2R5SA

The crystal structure of a domain of protein vp0806 (unknown function) from vibrio parahaemolyticus rimd 2210633
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
171
structure length
171
Chain Sequence
DEQLLKQVSELLQQGEHAQALNVIQTLSDELQSRGDVKLAKADCLLETKQFELAQELLATIPLEYQDNSYKSLIAKLELHQQAAESPELKRLEQELAANPDNFELACELAVQYNQVGRDEEALELLWNILKVNLGAQDGEVKKTFMDILSALGQGNAIASKYRRQLYSILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein VP0806
publication title The crystal structure of a domain of protein VP0806 (unknown function) from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Structural genomics, unknown function
total genus 69
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
A PF14561 TPR_20 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2r5sA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2r5sA01
2VGXA 3UUXA 5CHEE 3URZA 1YA0A 3ZGQA 4G2VA 3LPZA 4J0UA 4JA7A 4GA1A 4U0SA 5LCWC 4A1SA 4BWRA 3RO3A 3R9AB 1KT0A 1B89A 3U3WA 4UQYA 3QWPA 1ZU2A 3RKVA 4AY5A 3AS5A 2FI7A 3TG4A 2I6HA 5G05C 5LCWJ 2YHCA 3CV0A 4UQZA 5CCLA 4N39A 4WNGA 4NRHB 4AM9A 1ELWA 4J8EA 4N5CA 3ZN3A 4H7YA 2Y4TA 4BT8A 5A6CA 4WNFA 3RIBA 5JJ7A 5BT1A 2VGYA 4HOTA 3OXLA 4HORA 4N3AA 2AVPA 5FZRA 4GCNA 1E96B 3Q5MA 3IEGA 4I1AA 3FP3A 2HYZA 3TG5A 1HXIA 2E2EA 3S7DA 4UI9K 3SF4A 3RJVA 3MV2B 5EX3A 4H7XA 1QZ2A 2BUGA 5BW8C 1NA0A 3N71A 2C0LA 4GCOA 4G23A 4N2QA 1HH8A 4GZ5A 4JHRA 3CKCA 4GZ6A 3ULQA 2HR2A 4CGWA 4I9EA 3GW4A 4Y6WA 4J8FA 3FWVA 3Q49B 3EDTB 4BT9A 5M72A 3S7JA 4G1TA 4EQFA 5D0QD 2KATA 3OXFA 3NF1A 5FZQA 5EKQD 3S7FA 2VYIA 4WNDA 3QOUA 4G24A 1P5QA 5HQ8A 3CVNA 5JJ6A 3GZ2A 2WPVA 4GA0A 3ZHEB 2VQ2A 3CK9A 1WM5A 4HOUA 4HOSA 3UQ3A 2XPIA 4GYYA 2R5SA 2PL2A 2XCBA 1NZNA 1HZ4A 4W9RA 3WXXA 1QQEA 4WUYA 4AIFA 4U0ZA 4B94A 3ASDA 1KT1A 5DIZA 2MHKA 2XGSA 4BTBA 3Q4AB 3S7BA 4APOA 3QDNA 4BTAA 5JJTA 2KCVA 4UI9C 3LY8A 4NQ0A 1PC2A 2XCCA 4I2ZA 4YNDA 3OXGA 4GA2A 1KLXA 4Y6CA 2IF4A 5ARFA 2XGMA 2DBAA 5C1DA 1ZBPA 3PE4A 2J9QA 3LKUA 5BNWA 3TGOA 5AYWD 3LYAA 5CCMA 3CVQA 1ELRA 2KCKA 2UY1B 2JLBA 4UI9J 1OUVA 4RG6A 3O48A 3CK8A 3LY7A 4YVQC 4KBQA 2YQ8A 2Q7FA 3ASHA 5FTPA 4U07A 1WAO1 3ZHEA 5D0OD 4I17A 2KCLA 5FT9A 4HOQA 2LSVA 3Q15A 4XI0A 3ZFWA 1A17A 2VSNA 2V5FA 5G04J 4O6FA 3ESKA 4ME2A 4JA9A 2PQNA 4AY6A 4KXKB 2XEVA 2VSYA 1XNFA 4F3VA 5KJLA 1IYGA 4U0UA 5DBKA 1FCHA 4N3BA 3GYZA 5FJYA 3JYSA 2C0MA 4JL0A 3MEKA 2P58C 3U4TA 2UWJG 2HO1A 2NC9A 3KS2A 5ARGA 5HI7A 2VGXB 3RO2A 4G26A 4I2WA 5A7DB 3LY9A 4U04A 3GZ1A 5KJNA 4GPKA 4YVOA 4WNEA 4GYWA 3CVLA 4N2SA 3MKRA 2PZIA 2UY1A 3CEQA 3RU0A 3QWVA 2PQRA 2Y4UA 2ONDA 3K9IA 3QKYA 4ABNA 4XI9A 3MA5A 3CK7A 4GZ3A 3E4BA 2WQHA 2IFUA 3LCAA 3KD7A 3KAEA 5G05J 2C2LA 2LNIA 4CDRA 3FFLA 2QFCA 3UPVA 1Y8MA 4CGVA 3ASGA 3ZPJA 1NA3A 3AS8A 3CVPA 4IN3B 5FZSA 2FBNA 3AS4A 3SZ7A 2FO7A 3PDNA 3VTXA 4RG9A 3PE3A 3Q47B 3ASFA 4GYOA 4XIFA 1TJCA 4N3CA 2XGOA 5G04C 4UQXA 2LSUA 1IHGA 2L6JA 4I9CA 5EX0A 3QWWA 4G25A 3TAXA 4J8DA 3BEEA 3VTYA 2FF4A 3HYMB 4LEUA 1W3BA 2OOEA 3MV3B 2KC7A 5KJKA 3CKBA 4KYOB 5KJMA 2FEZA 2GW1A
chains in the Genus database with same CATH superfamily
1H0AA 2VGXA 4RVBA 3UUXA 1UW4B 3ZGQA 3T8MA 2CFUA 3LPZA 4J0UA 3ZIMA 4LNGA 2AXVA 4GA1A 3LJ3A 4GTQA 3SD5A 2EIME 3FTWA 4BWRA 3CLJA 3G2UA 4AV7A 1S70B 4Z68A 1B89A 3ULYA 2Y69E 5EYLA 2PM7A 2FI7A 3AG4E 3WG7E 3PZ2A 4LG6A 1LD7A 1Z3XA 5G05C 4NURA 2YHCA 5ENOD 1JUQA 2V0PA 3CV0A 4G8LA 2WQ6A 3OTNA 3PVLA 5KNGA 4DK5A 4NRHB 5D66A 3PZ4A 4U7EB 1ELWA 2YNQA 3CIAA 4PS8A 3GZSA 3ZN3A 1H2VC 5T4YA 4IRUA 3CSFA 4URKA 2IOLA 2LXLA 2A4ZA 2WMNA 4UWLA 4GMJA 2ETCA 2ZGGA 3Q7FA 5BT1A 4CRWA 4JEUA 4N3AA 2AVPA 2DCPA 1V55E 1E96B 3ZXPA 3G2WA 4I1AA 4TUMA 1TNOA 3PRZA 2BF0X 3I4RB 2IJGX 3SFYA 4IYPA 3FTVA 4TXPA 3SF4A 4H7XA 4ZFHA 2J8SD 1H6OA 2J09A 3Q78A 3J5QB 1MX6A 3PREA 1UOHA 3ULQA 4FADA 4P29A 2HR2A 5AJDA 4M7CA 5AQAA 3Q49B 2P9SG 4HLEA 2ILRA 2YHEA 3LVRE 4I6JA 2WVIA 2P9PG 3IHYA 1H2UA 3QOUA 4CDNA 2J4DA 1P5QA 2IU1A 5HQ8A 1N95A 2OEWA 1WM5A 3SI5A 3KSQA 3UQ3A 3RRUA 3ABKE 3QB2A 4YDYA 4J8YA 4I6GA 2PL2A 2XCBA 3WXXA 1QYMA 1AP7A 3CHOA 2B6CA 2P2CP 4GZCA 4WUYA 4AIFA 3DEPA 1U3CA 1EYHA 1FT1A 2ZU6B 3IKOB 4O1PA 5CEDB 2NYJA 2LO6A 3FU0A 3Q4AB 3L54A 3CQCB 4K0RA 1Z3YA 4J8SA 3QDNA 3FH5A 4BTAA 4GB9A 2KCVA 2WXPA 2L0IA 5CMWA 5ENPD 1MQSA 4Y6CA 2XGMA 2DBAA 1UG3A 5AYWD 4JVSA 3OAWA 3EHNA 4HLLA 1D8EA 3IHVA 4NIKA 5CCMA 2MYOA 4FP7A 1UJKA 5JA4D 1ELRA 5ENTD 1OT8A 2UY1B 1DCQA 3JXJA 1TEZA 4UI9J 1TJFA 4EZJA 1OUVA 2Q7FA 3ASHA 4HNAD 4HRNA 5A23A 3D9HA 1UJJA 2R17C 1E90A 2F37A 3FUNA 4TUUA 2I9CA 1OWNA 3ENEA 4I17A 2KCLA 5FT9A 4HOQA 4JB8P 1S63A 3C72A 3G2TA 5IY5E 4L7TA 5LOZA 3U64A 1A17A 2VSNA 2V5FA 5G04J 4FA6A 2J49A 2L6BA 2GRNB 4KXKB 2VSYA 2NXPA 1E8ZA 4EBAA 3PNTB 3CHMA 5DBKA 1OCOE 2X6JA 4ATGA 2C0MA 4JL0A 4BSXA 1LF8A 1SZ9A 1WDYA 3MEKA 5AQ9A 4B8CB 4GPMA 3KS2A 5ARGA 4R7LA 3EIJA 2QY7A 4U04A 2EIKE 3TWUA 3GZ1A 3ZW3A 3D9IA 3EU9A 4HI9A 3HVEB 1IQRA 1K1BA 3FUJA 3VLEA 3L17A 2RD0A 1BPOA 3MKRA 2DYRE 1H6KA 4DPRA 5AN8A 5EIDA 1D9SA 2UY1A 3CEQA 3NZUA 3QWVA 3B7TA 1RZ4A 4JXTA 5CRUA 2CHZA 2WXJA 1H2TC 3DSVA 3E30A 2QFCA 5CEAA 3C5RA 3ZPJA 1NA3A 4CT0A 1DCEA 5D2MC 4A63B 3SQVA 3AS4A 3SZ7A 3UMVA 1SW6A 3CHSA 1A5EA 2FULA 4B93B 3VTXA 1EF1C 3ASFA 1TJCA 2XGOA 3FU5A 3ONKA 5G04C 1SZAA 3JUIA 3V31A 4JD2G 3R9MA 4GTRA 3TAXA 4EHMA 4LEUA 3ZUVB 4M3OA 3SNXA 3BG0B 5ANRA 3L08A 1FVFA 1PAQA 4K03A 5KJKA 3F6QA 3UM3A 1BU9A 1O1TA 4G11A 3ML9A 5EDSA 4AP2A 2GW1A 3L16A 3B7BA 2CG2A 5CHEE 3AG2E 2GGFA 1L5JA 3Q7AA 3CVXA 2M63A 5AJLA 3HXDA 3HVEA 5LCWC 5CBNA 4TRQA 4I1MA 3R9AB 4ANXA 3E33A 3EHQA 2LAIA 3ZYQA 1HFAA 4UQYA 1ZU2A 3AS5A 1MZCA 1D8DA 1S64A 3TG4A 4HFGA 3ZRHA 5HKPA 1N4RA 4ILGA 1K3ZD 4JPSA 2WXRA 3DXKG 3BU8A 4O1OA 1HF8A 4LRZA 4N39A 3W9GA 2XPZA 4PS3A 3HXCA 1X81A 2VJ8A 2Y0BG 4J8EA 4N5CA 2VGEA 3NB2A 2PNNA 2VSOE 3MGBA 5A6CA 4D10C 4F53A 4F7AA 3RIBA 2LUHA 5JJ7A 3CVVA 3OXLA 3TXMA 2R2LA 3L6AA 3HDXA 4GCNA 3D9NA 4A3TA 3FP3A 5KNHD 4GTOA 3TG5A 1E8XA 2E2EA 3UT4A 4CEMA 3S7DA 4F1PA 2BUGA 3IV0A 1NA0A 3N71A 4C48B 2RFMA 2JEKA 3SBSA 3R7RA 3U66A 4RSYA 1DNPA 3DPYA 4I9EA 2GRPB 1K8KG 1Y6IA 3GW4A 4Y6WA 4J8FA 3FWVA 3EDTB 4YDEA 4BT9A 3S7JA 4G1TA 3DEOA 2KATA 4OVUA 2F8YA 3OXFA 3E32A 1V54E 3SBTB 3EIQC 1N4QA 4XKBA 5BXOA 3PEVB 4CYMD 1GW6A 1OCRE 4UWGA 2VQ2A 3ZHEB 4JC8A 4WAFA 3DSTA 3FUHA 3L9TA 3D9LA 2R02A 2XRZA 1N9AA 4TXQA 4GTVA 3ZNGA 3ASOE 3JQ1A 3Q73A 2R03A 4MRUA 3FY4A 3D9MA 5DIZA 1LD8A 2LAHA 2F0YA 4RQIA 3DRAA 5FQ4A 3FUDA 3ASNE 3JQ0A 2LXMA 4ANUA 4EZKA 3E34A 2ZISA 3UKUG 2V4LA 4PH4B 3T9KA 4I2ZA 3PS6A 4YNDA 5HS0A 4GA2A 2IF4A 3LKUA 1Q2ZA 3CVQA 1OY3D 4FHJA 2KCKA 3CR3A 1IHBA 4PS7A 1TNYA 3UM0A 4Q69A 3O48A 3D3MA 3CK8A 3TWTA 4YVQC 4KBQA 3FTUA 2YQ8A 3FUKA 3CVWA 1KPSB 3ZKJA 3FEYA 3ZHEA 4U8VD 4JEHA 2LSVA 1MHQA 2X6KA 4XI0A 3ZFWA 5LP0A 3HRAA 5J08A 4KVOA 4APFA 4DX1A 3ESKA 4JA9A 4I43A 2PQNA 4AY6A 4F3VA 4BY6A 4U0UA 3W9FA 4BETA 3VLDA 4GTMA 3JYSA 3EHRA 1TR4A 3UINC 3EU5A 4BFRA 3V2XA 3EJNA 3RSEG 3NQPA 4I2WA 4ANWA 4BEPA 3PZDA 3EHMA 3DPDA 1HG5A 3FTZA 2MOWA 5G55A 2B0OE 2KZTB 2H6GA 4WNEA 3IBEA 2IONA 3CVLA 1VDYA 5B1AE 2VSXE 5B1BE 2Y4UA 3QKYA 4ABNA 3U9WA 2CHWA 1NP7A 1JPLA 3TWVA 3DSSA 3BQOA 4WWOA 1BD8A 3UT7A 2WQHA 3LCAA 3KD7A 3Q9NC 2OVBA 4PUCA 3KAEA 3FFLA 3UPVA 3B7RL 4L2YA 3ASGA 4AEZC 5T3RA 4X8QA 3CVPA 3FHEA 2XENA 3VLFA 3UX4A 2KBXA 2OV8A 4GYOA 3DWLG 1N94A 2VTBB 1FVHA 4UQXA 2LSUA 1TNZA 2X38A 3TWRA 4I9CA 5EX0A 4JZYA 2H6FA 3P1UA 4GMRA 3VTYA 2FF4A 3DSUA 1UN9A 2WXHA 2I1KA 2BKKB 1W3BA 4ANVA 5AENA 3MV3B 5KJMA 2FEZA 2WB2A 5FQ6A 4ILHB 5ENSD 1EDUA 3UT8A 3CSTA 2IQCA 2X6FA 1YA0A 5T8IA 3FU3A 4AOFA 1HX8A 3Q75A 4G2VA 3QK0A 4JA7A 3DSWA 4U0SA 2KZTA 5E75A 4ILIA 1AWCB 2X3MA 3RO3A 3UM2A 4B89A 1DC2A 5G2NA 3QWPA 3RKVA 5JHBA 4A55A 2PM6A 1LTXA 3AU4A 3FTYA 1N0QA 4HRLA 4J6IA 5LCWJ 5FIOA 4YDOA 2GROB 3ABLE 3AG3E 2DZNA 4FU3A 2JABA 4UQZA 4E6HA 3P2BA 5CCLA 3T8KA 2WXNA 4WNGA 4Q94A 5ENRD 4XZ4A 3FU6A 2Y3AA 2VTBA 3FULA 4U96D 4WNFA 4BESA 3HG0D 2WQ7A 1IQUA 3NOCD 4UWKA 4LSZE 2L9BA 1HG2A 4L2LA 3Q5MA 2I1JA 1N4PA 2XPYA 1HXIA 2HM8A 4MBGA 4FLBA 1E7UA 3RJVA 5EX3A 5BW8C 3NBNB 4DLOA 5CERB 5JHAA 3JUEA 4G23A 4DRXE 1ZB1A 1HH8A 1JWGA 4FJZA 4GZ5A 4UUCA 3UM1A 4AVXA 5BPPA 4AXHA 1YYHA 4B8AA 5BV1A 5KWDA 3CHPA 4CGWA 2CFZA 4K5BA 1SA5A 3QC1A 4C9BB 4EBAG 5M72A 2I2OA 4F1SA 1HS6A 3PZ3A 3JXIA 4EQFA 1JCRA 5D0QD 2KXPC 2EIJE 2DZOA 3UI2A 4F6RD 4A3VA 5EKQD 5FINA 2VYIA 4WNDA 2ETAA 4G24A 4B0ZA 2MRIA 3CVNA 3AJIA 2J4BA 4KVMA 4GA0A 3CK9A 3CHRA 2V8SE 4HOUA 2WXOA 3HIZA 3PUKA 2P9IG 2ZIRA 2XPIA 4GYYA 2R5SA 1HZ4A 1NZNA 4W9RA 1QQEA 1TYQG 2EQXA 4U0ZA 4XEIG 4FHKA 3ESLA 3ASDA 4V3IA 3X2QE 1JCQA 4ACLA 2XGSA 4BTBA 2BTDA 4U63A 3S7BA 2QC9A 2XS1A 3PEUB 3D9KA 3CHQA 2WXFA 2XCCA 3OXGA 3HXFA 1NL4A 5ARFA 5AQ7A 5C1DA 3PE4A 3TWQA 5FQ7A 4BX9A 3TGOA 1E8YA 4OYSA 3KEZA 4TXRA 1Z6TA 4HB5A 1TN7A 4FLHA 3MCXA 2HE0A 2JLBA 3LS8A 4QQIA 2J07A 4YDWA 3BG1B 3MJWA 1SA4A 4J7WA 3IXEA 3ZYKA 2IO3C 2V5QC 2WM9A 2QYUA 5FTPA 4GMLA 4FULA 5FQ8A 2XZDG 3HXEA 3I4GA 4U07A 5JMND 3T5XA 2IOSA 2RFAA 4BX8A 5D0OD 2DWZA 3V79K 2RG8A 4I6EA 4DX2A 3TJPA 1FPPA 4HRMB 4FJYA 1U2VG 4O6FA 1U3DA 3MX3A 4GTSA 3TL5A 4DI3A 3ZVVA 2XEVA 4K5AB 3FTSA 1XNFA 4OAVB 2WXKA 4BERA 1FCHA 3GYZA 1QBQA 4JW1A 4DJAA 5FJYA 3G2VA 3PNLB 3MKQB 3L82A 3U4TA 3G2SA 2NC9A 3UIOC 4XE0A 3RO2A 1N0RA 5ENQD 3LEWA 3FTXA 3PH0C 1JWFA 3UKRG 3KSLA 4CDMA 4GYWA 1MX4A 2DYSE 4N2SA 2WXIA 3D9JA 3RU0A 3NOGD 2ONDA 4GTTA 1N4SA 1YMPA 4GAAA 3E4BA 3FH8A 3DBSA 3FUMA 1WG0A 2C2LA 4CDRA 4O60A 5EIBE 3AAAC 3ML8A 4L23A 3C3OA 2E0IA 1H6PA 1DVPA 5FZSA 1FT2A 4IULA 2FO1E 2FBNA 2YINA 2FO7A 2P9KG 3PDNA 4EZLA 3PE3A 3Q47B 4LNBA 2P9UG 2EILE 2P9LG 2OVFA 3SFXA 4K5CA 4GZDA 2CG3A 2L6JA 4ZHBA 3LXUX 3L13A 4G25A 3BEEA 3CGHA 3HYMB 5E76A 2A5UA 4U8HA 2R05A 2OOEA 5CMYA 2P9NG 3SO8A 3MKQA 4GU5A 1X5BA 3J5PA 2KM4A 4HS2A 1OWPA 1O1SA 2XHEA 4FC8A 4JHKA 5AIJA 2BEDA 4CCAA 3FUFA 2NSZA 3URZA 3RRMB 2X6HA 5J90A 1ELKA 4EECA 1PY1A 3Q9UC 4A1SA 4HBDA 4UWFA 2BKGA 1O1RA 2IY0C 4UWHA 1KT0A 3U3WA 3QAQA 5ANLA 2L0TB 3V30A 4AY5A 3BUAA 4TV3A 3E37A 3JCKC 2R59A 4CZ2D 2DIWA 4NACA 3AG1E 2I6HA 4OAUC 1EPUA 5EN5D 4OVVA 5ENNA 5HRYA 3MZLB 3D9OA 1O5MA 4U95D 2WMOA 1NI1A 4AM9A 4HQDA 4ACKA 2AXZA 2AWIA 4QFVA 4G8KA 4MS6A 3UTMA 3APFA 1BI7B 4H7YA 1K1AA 2ETBA 3QARA 5KBAA 2Y4TA 3ONLA 1XGWA 4BT8A 3FUIA 5BV0A 4KZCA 5B3SE 2VGYA 4HOTA 4HORA 1E7VA 5FZRA 1YCSB 4XX5A 1WY6A 3IEGA 4LUNU 1SQMA 2HYZA 3ISMC 3UXGA 2XEHA 2X6IA 3CQGB 4AJWA 4UI9K 3SY2A 3MV2B 1QZ2A 4EPZA 4HXIA 2C0LA 4GCOA 2GRQB 4N2QA 3D9PA 2CHXA 4JHRA 3CKCA 4GZ6A 3RAUA 1NFIE 1OWMA 4KMOA 3AU5A 3I5PA 2XQ0A 3HHMA 3O4ZA 4XKCA 3RK6A 4L1BA 3NF1A 5FZQA 3TXNA 3ABME 3S7FA 3ZU7B 3MYVA 4CT4A 4DI4A 4I1OB 2OCCE 5JJ6A 3I3NA 4LCTA 3GZ2A 3C3QA 3SGHA 2H6IA 2WPVA 3UIPC 1N52A 1HU3A 5AAOA 4HOSA 2V4HC 5H7PA 3ZYMA 3ZYLA 4B94A 4MKTA 2ZXWE 3V2OA 1KT1A 2GRRB 2MHKA 4C0EA 3LDZA 2XZTG 2WXMA 4U8YD 4APOA 3ZXSA 4E85A 3QNKA 1H19A 2XS8A 5CRVA 3CVYA 5JJTA 1OCZE 1IKND 4UI9C 2DVWA 3LY8A 1PC2A 1MJ0A 3APDA 4NQ0A 2WXQA 3NAWA 3QJZA 4Q96A 1TN8A 1KLXA 3TWWA 2XRYA 2WXLA 1ZBPA 2J9QA 1N54A 1INZA 5BNWA 3FH7A 2AW6A 3LYAA 2EINE 4MLPA 3NZSA 1OWLA 5LX8A 4RG6A 1G3NB 3LY7A 4LNUD 2RKKA 1E8WA 1BLXB 4RLYA 3RRNB 2H6HA 2GRLA 4L9PA 1MX2A 1TNBA 3B7SA 1RW2A 3B7UX 1WAO1 1MYOA 2F8XK 2J08A 3B13A 4DUIA 2QYJA 3Q15A 3TWSA 1Z5SC 4DLQA 4WWPA 5CBOA 3Q79A 4ME2A 1HO8A 5EILA 1TNUA 3LJNA 5KJLA 1IYGA 3APCA 4N3BA 4DX5D 1OXJA 4GTPA 4A1GA 3FDHA 5AARA 4DX7D 2AJAA 4KT6B 3C3RA 2P58C 4N5QA 2UWJG 3PZ1A 1KZOA 2HO1A 1IXVA 1JCSA 5HI7A 2VGXB 4G26A 3DSXA 5A7DB 3LY9A 3KEAA 2QZAA 4LERA 5EYPF 5KJNA 5BXUA 4GPKA 4YVOA 1KZPA 3T5VA 2IEJA 1UN8A 2PZIA 2WXGA 3R7QA 2PQRA 3K9IA 1TN6A 3EUVA 3LVQE 1QNFA 4XI9A 3MA5A 3L22A 3B95A 2XEEA 3CK7A 5LFAA 3FEXA 4GZ3A 2IFUA 3SFZA 5FWQA 2Y1LE 3CVUA 2OEVA 4C0MA 5G05J 2LNIA 4PDXA 5KCMA 1HE8A 1Y8MA 5CECB 4CGVA 1N11A 3AS8A 2A5EA 1BI8B 4IN3B 4JHJA 2AXUA 3DXMG 4HI8A 2ZGDA 1OCCE 4WWNA 4RG9A 1OWOA 3ULEG 1S0PA 4XIFA 4N3CA 5ITZF 4ATZD 3PUJA 3C98A 1IHGA 3TWXA 3SHFA 5C2YA 3HXBA 3QWWA 4J8DA 5AQBA 2GRMA 4KZ0A 4HVBA 4DX6D 2IO2C 2KC7A 3ZEFA 1SVXA 3CKBA 4KYOB 4BSZB 5BUZA 3FUEA 3S2AA
chains in the Genus database with same CATH topology
1H0AA 5AIJA 3L16A 2VGXA 3UT8A 2CG2A 4CCAA 3CSTA 3FUFA 2IQCA 2X6FA 2NSZA 4RVBA 5CHEE 3URZA 1YA0A 5T8IA 3RRMB 3UUXA 1UW4B 3FU3A 1HX8A 3ZGQA 2GGFA 4AOFA 1L5JA 4G2VA 3T8MA 2CFUA 3LPZA 4J0UA 3QK0A 3ZIMA 3CVXA 4JA7A 2X6HA 2AXVA 4GA1A 4U0SA 5J90A 2M63A 1ELKA 3LJ3A 5AJLA 3SD5A 3HVEA 2KZTA 1PY1A 4ILIA 5E75A 4EECA 5LCWC 4A1SA 3FTWA 4UWFA 4TRQA 4BWRA 2X3MA 4I1MA 3RO3A 3CLJA 3G2UA 4AV7A 3R9AB 4ANXA 2LAIA 1KT0A 1B89A 1HFAA 4UWHA 3ZYQA 5G2NA 4UQYA 3QWPA 4B89A 3U3WA 1ZU2A 3QAQA 5ANLA 3RKVA 2L0TB 5JHBA 4A55A 4AY5A 2PM7A 3AS5A 4TV3A 2PM6A 2FI7A 3TG4A 4HFGA 3ZRHA 3JCKC 2R59A 3AU4A 3FTYA 2DIWA 4ILGA 4NACA 1Z3XA 4J6IA 2I6HA 5G05C 4JPSA 5LCWJ 2WXRA 4NURA 2YHCA 1JUQA 2V0PA 1EPUA 3CV0A 5ENNA 4OVVA 4FU3A 4UQZA 3MZLB 3D9OA 4E6HA 3P2BA 1HF8A 5CCLA 2WQ6A 4LRZA 4N39A 3OTNA 3PVLA 2XPZA 2WXNA 4WNGA 4Q94A 4PS3A 4DK5A 4NRHB 2WMOA 4AM9A 4ACKA 4XZ4A 2VJ8A 1ELWA 2AXZA 2AWIA 2YNQA 3CIAA 3FU6A 2Y3AA 4PS8A 3GZSA 4QFVA 4MS6A 4J8EA 4N5CA 3APFA 3ZN3A 1H2VC 4H7YA 5T4YA 4IRUA 2VTBA 3CSFA 4URKA 2IOLA 3QARA 2Y4TA 3FULA 2VSOE 3MGBA 3ONLA 1XGWA 4BT8A 5A6CA 2A4ZA 2WMNA 4WNFA 4UWLA 3FUIA 4GMJA 4D10C 4F53A 4F7AA 5BV0A 3RIBA 5JJ7A 5BT1A 4KZCA 1IQUA 2WQ7A 4CRWA 2VGYA 3CVVA 3OXLA 4HOTA 4JEUA 3TXMA 4UWKA 3L6AA 4HORA 2L9BA 1E7VA 3HDXA 4N3AA 2AVPA 5FZRA 4XX5A 1HG2A 4GCNA 1WY6A 2DCPA 3D9NA 4L2LA 1E96B 3Q5MA 2I1JA 3IEGA 3G2WA 4I1AA 4LUNU 2XPYA 4A3TA 3FP3A 1SQMA 2HYZA 3PRZA 2BF0X 3TG5A 1HXIA 3I4RB 1E8XA 2E2EA 2IJGX 3UT4A 4CEMA 2X6IA 3FTVA 4IYPA 2HM8A 3S7DA 4FLBA 1E7UA 3CQGB 4UI9K 3RJVA 3MV2B 5EX3A 3SF4A 1QZ2A 4H7XA 4AJWA 2BUGA 3IV0A 4EPZA 5BW8C 1NA0A 3N71A 4HXIA 2C0LA 2J09A 4DLOA 5JHAA 2JEKA 4GCOA 4G23A 3SBSA 4N2QA 3D9PA 3R7RA 1HH8A 1JWGA 2CHXA 3PREA 4FJZA 4GZ5A 4JHRA 3CKCA 3U66A 4AVXA 5BPPA 4GZ6A 3ULQA 4AXHA 4FADA 4P29A 2HR2A 5AJDA 4B8AA 4RSYA 1DNPA 3CHPA 5BV1A 1OWMA 4CGWA 4I9EA 1Y6IA 3GW4A 4Y6WA 2CFZA 4J8FA 3FWVA 3Q49B 3QC1A 4KMOA 3AU5A 4C9BB 3EDTB 3I5PA 2XQ0A 3HHMA 4EBAG 4BT9A 5M72A 3S7JA 4G1TA 2I2OA 4F1SA 1HS6A 3O4ZA 4XKCA 4HLEA 2ILRA 3RK6A 2YHEA 4EQFA 5D0QD 3LVRE 4I6JA 4L1BA 2KATA 4OVUA 2WVIA 3NF1A 3OXFA 5FZQA 3TXNA 4A3VA 5EKQD 3S7FA 2VYIA 4WNDA 3EIQC 3IHYA 3SBTB 3MYVA 1H2UA 3QOUA 4XKBA 4CT4A 4G24A 4CDNA 2J4DA 1P5QA 2IU1A 4B0ZA 2MRIA 5HQ8A 4DI4A 3CVNA 4I1OB 3PEVB 5JJ6A 3I3NA 4LCTA 3GZ2A 2J4BA 3SGHA 1GW6A 2WPVA 4KVMA 4GA0A 4UWGA 3ZHEB 2VQ2A 3CK9A 3CHRA 1WM5A 2V8SE 4HOUA 1N52A 2WXOA 3SI5A 4JC8A 3HIZA 1HU3A 4WAFA 3PUKA 3FUHA 4HOSA 3UQ3A 3RRUA 3QB2A 2XPIA 4GYYA 2R5SA 4I6GA 2PL2A 2XCBA 1HZ4A 1NZNA 4W9RA 3WXXA 3D9LA 2XRZA 3CHOA 3ZYMA 1QQEA 4GZCA 3ZYLA 4WUYA 4AIFA 2EQXA 1U3CA 1EYHA 4U0ZA 4B94A 3JQ1A 2ZU6B 4MRUA 3FY4A 4MKTA 4FHKA 3ESLA 3IKOB 3ASDA 4V3IA 3D9MA 1KT1A 5DIZA 4ACLA 2MHKA 2XGSA 2LAHA 4C0EA 2LO6A 3FU0A 3LDZA 4BTBA 2WXMA 2BTDA 3Q4AB 4U63A 4JHKA 3L54A 3S7BA 5FQ4A 4APOA 3CQCB 3FUDA 4K0RA 3ZXSA 4E85A 3JQ0A 1Z3YA 3QNKA 4J8SA 1H19A 3PEUB 4ANUA 3QDNA 4EZKA 3FH5A 4BTAA 3CVYA 2V4LA 3D9KA 5JJTA 4GB9A 3CHQA 2KCVA 2WXPA 4UI9C 3LY8A 4NQ0A 1PC2A 3APDA 4PH4B 2WXFA 2XCCA 4I2ZA 2WXQA 3PS6A 3S2AA 2L0IA 3QJZA 4YNDA 3OXGA 4GA2A 4Q96A 1KLXA 5CMWA 1MQSA 2IF4A 4Y6CA 5ARFA 2XRYA 2XGMA 2DBAA 2WXLA 5C1DA 1ZBPA 1UG3A 3PE4A 2J9QA 1N54A 3LKUA 1INZA 5BNWA 5FQ7A 4BX9A 3TGOA 5AYWD 1E8YA 4OYSA 4JVSA 3OAWA 3EHNA 3KEZA 3FH7A 1Z6TA 2AW6A 3IHVA 3LYAA 5CCMA 3CVQA 4FP7A 1UJKA 1ELRA 4MLPA 4FHJA 2KCKA 4FLHA 3NZSA 2UY1B 3CR3A 1OWLA 3MCXA 1TEZA 2JLBA 4UI9J 3LS8A 1TJFA 5LX8A 4EZJA 1OUVA 2J07A 4RG6A 4PS7A 4Q69A 3O48A 3D3MA 3CK8A 3BG1B 3MJWA 3LY7A 1E8WA 4KBQA 3FTUA 4YVQC 2YQ8A 2Q7FA 3ZYKA 3ASHA 3RRNB 3FUKA 5A23A 3CVWA 2GRLA 1UJJA 2R17C 2WM9A 1E90A 4TUUA 3FUNA 5FTPA 4GMLA 3B7SA 4FULA 2I9CA 3I4GA 1OWNA 3B7UX 4U07A 1WAO1 3ENEA 3T5XA 3FEYA 2IOSA 3ZHEA 4BX8A 5D0OD 4I17A 2KCLA 4JEHA 2J08A 2RG8A 3B13A 4HOQA 4I6EA 5FT9A 2LSVA 3TJPA 3Q15A 1MHQA 2X6KA 3G2TA 4XI0A 4L7TA 5LOZA 3ZFWA 5LP0A 3U64A 1A17A 4FJYA 5J08A 2VSNA 4DLQA 4WWPA 4KVOA 2V5FA 5G04J 4O6FA 4APFA 4FA6A 3ESKA 1U3DA 2J49A 3MX3A 4ME2A 4JA9A 1HO8A 4I43A 3TL5A 2PQNA 4AY6A 4DI3A 3ZVVA 4KXKB 2XEVA 2VSYA 3FTSA 2NXPA 1XNFA 1E8ZA 4BY6A 4F3VA 4EBAA 5KJLA 1IYGA 2WXKA 3PNTB 3CHMA 3APCA 4U0UA 5DBKA 1FCHA 4N3BA 2X6JA 3VLDA 3GYZA 4JW1A 4A1GA 3FDHA 4DJAA 5FJYA 4ATGA 3G2VA 3JYSA 4KT6B 2C0MA 4JL0A 4BSXA 1LF8A 3PNLB 1SZ9A 3MKQB 4BFRA 3MEKA 2P58C 3U4TA 4B8CB 3EJNA 2UWJG 3G2SA 2HO1A 2NC9A 3KS2A 5ARGA 5HI7A 2VGXB 3NQPA 4R7LA 4XE0A 4G26A 4I2WA 3RO2A 3EIJA 4ANWA 2QY7A 5A7DB 3LY9A 4U04A 3PZDA 3LEWA 3EHMA 3GZ1A 3ZW3A 3FTXA 4LERA 3D9IA 3DPDA 3PH0C 1JWFA 5KJNA 1HG5A 3FTZA 2MOWA 5G55A 4GPKA 4YVOA 4CDMA 3HVEB 2KZTB 1IQRA 4WNEA 3FUJA 3IBEA 4GYWA 3T5VA 3VLEA 2IONA 3CVLA 1VDYA 2RD0A 3L17A 1BPOA 1UN8A 2WXIA 4N2SA 2VSXE 3MKRA 1H6KA 3D9JA 4DPRA 2PZIA 2UY1A 3CEQA 3RU0A 3NZUA 3QWVA 2WXGA 3B7TA 3R7QA 2PQRA 2Y4UA 2ONDA 3K9IA 3QKYA 4ABNA 3U9WA 3LVQE 1QNFA 4JXTA 2CHWA 3MA5A 4XI9A 1NP7A 1JPLA 3L22A 3CK7A 5LFAA 3FEXA 4GAAA 4GZ3A 3E4BA 2WQHA 2IFUA 3LCAA 4WWOA 3KD7A 3UT7A 2CHZA 3SFZA 5FWQA 2WXJA 3FH8A 2OVBA 1H2TC 3DBSA 3FUMA 3CVUA 4PUCA 4C0MA 3KAEA 5G05J 2C2LA 2LNIA 4CDRA 3FFLA 4PDXA 2QFCA 5KCMA 1HE8A 3ML8A 3UPVA 1Y8MA 3B7RL 4L2YA 4L23A 4CGVA 3ASGA 3ZPJA 1NA3A 4AEZC 4CT0A 5T3RA 2E0IA 3AS8A 3CVPA 1DVPA 4IN3B 3FHEA 4JHJA 5FZSA 2AXUA 4IULA 2FBNA 3AS4A 3SZ7A 3UMVA 2YINA 2FO7A 3CHSA 2FULA 3PDNA 3VLFA 4WWNA 3UX4A 3VTXA 1EF1C 4RG9A 4EZLA 1OWOA 3PE3A 2OV8A 1S0PA 3ASFA 3Q47B 4GYOA 4XIFA 2VTBB 1TJCA 4N3CA 2OVFA 2XGOA 3FU5A 3ONKA 5G04C 1FVHA 3C98A 3PUJA 4UQXA 4GZDA 2LSUA 1IHGA 1SZAA 2CG3A 2L6JA 3JUIA 2X38A 4I9CA 3LXUX 5EX0A 5C2YA 4JZYA 3SHFA 3QWWA 3L13A 4G25A 3TAXA 3P1UA 4J8DA 3BEEA 3VTYA 3CGHA 2FF4A 3HYMB 1UN9A 2A5UA 4LEUA 4U8HA 5E76A 2WXHA 2I1KA 4M3OA 1W3BA 3SNXA 4ANVA 2OOEA 5CMYA 3BG0B 5AENA 5ANRA 2GRMA 3L08A 1FVFA 1PAQA 4KZ0A 4HVBA 3MV3B 4K03A 2KC7A 3ZEFA 5KJKA 3CKBA 4KYOB 5KJMA 2FEZA 3MKQA 4G11A 4GU5A 1X5BA 3ML9A 2KM4A 4HS2A 1OWPA 4AP2A 5EDSA 5BUZA 2WB2A 2XHEA 2GW1A 5FQ6A 4ILHB 4FC8A 1EDUA 3FUEA 5FQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGX A;  3UUX A;  5CHE E;  3URZ A;  1YA0 A;  3ZGQ A;  4G2V A;  3LPZ A;  4J0U A;  4JA7 A;  4GA1 A;  4U0S A;  5LCW C;  4A1S A;  4BWR A;  3RO3 A;  3R9A B;  1KT0 A;  1B89 A;  3U3W A;  4UQY A;  3QWP A;  1ZU2 A;  3RKV A;  4AY5 A;  3AS5 A;  2FI7 A;  3TG4 A;  2I6H A;  5G05 C;  5LCW J;  2YHC A;  3CV0 A;  4UQZ A;  5CCL A;  4N39 A;  4WNG A;  4NRH B;  4AM9 A;  1ELW A;  4J8E A;  4N5C A;  3ZN3 A;  4H7Y A;  2Y4T A;  4BT8 A;  5A6C A;  4WNF A;  3RIB A;  5JJ7 A;  5BT1 A;  2VGY A;  4HOT A;  3OXL A;  4HOR A;  4N3A A;  2AVP A;  5FZR A;  4GCN A;  1E96 B;  3Q5M A;  3IEG A;  4I1A A;  3FP3 A;  2HYZ A;  3TG5 A;  1HXI A;  2E2E A;  3S7D A;  4UI9 K;  3SF4 A;  3RJV A;  3MV2 B;  5EX3 A;  4H7X A;  1QZ2 A;  2BUG A;  5BW8 C;  1NA0 A;  3N71 A;  2C0L A;  4GCO A;  4G23 A;  4N2Q A;  1HH8 A;  4GZ5 A;  4JHR A;  3CKC A;  4GZ6 A;  3ULQ A;  2HR2 A;  4CGW A;  4I9E A;  3GW4 A;  4Y6W A;  4J8F A;  3FWV A;  3Q49 B;  3EDT B;  4BT9 A;  5M72 A;  3S7J A;  4G1T A;  4EQF A;  5D0Q D;  2KAT A;  3OXF A;  3NF1 A;  5FZQ A;  5EKQ D;  3S7F A;  2VYI A;  4WND A;  3QOU A;  4G24 A;  1P5Q A;  5HQ8 A;  3CVN A;  5JJ6 A;  3GZ2 A;  2WPV A;  4GA0 A;  3ZHE B;  2VQ2 A;  3CK9 A;  1WM5 A;  4HOU A;  4HOS A;  3UQ3 A;  2XPI A;  4GYY A;  2R5S A;  2PL2 A;  2XCB A;  1NZN A;  1HZ4 A;  4W9R A;  3WXX A;  1QQE A;  4WUY A;  4AIF A;  4U0Z A;  4B94 A;  3ASD A;  1KT1 A;  5DIZ A;  2MHK A;  2XGS A;  4BTB A;  3Q4A B;  3S7B A;  4APO A;  3QDN A;  4BTA A;  5JJT A;  2KCV A;  4UI9 C;  3LY8 A;  4NQ0 A;  1PC2 A;  2XCC A;  4I2Z A;  4YND A;  3OXG A;  4GA2 A;  1KLX A;  4Y6C A;  2IF4 A;  5ARF A;  2XGM A;  2DBA A;  5C1D A;  1ZBP A;  3PE4 A;  2J9Q A;  3LKU A;  5BNW A;  3TGO A;  5AYW D;  3LYA A;  5CCM A;  3CVQ A;  1ELR A;  2KCK A;  2UY1 B;  2JLB A;  4UI9 J;  1OUV A;  4RG6 A;  3O48 A;  3CK8 A;  3LY7 A;  4YVQ C;  4KBQ A;  2YQ8 A;  2Q7F A;  3ASH A;  5FTP A;  4U07 A;  1WAO 1;  3ZHE A;  5D0O D;  4I17 A;  2KCL A;  5FT9 A;  4HOQ A;  2LSV A;  3Q15 A;  4XI0 A;  3ZFW A;  1A17 A;  2VSN A;  2V5F A;  5G04 J;  4O6F A;  3ESK A;  4ME2 A;  4JA9 A;  2PQN A;  4AY6 A;  4KXK B;  2XEV A;  2VSY A;  1XNF A;  4F3V A;  5KJL A;  1IYG A;  4U0U A;  5DBK A;  1FCH A;  4N3B A;  3GYZ A;  5FJY A;  3JYS A;  2C0M A;  4JL0 A;  3MEK A;  2P58 C;  3U4T A;  2UWJ G;  2HO1 A;  2NC9 A;  3KS2 A;  5ARG A;  5HI7 A;  2VGX B;  3RO2 A;  4G26 A;  4I2W A;  5A7D B;  3LY9 A;  4U04 A;  3GZ1 A;  5KJN A;  4GPK A;  4YVO A;  4WNE A;  4GYW A;  3CVL A;  4N2S A;  3MKR A;  2PZI A;  2UY1 A;  3CEQ A;  3RU0 A;  3QWV A;  2PQR A;  2Y4U A;  2OND A;  3K9I A;  3QKY A;  4ABN A;  4XI9 A;  3MA5 A;  3CK7 A;  4GZ3 A;  3E4B A;  2WQH A;  2IFU A;  3LCA A;  3KD7 A;  3KAE A;  5G05 J;  2C2L A;  2LNI A;  4CDR A;  3FFL A;  2QFC A;  3UPV A;  1Y8M A;  4CGV A;  3ASG A;  3ZPJ A;  1NA3 A;  3AS8 A;  3CVP A;  4IN3 B;  5FZS A;  2FBN A;  3AS4 A;  3SZ7 A;  2FO7 A;  3PDN A;  3VTX A;  4RG9 A;  3PE3 A;  3Q47 B;  3ASF A;  4GYO A;  4XIF A;  1TJC A;  4N3C A;  2XGO A;  5G04 C;  4UQX A;  2LSU A;  1IHG A;  2L6J A;  4I9C A;  5EX0 A;  3QWW A;  4G25 A;  3TAX A;  4J8D A;  3BEE A;  3VTY A;  2FF4 A;  3HYM B;  4LEU A;  1W3B A;  2OOE A;  3MV3 B;  2KC7 A;  5KJK A;  3CKB A;  4KYO B;  5KJM A;  2FEZ A;  2GW1 A; 
#chains in the Genus database with same CATH topology
 1H0A A;  2VGX A;  4RVB A;  3UUX A;  1UW4 B;  3ZGQ A;  3T8M A;  2CFU A;  3LPZ A;  4J0U A;  3ZIM A;  4LNG A;  2AXV A;  4GA1 A;  3LJ3 A;  4GTQ A;  3SD5 A;  2EIM E;  3FTW A;  4BWR A;  3CLJ A;  3G2U A;  4AV7 A;  1S70 B;  4Z68 A;  1B89 A;  3ULY A;  2Y69 E;  5EYL A;  2PM7 A;  2FI7 A;  3AG4 E;  3WG7 E;  3PZ2 A;  4LG6 A;  1LD7 A;  1Z3X A;  5G05 C;  4NUR A;  2YHC A;  5ENO D;  1JUQ A;  2V0P A;  3CV0 A;  4G8L A;  2WQ6 A;  3OTN A;  3PVL A;  5KNG A;  4DK5 A;  4NRH B;  5D66 A;  3PZ4 A;  4U7E B;  1ELW A;  2YNQ A;  3CIA A;  4PS8 A;  3GZS A;  3ZN3 A;  1H2V C;  5T4Y A;  4IRU A;  3CSF A;  4URK A;  2IOL A;  2LXL A;  2A4Z A;  2WMN A;  4UWL A;  4GMJ A;  2ETC A;  2ZGG A;  3Q7F A;  5BT1 A;  4CRW A;  4JEU A;  4N3A A;  2AVP A;  2DCP A;  1V55 E;  1E96 B;  3ZXP A;  3G2W A;  4I1A A;  4TUM A;  1TNO A;  3PRZ A;  2BF0 X;  3I4R B;  2IJG X;  3SFY A;  4IYP A;  3FTV A;  4TXP A;  3SF4 A;  4H7X A;  4ZFH A;  2J8S D;  1H6O A;  2J09 A;  3Q78 A;  3J5Q B;  1MX6 A;  3PRE A;  1UOH A;  3ULQ A;  4FAD A;  4P29 A;  2HR2 A;  5AJD A;  4M7C A;  5AQA A;  3Q49 B;  2P9S G;  4HLE A;  2ILR A;  2YHE A;  3LVR E;  4I6J A;  2WVI A;  2P9P G;  3IHY A;  1H2U A;  3QOU A;  4CDN A;  2J4D A;  1P5Q A;  2IU1 A;  5HQ8 A;  1N95 A;  2OEW A;  1WM5 A;  3SI5 A;  3KSQ A;  3UQ3 A;  3RRU A;  3ABK E;  3QB2 A;  4YDY A;  4J8Y A;  4I6G A;  2PL2 A;  2XCB A;  3WXX A;  1QYM A;  1AP7 A;  3CHO A;  2B6C A;  2P2C P;  4GZC A;  4WUY A;  4AIF A;  3DEP A;  1U3C A;  1EYH A;  1FT1 A;  2ZU6 B;  3IKO B;  4O1P A;  5CED B;  2NYJ A;  2LO6 A;  3FU0 A;  3Q4A B;  3L54 A;  3CQC B;  4K0R A;  1Z3Y A;  4J8S A;  3QDN A;  3FH5 A;  4BTA A;  4GB9 A;  2KCV A;  2WXP A;  2L0I A;  5CMW A;  5ENP D;  1MQS A;  4Y6C A;  2XGM A;  2DBA A;  1UG3 A;  5AYW D;  4JVS A;  3OAW A;  3EHN A;  4HLL A;  1D8E A;  3IHV A;  4NIK A;  5CCM A;  2MYO A;  4FP7 A;  1UJK A;  5JA4 D;  1ELR A;  5ENT D;  1OT8 A;  2UY1 B;  1DCQ A;  3JXJ A;  1TEZ A;  4UI9 J;  1TJF A;  4EZJ A;  1OUV A;  2Q7F A;  3ASH A;  4HNA D;  4HRN A;  5A23 A;  3D9H A;  1UJJ A;  2R17 C;  1E90 A;  2F37 A;  3FUN A;  4TUU A;  2I9C A;  1OWN A;  3ENE A;  4I17 A;  2KCL A;  5FT9 A;  4HOQ A;  4JB8 P;  1S63 A;  3C72 A;  3G2T A;  5IY5 E;  4L7T A;  5LOZ A;  3U64 A;  1A17 A;  2VSN A;  2V5F A;  5G04 J;  4FA6 A;  2J49 A;  2L6B A;  2GRN B;  4KXK B;  2VSY A;  2NXP A;  1E8Z A;  4EBA A;  3PNT B;  3CHM A;  5DBK A;  1OCO E;  2X6J A;  4ATG A;  2C0M A;  4JL0 A;  4BSX A;  1LF8 A;  1SZ9 A;  1WDY A;  3MEK A;  5AQ9 A;  4B8C B;  4GPM A;  3KS2 A;  5ARG A;  4R7L A;  3EIJ A;  2QY7 A;  4U04 A;  2EIK E;  3TWU A;  3GZ1 A;  3ZW3 A;  3D9I A;  3EU9 A;  4HI9 A;  3HVE B;  1IQR A;  1K1B A;  3FUJ A;  3VLE A;  3L17 A;  2RD0 A;  1BPO A;  3MKR A;  2DYR E;  1H6K A;  4DPR A;  5AN8 A;  5EID A;  1D9S A;  2UY1 A;  3CEQ A;  3NZU A;  3QWV A;  3B7T A;  1RZ4 A;  4JXT A;  5CRU A;  2CHZ A;  2WXJ A;  1H2T C;  3DSV A;  3E30 A;  2QFC A;  5CEA A;  3C5R A;  3ZPJ A;  1NA3 A;  4CT0 A;  1DCE A;  5D2M C;  4A63 B;  3SQV A;  3AS4 A;  3SZ7 A;  3UMV A;  1SW6 A;  3CHS A;  1A5E A;  2FUL A;  4B93 B;  3VTX A;  1EF1 C;  3ASF A;  1TJC A;  2XGO A;  3FU5 A;  3ONK A;  5G04 C;  1SZA A;  3JUI A;  3V31 A;  4JD2 G;  3R9M A;  4GTR A;  3TAX A;  4EHM A;  4LEU A;  3ZUV B;  4M3O A;  3SNX A;  3BG0 B;  5ANR A;  3L08 A;  1FVF A;  1PAQ A;  4K03 A;  5KJK A;  3F6Q A;  3UM3 A;  1BU9 A;  1O1T A;  4G11 A;  3ML9 A;  5EDS A;  4AP2 A;  2GW1 A;  3L16 A;  3B7B A;  2CG2 A;  5CHE E;  3AG2 E;  2GGF A;  1L5J A;  3Q7A A;  3CVX A;  2M63 A;  5AJL A;  3HXD A;  3HVE A;  5LCW C;  5CBN A;  4TRQ A;  4I1M A;  3R9A B;  4ANX A;  3E33 A;  3EHQ A;  2LAI A;  3ZYQ A;  1HFA A;  4UQY A;  1ZU2 A;  3AS5 A;  1MZC A;  1D8D A;  1S64 A;  3TG4 A;  4HFG A;  3ZRH A;  5HKP A;  1N4R A;  4ILG A;  1K3Z D;  4JPS A;  2WXR A;  3DXK G;  3BU8 A;  4O1O A;  1HF8 A;  4LRZ A;  4N39 A;  3W9G A;  2XPZ A;  4PS3 A;  3HXC A;  1X81 A;  2VJ8 A;  2Y0B G;  4J8E A;  4N5C A;  2VGE A;  3NB2 A;  2PNN A;  2VSO E;  3MGB A;  5A6C A;  4D10 C;  4F53 A;  4F7A A;  3RIB A;  2LUH A;  5JJ7 A;  3CVV A;  3OXL A;  3TXM A;  2R2L A;  3L6A A;  3HDX A;  4GCN A;  3D9N A;  4A3T A;  3FP3 A;  5KNH D;  4GTO A;  3TG5 A;  1E8X A;  2E2E A;  3UT4 A;  4CEM A;  3S7D A;  4F1P A;  2BUG A;  3IV0 A;  1NA0 A;  3N71 A;  4C48 B;  2RFM A;  2JEK A;  3SBS A;  3R7R A;  3U66 A;  4RSY A;  1DNP A;  3DPY A;  4I9E A;  2GRP B;  1K8K G;  1Y6I A;  3GW4 A;  4Y6W A;  4J8F A;  3FWV A;  3EDT B;  4YDE A;  4BT9 A;  3S7J A;  4G1T A;  3DEO A;  2KAT A;  4OVU A;  2F8Y A;  3OXF A;  3E32 A;  1V54 E;  3SBT B;  3EIQ C;  1N4Q A;  4XKB A;  5BXO A;  3PEV B;  4CYM D;  1GW6 A;  1OCR E;  4UWG A;  2VQ2 A;  3ZHE B;  4JC8 A;  4WAF A;  3DST A;  3FUH A;  3L9T A;  3D9L A;  2R02 A;  2XRZ A;  1N9A A;  4TXQ A;  4GTV A;  3ZNG A;  3ASO E;  3JQ1 A;  3Q73 A;  2R03 A;  4MRU A;  3FY4 A;  3D9M A;  5DIZ A;  1LD8 A;  2LAH A;  2F0Y A;  4RQI A;  3DRA A;  5FQ4 A;  3FUD A;  3ASN E;  3JQ0 A;  2LXM A;  4ANU A;  4EZK A;  3E34 A;  2ZIS A;  3UKU G;  2V4L A;  4PH4 B;  3T9K A;  4I2Z A;  3PS6 A;  4YND A;  5HS0 A;  4GA2 A;  2IF4 A;  3LKU A;  1Q2Z A;  3CVQ A;  1OY3 D;  4FHJ A;  2KCK A;  3CR3 A;  1IHB A;  4PS7 A;  1TNY A;  3UM0 A;  4Q69 A;  3O48 A;  3D3M A;  3CK8 A;  3TWT A;  4YVQ C;  4KBQ A;  3FTU A;  2YQ8 A;  3FUK A;  3CVW A;  1KPS B;  3ZKJ A;  3FEY A;  3ZHE A;  4U8V D;  4JEH A;  2LSV A;  1MHQ A;  2X6K A;  4XI0 A;  3ZFW A;  5LP0 A;  3HRA A;  5J08 A;  4KVO A;  4APF A;  4DX1 A;  3ESK A;  4JA9 A;  4I43 A;  2PQN A;  4AY6 A;  4F3V A;  4BY6 A;  4U0U A;  3W9F A;  4BET A;  3VLD A;  4GTM A;  3JYS A;  3EHR A;  1TR4 A;  3UIN C;  3EU5 A;  4BFR A;  3V2X A;  3EJN A;  3RSE G;  3NQP A;  4I2W A;  4ANW A;  4BEP A;  3PZD A;  3EHM A;  3DPD A;  1HG5 A;  3FTZ A;  2MOW A;  5G55 A;  2B0O E;  2KZT B;  2H6G A;  4WNE A;  3IBE A;  2ION A;  3CVL A;  1VDY A;  5B1A E;  2VSX E;  5B1B E;  2Y4U A;  3QKY A;  4ABN A;  3U9W A;  2CHW A;  1NP7 A;  1JPL A;  3TWV A;  3DSS A;  3BQO A;  4WWO A;  1BD8 A;  3UT7 A;  2WQH A;  3LCA A;  3KD7 A;  3Q9N C;  2OVB A;  4PUC A;  3KAE A;  3FFL A;  3UPV A;  3B7R L;  4L2Y A;  3ASG A;  4AEZ C;  5T3R A;  4X8Q A;  3CVP A;  3FHE A;  2XEN A;  3VLF A;  3UX4 A;  2KBX A;  2OV8 A;  4GYO A;  3DWL G;  1N94 A;  2VTB B;  1FVH A;  4UQX A;  2LSU A;  1TNZ A;  2X38 A;  3TWR A;  4I9C A;  5EX0 A;  4JZY A;  2H6F A;  3P1U A;  4GMR A;  3VTY A;  2FF4 A;  3DSU A;  1UN9 A;  2WXH A;  2I1K A;  2BKK B;  1W3B A;  4ANV A;  5AEN A;  3MV3 B;  5KJM A;  2FEZ A;  2WB2 A;  5FQ6 A;  4ILH B;  5ENS D;  1EDU A;  3UT8 A;  3CST A;  2IQC A;  2X6F A;  1YA0 A;  5T8I A;  3FU3 A;  4AOF A;  1HX8 A;  3Q75 A;  4G2V A;  3QK0 A;  4JA7 A;  3DSW A;  4U0S A;  2KZT A;  5E75 A;  4ILI A;  1AWC B;  2X3M A;  3RO3 A;  3UM2 A;  4B89 A;  1DC2 A;  5G2N A;  3QWP A;  3RKV A;  5JHB A;  4A55 A;  2PM6 A;  1LTX A;  3AU4 A;  3FTY A;  1N0Q A;  4HRL A;  4J6I A;  5LCW J;  5FIO A;  4YDO A;  2GRO B;  3ABL E;  3AG3 E;  2DZN A;  4FU3 A;  2JAB A;  4UQZ A;  4E6H A;  3P2B A;  5CCL A;  3T8K A;  2WXN A;  4WNG A;  4Q94 A;  5ENR D;  4XZ4 A;  3FU6 A;  2Y3A A;  2VTB A;  3FUL A;  4U96 D;  4WNF A;  4BES A;  3HG0 D;  2WQ7 A;  1IQU A;  3NOC D;  4UWK A;  4LSZ E;  2L9B A;  1HG2 A;  4L2L A;  3Q5M A;  2I1J A;  1N4P A;  2XPY A;  1HXI A;  2HM8 A;  4MBG A;  4FLB A;  1E7U A;  3RJV A;  5EX3 A;  5BW8 C;  3NBN B;  4DLO A;  5CER B;  5JHA A;  3JUE A;  4G23 A;  4DRX E;  1ZB1 A;  1HH8 A;  1JWG A;  4FJZ A;  4GZ5 A;  4UUC A;  3UM1 A;  4AVX A;  5BPP A;  4AXH A;  1YYH A;  4B8A A;  5BV1 A;  5KWD A;  3CHP A;  4CGW A;  2CFZ A;  4K5B A;  1SA5 A;  3QC1 A;  4C9B B;  4EBA G;  5M72 A;  2I2O A;  4F1S A;  1HS6 A;  3PZ3 A;  3JXI A;  4EQF A;  1JCR A;  5D0Q D;  2KXP C;  2EIJ E;  2DZO A;  3UI2 A;  4F6R D;  4A3V A;  5EKQ D;  5FIN A;  2VYI A;  4WND A;  2ETA A;  4G24 A;  4B0Z A;  2MRI A;  3CVN A;  3AJI A;  2J4B A;  4KVM A;  4GA0 A;  3CK9 A;  3CHR A;  2V8S E;  4HOU A;  2WXO A;  3HIZ A;  3PUK A;  2P9I G;  2ZIR A;  2XPI A;  4GYY A;  2R5S A;  1HZ4 A;  1NZN A;  4W9R A;  1QQE A;  1TYQ G;  2EQX A;  4U0Z A;  4XEI G;  4FHK A;  3ESL A;  3ASD A;  4V3I A;  3X2Q E;  1JCQ A;  4ACL A;  2XGS A;  4BTB A;  2BTD A;  4U63 A;  3S7B A;  2QC9 A;  2XS1 A;  3PEU B;  3D9K A;  3CHQ A;  2WXF A;  2XCC A;  3OXG A;  3HXF A;  1NL4 A;  5ARF A;  5AQ7 A;  5C1D A;  3PE4 A;  3TWQ A;  5FQ7 A;  4BX9 A;  3TGO A;  1E8Y A;  4OYS A;  3KEZ A;  4TXR A;  1Z6T A;  4HB5 A;  1TN7 A;  4FLH A;  3MCX A;  2HE0 A;  2JLB A;  3LS8 A;  4QQI A;  2J07 A;  4YDW A;  3BG1 B;  3MJW A;  1SA4 A;  4J7W A;  3IXE A;  3ZYK A;  2IO3 C;  2V5Q C;  2WM9 A;  2QYU A;  5FTP A;  4GML A;  4FUL A;  5FQ8 A;  2XZD G;  3HXE A;  3I4G A;  4U07 A;  5JMN D;  3T5X A;  2IOS A;  2RFA A;  4BX8 A;  5D0O D;  2DWZ A;  3V79 K;  2RG8 A;  4I6E A;  4DX2 A;  3TJP A;  1FPP A;  4HRM B;  4FJY A;  1U2V G;  4O6F A;  1U3D A;  3MX3 A;  4GTS A;  3TL5 A;  4DI3 A;  3ZVV A;  2XEV A;  4K5A B;  3FTS A;  1XNF A;  4OAV B;  2WXK A;  4BER A;  1FCH A;  3GYZ A;  1QBQ A;  4JW1 A;  4DJA A;  5FJY A;  3G2V A;  3PNL B;  3MKQ B;  3L82 A;  3U4T A;  3G2S A;  2NC9 A;  3UIO C;  4XE0 A;  3RO2 A;  1N0R A;  5ENQ D;  3LEW A;  3FTX A;  3PH0 C;  1JWF A;  3UKR G;  3KSL A;  4CDM A;  4GYW A;  1MX4 A;  2DYS E;  4N2S A;  2WXI A;  3D9J A;  3RU0 A;  3NOG D;  2OND A;  4GTT A;  1N4S A;  1YMP A;  4GAA A;  3E4B A;  3FH8 A;  3DBS A;  3FUM A;  1WG0 A;  2C2L A;  4CDR A;  4O60 A;  5EIB E;  3AAA C;  3ML8 A;  4L23 A;  3C3O A;  2E0I A;  1H6P A;  1DVP A;  5FZS A;  1FT2 A;  4IUL A;  2FO1 E;  2FBN A;  2YIN A;  2FO7 A;  2P9K G;  3PDN A;  4EZL A;  3PE3 A;  3Q47 B;  4LNB A;  2P9U G;  2EIL E;  2P9L G;  2OVF A;  3SFX A;  4K5C A;  4GZD A;  2CG3 A;  2L6J A;  4ZHB A;  3LXU X;  3L13 A;  4G25 A;  3BEE A;  3CGH A;  3HYM B;  5E76 A;  2A5U A;  4U8H A;  2R05 A;  2OOE A;  5CMY A;  2P9N G;  3SO8 A;  3MKQ A;  4GU5 A;  1X5B A;  3J5P A;  2KM4 A;  4HS2 A;  1OWP A;  1O1S A;  2XHE A;  4FC8 A;  4JHK A;  5AIJ A;  2BED A;  4CCA A;  3FUF A;  2NSZ A;  3URZ A;  3RRM B;  2X6H A;  5J90 A;  1ELK A;  4EEC A;  1PY1 A;  3Q9U C;  4A1S A;  4HBD A;  4UWF A;  2BKG A;  1O1R A;  2IY0 C;  4UWH A;  1KT0 A;  3U3W A;  3QAQ A;  5ANL A;  2L0T B;  3V30 A;  4AY5 A;  3BUA A;  4TV3 A;  3E37 A;  3JCK C;  2R59 A;  4CZ2 D;  2DIW A;  4NAC A;  3AG1 E;  2I6H A;  4OAU C;  1EPU A;  5EN5 D;  4OVV A;  5ENN A;  5HRY A;  3MZL B;  3D9O A;  1O5M A;  4U95 D;  2WMO A;  1NI1 A;  4AM9 A;  4HQD A;  4ACK A;  2AXZ A;  2AWI A;  4QFV A;  4G8K A;  4MS6 A;  3UTM A;  3APF A;  1BI7 B;  4H7Y A;  1K1A A;  2ETB A;  3QAR A;  5KBA A;  2Y4T A;  3ONL A;  1XGW A;  4BT8 A;  3FUI A;  5BV0 A;  4KZC A;  5B3S E;  2VGY A;  4HOT A;  4HOR A;  1E7V A;  5FZR A;  1YCS B;  4XX5 A;  1WY6 A;  3IEG A;  4LUN U;  1SQM A;  2HYZ A;  3ISM C;  3UXG A;  2XEH A;  2X6I A;  3CQG B;  4AJW A;  4UI9 K;  3SY2 A;  3MV2 B;  1QZ2 A;  4EPZ A;  4HXI A;  2C0L A;  4GCO A;  2GRQ B;  4N2Q A;  3D9P A;  2CHX A;  4JHR A;  3CKC A;  4GZ6 A;  3RAU A;  1NFI E;  1OWM A;  4KMO A;  3AU5 A;  3I5P A;  2XQ0 A;  3HHM A;  3O4Z A;  4XKC A;  3RK6 A;  4L1B A;  3NF1 A;  5FZQ A;  3TXN A;  3ABM E;  3S7F A;  3ZU7 B;  3MYV A;  4CT4 A;  4DI4 A;  4I1O B;  2OCC E;  5JJ6 A;  3I3N A;  4LCT A;  3GZ2 A;  3C3Q A;  3SGH A;  2H6I A;  2WPV A;  3UIP C;  1N52 A;  1HU3 A;  5AAO A;  4HOS A;  2V4H C;  5H7P A;  3ZYM A;  3ZYL A;  4B94 A;  4MKT A;  2ZXW E;  3V2O A;  1KT1 A;  2GRR B;  2MHK A;  4C0E A;  3LDZ A;  2XZT G;  2WXM A;  4U8Y D;  4APO A;  3ZXS A;  4E85 A;  3QNK A;  1H19 A;  2XS8 A;  5CRV A;  3CVY A;  5JJT A;  1OCZ E;  1IKN D;  4UI9 C;  2DVW A;  3LY8 A;  1PC2 A;  1MJ0 A;  3APD A;  4NQ0 A;  2WXQ A;  3NAW A;  3QJZ A;  4Q96 A;  1TN8 A;  1KLX A;  3TWW A;  2XRY A;  2WXL A;  1ZBP A;  2J9Q A;  1N54 A;  1INZ A;  5BNW A;  3FH7 A;  2AW6 A;  3LYA A;  2EIN E;  4MLP A;  3NZS A;  1OWL A;  5LX8 A;  4RG6 A;  1G3N B;  3LY7 A;  4LNU D;  2RKK A;  1E8W A;  1BLX B;  4RLY A;  3RRN B;  2H6H A;  2GRL A;  4L9P A;  1MX2 A;  1TNB A;  3B7S A;  1RW2 A;  3B7U X;  1WAO 1;  1MYO A;  2F8X K;  2J08 A;  3B13 A;  4DUI A;  2QYJ A;  3Q15 A;  3TWS A;  1Z5S C;  4DLQ A;  4WWP A;  5CBO A;  3Q79 A;  4ME2 A;  1HO8 A;  5EIL A;  1TNU A;  3LJN A;  5KJL A;  1IYG A;  3APC A;  4N3B A;  4DX5 D;  1OXJ A;  4GTP A;  4A1G A;  3FDH A;  5AAR A;  4DX7 D;  2AJA A;  4KT6 B;  3C3R A;  2P58 C;  4N5Q A;  2UWJ G;  3PZ1 A;  1KZO A;  2HO1 A;  1IXV A;  1JCS A;  5HI7 A;  2VGX B;  4G26 A;  3DSX A;  5A7D B;  3LY9 A;  3KEA A;  2QZA A;  4LER A;  5EYP F;  5KJN A;  5BXU A;  4GPK A;  4YVO A;  1KZP A;  3T5V A;  2IEJ A;  1UN8 A;  2PZI A;  2WXG A;  3R7Q A;  2PQR A;  3K9I A;  1TN6 A;  3EUV A;  3LVQ E;  1QNF A;  4XI9 A;  3MA5 A;  3L22 A;  3B95 A;  2XEE A;  3CK7 A;  5LFA A;  3FEX A;  4GZ3 A;  2IFU A;  3SFZ A;  5FWQ A;  2Y1L E;  3CVU A;  2OEV A;  4C0M A;  5G05 J;  2LNI A;  4PDX A;  5KCM A;  1HE8 A;  1Y8M A;  5CEC B;  4CGV A;  1N11 A;  3AS8 A;  2A5E A;  1BI8 B;  4IN3 B;  4JHJ A;  2AXU A;  3DXM G;  4HI8 A;  2ZGD A;  1OCC E;  4WWN A;  4RG9 A;  1OWO A;  3ULE G;  1S0P A;  4XIF A;  4N3C A;  5ITZ F;  4ATZ D;  3PUJ A;  3C98 A;  1IHG A;  3TWX A;  3SHF A;  5C2Y A;  3HXB A;  3QWW A;  4J8D A;  5AQB A;  2GRM A;  4KZ0 A;  4HVB A;  4DX6 D;  2IO2 C;  2KC7 A;  3ZEF A;  1SVX A;  3CKB A;  4KYO B;  4BSZ B;  5BUZ A;  3FUE A;  3S2A A; 
#chains in the Genus database with same CATH homology
 1H0A A;  5AIJ A;  3L16 A;  2VGX A;  3UT8 A;  2CG2 A;  4CCA A;  3CST A;  3FUF A;  2IQC A;  2X6F A;  2NSZ A;  4RVB A;  5CHE E;  3URZ A;  1YA0 A;  5T8I A;  3RRM B;  3UUX A;  1UW4 B;  3FU3 A;  1HX8 A;  3ZGQ A;  2GGF A;  4AOF A;  1L5J A;  4G2V A;  3T8M A;  2CFU A;  3LPZ A;  4J0U A;  3QK0 A;  3ZIM A;  3CVX A;  4JA7 A;  2X6H A;  2AXV A;  4GA1 A;  4U0S A;  5J90 A;  2M63 A;  1ELK A;  3LJ3 A;  5AJL A;  3SD5 A;  3HVE A;  2KZT A;  1PY1 A;  4ILI A;  5E75 A;  4EEC A;  5LCW C;  4A1S A;  3FTW A;  4UWF A;  4TRQ A;  4BWR A;  2X3M A;  4I1M A;  3RO3 A;  3CLJ A;  3G2U A;  4AV7 A;  3R9A B;  4ANX A;  2LAI A;  1KT0 A;  1B89 A;  1HFA A;  4UWH A;  3ZYQ A;  5G2N A;  4UQY A;  3QWP A;  4B89 A;  3U3W A;  1ZU2 A;  3QAQ A;  5ANL A;  3RKV A;  2L0T B;  5JHB A;  4A55 A;  4AY5 A;  2PM7 A;  3AS5 A;  4TV3 A;  2PM6 A;  2FI7 A;  3TG4 A;  4HFG A;  3ZRH A;  3JCK C;  2R59 A;  3AU4 A;  3FTY A;  2DIW A;  4ILG A;  4NAC A;  1Z3X A;  4J6I A;  2I6H A;  5G05 C;  4JPS A;  5LCW J;  2WXR A;  4NUR A;  2YHC A;  1JUQ A;  2V0P A;  1EPU A;  3CV0 A;  5ENN A;  4OVV A;  4FU3 A;  4UQZ A;  3MZL B;  3D9O A;  4E6H A;  3P2B A;  1HF8 A;  5CCL A;  2WQ6 A;  4LRZ A;  4N39 A;  3OTN A;  3PVL A;  2XPZ A;  2WXN A;  4WNG A;  4Q94 A;  4PS3 A;  4DK5 A;  4NRH B;  2WMO A;  4AM9 A;  4ACK A;  4XZ4 A;  2VJ8 A;  1ELW A;  2AXZ A;  2AWI A;  2YNQ A;  3CIA A;  3FU6 A;  2Y3A A;  4PS8 A;  3GZS A;  4QFV A;  4MS6 A;  4J8E A;  4N5C A;  3APF A;  3ZN3 A;  1H2V C;  4H7Y A;  5T4Y A;  4IRU A;  2VTB A;  3CSF A;  4URK A;  2IOL A;  3QAR A;  2Y4T A;  3FUL A;  2VSO E;  3MGB A;  3ONL A;  1XGW A;  4BT8 A;  5A6C A;  2A4Z A;  2WMN A;  4WNF A;  4UWL A;  3FUI A;  4GMJ A;  4D10 C;  4F53 A;  4F7A A;  5BV0 A;  3RIB A;  5JJ7 A;  5BT1 A;  4KZC A;  1IQU A;  2WQ7 A;  4CRW A;  2VGY A;  3CVV A;  3OXL A;  4HOT A;  4JEU A;  3TXM A;  4UWK A;  3L6A A;  4HOR A;  2L9B A;  1E7V A;  3HDX A;  4N3A A;  2AVP A;  5FZR A;  4XX5 A;  1HG2 A;  4GCN A;  1WY6 A;  2DCP A;  3D9N A;  4L2L A;  1E96 B;  3Q5M A;  2I1J A;  3IEG A;  3G2W A;  4I1A A;  4LUN U;  2XPY A;  4A3T A;  3FP3 A;  1SQM A;  2HYZ A;  3PRZ A;  2BF0 X;  3TG5 A;  1HXI A;  3I4R B;  1E8X A;  2E2E A;  2IJG X;  3UT4 A;  4CEM A;  2X6I A;  3FTV A;  4IYP A;  2HM8 A;  3S7D A;  4FLB A;  1E7U A;  3CQG B;  4UI9 K;  3RJV A;  3MV2 B;  5EX3 A;  3SF4 A;  1QZ2 A;  4H7X A;  4AJW A;  2BUG A;  3IV0 A;  4EPZ A;  5BW8 C;  1NA0 A;  3N71 A;  4HXI A;  2C0L A;  2J09 A;  4DLO A;  5JHA A;  2JEK A;  4GCO A;  4G23 A;  3SBS A;  4N2Q A;  3D9P A;  3R7R A;  1HH8 A;  1JWG A;  2CHX A;  3PRE A;  4FJZ A;  4GZ5 A;  4JHR A;  3CKC A;  3U66 A;  4AVX A;  5BPP A;  4GZ6 A;  3ULQ A;  4AXH A;  4FAD A;  4P29 A;  2HR2 A;  5AJD A;  4B8A A;  4RSY A;  1DNP A;  3CHP A;  5BV1 A;  1OWM A;  4CGW A;  4I9E A;  1Y6I A;  3GW4 A;  4Y6W A;  2CFZ A;  4J8F A;  3FWV A;  3Q49 B;  3QC1 A;  4KMO A;  3AU5 A;  4C9B B;  3EDT B;  3I5P A;  2XQ0 A;  3HHM A;  4EBA G;  4BT9 A;  5M72 A;  3S7J A;  4G1T A;  2I2O A;  4F1S A;  1HS6 A;  3O4Z A;  4XKC A;  4HLE A;  2ILR A;  3RK6 A;  2YHE A;  4EQF A;  5D0Q D;  3LVR E;  4I6J A;  4L1B A;  2KAT A;  4OVU A;  2WVI A;  3NF1 A;  3OXF A;  5FZQ A;  3TXN A;  4A3V A;  5EKQ D;  3S7F A;  2VYI A;  4WND A;  3EIQ C;  3IHY A;  3SBT B;  3MYV A;  1H2U A;  3QOU A;  4XKB A;  4CT4 A;  4G24 A;  4CDN A;  2J4D A;  1P5Q A;  2IU1 A;  4B0Z A;  2MRI A;  5HQ8 A;  4DI4 A;  3CVN A;  4I1O B;  3PEV B;  5JJ6 A;  3I3N A;  4LCT A;  3GZ2 A;  2J4B A;  3SGH A;  1GW6 A;  2WPV A;  4KVM A;  4GA0 A;  4UWG A;  3ZHE B;  2VQ2 A;  3CK9 A;  3CHR A;  1WM5 A;  2V8S E;  4HOU A;  1N52 A;  2WXO A;  3SI5 A;  4JC8 A;  3HIZ A;  1HU3 A;  4WAF A;  3PUK A;  3FUH A;  4HOS A;  3UQ3 A;  3RRU A;  3QB2 A;  2XPI A;  4GYY A;  2R5S A;  4I6G A;  2PL2 A;  2XCB A;  1HZ4 A;  1NZN A;  4W9R A;  3WXX A;  3D9L A;  2XRZ A;  3CHO A;  3ZYM A;  1QQE A;  4GZC A;  3ZYL A;  4WUY A;  4AIF A;  2EQX A;  1U3C A;  1EYH A;  4U0Z A;  4B94 A;  3JQ1 A;  2ZU6 B;  4MRU A;  3FY4 A;  4MKT A;  4FHK A;  3ESL A;  3IKO B;  3ASD A;  4V3I A;  3D9M A;  1KT1 A;  5DIZ A;  4ACL A;  2MHK A;  2XGS A;  2LAH A;  4C0E A;  2LO6 A;  3FU0 A;  3LDZ A;  4BTB A;  2WXM A;  2BTD A;  3Q4A B;  4U63 A;  4JHK A;  3L54 A;  3S7B A;  5FQ4 A;  4APO A;  3CQC B;  3FUD A;  4K0R A;  3ZXS A;  4E85 A;  3JQ0 A;  1Z3Y A;  3QNK A;  4J8S A;  1H19 A;  3PEU B;  4ANU A;  3QDN A;  4EZK A;  3FH5 A;  4BTA A;  3CVY A;  2V4L A;  3D9K A;  5JJT A;  4GB9 A;  3CHQ A;  2KCV A;  2WXP A;  4UI9 C;  3LY8 A;  4NQ0 A;  1PC2 A;  3APD A;  4PH4 B;  2WXF A;  2XCC A;  4I2Z A;  2WXQ A;  3PS6 A;  3S2A A;  2L0I A;  3QJZ A;  4YND A;  3OXG A;  4GA2 A;  4Q96 A;  1KLX A;  5CMW A;  1MQS A;  2IF4 A;  4Y6C A;  5ARF A;  2XRY A;  2XGM A;  2DBA A;  2WXL A;  5C1D A;  1ZBP A;  1UG3 A;  3PE4 A;  2J9Q A;  1N54 A;  3LKU A;  1INZ A;  5BNW A;  5FQ7 A;  4BX9 A;  3TGO A;  5AYW D;  1E8Y A;  4OYS A;  4JVS A;  3OAW A;  3EHN A;  3KEZ A;  3FH7 A;  1Z6T A;  2AW6 A;  3IHV A;  3LYA A;  5CCM A;  3CVQ A;  4FP7 A;  1UJK A;  1ELR A;  4MLP A;  4FHJ A;  2KCK A;  4FLH A;  3NZS A;  2UY1 B;  3CR3 A;  1OWL A;  3MCX A;  1TEZ A;  2JLB A;  4UI9 J;  3LS8 A;  1TJF A;  5LX8 A;  4EZJ A;  1OUV A;  2J07 A;  4RG6 A;  4PS7 A;  4Q69 A;  3O48 A;  3D3M A;  3CK8 A;  3BG1 B;  3MJW A;  3LY7 A;  1E8W A;  4KBQ A;  3FTU A;  4YVQ C;  2YQ8 A;  2Q7F A;  3ZYK A;  3ASH A;  3RRN B;  3FUK A;  5A23 A;  3CVW A;  2GRL A;  1UJJ A;  2R17 C;  2WM9 A;  1E90 A;  4TUU A;  3FUN A;  5FTP A;  4GML A;  3B7S A;  4FUL A;  2I9C A;  3I4G A;  1OWN A;  3B7U X;  4U07 A;  1WAO 1;  3ENE A;  3T5X A;  3FEY A;  2IOS A;  3ZHE A;  4BX8 A;  5D0O D;  4I17 A;  2KCL A;  4JEH A;  2J08 A;  2RG8 A;  3B13 A;  4HOQ A;  4I6E A;  5FT9 A;  2LSV A;  3TJP A;  3Q15 A;  1MHQ A;  2X6K A;  3G2T A;  4XI0 A;  4L7T A;  5LOZ A;  3ZFW A;  5LP0 A;  3U64 A;  1A17 A;  4FJY A;  5J08 A;  2VSN A;  4DLQ A;  4WWP A;  4KVO A;  2V5F A;  5G04 J;  4O6F A;  4APF A;  4FA6 A;  3ESK A;  1U3D A;  2J49 A;  3MX3 A;  4ME2 A;  4JA9 A;  1HO8 A;  4I43 A;  3TL5 A;  2PQN A;  4AY6 A;  4DI3 A;  3ZVV A;  4KXK B;  2XEV A;  2VSY A;  3FTS A;  2NXP A;  1XNF A;  1E8Z A;  4BY6 A;  4F3V A;  4EBA A;  5KJL A;  1IYG A;  2WXK A;  3PNT B;  3CHM A;  3APC A;  4U0U A;  5DBK A;  1FCH A;  4N3B A;  2X6J A;  3VLD A;  3GYZ A;  4JW1 A;  4A1G A;  3FDH A;  4DJA A;  5FJY A;  4ATG A;  3G2V A;  3JYS A;  4KT6 B;  2C0M A;  4JL0 A;  4BSX A;  1LF8 A;  3PNL B;  1SZ9 A;  3MKQ B;  4BFR A;  3MEK A;  2P58 C;  3U4T A;  4B8C B;  3EJN A;  2UWJ G;  3G2S A;  2HO1 A;  2NC9 A;  3KS2 A;  5ARG A;  5HI7 A;  2VGX B;  3NQP A;  4R7L A;  4XE0 A;  4G26 A;  4I2W A;  3RO2 A;  3EIJ A;  4ANW A;  2QY7 A;  5A7D B;  3LY9 A;  4U04 A;  3PZD A;  3LEW A;  3EHM A;  3GZ1 A;  3ZW3 A;  3FTX A;  4LER A;  3D9I A;  3DPD A;  3PH0 C;  1JWF A;  5KJN A;  1HG5 A;  3FTZ A;  2MOW A;  5G55 A;  4GPK A;  4YVO A;  4CDM A;  3HVE B;  2KZT B;  1IQR A;  4WNE A;  3FUJ A;  3IBE A;  4GYW A;  3T5V A;  3VLE A;  2ION A;  3CVL A;  1VDY A;  2RD0 A;  3L17 A;  1BPO A;  1UN8 A;  2WXI A;  4N2S A;  2VSX E;  3MKR A;  1H6K A;  3D9J A;  4DPR A;  2PZI A;  2UY1 A;  3CEQ A;  3RU0 A;  3NZU A;  3QWV A;  2WXG A;  3B7T A;  3R7Q A;  2PQR A;  2Y4U A;  2OND A;  3K9I A;  3QKY A;  4ABN A;  3U9W A;  3LVQ E;  1QNF A;  4JXT A;  2CHW A;  3MA5 A;  4XI9 A;  1NP7 A;  1JPL A;  3L22 A;  3CK7 A;  5LFA A;  3FEX A;  4GAA A;  4GZ3 A;  3E4B A;  2WQH A;  2IFU A;  3LCA A;  4WWO A;  3KD7 A;  3UT7 A;  2CHZ A;  3SFZ A;  5FWQ A;  2WXJ A;  3FH8 A;  2OVB A;  1H2T C;  3DBS A;  3FUM A;  3CVU A;  4PUC A;  4C0M A;  3KAE A;  5G05 J;  2C2L A;  2LNI A;  4CDR A;  3FFL A;  4PDX A;  2QFC A;  5KCM A;  1HE8 A;  3ML8 A;  3UPV A;  1Y8M A;  3B7R L;  4L2Y A;  4L23 A;  4CGV A;  3ASG A;  3ZPJ A;  1NA3 A;  4AEZ C;  4CT0 A;  5T3R A;  2E0I A;  3AS8 A;  3CVP A;  1DVP A;  4IN3 B;  3FHE A;  4JHJ A;  5FZS A;  2AXU A;  4IUL A;  2FBN A;  3AS4 A;  3SZ7 A;  3UMV A;  2YIN A;  2FO7 A;  3CHS A;  2FUL A;  3PDN A;  3VLF A;  4WWN A;  3UX4 A;  3VTX A;  1EF1 C;  4RG9 A;  4EZL A;  1OWO A;  3PE3 A;  2OV8 A;  1S0P A;  3ASF A;  3Q47 B;  4GYO A;  4XIF A;  2VTB B;  1TJC A;  4N3C A;  2OVF A;  2XGO A;  3FU5 A;  3ONK A;  5G04 C;  1FVH A;  3C98 A;  3PUJ A;  4UQX A;  4GZD A;  2LSU A;  1IHG A;  1SZA A;  2CG3 A;  2L6J A;  3JUI A;  2X38 A;  4I9C A;  3LXU X;  5EX0 A;  5C2Y A;  4JZY A;  3SHF A;  3QWW A;  3L13 A;  4G25 A;  3TAX A;  3P1U A;  4J8D A;  3BEE A;  3VTY A;  3CGH A;  2FF4 A;  3HYM B;  1UN9 A;  2A5U A;  4LEU A;  4U8H A;  5E76 A;  2WXH A;  2I1K A;  4M3O A;  1W3B A;  3SNX A;  4ANV A;  2OOE A;  5CMY A;  3BG0 B;  5AEN A;  5ANR A;  2GRM A;  3L08 A;  1FVF A;  1PAQ A;  4KZ0 A;  4HVB A;  3MV3 B;  4K03 A;  2KC7 A;  3ZEF A;  5KJK A;  3CKB A;  4KYO B;  5KJM A;  2FEZ A;  3MKQ A;  4G11 A;  4GU5 A;  1X5B A;  3ML9 A;  2KM4 A;  4HS2 A;  1OWP A;  4AP2 A;  5EDS A;  5BUZ A;  2WB2 A;  2XHE A;  2GW1 A;  5FQ6 A;  4ILH B;  4FC8 A;  1EDU A;  3FUE A;  5FQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...