2KZTB

Structure of the tandem ma-3 region of pdcd4
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
b'GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed cell death protein 4
publication title Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 37
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kztB00
4JHKA 5ANRA 1PAQA 4B8AA 4JHJA 2ZU6B 1N54A 2VSXE 3D3MA 2IONA 3L6AA 4IULA 1UW4B 4C9BB 2GGFA 4GMLA 4CRWA 2I2OA 2IU1A 3EIJA 1N52A 3FEYA 1H2VC 4CT4A 1H2TC 4GMJA 3RK6A 2NSZA 2FULA 1H2UA 2IOLA 2IOSA 4B8CB 2VSOE 3EIQC 3JUIA 1HU3A 4B89A 4LUNU 2KZTA 3FEXA 2HM8A 2KZTB 1H6KA 1UG3A 2RG8A 4CEMA
chains in the Genus database with same CATH superfamily
3FUKA 1HO8A 2J8SD 2CG3A 2BKKB 4GZCA 3GYZA 1V55E 2C2LA 3LPZA 3QNKA 1N0QA 4G8LA 4G26A 3RRNB 3PZ1A 1K1BA 4AM9A 4DJAA 4N5CA 3ISMC 3UT4A 3RRMB 2FBNA 2IEJA 4JHJA 4GTTA 3U3WA 3FP3A 2I2OA 3HXEA 3CLJA 4U04A 5CBOA 3UIOC 1YYHA 4KXKB 4GAAA 3W9GA 3B13A 3CKBA 3CHQA 4G11A 3JYSA 2IO2C 3CSTA 5AQBA 2ILRA 3D3MA 4FJZA 1UW4B 1TJFA 3KSQA 4BTAA 2J4DA 1JCRA 3QJZA 2XENA 1FCHA 3ABME 2Y1LE 5AQAA 4XKBA 2CHXA 2C0MA 3FTXA 4HVBA 1PC2A 1MQSA 1S63A 3K9IA 4U63A 4LCTA 2XS8A 5AN8A 3FU6A 3VLEA 4FADA 2LNIA 3DSXA 3JXJA 1N95A 3OXFA 4DI3A 3FTVA 3ZUVB 2DIWA 5KJKA 3HXDA 3LVRE 4LRZA 4LNUD 4GTRA 1IHGA 4Q96A 1HS6A 2L0TB 5FQ4A 1LTXA 4OVVA 3SQVA 5ENSD 2VGXA 3ASOE 3P2BA 3SNXA 2Y3AA 1IHBA 3QK0A 2VGYA 3ZGQA 1PAQA 3FULA 5D66A 4MBGA 3UXGA 2X6KA 2XZTG 2B6CA 3ZU7B 4HLEA 3RJVA 4UQXA 5HKPA 3FTYA 3ABLE 1K1AA 5CEDB 5C1DA 4Z68A 3EU9A 3PNTB 3QWPA 3HXBA 2A5UA 3I3NA 2XPZA 4JL0A 2J9QA 4O1PA 4GMJA 4APFA 2QY7A 3R9MA 2P2CP 1FVFA 4HBDA 3UT8A 3CGHA 3LXUX 3PS6A 1X81A 4HI9A 3ENEA 2V4LA 5G04J 5T4YA 1E7UA 4L2YA 3MV2B 5AJDA 1ELRA 3U64A 3F6QA 3B7TA 3UINC 3S7JA 1GW6A 1HG5A 2LXLA 2GRRB 1H6KA 2J09A 4EBAA 3FTUA 4BERA 2ZU6B 4AEZC 1QYMA 1LD7A 1BLXB 3U4TA 3PEUB 3SO8A 4I2WA 5JJ6A 3D9HA 4OYSA 4ILIA 5EN5D 5FZRA 4BETA 1H6PA 4K5AB 4RQIA 4J8FA 4DX1A 2OVBA 3PVLA 3MKQB 2RD0A 3Q47B 1N9AA 4DX5D 2V5FA 3FHEA 2EIME 4ANXA 4GTOA 3S7DA 3CV0A 4WAFA 2RFMA 3IBEA 4GB9A 3UUXA 5ENPD 2P9SG 3PZDA 3PZ4A 4HOUA 5FWQA 3QOUA 3DWLG 4FLBA 2AXZA 4JW1A 5AYWD 2WXJA 3E4BA 4EBAG 2I1JA 4H7YA 1Y8MA 3MX3A 3PEVB 2ZISA 1N4RA 4M3OA 3B95A 3NOCD 3SBTB 3CHOA 5B3SE 3UMVA 3G2WA 4GTMA 4GZ6A 4YVOA 3Q9NC 3TL5A 2OV8A 2IO3C 1NA0A 1FPPA 4HB5A 4KVMA 4GU5A 2P9NG 2QC9A 4G1TA 4IN3B 3E32A 3TAXA 2XEEA 4BY6A 4GPMA 3DSTA 5FZSA 4UI9J 4BEPA 4FA6A 1QZ2A 5JJ7A 5ARGA 2P9IG 1U2VG 2VQ2A 3FU3A 5M72A 5JHBA 3FH5A 4AP2A 2WQ6A 4AY6A 1EDUA 2KBXA 1FVHA 5HI7A 3SZ7A 2WXHA 3FTSA 5KJLA 4F3VA 1P5QA 2IQCA 2PM6A 1BI7B 1TNBA 2ZGGA 3LS8A 3ZIMA 4GMLA 2I6HA 2DWZA 2YQ8A 4PS7A 3OXLA 4M7CA 4JHRA 4U8VD 3T8KA 2KZTB 3MCXA 1IXVA 4DLQA 1UJKA 2XEVA 1SZAA 1K3ZD 4UWGA 4L7TA 2DYRE 4HOQA 3EIJA 4WUYA 4X8QA 5EDSA 5T8IA 1NP7A 3CVPA 1TJCA 2WMNA 4U7EB 3T5XA 2WXPA 3TWXA 1WG0A 1D8EA 4ANVA 2CFZA 2GRPB 4JXTA 2WXMA 3TWTA 2WXNA 2WQHA 3FUFA 4A63B 3FEYA 3FU5A 4PS3A 2QZAA 2H6HA 3TWSA 4YDWA 3V79K 1X5BA 2V8SE 3ASHA 3E33A 2ETCA 2PQRA 3NQPA 4ATZD 2GROB 2WXIA 4GYOA 4B8CB 1U3CA 4APOA 5HRYA 3EU5A 4L9PA 5KNHD 2WXLA 3G2UA 3T9KA 4NACA 3O48A 1SQMA 5FJYA 4MS6A 3UM0A 4U8YD 1HXIA 3CEQA 2JEKA 2Y69E 3DSWA 1ZB1A 4EZKA 2XZDG 1HX8A 2FULA 3PE4A 1ELKA 2P9KG 5CMYA 3Q5MA 4L1BA 4FLHA 3CR3A 3D9PA 3I4RB 3AS8A 4UWKA 1N94A 1U3DA 4A55A 3IHVA 2XQ0A 1FT1A 2ETBA 4BT9A 4BWRA 5CEAA 4CDMA 1LD8A 1XGWA 4K0RA 4HFGA 2P9LG 3FH8A 2HE0A 5A23A 1NI1A 1RZ4A 5DBKA 4PS8A 2WXGA 2L0IA 2R59A 4MLPA 4ACKA 3PUJA 5EIDA 1LF8A 4GTVA 1YCSB 3E37A 3EHQA 3HHMA 3C98A 3L54A 3RAUA 4CT0A 3V31A 2F0YA 4UI9K 1MX2A 2XHEA 4JD2G 2EIJE 4U07A 4XE0A 1HE8A 2IU1A 4G8KA 2BKGA 4CGWA 4UWLA 2XCCA 1SA4A 2KATA 2HO1A 1N4SA 3AU4A 3DRAA 5AARA 1TEZA 3NOGD 3FDHA 2IY0C 2WQ7A 3FUMA 4LERA 1NFIE 4TUUA 1HZ4A 4QFVA 3CVNA 4XI0A 1A17A 2L9BA 5G05C 3PE3A 1SA5A 3IHYA 1V54E 5EILA 1H6OA 4KT6B 2AVPA 3MA5A 3NAWA 4I9EA 2LO6A 4B93B 2V4HC 4URKA 2R03A 2GRQB 3NF1A 5ENTD 4GCNA 4YNDA 5CRUA 5EX0A 4AV7A 3V2XA 1OUVA 3CVUA 4XKCA 4HORA 3AG3E 3PNLB 3HVEA 4BSXA 4J6IA 4AXHA 4ZHBA 3D9MA 1E7VA 2EINE 4DPRA 1Y6IA 2CFUA 2AXUA 4JVSA 4HS2A 4A1GA 2YNQA 2DZOA 2V5QC 4JZYA 4QQIA 4C48B 3PDNA 4KYOB 5BPPA 4YDYA 3Q79A 3TWQA 4CZ2D 4L23A 5KJNA 2XS1A 2P9UG 1S64A 4ANUA 5D2MC 2LUHA 3ZPJA 5KCMA 2BTDA 2CHZA 5FIOA 3OAWA 4OAVB 4UWFA 1Q2ZA 3GZ1A 5AAOA 4LNBA 2ONDA 2QYJA 3C5RA 3KS2A 3JXIA 4WNDA 3TXNA 3L17A 3MZLB 4YDEA 3CHPA 5T3RA 4CT4A 1OT8A 3IEGA 5C2YA 1OCRE 5ENNA 2DZNA 1WY6A 5LCWJ 4G24A 3ULYA 1KT1A 3SGHA 2X6JA 1UOHA 5CERB 4EPZA 2H6FA 1OY3D 2CHWA 3PREA 3ZHEB 2XGOA 3DEPA 3FFLA 4HNAD 3ZNGA 5KJMA 3VTXA 1XNFA 3ZXSA 1UN8A 3EHNA 4TV3A 4WWOA 4KZ0A 4GYWA 5D0OD 2FI7A 1SZ9A 3ZYMA 4N5QA 3UQ3A 5BUZA 2LAIA 4IRUA 3UIPC 1N54A 3MKQA 4IULA 2NXPA 2I9CA 3BU8A 2H6GA 3FU0A 2F8XK 1L5JA 4KMOA 4XEIG 4U8HA 4ABNA 1HFAA 4BX9A 4HRMB 5CECB 5BV0A 3FWVA 1O1TA 1DC2A 2Y4TA 4GA1A 4FULA 3HDXA 3Q7AA 1MYOA 1E8XA 3L22A 4DUIA 3QAQA 5D0QD 1TN8A 4B89A 4O1OA 1OWOA 5HQ8A 3JQ0A 3V30A 3Q15A 4ANWA 3KD7A 4TXQA 1TNOA 4LG6A 2E0IA 4PH4B 5ANLA 1TN6A 5A6CA 4CYMD 1SVXA 4TXRA 3QWWA 3W9FA 3Q75A 1O1RA 4HOSA 3L16A 4N3CA 3ULEG 3FUJA 4GCOA 1WDYA 3EHRA 4I6EA 4EQFA 4B8AA 1IYGA 2WXOA 3FH7A 3LY8A 3ZKJA 3OXGA 4GZDA 4WNEA 3LYAA 4GA0A 3EIQC 3X2QE 3FUEA 2PNNA 4BFRA 2VTBB 3LJNA 5A7DB 5LFAA 4UUCA 5CRVA 4I17A 5IY5E 4YVQC 4KZCA 1AP7A 2B0OE 3N71A 1H2TC 3QKYA 4J0UA 1OXJA 3KSLA 4HI8A 5ARFA 3UPVA 3S7FA 3G2VA 4G25A 4XZ4A 3ESKA 4DK5A 3AJIA 5FTPA 5CCLA 2R17C 3R7RA 3C3QA 3TWWA 2ZGDA 4YDOA 2VYIA 3CVWA 5FZQA 3R9AB 3LY9A 3RU0A 4ZFHA 4AJWA 3SHFA 2J4BA 5FQ8A 3G2TA 2PM7A 3CHSA 3PH0C 3APCA 2KCLA 2H6IA 3AAAC 2VGEA 3TG5A 2VSYA 1OWNA 2X6HA 2ETAA 1JCSA 2BEDA 2XPIA 3O4ZA 3NBNB 2YHCA 2L6JA 3FEXA 3KEZA 3UM2A 1Z6TA 1BD8A 4GZ3A 5ANRA 3UKUG 5G2NA 3QARA 3T5VA 5AENA 4I9CA 4UQYA 4CRWA 3HIZA 2YHEA 4R7LA 2I1KA 3DSUA 3FUHA 3SFZA 2YINA 5JMND 2GRNB 2R02A 5ENOD 5J08A 1E90A 1N4QA 4TRQA 1S0PA 4F53A 4J8DA 4CGVA 2AJAA 5AQ7A 3E34A 5EIBE 3D9KA 2MRIA 4JHKA 4JA9A 3SY2A 1QBQA 3D9IA 1DCEA 3CQCB 4TXPA 4RVBA 2KCKA 3FY4A 4A1SA 3AG4E 3RK6A 3AS4A 3UTMA 2AWIA 4IYPA 1TNZA 5E76A 3JUIA 1KLXA 3ZFWA 1INZA 3ASNE 4MKTA 4DX6D 1TNUA 1N0RA 1D8DA 3Q9UC 1DNPA 2UY1A 5H7PA 2UWJG 2WXQA 1TR4A 3IKOB 2OCCE 3CVYA 4EECA 3NZUA 4BSZB 5ENRD 1Z5SC 1O5MA 3VLDA 5EKQD 4JB8P 1B89A 4I6GA 2RG8A 2P58C 5B1AE 1RW2A 4AIFA 2X3MA 2OEWA 5LOZA 2HYZA 3L82A 4U0SA 3B7SA 4N39A 4I6JA 5ENQD 4N2SA 2X6IA 3U9WA 3Q78A 2F37A 4G23A 3TWUA 1QQEA 1FT2A 1K8KG 3ONKA 4E85A 2FO1E 2Y0BG 1KT0A 2WB2A 2JABA 5CHEE 4A3VA 3FUNA 3QDNA 5AQ9A 5AJLA 4G2VA 1DVPA 3MKRA 3SFYA 4AOFA 3JCKC 3U66A 3DXKG 3CVVA 3SI5A 3TWRA 2QYUA 5FINA 3D9LA 3ZYKA 5FQ7A 4LSZE 4ATGA 4J7WA 5AIJA 5CCMA 5EX3A 4HRLA 3BQOA 1WM5A 3QWVA 4N3BA 2WXFA 4HLLA 3TWVA 1E8YA 4BT8A 3MGBA 3ASFA 4AY5A 2JLBA 4ILHB 3QC1A 4UI9C 5DIZA 3ZYQA 3I4GA 1OWPA 3WXXA 2IJGX 3QB2A 3IXEA 5E75A 4I43A 4WNFA 5BW8C 1VDYA 3LEWA 2IOSA 3L08A 5EYLA 5BV1A 2GRLA 5KWDA 2WXKA 4XIFA 3ML8A 4GTSA 1DCQA 1OWMA 1HF8A 2J07A 2Q7FA 4B94A 3ZVVA 2ZIRA 3FTZA 4I1OB 2VSNA 2NYJA 1KPSB 2AXVA 3S2AA 3BG0B 3CVQA 1EF1C 4D10C 1Z3XA 2LAHA 5BXOA 1HH8A 4K03A 3PUKA 3AU5A 4NURA 3R7QA 5CMWA 2IFUA 3RO2A 3VTYA 3CQGB 3DPDA 3HVEB 5G55A 4FHJA 4Y6WA 3CK7A 2WPVA 3AG2E 4TUMA 3UI2A 4XI9A 3D9OA 5FT9A 1E96B 3D9JA 2E2EA 2VJ8A 3AG1E 5KBAA 4DI4A 3HXCA 3EJNA 1ZBPA 3UM1A 5LX8A 1N52A 5BNWA 4O6FA 2X6FA 2V0PA 1H2UA 2VGXB 3MEKA 5B1BE 4K5CA 3Q7FA 2PZIA 2XPYA 3DXMG 3L9TA 3SF4A 2PQNA 4C0EA 3RSEG 1MX6A 3D9NA 3BEEA 3UKRG 3SBSA 3RRUA 2RKKA 4RG9A 4I1MA 1NL4A 1UN9A 4Q69A 4BESA 2KM4A 2PL2A 3CKCA 4ACLA 2LSVA 4W9RA 4NRHB 4GTQA 3ULQA 4U0ZA 4J8YA 4JEHA 4JA7A 4PDXA 3ZHEA 4LNGA 2EQXA 1WAO1 3I5PA 3HRAA 3RIBA 4EZJA 4BX8A 1D9SA 1IQRA 4N2QA 1YA0A 5BXUA 4F6RD 2GGFA 4HOTA 1H0AA 3PZ3A 4FP7A 1ZU2A 5BT1A 1H2VC 4U95D 2WM9A 1OCOE 3ML9A 4JEUA 1UG3A 2DYSE 1EYHA 1KZPA 1JPLA 4HRNA 4GZ5A 4V3IA 3C3RA 2IONA 2LXMA 3B7RL 2AW6A 1JUQA 3V2OA 3EDTB 3NB2A 1OWLA 2EIKE 2OEVA 2HM8A 4OVUA 3TJPA 4F1SA 3ASDA 3JQ1A 2OOEA 4XX5A 1OCCE 3LY7A 2X38A 3ZXPA 3L6AA 4JC8A 4BTBA 3OTNA 1MZCA 3TGOA 4PUCA 4RLYA 3CK8A 3TG4A 1BI8B 4OAUC 4UWHA 3DPYA 3ZN3A 3LDZA 2R5SA 3J5QB 4WNGA 4F1PA 4DX7D 3Q73A 3Q49B 3SFXA 1QNFA 4GMRA 3KAEA 2IF4A 3CIAA 5CBNA 2FF4A 2EILE 4CEMA 4E6HA 3CK9A 3HYMB 5EYPF 3ABKE 2XCBA 3L13A 3MJWA 2J08A 3FTWA 4Y6CA 5KNGA 2Y4UA 3CSFA 4C0MA 1MHQA 4KVOA 2M63A 3ASGA 4AVXA 2NSZA 3APFA 3RKVA 4GPKA 1HU3A 3DSSA 3WG7E 3LCAA 2VTBA 3HG0D 3E30A 5ITZF 4GYYA 2RFAA 2FO7A 5G05J 2HR2A 2WVIA 1JCQA 1G3NB 3ZRHA 1UJJA 3NZSA 3ESLA 3PRZA 2KCVA 5JJTA 4ME2A 2DCPA 3S7BA 3DEOA 1MJ0A 5J90A 1HG2A 2C0LA 2BUGA 3DBSA 5LP0A 1Z3YA 2XEHA 1N4PA 2IOLA 2QFCA 4MRUA 3TXMA 3Q4AB 2KZTA 4DRXE 3FUIA 3AS5A 1E8ZA 5HS0A 4GA2A 4A3TA 4EZLA 2WXRA 2LSUA 3J5PA 1TN7A 2BF0X 1TYQG 4LEUA 2A5EA 1IQUA 2GRMA 3CHMA 2F8YA 4DX2A 3FUDA 1OCZE 1MX4A 2XRYA 2MHKA 3C72A 3CVXA 2ZXWE 2L6BA 4FC8A 3UX4A 4NIKA 3KEAA 4NQ0A 4K5BA 4U96D 4CCAA 1TNYA 3UM3A 1JWGA 4HQDA 4J8SA 3LVQE 4CDRA 1A5EA 3GZ2A 2R05A 1SW6A 2MYOA 2VSXE 3PZ2A 5LCWC 1AWCB 2DVWA 4I2ZA 3G2SA 2MOWA 5G04C 2P9PG 4B0ZA 4P29A 3B7UX 3SD5A 4DLOA 2R2LA 2XGMA 1BPOA 4F7AA 4UQZA 4GTPA 1PY1A 3VLFA 5JHAA 3LJ3A 4C9BB 3ONLA 4JPSA 3P1UA 1E8WA 3DSVA 4FHKA 3UT7A 4L2LA 2XRZA 2KC7A 2CG2A 4O60A 4EHMA 3BG1B 4KBQA 3CHRA 2XGSA 3B7BA 3T8MA 2A4ZA 1H19A 2J49A 3MV3B 1S70B 3GW4A 1N11A 4J8EA 1O1SA 2NC9A 3MYVA 3URZA 4I1AA 1KZOA 3RO3A 2OVFA 3ZEFA 4WWNA 4ILGA 2UY1B 3GZSA 3CVLA 3EUVA 1BU9A 1NA3A 4WWPA 4CDNA 2DBAA 4FJYA 3BUAA 3C3OA 1YMPA 4FU3A 3LKUA 1EPUA 5JA4D 1IKND 3APDA 3JUEA 2FEZA 3HXFA 4U0UA 3IV0A 4RSYA 1W3BA 4H7XA 4RG6A 4N3AA 1ELWA 2GW1A 3ZYLA 4Q94A 2WMOA 3EHMA 3ZW3A 1JWFA 2KXPC 2VSOE 5FQ6A 4LUNU 1NZNA 4HXIA
chains in the Genus database with same CATH topology
2WXPA 3FUKA 5HQ8A 1HO8A 3JQ0A 2PZIA 2XPYA 2CG3A 4ANWA 3Q15A 4GZCA 4ANVA 3GYZA 3KD7A 3SF4A 2CFZA 2C2LA 4JXTA 2PQNA 3LPZA 2E0IA 2WXMA 4C0EA 4PH4B 2WXNA 3QNKA 2WQHA 5ANLA 5A6CA 3D9NA 3FUFA 3FEYA 3BEEA 3SBSA 3RRUA 4G26A 3QWWA 3FU5A 4RG9A 4I1MA 4PS3A 3RRNB 4HOSA 3L16A 4N3CA 3FUJA 1UN9A 4AM9A 4DJAA 4GCOA 4N5CA 1X5BA 4Q69A 3UT4A 2V8SE 4I6EA 3RRMB 3ASHA 4EQFA 2FBNA 4B8AA 1IYGA 2WXOA 4JHJA 3FH7A 2PQRA 3NQPA 3LY8A 3U3WA 2KM4A 2PL2A 3CKCA 4ACLA 2LSVA 3FP3A 4W9RA 4NRHB 2WXIA 2I2OA 3ULQA 3OXGA 4U0ZA 3CLJA 4GYOA 4GZDA 4JEHA 4WNEA 4JA7A 4U04A 3LYAA 4B8CB 4GA0A 1U3CA 4PDXA 3ZHEA 3EIQC 2EQXA 4APOA 4KXKB 4GAAA 1WAO1 3FUEA 3I5PA 3RIBA 3B13A 4BFRA 2WXLA 3CKBA 3G2UA 2VTBB 3CHQA 5A7DB 4BX8A 4EZJA 5LFAA 4G11A 1IQRA 3O48A 1SQMA 4NACA 5FJYA 3JYSA 1YA0A 4N2QA 3CSTA 4MS6A 2ILRA 3D3MA 4I17A 4FJZA 1HXIA 3CEQA 1UW4B 1TJFA 2GGFA 4YVQC 4BTAA 1H0AA 2J4DA 4HOTA 4KZCA 2JEKA 3QJZA 3N71A 4FP7A 1FCHA 1ZU2A 4EZKA 1H2VC 5BT1A 1H2TC 2WM9A 3QKYA 1HX8A 2FULA 3PE4A 4XKBA 3ML9A 4J0UA 1ELKA 2CHXA 4JEUA 2C0MA 5CMYA 3FTXA 1UG3A 5ARFA 1PC2A 1EYHA 3Q5MA 1MQSA 4HVBA 3UPVA 3S7FA 4L1BA 4FLHA 1JPLA 4GZ5A 3G2VA 3K9IA 4U63A 4V3IA 3CR3A 3D9PA 3I4RB 2IONA 4G25A 3B7RL 4XZ4A 3ESKA 4LCTA 4DK5A 3AS8A 4UWKA 5FTPA 2AW6A 1U3DA 4A55A 3FU6A 3IHVA 5CCLA 1JUQA 2R17C 2XQ0A 3VLEA 3R7RA 4FADA 2LNIA 3EDTB 2VYIA 1OWLA 3CVWA 5FZQA 3R9AB 3LY9A 3OXFA 3RU0A 4BT9A 4BWRA 4DI3A 4AJWA 2HM8A 4OVUA 3SHFA 4CDMA 3FTVA 2J4BA 1XGWA 5FQ8A 2DIWA 5KJKA 3TJPA 4K0RA 3ASDA 3G2TA 3LVRE 3JQ1A 4HFGA 4LRZA 4F1SA 3FH8A 2PM7A 2OOEA 3CHSA 4XX5A 3LY7A 3PH0C 5A23A 1IHGA 2X38A 4Q96A 3APCA 1HS6A 2L0TB 2KCLA 3L6AA 4JC8A 4BTBA 3OTNA 5FQ4A 5DBKA 3TGOA 4PS8A 2WXGA 3TG5A 2L0IA 4PUCA 4OVVA 2VSYA 2R59A 4MLPA 1OWNA 2X6HA 3CK8A 3TG4A 4ACKA 3PUJA 2VGXA 2XPIA 3O4ZA 1LF8A 3P2BA 3SNXA 2Y3AA 4UWHA 3QK0A 2YHCA 3ZN3A 2VGYA 2L6JA 3LDZA 3FEXA 2R5SA 3KEZA 1Z6TA 3HHMA 3L54A 3C98A 4GZ3A 4WNGA 3ZGQA 5ANRA 1PAQA 4CT0A 5G2NA 3QARA 3FULA 3Q49B 3T5VA 5AENA 4UI9K 1QNFA 2XHEA 4I9CA 4UQYA 2X6KA 4CRWA 4U07A 3HIZA 4XE0A 1HE8A 2IU1A 2YHEA 4R7LA 2I1KA 4HLEA 4CGWA 3KAEA 3RJVA 4UQXA 4UWLA 2IF4A 3FUHA 2XCCA 3SFZA 2YINA 3CIAA 3FTYA 2KATA 2HO1A 2FF4A 3AU4A 5C1DA 4CEMA 4E6HA 3CK9A 3PNTB 3QWPA 3HYMB 1TEZA 2A5UA 3FDHA 2XCBA 2WQ7A 3I3NA 3L13A 3MJWA 2J08A 5J08A 3FUMA 2XPZA 4JL0A 2J9QA 1E90A 3FTWA 4LERA 4TUUA 1HZ4A 4Y6CA 2Y4UA 4QFVA 3CSFA 4C0MA 3CVNA 1MHQA 4XI0A 4KVOA 4GMJA 4TRQA 4APFA 2M63A 3ASGA 1S0PA 1A17A 2NSZA 2QY7A 4AVXA 2L9BA 4F53A 5G05C 3APFA 3PE3A 4J8DA 3RKVA 4GPKA 1HU3A 1FVFA 3IHYA 4CGVA 3LCAA 2VTBA 3UT8A 3CGHA 3D9KA 2MRIA 4JHKA 4KT6B 2AVPA 3LXUX 3PS6A 4JA9A 3MA5A 3D9IA 4I9EA 3CQCB 3ENEA 2V4LA 4GYYA 2LO6A 5G04J 4RVBA 5T4YA 2KCKA 2FO7A 4URKA 1E7UA 5G05J 2HR2A 3FY4A 2WVIA 4L2YA 4A1SA 3MV2B 3NF1A 5AJDA 1ELRA 3U64A 3ZRHA 3RK6A 3AS4A 3B7TA 1UJJA 4GCNA 3NZSA 4YNDA 2AWIA 3ESLA 4IYPA 5E76A 3S7JA 1GW6A 3JUIA 1KLXA 1HG5A 3ZFWA 5EX0A 1INZA 1H6KA 4AV7A 2J09A 4MKTA 3PRZA 2KCVA 4EBAA 1DNPA 1OUVA 2UY1A 5JJTA 3FTUA 3CVUA 2UWJG 4ME2A 2ZU6B 2WXQA 4AEZC 2DCPA 4XKCA 4HORA 3IKOB 3S7BA 3PNLB 3U4TA 3CVYA 3PEUB 4EECA 3HVEA 3NZUA 4I2WA 5J90A 5JJ6A 1HG2A 2C0LA 2BUGA 3DBSA 4BSXA 4J6IA 1Z3YA 4AXHA 5LP0A 3D9MA 1E7VA 2IOLA 4OYSA 3VLDA 4ILIA 4DPRA 1Y6IA 5EKQD 2CFUA 2QFCA 4MRUA 3Q4AB 3TXMA 5FZRA 2KZTA 1B89A 2AXUA 4I6GA 4JVSA 3FUIA 4HS2A 3AS5A 2RG8A 2P58C 1E8ZA 4AIFA 4A1GA 4J8FA 2YNQA 4GA2A 4A3TA 2X3MA 4EZLA 2WXRA 2OVBA 4JZYA 3PVLA 2LSUA 3MKQB 3PDNA 4KYOB 2RD0A 2BF0X 3Q47B 5LOZA 5BPPA 4LEUA 2V5FA 3FHEA 2HYZA 4U0SA 3B7SA 4ANXA 4N39A 4L23A 4I6JA 1IQUA 2GRMA 3CHMA 4N2SA 3FUDA 2X6IA 5KJNA 3U9WA 3S7DA 2XRYA 2MHKA 3CV0A 3CVXA 4G23A 1QQEA 3ONKA 4FC8A 4WAFA 4ANUA 4E85A 2WB2A 1KT0A 5CHEE 3UX4A 3IBEA 4NQ0A 4GB9A 4A3VA 3FUNA 3UUXA 4CCAA 3ZPJA 3QDNA 5KCMA 3PZDA 2BTDA 2CHZA 1JWGA 4HOUA 5FWQA 3QOUA 3OAWA 4J8SA 5AJLA 4G2VA 1DVPA 3MKRA 3LVQE 4AOFA 3JCKC 4FLBA 2AXZA 4UWFA 4JW1A 5AYWD 4CDRA 3U66A 2WXJA 3GZ2A 3GZ1A 3CVVA 3SI5A 3E4BA 2ONDA 4EBAG 3KS2A 4WNDA 3D9LA 3ZYKA 5FQ7A 3TXNA 3L17A 4ATGA 3MZLB 5AIJA 2VSXE 2I1JA 5CCMA 5EX3A 4H7YA 1Y8MA 3MX3A 3PEVB 5LCWC 1WM5A 4M3OA 3CHPA 3QWVA 5T3RA 3SBTB 4CT4A 3CHOA 4I2ZA 3G2SA 4N3BA 2MOWA 3IEGA 5G04C 2WXFA 5C2YA 4B0ZA 5ENNA 3UMVA 4P29A 3G2WA 4GZ6A 3B7UX 1E8YA 3SD5A 4DLOA 2XGMA 4BT8A 3MGBA 4YVOA 1WY6A 3ASFA 1BPOA 4F7AA 4UQZA 2OV8A 3TL5A 4AY5A 2JLBA 5LCWJ 4ILHB 3QC1A 4G24A 1PY1A 3VLFA 1KT1A 3SGHA 4UI9C 5DIZA 5JHAA 3ZYQA 3I4GA 1NA0A 1OWPA 3WXXA 4KVMA 2X6JA 3LJ3A 3ONLA 4C9BB 4GU5A 4JPSA 2IJGX 3QB2A 4EPZA 4G1TA 4IN3B 5E75A 3P1UA 4I43A 4WNFA 3TAXA 1E8WA 5BW8C 1VDYA 3LEWA 2IOSA 3L08A 2CHWA 5BV1A 4FHKA 3UT7A 2GRLA 4BY6A 3PREA 2WXKA 3ZHEB 2XGOA 3FFLA 4XIFA 5FZSA 4UI9J 5KJMA 3VTXA 1XNFA 4L2LA 3ZXSA 2XRZA 2KC7A 4FA6A 1QZ2A 1UN8A 2CG2A 3EHNA 3ML8A 3BG1B 1OWMA 5JJ7A 1HF8A 2J07A 2Q7FA 4TV3A 4WWOA 5ARGA 4KBQA 4B94A 2VQ2A 3CHRA 3ZVVA 3FU3A 2XGSA 4KZ0A 5M72A 3FTZA 5JHBA 4I1OB 4GYWA 2VSNA 5D0OD 3T8MA 2A4ZA 3FH5A 1H19A 2FI7A 2J49A 3MV3B 4AP2A 1SZ9A 3GW4A 2AXVA 3S2AA 3BG0B 4J8EA 2WQ6A 3CVQA 4AY6A 1EDUA 3ZYMA 2NC9A 1FVHA 3MYVA 5HI7A 1EF1C 3URZA 4I1AA 4D10C 3UQ3A 3SZ7A 1Z3XA 2LAHA 1HH8A 2WXHA 3FTSA 5KJLA 3RO3A 4K03A 2OVFA 3ZEFA 3PUKA 4WWNA 4ILGA 4F3VA 2UY1B 3AU5A 1P5QA 2LAIA 3GZSA 5BUZA 2IQCA 3CVLA 4NURA 4IRUA 3R7QA 5CMWA 1N54A 2IFUA 2PM6A 3RO2A 3MKQA 3VTYA 4IULA 3LS8A 3CQGB 3ZIMA 1NA3A 2NXPA 2I9CA 4GMLA 4WWPA 2I6HA 3DPDA 3HVEB 2DBAA 3FU0A 2YQ8A 4FJYA 5G55A 4CDNA 4FU3A 1L5JA 3LKUA 4PS7A 4KMOA 3OXLA 1EPUA 4FHJA 4U8HA 4Y6WA 3CK7A 4ABNA 4JHRA 2WPVA 3APDA 1HFAA 2FEZA 4BX9A 4XI9A 3D9OA 5FT9A 1E96B 2KZTB 4U0UA 3D9JA 3MCXA 3IV0A 4RSYA 2E2EA 3FWVA 5BV0A 2VJ8A 4DLQA 1UJKA 2XEVA 2Y4TA 4GA1A 4FULA 3HDXA 4DI4A 1W3BA 1SZAA 3EJNA 4H7XA 1ZBPA 4RG6A 4N3AA 1ELWA 4UWGA 1E8XA 4L7TA 2GW1A 4HOQA 3ZYLA 3EIJA 4WUYA 1N52A 3L22A 5LX8A 4Q94A 2WMOA 5BNWA 5EDSA 5T8IA 3EHMA 4O6FA 3QAQA 3ZW3A 1NP7A 2X6FA 3CVPA 2V0PA 1JWFA 1H2UA 5D0QD 1TJCA 2VSOE 2VGXB 5FQ6A 2WMNA 4B89A 3MEKA 4LUNU 1NZNA 4HXIA 3T5XA 1OWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHK A;  5ANR A;  1PAQ A;  4B8A A;  4JHJ A;  2ZU6 B;  1N54 A;  2VSX E;  3D3M A;  2ION A;  3L6A A;  4IUL A;  1UW4 B;  4C9B B;  2GGF A;  4GML A;  4CRW A;  2I2O A;  2IU1 A;  3EIJ A;  1N52 A;  3FEY A;  1H2V C;  4CT4 A;  1H2T C;  4GMJ A;  3RK6 A;  2NSZ A;  2FUL A;  1H2U A;  2IOL A;  2IOS A;  4B8C B;  2VSO E;  3EIQ C;  3JUI A;  1HU3 A;  4B89 A;  4LUN U;  2KZT A;  3FEX A;  2HM8 A;  2KZT B;  1H6K A;  1UG3 A;  2RG8 A;  4CEM A; 
#chains in the Genus database with same CATH topology
 3FUK A;  1HO8 A;  2J8S D;  2CG3 A;  2BKK B;  4GZC A;  3GYZ A;  1V55 E;  2C2L A;  3LPZ A;  3QNK A;  1N0Q A;  4G8L A;  4G26 A;  3RRN B;  3PZ1 A;  1K1B A;  4AM9 A;  4DJA A;  4N5C A;  3ISM C;  3UT4 A;  3RRM B;  2FBN A;  2IEJ A;  4JHJ A;  4GTT A;  3U3W A;  3FP3 A;  2I2O A;  3HXE A;  3CLJ A;  4U04 A;  5CBO A;  3UIO C;  1YYH A;  4KXK B;  4GAA A;  3W9G A;  3B13 A;  3CKB A;  3CHQ A;  4G11 A;  3JYS A;  2IO2 C;  3CST A;  5AQB A;  2ILR A;  3D3M A;  4FJZ A;  1UW4 B;  1TJF A;  3KSQ A;  4BTA A;  2J4D A;  1JCR A;  3QJZ A;  2XEN A;  1FCH A;  3ABM E;  2Y1L E;  5AQA A;  4XKB A;  2CHX A;  2C0M A;  3FTX A;  4HVB A;  1PC2 A;  1MQS A;  1S63 A;  3K9I A;  4U63 A;  4LCT A;  2XS8 A;  5AN8 A;  3FU6 A;  3VLE A;  4FAD A;  2LNI A;  3DSX A;  3JXJ A;  1N95 A;  3OXF A;  4DI3 A;  3FTV A;  3ZUV B;  2DIW A;  5KJK A;  3HXD A;  3LVR E;  4LRZ A;  4LNU D;  4GTR A;  1IHG A;  4Q96 A;  1HS6 A;  2L0T B;  5FQ4 A;  1LTX A;  4OVV A;  3SQV A;  5ENS D;  2VGX A;  3ASO E;  3P2B A;  3SNX A;  2Y3A A;  1IHB A;  3QK0 A;  2VGY A;  3ZGQ A;  1PAQ A;  3FUL A;  5D66 A;  4MBG A;  3UXG A;  2X6K A;  2XZT G;  2B6C A;  3ZU7 B;  4HLE A;  3RJV A;  4UQX A;  5HKP A;  3FTY A;  3ABL E;  1K1A A;  5CED B;  5C1D A;  4Z68 A;  3EU9 A;  3PNT B;  3QWP A;  3HXB A;  2A5U A;  3I3N A;  2XPZ A;  4JL0 A;  2J9Q A;  4O1P A;  4GMJ A;  4APF A;  2QY7 A;  3R9M A;  2P2C P;  1FVF A;  4HBD A;  3UT8 A;  3CGH A;  3LXU X;  3PS6 A;  1X81 A;  4HI9 A;  3ENE A;  2V4L A;  5G04 J;  5T4Y A;  1E7U A;  4L2Y A;  3MV2 B;  5AJD A;  1ELR A;  3U64 A;  3F6Q A;  3B7T A;  3UIN C;  3S7J A;  1GW6 A;  1HG5 A;  2LXL A;  2GRR B;  1H6K A;  2J09 A;  4EBA A;  3FTU A;  4BER A;  2ZU6 B;  4AEZ C;  1QYM A;  1LD7 A;  1BLX B;  3U4T A;  3PEU B;  3SO8 A;  4I2W A;  5JJ6 A;  3D9H A;  4OYS A;  4ILI A;  5EN5 D;  5FZR A;  4BET A;  1H6P A;  4K5A B;  4RQI A;  4J8F A;  4DX1 A;  2OVB A;  3PVL A;  3MKQ B;  2RD0 A;  3Q47 B;  1N9A A;  4DX5 D;  2V5F A;  3FHE A;  2EIM E;  4ANX A;  4GTO A;  3S7D A;  3CV0 A;  4WAF A;  2RFM A;  3IBE A;  4GB9 A;  3UUX A;  5ENP D;  2P9S G;  3PZD A;  3PZ4 A;  4HOU A;  5FWQ A;  3QOU A;  3DWL G;  4FLB A;  2AXZ A;  4JW1 A;  5AYW D;  2WXJ A;  3E4B A;  4EBA G;  2I1J A;  4H7Y A;  1Y8M A;  3MX3 A;  3PEV B;  2ZIS A;  1N4R A;  4M3O A;  3B95 A;  3NOC D;  3SBT B;  3CHO A;  5B3S E;  3UMV A;  3G2W A;  4GTM A;  4GZ6 A;  4YVO A;  3Q9N C;  3TL5 A;  2OV8 A;  2IO3 C;  1NA0 A;  1FPP A;  4HB5 A;  4KVM A;  4GU5 A;  2P9N G;  2QC9 A;  4G1T A;  4IN3 B;  3E32 A;  3TAX A;  2XEE A;  4BY6 A;  4GPM A;  3DST A;  5FZS A;  4UI9 J;  4BEP A;  4FA6 A;  1QZ2 A;  5JJ7 A;  5ARG A;  2P9I G;  1U2V G;  2VQ2 A;  3FU3 A;  5M72 A;  5JHB A;  3FH5 A;  4AP2 A;  2WQ6 A;  4AY6 A;  1EDU A;  2KBX A;  1FVH A;  5HI7 A;  3SZ7 A;  2WXH A;  3FTS A;  5KJL A;  4F3V A;  1P5Q A;  2IQC A;  2PM6 A;  1BI7 B;  1TNB A;  2ZGG A;  3LS8 A;  3ZIM A;  4GML A;  2I6H A;  2DWZ A;  2YQ8 A;  4PS7 A;  3OXL A;  4M7C A;  4JHR A;  4U8V D;  3T8K A;  2KZT B;  3MCX A;  1IXV A;  4DLQ A;  1UJK A;  2XEV A;  1SZA A;  1K3Z D;  4UWG A;  4L7T A;  2DYR E;  4HOQ A;  3EIJ A;  4WUY A;  4X8Q A;  5EDS A;  5T8I A;  1NP7 A;  3CVP A;  1TJC A;  2WMN A;  4U7E B;  3T5X A;  2WXP A;  3TWX A;  1WG0 A;  1D8E A;  4ANV A;  2CFZ A;  2GRP B;  4JXT A;  2WXM A;  3TWT A;  2WXN A;  2WQH A;  3FUF A;  4A63 B;  3FEY A;  3FU5 A;  4PS3 A;  2QZA A;  2H6H A;  3TWS A;  4YDW A;  3V79 K;  1X5B A;  2V8S E;  3ASH A;  3E33 A;  2ETC A;  2PQR A;  3NQP A;  4ATZ D;  2GRO B;  2WXI A;  4GYO A;  4B8C B;  1U3C A;  4APO A;  5HRY A;  3EU5 A;  4L9P A;  5KNH D;  2WXL A;  3G2U A;  3T9K A;  4NAC A;  3O48 A;  1SQM A;  5FJY A;  4MS6 A;  3UM0 A;  4U8Y D;  1HXI A;  3CEQ A;  2JEK A;  2Y69 E;  3DSW A;  1ZB1 A;  4EZK A;  2XZD G;  1HX8 A;  2FUL A;  3PE4 A;  1ELK A;  2P9K G;  5CMY A;  3Q5M A;  4L1B A;  4FLH A;  3CR3 A;  3D9P A;  3I4R B;  3AS8 A;  4UWK A;  1N94 A;  1U3D A;  4A55 A;  3IHV A;  2XQ0 A;  1FT1 A;  2ETB A;  4BT9 A;  4BWR A;  5CEA A;  4CDM A;  1LD8 A;  1XGW A;  4K0R A;  4HFG A;  2P9L G;  3FH8 A;  2HE0 A;  5A23 A;  1NI1 A;  1RZ4 A;  5DBK A;  4PS8 A;  2WXG A;  2L0I A;  2R59 A;  4MLP A;  4ACK A;  3PUJ A;  5EID A;  1LF8 A;  4GTV A;  1YCS B;  3E37 A;  3EHQ A;  3HHM A;  3C98 A;  3L54 A;  3RAU A;  4CT0 A;  3V31 A;  2F0Y A;  4UI9 K;  1MX2 A;  2XHE A;  4JD2 G;  2EIJ E;  4U07 A;  4XE0 A;  1HE8 A;  2IU1 A;  4G8K A;  2BKG A;  4CGW A;  4UWL A;  2XCC A;  1SA4 A;  2KAT A;  2HO1 A;  1N4S A;  3AU4 A;  3DRA A;  5AAR A;  1TEZ A;  3NOG D;  3FDH A;  2IY0 C;  2WQ7 A;  3FUM A;  4LER A;  1NFI E;  4TUU A;  1HZ4 A;  4QFV A;  3CVN A;  4XI0 A;  1A17 A;  2L9B A;  5G05 C;  3PE3 A;  1SA5 A;  3IHY A;  1V54 E;  5EIL A;  1H6O A;  4KT6 B;  2AVP A;  3MA5 A;  3NAW A;  4I9E A;  2LO6 A;  4B93 B;  2V4H C;  4URK A;  2R03 A;  2GRQ B;  3NF1 A;  5ENT D;  4GCN A;  4YND A;  5CRU A;  5EX0 A;  4AV7 A;  3V2X A;  1OUV A;  3CVU A;  4XKC A;  4HOR A;  3AG3 E;  3PNL B;  3HVE A;  4BSX A;  4J6I A;  4AXH A;  4ZHB A;  3D9M A;  1E7V A;  2EIN E;  4DPR A;  1Y6I A;  2CFU A;  2AXU A;  4JVS A;  4HS2 A;  4A1G A;  2YNQ A;  2DZO A;  2V5Q C;  4JZY A;  4QQI A;  4C48 B;  3PDN A;  4KYO B;  5BPP A;  4YDY A;  3Q79 A;  3TWQ A;  4CZ2 D;  4L23 A;  5KJN A;  2XS1 A;  2P9U G;  1S64 A;  4ANU A;  5D2M C;  2LUH A;  3ZPJ A;  5KCM A;  2BTD A;  2CHZ A;  5FIO A;  3OAW A;  4OAV B;  4UWF A;  1Q2Z A;  3GZ1 A;  5AAO A;  4LNB A;  2OND A;  2QYJ A;  3C5R A;  3KS2 A;  3JXI A;  4WND A;  3TXN A;  3L17 A;  3MZL B;  4YDE A;  3CHP A;  5T3R A;  4CT4 A;  1OT8 A;  3IEG A;  5C2Y A;  1OCR E;  5ENN A;  2DZN A;  1WY6 A;  5LCW J;  4G24 A;  3ULY A;  1KT1 A;  3SGH A;  2X6J A;  1UOH A;  5CER B;  4EPZ A;  2H6F A;  1OY3 D;  2CHW A;  3PRE A;  3ZHE B;  2XGO A;  3DEP A;  3FFL A;  4HNA D;  3ZNG A;  5KJM A;  3VTX A;  1XNF A;  3ZXS A;  1UN8 A;  3EHN A;  4TV3 A;  4WWO A;  4KZ0 A;  4GYW A;  5D0O D;  2FI7 A;  1SZ9 A;  3ZYM A;  4N5Q A;  3UQ3 A;  5BUZ A;  2LAI A;  4IRU A;  3UIP C;  1N54 A;  3MKQ A;  4IUL A;  2NXP A;  2I9C A;  3BU8 A;  2H6G A;  3FU0 A;  2F8X K;  1L5J A;  4KMO A;  4XEI G;  4U8H A;  4ABN A;  1HFA A;  4BX9 A;  4HRM B;  5CEC B;  5BV0 A;  3FWV A;  1O1T A;  1DC2 A;  2Y4T A;  4GA1 A;  4FUL A;  3HDX A;  3Q7A A;  1MYO A;  1E8X A;  3L22 A;  4DUI A;  3QAQ A;  5D0Q D;  1TN8 A;  4B89 A;  4O1O A;  1OWO A;  5HQ8 A;  3JQ0 A;  3V30 A;  3Q15 A;  4ANW A;  3KD7 A;  4TXQ A;  1TNO A;  4LG6 A;  2E0I A;  4PH4 B;  5ANL A;  1TN6 A;  5A6C A;  4CYM D;  1SVX A;  4TXR A;  3QWW A;  3W9F A;  3Q75 A;  1O1R A;  4HOS A;  3L16 A;  4N3C A;  3ULE G;  3FUJ A;  4GCO A;  1WDY A;  3EHR A;  4I6E A;  4EQF A;  4B8A A;  1IYG A;  2WXO A;  3FH7 A;  3LY8 A;  3ZKJ A;  3OXG A;  4GZD A;  4WNE A;  3LYA A;  4GA0 A;  3EIQ C;  3X2Q E;  3FUE A;  2PNN A;  4BFR A;  2VTB B;  3LJN A;  5A7D B;  5LFA A;  4UUC A;  5CRV A;  4I17 A;  5IY5 E;  4YVQ C;  4KZC A;  1AP7 A;  2B0O E;  3N71 A;  1H2T C;  3QKY A;  4J0U A;  1OXJ A;  3KSL A;  4HI8 A;  5ARF A;  3UPV A;  3S7F A;  3G2V A;  4G25 A;  4XZ4 A;  3ESK A;  4DK5 A;  3AJI A;  5FTP A;  5CCL A;  2R17 C;  3R7R A;  3C3Q A;  3TWW A;  2ZGD A;  4YDO A;  2VYI A;  3CVW A;  5FZQ A;  3R9A B;  3LY9 A;  3RU0 A;  4ZFH A;  4AJW A;  3SHF A;  2J4B A;  5FQ8 A;  3G2T A;  2PM7 A;  3CHS A;  3PH0 C;  3APC A;  2KCL A;  2H6I A;  3AAA C;  2VGE A;  3TG5 A;  2VSY A;  1OWN A;  2X6H A;  2ETA A;  1JCS A;  2BED A;  2XPI A;  3O4Z A;  3NBN B;  2YHC A;  2L6J A;  3FEX A;  3KEZ A;  3UM2 A;  1Z6T A;  1BD8 A;  4GZ3 A;  5ANR A;  3UKU G;  5G2N A;  3QAR A;  3T5V A;  5AEN A;  4I9C A;  4UQY A;  4CRW A;  3HIZ A;  2YHE A;  4R7L A;  2I1K A;  3DSU A;  3FUH A;  3SFZ A;  2YIN A;  5JMN D;  2GRN B;  2R02 A;  5ENO D;  5J08 A;  1E90 A;  1N4Q A;  4TRQ A;  1S0P A;  4F53 A;  4J8D A;  4CGV A;  2AJA A;  5AQ7 A;  3E34 A;  5EIB E;  3D9K A;  2MRI A;  4JHK A;  4JA9 A;  3SY2 A;  1QBQ A;  3D9I A;  1DCE A;  3CQC B;  4TXP A;  4RVB A;  2KCK A;  3FY4 A;  4A1S A;  3AG4 E;  3RK6 A;  3AS4 A;  3UTM A;  2AWI A;  4IYP A;  1TNZ A;  5E76 A;  3JUI A;  1KLX A;  3ZFW A;  1INZ A;  3ASN E;  4MKT A;  4DX6 D;  1TNU A;  1N0R A;  1D8D A;  3Q9U C;  1DNP A;  2UY1 A;  5H7P A;  2UWJ G;  2WXQ A;  1TR4 A;  3IKO B;  2OCC E;  3CVY A;  4EEC A;  3NZU A;  4BSZ B;  5ENR D;  1Z5S C;  1O5M A;  3VLD A;  5EKQ D;  4JB8 P;  1B89 A;  4I6G A;  2RG8 A;  2P58 C;  5B1A E;  1RW2 A;  4AIF A;  2X3M A;  2OEW A;  5LOZ A;  2HYZ A;  3L82 A;  4U0S A;  3B7S A;  4N39 A;  4I6J A;  5ENQ D;  4N2S A;  2X6I A;  3U9W A;  3Q78 A;  2F37 A;  4G23 A;  3TWU A;  1QQE A;  1FT2 A;  1K8K G;  3ONK A;  4E85 A;  2FO1 E;  2Y0B G;  1KT0 A;  2WB2 A;  2JAB A;  5CHE E;  4A3V A;  3FUN A;  3QDN A;  5AQ9 A;  5AJL A;  4G2V A;  1DVP A;  3MKR A;  3SFY A;  4AOF A;  3JCK C;  3U66 A;  3DXK G;  3CVV A;  3SI5 A;  3TWR A;  2QYU A;  5FIN A;  3D9L A;  3ZYK A;  5FQ7 A;  4LSZ E;  4ATG A;  4J7W A;  5AIJ A;  5CCM A;  5EX3 A;  4HRL A;  3BQO A;  1WM5 A;  3QWV A;  4N3B A;  2WXF A;  4HLL A;  3TWV A;  1E8Y A;  4BT8 A;  3MGB A;  3ASF A;  4AY5 A;  2JLB A;  4ILH B;  3QC1 A;  4UI9 C;  5DIZ A;  3ZYQ A;  3I4G A;  1OWP A;  3WXX A;  2IJG X;  3QB2 A;  3IXE A;  5E75 A;  4I43 A;  4WNF A;  5BW8 C;  1VDY A;  3LEW A;  2IOS A;  3L08 A;  5EYL A;  5BV1 A;  2GRL A;  5KWD A;  2WXK A;  4XIF A;  3ML8 A;  4GTS A;  1DCQ A;  1OWM A;  1HF8 A;  2J07 A;  2Q7F A;  4B94 A;  3ZVV A;  2ZIR A;  3FTZ A;  4I1O B;  2VSN A;  2NYJ A;  1KPS B;  2AXV A;  3S2A A;  3BG0 B;  3CVQ A;  1EF1 C;  4D10 C;  1Z3X A;  2LAH A;  5BXO A;  1HH8 A;  4K03 A;  3PUK A;  3AU5 A;  4NUR A;  3R7Q A;  5CMW A;  2IFU A;  3RO2 A;  3VTY A;  3CQG B;  3DPD A;  3HVE B;  5G55 A;  4FHJ A;  4Y6W A;  3CK7 A;  2WPV A;  3AG2 E;  4TUM A;  3UI2 A;  4XI9 A;  3D9O A;  5FT9 A;  1E96 B;  3D9J A;  2E2E A;  2VJ8 A;  3AG1 E;  5KBA A;  4DI4 A;  3HXC A;  3EJN A;  1ZBP A;  3UM1 A;  5LX8 A;  1N52 A;  5BNW A;  4O6F A;  2X6F A;  2V0P A;  1H2U A;  2VGX B;  3MEK A;  5B1B E;  4K5C A;  3Q7F A;  2PZI A;  2XPY A;  3DXM G;  3L9T A;  3SF4 A;  2PQN A;  4C0E A;  3RSE G;  1MX6 A;  3D9N A;  3BEE A;  3UKR G;  3SBS A;  3RRU A;  2RKK A;  4RG9 A;  4I1M A;  1NL4 A;  1UN9 A;  4Q69 A;  4BES A;  2KM4 A;  2PL2 A;  3CKC A;  4ACL A;  2LSV A;  4W9R A;  4NRH B;  4GTQ A;  3ULQ A;  4U0Z A;  4J8Y A;  4JEH A;  4JA7 A;  4PDX A;  3ZHE A;  4LNG A;  2EQX A;  1WAO 1;  3I5P A;  3HRA A;  3RIB A;  4EZJ A;  4BX8 A;  1D9S A;  1IQR A;  4N2Q A;  1YA0 A;  5BXU A;  4F6R D;  2GGF A;  4HOT A;  1H0A A;  3PZ3 A;  4FP7 A;  1ZU2 A;  5BT1 A;  1H2V C;  4U95 D;  2WM9 A;  1OCO E;  3ML9 A;  4JEU A;  1UG3 A;  2DYS E;  1EYH A;  1KZP A;  1JPL A;  4HRN A;  4GZ5 A;  4V3I A;  3C3R A;  2ION A;  2LXM A;  3B7R L;  2AW6 A;  1JUQ A;  3V2O A;  3EDT B;  3NB2 A;  1OWL A;  2EIK E;  2OEV A;  2HM8 A;  4OVU A;  3TJP A;  4F1S A;  3ASD A;  3JQ1 A;  2OOE A;  4XX5 A;  1OCC E;  3LY7 A;  2X38 A;  3ZXP A;  3L6A A;  4JC8 A;  4BTB A;  3OTN A;  1MZC A;  3TGO A;  4PUC A;  4RLY A;  3CK8 A;  3TG4 A;  1BI8 B;  4OAU C;  4UWH A;  3DPY A;  3ZN3 A;  3LDZ A;  2R5S A;  3J5Q B;  4WNG A;  4F1P A;  4DX7 D;  3Q73 A;  3Q49 B;  3SFX A;  1QNF A;  4GMR A;  3KAE A;  2IF4 A;  3CIA A;  5CBN A;  2FF4 A;  2EIL E;  4CEM A;  4E6H A;  3CK9 A;  3HYM B;  5EYP F;  3ABK E;  2XCB A;  3L13 A;  3MJW A;  2J08 A;  3FTW A;  4Y6C A;  5KNG A;  2Y4U A;  3CSF A;  4C0M A;  1MHQ A;  4KVO A;  2M63 A;  3ASG A;  4AVX A;  2NSZ A;  3APF A;  3RKV A;  4GPK A;  1HU3 A;  3DSS A;  3WG7 E;  3LCA A;  2VTB A;  3HG0 D;  3E30 A;  5ITZ F;  4GYY A;  2RFA A;  2FO7 A;  5G05 J;  2HR2 A;  2WVI A;  1JCQ A;  1G3N B;  3ZRH A;  1UJJ A;  3NZS A;  3ESL A;  3PRZ A;  2KCV A;  5JJT A;  4ME2 A;  2DCP A;  3S7B A;  3DEO A;  1MJ0 A;  5J90 A;  1HG2 A;  2C0L A;  2BUG A;  3DBS A;  5LP0 A;  1Z3Y A;  2XEH A;  1N4P A;  2IOL A;  2QFC A;  4MRU A;  3TXM A;  3Q4A B;  2KZT A;  4DRX E;  3FUI A;  3AS5 A;  1E8Z A;  5HS0 A;  4GA2 A;  4A3T A;  4EZL A;  2WXR A;  2LSU A;  3J5P A;  1TN7 A;  2BF0 X;  1TYQ G;  4LEU A;  2A5E A;  1IQU A;  2GRM A;  3CHM A;  2F8Y A;  4DX2 A;  3FUD A;  1OCZ E;  1MX4 A;  2XRY A;  2MHK A;  3C72 A;  3CVX A;  2ZXW E;  2L6B A;  4FC8 A;  3UX4 A;  4NIK A;  3KEA A;  4NQ0 A;  4K5B A;  4U96 D;  4CCA A;  1TNY A;  3UM3 A;  1JWG A;  4HQD A;  4J8S A;  3LVQ E;  4CDR A;  1A5E A;  3GZ2 A;  2R05 A;  1SW6 A;  2MYO A;  2VSX E;  3PZ2 A;  5LCW C;  1AWC B;  2DVW A;  4I2Z A;  3G2S A;  2MOW A;  5G04 C;  2P9P G;  4B0Z A;  4P29 A;  3B7U X;  3SD5 A;  4DLO A;  2R2L A;  2XGM A;  1BPO A;  4F7A A;  4UQZ A;  4GTP A;  1PY1 A;  3VLF A;  5JHA A;  3LJ3 A;  4C9B B;  3ONL A;  4JPS A;  3P1U A;  1E8W A;  3DSV A;  4FHK A;  3UT7 A;  4L2L A;  2XRZ A;  2KC7 A;  2CG2 A;  4O60 A;  4EHM A;  3BG1 B;  4KBQ A;  3CHR A;  2XGS A;  3B7B A;  3T8M A;  2A4Z A;  1H19 A;  2J49 A;  3MV3 B;  1S70 B;  3GW4 A;  1N11 A;  4J8E A;  1O1S A;  2NC9 A;  3MYV A;  3URZ A;  4I1A A;  1KZO A;  3RO3 A;  2OVF A;  3ZEF A;  4WWN A;  4ILG A;  2UY1 B;  3GZS A;  3CVL A;  3EUV A;  1BU9 A;  1NA3 A;  4WWP A;  4CDN A;  2DBA A;  4FJY A;  3BUA A;  3C3O A;  1YMP A;  4FU3 A;  3LKU A;  1EPU A;  5JA4 D;  1IKN D;  3APD A;  3JUE A;  2FEZ A;  3HXF A;  4U0U A;  3IV0 A;  4RSY A;  1W3B A;  4H7X A;  4RG6 A;  4N3A A;  1ELW A;  2GW1 A;  3ZYL A;  4Q94 A;  2WMO A;  3EHM A;  3ZW3 A;  1JWF A;  2KXP C;  2VSO E;  5FQ6 A;  4LUN U;  1NZN A;  4HXI A; 
#chains in the Genus database with same CATH homology
 2WXP A;  3FUK A;  5HQ8 A;  1HO8 A;  3JQ0 A;  2PZI A;  2XPY A;  2CG3 A;  4ANW A;  3Q15 A;  4GZC A;  4ANV A;  3GYZ A;  3KD7 A;  3SF4 A;  2CFZ A;  2C2L A;  4JXT A;  2PQN A;  3LPZ A;  2E0I A;  2WXM A;  4C0E A;  4PH4 B;  2WXN A;  3QNK A;  2WQH A;  5ANL A;  5A6C A;  3D9N A;  3FUF A;  3FEY A;  3BEE A;  3SBS A;  3RRU A;  4G26 A;  3QWW A;  3FU5 A;  4RG9 A;  4I1M A;  4PS3 A;  3RRN B;  4HOS A;  3L16 A;  4N3C A;  3FUJ A;  1UN9 A;  4AM9 A;  4DJA A;  4GCO A;  4N5C A;  1X5B A;  4Q69 A;  3UT4 A;  2V8S E;  4I6E A;  3RRM B;  3ASH A;  4EQF A;  2FBN A;  4B8A A;  1IYG A;  2WXO A;  4JHJ A;  3FH7 A;  2PQR A;  3NQP A;  3LY8 A;  3U3W A;  2KM4 A;  2PL2 A;  3CKC A;  4ACL A;  2LSV A;  3FP3 A;  4W9R A;  4NRH B;  2WXI A;  2I2O A;  3ULQ A;  3OXG A;  4U0Z A;  3CLJ A;  4GYO A;  4GZD A;  4JEH A;  4WNE A;  4JA7 A;  4U04 A;  3LYA A;  4B8C B;  4GA0 A;  1U3C A;  4PDX A;  3ZHE A;  3EIQ C;  2EQX A;  4APO A;  4KXK B;  4GAA A;  1WAO 1;  3FUE A;  3I5P A;  3RIB A;  3B13 A;  4BFR A;  2WXL A;  3CKB A;  3G2U A;  2VTB B;  3CHQ A;  5A7D B;  4BX8 A;  4EZJ A;  5LFA A;  4G11 A;  1IQR A;  3O48 A;  1SQM A;  4NAC A;  5FJY A;  3JYS A;  1YA0 A;  4N2Q A;  3CST A;  4MS6 A;  2ILR A;  3D3M A;  4I17 A;  4FJZ A;  1HXI A;  3CEQ A;  1UW4 B;  1TJF A;  2GGF A;  4YVQ C;  4BTA A;  1H0A A;  2J4D A;  4HOT A;  4KZC A;  2JEK A;  3QJZ A;  3N71 A;  4FP7 A;  1FCH A;  1ZU2 A;  4EZK A;  1H2V C;  5BT1 A;  1H2T C;  2WM9 A;  3QKY A;  1HX8 A;  2FUL A;  3PE4 A;  4XKB A;  3ML9 A;  4J0U A;  1ELK A;  2CHX A;  4JEU A;  2C0M A;  5CMY A;  3FTX A;  1UG3 A;  5ARF A;  1PC2 A;  1EYH A;  3Q5M A;  1MQS A;  4HVB A;  3UPV A;  3S7F A;  4L1B A;  4FLH A;  1JPL A;  4GZ5 A;  3G2V A;  3K9I A;  4U63 A;  4V3I A;  3CR3 A;  3D9P A;  3I4R B;  2ION A;  4G25 A;  3B7R L;  4XZ4 A;  3ESK A;  4LCT A;  4DK5 A;  3AS8 A;  4UWK A;  5FTP A;  2AW6 A;  1U3D A;  4A55 A;  3FU6 A;  3IHV A;  5CCL A;  1JUQ A;  2R17 C;  2XQ0 A;  3VLE A;  3R7R A;  4FAD A;  2LNI A;  3EDT B;  2VYI A;  1OWL A;  3CVW A;  5FZQ A;  3R9A B;  3LY9 A;  3OXF A;  3RU0 A;  4BT9 A;  4BWR A;  4DI3 A;  4AJW A;  2HM8 A;  4OVU A;  3SHF A;  4CDM A;  3FTV A;  2J4B A;  1XGW A;  5FQ8 A;  2DIW A;  5KJK A;  3TJP A;  4K0R A;  3ASD A;  3G2T A;  3LVR E;  3JQ1 A;  4HFG A;  4LRZ A;  4F1S A;  3FH8 A;  2PM7 A;  2OOE A;  3CHS A;  4XX5 A;  3LY7 A;  3PH0 C;  5A23 A;  1IHG A;  2X38 A;  4Q96 A;  3APC A;  1HS6 A;  2L0T B;  2KCL A;  3L6A A;  4JC8 A;  4BTB A;  3OTN A;  5FQ4 A;  5DBK A;  3TGO A;  4PS8 A;  2WXG A;  3TG5 A;  2L0I A;  4PUC A;  4OVV A;  2VSY A;  2R59 A;  4MLP A;  1OWN A;  2X6H A;  3CK8 A;  3TG4 A;  4ACK A;  3PUJ A;  2VGX A;  2XPI A;  3O4Z A;  1LF8 A;  3P2B A;  3SNX A;  2Y3A A;  4UWH A;  3QK0 A;  2YHC A;  3ZN3 A;  2VGY A;  2L6J A;  3LDZ A;  3FEX A;  2R5S A;  3KEZ A;  1Z6T A;  3HHM A;  3L54 A;  3C98 A;  4GZ3 A;  4WNG A;  3ZGQ A;  5ANR A;  1PAQ A;  4CT0 A;  5G2N A;  3QAR A;  3FUL A;  3Q49 B;  3T5V A;  5AEN A;  4UI9 K;  1QNF A;  2XHE A;  4I9C A;  4UQY A;  2X6K A;  4CRW A;  4U07 A;  3HIZ A;  4XE0 A;  1HE8 A;  2IU1 A;  2YHE A;  4R7L A;  2I1K A;  4HLE A;  4CGW A;  3KAE A;  3RJV A;  4UQX A;  4UWL A;  2IF4 A;  3FUH A;  2XCC A;  3SFZ A;  2YIN A;  3CIA A;  3FTY A;  2KAT A;  2HO1 A;  2FF4 A;  3AU4 A;  5C1D A;  4CEM A;  4E6H A;  3CK9 A;  3PNT B;  3QWP A;  3HYM B;  1TEZ A;  2A5U A;  3FDH A;  2XCB A;  2WQ7 A;  3I3N A;  3L13 A;  3MJW A;  2J08 A;  5J08 A;  3FUM A;  2XPZ A;  4JL0 A;  2J9Q A;  1E90 A;  3FTW A;  4LER A;  4TUU A;  1HZ4 A;  4Y6C A;  2Y4U A;  4QFV A;  3CSF A;  4C0M A;  3CVN A;  1MHQ A;  4XI0 A;  4KVO A;  4GMJ A;  4TRQ A;  4APF A;  2M63 A;  3ASG A;  1S0P A;  1A17 A;  2NSZ A;  2QY7 A;  4AVX A;  2L9B A;  4F53 A;  5G05 C;  3APF A;  3PE3 A;  4J8D A;  3RKV A;  4GPK A;  1HU3 A;  1FVF A;  3IHY A;  4CGV A;  3LCA A;  2VTB A;  3UT8 A;  3CGH A;  3D9K A;  2MRI A;  4JHK A;  4KT6 B;  2AVP A;  3LXU X;  3PS6 A;  4JA9 A;  3MA5 A;  3D9I A;  4I9E A;  3CQC B;  3ENE A;  2V4L A;  4GYY A;  2LO6 A;  5G04 J;  4RVB A;  5T4Y A;  2KCK A;  2FO7 A;  4URK A;  1E7U A;  5G05 J;  2HR2 A;  3FY4 A;  2WVI A;  4L2Y A;  4A1S A;  3MV2 B;  3NF1 A;  5AJD A;  1ELR A;  3U64 A;  3ZRH A;  3RK6 A;  3AS4 A;  3B7T A;  1UJJ A;  4GCN A;  3NZS A;  4YND A;  2AWI A;  3ESL A;  4IYP A;  5E76 A;  3S7J A;  1GW6 A;  3JUI A;  1KLX A;  1HG5 A;  3ZFW A;  5EX0 A;  1INZ A;  1H6K A;  4AV7 A;  2J09 A;  4MKT A;  3PRZ A;  2KCV A;  4EBA A;  1DNP A;  1OUV A;  2UY1 A;  5JJT A;  3FTU A;  3CVU A;  2UWJ G;  4ME2 A;  2ZU6 B;  2WXQ A;  4AEZ C;  2DCP A;  4XKC A;  4HOR A;  3IKO B;  3S7B A;  3PNL B;  3U4T A;  3CVY A;  3PEU B;  4EEC A;  3HVE A;  3NZU A;  4I2W A;  5J90 A;  5JJ6 A;  1HG2 A;  2C0L A;  2BUG A;  3DBS A;  4BSX A;  4J6I A;  1Z3Y A;  4AXH A;  5LP0 A;  3D9M A;  1E7V A;  2IOL A;  4OYS A;  3VLD A;  4ILI A;  4DPR A;  1Y6I A;  5EKQ D;  2CFU A;  2QFC A;  4MRU A;  3Q4A B;  3TXM A;  5FZR A;  2KZT A;  1B89 A;  2AXU A;  4I6G A;  4JVS A;  3FUI A;  4HS2 A;  3AS5 A;  2RG8 A;  2P58 C;  1E8Z A;  4AIF A;  4A1G A;  4J8F A;  2YNQ A;  4GA2 A;  4A3T A;  2X3M A;  4EZL A;  2WXR A;  2OVB A;  4JZY A;  3PVL A;  2LSU A;  3MKQ B;  3PDN A;  4KYO B;  2RD0 A;  2BF0 X;  3Q47 B;  5LOZ A;  5BPP A;  4LEU A;  2V5F A;  3FHE A;  2HYZ A;  4U0S A;  3B7S A;  4ANX A;  4N39 A;  4L23 A;  4I6J A;  1IQU A;  2GRM A;  3CHM A;  4N2S A;  3FUD A;  2X6I A;  5KJN A;  3U9W A;  3S7D A;  2XRY A;  2MHK A;  3CV0 A;  3CVX A;  4G23 A;  1QQE A;  3ONK A;  4FC8 A;  4WAF A;  4ANU A;  4E85 A;  2WB2 A;  1KT0 A;  5CHE E;  3UX4 A;  3IBE A;  4NQ0 A;  4GB9 A;  4A3V A;  3FUN A;  3UUX A;  4CCA A;  3ZPJ A;  3QDN A;  5KCM A;  3PZD A;  2BTD A;  2CHZ A;  1JWG A;  4HOU A;  5FWQ A;  3QOU A;  3OAW A;  4J8S A;  5AJL A;  4G2V A;  1DVP A;  3MKR A;  3LVQ E;  4AOF A;  3JCK C;  4FLB A;  2AXZ A;  4UWF A;  4JW1 A;  5AYW D;  4CDR A;  3U66 A;  2WXJ A;  3GZ2 A;  3GZ1 A;  3CVV A;  3SI5 A;  3E4B A;  2OND A;  4EBA G;  3KS2 A;  4WND A;  3D9L A;  3ZYK A;  5FQ7 A;  3TXN A;  3L17 A;  4ATG A;  3MZL B;  5AIJ A;  2VSX E;  2I1J A;  5CCM A;  5EX3 A;  4H7Y A;  1Y8M A;  3MX3 A;  3PEV B;  5LCW C;  1WM5 A;  4M3O A;  3CHP A;  3QWV A;  5T3R A;  3SBT B;  4CT4 A;  3CHO A;  4I2Z A;  3G2S A;  4N3B A;  2MOW A;  3IEG A;  5G04 C;  2WXF A;  5C2Y A;  4B0Z A;  5ENN A;  3UMV A;  4P29 A;  3G2W A;  4GZ6 A;  3B7U X;  1E8Y A;  3SD5 A;  4DLO A;  2XGM A;  4BT8 A;  3MGB A;  4YVO A;  1WY6 A;  3ASF A;  1BPO A;  4F7A A;  4UQZ A;  2OV8 A;  3TL5 A;  4AY5 A;  2JLB A;  5LCW J;  4ILH B;  3QC1 A;  4G24 A;  1PY1 A;  3VLF A;  1KT1 A;  3SGH A;  4UI9 C;  5DIZ A;  5JHA A;  3ZYQ A;  3I4G A;  1NA0 A;  1OWP A;  3WXX A;  4KVM A;  2X6J A;  3LJ3 A;  3ONL A;  4C9B B;  4GU5 A;  4JPS A;  2IJG X;  3QB2 A;  4EPZ A;  4G1T A;  4IN3 B;  5E75 A;  3P1U A;  4I43 A;  4WNF A;  3TAX A;  1E8W A;  5BW8 C;  1VDY A;  3LEW A;  2IOS A;  3L08 A;  2CHW A;  5BV1 A;  4FHK A;  3UT7 A;  2GRL A;  4BY6 A;  3PRE A;  2WXK A;  3ZHE B;  2XGO A;  3FFL A;  4XIF A;  5FZS A;  4UI9 J;  5KJM A;  3VTX A;  1XNF A;  4L2L A;  3ZXS A;  2XRZ A;  2KC7 A;  4FA6 A;  1QZ2 A;  1UN8 A;  2CG2 A;  3EHN A;  3ML8 A;  3BG1 B;  1OWM A;  5JJ7 A;  1HF8 A;  2J07 A;  2Q7F A;  4TV3 A;  4WWO A;  5ARG A;  4KBQ A;  4B94 A;  2VQ2 A;  3CHR A;  3ZVV A;  3FU3 A;  2XGS A;  4KZ0 A;  5M72 A;  3FTZ A;  5JHB A;  4I1O B;  4GYW A;  2VSN A;  5D0O D;  3T8M A;  2A4Z A;  3FH5 A;  1H19 A;  2FI7 A;  2J49 A;  3MV3 B;  4AP2 A;  1SZ9 A;  3GW4 A;  2AXV A;  3S2A A;  3BG0 B;  4J8E A;  2WQ6 A;  3CVQ A;  4AY6 A;  1EDU A;  3ZYM A;  2NC9 A;  1FVH A;  3MYV A;  5HI7 A;  1EF1 C;  3URZ A;  4I1A A;  4D10 C;  3UQ3 A;  3SZ7 A;  1Z3X A;  2LAH A;  1HH8 A;  2WXH A;  3FTS A;  5KJL A;  3RO3 A;  4K03 A;  2OVF A;  3ZEF A;  3PUK A;  4WWN A;  4ILG A;  4F3V A;  2UY1 B;  3AU5 A;  1P5Q A;  2LAI A;  3GZS A;  5BUZ A;  2IQC A;  3CVL A;  4NUR A;  4IRU A;  3R7Q A;  5CMW A;  1N54 A;  2IFU A;  2PM6 A;  3RO2 A;  3MKQ A;  3VTY A;  4IUL A;  3LS8 A;  3CQG B;  3ZIM A;  1NA3 A;  2NXP A;  2I9C A;  4GML A;  4WWP A;  2I6H A;  3DPD A;  3HVE B;  2DBA A;  3FU0 A;  2YQ8 A;  4FJY A;  5G55 A;  4CDN A;  4FU3 A;  1L5J A;  3LKU A;  4PS7 A;  4KMO A;  3OXL A;  1EPU A;  4FHJ A;  4U8H A;  4Y6W A;  3CK7 A;  4ABN A;  4JHR A;  2WPV A;  3APD A;  1HFA A;  2FEZ A;  4BX9 A;  4XI9 A;  3D9O A;  5FT9 A;  1E96 B;  2KZT B;  4U0U A;  3D9J A;  3MCX A;  3IV0 A;  4RSY A;  2E2E A;  3FWV A;  5BV0 A;  2VJ8 A;  4DLQ A;  1UJK A;  2XEV A;  2Y4T A;  4GA1 A;  4FUL A;  3HDX A;  4DI4 A;  1W3B A;  1SZA A;  3EJN A;  4H7X A;  1ZBP A;  4RG6 A;  4N3A A;  1ELW A;  4UWG A;  1E8X A;  4L7T A;  2GW1 A;  4HOQ A;  3ZYL A;  3EIJ A;  4WUY A;  1N52 A;  3L22 A;  5LX8 A;  4Q94 A;  2WMO A;  5BNW A;  5EDS A;  5T8I A;  3EHM A;  4O6F A;  3QAQ A;  3ZW3 A;  1NP7 A;  2X6F A;  3CVP A;  2V0P A;  1JWF A;  1H2U A;  5D0Q D;  1TJC A;  2VSO E;  2VGX B;  5FQ6 A;  2WMN A;  4B89 A;  3MEK A;  4LUN U;  1NZN A;  4HXI A;  3T5X A;  1OWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...