;  4L7T A;  3SI5 A;  4C0M A;  3TG5 A;  1S0P A;  2Y3A A;  1E7V A;  3EDT B;  3Q73 A;  5EDS A;  1N4Q A;  2J4D A;  3R7R A;  3KD7 A;  5CBN A;  3TAX A;  2XGS A;  3NZU A;  3SZ7 A;  2DWZ A;  2QFC A;  1HG2 A;  5HKP A;  3TXM A;  4U8V D;  4N39 A;  5BPP A;  4OVU A;  2KZT B;  2NSZ A;  4GB9 A;  2IQC A;  1TEZ A;  4N5C A;  3LPZ A;  2WB2 A;  2XPY A;  3T9K A;  3EU9 A;  3PUK A;  3PE4 A;  4EZL A;  4JB8 P;  2LSV A;  3ZUV B;  4JC8 A;  3FTZ A;  2P2C P;  4UWK A;  4WND A;  1FPP A;  3FUL A;  4AXH A;  5CEA A;  3R7Q A;  1UG3 A;  3AG3 E;  1EDU A;  5ENR D;  3CK8 A;  4R7L A;  5FZQ A;  2R5S A;  4QQI A;  3ZW3 A;  2J07 A;  1V55 E;  4HRL A;  3EU5 A;  3CHP A;  3PZ2 A;  1YYH A;  2YIN A;  4HFG A;  2Y4T A;  4TUU A;  3PEU B;  2ETC A;  5KBA A;  3VLD A;  3RRN B;  1OCO E;  2VSO E;  4MRU A;  2CHX A;  3ONK A;  4BFR A;  5G04 J;  4I43 A;  4HBD A;  3IHV A;  4YDO A;  2KCK A;  2V4L A;  3ZFW A;  4LRZ A;  1A17 A;  1H0A A;  3L6A A;  5T4Y A;  3FU0 A;  4KYO B;  2WXQ A;  4K5C A;  2ILR A;  3R9A B;  3FDH A;  4JHK A;  3B7S A;  2M63 A;  3UIN C;  3T5X A;  3FTX A;  4NQ0 A;  5IY5 E;  3JQ0 A;  3GW4 A;  3TWV A;  3PZ3 A;  1OWP A;  4N3B A;  3Q47 B;  5JJ7 A;  1QQE A;  3UT8 A;  4JXT A;  3MKQ B;  3G2S A;  1JWF A;  3AG2 E;  4TUM A;  1SA5 A;  2QZA A;  4EHM A;  2KBX A;  1X81 A;  3V79 K;  2X38 A;  1HFA A;  3DEP A;  4JVS A;  3QOU A;  2RG8 A;  3MV2 B;  5BT1 A;  1TNZ A;  3UUX A;  3CVL A;  2KCV A;  2XCC A;  4PH4 B;  4I6G A;  1TN7 A;  3ASG A;  3MCX A;  3Q79 A;  4I1M A;  1IKN D;  1FVF A;  4B94 A;  3QB2 A;  4AIF A;  3RU0 A;  3L22 A;  3ZRH A;  4GAA A;  4FU3 A;  4F1P A;  2WMO A;  4LNB A;  1UN9 A;  5A23 A;  4AY5 A;  4GPM A;  3ML9 A;  1OCZ E;  3FUI A;  1H2T C;  3ASN E;  2KXP C;  4H7Y A;  3G2V A;  4I1A A;  4TXQ A;  3KAE A;  2J49 A;  4ANU A;  2HE0 A;  4C48 B;  4OAV B;  5EKQ D;  3CK9 A;  3FUN A;  1EYH A;  2JAB A;  3Q15 A;  5LFA A;  3RRU A;  3N71 A;  4GTV A;  3CHS A;  2XEN A;  2Y0B G;  2WXK A;  4ZHB A;  4ANW A;  4Z68 A;  3PNL B;  1BI7 B;  3U66 A;  1HZ4 A;  2F8Y A;  2VQ2 A;  2HYZ A;  2VJ8 A;  3QAQ A;  3CVV A;  3SFZ A;  2VGX A;  1PAQ A;  2XEV A;  4RG6 A;  3T8M A;  5AJD A;  1EPU A;  3UX4 A;  4NIK A;  2DCP A;  4YDY A;  2P9N G;  1IHG A;  5AQA A;  3SBT B;  3LXU X;  3BG1 B;  3BQO A;  3FUE A;  4CT4 A;  1K1A A;  4GTO A;  3W9F A;  2HM8 A;  3OXF A;  4BX9 A;  3CKB A;  2FF4 A;  3I3N A;  2PM7 A;  3P2B A;  5EIL A;  2WXG A;  5ARG A;  2XPZ A;  3W9G A;  2A4Z A;  1BD8 A;  4U0Z A;  4GA0 A;  3RO2 A;  2L9B A;  4JHR A;  1Z3Y A;  1OT8 A;  3DSU A;  3D9I A;  1WAO 1;  5J08 A;  4DX1 A;  4CEM A;  3FUJ A;  5LCW J;  4Y6W A;  2NC9 A;  2PL2 A;  3G2U A;  3PH0 C;  3E30 A;  2KCL A;  3CVX A;  4U95 D;  3GZS A;  4HOS A;  3IBE A;  3MZL B; 
#chains in the Genus database with same CATH homology
 2A5U A;  3D9M A;  4AOF A;  2QY7 A;  4XKC A;  3CST A;  3EHN A;  4G11 A;  3QKY A;  2V5F A;  3MA5 A;  2J4B A;  4H7X A;  4MKT A;  3LVQ E;  4ILH B;  5DBK A;  4BY6 A;  4EZK A;  2KZT A;  3ESL A;  3S7B A;  2L0T B;  3B7U X;  5FQ8 A;  3B7T A;  3FTS A;  3ASF A;  4CT0 A;  3G2T A;  4UI9 J;  4GU5 A;  2AWI A;  3S2A A;  4KBQ A;  1KLX A;  4J8S A;  2MHK A;  4JA9 A;  2KAT A;  2OND A;  4I9C A;  1OWO A;  2C0M A;  4KZC A;  4L2Y A;  4WWP A;  3UT4 A;  5EX3 A;  3KEZ A;  1MQS A;  4J8D A;  4OYS A;  3ZHE A;  5BV1 A;  4W9R A;  4APF A;  4GA1 A;  3TGO A;  4FLH A;  3G2W A;  2CG2 A;  3K9I A;  2BTD A;  1H19 A;  4DPR A;  1H2U A;  3L17 A;  3MKQ A;  2Q7F A;  3VTY A;  4FJY A;  4KMO A;  5JHA A;  4ANV A;  5G55 A;  2I1K A;  2MRI A;  4JA7 A;  5KJK A;  1E90 A;  3APC A;  1UJK A;  3L08 A;  4I2Z A;  4AVX A;  5FQ4 A;  2X6J A;  2J9Q A;  3OTN A;  4L23 A;  2X6K A;  4M3O A;  1UN8 A;  1INZ A;  2WXJ A;  3S7F A;  1SZA A;  1U3C A;  1FVH A;  3AS5 A;  2XHE A;  4ACL A;  2FBN A;  4GA2 A;  3ZIM A;  4BX8 A;  2VTB A;  3EIJ A;  2CHZ A;  3D9K A;  2WXM A;  1NP7 A;  2BF0 X;  5AEN A;  3O4Z A;  2LAH A;  2I9C A;  5KJL A;  3QWV A;  3SHF A;  3QAR A;  5G04 C;  2RD0 A;  2XGM A;  3APD A;  4B0Z A;  3GYZ A;  1SQM A;  5DIZ A;  4DLO A;  5JHB A;  4ME2 A;  3JCK C;  2WXH A;  3O48 A;  3RJV A;  4WNG A;  4HLE A;  1XNF A;  4HOT A;  4HOQ A;  1Y6I A;  4I1O B;  2VGY A;  3CQC B;  4EZJ A;  3TG4 A;  3FUM A;  3CR3 A;  4B89 A;  3LJ3 A;  3LY8 A;  3HHM A;  4L2L A;  2WVI A;  3LKU A;  3CVQ A;  4GZ3 A;  4UI9 C;  3QWP A;  3B7R L;  2WXL A;  1W3B A;  2YQ8 A;  2OOE A;  2WXP A;  4QFV A;  3ZHE B;  3FFL A;  4NUR A;  2IU1 A;  5ARF A;  1H2V C;  1Y8M A;  4ABN A;  5C2Y A;  4N3A A;  3T5V A;  3GZ2 A;  4ATG A;  2I2O A;  5LP0 A;  3BEE A;  4N3C A;  1NA3 A;  3NF1 A;  4HXI A;  3MJW A;  4U8H A;  2V8S E;  3IV0 A;  3FU3 A;  3LS8 A;  4IUL A;  5D0O D;  4CGW A;  5C1D A;  4JPS A;  4UQX A;  1XGW A;  4L7T A;  2JLB A;  3SI5 A;  4C0E A;  4BSX A;  4C0M A;  3TG5 A;  2LO6 A;  4NAC A;  1S0P A;  4V3I A;  1IQU A;  2Y3A A;  1E7V A;  3EDT B;  5T8I A;  4DJA A;  2XRZ A;  2OV8 A;  2XRY A;  5EDS A;  4E85 A;  3OXG A;  1HXI A;  2AXU A;  2J4D A;  3R7R A;  2AXV A;  2WXI A;  3KD7 A;  2C2L A;  3TAX A;  2XPI A;  2XGS A;  3NZU A;  3PRE A;  3QNK A;  4XE0 A;  3SZ7 A;  1OWN A;  3LVR E;  4CDR A;  2QFC A;  2HO1 A;  3PRZ A;  1HG2 A;  3TXM A;  2E2E A;  2WXF A;  4PDX A;  1OUV A;  2WXN A;  3CIA A;  3LY9 A;  3TXN A;  2PM6 A;  2CG3 A;  4JEU A;  4N39 A;  1Z6T A;  2J08 A;  4FHJ A;  5FZR A;  5BPP A;  4OVU A;  1N54 A;  3JQ1 A;  4U07 A;  5CMY A;  2KZT B;  2NSZ A;  2ION A;  3U9W A;  1B89 A;  2IQC A;  4GB9 A;  4A3T A;  3CHO A;  1TEZ A;  4N5C A;  4GZ6 A;  3LPZ A;  1E96 B;  3FH8 A;  1HO8 A;  4ANX A;  2XPY A;  4PS8 A;  2WB2 A;  4KXK B;  4O6F A;  2Y4U A;  5FTP A;  2V0P A;  5ANL A;  3FEY A;  4CDN A;  3PUK A;  4BTA A;  2GW1 A;  3MEK A;  3PE4 A;  1NZN A;  3MX3 A;  4EZL A;  4UWG A;  2LSV A;  3D9J A;  4JHJ A;  5AJL A;  2X6H A;  3PS6 A;  4JC8 A;  3FTZ A;  2LAI A;  4PS3 A;  4F1S A;  4LEU A;  4URK A;  1HH8 A;  2DBA A;  1IYG A;  4UWK A;  4FJZ A;  4WND A;  4K0R A;  3FUL A;  4AXH A;  2CHW A;  3ZYQ A;  3R7Q A;  4LCT A;  1UG3 A;  1WM5 A;  4APO A;  1H6K A;  3CGH A;  1EDU A;  4YND A;  5FZQ A;  3CK8 A;  4R7L A;  1U3D A;  2R5S A;  3ZYL A;  1E8Z A;  2UWJ G;  3PZD A;  5T3R A;  3ZW3 A;  2J07 A;  4TRQ A;  3U3W A;  4EPZ A;  3CHP A;  3MKR A;  3SGH A;  4LUN U;  4L1B A;  4ILI A;  2YIN A;  4HFG A;  2WQ6 A;  2Y4T A;  4FHK A;  2LSU A;  4A55 A;  4TUU A;  3PEU B;  1HU3 A;  3OAW A;  2KC7 A;  3VLD A;  2WM9 A;  1YA0 A;  3JYS A;  4I6E A;  3Q49 B;  1JUQ A;  3RRN B;  2CFZ A;  2MOW A;  2OVB A;  5E75 A;  3URZ A;  1HX8 A;  4AY6 A;  3LEW A;  5JJ6 A;  3CV0 A;  4AV7 A;  2VSO E;  4WAF A;  4MRU A;  3EIQ C;  4PUC A;  2CHX A;  5FQ7 A;  3CKC A;  4GZC A;  3ONK A;  4BFR A;  3UQ3 A;  5G04 J;  2UY1 A;  2XCB A;  5ENN A;  1MHQ A;  3RRM B;  4I43 A;  1EF1 C;  4XZ4 A;  3IHV A;  4ILG A;  3FWV A;  2KM4 A;  3QC1 A;  4EQF A;  1ZU2 A;  2I1J A;  3HIZ A;  2KCK A;  5G05 C;  2V4L A;  3ZYM A;  3ZFW A;  4LRZ A;  2X6I A;  1A17 A;  3U4T A;  1H0A A;  3L6A A;  5T4Y A;  4CCA A;  3ZGQ A;  4AEZ C;  3FU0 A;  4DLQ A;  1P5Q A;  2WXQ A;  2VSN A;  2WQH A;  4KYO B;  2VGX B;  5AYW D;  3VLE A;  3CEQ A;  3GZ1 A;  3FUH A;  2ILR A;  3ASD A;  3R9A B;  3FDH A;  2IF4 A;  4JZY A;  4A3V A;  1VDY A;  4JHK A;  4MS6 A;  3CHR A;  3PNT B;  3B7S A;  4HVB A;  2WXO A;  2M63 A;  2FUL A;  4BT8 A;  3SNX A;  3T5X A;  1LF8 A;  3IHY A;  4KVM A;  3FTX A;  4J8F A;  4NQ0 A;  3JQ0 A;  3ZN3 A;  3CHM A;  3HDX A;  3GW4 A;  3LYA A;  4J6I A;  3B13 A;  3ZEF A;  1ELW A;  2L6J A;  1WY6 A;  4U0S A;  1BPO A;  4Q94 A;  4CRW A;  4UQZ A;  3LCA A;  1OWP A;  4IRU A;  4A1S A;  1DNP A;  1IQR A;  4N3B A;  3CVU A;  3Q47 B;  4EBA A;  5JJ7 A;  3ML8 A;  4XX5 A;  1N52 A;  2GGF A;  2XQ0 A;  1QQE A;  3CVW A;  3L13 A;  3ESK A;  3FEX A;  2P58 C;  3CVP A;  3UT8 A;  1E8X A;  4G25 A;  4JXT A;  3RK6 A;  3NQP A;  5E76 A;  3MKQ B;  3SF4 A;  5A6C A;  2VSY A;  3G2S A;  3PVL A;  1JWF A;  4I9E A;  3KS2 A;  5BW8 C;  4FLB A;  4B8C B;  4JEH A;  4F3V A;  1TJF A;  4MLP A;  1OWL A;  4CDM A;  3NZS A;  4DK5 A;  3I4G A;  1HF8 A;  4EBA G;  2FO7 A;  4GMJ A;  2X6F A;  3TL5 A;  2PZI A;  1KT0 A;  5LX8 A;  4GCO A;  5FJY A;  2EQX A;  3IEG A;  5HQ8 A;  2X38 A;  1HFA A;  4I2W A;  4UI9 K;  5LCW C;  2AVP A;  3ENE A;  1HS6 A;  3EJN A;  4PS7 A;  1ZBP A;  4JVS A;  3QOU A;  5JJT A;  2RG8 A;  3QWW A;  5FZS A;  3AU4 A;  3BG0 B;  4KZ0 A;  2LNI A;  3MV2 B;  4J8E A;  2R17 C;  5BT1 A;  5ANR A;  5G2N A;  4OVV A;  5AIJ A;  3UUX A;  3FU6 A;  3CK7 A;  4G26 A;  2FI7 A;  5HI7 A;  5KJM A;  3CVL A;  4FP7 A;  4RVB A;  4E6H A;  4CGV A;  2KCV A;  2XCC A;  4PH4 B;  4I6G A;  4U04 A;  2L0I A;  1ELR A;  3ASG A;  1PC2 A;  3MCX A;  5LOZ A;  2WQ7 A;  3CLJ A;  3FTY A;  4BT9 A;  5FWQ A;  2BUG A;  3DPD A;  4JL0 A;  3RIB A;  4I1M A;  4RSY A;  4F53 A;  1FVF A;  3E4B A;  3FUD A;  4UWH A;  2WPV A;  4B94 A;  1DVP A;  1Z3X A;  3I5P A;  2YHE A;  2GRM A;  5FT9 A;  3MYV A;  3QB2 A;  1X5B A;  4AIF A;  1E7U A;  3RU0 A;  3L16 A;  3L22 A;  4AP2 A;  3ZRH A;  2WMN A;  1SZ9 A;  4D10 C;  3FUF A;  4FAD A;  4YVO A;  4GAA A;  4FU3 A;  2WMO A;  4BTB A;  4WNE A;  4N2Q A;  4XKB A;  4B8A A;  3EHM A;  5KCM A;  1UN9 A;  4P29 A;  4AY5 A;  5A23 A;  3MGB A;  3ML9 A;  4F7A A;  4IN3 B;  3APF A;  3I4R B;  3PE3 A;  3WXX A;  3HVE B;  3CQG B;  3S7J A;  4J0U A;  4IYP A;  1GW6 A;  3FTU A;  3CVY A;  3HVE A;  3CVN A;  3FUI A;  1H2T C;  4G23 A;  3ONL A;  2OVF A;  4KT6 B;  2IFU A;  4H7Y A;  4GZD A;  4AM9 A;  3G2V A;  2E0I A;  5J90 A;  5BUZ A;  4I1A A;  5FQ6 A;  4UWL A;  5CCL A;  2FEZ A;  3KAE A;  2J49 A;  1JWG A;  4UWF A;  4I17 A;  3PUJ A;  4GML A;  2XGO A;  4ANU A;  5A7D B;  4WUY A;  3UMV A;  5EKQ D;  3AU5 A;  3CK9 A;  3FUN A;  3IKO B;  3L54 A;  2I6H A;  3QDN A;  1EYH A;  3Q15 A;  5LFA A;  3FHE A;  3RRU A;  4A1G A;  4UQY A;  3N71 A;  4GCN A;  1QNF A;  4YVQ C;  3Q5M A;  1HE8 A;  4WWO A;  3OXL A;  2JEK A;  4FC8 A;  1UW4 B;  3VLF A;  3CHS A;  3ZPJ A;  4XI0 A;  5CCM A;  1UJJ A;  3D3M A;  2PQN A;  3ZVV A;  2WXK A;  4ANW A;  3PDN A;  3PNL B;  4WWN A;  4EEC A;  5BNW A;  3RKV A;  3FUK A;  5BV0 A;  3U66 A;  1L5J A;  3D9L A;  4KVO A;  1HZ4 A;  3AS8 A;  1E8W A;  3D9P A;  4LER A;  3SD5 A;  1QZ2 A;  2VQ2 A;  2ZU6 B;  1E8Y A;  2HYZ A;  2VJ8 A;  3FP3 A;  3QAQ A;  4N2S A;  3CVV A;  3SFZ A;  5M72 A;  2VGX A;  1PAQ A;  2XEV A;  4RG6 A;  4FUL A;  2CFU A;  1HG5 A;  3AS4 A;  3T8M A;  4XIF A;  1EPU A;  5AJD A;  2R59 A;  3UT7 A;  3UX4 A;  3QJZ A;  2GRL A;  4C9B B;  2NXP A;  3D9N A;  2YHC A;  3Q4A B;  2DCP A;  4HS2 A;  3TJP A;  4DI3 A;  5CMW A;  3JUI A;  3ZXS A;  1IHG A;  3SBT B;  3LXU X;  5D0Q D;  4Q96 A;  3ULQ A;  2YNQ A;  2J09 A;  3BG1 B;  4XI9 A;  4HOU A;  4JW1 A;  4AJW A;  3MV3 B;  3RO3 A;  2X3M A;  4GYO A;  3FUE A;  3FY4 A;  3SBS A;  4CT4 A;  5KJN A;  3QK0 A;  3HYM B;  4BWR A;  4RG9 A;  1JPL A;  3FTW A;  1FCH A;  2HM8 A;  1ELK A;  3OXF A;  4DI4 A;  4BX9 A;  4NRH B;  3CKB A;  3D9O A;  2FF4 A;  3ASH A;  3I3N A;  3S7D A;  2PM7 A;  3P2B A;  2HR2 A;  3ZYK A;  4GPK A;  1NA0 A;  2VSX E;  2WXG A;  5G05 J;  1PY1 A;  2IOS A;  2IJG X;  3FH7 A;  5ARG A;  2XPZ A;  2A4Z A;  4Q69 A;  1OWM A;  3P1U A;  4U0Z A;  4GA0 A;  3RO2 A;  1TJC A;  2IOL A;  2AW6 A;  2L9B A;  4GYW A;  3LY7 A;  3UPV A;  4I6J A;  4JHR A;  2UY1 B;  1Z3Y A;  3C98 A;  3DBS A;  2C0L A;  4HOR A;  2DIW A;  3D9I A;  4K03 A;  1WAO 1;  4G1T A;  5J08 A;  4FA6 A;  4CEM A;  3PEV B;  3FH5 A;  3FUJ A;  5LCW J;  4ACK A;  4G24 A;  4GYY A;  2NC9 A;  2PL2 A;  4GZ5 A;  4U63 A;  3G2U A;  2WXR A;  3FU5 A;  3PH0 C;  4WNF A;  4Y6W A;  4U0U A;  3CSF A;  2KCL A;  3U64 A;  2VTB B;  3CVX A;  2VYI A;  4G2V A;  3LDZ A;  3CHQ A;  3GZS A;  4HOS A;  3FTV A;  5EX0 A;  2PQR A;  4Y6C A;  2AXZ A;  3IBE A;  4TV3 A;  3VTX A;  5CHE E;  1KT1 A;  3MZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...