2R5SA

The crystal structure of a domain of protein vp0806 (unknown function) from vibrio parahaemolyticus rimd 2210633
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
171
structure length
171
Chain Sequence
DEQLLKQVSELLQQGEHAQALNVIQTLSDELQSRGDVKLAKADCLLETKQFELAQELLATIPLEYQDNSYKSLIAKLELHQQAAESPELKRLEQELAANPDNFELACELAVQYNQVGRDEEALELLWNILKVNLGAQDGEVKKTFMDILSALGQGNAIASKYRRQLYSILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein VP0806
publication title The crystal structure of a domain of protein VP0806 (unknown function) from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus
total genus 69
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
A PF14561 TPR_20 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2r5sA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2r5sA01
2J9QA 2I6HA 2KCVA 2XCCA 3RU0A 2VGXB 3GZ1A 5LCWJ 3IEGA 4G26A 4GZ3A 2JLBA 1WM5A 5A6CA 3OXFA 4XIFA 4UQZA 3ASGA 4N5CA 5EX3A 3UUXA 3AS4A 4YNDA 2Q7FA 3CVLA 1QZ2A 4I17A 1NA0A 5EX0A 2IFUA 2HYZA 5ARGA 2LSUA 5M72A 2V5FA 4I2ZA 2HR2A 3HYMB 4N39A 3ASDA 4APOA 3UPVA 1HZ4A 3KAEA 2DBAA 3AS8A 3PE3A 4G25A 5KJLA 4HOUA 1KT1A 3N71A 4Y6WA 3MV2B 2XPIA 1OUVA 4ABNA 2FEZA 4UI9C 3GW4A 2Y4UA 4UQXA 2WQHA 4F3VA 3ULQA 4I9EA 4BWRA 3QWVA 3S7FA 4B94A 3CK8A 3WXXA 4U0SA 5CHEE 3ASFA 3O48A 3TGOA 2XCBA 4AM9A 3U4TA 1ELWA 3KD7A 4AY5A 3LYAA 4LEUA 5LCWC 3R9AB 3ASHA 4AIFA 3Q49B 4UI9J 4J8DA 2KCKA 1B89A 2VGXA 4A1SA 2IF4A 2PQRA 3S7DA 3LY9A 2UY1A 4J8EA 1KT0A 2QFCA 4UI9K 3CEQA 3FP3A 4GA1A 3ZN3A 2YHCA 3MA5A 3ZPJA 4KXKB 4NQ0A 4GZ5A 3AS5A 3TG4A 1PC2A 1HH8A 1Y8MA 1TJCA 4BTBA 2GW1A 4GYYA 4AY6A 4JL0A 3ESKA 5CCMA 2UY1B 5FZRA 2Y4TA 4GYWA 4W9RA 2NC9A 2E2EA 5FZQA 2VGYA 5JJTA 3LY7A 3UQ3A 4Y6CA 4H7YA 2XGOA 3QDNA 3FWVA 3NF1A 1YA0A 4NRHB 2XEVA 3QWWA 2HO1A 3VTXA 2OOEA 3CVQA 4WNGA 4WUYA 4JA9A 3LPZA 5G04J 3LY8A 4G1TA 4WNEA 3CKBA 4I1AA 5ARFA 4N3BA 3GZ2A 4XI0A 3CV0A 3Q47B 4U04A 4YVQC 3E4BA 1ZBPA 3RJVA 2FF4A 4U0ZA 3GYZA 1FCHA 3OXGA 4GCNA 5BNWA 3PE4A 1IHGA 1W3BA 4GPKA 3ZHEA 2VSNA 1WAO1 1ELRA 2UWJG 4N2QA 3CVNA 5KJKA 2LSVA 1NA3A 3Q4AB 4N3CA 4JHRA 3K9IA 3BEEA 5KJMA 2FI7A 2VQ2A 2FBNA 5A7DB 2BUGA 1IYGA 4CGVA 3ZHEB 4ME2A 4G23A 3SZ7A 2C2LA 4GA2A 5G05C 4YVOA 4WNDA 3FFLA 2PQNA 4J0UA 2VSYA 4IN3B 3QKYA 3LKUA 5G04C 4BT8A 4J8FA 2MHKA 1P5QA 5BW8C 2C0LA 4JA7A 4RG9A 5FJYA 3ZFWA 4GYOA 4I9CA 3MV3B 5G05J 3SF4A 1A17A 3CVPA 5JJ6A 2YQ8A 2L6JA 2P58C 1E96B 5AYWD 4WNFA 5FT9A 4GCOA 4BT9A 5HI7A 3QOUA 1KLXA 4N3AA 2XGMA 4G24A 1NZNA 4HOSA 3RIBA 3CKCA 3TAXA 5BT1A 4GZ6A 5EKQD 4HORA 4RG6A 2AVPA 5KJNA 4CDRA 3MEKA 3CK9A 1XNFA 2FO7A 3CK7A 4GA0A 5CCLA 4BTAA 1ZU2A 4KBQA 3LCAA 3OXLA 3S7JA 3TG5A 5HQ8A 4EQFA 2R5SA 5FZSA 2C0MA 3Q15A 5D0OD 4I2WA 3Q5MA 5C1DA 4UQYA 3MKRA 2WPVA 3QWPA 4HOTA 3U3WA 1QQEA 4G2VA 5DIZA 4CGWA 5DBKA 2KATA 4H7XA 4KYOB 5JJ7A 4U0UA 2LNIA 2XGSA 3EDTB 3JYSA 3S7BA 3RKVA 4U07A 2KCLA 4O6FA 5FTPA 3VTYA 3RO2A 4N2SA 2PZIA 3ZGQA 4XI9A 3RO3A 5D0QD 2ONDA 2VYIA 3PDNA 2PL2A 4HOQA 1HXIA 3URZA 3KS2A 2KC7A
chains in the Genus database with same CATH superfamily
1U3DA 3PZ2A 4I1MA 4GTQA 3RU0A 3VLFA 5LCWJ 4JXTA 4GZ3A 1E7UA 3NB2A 1WM5A 1PAQA 2BKKB 1HO8A 3ABLE 1OXJA 4XZ4A 5AQ9A 2AXZA 3CQGB 2GRPB 1H6KA 1QZ2A 3FTSA 5EX0A 2IFUA 5M72A 2V4LA 2V5FA 1TN8A 1HFAA 2I1KA 3SGHA 2LXMA 3ENEA 4B8AA 4U96D 1QNFA 4APOA 4UWFA 3UPVA 3O4ZA 4G8KA 3HVEA 2DBAA 3AS8A 2AWIA 3PE3A 4OVUA 5AIJA 5KJLA 4HLEA 5LOZA 1K8KG 3N71A 1SZAA 1YMPA 3ZYLA 3MV2B 4DLOA 5CEAA 1SZ9A 3LEWA 4F7AA 1UJJA 3Q75A 4RLYA 3HXBA 2WXJA 1WY6A 1MX6A 3ZU7B 1O5MA 3RK6A 2I9CA 4BX8A 2J8SD 2EQXA 1N4QA 5FINA 2GROB 4GTOA 2YINA 3TGOA 1MQSA 2XCBA 3U4TA 1SW6A 3U64A 1MX2A 5LCWC 3SO8A 4BESA 1S63A 1OCCE 5ITZF 4NACA 4HFGA 2VGXA 4A1SA 2KM4A 3S7DA 2LUHA 3J5QB 4CZ2D 2QFCA 4UI9K 3HXCA 3E33A 2P9SG 3MA5A 4KXKB 3ULYA 3CSFA 3NZUA 3TG4A 3QJZA 1Y8MA 2A5UA 4ACLA 2EIME 1LD8A 4GYYA 4AY6A 3FUMA 1NFIE 3ESKA 5CCMA 2UY1B 3FH8A 4GYWA 4DJAA 4PDXA 2GRLA 2WXPA 2E2EA 1Y6IA 2CHXA 5JJTA 3D9JA 4UWLA 2IO2C 3FUIA 4LCTA 3LY7A 4GU5A 4C9BB 4ANWA 3DBSA 3UQ3A 3ZXSA 5ANRA 4H7YA 3ZNGA 3HHMA 4GTMA 1OWLA 5E75A 2J07A 5EIDA 2HO1A 2LAHA 3L22A 1N4RA 4ILIA 5BUZA 5ENTD 4HBDA 1TJFA 3HRAA 1FT1A 2Y1LE 5G2NA 2AJAA 1Z3YA 2XS1A 2OCCE 5BXUA 2FF4A 2NYJA 5JA4D 3CVYA 4EPZA 2JABA 2X3MA 4KVMA 1IHGA 5KBAA 3B95A 3EIQC 1NA3A 4JHRA 1VDYA 1HG5A 3T5XA 3SFYA 4J7WA 3EUVA 4F1PA 3CHMA 2P9NG 3FULA 3UKRG 3JUEA 4CGVA 3ZHEB 4ME2A 4BSXA 5J90A 1LF8A 3CVVA 3L9TA 2WXLA 4WNDA 2Y0BG 3FFLA 4LNUD 2I1JA 1N0RA 4HNAD 2WXMA 2WXFA 5E76A 3FH5A 4J8FA 4A55A 1E8YA 4JA7A 3C98A 5BV0A 3TWXA 3LS8A 4CYMD 5FJYA 5T3RA 5T8IA 3SF4A 1A17A 1K1BA 3CVPA 3I5PA 4B8CB 2P58C 2RFAA 2P9LG 5CMWA 3R7RA 2PNNA 3FTWA 2MRIA 1KLXA 2WXGA 4N3AA 2XGMA 4EBAA 4TXRA 2AXUA 2Y69E 4ZFHA 1N9AA 2XPYA 4OAVB 5AQBA 2OEVA 2FO7A 3AG4E 5CCLA 4KBQA 1U2VG 1G3NB 5BXOA 3ONLA 3CLJA 4HLLA 2R59A 2HM8A 5HQ8A 3MZLB 1OCOE 2R5SA 1DCQA 3SBTB 4KZ0A 3ABKE 2XPZA 1AP7A 3UX4A 3MKRA 3NQPA 3QWPA 3MGBA 4U8HA 5DBKA 1EDUA 2LNIA 4NURA 4K5AB 3S7BA 4HRMB 2A5EA 3NZSA 4O6FA 4I1OB 3SHFA 2RKKA 3ZGQA 4XI9A 3EU9A 3P2BA 3CHQA 4HOQA 4TXQA 1HXIA 4MKTA 3KS2A 2XS8A 2WXNA 2I6HA 3AU5A 3X2QE 2JEKA 3G2TA 4MLPA 3CVWA 3BUAA 5FQ6A 2JLBA 5A6CA 5D2MC 2V0PA 1O1RA 1N94A 4F53A 3EHQA 1OCZE 3C3RA 4N5CA 3C72A 3AS4A 1SA5A 4YNDA 2J4BA 2Q7FA 1OWNA 2HYZA 2LSUA 4HXIA 4OYSA 1JCQA 2R03A 2P9KG 1HZ4A 2CHZA 2KZTB 4FC8A 4URKA 4DPRA 3RRNB 4G25A 3APCA 1WG0A 4TUUA 4HOUA 2WQ7A 4U95D 3B7TA 3DPDA 3FTZA 3HG0D 1DCEA 4Y6WA 4LNBA 2QYUA 2XPIA 2Y4UA 4IULA 3KEAA 3TWWA 4C0EA 4O1OA 4F1SA 3B7UX 3QWVA 4B94A 5EYPF 4AVXA 2IOLA 2BTDA 3OAWA 1TYQG 4R7LA 5AENA 2X6IA 4BERA 4TV3A 2WXRA 3KD7A 3DSVA 3IBEA 5EIBE 3U9WA 4LEUA 3CIAA 3SBSA 4B0ZA 1FPPA 3DSXA 3I4RB 1N4PA 2IOSA 3TWQA 4NIKA 3LJNA 4EZLA 2B6CA 2NXPA 3LY9A 2UY1A 2KBXA 1HF8A 4EECA 3ESLA 3FP3A 2OEWA 2YHCA 4DX1A 1UJKA 2NSZA 4E6HA 4NQ0A 4G11A 3D9IA 4HVBA 5AJLA 2B0OE 3AS5A 2VSOE 3UT7A 2ETCA 1NL4A 3SNXA 3UT8A 3NOCD 3ISMC 3LVQE 2YNQA 3S2AA 2J09A 4K0RA 1WDYA 5EYLA 1N54A 4I6GA 3Q73A 3D9KA 5B1BE 2ZU6B 3F6QA 3AG1E 2ETBA 4RVBA 1IQUA 4BX9A 3KSQA 4JEHA 4X8QA 3ASOE 2OV8A 4U63A 3APDA 1H6OA 1LTXA 3NF1A 1YA0A 4NRHB 2H6GA 3LXUX 3QB2A 2OOEA 1KZPA 1FVFA 3I4GA 5G04J 4ACKA 3LY8A 4G1TA 2L0IA 3G2UA 1Z5SC 3ZIMA 4N3BA 3GZ2A 2EILE 4XI0A 2R2LA 3CV0A 4N5QA 5ENNA 3SFZA 3EJNA 3E4BA 1FCHA 3PE4A 1MHQA 4B93B 3ZHEA 2VSNA 5KNGA 4GMRA 3PVLA 3D9NA 4FHKA 4BSZB 4N3CA 3G2SA 4GTVA 4WWNA 3K9IA 4BETA 2WB2A 4A3TA 5KJMA 1HX8A 1HS6A 5A7DB 2DVWA 4DX7D 3RAUA 4IYPA 3UXGA 2ZXWE 3PH0C 3UINC 2EINE 3G2VA 3PZ4A 3MCXA 3PREA 2FULA 1E8XA 3RRUA 3TL5A 3CHPA 1H2VC 3CVXA 3L82A 5EILA 3FEXA 2PQNA 4J0UA 2X6KA 3RRMB 1QYMA 5B3SE 3HDXA 1H19A 5G04C 2QC9A 2DYSE 2R05A 2C0LA 5LP0A 3ZFWA 3OTNA 1X5BA 5LX8A 3FTUA 5JJ6A 4JZYA 5CBNA 3UM3A 3MYVA 2WXHA 4EZJA 4G24A 4HOSA 1MYOA 1JCRA 4Q69A 1S0PA 2GRNB 1BPOA 5BT1A 4GZ6A 4HORA 4RG6A 4MS6A 2AVPA 1BD8A 5KJNA 3EHMA 4M3OA 3BG0B 3MEKA 3CK9A 1XNFA 4ANXA 4GA0A 2BEDA 2RG8A 4ILHB 3LCAA 3GZSA 3OXLA 4GTTA 3S7JA 1INZA 2ZGGA 4EQFA 5H7PA 5FZSA 4K5CA 3ULEG 5AAOA 2VGEA 4L23A 5C1DA 4UQYA 2EIJE 2WPVA 1TNYA 5DIZA 3L17A 1DNPA 3PEVB 4KYOB 5JJ7A 4U0UA 2ZIRA 2XGSA 1D8EA 3SI5A 4ATGA 3FTVA 2KCLA 4AJWA 3EHRA 3HXEA 4EZKA 4FULA 3RO2A 3L13A 2VJ8A 2ILRA 2DZOA 1X81A 2VTBB 3PDNA 2PL2A 2V5QC 3PZ3A 1OY3D 2AW6A 3URZA 2WXOA 2KC7A 1MZCA 3W9GA 2J9QA 4RSYA 2XCCA 2X38A 4K5BA 4G8LA 1E7VA 5IY5E 1BI7B 4GMJA 2VGXB 3IEGA 4G26A 3PEUB 3LDZA 3OXFA 3UI2A 4PH4B 2KZTA 3MX3A 3CHRA 4FU3A 3NBNB 4DLQA 5A23A 4I17A 2QY7A 4XE0A 1NA0A 4KZCA 5ARGA 2IO3C 1TNZA 5CERB 3CSTA 1TEZA 4I2ZA 2HR2A 4N39A 1Z3XA 4E85A 4L7TA 4RQIA 3KAEA 4P29A 4JVSA 1D9SA 4L1BA 2WXQA 2KXPC 3I3NA 3UMVA 1KT1A 1H6PA 3UTMA 4ABNA 4CT4A 1HG2A 4UI9C 3GW4A 4UQXA 3DSSA 1ZB1A 2XEEA 3ULQA 3V30A 3DSTA 4BWRA 2H6HA 2I2OA 3S7FA 3TWUA 2L9BA 3CK8A 3Q9UC 3CVUA 4GTSA 3NAWA 3T9KA 2LAIA 1K3ZD 4Q94A 3DWLG 2GRQB 4HRLA 2WQ6A 4FJYA 2P2CP 3B7RL 3O48A 1XGWA 3QC1A 3DEOA 4AY5A 3LYAA 1DVPA 2IEJA 3Q49B 2V8SE 4J8DA 3CHSA 2KCKA 2PM7A 1B89A 2PQRA 4L2LA 2XRYA 3L16A 4M7CA 1KT0A 5AQ7A 3JUIA 3CEQA 3ZN3A 3LJ3A 3TXNA 4CRWA 2FO1E 3FEYA 4FP7A 3JQ0A 3JQ1A 1IKND 3IHYA 3E30A 4JL0A 4PUCA 1LD7A 2Y4TA 2LXLA 4J8SA 4ATZD 1UG3A 2NC9A 3FUEA 3D9HA 5ENOD 4DX6D 1TNUA 3ZXPA 1BLXB 1UN9A 4XKCA 3UIOC 4AEZC 1PY1A 3ASNE 4B89A 4GTPA 2OVFA 4QQIA 3QDNA 4FJZA 2LO6A 3MKQB 1JUQA 4L2YA 3JCKC 3VTXA 3FTYA 3CVQA 4JB8P 4WNGA 4WUYA 3DRAA 4JA9A 3LPZA 1JPLA 4I1AA 5ARFA 1V55E 1OWPA 4LRZA 1TN7A 1SQMA 1EPUA 5C2YA 3SD5A 1HU3A 3PUKA 3Q47B 3DEPA 4C48B 4AOFA 3RJVA 4U0ZA 3GYZA 4GMLA 3V2XA 4GCNA 5EDSA 3UM1A 4ANUA 1W3BA 1S64A 2XRZA 4JHKA 1JWGA 1WAO1 1ELRA 1OWOA 1MJ0A 2UWJG 4N2QA 1NI1A 2MOWA 4J6IA 5KWDA 4JHJA 3CVNA 5KJKA 3JXJA 3ABME 1D8DA 3Q79A 3Q7FA 3FTXA 2CFZA 1FT2A 3ZYQA 4YDEA 4G23A 1RW2A 2OVBA 3DSUA 2C2LA 1O1TA 4A63B 3EIJA 5G05C 4GTRA 3AU4A 4CEMA 3E34A 5JHBA 4LNGA 2RD0A 5FQ7A 1FVHA 4GZCA 3B7BA 3AG2E 3T8KA 2DZNA 4IN3B 4YDOA 4BEPA 3QNKA 2DCPA 3LKUA 4BT8A 4DI4A 1NP7A 2MHKA 3DXKG 4KVOA 1P5QA 3FU0A 5CRUA 2H6FA 1N11A 1L5JA 4UUCA 4RG9A 5FIOA 4DUIA 4GYOA 4I9CA 2AXVA 4MRUA 5T4YA 3JXIA 2YQ8A 3E32A 2HE0A 4OAUC 2F37A 4WWPA 3C3OA 3CQCB 4WNFA 4GCOA 5HI7A 3EU5A 2V4HC 3FUNA 3FU5A 4EBAG 2F0YA 3IV0A 1IHBA 2WXKA 3L6AA 1UOHA 5ENQD 3CK7A 4FLBA 4BTAA 1HE8A 3FDHA 1YCSB 5JHAA 3J5PA 3TG5A 2WM9A 1Z6TA 2C0MA 2RFMA 3W9FA 4CDMA 2XENA 2Y3AA 5CRVA 3KSLA 5HS0A 4CCAA 4PS7A 3R7QA 3PUJA 4FA6A 3WG7E 2L6BA 2VTBA 1EF1C 3Q9NC 4AP2A 4HOTA 4FADA 4CGWA 4XEIG 3D9PA 4H7XA 1TNOA 3JYSA 2CG2A 4YDYA 1SVXA 4LERA 4LG6A 5FTPA 2P9IG 4O60A 3UKUG 2WXIA 4N2SA 2PZIA 4WWOA 3ZVVA 3RO3A 3AG3E 2MYOA 2H6IA 5D0QD 2ONDA 4XKBA 1EYHA 4FLHA 3MJWA 4LSZE 2P9UG 3B7SA 3VLEA 5CMYA 1ELKA 4MBGA 2XEHA 3PZ1A 3TJPA 5HKPA 4YDWA 1YYHA 2ZGDA 2KCVA 3CHOA 4TXPA 3FUJA 4XX5A 3UIPC 3GZ1A 4TUMA 1BI8B 5KCMA 4XIFA 4UQZA 2R02A 3ASGA 5D66A 5CECB 5EX3A 5BV1A 3ML9A 3UUXA 3ZEFA 3CVLA 3D9LA 2VSXE 2GRRB 4GB9A 2F8XK 3L54A 3HYMB 4U8VD 3ASDA 5J08A 1TR4A 2M63A 2E0IA 3PRZA 3ONKA 3D9OA 2J08A 3Q7AA 3SFXA 4TRQA 3DPYA 3C3QA 4JD2G 1H0AA 1OUVA 3UM2A 1JWFA 1S70B 3E37A 4A1GA 2FEZA 1IQRA 4I6EA 2WQHA 4F3VA 3RSEG 5ANLA 1JCSA 4I9EA 3HVEB 3CR3A 3WXXA 2IQCA 3CGHA 2IU1A 4U0SA 3BQOA 4DI3A 3ZW3A 5CHEE 1K1AA 3ASFA 3FUDA 3D3MA 5EN5D 3HXFA 4AM9A 4UWGA 2ZISA 3QK0A 1ELWA 3TWSA 1RZ4A 3SQVA 4CDNA 3HXDA 3R9AB 3ASHA 4AIFA 5BPPA 4UI9J 3FY4A 1V54E 2A4ZA 5AQAA 3ZUVB 1AWCB 1MX4A 2IF4A 4LUNU 2GRMA 3AJIA 4JEUA 3ML8A 3C5RA 4J8EA 3IXEA 4C0MA 4GA1A 3B13A 4UWHA 3ZPJA 4GZ5A 2F8YA 1N95A 5ENRD 1PC2A 4HI8A 1HH8A 5AARA 1TJCA 4BTBA 2GW1A 2BKGA 2XQ0A 2XZDG 4U8YD 5KNHD 5FZRA 4W9RA 2L0TB 4FHJA 2QZAA 4L9PA 3HIZA 5AJDA 3MKQA 3AAAC 5FZQA 2VGYA 3P1UA 1E8WA 2WVIA 3T8MA 4ILGA 5B1AE 4PS3A 5LFAA 1TNBA 3FUHA 4Y6CA 2IONA 2XGOA 3QARA 5AN8A 3FWVA 3UM0A 2XEVA 3L08A 4ZHBA 3QWWA 3UT4A 4AV7A 2J49A 2R17C 5HRYA 4Q96A 3FU3A 4WNEA 3CKBA 5G55A 4GZDA 4J8YA 3Q78A 3ZRHA 2CFUA 3V31A 4U04A 2CHWA 3U66A 4OVVA 4YVQC 4AXHA 1U3CA 1KPSB 1ZBPA 1QBQA 2WMNA 5CBOA 1E8ZA 3OXGA 5BNWA 3R9MA 4GPKA 4HQDA 4HRNA 1A5EA 3BG1B 4BFRA 3DSWA 3T5VA 4KMOA 2DIWA 1SA4A 3VLDA 2LSVA 3Q4AB 2ETAA 1UN8A 4CT0A 1IXVA 3BEEA 2DWZA 2FI7A 2VQ2A 2FBNA 2BUGA 4HI9A 4Z68A 5FQ4A 1IYGA 3ZKJA 5ENSD 3IHVA 3SZ7A 1O1SA 4GA2A 3FUFA 2QYJA 4D10C 4QFVA 4DX5D 3LVRE 4YVOA 1OT8A 3PNLB 3FH7A 2GGFA 2J4DA 2VSYA 3PNTB 1Q2ZA 3V79K 2PM6A 4F6RD 3QKYA 1BU9A 3SY2A 4HS2A 2P9PG 5BW8C 3IKOB 4DK5A 4U7EB 2XZTG 3MV3B 4O1PA 5G05J 4I6JA 3TWTA 4ANVA 2L6JA 3ZYKA 1E96B 3DXMG 5AYWD 2X6HA 5JMND 5FT9A 4BT9A 3QOUA 1H2TC 1KZOA 4PS8A 4A3VA 1NZNA 4GPMA 3FU6A 2X6JA 4JPSA 3RIBA 3NOGD 3CKCA 3TAXA 3TXMA 5EKQD 2IJGX 4I43A 1E90A 3KEZA 4CDRA 2X6FA 2CG3A 3BU8A 1OWMA 1TN6A 4GAAA 1DC2A 1GW6A 1ZU2A 4UWKA 4BY6A 4HB5A 3ZYMA 5ENPD 4DRXE 3EHNA 1N52A 3Q15A 5D0OD 3APFA 4I2WA 3Q5MA 3PZDA 4EHMA 1N4SA 2EIKE 3U3WA 1QQEA 2WMOA 4G2VA 3TWVA 1N0QA 2KATA 4APFA 3EDTB 3PS6A 3RKVA 1H2UA 4U07A 5FQ8A 3TWRA 2XHEA 4K03A 3V2OA 5CEDB 1OCRE 2DYRE 3QAQA 3VTYA 4JC8A 4WAFA 4V3IA 4IRUA 4JW1A 3FHEA 2VYIA 4DX2A 5FWQA 1UW4B 3FUKA 3D9MA 3G2WA 2YHEA 2IY0C 4KT6B 2BF0X
chains in the Genus database with same CATH topology
2WXNA 1U3DA 2J9QA 2I6HA 4I1MA 4RSYA 2KCVA 2XCCA 2X38A 3AU5A 3CHOA 1E7VA 2JEKA 3G2TA 4GMJA 3FUJA 4XX5A 3RU0A 2VGXB 3GZ1A 4MLPA 3VLFA 5LCWJ 3IEGA 4JXTA 4G26A 4GZ3A 3CVWA 1E7UA 3PEUB 3LDZA 2JLBA 5FQ6A 1WM5A 5A6CA 1PAQA 3OXFA 5KCMA 2V0PA 4XIFA 4UQZA 4F53A 4PH4B 3ASGA 4N5CA 1HO8A 5EX3A 2KZTA 3MX3A 5BV1A 3CHRA 4XZ4A 4FU3A 2AXZA 3CQGB 3ML9A 3UUXA 3AS4A 4DLQA 4YNDA 1H6KA 2J4BA 2Q7FA 3ZEFA 3CVLA 5A23A 1QZ2A 4I17A 2QY7A 1OWNA 1NA0A 3FTSA 2IFUA 3D9LA 4KZCA 4XE0A 2HYZA 5EX0A 5ARGA 2LSUA 2VSXE 2V4LA 5M72A 2V5FA 4HXIA 4OYSA 4GB9A 3CSTA 1TEZA 3L54A 1HFAA 4I2ZA 2HR2A 2I1KA 3SGHA 3HYMB 3ENEA 4N39A 4B8AA 3ASDA 1QNFA 4APOA 5J08A 1Z3XA 2M63A 4UWFA 3UPVA 3O4ZA 1HZ4A 4E85A 2CHZA 4L7TA 3HVEA 3KAEA 2DBAA 2E0IA 4P29A 2KZTB 3PRZA 4JVSA 3ONKA 3AS8A 3D9OA 4FC8A 4URKA 4DPRA 2AWIA 2J08A 3PE3A 4L1BA 4G25A 3APCA 4OVUA 4TRQA 4TUUA 3RRNB 5AIJA 2WXQA 5KJLA 4HOUA 4HLEA 3I3NA 3UMVA 2WQ7A 1KT1A 3B7TA 5LOZA 3N71A 3DPDA 1SZAA 3FTZA 4Y6WA 3ZYLA 1H0AA 3MV2B 2XPIA 1OUVA 1JWFA 4DLOA 4ABNA 4CT4A 1HG2A 4A1GA 2FEZA 4UI9C 1IQRA 3GW4A 2Y4UA 4IULA 4I6EA 4UQXA 2WQHA 1SZ9A 4F3VA 3LEWA 5ANLA 1UJJA 4C0EA 4F7AA 3ULQA 2WXJA 4F1SA 1WY6A 3B7UX 4I9EA 4BWRA 3QWVA 2I2OA 3S7FA 4B94A 3HVEB 2L9BA 3CR3A 3CK8A 3RK6A 2IQCA 3WXXA 3CGHA 4AVXA 2I9CA 2IOLA 2IU1A 3CVUA 4BX8A 4U0SA 4DI3A 2EQXA 2BTDA 2LAIA 3OAWA 3ZW3A 4Q94A 5CHEE 4R7LA 3ASFA 2X6IA 5AENA 3FUDA 2WQ6A 4FJYA 3B7RL 3D3MA 4TV3A 3O48A 2YINA 1XGWA 3TGOA 2WXRA 1MQSA 2XCBA 3QC1A 4AM9A 3U4TA 4UWGA 3QK0A 1ELWA 3KD7A 4AY5A 3LYAA 3IBEA 3U64A 3U9WA 4LEUA 1DVPA 5LCWC 4CDNA 3CIAA 3SBSA 4B0ZA 3R9AB 3ASHA 4AIFA 5BPPA 3Q49B 3I4RB 2V8SE 3FY4A 2A4ZA 4UI9J 4J8DA 3CHSA 2IOSA 2KCKA 4NACA 4HFGA 2PM7A 1B89A 2VGXA 4A1SA 2IF4A 2PQRA 4L2LA 2XRYA 4LUNU 2GRMA 3L16A 2KM4A 4EZLA 3S7DA 4JEUA 2NXPA 3LY9A 3ML8A 2UY1A 1HF8A 4J8EA 4EECA 1KT0A 4C0MA 3ESLA 2QFCA 3JUIA 3CEQA 4UI9K 3FP3A 4GA1A 3ZN3A 2YHCA 1UJKA 3LJ3A 3B13A 3MA5A 4UWHA 2NSZA 4E6HA 3ZPJA 4KXKB 4NQ0A 4GZ5A 3TXNA 4G11A 3CSFA 3D9IA 4CRWA 3NZUA 4HVBA 5AJLA 3AS5A 3TG4A 2VSOE 3UT7A 1PC2A 1HH8A 3QJZA 3SNXA 3UT8A 1Y8MA 3FEYA 4FP7A 2A5UA 3JQ0A 3LVQE 1TJCA 2YNQA 2GW1A 2J09A 3JQ1A 3S2AA 4ACLA 2XQ0A 4K0RA 3IHYA 4BTBA 4GYYA 1N54A 4AY6A 3FUMA 4JL0A 4PUCA 3ESKA 5CCMA 2UY1B 3FH8A 2Y4TA 4I6GA 4GYWA 5FZRA 4J8SA 3D9KA 4W9RA 4DJAA 4PDXA 2L0TB 1UG3A 2NC9A 4FHJA 2GRLA 3FUEA 2WXPA 2ZU6B 3HIZA 2E2EA 5AJDA 1Y6IA 3MKQA 5FZQA 2VGYA 4RVBA 2CHXA 5JJTA 1IQUA 3P1UA 3D9JA 1E8WA 2WVIA 4UWLA 3FUIA 4LCTA 4BX9A 3T8MA 3LY7A 4ILGA 4GU5A 1UN9A 4C9BB 4PS3A 4XKCA 5LFAA 4ANWA 4JEHA 1PY1A 4AEZC 3DBSA 3FUHA 3UQ3A 4Y6CA 3ZXSA 4B89A 5ANRA 2OV8A 4H7YA 2IONA 2OVFA 2XGOA 4U63A 3QARA 3QDNA 3APDA 3FWVA 3HHMA 3NF1A 4FJZA 1OWLA 1YA0A 4NRHB 2XEVA 2LO6A 3L08A 5E75A 3MKQB 1JUQA 2J07A 3LXUX 3QWWA 2HO1A 4L2YA 3UT4A 4AV7A 3JCKC 3VTXA 3QB2A 3FTYA 2LAHA 2OOEA 3CVQA 3L22A 4WNGA 4WUYA 4JA9A 4ILIA 5BUZA 3LPZA 2J49A 1FVFA 3I4GA 2R17C 5G04J 4ACKA 3LY8A 4G1TA 1JPLA 4Q96A 2L0IA 3FU3A 4WNEA 3CKBA 5G55A 3G2UA 1TJFA 4GZDA 4I1AA 5ARFA 3ZIMA 4N3BA 3GZ2A 4XI0A 1OWPA 4LRZA 3SD5A 1SQMA 1EPUA 3CV0A 5C2YA 1HU3A 2CFUA 3PUKA 5G2NA 3ZRHA 3Q47B 4U04A 5ENNA 2CHWA 1Z3YA 3SFZA 3U66A 3EJNA 4OVVA 4YVQC 4AXHA 1U3CA 3E4BA 1ZBPA 4AOFA 3RJVA 2FF4A 2WMNA 4U0ZA 3GYZA 1FCHA 4GMLA 3CVYA 1E8ZA 3OXGA 4EPZA 4GCNA 5BNWA 5EDSA 2X3MA 3PE4A 4KVMA 1IHGA 1MHQA 4ANUA 1W3BA 4GPKA 2XRZA 4JHKA 1JWGA 3ZHEA 2VSNA 1WAO1 1ELRA 1OWOA 3PVLA 3EIQC 3D9NA 3BG1B 4BFRA 2UWJG 3T5VA 4N2QA 4FHKA 2MOWA 4J6IA 4JHJA 4KMOA 2DIWA 3CVNA 3VLDA 5KJKA 2LSVA 1NA3A 3Q4AB 4N3CA 3G2SA 4JHRA 1UN8A 4WWNA 4CT0A 3K9IA 1VDYA 2WB2A 4A3TA 1HG5A 3T5XA 3BEEA 5KJMA 1HX8A 1HS6A 2FBNA 2FI7A 2VQ2A 5A7DB 4IYPA 2BUGA 3FTXA 5FQ4A 3CHMA 3PH0C 1IYGA 2CFZA 3FULA 3ZYQA 4CGVA 3ZHEB 4ME2A 4G23A 3IHVA 3SZ7A 4BSXA 3G2VA 2OVBA 5J90A 2C2LA 3MCXA 3PREA 4GA2A 3FUFA 2FULA 3EIJA 4QFVA 5G05C 4D10C 1E8XA 1LF8A 3LVRE 3AU4A 4YVOA 3RRUA 3TL5A 4CEMA 3CHPA 1H2VC 3CVVA 5JHBA 3CVXA 2WXLA 3PNLB 4WNDA 2RD0A 3FFLA 5FQ7A 3FEXA 1FVHA 2PQNA 3FH7A 2GGFA 4J0UA 2J4DA 2VSYA 4GZCA 2I1JA 2X6KA 3PNTB 2WXMA 3RRMB 2WXFA 2PM6A 5E76A 4IN3B 3HDXA 3QNKA 3FH5A 1H19A 3QKYA 2DCPA 3LKUA 5G04C 4BT8A 4J8FA 4DI4A 4HS2A 1NP7A 2MHKA 4KVOA 1P5QA 5BW8C 4A55A 3FU0A 1E8YA 2C0LA 4JA7A 3C98A 5BV0A 5LP0A 1L5JA 3IKOB 4RG9A 3LS8A 5FJYA 3ZFWA 4DK5A 3OTNA 4GYOA 4I9CA 1X5BA 3MV3B 5T3RA 5T8IA 5G05J 4I6JA 3SF4A 4ANVA 2AXVA 5LX8A 1A17A 4MRUA 3CVPA 3FTUA 5T4YA 5JJ6A 2YQ8A 2L6JA 3I5PA 4JZYA 4B8CB 2P58C 3ZYKA 1E96B 5AYWD 2X6HA 5CMWA 3R7RA 4WWPA 3CQCB 4WNFA 5FT9A 3FTWA 3MYVA 4GCOA 2MRIA 2WXHA 5HI7A 3QOUA 4BT9A 4EZJA 1KLXA 2WXGA 1H2TC 2XGMA 4N3AA 4EBAA 4PS8A 4G24A 2AXUA 4A3VA 1NZNA 4HOSA 3FU6A 4Q69A 2X6JA 4JPSA 3RIBA 3FUNA 1S0PA 3CKCA 3FU5A 1BPOA 3TAXA 4EBAG 3TXMA 5BT1A 4GZ6A 5EKQD 4HORA 4RG6A 4MS6A 3IV0A 2XPYA 2IJGX 2WXKA 4I43A 3L6AA 2AVPA 1E90A 5KJNA 3KEZA 3EHMA 4M3OA 4CDRA 2X6FA 3BG0B 2CG3A 1OWMA 3MEKA 3CK9A 1XNFA 4GAAA 2FO7A 4ANXA 3CK7A 4GA0A 1GW6A 5CCLA 2RG8A 1ZU2A 4FLBA 4BTAA 1HE8A 4KBQA 4UWKA 4BY6A 4ILHB 3FDHA 3LCAA 3ZYMA 3GZSA 3OXLA 3S7JA 3ONLA 5JHAA 3CLJA 3EHNA 2R59A 2HM8A 3TG5A 3MZLB 5HQ8A 4EQFA 1N52A 2WM9A 1INZA 2R5SA 1Z6TA 5FZSA 2C0MA 3Q15A 5D0OD 3APFA 3SBTB 4I2WA 4CDMA 4KZ0A 2Y3AA 3Q5MA 2XPZA 4L23A 5C1DA 4UQYA 3UX4A 4CCAA 4PS7A 3MKRA 3PZDA 3R7QA 3PUJA 2WPVA 4FA6A 3NQPA 3QWPA 2VTBA 1EF1C 4AP2A 4HOTA 3MGBA 4FADA 3U3WA 1QQEA 2WMOA 4G2VA 5DIZA 4U8HA 4CGWA 3L17A 5DBKA 1EDUA 3D9PA 1DNPA 3PEVB 2KATA 4H7XA 4KYOB 5JJ7A 4U0UA 4APFA 2LNIA 2XGSA 3EDTB 3PS6A 3JYSA 4NURA 3S7BA 3SI5A 3RKVA 1H2UA 4U07A 4ATGA 3FTVA 5FQ8A 2KCLA 2CG2A 3NZSA 2XHEA 4LERA 4K03A 4AJWA 4O6FA 4EZKA 4FULA 4I1OB 3SHFA 3QAQA 5FTPA 3VTYA 3RO2A 3L13A 4JC8A 2VJ8A 4V3IA 4WAFA 4N2SA 2WXIA 4IRUA 4JW1A 2PZIA 2ILRA 3ZGQA 4XI9A 4WWOA 3ZVVA 3RO3A 2VTBB 3P2BA 5D0QD 3FHEA 2ONDA 1EYHA 2VYIA 3CHQA 3MJWA 2PL2A 3PDNA 4FLHA 4XKBA 4HOQA 1HXIA 3B7SA 3VLEA 2AW6A 5FWQA 1UW4B 4MKTA 1ELKA 3FUKA 3D9MA 3G2WA 3KS2A 5CMYA 3URZA 2WXOA 2KC7A 2YHEA 3TJPA 4KT6B 2BF0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9Q A;  2I6H A;  2KCV A;  2XCC A;  3RU0 A;  2VGX B;  3GZ1 A;  5LCW J;  3IEG A;  4G26 A;  4GZ3 A;  2JLB A;  1WM5 A;  5A6C A;  3OXF A;  4XIF A;  4UQZ A;  3ASG A;  4N5C A;  5EX3 A;  3UUX A;  3AS4 A;  4YND A;  2Q7F A;  3CVL A;  1QZ2 A;  4I17 A;  1NA0 A;  5EX0 A;  2IFU A;  2HYZ A;  5ARG A;  2LSU A;  5M72 A;  2V5F A;  4I2Z A;  2HR2 A;  3HYM B;  4N39 A;  3ASD A;  4APO A;  3UPV A;  1HZ4 A;  3KAE A;  2DBA A;  3AS8 A;  3PE3 A;  4G25 A;  5KJL A;  4HOU A;  1KT1 A;  3N71 A;  4Y6W A;  3MV2 B;  2XPI A;  1OUV A;  4ABN A;  2FEZ A;  4UI9 C;  3GW4 A;  2Y4U A;  4UQX A;  2WQH A;  4F3V A;  3ULQ A;  4I9E A;  4BWR A;  3QWV A;  3S7F A;  4B94 A;  3CK8 A;  3WXX A;  4U0S A;  5CHE E;  3ASF A;  3O48 A;  3TGO A;  2XCB A;  4AM9 A;  3U4T A;  1ELW A;  3KD7 A;  4AY5 A;  3LYA A;  4LEU A;  5LCW C;  3R9A B;  3ASH A;  4AIF A;  3Q49 B;  4UI9 J;  4J8D A;  2KCK A;  1B89 A;  2VGX A;  4A1S A;  2IF4 A;  2PQR A;  3S7D A;  3LY9 A;  2UY1 A;  4J8E A;  1KT0 A;  2QFC A;  4UI9 K;  3CEQ A;  3FP3 A;  4GA1 A;  3ZN3 A;  2YHC A;  3MA5 A;  3ZPJ A;  4KXK B;  4NQ0 A;  4GZ5 A;  3AS5 A;  3TG4 A;  1PC2 A;  1HH8 A;  1Y8M A;  1TJC A;  4BTB A;  2GW1 A;  4GYY A;  4AY6 A;  4JL0 A;  3ESK A;  5CCM A;  2UY1 B;  5FZR A;  2Y4T A;  4GYW A;  4W9R A;  2NC9 A;  2E2E A;  5FZQ A;  2VGY A;  5JJT A;  3LY7 A;  3UQ3 A;  4Y6C A;  4H7Y A;  2XGO A;  3QDN A;  3FWV A;  3NF1 A;  1YA0 A;  4NRH B;  2XEV A;  3QWW A;  2HO1 A;  3VTX A;  2OOE A;  3CVQ A;  4WNG A;  4WUY A;  4JA9 A;  3LPZ A;  5G04 J;  3LY8 A;  4G1T A;  4WNE A;  3CKB A;  4I1A A;  5ARF A;  4N3B A;  3GZ2 A;  4XI0 A;  3CV0 A;  3Q47 B;  4U04 A;  4YVQ C;  3E4B A;  1ZBP A;  3RJV A;  2FF4 A;  4U0Z A;  3GYZ A;  1FCH A;  3OXG A;  4GCN A;  5BNW A;  3PE4 A;  1IHG A;  1W3B A;  4GPK A;  3ZHE A;  2VSN A;  1WAO 1;  1ELR A;  2UWJ G;  4N2Q A;  3CVN A;  5KJK A;  2LSV A;  1NA3 A;  3Q4A B;  4N3C A;  4JHR A;  3K9I A;  3BEE A;  5KJM A;  2FI7 A;  2VQ2 A;  2FBN A;  5A7D B;  2BUG A;  1IYG A;  4CGV A;  3ZHE B;  4ME2 A;  4G23 A;  3SZ7 A;  2C2L A;  4GA2 A;  5G05 C;  4YVO A;  4WND A;  3FFL A;  2PQN A;  4J0U A;  2VSY A;  4IN3 B;  3QKY A;  3LKU A;  5G04 C;  4BT8 A;  4J8F A;  2MHK A;  1P5Q A;  5BW8 C;  2C0L A;  4JA7 A;  4RG9 A;  5FJY A;  3ZFW A;  4GYO A;  4I9C A;  3MV3 B;  5G05 J;  3SF4 A;  1A17 A;  3CVP A;  5JJ6 A;  2YQ8 A;  2L6J A;  2P58 C;  1E96 B;  5AYW D;  4WNF A;  5FT9 A;  4GCO A;  4BT9 A;  5HI7 A;  3QOU A;  1KLX A;  4N3A A;  2XGM A;  4G24 A;  1NZN A;  4HOS A;  3RIB A;  3CKC A;  3TAX A;  5BT1 A;  4GZ6 A;  5EKQ D;  4HOR A;  4RG6 A;  2AVP A;  5KJN A;  4CDR A;  3MEK A;  3CK9 A;  1XNF A;  2FO7 A;  3CK7 A;  4GA0 A;  5CCL A;  4BTA A;  1ZU2 A;  4KBQ A;  3LCA A;  3OXL A;  3S7J A;  3TG5 A;  5HQ8 A;  4EQF A;  2R5S A;  5FZS A;  2C0M A;  3Q15 A;  5D0O D;  4I2W A;  3Q5M A;  5C1D A;  4UQY A;  3MKR A;  2WPV A;  3QWP A;  4HOT A;  3U3W A;  1QQE A;  4G2V A;  5DIZ A;  4CGW A;  5DBK A;  2KAT A;  4H7X A;  4KYO B;  5JJ7 A;  4U0U A;  2LNI A;  2XGS A;  3EDT B;  3JYS A;  3S7B A;  3RKV A;  4U07 A;  2KCL A;  4O6F A;  5FTP A;  3VTY A;  3RO2 A;  4N2S A;  2PZI A;  3ZGQ A;  4XI9 A;  3RO3 A;  5D0Q D;  2OND A;  2VYI A;  3PDN A;  2PL2 A;  4HOQ A;  1HXI A;  3URZ A;  3KS2 A;  2KC7 A; 
#chains in the Genus database with same CATH topology
 1U3D A;  3PZ2 A;  4I1M A;  4GTQ A;  3RU0 A;  3VLF A;  5LCW J;  4JXT A;  4GZ3 A;  1E7U A;  3NB2 A;  1WM5 A;  1PAQ A;  2BKK B;  1HO8 A;  3ABL E;  1OXJ A;  4XZ4 A;  5AQ9 A;  2AXZ A;  3CQG B;  2GRP B;  1H6K A;  1QZ2 A;  3FTS A;  5EX0 A;  2IFU A;  5M72 A;  2V4L A;  2V5F A;  1TN8 A;  1HFA A;  2I1K A;  3SGH A;  2LXM A;  3ENE A;  4B8A A;  4U96 D;  1QNF A;  4APO A;  4UWF A;  3UPV A;  3O4Z A;  4G8K A;  3HVE A;  2DBA A;  3AS8 A;  2AWI A;  3PE3 A;  4OVU A;  5AIJ A;  5KJL A;  4HLE A;  5LOZ A;  1K8K G;  3N71 A;  1SZA A;  1YMP A;  3ZYL A;  3MV2 B;  4DLO A;  5CEA A;  1SZ9 A;  3LEW A;  4F7A A;  1UJJ A;  3Q75 A;  4RLY A;  3HXB A;  2WXJ A;  1WY6 A;  1MX6 A;  3ZU7 B;  1O5M A;  3RK6 A;  2I9C A;  4BX8 A;  2J8S D;  2EQX A;  1N4Q A;  5FIN A;  2GRO B;  4GTO A;  2YIN A;  3TGO A;  1MQS A;  2XCB A;  3U4T A;  1SW6 A;  3U64 A;  1MX2 A;  5LCW C;  3SO8 A;  4BES A;  1S63 A;  1OCC E;  5ITZ F;  4NAC A;  4HFG A;  2VGX A;  4A1S A;  2KM4 A;  3S7D A;  2LUH A;  3J5Q B;  4CZ2 D;  2QFC A;  4UI9 K;  3HXC A;  3E33 A;  2P9S G;  3MA5 A;  4KXK B;  3ULY A;  3CSF A;  3NZU A;  3TG4 A;  3QJZ A;  1Y8M A;  2A5U A;  4ACL A;  2EIM E;  1LD8 A;  4GYY A;  4AY6 A;  3FUM A;  1NFI E;  3ESK A;  5CCM A;  2UY1 B;  3FH8 A;  4GYW A;  4DJA A;  4PDX A;  2GRL A;  2WXP A;  2E2E A;  1Y6I A;  2CHX A;  5JJT A;  3D9J A;  4UWL A;  2IO2 C;  3FUI A;  4LCT A;  3LY7 A;  4GU5 A;  4C9B B;  4ANW A;  3DBS A;  3UQ3 A;  3ZXS A;  5ANR A;  4H7Y A;  3ZNG A;  3HHM A;  4GTM A;  1OWL A;  5E75 A;  2J07 A;  5EID A;  2HO1 A;  2LAH A;  3L22 A;  1N4R A;  4ILI A;  5BUZ A;  5ENT D;  4HBD A;  1TJF A;  3HRA A;  1FT1 A;  2Y1L E;  5G2N A;  2AJA A;  1Z3Y A;  2XS1 A;  2OCC E;  5BXU A;  2FF4 A;  2NYJ A;  5JA4 D;  3CVY A;  4EPZ A;  2JAB A;  2X3M A;  4KVM A;  1IHG A;  5KBA A;  3B95 A;  3EIQ C;  1NA3 A;  4JHR A;  1VDY A;  1HG5 A;  3T5X A;  3SFY A;  4J7W A;  3EUV A;  4F1P A;  3CHM A;  2P9N G;  3FUL A;  3UKR G;  3JUE A;  4CGV A;  3ZHE B;  4ME2 A;  4BSX A;  5J90 A;  1LF8 A;  3CVV A;  3L9T A;  2WXL A;  4WND A;  2Y0B G;  3FFL A;  4LNU D;  2I1J A;  1N0R A;  4HNA D;  2WXM A;  2WXF A;  5E76 A;  3FH5 A;  4J8F A;  4A55 A;  1E8Y A;  4JA7 A;  3C98 A;  5BV0 A;  3TWX A;  3LS8 A;  4CYM D;  5FJY A;  5T3R A;  5T8I A;  3SF4 A;  1A17 A;  1K1B A;  3CVP A;  3I5P A;  4B8C B;  2P58 C;  2RFA A;  2P9L G;  5CMW A;  3R7R A;  2PNN A;  3FTW A;  2MRI A;  1KLX A;  2WXG A;  4N3A A;  2XGM A;  4EBA A;  4TXR A;  2AXU A;  2Y69 E;  4ZFH A;  1N9A A;  2XPY A;  4OAV B;  5AQB A;  2OEV A;  2FO7 A;  3AG4 E;  5CCL A;  4KBQ A;  1U2V G;  1G3N B;  5BXO A;  3ONL A;  3CLJ A;  4HLL A;  2R59 A;  2HM8 A;  5HQ8 A;  3MZL B;  1OCO E;  2R5S A;  1DCQ A;  3SBT B;  4KZ0 A;  3ABK E;  2XPZ A;  1AP7 A;  3UX4 A;  3MKR A;  3NQP A;  3QWP A;  3MGB A;  4U8H A;  5DBK A;  1EDU A;  2LNI A;  4NUR A;  4K5A B;  3S7B A;  4HRM B;  2A5E A;  3NZS A;  4O6F A;  4I1O B;  3SHF A;  2RKK A;  3ZGQ A;  4XI9 A;  3EU9 A;  3P2B A;  3CHQ A;  4HOQ A;  4TXQ A;  1HXI A;  4MKT A;  3KS2 A;  2XS8 A;  2WXN A;  2I6H A;  3AU5 A;  3X2Q E;  2JEK A;  3G2T A;  4MLP A;  3CVW A;  3BUA A;  5FQ6 A;  2JLB A;  5A6C A;  5D2M C;  2V0P A;  1O1R A;  1N94 A;  4F53 A;  3EHQ A;  1OCZ E;  3C3R A;  4N5C A;  3C72 A;  3AS4 A;  1SA5 A;  4YND A;  2J4B A;  2Q7F A;  1OWN A;  2HYZ A;  2LSU A;  4HXI A;  4OYS A;  1JCQ A;  2R03 A;  2P9K G;  1HZ4 A;  2CHZ A;  2KZT B;  4FC8 A;  4URK A;  4DPR A;  3RRN B;  4G25 A;  3APC A;  1WG0 A;  4TUU A;  4HOU A;  2WQ7 A;  4U95 D;  3B7T A;  3DPD A;  3FTZ A;  3HG0 D;  1DCE A;  4Y6W A;  4LNB A;  2QYU A;  2XPI A;  2Y4U A;  4IUL A;  3KEA A;  3TWW A;  4C0E A;  4O1O A;  4F1S A;  3B7U X;  3QWV A;  4B94 A;  5EYP F;  4AVX A;  2IOL A;  2BTD A;  3OAW A;  1TYQ G;  4R7L A;  5AEN A;  2X6I A;  4BER A;  4TV3 A;  2WXR A;  3KD7 A;  3DSV A;  3IBE A;  5EIB E;  3U9W A;  4LEU A;  3CIA A;  3SBS A;  4B0Z A;  1FPP A;  3DSX A;  3I4R B;  1N4P A;  2IOS A;  3TWQ A;  4NIK A;  3LJN A;  4EZL A;  2B6C A;  2NXP A;  3LY9 A;  2UY1 A;  2KBX A;  1HF8 A;  4EEC A;  3ESL A;  3FP3 A;  2OEW A;  2YHC A;  4DX1 A;  1UJK A;  2NSZ A;  4E6H A;  4NQ0 A;  4G11 A;  3D9I A;  4HVB A;  5AJL A;  2B0O E;  3AS5 A;  2VSO E;  3UT7 A;  2ETC A;  1NL4 A;  3SNX A;  3UT8 A;  3NOC D;  3ISM C;  3LVQ E;  2YNQ A;  3S2A A;  2J09 A;  4K0R A;  1WDY A;  5EYL A;  1N54 A;  4I6G A;  3Q73 A;  3D9K A;  5B1B E;  2ZU6 B;  3F6Q A;  3AG1 E;  2ETB A;  4RVB A;  1IQU A;  4BX9 A;  3KSQ A;  4JEH A;  4X8Q A;  3ASO E;  2OV8 A;  4U63 A;  3APD A;  1H6O A;  1LTX A;  3NF1 A;  1YA0 A;  4NRH B;  2H6G A;  3LXU X;  3QB2 A;  2OOE A;  1KZP A;  1FVF A;  3I4G A;  5G04 J;  4ACK A;  3LY8 A;  4G1T A;  2L0I A;  3G2U A;  1Z5S C;  3ZIM A;  4N3B A;  3GZ2 A;  2EIL E;  4XI0 A;  2R2L A;  3CV0 A;  4N5Q A;  5ENN A;  3SFZ A;  3EJN A;  3E4B A;  1FCH A;  3PE4 A;  1MHQ A;  4B93 B;  3ZHE A;  2VSN A;  5KNG A;  4GMR A;  3PVL A;  3D9N A;  4FHK A;  4BSZ B;  4N3C A;  3G2S A;  4GTV A;  4WWN A;  3K9I A;  4BET A;  2WB2 A;  4A3T A;  5KJM A;  1HX8 A;  1HS6 A;  5A7D B;  2DVW A;  4DX7 D;  3RAU A;  4IYP A;  3UXG A;  2ZXW E;  3PH0 C;  3UIN C;  2EIN E;  3G2V A;  3PZ4 A;  3MCX A;  3PRE A;  2FUL A;  1E8X A;  3RRU A;  3TL5 A;  3CHP A;  1H2V C;  3CVX A;  3L82 A;  5EIL A;  3FEX A;  2PQN A;  4J0U A;  2X6K A;  3RRM B;  1QYM A;  5B3S E;  3HDX A;  1H19 A;  5G04 C;  2QC9 A;  2DYS E;  2R05 A;  2C0L A;  5LP0 A;  3ZFW A;  3OTN A;  1X5B A;  5LX8 A;  3FTU A;  5JJ6 A;  4JZY A;  5CBN A;  3UM3 A;  3MYV A;  2WXH A;  4EZJ A;  4G24 A;  4HOS A;  1MYO A;  1JCR A;  4Q69 A;  1S0P A;  2GRN B;  1BPO A;  5BT1 A;  4GZ6 A;  4HOR A;  4RG6 A;  4MS6 A;  2AVP A;  1BD8 A;  5KJN A;  3EHM A;  4M3O A;  3BG0 B;  3MEK A;  3CK9 A;  1XNF A;  4ANX A;  4GA0 A;  2BED A;  2RG8 A;  4ILH B;  3LCA A;  3GZS A;  3OXL A;  4GTT A;  3S7J A;  1INZ A;  2ZGG A;  4EQF A;  5H7P A;  5FZS A;  4K5C A;  3ULE G;  5AAO A;  2VGE A;  4L23 A;  5C1D A;  4UQY A;  2EIJ E;  2WPV A;  1TNY A;  5DIZ A;  3L17 A;  1DNP A;  3PEV B;  4KYO B;  5JJ7 A;  4U0U A;  2ZIR A;  2XGS A;  1D8E A;  3SI5 A;  4ATG A;  3FTV A;  2KCL A;  4AJW A;  3EHR A;  3HXE A;  4EZK A;  4FUL A;  3RO2 A;  3L13 A;  2VJ8 A;  2ILR A;  2DZO A;  1X81 A;  2VTB B;  3PDN A;  2PL2 A;  2V5Q C;  3PZ3 A;  1OY3 D;  2AW6 A;  3URZ A;  2WXO A;  2KC7 A;  1MZC A;  3W9G A;  2J9Q A;  4RSY A;  2XCC A;  2X38 A;  4K5B A;  4G8L A;  1E7V A;  5IY5 E;  1BI7 B;  4GMJ A;  2VGX B;  3IEG A;  4G26 A;  3PEU B;  3LDZ A;  3OXF A;  3UI2 A;  4PH4 B;  2KZT A;  3MX3 A;  3CHR A;  4FU3 A;  3NBN B;  4DLQ A;  5A23 A;  4I17 A;  2QY7 A;  4XE0 A;  1NA0 A;  4KZC A;  5ARG A;  2IO3 C;  1TNZ A;  5CER B;  3CST A;  1TEZ A;  4I2Z A;  2HR2 A;  4N39 A;  1Z3X A;  4E85 A;  4L7T A;  4RQI A;  3KAE A;  4P29 A;  4JVS A;  1D9S A;  4L1B A;  2WXQ A;  2KXP C;  3I3N A;  3UMV A;  1KT1 A;  1H6P A;  3UTM A;  4ABN A;  4CT4 A;  1HG2 A;  4UI9 C;  3GW4 A;  4UQX A;  3DSS A;  1ZB1 A;  2XEE A;  3ULQ A;  3V30 A;  3DST A;  4BWR A;  2H6H A;  2I2O A;  3S7F A;  3TWU A;  2L9B A;  3CK8 A;  3Q9U C;  3CVU A;  4GTS A;  3NAW A;  3T9K A;  2LAI A;  1K3Z D;  4Q94 A;  3DWL G;  2GRQ B;  4HRL A;  2WQ6 A;  4FJY A;  2P2C P;  3B7R L;  3O48 A;  1XGW A;  3QC1 A;  3DEO A;  4AY5 A;  3LYA A;  1DVP A;  2IEJ A;  3Q49 B;  2V8S E;  4J8D A;  3CHS A;  2KCK A;  2PM7 A;  1B89 A;  2PQR A;  4L2L A;  2XRY A;  3L16 A;  4M7C A;  1KT0 A;  5AQ7 A;  3JUI A;  3CEQ A;  3ZN3 A;  3LJ3 A;  3TXN A;  4CRW A;  2FO1 E;  3FEY A;  4FP7 A;  3JQ0 A;  3JQ1 A;  1IKN D;  3IHY A;  3E30 A;  4JL0 A;  4PUC A;  1LD7 A;  2Y4T A;  2LXL A;  4J8S A;  4ATZ D;  1UG3 A;  2NC9 A;  3FUE A;  3D9H A;  5ENO D;  4DX6 D;  1TNU A;  3ZXP A;  1BLX B;  1UN9 A;  4XKC A;  3UIO C;  4AEZ C;  1PY1 A;  3ASN E;  4B89 A;  4GTP A;  2OVF A;  4QQI A;  3QDN A;  4FJZ A;  2LO6 A;  3MKQ B;  1JUQ A;  4L2Y A;  3JCK C;  3VTX A;  3FTY A;  3CVQ A;  4JB8 P;  4WNG A;  4WUY A;  3DRA A;  4JA9 A;  3LPZ A;  1JPL A;  4I1A A;  5ARF A;  1V55 E;  1OWP A;  4LRZ A;  1TN7 A;  1SQM A;  1EPU A;  5C2Y A;  3SD5 A;  1HU3 A;  3PUK A;  3Q47 B;  3DEP A;  4C48 B;  4AOF A;  3RJV A;  4U0Z A;  3GYZ A;  4GML A;  3V2X A;  4GCN A;  5EDS A;  3UM1 A;  4ANU A;  1W3B A;  1S64 A;  2XRZ A;  4JHK A;  1JWG A;  1WAO 1;  1ELR A;  1OWO A;  1MJ0 A;  2UWJ G;  4N2Q A;  1NI1 A;  2MOW A;  4J6I A;  5KWD A;  4JHJ A;  3CVN A;  5KJK A;  3JXJ A;  3ABM E;  1D8D A;  3Q79 A;  3Q7F A;  3FTX A;  2CFZ A;  1FT2 A;  3ZYQ A;  4YDE A;  4G23 A;  1RW2 A;  2OVB A;  3DSU A;  2C2L A;  1O1T A;  4A63 B;  3EIJ A;  5G05 C;  4GTR A;  3AU4 A;  4CEM A;  3E34 A;  5JHB A;  4LNG A;  2RD0 A;  5FQ7 A;  1FVH A;  4GZC A;  3B7B A;  3AG2 E;  3T8K A;  2DZN A;  4IN3 B;  4YDO A;  4BEP A;  3QNK A;  2DCP A;  3LKU A;  4BT8 A;  4DI4 A;  1NP7 A;  2MHK A;  3DXK G;  4KVO A;  1P5Q A;  3FU0 A;  5CRU A;  2H6F A;  1N11 A;  1L5J A;  4UUC A;  4RG9 A;  5FIO A;  4DUI A;  4GYO A;  4I9C A;  2AXV A;  4MRU A;  5T4Y A;  3JXI A;  2YQ8 A;  3E32 A;  2HE0 A;  4OAU C;  2F37 A;  4WWP A;  3C3O A;  3CQC B;  4WNF A;  4GCO A;  5HI7 A;  3EU5 A;  2V4H C;  3FUN A;  3FU5 A;  4EBA G;  2F0Y A;  3IV0 A;  1IHB A;  2WXK A;  3L6A A;  1UOH A;  5ENQ D;  3CK7 A;  4FLB A;  4BTA A;  1HE8 A;  3FDH A;  1YCS B;  5JHA A;  3J5P A;  3TG5 A;  2WM9 A;  1Z6T A;  2C0M A;  2RFM A;  3W9F A;  4CDM A;  2XEN A;  2Y3A A;  5CRV A;  3KSL A;  5HS0 A;  4CCA A;  4PS7 A;  3R7Q A;  3PUJ A;  4FA6 A;  3WG7 E;  2L6B A;  2VTB A;  1EF1 C;  3Q9N C;  4AP2 A;  4HOT A;  4FAD A;  4CGW A;  4XEI G;  3D9P A;  4H7X A;  1TNO A;  3JYS A;  2CG2 A;  4YDY A;  1SVX A;  4LER A;  4LG6 A;  5FTP A;  2P9I G;  4O60 A;  3UKU G;  2WXI A;  4N2S A;  2PZI A;  4WWO A;  3ZVV A;  3RO3 A;  3AG3 E;  2MYO A;  2H6I A;  5D0Q D;  2OND A;  4XKB A;  1EYH A;  4FLH A;  3MJW A;  4LSZ E;  2P9U G;  3B7S A;  3VLE A;  5CMY A;  1ELK A;  4MBG A;  2XEH A;  3PZ1 A;  3TJP A;  5HKP A;  4YDW A;  1YYH A;  2ZGD A;  2KCV A;  3CHO A;  4TXP A;  3FUJ A;  4XX5 A;  3UIP C;  3GZ1 A;  4TUM A;  1BI8 B;  5KCM A;  4XIF A;  4UQZ A;  2R02 A;  3ASG A;  5D66 A;  5CEC B;  5EX3 A;  5BV1 A;  3ML9 A;  3UUX A;  3ZEF A;  3CVL A;  3D9L A;  2VSX E;  2GRR B;  4GB9 A;  2F8X K;  3L54 A;  3HYM B;  4U8V D;  3ASD A;  5J08 A;  1TR4 A;  2M63 A;  2E0I A;  3PRZ A;  3ONK A;  3D9O A;  2J08 A;  3Q7A A;  3SFX A;  4TRQ A;  3DPY A;  3C3Q A;  4JD2 G;  1H0A A;  1OUV A;  3UM2 A;  1JWF A;  1S70 B;  3E37 A;  4A1G A;  2FEZ A;  1IQR A;  4I6E A;  2WQH A;  4F3V A;  3RSE G;  5ANL A;  1JCS A;  4I9E A;  3HVE B;  3CR3 A;  3WXX A;  2IQC A;  3CGH A;  2IU1 A;  4U0S A;  3BQO A;  4DI3 A;  3ZW3 A;  5CHE E;  1K1A A;  3ASF A;  3FUD A;  3D3M A;  5EN5 D;  3HXF A;  4AM9 A;  4UWG A;  2ZIS A;  3QK0 A;  1ELW A;  3TWS A;  1RZ4 A;  3SQV A;  4CDN A;  3HXD A;  3R9A B;  3ASH A;  4AIF A;  5BPP A;  4UI9 J;  3FY4 A;  1V54 E;  2A4Z A;  5AQA A;  3ZUV B;  1AWC B;  1MX4 A;  2IF4 A;  4LUN U;  2GRM A;  3AJI A;  4JEU A;  3ML8 A;  3C5R A;  4J8E A;  3IXE A;  4C0M A;  4GA1 A;  3B13 A;  4UWH A;  3ZPJ A;  4GZ5 A;  2F8Y A;  1N95 A;  5ENR D;  1PC2 A;  4HI8 A;  1HH8 A;  5AAR A;  1TJC A;  4BTB A;  2GW1 A;  2BKG A;  2XQ0 A;  2XZD G;  4U8Y D;  5KNH D;  5FZR A;  4W9R A;  2L0T B;  4FHJ A;  2QZA A;  4L9P A;  3HIZ A;  5AJD A;  3MKQ A;  3AAA C;  5FZQ A;  2VGY A;  3P1U A;  1E8W A;  2WVI A;  3T8M A;  4ILG A;  5B1A E;  4PS3 A;  5LFA A;  1TNB A;  3FUH A;  4Y6C A;  2ION A;  2XGO A;  3QAR A;  5AN8 A;  3FWV A;  3UM0 A;  2XEV A;  3L08 A;  4ZHB A;  3QWW A;  3UT4 A;  4AV7 A;  2J49 A;  2R17 C;  5HRY A;  4Q96 A;  3FU3 A;  4WNE A;  3CKB A;  5G55 A;  4GZD A;  4J8Y A;  3Q78 A;  3ZRH A;  2CFU A;  3V31 A;  4U04 A;  2CHW A;  3U66 A;  4OVV A;  4YVQ C;  4AXH A;  1U3C A;  1KPS B;  1ZBP A;  1QBQ A;  2WMN A;  5CBO A;  1E8Z A;  3OXG A;  5BNW A;  3R9M A;  4GPK A;  4HQD A;  4HRN A;  1A5E A;  3BG1 B;  4BFR A;  3DSW A;  3T5V A;  4KMO A;  2DIW A;  1SA4 A;  3VLD A;  2LSV A;  3Q4A B;  2ETA A;  1UN8 A;  4CT0 A;  1IXV A;  3BEE A;  2DWZ A;  2FI7 A;  2VQ2 A;  2FBN A;  2BUG A;  4HI9 A;  4Z68 A;  5FQ4 A;  1IYG A;  3ZKJ A;  5ENS D;  3IHV A;  3SZ7 A;  1O1S A;  4GA2 A;  3FUF A;  2QYJ A;  4D10 C;  4QFV A;  4DX5 D;  3LVR E;  4YVO A;  1OT8 A;  3PNL B;  3FH7 A;  2GGF A;  2J4D A;  2VSY A;  3PNT B;  1Q2Z A;  3V79 K;  2PM6 A;  4F6R D;  3QKY A;  1BU9 A;  3SY2 A;  4HS2 A;  2P9P G;  5BW8 C;  3IKO B;  4DK5 A;  4U7E B;  2XZT G;  3MV3 B;  4O1P A;  5G05 J;  4I6J A;  3TWT A;  4ANV A;  2L6J A;  3ZYK A;  1E96 B;  3DXM G;  5AYW D;  2X6H A;  5JMN D;  5FT9 A;  4BT9 A;  3QOU A;  1H2T C;  1KZO A;  4PS8 A;  4A3V A;  1NZN A;  4GPM A;  3FU6 A;  2X6J A;  4JPS A;  3RIB A;  3NOG D;  3CKC A;  3TAX A;  3TXM A;  5EKQ D;  2IJG X;  4I43 A;  1E90 A;  3KEZ A;  4CDR A;  2X6F A;  2CG3 A;  3BU8 A;  1OWM A;  1TN6 A;  4GAA A;  1DC2 A;  1GW6 A;  1ZU2 A;  4UWK A;  4BY6 A;  4HB5 A;  3ZYM A;  5ENP D;  4DRX E;  3EHN A;  1N52 A;  3Q15 A;  5D0O D;  3APF A;  4I2W A;  3Q5M A;  3PZD A;  4EHM A;  1N4S A;  2EIK E;  3U3W A;  1QQE A;  2WMO A;  4G2V A;  3TWV A;  1N0Q A;  2KAT A;  4APF A;  3EDT B;  3PS6 A;  3RKV A;  1H2U A;  4U07 A;  5FQ8 A;  3TWR A;  2XHE A;  4K03 A;  3V2O A;  5CED B;  1OCR E;  2DYR E;  3QAQ A;  3VTY A;  4JC8 A;  4WAF A;  4V3I A;  4IRU A;  4JW1 A;  3FHE A;  2VYI A;  4DX2 A;  5FWQ A;  1UW4 B;  3FUK A;  3D9M A;  3G2W A;  2YHE A;  2IY0 C;  4KT6 B;  2BF0 X; 
#chains in the Genus database with same CATH homology
 2WXN A;  1U3D A;  2J9Q A;  2I6H A;  4I1M A;  4RSY A;  2KCV A;  2XCC A;  2X38 A;  3AU5 A;  3CHO A;  1E7V A;  2JEK A;  3G2T A;  4GMJ A;  3FUJ A;  4XX5 A;  3RU0 A;  2VGX B;  3GZ1 A;  4MLP A;  3VLF A;  5LCW J;  3IEG A;  4JXT A;  4G26 A;  4GZ3 A;  3CVW A;  1E7U A;  3PEU B;  3LDZ A;  2JLB A;  5FQ6 A;  1WM5 A;  5A6C A;  1PAQ A;  3OXF A;  5KCM A;  2V0P A;  4XIF A;  4UQZ A;  4F53 A;  4PH4 B;  3ASG A;  4N5C A;  1HO8 A;  5EX3 A;  2KZT A;  3MX3 A;  5BV1 A;  3CHR A;  4XZ4 A;  4FU3 A;  2AXZ A;  3CQG B;  3ML9 A;  3UUX A;  3AS4 A;  4DLQ A;  4YND A;  1H6K A;  2J4B A;  2Q7F A;  3ZEF A;  3CVL A;  5A23 A;  1QZ2 A;  4I17 A;  2QY7 A;  1OWN A;  1NA0 A;  3FTS A;  2IFU A;  3D9L A;  4KZC A;  4XE0 A;  2HYZ A;  5EX0 A;  5ARG A;  2LSU A;  2VSX E;  2V4L A;  5M72 A;  2V5F A;  4HXI A;  4OYS A;  4GB9 A;  3CST A;  1TEZ A;  3L54 A;  1HFA A;  4I2Z A;  2HR2 A;  2I1K A;  3SGH A;  3HYM B;  3ENE A;  4N39 A;  4B8A A;  3ASD A;  1QNF A;  4APO A;  5J08 A;  1Z3X A;  2M63 A;  4UWF A;  3UPV A;  3O4Z A;  1HZ4 A;  4E85 A;  2CHZ A;  4L7T A;  3HVE A;  3KAE A;  2DBA A;  2E0I A;  4P29 A;  2KZT B;  3PRZ A;  4JVS A;  3ONK A;  3AS8 A;  3D9O A;  4FC8 A;  4URK A;  4DPR A;  2AWI A;  2J08 A;  3PE3 A;  4L1B A;  4G25 A;  3APC A;  4OVU A;  4TRQ A;  4TUU A;  3RRN B;  5AIJ A;  2WXQ A;  5KJL A;  4HOU A;  4HLE A;  3I3N A;  3UMV A;  2WQ7 A;  1KT1 A;  3B7T A;  5LOZ A;  3N71 A;  3DPD A;  1SZA A;  3FTZ A;  4Y6W A;  3ZYL A;  1H0A A;  3MV2 B;  2XPI A;  1OUV A;  1JWF A;  4DLO A;  4ABN A;  4CT4 A;  1HG2 A;  4A1G A;  2FEZ A;  4UI9 C;  1IQR A;  3GW4 A;  2Y4U A;  4IUL A;  4I6E A;  4UQX A;  2WQH A;  1SZ9 A;  4F3V A;  3LEW A;  5ANL A;  1UJJ A;  4C0E A;  4F7A A;  3ULQ A;  2WXJ A;  4F1S A;  1WY6 A;  3B7U X;  4I9E A;  4BWR A;  3QWV A;  2I2O A;  3S7F A;  4B94 A;  3HVE B;  2L9B A;  3CR3 A;  3CK8 A;  3RK6 A;  2IQC A;  3WXX A;  3CGH A;  4AVX A;  2I9C A;  2IOL A;  2IU1 A;  3CVU A;  4BX8 A;  4U0S A;  4DI3 A;  2EQX A;  2BTD A;  2LAI A;  3OAW A;  3ZW3 A;  4Q94 A;  5CHE E;  4R7L A;  3ASF A;  2X6I A;  5AEN A;  3FUD A;  2WQ6 A;  4FJY A;  3B7R L;  3D3M A;  4TV3 A;  3O48 A;  2YIN A;  1XGW A;  3TGO A;  2WXR A;  1MQS A;  2XCB A;  3QC1 A;  4AM9 A;  3U4T A;  4UWG A;  3QK0 A;  1ELW A;  3KD7 A;  4AY5 A;  3LYA A;  3IBE A;  3U64 A;  3U9W A;  4LEU A;  1DVP A;  5LCW C;  4CDN A;  3CIA A;  3SBS A;  4B0Z A;  3R9A B;  3ASH A;  4AIF A;  5BPP A;  3Q49 B;  3I4R B;  2V8S E;  3FY4 A;  2A4Z A;  4UI9 J;  4J8D A;  3CHS A;  2IOS A;  2KCK A;  4NAC A;  4HFG A;  2PM7 A;  1B89 A;  2VGX A;  4A1S A;  2IF4 A;  2PQR A;  4L2L A;  2XRY A;  4LUN U;  2GRM A;  3L16 A;  2KM4 A;  4EZL A;  3S7D A;  4JEU A;  2NXP A;  3LY9 A;  3ML8 A;  2UY1 A;  1HF8 A;  4J8E A;  4EEC A;  1KT0 A;  4C0M A;  3ESL A;  2QFC A;  3JUI A;  3CEQ A;  4UI9 K;  3FP3 A;  4GA1 A;  3ZN3 A;  2YHC A;  1UJK A;  3LJ3 A;  3B13 A;  3MA5 A;  4UWH A;  2NSZ A;  4E6H A;  3ZPJ A;  4KXK B;  4NQ0 A;  4GZ5 A;  3TXN A;  4G11 A;  3CSF A;  3D9I A;  4CRW A;  3NZU A;  4HVB A;  5AJL A;  3AS5 A;  3TG4 A;  2VSO E;  3UT7 A;  1PC2 A;  1HH8 A;  3QJZ A;  3SNX A;  3UT8 A;  1Y8M A;  3FEY A;  4FP7 A;  2A5U A;  3JQ0 A;  3LVQ E;  1TJC A;  2YNQ A;  2GW1 A;  2J09 A;  3JQ1 A;  3S2A A;  4ACL A;  2XQ0 A;  4K0R A;  3IHY A;  4BTB A;  4GYY A;  1N54 A;  4AY6 A;  3FUM A;  4JL0 A;  4PUC A;  3ESK A;  5CCM A;  2UY1 B;  3FH8 A;  2Y4T A;  4I6G A;  4GYW A;  5FZR A;  4J8S A;  3D9K A;  4W9R A;  4DJA A;  4PDX A;  2L0T B;  1UG3 A;  2NC9 A;  4FHJ A;  2GRL A;  3FUE A;  2WXP A;  2ZU6 B;  3HIZ A;  2E2E A;  5AJD A;  1Y6I A;  3MKQ A;  5FZQ A;  2VGY A;  4RVB A;  2CHX A;  5JJT A;  1IQU A;  3P1U A;  3D9J A;  1E8W A;  2WVI A;  4UWL A;  3FUI A;  4LCT A;  4BX9 A;  3T8M A;  3LY7 A;  4ILG A;  4GU5 A;  1UN9 A;  4C9B B;  4PS3 A;  4XKC A;  5LFA A;  4ANW A;  4JEH A;  1PY1 A;  4AEZ C;  3DBS A;  3FUH A;  3UQ3 A;  4Y6C A;  3ZXS A;  4B89 A;  5ANR A;  2OV8 A;  4H7Y A;  2ION A;  2OVF A;  2XGO A;  4U63 A;  3QAR A;  3QDN A;  3APD A;  3FWV A;  3HHM A;  3NF1 A;  4FJZ A;  1OWL A;  1YA0 A;  4NRH B;  2XEV A;  2LO6 A;  3L08 A;  5E75 A;  3MKQ B;  1JUQ A;  2J07 A;  3LXU X;  3QWW A;  2HO1 A;  4L2Y A;  3UT4 A;  4AV7 A;  3JCK C;  3VTX A;  3QB2 A;  3FTY A;  2LAH A;  2OOE A;  3CVQ A;  3L22 A;  4WNG A;  4WUY A;  4JA9 A;  4ILI A;  5BUZ A;  3LPZ A;  2J49 A;  1FVF A;  3I4G A;  2R17 C;  5G04 J;  4ACK A;  3LY8 A;  4G1T A;  1JPL A;  4Q96 A;  2L0I A;  3FU3 A;  4WNE A;  3CKB A;  5G55 A;  3G2U A;  1TJF A;  4GZD A;  4I1A A;  5ARF A;  3ZIM A;  4N3B A;  3GZ2 A;  4XI0 A;  1OWP A;  4LRZ A;  3SD5 A;  1SQM A;  1EPU A;  3CV0 A;  5C2Y A;  1HU3 A;  2CFU A;  3PUK A;  5G2N A;  3ZRH A;  3Q47 B;  4U04 A;  5ENN A;  2CHW A;  1Z3Y A;  3SFZ A;  3U66 A;  3EJN A;  4OVV A;  4YVQ C;  4AXH A;  1U3C A;  3E4B A;  1ZBP A;  4AOF A;  3RJV A;  2FF4 A;  2WMN A;  4U0Z A;  3GYZ A;  1FCH A;  4GML A;  3CVY A;  1E8Z A;  3OXG A;  4EPZ A;  4GCN A;  5BNW A;  5EDS A;  2X3M A;  3PE4 A;  4KVM A;  1IHG A;  1MHQ A;  4ANU A;  1W3B A;  4GPK A;  2XRZ A;  4JHK A;  1JWG A;  3ZHE A;  2VSN A;  1WAO 1;  1ELR A;  1OWO A;  3PVL A;  3EIQ C;  3D9N A;  3BG1 B;  4BFR A;  2UWJ G;  3T5V A;  4N2Q A;  4FHK A;  2MOW A;  4J6I A;  4JHJ A;  4KMO A;  2DIW A;  3CVN A;  3VLD A;  5KJK A;  2LSV A;  1NA3 A;  3Q4A B;  4N3C A;  3G2S A;  4JHR A;  1UN8 A;  4WWN A;  4CT0 A;  3K9I A;  1VDY A;  2WB2 A;  4A3T A;  1HG5 A;  3T5X A;  3BEE A;  5KJM A;  1HX8 A;  1HS6 A;  2FBN A;  2FI7 A;  2VQ2 A;  5A7D B;  4IYP A;  2BUG A;  3FTX A;  5FQ4 A;  3CHM A;  3PH0 C;  1IYG A;  2CFZ A;  3FUL A;  3ZYQ A;  4CGV A;  3ZHE B;  4ME2 A;  4G23 A;  3IHV A;  3SZ7 A;  4BSX A;  3G2V A;  2OVB A;  5J90 A;  2C2L A;  3MCX A;  3PRE A;  4GA2 A;  3FUF A;  2FUL A;  3EIJ A;  4QFV A;  5G05 C;  4D10 C;  1E8X A;  1LF8 A;  3LVR E;  3AU4 A;  4YVO A;  3RRU A;  3TL5 A;  4CEM A;  3CHP A;  1H2V C;  3CVV A;  5JHB A;  3CVX A;  2WXL A;  3PNL B;  4WND A;  2RD0 A;  3FFL A;  5FQ7 A;  3FEX A;  1FVH A;  2PQN A;  3FH7 A;  2GGF A;  4J0U A;  2J4D A;  2VSY A;  4GZC A;  2I1J A;  2X6K A;  3PNT B;  2WXM A;  3RRM B;  2WXF A;  2PM6 A;  5E76 A;  4IN3 B;  3HDX A;  3QNK A;  3FH5 A;  1H19 A;  3QKY A;  2DCP A;  3LKU A;  5G04 C;  4BT8 A;  4J8F A;  4DI4 A;  4HS2 A;  1NP7 A;  2MHK A;  4KVO A;  1P5Q A;  5BW8 C;  4A55 A;  3FU0 A;  1E8Y A;  2C0L A;  4JA7 A;  3C98 A;  5BV0 A;  5LP0 A;  1L5J A;  3IKO B;  4RG9 A;  3LS8 A;  5FJY A;  3ZFW A;  4DK5 A;  3OTN A;  4GYO A;  4I9C A;  1X5B A;  3MV3 B;  5T3R A;  5T8I A;  5G05 J;  4I6J A;  3SF4 A;  4ANV A;  2AXV A;  5LX8 A;  1A17 A;  4MRU A;  3CVP A;  3FTU A;  5T4Y A;  5JJ6 A;  2YQ8 A;  2L6J A;  3I5P A;  4JZY A;  4B8C B;  2P58 C;  3ZYK A;  1E96 B;  5AYW D;  2X6H A;  5CMW A;  3R7R A;  4WWP A;  3CQC B;  4WNF A;  5FT9 A;  3FTW A;  3MYV A;  4GCO A;  2MRI A;  2WXH A;  5HI7 A;  3QOU A;  4BT9 A;  4EZJ A;  1KLX A;  2WXG A;  1H2T C;  2XGM A;  4N3A A;  4EBA A;  4PS8 A;  4G24 A;  2AXU A;  4A3V A;  1NZN A;  4HOS A;  3FU6 A;  4Q69 A;  2X6J A;  4JPS A;  3RIB A;  3FUN A;  1S0P A;  3CKC A;  3FU5 A;  1BPO A;  3TAX A;  4EBA G;  3TXM A;  5BT1 A;  4GZ6 A;  5EKQ D;  4HOR A;  4RG6 A;  4MS6 A;  3IV0 A;  2XPY A;  2IJG X;  2WXK A;  4I43 A;  3L6A A;  2AVP A;  1E90 A;  5KJN A;  3KEZ A;  3EHM A;  4M3O A;  4CDR A;  2X6F A;  3BG0 B;  2CG3 A;  1OWM A;  3MEK A;  3CK9 A;  1XNF A;  4GAA A;  2FO7 A;  4ANX A;  3CK7 A;  4GA0 A;  1GW6 A;  5CCL A;  2RG8 A;  1ZU2 A;  4FLB A;  4BTA A;  1HE8 A;  4KBQ A;  4UWK A;  4BY6 A;  4ILH B;  3FDH A;  3LCA A;  3ZYM A;  3GZS A;  3OXL A;  3S7J A;  3ONL A;  5JHA A;  3CLJ A;  3EHN A;  2R59 A;  2HM8 A;  3TG5 A;  3MZL B;  5HQ8 A;  4EQF A;  1N52 A;  2WM9 A;  1INZ A;  2R5S A;  1Z6T A;  5FZS A;  2C0M A;  3Q15 A;  5D0O D;  3APF A;  3SBT B;  4I2W A;  4CDM A;  4KZ0 A;  2Y3A A;  3Q5M A;  2XPZ A;  4L23 A;  5C1D A;  4UQY A;  3UX4 A;  4CCA A;  4PS7 A;  3MKR A;  3PZD A;  3R7Q A;  3PUJ A;  2WPV A;  4FA6 A;  3NQP A;  3QWP A;  2VTB A;  1EF1 C;  4AP2 A;  4HOT A;  3MGB A;  4FAD A;  3U3W A;  1QQE A;  2WMO A;  4G2V A;  5DIZ A;  4U8H A;  4CGW A;  3L17 A;  5DBK A;  1EDU A;  3D9P A;  1DNP A;  3PEV B;  2KAT A;  4H7X A;  4KYO B;  5JJ7 A;  4U0U A;  4APF A;  2LNI A;  2XGS A;  3EDT B;  3PS6 A;  3JYS A;  4NUR A;  3S7B A;  3SI5 A;  3RKV A;  1H2U A;  4U07 A;  4ATG A;  3FTV A;  5FQ8 A;  2KCL A;  2CG2 A;  3NZS A;  2XHE A;  4LER A;  4K03 A;  4AJW A;  4O6F A;  4EZK A;  4FUL A;  4I1O B;  3SHF A;  3QAQ A;  5FTP A;  3VTY A;  3RO2 A;  3L13 A;  4JC8 A;  2VJ8 A;  4V3I A;  4WAF A;  4N2S A;  2WXI A;  4IRU A;  4JW1 A;  2PZI A;  2ILR A;  3ZGQ A;  4XI9 A;  4WWO A;  3ZVV A;  3RO3 A;  2VTB B;  3P2B A;  5D0Q D;  3FHE A;  2OND A;  1EYH A;  2VYI A;  3CHQ A;  3MJW A;  2PL2 A;  3PDN A;  4FLH A;  4XKB A;  4HOQ A;  1HXI A;  3B7S A;  3VLE A;  2AW6 A;  5FWQ A;  1UW4 B;  4MKT A;  1ELK A;  3FUK A;  3D9M A;  3G2W A;  3KS2 A;  5CMY A;  3URZ A;  2WXO A;  2KC7 A;  2YHE A;  3TJP A;  4KT6 B;  2BF0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...