2KZTB

Structure of the tandem ma-3 region of pdcd4
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed cell death protein 4
publication title Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 37
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kztB00
4B89A 1UG3A 1N54A 1H6KA 4CRWA 2I2OA 4GMJA 4GMLA 1H2UA 4C9BB 1H2VC 3EIQC 4B8CB 3FEXA 2RG8A 3L6AA 2VSOE 2HM8A 4B8AA 3FEYA 4JHKA 1N52A 2FULA 2IOLA 2IOSA 3D3MA 2IONA 1PAQA 2KZTB 3RK6A 4JHJA 5ANRA 2GGFA 4CT4A 3EIJA 4LUNU 2ZU6B 3JUIA 4CEMA 2VSXE 1HU3A 2KZTA 1UW4B 1H2TC 2NSZA 2IU1A 4IULA
chains in the Genus database with same CATH superfamily
3Q49B 3LJNA 4CCAA 3CLJA 1YA0A 2GRRB 3OTNA 4HLEA 1IHBA 1SVXA 3SGHA 3CVUA 2EQXA 3RIBA 3CVYA 1H6PA 3HHMA 1NA0A 3O48A 1BI7B 4AEZC 1XGWA 4P29A 1DC2A 4C0MA 4UI9J 1TNUA 5LP0A 2YHCA 3CVNA 3EHMA 2WXIA 1Y8MA 3SBSA 1IXVA 1K3ZD 5AQBA 3DXKG 4DX6D 2L9BA 2Y0BG 3PDNA 3D9OA 3OAWA 3DSVA 2DYSE 4GYWA 3S2AA 5EILA 3D9NA 1YCSB 1OWLA 5KJMA 2XGOA 4FLBA 3SFYA 4FHJA 2J07A 5BV1A 4HOQA 4IYPA 3ASOE 2Y3AA 3QKYA 2XGMA 4BWRA 4JHJA 3ZN3A 4G8LA 4BESA 2XPIA 4TV3A 4RQIA 1U3DA 1JWGA 4N2QA 1X81A 4ILGA 4DK5A 3SI5A 3FUJA 3RKVA 4PDXA 2XZDG 2XENA 2ZGGA 5B1BE 1N4PA 1XNFA 2WXRA 2WM9A 4FULA 4WNDA 3KSLA 3FUHA 1OUVA 4GA2A 3UMVA 3UI2A 4DX2A 3DSXA 5J08A 3UIOC 2XCBA 4JEUA 3ULYA 2CHWA 3FTUA 4DRXE 2PM6A 1DVPA 5EN5D 3Q9UC 2UY1A 3JCKC 5CCLA 3CK8A 3GZ1A 4RG6A 1Z3XA 1ZB1A 4ANUA 5ENQD 3Q73A 4XX5A 1U2VG 2IONA 4ZFHA 2RD0A 5CHEE 2WXPA 4GAAA 4MRUA 2X6JA 4N3AA 1UG3A 3ASHA 4CRWA 5FJYA 3DPDA 5FZRA 1SQMA 3BU8A 3EIQC 1Z3YA 1UN9A 4GA0A 4QFVA 4GMRA 2RKKA 1EPUA 3FTZA 5M72A 3ASFA 1JCQA 2X38A 3Q9NC 4HVBA 4H7XA 2NXPA 2LAIA 3L13A 3WG7E 3TG5A 4GU5A 2LAHA 4F1PA 3GYZA 3FH8A 1TR4A 5JA4D 1MX6A 3C5RA 1PAQA 3NOGD 3PUJA 3UINC 3HXEA 1BLXB 3QWPA 4XZ4A 2XS1A 4U95D 4BFRA 3PUKA 1H2UA 4HLLA 3FUDA 3ZU7B 1MJ0A 5E76A 1H0AA 3VLEA 3TL5A 3Q47B 3Q15A 2WXGA 4WNGA 5AJDA 4N5QA 4GCOA 3BEEA 3Q7AA 4CYMD 4K5BA 3EDTB 5DIZA 2MHKA 1S0PA 2OVFA 3FU5A 3UPVA 3TWWA 3MKQB 3QARA 3JXIA 4U8VD 4H7YA 1X5BA 4G1TA 4ANVA 4IN3B 1TNBA 1KZOA 4LRZA 3CK7A 1HG2A 3QAQA 4TUUA 1IHGA 5D2MC 1S70B 4G11A 3KD7A 3TGOA 4I9CA 2CHZA 3JUEA 4TXRA 3V2XA 4YVOA 2GRQB 3CVPA 5CBNA 4K5CA 4URKA 2HO1A 2WXQA 4TRQA 4IRUA 4KT6B 2R59A 3LY8A 2WQHA 3L54A 1SA5A 1S63A 3SFXA 3T5VA 4U0SA 4GTQA 3HXCA 4BY6A 2WMOA 4JC8A 4LCTA 4RVBA 1EF1C 4HRNA 2IEJA 4G25A 3ZRHA 2QY7A 3LYAA 2OEWA 5KNHD 3R9AB 3UKRG 1E7VA 3BG1B 3TJPA 3CHQA 2X6KA 2OOEA 3URZA 3CVWA 3ZVVA 3FDHA 4GTOA 3B7RL 2P9IG 4ATGA 4U0ZA 4EBAA 3PEVB 3OXLA 2R05A 4N2SA 1TJFA 1RZ4A 5HRYA 1W3BA 3TXNA 1FVFA 1UJKA 3KAEA 2J4BA 4E6HA 3MA5A 4G26A 3UX4A 2DIWA 1TN6A 4NURA 2LO6A 4I9EA 5CRUA 5B3SE 5G05C 2P58C 4GCNA 1NA3A 3NQPA 1ELKA 1IKND 4AOFA 2V0PA 4G24A 3DSWA 3T5XA 4FJYA 3IBEA 1LD7A 3PEUB 4B93B 3QNKA 2VJ8A 2R02A 5CEAA 3U3WA 4J8EA 4J6IA 4UQZA 1O1SA 2WMNA 1OWOA 4YDWA 3UKUG 4PH4B 4JZYA 4BERA 4I6EA 4I6JA 3FEYA 2J08A 4MBGA 3CSFA 4HQDA 1BI8B 5FTPA 2IJGX 5LCWJ 4UQYA 1QZ2A 3LS8A 4ZHBA 4HORA 5G04J 1E8ZA 2B6CA 4WWNA 3SF4A 2AVPA 3EHQA 2PQRA 4I2ZA 2LXMA 2CHXA 5LX8A 3SD5A 4ILHB 3B7TA 1OWNA 2OVBA 2VSYA 2H6IA 3L82A 4G2VA 4WNEA 1K1BA 4APOA 2X6HA 4UI9K 1TEZA 1H2TC 4HBDA 5T3RA 1LTXA 3ZXSA 3IV0A 3Q7FA 4TXQA 2XPYA 4DUIA 1E8XA 1WDYA 5EX3A 4Q69A 5C2YA 4R7LA 4XI9A 3PNTB 4BSXA 4O6FA 3PNLB 1D8DA 3S7FA 2BKGA 4PS8A 4IULA 2OEVA 1E7UA 3RU0A 2C0LA 3APFA 3D9MA 2VSOE 3AG1E 4B0ZA 1HO8A 3EHRA 4BEPA 4GTRA 3UM1A 5FWQA 3EUVA 3W9GA 3PREA 1N4RA 3ML8A 2H6HA 1GW6A 5HS0A 4XI0A 1OWPA 4A1SA 4EBAG 1NL4A 5JHBA 2L0IA 2F8XK 1BU9A 1N4QA 1E8YA 4GZCA 4AJWA 3CHMA 1H6OA 3RRMB 4FC8A 3E37A 5A7DB 4KYOB 4UI9C 2WXNA 3J5QB 3QJZA 2PZIA 2RFAA 3MX3A 3UT4A 3UM2A 3SNXA 3ENEA 3V31A 3PZ3A 3ULEG 3DSUA 1PY1A 4ACKA 2Y1LE 2WB2A 3QB2A 4K5AB 2H6GA 1VDYA 4I6GA 2CG3A 2LUHA 3NBNB 2WXFA 4KVOA 1O5MA 3ZIMA 4X8QA 3HRAA 4ANXA 2VTBA 3CVQA 3FFLA 1Z5SC 4U96D 4F3VA 3L17A 5CBOA 4EPZA 5CMYA 4B94A 4FHKA 3SZ7A 2YNQA 4N5CA 3CEQA 4AVXA 1V54E 4HI9A 3V30A 3Q75A 3CK9A 4Z68A 2XHEA 2M63A 3ESLA 3C3QA 4LSZE 3MV3B 3PVLA 2L6JA 3NZSA 3CQGB 2EIKE 4O60A 2VSNA 4CGWA 3ZXPA 3JYSA 4NIKA 3MZLB 3VTXA 2GRMA 2A5EA 4N39A 4AY5A 2JABA 2UY1B 2HYZA 3PZ2A 5KWDA 3TXMA 3FTWA 1FT1A 1ELRA 1FPPA 2XCCA 2PQNA 2WVIA 1ELWA 1HF8A 2KM4A 1KT0A 1KLXA 3KEAA 1BPOA 2MYOA 2BKKB 3Q5MA 4C9BB 4HRMB 5BNWA 3TWVA 1TYQG 4BETA 4XE0A 2ETBA 3AS5A 4XKBA 4N3BA 2WXJA 5A23A 4KXKB 5JJ7A 2LNIA 4JA9A 3MEKA 3FUIA 2X6IA 3Q79A 2L0TB 4EHMA 4JHKA 3LVRE 3L16A 4AP2A 1V55E 3ZPJA 5ANRA 1TNZA 2BF0X 3FTVA 3W9FA 2NYJA 3NAWA 3O4ZA 1OT8A 3R7QA 3WXXA 2I2OA 5FQ8A 3ASNE 4HOTA 3TWUA 4BX8A 1WAO1 3LJ3A 2XZTG 1EYHA 4KBQA 2IOLA 3ISMC 4HI8A 5FQ4A 2EILE 4UWKA 4FU3A 3UIPC 1OCZE 1TN7A 2ONDA 3PH0C 1L5JA 1WG0A 2E0IA 3PE4A 4HOUA 5EIBE 2KCLA 3FHEA 3AU5A 2KC7A 3D9HA 3OXGA 3RO2A 4M7CA 5AQAA 5AQ9A 3ZW3A 4K0RA 4A1GA 4DX7D 3APCA 3ZEFA 4B8AA 2P9PG 4GPKA 3KEZA 3HXBA 3EHNA 5EIDA 4LUNU 5JMND 2ETCA 4LNGA 4JVSA 1H6KA 1FCHA 4GMJA 5ENOD 3TAXA 5CRVA 4CT0A 5KBAA 4AY6A 3APDA 1IYGA 3ASDA 3ONLA 3PRZA 2F37A 1P5QA 3E34A 3U4TA 3PS6A 5G2NA 4U7EB 1QQEA 4BT8A 2R17C 5DBKA 3TG4A 1Q2ZA 3DSTA 3T8KA 4QQIA 2KZTB 4JHRA 2B0OE 3JUIA 2IF4A 5ENRD 3R9MA 3ZHEB 1S64A 4EECA 5AN8A 3ESKA 4UWFA 4JXTA 5AQ7A 2WXMA 1SZ9A 1KPSB 3PZ1A 4NRHB 2IQCA 1NI1A 4XEIG 4GYOA 2KZTA 3P2BA 1NZNA 4HNAD 4EZKA 4GMLA 3E30A 3ZHEA 1KZPA 1AP7A 3LVQE 3L6AA 2LXLA 4DJAA 5C1DA 3NF1A 1MX2A 1MX4A 1OCCE 4GZ6A 3I4GA 1KT1A 4J8SA 4HB5A 1H2VC 2ETAA 2X6FA 2P9UG 3MYVA 1YMPA 3TWXA 2DZOA 2F8YA 3S7DA 4JL0A 4ABNA 3JQ1A 2ZXWE 1SZAA 4GTSA 3L22A 1QYMA 1UW4B 1N4SA 2XPZA 4YNDA 4L2LA 5EX0A 4GPMA 5FINA 5ITZF 5E75A 1N9AA 4DI3A 2CFZA 1B89A 2FO1E 3LKUA 4JB8P 2VGXA 3ZYMA 2J49A 2QYJA 4F6RD 2ZIRA 2DZNA 4U07A 4WNFA 3ZYLA 4JEHA 3RRNB 1K1AA 2YINA 1N11A 2KCVA 4GTMA 5FZQA 1INZA 5LCWC 1N52A 3RAUA 5G04C 2J9QA 5T4YA 1FT2A 4WWPA 2QZAA 3X2QE 1EDUA 3PZDA 3SFZA 3DEOA 4YDYA 4J8DA 1Y6IA 2V4HC 4Y6CA 4TXPA 3ABKE 2Y4TA 2AJAA 3CHSA 3FUMA 2P9NG 3IEGA 3SHFA 2WXHA 2GGFA 2XRYA 3ULQA 4L1BA 3EIJA 4I43A 4J8FA 3FH7A 4U63A 3B7UX 4OAVB 3CHPA 1A17A 4CGVA 4LEUA 3SY2A 1AWCB 4G23A 4GB9A 4L23A 2PL2A 1O1TA 2BEDA 2P9LG 4YDEA 2IOSA 3I4RB 2BUGA 3HIZA 2XGSA 2WQ6A 1TJCA 4DX1A 4F1SA 4HS2A 3VLFA 2X3MA 2VQ2A 4FP7A 3D3MA 2FULA 2WXKA 4YDOA 5D66A 4GYYA 4AIFA 2R03A 3FWVA 4OAUC 5KJLA 2RFMA 1HS6A 4OVUA 1MZCA 4L7TA 4A3VA 2LSUA 3ZKJA 4D10C 2EIJE 3FULA 4A3TA 3L08A 3ML9A 4Q94A 3B7BA 4GTPA 3HVEB 3EU5A 5FQ6A 3AG3E 3QDNA 3ZYKA 3B13A 3LY9A 4FA6A 4ACLA 4A63B 3AAAC 1OCOE 4AXHA 2VTBB 5EDSA 2VSXE 4K03A 3J5PA 4BSZB 3D9KA 5CERB 3VTYA 3ZFWA 1JPLA 3MJWA 2AW6A 4JD2G 3DPYA 3AU4A 4NACA 3HVEA 3CSTA 3DEPA 4APFA 3RK6A 5KJNA 1HXIA 3DXMG 2UWJG 5JJTA 2V5QC 1E8WA 2V8SE 5KNGA 3AG2E 4DX5D 4L2YA 3E4BA 4BT9A 4UUCA 4E85A 3AJIA 1D8EA 2FBNA 3FUKA 2XQ0A 3CKCA 4I1MA 3UM0A 3TWTA 4J0UA 4DLQA 2A5UA 2LSVA 2IO2C 4I1OB 3AS8A 2AXZA 2QC9A 3I5PA 4I17A 5JJ6A 1SW6A 4U8YD 4N3CA 5AAOA 4PS3A 1N0RA 2QFCA 3FTSA 2DCPA 3JXJA 4C48B 4V3IA 1Z6TA 2IU1A 3T9KA 2P9KG 1N54A 3UXGA 5CCMA 3CR3A 4HFGA 1OWMA 1IQUA 2IY0C 1JCRA 5EKQD 1LF8A 1U3CA 1PC2A 4AM9A 3IXEA 3V2OA 5ARGA 5AJLA 3D9LA 4WAFA 3CV0A 1E90A 5G55A 2FF4A 1BD8A 2CG2A 4B8CB 2Q7FA 4MKTA 4TUMA 2R5SA 5KCMA 4BTBA 2KBXA 2AXVA 2CFUA 4O1OA 4HOSA 3RJVA 3HYMB 4C0EA 3U64A 3CHRA 5ENNA 1JUQA 3U9WA 3NZUA 4HRLA 4Q96A 1DNPA 3TWRA 2V5FA 3L9TA 4GA1A 3ZNGA 2A4ZA 1A5EA 4F7AA 3AS4A 3FEXA 4ILIA 1ZBPA 3BUAA 3CIAA 3T8MA 4CDMA 4XIFA 4I2WA 5T8IA 2I1JA 3FP3A 3RO3A 3RRUA 2HR2A 3ASGA 3IHYA 4G8KA 4MS6A 1UN8A 3DBSA 3QWVA 3SBTB 1WY6A 3KS2A 1LD8A 4U04A 4A55A 1TNYA 3IKOB 2KATA 4B89A 3JQ0A 3LXUX 2DVWA 3CQCB 2DYRE 2NC9A 3FUNA 3NB2A 3ONKA 4BTAA 3ZYQA 3PE3A 4PS7A 2OCCE 3ZUVB 5BXUA 2Y4UA 2OV8A 1ZU2A 2PM7A 2XEVA 4KVMA 2VGYA 2NSZA 4FADA 4JPSA 2YQ8A 3D9IA 4DPRA 3ABME 1MQSA 4OVVA 1TNOA 3FTYA 1HFAA 3LEWA 4UWGA 4RSYA 3LY7A 4LNUD 5LFAA 1NP7A 3CGHA 4LG6A 5CMWA 3CHOA 4JW1A 5AARA 5CECB 2FI7A 4FJZA 2RG8A 4KMOA 5HKPA 1N94A 1UJJA 2F0YA 3S7BA 3DSSA 3Q78A 2JEKA 4U0UA 2ZU6B 3I3NA 2KCKA 3HDXA 1FVHA 2BTDA 3MCXA 2H6FA 2ZGDA 2YHEA 2DWZA 3LDZA 3FH5A 3K9IA 3UTMA 4JA7A 5CEDB 3ZGQA 5HQ8A 2J8SD 1N0QA 3G2VA 4UWLA 3FU3A 1H19A 3G2SA 3D9JA 3G2UA 4CZ2D 1HE8A 5BW8C 2C2LA 1JCSA 4XKCA 4DLOA 5FT9A 3DWLG 3MKQA 3UQ3A 1SA4A 2PNNA 1TN8A 3QC1A 1MHQA 1IQRA 1UOHA 3FTXA 4LNBA 3TWQA 3C72A 2HE0A 3BG0B 3IHVA 5AENA 4EZLA 1YYHA 4CT4A 2I1KA 2VGEA 5BXOA 3GW4A 3HG0D 1OXJA 5IY5E 5AIJA 2WQ7A 2P2CP 1G3NB 5ARFA 4O1PA 1K8KG 4GZ3A 5KJKA 1HG5A 2VGXB 3LPZA 3CVLA 2IFUA 4MLPA 4YVQC 2KXPC 1O1RA 3HXDA 3V79K 1DCQA 3FU6A 3TWSA 5J90A 1E96B 3FY4A 4M3OA 5FIOA 2P9SG 4ME2A 3UM3A 3MGBA 1N95A 4UWHA 2HM8A 1DCEA 3EJNA 5FQ7A 2J4DA 3ABLE 3U66A 5BUZA 2C0MA 5LOZA 4F53A 1RW2A 4PUCA 2MOWA 3B95A 1MYOA 3S7JA 4U8HA 2XEHA 5AYWD 4AV7A 3D9PA 3B7SA 5ANLA 5HI7A 3UT8A 1WM5A 4HXIA 2WXLA 3FU0A 2IO3C 5EYPF 4GTTA 5H7PA 1QNFA 2GW1A 2GROB 2VYIA 4I1AA 3E33A 3R7RA 3CVXA 4J7WA 2GRLA 4EZJA 4RG9A 4KZ0A 2WPVA 2EINE 2V4LA 4OYSA 3SO8A 5G05J 5A6CA 3UT7A 5B1AE 2ILRA 4W9RA 3QWWA 1OCRE 2DBAA 3MKRA 2XRZA 3P1UA 5BV0A 3FUEA 3F6QA 4CDRA 4KZCA 2GRPB 3BQOA 4EQFA 5D0QD 3AG4E 2FO7A 2WXOA 4ATZD 4WWOA 3GZSA 5ENSD 2R2LA 3N71A 3NOCD 3Q4AB 3PZ4A 3C98A 4CEMA 3OXFA 4DI4A 3VLDA 4GZDA 2L6BA 2JLBA 2J09A 5ENPD 4UQXA 4Y6WA 4LERA 4GTVA 4NQ0A 3MV2B 3KSQA 5FZSA 4GZ5A 1HZ4A 4ANWA 3CVVA 3RSEG 3QK0A 1HX8A 4RLYA 1HU3A 3LCAA 2I9CA 5D0OD 2AWIA 2EIME 2QYUA 1JWFA 3C3OA 3GZ2A 4BX9A 2I6HA 3HXFA 5EYLA 5ENTD 3DRAA 3EU9A 4CDNA 3QOUA 3CKBA 2MRIA 5JHAA 1OY3D 3G2TA 2GRNB 3E32A 2ZISA 1D9SA 3UUXA 5BT1A 2AXUA 1HH8A 1NFIE 2Y69E 2XEEA 3G2WA 2E2EA 4FLHA 3SQVA 4L9PA 3FUFA 2FEZA 3C3RA 4WUYA 2XS8A 5BPPA 1QBQA 4J8YA
chains in the Genus database with same CATH topology
1OWOA 2A4ZA 3Q49B 4CCAA 3ESKA 4F7AA 3CLJA 1YA0A 4UWFA 3OTNA 4HLEA 4JXTA 3AS4A 4PH4B 4JZYA 3FEXA 4ILIA 4I6EA 4I6JA 3SGHA 2WXMA 3CVUA 1ZBPA 2EQXA 3FEYA 2J08A 3RIBA 3CIAA 3CVYA 3CSFA 1SZ9A 5FTPA 2IJGX 3T8MA 4CDMA 5LCWJ 4UQYA 3HHMA 4NRHB 4XIFA 1QZ2A 3LS8A 1NA0A 4I2WA 5T8IA 2IQCA 5G04J 4HORA 1E8ZA 2I1JA 3FP3A 3O48A 4WWNA 4AEZC 1XGWA 4P29A 4GYOA 3SF4A 3RO3A 2KZTA 3P2BA 4UI9J 3RRUA 4C0MA 5LP0A 2HR2A 1NZNA 2YHCA 3ASGA 3CVNA 4EZKA 3IHYA 2AVPA 4GMLA 2PQRA 3EHMA 4I2ZA 2WXIA 1Y8MA 3ZHEA 3LVQE 1UN8A 2CHXA 3L6AA 4MS6A 5LX8A 3SBSA 3SD5A 4ILHB 3DBSA 3QWVA 3B7TA 4DJAA 1OWNA 3SBTB 5C1DA 1WY6A 2OVBA 2VSYA 3NF1A 3KS2A 4U04A 4G2VA 4GZ6A 4WNEA 3I4GA 4A55A 1KT1A 2L9BA 4J8SA 3IKOB 4APOA 2X6HA 3PDNA 4UI9K 3D9OA 1TEZA 3OAWA 2KATA 1H2TC 4GYWA 3S2AA 4B89A 3D9NA 5T3RA 1OWLA 5KJMA 3JQ0A 3LXUX 1H2VC 2XGOA 2X6FA 3ZXSA 3IV0A 3MYVA 4FLBA 3CQCB 5BV1A 4FHJA 2J07A 4HOQA 2XPYA 4IYPA 1E8XA 2NC9A 3FUNA 3ONKA 4BTAA 3S7DA 5EX3A 4JL0A 2Y3AA 3QKYA 3ZYQA 4ABNA 2XGMA 3PE3A 4Q69A 4PS7A 4BWRA 3JQ1A 5C2YA 4JHJA 3ZN3A 2Y4UA 1SZAA 2OV8A 4R7LA 4XI9A 1ZU2A 3PNTB 2XPIA 4BSXA 3L22A 2PM7A 3PNLB 4O6FA 2XEVA 4KVMA 4TV3A 2VGYA 3S7FA 1U3DA 1UW4B 1JWGA 2XPZA 4YNDA 2NSZA 4N2QA 4FADA 4JPSA 4PS8A 4IULA 2YQ8A 1E7UA 4L2LA 4ILGA 3RU0A 4DK5A 2C0LA 3SI5A 3FUJA 3RKVA 3D9IA 4DPRA 5EX0A 4PDXA 3APFA 1MQSA 3D9MA 2VSOE 5E75A 4OVVA 4B0ZA 1HO8A 1XNFA 2WXRA 2WM9A 4DI3A 3FTYA 1HFAA 3LEWA 4FULA 4WNDA 2CFZA 1B89A 4RSYA 4UWGA 5FWQA 3LKUA 3LY7A 3PREA 5LFAA 2VGXA 1NP7A 3CGHA 1OUVA 2J49A 3FUHA 3ML8A 3ZYMA 5CMWA 4GA2A 1GW6A 4XI0A 1OWPA 3UMVA 4A1SA 4EBAG 3CHOA 4JW1A 5JHBA 2L0IA 4U07A 4WNFA 3ZYLA 4JEHA 5J08A 3RRNB 2XCBA 4JEUA 2YINA 2CHWA 3FTUA 2KCVA 2FI7A 1E8YA 2RG8A 4FJZA 4GZCA 4KMOA 5FZQA 1INZA 4AJWA 2PM6A 3CHMA 3RRMB 5LCWC 1DVPA 1UJJA 4FC8A 1N52A 3S7BA 5A7DB 5G04C 2J9QA 4KYOB 2UY1A 5T4YA 2JEKA 4U0UA 2ZU6B 3I3NA 4WWPA 2KCKA 4UI9C 2WXNA 3HDXA 3QJZA 2PZIA 3JCKC 3UT4A 1FVHA 3MX3A 1EDUA 2BTDA 5CCLA 3MCXA 3CK8A 3PZDA 3ENEA 3SNXA 3GZ1A 3SFZA 4RG6A 1Z3XA 2YHEA 4J8DA 4ANUA 1Y6IA 3LDZA 3FH5A 1PY1A 4Y6CA 4ACKA 3K9IA 4XX5A 4JA7A 2WB2A 3ZGQA 5HQ8A 2Y4TA 3CHSA 3FUMA 3QB2A 3IEGA 3G2VA 1VDYA 3SHFA 2IONA 4UWLA 2WXHA 2RD0A 4I6GA 2CG3A 3FU3A 1H19A 2GGFA 2XRYA 3D9JA 2WXPA 3G2SA 3G2UA 4L1BA 5CHEE 3EIJA 3ULQA 2WXFA 4I43A 4J8FA 4KVOA 1HE8A 3FH7A 5BW8C 2C2LA 4U63A 4GAAA 4MRUA 3ZIMA 4XKCA 2X6JA 4ANXA 3B7UX 4DLOA 3CVQA 4N3AA 2VTBA 1UG3A 3ASHA 4CRWA 5FJYA 5FT9A 3CHPA 1A17A 4CGVA 4LEUA 3DPDA 5FZRA 3MKQA 1SQMA 3EIQC 1Z3YA 1UN9A 3UQ3A 4GA0A 3FFLA 4G23A 4GB9A 3QC1A 4L23A 4QFVA 2PL2A 1MHQA 1IQRA 3FTXA 4F3VA 2IOSA 3L17A 3BG0B 5AENA 3IHVA 1EPUA 4EZLA 3I4RB 4EPZA 5CMYA 2BUGA 4B94A 3FTZA 4FHKA 3SZ7A 3ASFA 5M72A 4CT4A 2I1KA 2YNQA 4N5CA 3HIZA 2X38A 3CEQA 4HVBA 2XGSA 4H7XA 2NXPA 3GW4A 2WQ6A 2LAIA 1TJCA 4AVXA 3L13A 3TG5A 4GU5A 4F1SA 2LAHA 3CK9A 5AIJA 3GYZA 2WQ7A 2XHEA 2M63A 3ESLA 5ARFA 3FH8A 4GZ3A 4HS2A 3VLFA 5KJKA 2X3MA 2VQ2A 1HG5A 3MV3B 4FP7A 3PVLA 2VGXB 2L6JA 3LPZA 3NZSA 3D3MA 2FULA 2WXKA 3CQGB 1PAQA 3CVLA 2IFUA 4MLPA 3PUJA 4GYYA 4AIFA 2VSNA 4YVQC 4CGWA 3JYSA 3FU6A 5J90A 1E96B 3FY4A 3FWVA 3MZLB 3QWPA 4M3OA 5KJLA 3VTXA 4XZ4A 2GRMA 1HS6A 4ME2A 4N39A 4BFRA 4OVUA 3PUKA 1H2UA 4AY5A 4L7TA 3MGBA 3FUDA 4A3VA 4UWHA 2LSUA 2UY1B 2HM8A 5E76A 2HYZA 1H0AA 3EJNA 3VLEA 3TL5A 4D10C 5FQ7A 3Q47B 3TXMA 3FTWA 1ELRA 2J4DA 2XCCA 3U66A 2PQNA 3FULA 3Q15A 2WVIA 5BUZA 2WXGA 4A3TA 4WNGA 2C0MA 3L08A 1ELWA 1HF8A 5AJDA 3ML9A 2KM4A 1KT0A 4Q94A 1KLXA 5LOZA 4F53A 1BPOA 4GCOA 3HVEB 4PUCA 2MOWA 3BEEA 3Q5MA 4C9BB 5FQ6A 5BNWA 3QDNA 3EDTB 3S7JA 5DIZA 4XE0A 2MHKA 4U8HA 5AYWD 3ZYKA 3AS5A 3B13A 3LY9A 4ACLA 3D9PA 3B7SA 4AV7A 4FA6A 1S0PA 5ANLA 4AXHA 5HI7A 4XKBA 3UT8A 1WM5A 4HXIA 4N3BA 2VTBB 2OVFA 2WXLA 2WXJA 2VSXE 3FU0A 3FU5A 5EDSA 3UPVA 4K03A 3MKQB 1QNFA 5A23A 2GW1A 4KXKB 5JJ7A 3QARA 2VYIA 4I1AA 2LNIA 4JA9A 3D9KA 3MEKA 3FUIA 3R7RA 4H7YA 1X5BA 4G1TA 2X6IA 3VTYA 3ZFWA 1JPLA 3MJWA 3CVXA 4ANVA 4IN3B 2AW6A 2GRLA 2L0TB 4EZJA 4RG9A 3AU4A 4JHKA 4NACA 3HVEA 4KZ0A 4LRZA 3LVRE 3CK7A 3L16A 4AP2A 3CSTA 1HG2A 2WPVA 3QAQA 1HXIA 1IHGA 4TUUA 3RK6A 5ANRA 3ZPJA 4APFA 2UWJG 5KJNA 5JJTA 4G11A 1E8WA 3KD7A 2BF0X 3FTVA 3TGOA 2V4LA 2V8SE 4OYSA 4I9CA 5G05J 4L2YA 2CHZA 3E4BA 5A6CA 4BT9A 3O4ZA 4E85A 4YVOA 3R7QA 3UT7A 2I2OA 3CVPA 2ILRA 3WXXA 4W9RA 3QWWA 4URKA 2HO1A 2WXQA 4TRQA 5FQ8A 4IRUA 2DBAA 3MKRA 4KT6B 2FBNA 2XRZA 4HOTA 3FUKA 3P1UA 2R59A 5BV0A 4BX8A 1WAO1 3FUEA 3LJ3A 2XQ0A 3LY8A 2WQHA 1EYHA 4KBQA 3L54A 2IOLA 3CKCA 4CDRA 4KZCA 3T5VA 4I1MA 5FQ4A 4U0SA 4UWKA 4FU3A 4J0UA 4EQFA 4DLQA 4BY6A 2WMOA 2A5UA 2LSVA 4JC8A 5D0QD 2ONDA 4I1OB 3PH0C 4LCTA 3AS8A 4RVBA 2AXZA 1L5JA 2FO7A 1EF1C 3I5PA 4I17A 5JJ6A 2E0IA 2WXOA 3PE4A 4G25A 4HOUA 3ZRHA 2QY7A 3LYAA 4N3CA 4WWOA 2KCLA 3GZSA 4PS3A 3FHEA 3R9AB 2QFCA 3FTSA 3N71A 2DCPA 3Q4AB 3AU5A 1E7VA 3BG1B 3C98A 2KC7A 3TJPA 4CEMA 3OXFA 3CHQA 4V3IA 4DI4A 3VLDA 1Z6TA 3OXGA 4GZDA 2JLBA 2X6KA 3RO2A 2J09A 2IU1A 1N54A 2OOEA 4UQXA 3URZA 3CVWA 3ZW3A 4Y6WA 3ZVVA 3FDHA 4LERA 4K0RA 4A1GA 5CCMA 3CR3A 4HFGA 4NQ0A 1OWMA 1IQUA 3B7RL 3MV2B 5FZSA 3APCA 4ATGA 4GZ5A 3ZEFA 4B8AA 4U0ZA 5EKQD 4EBAA 3PEVB 1HZ4A 3OXLA 4GPKA 4ANWA 3CVVA 3KEZA 4N2SA 3QK0A 1TJFA 1LF8A 1U3CA 1HX8A 3EHNA 1PC2A 4LUNU 4AM9A 1HU3A 3LCAA 1W3BA 3TXNA 1FVFA 5ARGA 1UJKA 5AJLA 3KAEA 2I9CA 5D0OD 2J4BA 4JVSA 4E6HA 1H6KA 1FCHA 3D9LA 2AWIA 4GMJA 4WAFA 3CV0A 3TAXA 4CT0A 1E90A 5G55A 3MA5A 2FF4A 4AY6A 2CG2A 3APDA 4B8CB 1JWFA 2Q7FA 4G26A 3UX4A 2DIWA 4MKTA 1IYGA 3GZ2A 3ASDA 4BX9A 2R5SA 2I6HA 5KCMA 4NURA 4BTBA 2LO6A 4I9EA 2AXVA 2CFUA 3ONLA 5G05C 2P58C 3PRZA 4GCNA 4HOSA 3RJVA 3HYMB 1P5QA 1NA3A 3NQPA 4C0EA 3U64A 3QOUA 4CDNA 3CKBA 1ELKA 3CHRA 3U4TA 2MRIA 3PS6A 5G2NA 4AOFA 5JHAA 3G2TA 5ENNA 1QQEA 2V0PA 4BT8A 2R17C 4G24A 5DBKA 3UUXA 5BT1A 3T5XA 1JUQA 2AXUA 3TG4A 3U9WA 1HH8A 4FJYA 3NZUA 4Q96A 3IBEA 1DNPA 2V5FA 3PEUB 3QNKA 2VJ8A 3G2WA 2E2EA 2KZTB 4FLHA 3U3WA 4J8EA 4JHRA 4GA1A 3JUIA 2IF4A 4J6IA 3FUFA 4UQZA 2FEZA 3ZHEB 4EECA 4WUYA 2WMNA 5BPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B89 A;  1UG3 A;  1N54 A;  1H6K A;  4CRW A;  2I2O A;  4GMJ A;  4GML A;  1H2U A;  4C9B B;  1H2V C;  3EIQ C;  4B8C B;  3FEX A;  2RG8 A;  3L6A A;  2VSO E;  2HM8 A;  4B8A A;  3FEY A;  4JHK A;  1N52 A;  2FUL A;  2IOL A;  2IOS A;  3D3M A;  2ION A;  1PAQ A;  2KZT B;  3RK6 A;  4JHJ A;  5ANR A;  2GGF A;  4CT4 A;  3EIJ A;  4LUN U;  2ZU6 B;  3JUI A;  4CEM A;  2VSX E;  1HU3 A;  2KZT A;  1UW4 B;  1H2T C;  2NSZ A;  2IU1 A;  4IUL A; 
#chains in the Genus database with same CATH topology
 3Q49 B;  3LJN A;  4CCA A;  3CLJ A;  1YA0 A;  2GRR B;  3OTN A;  4HLE A;  1IHB A;  1SVX A;  3SGH A;  3CVU A;  2EQX A;  3RIB A;  3CVY A;  1H6P A;  3HHM A;  1NA0 A;  3O48 A;  1BI7 B;  4AEZ C;  1XGW A;  4P29 A;  1DC2 A;  4C0M A;  4UI9 J;  1TNU A;  5LP0 A;  2YHC A;  3CVN A;  3EHM A;  2WXI A;  1Y8M A;  3SBS A;  1IXV A;  1K3Z D;  5AQB A;  3DXK G;  4DX6 D;  2L9B A;  2Y0B G;  3PDN A;  3D9O A;  3OAW A;  3DSV A;  2DYS E;  4GYW A;  3S2A A;  5EIL A;  3D9N A;  1YCS B;  1OWL A;  5KJM A;  2XGO A;  4FLB A;  3SFY A;  4FHJ A;  2J07 A;  5BV1 A;  4HOQ A;  4IYP A;  3ASO E;  2Y3A A;  3QKY A;  2XGM A;  4BWR A;  4JHJ A;  3ZN3 A;  4G8L A;  4BES A;  2XPI A;  4TV3 A;  4RQI A;  1U3D A;  1JWG A;  4N2Q A;  1X81 A;  4ILG A;  4DK5 A;  3SI5 A;  3FUJ A;  3RKV A;  4PDX A;  2XZD G;  2XEN A;  2ZGG A;  5B1B E;  1N4P A;  1XNF A;  2WXR A;  2WM9 A;  4FUL A;  4WND A;  3KSL A;  3FUH A;  1OUV A;  4GA2 A;  3UMV A;  3UI2 A;  4DX2 A;  3DSX A;  5J08 A;  3UIO C;  2XCB A;  4JEU A;  3ULY A;  2CHW A;  3FTU A;  4DRX E;  2PM6 A;  1DVP A;  5EN5 D;  3Q9U C;  2UY1 A;  3JCK C;  5CCL A;  3CK8 A;  3GZ1 A;  4RG6 A;  1Z3X A;  1ZB1 A;  4ANU A;  5ENQ D;  3Q73 A;  4XX5 A;  1U2V G;  2ION A;  4ZFH A;  2RD0 A;  5CHE E;  2WXP A;  4GAA A;  4MRU A;  2X6J A;  4N3A A;  1UG3 A;  3ASH A;  4CRW A;  5FJY A;  3DPD A;  5FZR A;  1SQM A;  3BU8 A;  3EIQ C;  1Z3Y A;  1UN9 A;  4GA0 A;  4QFV A;  4GMR A;  2RKK A;  1EPU A;  3FTZ A;  5M72 A;  3ASF A;  1JCQ A;  2X38 A;  3Q9N C;  4HVB A;  4H7X A;  2NXP A;  2LAI A;  3L13 A;  3WG7 E;  3TG5 A;  4GU5 A;  2LAH A;  4F1P A;  3GYZ A;  3FH8 A;  1TR4 A;  5JA4 D;  1MX6 A;  3C5R A;  1PAQ A;  3NOG D;  3PUJ A;  3UIN C;  3HXE A;  1BLX B;  3QWP A;  4XZ4 A;  2XS1 A;  4U95 D;  4BFR A;  3PUK A;  1H2U A;  4HLL A;  3FUD A;  3ZU7 B;  1MJ0 A;  5E76 A;  1H0A A;  3VLE A;  3TL5 A;  3Q47 B;  3Q15 A;  2WXG A;  4WNG A;  5AJD A;  4N5Q A;  4GCO A;  3BEE A;  3Q7A A;  4CYM D;  4K5B A;  3EDT B;  5DIZ A;  2MHK A;  1S0P A;  2OVF A;  3FU5 A;  3UPV A;  3TWW A;  3MKQ B;  3QAR A;  3JXI A;  4U8V D;  4H7Y A;  1X5B A;  4G1T A;  4ANV A;  4IN3 B;  1TNB A;  1KZO A;  4LRZ A;  3CK7 A;  1HG2 A;  3QAQ A;  4TUU A;  1IHG A;  5D2M C;  1S70 B;  4G11 A;  3KD7 A;  3TGO A;  4I9C A;  2CHZ A;  3JUE A;  4TXR A;  3V2X A;  4YVO A;  2GRQ B;  3CVP A;  5CBN A;  4K5C A;  4URK A;  2HO1 A;  2WXQ A;  4TRQ A;  4IRU A;  4KT6 B;  2R59 A;  3LY8 A;  2WQH A;  3L54 A;  1SA5 A;  1S63 A;  3SFX A;  3T5V A;  4U0S A;  4GTQ A;  3HXC A;  4BY6 A;  2WMO A;  4JC8 A;  4LCT A;  4RVB A;  1EF1 C;  4HRN A;  2IEJ A;  4G25 A;  3ZRH A;  2QY7 A;  3LYA A;  2OEW A;  5KNH D;  3R9A B;  3UKR G;  1E7V A;  3BG1 B;  3TJP A;  3CHQ A;  2X6K A;  2OOE A;  3URZ A;  3CVW A;  3ZVV A;  3FDH A;  4GTO A;  3B7R L;  2P9I G;  4ATG A;  4U0Z A;  4EBA A;  3PEV B;  3OXL A;  2R05 A;  4N2S A;  1TJF A;  1RZ4 A;  5HRY A;  1W3B A;  3TXN A;  1FVF A;  1UJK A;  3KAE A;  2J4B A;  4E6H A;  3MA5 A;  4G26 A;  3UX4 A;  2DIW A;  1TN6 A;  4NUR A;  2LO6 A;  4I9E A;  5CRU A;  5B3S E;  5G05 C;  2P58 C;  4GCN A;  1NA3 A;  3NQP A;  1ELK A;  1IKN D;  4AOF A;  2V0P A;  4G24 A;  3DSW A;  3T5X A;  4FJY A;  3IBE A;  1LD7 A;  3PEU B;  4B93 B;  3QNK A;  2VJ8 A;  2R02 A;  5CEA A;  3U3W A;  4J8E A;  4J6I A;  4UQZ A;  1O1S A;  2WMN A;  1OWO A;  4YDW A;  3UKU G;  4PH4 B;  4JZY A;  4BER A;  4I6E A;  4I6J A;  3FEY A;  2J08 A;  4MBG A;  3CSF A;  4HQD A;  1BI8 B;  5FTP A;  2IJG X;  5LCW J;  4UQY A;  1QZ2 A;  3LS8 A;  4ZHB A;  4HOR A;  5G04 J;  1E8Z A;  2B6C A;  4WWN A;  3SF4 A;  2AVP A;  3EHQ A;  2PQR A;  4I2Z A;  2LXM A;  2CHX A;  5LX8 A;  3SD5 A;  4ILH B;  3B7T A;  1OWN A;  2OVB A;  2VSY A;  2H6I A;  3L82 A;  4G2V A;  4WNE A;  1K1B A;  4APO A;  2X6H A;  4UI9 K;  1TEZ A;  1H2T C;  4HBD A;  5T3R A;  1LTX A;  3ZXS A;  3IV0 A;  3Q7F A;  4TXQ A;  2XPY A;  4DUI A;  1E8X A;  1WDY A;  5EX3 A;  4Q69 A;  5C2Y A;  4R7L A;  4XI9 A;  3PNT B;  4BSX A;  4O6F A;  3PNL B;  1D8D A;  3S7F A;  2BKG A;  4PS8 A;  4IUL A;  2OEV A;  1E7U A;  3RU0 A;  2C0L A;  3APF A;  3D9M A;  2VSO E;  3AG1 E;  4B0Z A;  1HO8 A;  3EHR A;  4BEP A;  4GTR A;  3UM1 A;  5FWQ A;  3EUV A;  3W9G A;  3PRE A;  1N4R A;  3ML8 A;  2H6H A;  1GW6 A;  5HS0 A;  4XI0 A;  1OWP A;  4A1S A;  4EBA G;  1NL4 A;  5JHB A;  2L0I A;  2F8X K;  1BU9 A;  1N4Q A;  1E8Y A;  4GZC A;  4AJW A;  3CHM A;  1H6O A;  3RRM B;  4FC8 A;  3E37 A;  5A7D B;  4KYO B;  4UI9 C;  2WXN A;  3J5Q B;  3QJZ A;  2PZI A;  2RFA A;  3MX3 A;  3UT4 A;  3UM2 A;  3SNX A;  3ENE A;  3V31 A;  3PZ3 A;  3ULE G;  3DSU A;  1PY1 A;  4ACK A;  2Y1L E;  2WB2 A;  3QB2 A;  4K5A B;  2H6G A;  1VDY A;  4I6G A;  2CG3 A;  2LUH A;  3NBN B;  2WXF A;  4KVO A;  1O5M A;  3ZIM A;  4X8Q A;  3HRA A;  4ANX A;  2VTB A;  3CVQ A;  3FFL A;  1Z5S C;  4U96 D;  4F3V A;  3L17 A;  5CBO A;  4EPZ A;  5CMY A;  4B94 A;  4FHK A;  3SZ7 A;  2YNQ A;  4N5C A;  3CEQ A;  4AVX A;  1V54 E;  4HI9 A;  3V30 A;  3Q75 A;  3CK9 A;  4Z68 A;  2XHE A;  2M63 A;  3ESL A;  3C3Q A;  4LSZ E;  3MV3 B;  3PVL A;  2L6J A;  3NZS A;  3CQG B;  2EIK E;  4O60 A;  2VSN A;  4CGW A;  3ZXP A;  3JYS A;  4NIK A;  3MZL B;  3VTX A;  2GRM A;  2A5E A;  4N39 A;  4AY5 A;  2JAB A;  2UY1 B;  2HYZ A;  3PZ2 A;  5KWD A;  3TXM A;  3FTW A;  1FT1 A;  1ELR A;  1FPP A;  2XCC A;  2PQN A;  2WVI A;  1ELW A;  1HF8 A;  2KM4 A;  1KT0 A;  1KLX A;  3KEA A;  1BPO A;  2MYO A;  2BKK B;  3Q5M A;  4C9B B;  4HRM B;  5BNW A;  3TWV A;  1TYQ G;  4BET A;  4XE0 A;  2ETB A;  3AS5 A;  4XKB A;  4N3B A;  2WXJ A;  5A23 A;  4KXK B;  5JJ7 A;  2LNI A;  4JA9 A;  3MEK A;  3FUI A;  2X6I A;  3Q79 A;  2L0T B;  4EHM A;  4JHK A;  3LVR E;  3L16 A;  4AP2 A;  1V55 E;  3ZPJ A;  5ANR A;  1TNZ A;  2BF0 X;  3FTV A;  3W9F A;  2NYJ A;  3NAW A;  3O4Z A;  1OT8 A;  3R7Q A;  3WXX A;  2I2O A;  5FQ8 A;  3ASN E;  4HOT A;  3TWU A;  4BX8 A;  1WAO 1;  3LJ3 A;  2XZT G;  1EYH A;  4KBQ A;  2IOL A;  3ISM C;  4HI8 A;  5FQ4 A;  2EIL E;  4UWK A;  4FU3 A;  3UIP C;  1OCZ E;  1TN7 A;  2OND A;  3PH0 C;  1L5J A;  1WG0 A;  2E0I A;  3PE4 A;  4HOU A;  5EIB E;  2KCL A;  3FHE A;  3AU5 A;  2KC7 A;  3D9H A;  3OXG A;  3RO2 A;  4M7C A;  5AQA A;  5AQ9 A;  3ZW3 A;  4K0R A;  4A1G A;  4DX7 D;  3APC A;  3ZEF A;  4B8A A;  2P9P G;  4GPK A;  3KEZ A;  3HXB A;  3EHN A;  5EID A;  4LUN U;  5JMN D;  2ETC A;  4LNG A;  4JVS A;  1H6K A;  1FCH A;  4GMJ A;  5ENO D;  3TAX A;  5CRV A;  4CT0 A;  5KBA A;  4AY6 A;  3APD A;  1IYG A;  3ASD A;  3ONL A;  3PRZ A;  2F37 A;  1P5Q A;  3E34 A;  3U4T A;  3PS6 A;  5G2N A;  4U7E B;  1QQE A;  4BT8 A;  2R17 C;  5DBK A;  3TG4 A;  1Q2Z A;  3DST A;  3T8K A;  4QQI A;  2KZT B;  4JHR A;  2B0O E;  3JUI A;  2IF4 A;  5ENR D;  3R9M A;  3ZHE B;  1S64 A;  4EEC A;  5AN8 A;  3ESK A;  4UWF A;  4JXT A;  5AQ7 A;  2WXM A;  1SZ9 A;  1KPS B;  3PZ1 A;  4NRH B;  2IQC A;  1NI1 A;  4XEI G;  4GYO A;  2KZT A;  3P2B A;  1NZN A;  4HNA D;  4EZK A;  4GML A;  3E30 A;  3ZHE A;  1KZP A;  1AP7 A;  3LVQ E;  3L6A A;  2LXL A;  4DJA A;  5C1D A;  3NF1 A;  1MX2 A;  1MX4 A;  1OCC E;  4GZ6 A;  3I4G A;  1KT1 A;  4J8S A;  4HB5 A;  1H2V C;  2ETA A;  2X6F A;  2P9U G;  3MYV A;  1YMP A;  3TWX A;  2DZO A;  2F8Y A;  3S7D A;  4JL0 A;  4ABN A;  3JQ1 A;  2ZXW E;  1SZA A;  4GTS A;  3L22 A;  1QYM A;  1UW4 B;  1N4S A;  2XPZ A;  4YND A;  4L2L A;  5EX0 A;  4GPM A;  5FIN A;  5ITZ F;  5E75 A;  1N9A A;  4DI3 A;  2CFZ A;  1B89 A;  2FO1 E;  3LKU A;  4JB8 P;  2VGX A;  3ZYM A;  2J49 A;  2QYJ A;  4F6R D;  2ZIR A;  2DZN A;  4U07 A;  4WNF A;  3ZYL A;  4JEH A;  3RRN B;  1K1A A;  2YIN A;  1N11 A;  2KCV A;  4GTM A;  5FZQ A;  1INZ A;  5LCW C;  1N52 A;  3RAU A;  5G04 C;  2J9Q A;  5T4Y A;  1FT2 A;  4WWP A;  2QZA A;  3X2Q E;  1EDU A;  3PZD A;  3SFZ A;  3DEO A;  4YDY A;  4J8D A;  1Y6I A;  2V4H C;  4Y6C A;  4TXP A;  3ABK E;  2Y4T A;  2AJA A;  3CHS A;  3FUM A;  2P9N G;  3IEG A;  3SHF A;  2WXH A;  2GGF A;  2XRY A;  3ULQ A;  4L1B A;  3EIJ A;  4I43 A;  4J8F A;  3FH7 A;  4U63 A;  3B7U X;  4OAV B;  3CHP A;  1A17 A;  4CGV A;  4LEU A;  3SY2 A;  1AWC B;  4G23 A;  4GB9 A;  4L23 A;  2PL2 A;  1O1T A;  2BED A;  2P9L G;  4YDE A;  2IOS A;  3I4R B;  2BUG A;  3HIZ A;  2XGS A;  2WQ6 A;  1TJC A;  4DX1 A;  4F1S A;  4HS2 A;  3VLF A;  2X3M A;  2VQ2 A;  4FP7 A;  3D3M A;  2FUL A;  2WXK A;  4YDO A;  5D66 A;  4GYY A;  4AIF A;  2R03 A;  3FWV A;  4OAU C;  5KJL A;  2RFM A;  1HS6 A;  4OVU A;  1MZC A;  4L7T A;  4A3V A;  2LSU A;  3ZKJ A;  4D10 C;  2EIJ E;  3FUL A;  4A3T A;  3L08 A;  3ML9 A;  4Q94 A;  3B7B A;  4GTP A;  3HVE B;  3EU5 A;  5FQ6 A;  3AG3 E;  3QDN A;  3ZYK A;  3B13 A;  3LY9 A;  4FA6 A;  4ACL A;  4A63 B;  3AAA C;  1OCO E;  4AXH A;  2VTB B;  5EDS A;  2VSX E;  4K03 A;  3J5P A;  4BSZ B;  3D9K A;  5CER B;  3VTY A;  3ZFW A;  1JPL A;  3MJW A;  2AW6 A;  4JD2 G;  3DPY A;  3AU4 A;  4NAC A;  3HVE A;  3CST A;  3DEP A;  4APF A;  3RK6 A;  5KJN A;  1HXI A;  3DXM G;  2UWJ G;  5JJT A;  2V5Q C;  1E8W A;  2V8S E;  5KNG A;  3AG2 E;  4DX5 D;  4L2Y A;  3E4B A;  4BT9 A;  4UUC A;  4E85 A;  3AJI A;  1D8E A;  2FBN A;  3FUK A;  2XQ0 A;  3CKC A;  4I1M A;  3UM0 A;  3TWT A;  4J0U A;  4DLQ A;  2A5U A;  2LSV A;  2IO2 C;  4I1O B;  3AS8 A;  2AXZ A;  2QC9 A;  3I5P A;  4I17 A;  5JJ6 A;  1SW6 A;  4U8Y D;  4N3C A;  5AAO A;  4PS3 A;  1N0R A;  2QFC A;  3FTS A;  2DCP A;  3JXJ A;  4C48 B;  4V3I A;  1Z6T A;  2IU1 A;  3T9K A;  2P9K G;  1N54 A;  3UXG A;  5CCM A;  3CR3 A;  4HFG A;  1OWM A;  1IQU A;  2IY0 C;  1JCR A;  5EKQ D;  1LF8 A;  1U3C A;  1PC2 A;  4AM9 A;  3IXE A;  3V2O A;  5ARG A;  5AJL A;  3D9L A;  4WAF A;  3CV0 A;  1E90 A;  5G55 A;  2FF4 A;  1BD8 A;  2CG2 A;  4B8C B;  2Q7F A;  4MKT A;  4TUM A;  2R5S A;  5KCM A;  4BTB A;  2KBX A;  2AXV A;  2CFU A;  4O1O A;  4HOS A;  3RJV A;  3HYM B;  4C0E A;  3U64 A;  3CHR A;  5ENN A;  1JUQ A;  3U9W A;  3NZU A;  4HRL A;  4Q96 A;  1DNP A;  3TWR A;  2V5F A;  3L9T A;  4GA1 A;  3ZNG A;  2A4Z A;  1A5E A;  4F7A A;  3AS4 A;  3FEX A;  4ILI A;  1ZBP A;  3BUA A;  3CIA A;  3T8M A;  4CDM A;  4XIF A;  4I2W A;  5T8I A;  2I1J A;  3FP3 A;  3RO3 A;  3RRU A;  2HR2 A;  3ASG A;  3IHY A;  4G8K A;  4MS6 A;  1UN8 A;  3DBS A;  3QWV A;  3SBT B;  1WY6 A;  3KS2 A;  1LD8 A;  4U04 A;  4A55 A;  1TNY A;  3IKO B;  2KAT A;  4B89 A;  3JQ0 A;  3LXU X;  2DVW A;  3CQC B;  2DYR E;  2NC9 A;  3FUN A;  3NB2 A;  3ONK A;  4BTA A;  3ZYQ A;  3PE3 A;  4PS7 A;  2OCC E;  3ZUV B;  5BXU A;  2Y4U A;  2OV8 A;  1ZU2 A;  2PM7 A;  2XEV A;  4KVM A;  2VGY A;  2NSZ A;  4FAD A;  4JPS A;  2YQ8 A;  3D9I A;  4DPR A;  3ABM E;  1MQS A;  4OVV A;  1TNO A;  3FTY A;  1HFA A;  3LEW A;  4UWG A;  4RSY A;  3LY7 A;  4LNU D;  5LFA A;  1NP7 A;  3CGH A;  4LG6 A;  5CMW A;  3CHO A;  4JW1 A;  5AAR A;  5CEC B;  2FI7 A;  4FJZ A;  2RG8 A;  4KMO A;  5HKP A;  1N94 A;  1UJJ A;  2F0Y A;  3S7B A;  3DSS A;  3Q78 A;  2JEK A;  4U0U A;  2ZU6 B;  3I3N A;  2KCK A;  3HDX A;  1FVH A;  2BTD A;  3MCX A;  2H6F A;  2ZGD A;  2YHE A;  2DWZ A;  3LDZ A;  3FH5 A;  3K9I A;  3UTM A;  4JA7 A;  5CED B;  3ZGQ A;  5HQ8 A;  2J8S D;  1N0Q A;  3G2V A;  4UWL A;  3FU3 A;  1H19 A;  3G2S A;  3D9J A;  3G2U A;  4CZ2 D;  1HE8 A;  5BW8 C;  2C2L A;  1JCS A;  4XKC A;  4DLO A;  5FT9 A;  3DWL G;  3MKQ A;  3UQ3 A;  1SA4 A;  2PNN A;  1TN8 A;  3QC1 A;  1MHQ A;  1IQR A;  1UOH A;  3FTX A;  4LNB A;  3TWQ A;  3C72 A;  2HE0 A;  3BG0 B;  3IHV A;  5AEN A;  4EZL A;  1YYH A;  4CT4 A;  2I1K A;  2VGE A;  5BXO A;  3GW4 A;  3HG0 D;  1OXJ A;  5IY5 E;  5AIJ A;  2WQ7 A;  2P2C P;  1G3N B;  5ARF A;  4O1P A;  1K8K G;  4GZ3 A;  5KJK A;  1HG5 A;  2VGX B;  3LPZ A;  3CVL A;  2IFU A;  4MLP A;  4YVQ C;  2KXP C;  1O1R A;  3HXD A;  3V79 K;  1DCQ A;  3FU6 A;  3TWS A;  5J90 A;  1E96 B;  3FY4 A;  4M3O A;  5FIO A;  2P9S G;  4ME2 A;  3UM3 A;  3MGB A;  1N95 A;  4UWH A;  2HM8 A;  1DCE A;  3EJN A;  5FQ7 A;  2J4D A;  3ABL E;  3U66 A;  5BUZ A;  2C0M A;  5LOZ A;  4F53 A;  1RW2 A;  4PUC A;  2MOW A;  3B95 A;  1MYO A;  3S7J A;  4U8H A;  2XEH A;  5AYW D;  4AV7 A;  3D9P A;  3B7S A;  5ANL A;  5HI7 A;  3UT8 A;  1WM5 A;  4HXI A;  2WXL A;  3FU0 A;  2IO3 C;  5EYP F;  4GTT A;  5H7P A;  1QNF A;  2GW1 A;  2GRO B;  2VYI A;  4I1A A;  3E33 A;  3R7R A;  3CVX A;  4J7W A;  2GRL A;  4EZJ A;  4RG9 A;  4KZ0 A;  2WPV A;  2EIN E;  2V4L A;  4OYS A;  3SO8 A;  5G05 J;  5A6C A;  3UT7 A;  5B1A E;  2ILR A;  4W9R A;  3QWW A;  1OCR E;  2DBA A;  3MKR A;  2XRZ A;  3P1U A;  5BV0 A;  3FUE A;  3F6Q A;  4CDR A;  4KZC A;  2GRP B;  3BQO A;  4EQF A;  5D0Q D;  3AG4 E;  2FO7 A;  2WXO A;  4ATZ D;  4WWO A;  3GZS A;  5ENS D;  2R2L A;  3N71 A;  3NOC D;  3Q4A B;  3PZ4 A;  3C98 A;  4CEM A;  3OXF A;  4DI4 A;  3VLD A;  4GZD A;  2L6B A;  2JLB A;  2J09 A;  5ENP D;  4UQX A;  4Y6W A;  4LER A;  4GTV A;  4NQ0 A;  3MV2 B;  3KSQ A;  5FZS A;  4GZ5 A;  1HZ4 A;  4ANW A;  3CVV A;  3RSE G;  3QK0 A;  1HX8 A;  4RLY A;  1HU3 A;  3LCA A;  2I9C A;  5D0O D;  2AWI A;  2EIM E;  2QYU A;  1JWF A;  3C3O A;  3GZ2 A;  4BX9 A;  2I6H A;  3HXF A;  5EYL A;  5ENT D;  3DRA A;  3EU9 A;  4CDN A;  3QOU A;  3CKB A;  2MRI A;  5JHA A;  1OY3 D;  3G2T A;  2GRN B;  3E32 A;  2ZIS A;  1D9S A;  3UUX A;  5BT1 A;  2AXU A;  1HH8 A;  1NFI E;  2Y69 E;  2XEE A;  3G2W A;  2E2E A;  4FLH A;  3SQV A;  4L9P A;  3FUF A;  2FEZ A;  3C3R A;  4WUY A;  2XS8 A;  5BPP A;  1QBQ A;  4J8Y A; 
#chains in the Genus database with same CATH homology
 1OWO A;  2A4Z A;  3Q49 B;  4CCA A;  3ESK A;  4F7A A;  3CLJ A;  1YA0 A;  4UWF A;  3OTN A;  4HLE A;  4JXT A;  3AS4 A;  4PH4 B;  4JZY A;  3FEX A;  4ILI A;  4I6E A;  4I6J A;  3SGH A;  2WXM A;  3CVU A;  1ZBP A;  2EQX A;  3FEY A;  2J08 A;  3RIB A;  3CIA A;  3CVY A;  3CSF A;  1SZ9 A;  5FTP A;  2IJG X;  3T8M A;  4CDM A;  5LCW J;  4UQY A;  3HHM A;  4NRH B;  4XIF A;  1QZ2 A;  3LS8 A;  1NA0 A;  4I2W A;  5T8I A;  2IQC A;  5G04 J;  4HOR A;  1E8Z A;  2I1J A;  3FP3 A;  3O48 A;  4WWN A;  4AEZ C;  1XGW A;  4P29 A;  4GYO A;  3SF4 A;  3RO3 A;  2KZT A;  3P2B A;  4UI9 J;  3RRU A;  4C0M A;  5LP0 A;  2HR2 A;  1NZN A;  2YHC A;  3ASG A;  3CVN A;  4EZK A;  3IHY A;  2AVP A;  4GML A;  2PQR A;  3EHM A;  4I2Z A;  2WXI A;  1Y8M A;  3ZHE A;  3LVQ E;  1UN8 A;  2CHX A;  3L6A A;  4MS6 A;  5LX8 A;  3SBS A;  3SD5 A;  4ILH B;  3DBS A;  3QWV A;  3B7T A;  4DJA A;  1OWN A;  3SBT B;  5C1D A;  1WY6 A;  2OVB A;  2VSY A;  3NF1 A;  3KS2 A;  4U04 A;  4G2V A;  4GZ6 A;  4WNE A;  3I4G A;  4A55 A;  1KT1 A;  2L9B A;  4J8S A;  3IKO B;  4APO A;  2X6H A;  3PDN A;  4UI9 K;  3D9O A;  1TEZ A;  3OAW A;  2KAT A;  1H2T C;  4GYW A;  3S2A A;  4B89 A;  3D9N A;  5T3R A;  1OWL A;  5KJM A;  3JQ0 A;  3LXU X;  1H2V C;  2XGO A;  2X6F A;  3ZXS A;  3IV0 A;  3MYV A;  4FLB A;  3CQC B;  5BV1 A;  4FHJ A;  2J07 A;  4HOQ A;  2XPY A;  4IYP A;  1E8X A;  2NC9 A;  3FUN A;  3ONK A;  4BTA A;  3S7D A;  5EX3 A;  4JL0 A;  2Y3A A;  3QKY A;  3ZYQ A;  4ABN A;  2XGM A;  3PE3 A;  4Q69 A;  4PS7 A;  4BWR A;  3JQ1 A;  5C2Y A;  4JHJ A;  3ZN3 A;  2Y4U A;  1SZA A;  2OV8 A;  4R7L A;  4XI9 A;  1ZU2 A;  3PNT B;  2XPI A;  4BSX A;  3L22 A;  2PM7 A;  3PNL B;  4O6F A;  2XEV A;  4KVM A;  4TV3 A;  2VGY A;  3S7F A;  1U3D A;  1UW4 B;  1JWG A;  2XPZ A;  4YND A;  2NSZ A;  4N2Q A;  4FAD A;  4JPS A;  4PS8 A;  4IUL A;  2YQ8 A;  1E7U A;  4L2L A;  4ILG A;  3RU0 A;  4DK5 A;  2C0L A;  3SI5 A;  3FUJ A;  3RKV A;  3D9I A;  4DPR A;  5EX0 A;  4PDX A;  3APF A;  1MQS A;  3D9M A;  2VSO E;  5E75 A;  4OVV A;  4B0Z A;  1HO8 A;  1XNF A;  2WXR A;  2WM9 A;  4DI3 A;  3FTY A;  1HFA A;  3LEW A;  4FUL A;  4WND A;  2CFZ A;  1B89 A;  4RSY A;  4UWG A;  5FWQ A;  3LKU A;  3LY7 A;  3PRE A;  5LFA A;  2VGX A;  1NP7 A;  3CGH A;  1OUV A;  2J49 A;  3FUH A;  3ML8 A;  3ZYM A;  5CMW A;  4GA2 A;  1GW6 A;  4XI0 A;  1OWP A;  3UMV A;  4A1S A;  4EBA G;  3CHO A;  4JW1 A;  5JHB A;  2L0I A;  4U07 A;  4WNF A;  3ZYL A;  4JEH A;  5J08 A;  3RRN B;  2XCB A;  4JEU A;  2YIN A;  2CHW A;  3FTU A;  2KCV A;  2FI7 A;  1E8Y A;  2RG8 A;  4FJZ A;  4GZC A;  4KMO A;  5FZQ A;  1INZ A;  4AJW A;  2PM6 A;  3CHM A;  3RRM B;  5LCW C;  1DVP A;  1UJJ A;  4FC8 A;  1N52 A;  3S7B A;  5A7D B;  5G04 C;  2J9Q A;  4KYO B;  2UY1 A;  5T4Y A;  2JEK A;  4U0U A;  2ZU6 B;  3I3N A;  4WWP A;  2KCK A;  4UI9 C;  2WXN A;  3HDX A;  3QJZ A;  2PZI A;  3JCK C;  3UT4 A;  1FVH A;  3MX3 A;  1EDU A;  2BTD A;  5CCL A;  3MCX A;  3CK8 A;  3PZD A;  3ENE A;  3SNX A;  3GZ1 A;  3SFZ A;  4RG6 A;  1Z3X A;  2YHE A;  4J8D A;  4ANU A;  1Y6I A;  3LDZ A;  3FH5 A;  1PY1 A;  4Y6C A;  4ACK A;  3K9I A;  4XX5 A;  4JA7 A;  2WB2 A;  3ZGQ A;  5HQ8 A;  2Y4T A;  3CHS A;  3FUM A;  3QB2 A;  3IEG A;  3G2V A;  1VDY A;  3SHF A;  2ION A;  4UWL A;  2WXH A;  2RD0 A;  4I6G A;  2CG3 A;  3FU3 A;  1H19 A;  2GGF A;  2XRY A;  3D9J A;  2WXP A;  3G2S A;  3G2U A;  4L1B A;  5CHE E;  3EIJ A;  3ULQ A;  2WXF A;  4I43 A;  4J8F A;  4KVO A;  1HE8 A;  3FH7 A;  5BW8 C;  2C2L A;  4U63 A;  4GAA A;  4MRU A;  3ZIM A;  4XKC A;  2X6J A;  4ANX A;  3B7U X;  4DLO A;  3CVQ A;  4N3A A;  2VTB A;  1UG3 A;  3ASH A;  4CRW A;  5FJY A;  5FT9 A;  3CHP A;  1A17 A;  4CGV A;  4LEU A;  3DPD A;  5FZR A;  3MKQ A;  1SQM A;  3EIQ C;  1Z3Y A;  1UN9 A;  3UQ3 A;  4GA0 A;  3FFL A;  4G23 A;  4GB9 A;  3QC1 A;  4L23 A;  4QFV A;  2PL2 A;  1MHQ A;  1IQR A;  3FTX A;  4F3V A;  2IOS A;  3L17 A;  3BG0 B;  5AEN A;  3IHV A;  1EPU A;  4EZL A;  3I4R B;  4EPZ A;  5CMY A;  2BUG A;  4B94 A;  3FTZ A;  4FHK A;  3SZ7 A;  3ASF A;  5M72 A;  4CT4 A;  2I1K A;  2YNQ A;  4N5C A;  3HIZ A;  2X38 A;  3CEQ A;  4HVB A;  2XGS A;  4H7X A;  2NXP A;  3GW4 A;  2WQ6 A;  2LAI A;  1TJC A;  4AVX A;  3L13 A;  3TG5 A;  4GU5 A;  4F1S A;  2LAH A;  3CK9 A;  5AIJ A;  3GYZ A;  2WQ7 A;  2XHE A;  2M63 A;  3ESL A;  5ARF A;  3FH8 A;  4GZ3 A;  4HS2 A;  3VLF A;  5KJK A;  2X3M A;  2VQ2 A;  1HG5 A;  3MV3 B;  4FP7 A;  3PVL A;  2VGX B;  2L6J A;  3LPZ A;  3NZS A;  3D3M A;  2FUL A;  2WXK A;  3CQG B;  1PAQ A;  3CVL A;  2IFU A;  4MLP A;  3PUJ A;  4GYY A;  4AIF A;  2VSN A;  4YVQ C;  4CGW A;  3JYS A;  3FU6 A;  5J90 A;  1E96 B;  3FY4 A;  3FWV A;  3MZL B;  3QWP A;  4M3O A;  5KJL A;  3VTX A;  4XZ4 A;  2GRM A;  1HS6 A;  4ME2 A;  4N39 A;  4BFR A;  4OVU A;  3PUK A;  1H2U A;  4AY5 A;  4L7T A;  3MGB A;  3FUD A;  4A3V A;  4UWH A;  2LSU A;  2UY1 B;  2HM8 A;  5E76 A;  2HYZ A;  1H0A A;  3EJN A;  3VLE A;  3TL5 A;  4D10 C;  5FQ7 A;  3Q47 B;  3TXM A;  3FTW A;  1ELR A;  2J4D A;  2XCC A;  3U66 A;  2PQN A;  3FUL A;  3Q15 A;  2WVI A;  5BUZ A;  2WXG A;  4A3T A;  4WNG A;  2C0M A;  3L08 A;  1ELW A;  1HF8 A;  5AJD A;  3ML9 A;  2KM4 A;  1KT0 A;  4Q94 A;  1KLX A;  5LOZ A;  4F53 A;  1BPO A;  4GCO A;  3HVE B;  4PUC A;  2MOW A;  3BEE A;  3Q5M A;  4C9B B;  5FQ6 A;  5BNW A;  3QDN A;  3EDT B;  3S7J A;  5DIZ A;  4XE0 A;  2MHK A;  4U8H A;  5AYW D;  3ZYK A;  3AS5 A;  3B13 A;  3LY9 A;  4ACL A;  3D9P A;  3B7S A;  4AV7 A;  4FA6 A;  1S0P A;  5ANL A;  4AXH A;  5HI7 A;  4XKB A;  3UT8 A;  1WM5 A;  4HXI A;  4N3B A;  2VTB B;  2OVF A;  2WXL A;  2WXJ A;  2VSX E;  3FU0 A;  3FU5 A;  5EDS A;  3UPV A;  4K03 A;  3MKQ B;  1QNF A;  5A23 A;  2GW1 A;  4KXK B;  5JJ7 A;  3QAR A;  2VYI A;  4I1A A;  2LNI A;  4JA9 A;  3D9K A;  3MEK A;  3FUI A;  3R7R A;  4H7Y A;  1X5B A;  4G1T A;  2X6I A;  3VTY A;  3ZFW A;  1JPL A;  3MJW A;  3CVX A;  4ANV A;  4IN3 B;  2AW6 A;  2GRL A;  2L0T B;  4EZJ A;  4RG9 A;  3AU4 A;  4JHK A;  4NAC A;  3HVE A;  4KZ0 A;  4LRZ A;  3LVR E;  3CK7 A;  3L16 A;  4AP2 A;  3CST A;  1HG2 A;  2WPV A;  3QAQ A;  1HXI A;  1IHG A;  4TUU A;  3RK6 A;  5ANR A;  3ZPJ A;  4APF A;  2UWJ G;  5KJN A;  5JJT A;  4G11 A;  1E8W A;  3KD7 A;  2BF0 X;  3FTV A;  3TGO A;  2V4L A;  2V8S E;  4OYS A;  4I9C A;  5G05 J;  4L2Y A;  2CHZ A;  3E4B A;  5A6C A;  4BT9 A;  3O4Z A;  4E85 A;  4YVO A;  3R7Q A;  3UT7 A;  2I2O A;  3CVP A;  2ILR A;  3WXX A;  4W9R A;  3QWW A;  4URK A;  2HO1 A;  2WXQ A;  4TRQ A;  5FQ8 A;  4IRU A;  2DBA A;  3MKR A;  4KT6 B;  2FBN A;  2XRZ A;  4HOT A;  3FUK A;  3P1U A;  2R59 A;  5BV0 A;  4BX8 A;  1WAO 1;  3FUE A;  3LJ3 A;  2XQ0 A;  3LY8 A;  2WQH A;  1EYH A;  4KBQ A;  3L54 A;  2IOL A;  3CKC A;  4CDR A;  4KZC A;  3T5V A;  4I1M A;  5FQ4 A;  4U0S A;  4UWK A;  4FU3 A;  4J0U A;  4EQF A;  4DLQ A;  4BY6 A;  2WMO A;  2A5U A;  2LSV A;  4JC8 A;  5D0Q D;  2OND A;  4I1O B;  3PH0 C;  4LCT A;  3AS8 A;  4RVB A;  2AXZ A;  1L5J A;  2FO7 A;  1EF1 C;  3I5P A;  4I17 A;  5JJ6 A;  2E0I A;  2WXO A;  3PE4 A;  4G25 A;  4HOU A;  3ZRH A;  2QY7 A;  3LYA A;  4N3C A;  4WWO A;  2KCL A;  3GZS A;  4PS3 A;  3FHE A;  3R9A B;  2QFC A;  3FTS A;  3N71 A;  2DCP A;  3Q4A B;  3AU5 A;  1E7V A;  3BG1 B;  3C98 A;  2KC7 A;  3TJP A;  4CEM A;  3OXF A;  3CHQ A;  4V3I A;  4DI4 A;  3VLD A;  1Z6T A;  3OXG A;  4GZD A;  2JLB A;  2X6K A;  3RO2 A;  2J09 A;  2IU1 A;  1N54 A;  2OOE A;  4UQX A;  3URZ A;  3CVW A;  3ZW3 A;  4Y6W A;  3ZVV A;  3FDH A;  4LER A;  4K0R A;  4A1G A;  5CCM A;  3CR3 A;  4HFG A;  4NQ0 A;  1OWM A;  1IQU A;  3B7R L;  3MV2 B;  5FZS A;  3APC A;  4ATG A;  4GZ5 A;  3ZEF A;  4B8A A;  4U0Z A;  5EKQ D;  4EBA A;  3PEV B;  1HZ4 A;  3OXL A;  4GPK A;  4ANW A;  3CVV A;  3KEZ A;  4N2S A;  3QK0 A;  1TJF A;  1LF8 A;  1U3C A;  1HX8 A;  3EHN A;  1PC2 A;  4LUN U;  4AM9 A;  1HU3 A;  3LCA A;  1W3B A;  3TXN A;  1FVF A;  5ARG A;  1UJK A;  5AJL A;  3KAE A;  2I9C A;  5D0O D;  2J4B A;  4JVS A;  4E6H A;  1H6K A;  1FCH A;  3D9L A;  2AWI A;  4GMJ A;  4WAF A;  3CV0 A;  3TAX A;  4CT0 A;  1E90 A;  5G55 A;  3MA5 A;  2FF4 A;  4AY6 A;  2CG2 A;  3APD A;  4B8C B;  1JWF A;  2Q7F A;  4G26 A;  3UX4 A;  2DIW A;  4MKT A;  1IYG A;  3GZ2 A;  3ASD A;  4BX9 A;  2R5S A;  2I6H A;  5KCM A;  4NUR A;  4BTB A;  2LO6 A;  4I9E A;  2AXV A;  2CFU A;  3ONL A;  5G05 C;  2P58 C;  3PRZ A;  4GCN A;  4HOS A;  3RJV A;  3HYM B;  1P5Q A;  1NA3 A;  3NQP A;  4C0E A;  3U64 A;  3QOU A;  4CDN A;  3CKB A;  1ELK A;  3CHR A;  3U4T A;  2MRI A;  3PS6 A;  5G2N A;  4AOF A;  5JHA A;  3G2T A;  5ENN A;  1QQE A;  2V0P A;  4BT8 A;  2R17 C;  4G24 A;  5DBK A;  3UUX A;  5BT1 A;  3T5X A;  1JUQ A;  2AXU A;  3TG4 A;  3U9W A;  1HH8 A;  4FJY A;  3NZU A;  4Q96 A;  3IBE A;  1DNP A;  2V5F A;  3PEU B;  3QNK A;  2VJ8 A;  3G2W A;  2E2E A;  2KZT B;  4FLH A;  3U3W A;  4J8E A;  4JHR A;  4GA1 A;  3JUI A;  2IF4 A;  4J6I A;  3FUF A;  4UQZ A;  2FEZ A;  3ZHE B;  4EEC A;  4WUY A;  2WMN A;  5BPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...