2R5SA

The crystal structure of a domain of protein vp0806 (unknown function) from vibrio parahaemolyticus rimd 2210633
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
171
structure length
171
Chain Sequence
b'DEQLLKQVSELLQQGEHAQALNVIQTLSDELQSRGDVKLAKADCLLETKQFELAQELLATIPLEYQDNSYKSLIAKLELHQQAAESPELKRLEQELAANPDNFELACELAVQYNQVGRDEEALELLWNILKVNLGAQDGEVKKTFMDILSALGQGNAIASKYRRQLYSILY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein VP0806
publication title The crystal structure of a domain of protein VP0806 (unknown function) from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Structural genomics, unknown function
total genus 69
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
A PF14561 TPR_20 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2r5sA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2r5sA01
1KT1A 2FF4A 2YQ8A 1E96B 2HR2A 4F3VA 2XPIA 4I2WA 4HOTA 4N3BA 3LCAA 2AVPA 4U0UA 1HXIA 3KD7A 4AIFA 3MV3B 4YVQC 5CHEE 3Q5MA 4NQ0A 4RG6A 2XEVA 4EQFA 4GA1A 2IF4A 5BW8C 3GZ2A 4YNDA 4UQZA 2LSUA 5KJLA 2L6JA 4UQXA 3BEEA 5JJ6A 3PDNA 3CVLA 1KLXA 4XI0A 2C2LA 3PE3A 4WNEA 4AY6A 5CCLA 3UPVA 4WNFA 3CEQA 2JLBA 5FZQA 5EX3A 2QFCA 2C0LA 3MV2B 3AS5A 4N3CA 3RJVA 3QWPA 4ABNA 3RU0A 2PL2A 1OUVA 4J8FA 3ESKA 5DBKA 4N2QA 4U0ZA 2KCLA 4YVOA 3CK9A 4BTAA 2PQRA 5C1DA 2DBAA 2E2EA 3R9AB 3QWWA 3PE4A 4N5CA 2Q7FA 5EX0A 5KJKA 5AYWD 1NA0A 4GYOA 3CKBA 1WAO1 2UY1A 3ULQA 4JA9A 3LPZA 4B94A 4GYWA 2YHCA 2MHKA 5G04C 1PC2A 4N3AA 5D0OD 3GW4A 3ZHEB 2I6HA 2VGXA 4UI9K 4XIFA 3S7FA 3CV0A 3LY9A 4XI9A 1HZ4A 2VQ2A 3Q4AB 3AS8A 3QOUA 1IYGA 5JJ7A 3AS4A 5ARFA 4I9EA 4ME2A 5FZSA 4GZ3A 1NA3A 2UWJG 3VTXA 1HH8A 2NC9A 2GW1A 3IEGA 4WUYA 3GZ1A 4G2VA 3OXLA 2KATA 4Y6CA 1ZU2A 5BNWA 4CGWA 3TG4A 4H7YA 3Q47B 5A6CA 2HO1A 3KAEA 4AM9A 3FWVA 4UI9C 3FFLA 2KC7A 4G24A 3RKVA 4KBQA 1W3BA 2XCBA 2XGOA 4BT8A 4GCNA 2KCVA 4HOSA 3Q15A 1B89A 1ELWA 1KT0A 4Y6WA 3NF1A 5M72A 3LYAA 4GYYA 3QKYA 4LEUA 2LNIA 5G04J 3LY7A 4GCOA 3URZA 5DIZA 5LCWC 4WNGA 4RG9A 5ARGA 5HQ8A 2WQHA 4IN3B 3SZ7A 2VSYA 2V5FA 3RO3A 3S7BA 1WM5A 2PQNA 4KYOB 4NRHB 2FO7A 1TJCA 2FBNA 2R5SA 4HOUA 2UY1B 4I1AA 3ASDA 3CVPA 4GZ6A 2XGSA 1NZNA 3OXFA 3ZPJA 2LSVA 3ZHEA 5FJYA 4WNDA 4UI9J 5EKQD 5KJNA 3ASFA 3EDTB 3RIBA 1QZ2A 2HYZA 1A17A 3E4BA 1ZBPA 3CVQA 3ZFWA 1FCHA 4A1SA 3TAXA 3KS2A 3MKRA 2PZIA 1ELRA 2XCCA 3HYMB 3ASGA 4UQYA 2C0MA 4O6FA 3U3WA 4I2ZA 4GA0A 4GA2A 4G26A 5LCWJ 5KJMA 4JL0A 4I17A 3CK8A 3CKCA 4GPKA 2VSNA 4BTBA 3U4TA 2Y4UA 3UQ3A 1XNFA 2VYIA 3MEKA 4J0UA 3ASHA 2Y4TA 3S7DA 2J9QA 4KXKB 4BWRA 5FTPA 3UUXA 4U04A 3WXXA 4CDRA 1QQEA 2WPVA 3ZGQA 3OXGA 1Y8MA 3JYSA 3TG5A 2OOEA 4G25A 1YA0A 5CCMA 4N2SA 2FEZA 3SF4A 4JHRA 3QDNA 1IHGA 4CGVA 2P58C 3GYZA 5G05J 2VGYA 3N71A 4HORA 4I9CA 3S7JA 3FP3A 5JJTA 3MA5A 4J8EA 2XGMA 3TGOA 4G23A 3O48A 3K9IA 4GZ5A 2KCKA 2IFUA 4JA7A 2VGXB 3CVNA 3QWVA 3VTYA 3LKUA 4N39A 5FZRA 5D0QD 3CK7A 4APOA 4G1TA 3LY8A 5A7DB 4AY5A 5BT1A 4W9RA 5G05C 2FI7A 3ZN3A 2ONDA 5HI7A 4U0SA 4U07A 4J8DA 3Q49B 5FT9A 4HOQA 4H7XA 1P5QA 2BUGA 4BT9A 3RO2A
chains in the Genus database with same CATH superfamily
1KT1A 5T3RA 2WMNA 2HR2A 2XPIA 4A1GA 4LSZE 3DPYA 3ESLA 3D9JA 4LRZA 3LCAA 4O60A 2AVPA 1FPPA 1HXIA 1BLXB 1OXJA 3MV3B 1UN9A 4M7CA 3B7BA 3C98A 4JD2G 4IYPA 2XEVA 3FU3A 5D66A 4U8YD 2CHWA 2BEDA 3JUEA 1E8YA 4C0MA 1KPSB 3ZKJA 3CVLA 1UJKA 1V54E 4A3TA 1NP7A 1KLXA 5J90A 3VLEA 1WG0A 3PUKA 1OCCE 2DZOA 4YDWA 3PEUB 5EX3A 1LD8A 4HRMB 1N95A 2PM6A 3AS5A 5G55A 4N3CA 4Q94A 2AJAA 4EBAG 3RU0A 2L6BA 1OUVA 2RG8A 1TJFA 5BV1A 1O1TA 3PE4A 1ELKA 4FP7A 5KJKA 1N4PA 2B6CA 4GYOA 4N5QA 4HI8A 4FA6A 3C3OA 1OWOA 5E75A 4GYWA 5CEAA 2WXQA 4DX7D 3ZU7B 4N3AA 5D0OD 4V3IA 3GW4A 4KMOA 4GTVA 4FU3A 1S70B 4MS6A 2VGXA 3EUVA 5EILA 4WWNA 3OAWA 4JHKA 3LY9A 3C3RA 4JXTA 1HZ4A 3Q4AB 3QOUA 4CDMA 4ACLA 5ARFA 2IU1A 2LO6A 2WXLA 1TR4A 4ME2A 4APFA 1IXVA 2XEHA 3DBSA 2CHZA 4GMJA 3QK0A 3VTXA 5EYPF 2V4LA 5BXOA 5KWDA 2GRNB 1U3CA 5H7PA 3RAUA 2HO1A 3DXKG 3FWVA 2WXRA 4QQIA 2KC7A 2GRLA 4GZCA 2KBXA 3RKVA 3EHQA 1O1SA 1W3BA 4EHMA 3DSXA 1RZ4A 4GCNA 4GAAA 4I43A 2L0IA 1ELWA 1KT0A 4Y6WA 2XPYA 2H6IA 4GYYA 1DNPA 3W9GA 2BTDA 3SGHA 1LTXA 4K03A 3RRNB 4DLOA 3FUKA 3JXJA 4XEIG 1H2UA 5FQ7A 2X6HA 2XPZA 4JB8P 5AQBA 2WQHA 3FTVA 3QAQA 4IN3B 4F7AA 3SZ7A 4RSYA 2V5QC 3RO3A 1N11A 3S7BA 1H6PA 1UW4B 1KZPA 3S2AA 4PS3A 4B0ZA 2P2CP 3NBNB 2KM4A 2UY1B 1E8ZA 1INZA 2QYUA 3RK6A 2XGSA 2FULA 4LNUD 1FVFA 3DSUA 1YMPA 4LG6A 4NIKA 1Z3YA 3QB2A 4O1OA 4DX2A 2QYJA 3MJWA 2HE0A 3UI2A 4UWLA 3CSTA 3CVQA 3ZFWA 1JWFA 3E34A 2P9IG 1IKND 2ZU6B 2R02A 3FEXA 3TAXA 2PZIA 3ULEG 4HB5A 1K1AA 4BEPA 2J09A 4O6FA 4I2ZA 2WXIA 1E7UA 5LCWJ 5KBAA 4JL0A 3EIQC 1Y6IA 3QNKA 4I6GA 3CKCA 4IRUA 4FLBA 2WXJA 3UQ3A 4WAFA 1XNFA 2VYIA 3ABLE 3APCA 1HS6A 3ASHA 2Y4TA 4GTSA 1MHQA 2GRPB 4BWRA 2V8SE 3L22A 4CDRA 1HO8A 3ZNGA 1QQEA 4KZCA 4HBDA 1ZB1A 1H6KA 4RVBA 1Y8MA 3JYSA 5AJDA 1TEZA 2RKKA 4GU5A 5JHAA 4L2YA 3TWUA 3UIOC 4AP2A 4JHRA 1D9SA 1SA4A 1JCRA 1TYQG 4K5AB 4HS2A 4ANWA 4HFGA 4DUIA 4XZ4A 3N71A 2OEWA 4HORA 4GB9A 1N52A 3LEWA 3FP3A 1BU9A 2X38A 3FDHA 2B0OE 4U63A 3T5XA 5T4YA 3QARA 3L54A 3K9IA 4TUMA 4GZ5A 2KCKA 2VGXB 2DCPA 4DK5A 3CQCB 3D9LA 3CK7A 1QBQA 3ZN3A 5HI7A 1SA5A 4U07A 3Q49B 4HOQA 2BUGA 2MOWA 3G2WA 1HG2A 4GMRA 3HRAA 3RO2A 1MZCA 2EINE 2FF4A 4HOTA 4F3VA 4I2WA 3FTYA 1K3ZD 5BXUA 3FTUA 4N3BA 3DSTA 4U0UA 4UWGA 2R03A 3KD7A 3FUDA 4HRNA 1OCOE 4B89A 4ILIA 1D8DA 3RRUA 3CR3A 3Q5MA 1L5JA 4CYMD 3TJPA 4EQFA 1PAQA 3P2BA 4GA1A 4K0RA 2IF4A 5BW8C 5ANRA 4BSZB 5KJLA 2J4BA 2ZXWE 4UQXA 3UM2A 3D9KA 5KNHD 4UUCA 5J08A 4ILHB 3PE3A 4WNEA 3TWWA 3TXMA 4XKBA 3UPVA 4KT6B 5CRUA 3CEQA 5AQAA 3QC1A 2J07A 1JCSA 3IHYA 4F53A 1G3NB 3GZSA 2BKGA 3QWPA 5C2YA 2PL2A 4EZKA 4YVOA 2NXPA 3ZYQA 3FU5A 4K5CA 1UJJA 3QWWA 4N5CA 4HRLA 3R9AB 4Q96A 4A63B 4G11A 3G2SA 3DEOA 3EIJA 3G2UA 1NA0A 3ZVVA 3CKBA 1WAO1 2UY1A 4GPMA 4L23A 5ENOD 3D3MA 1DVPA 4FHJA 1UOHA 2MHKA 4ATGA 1PC2A 1DCEA 2P9UG 2I6HA 5FQ4A 1K8KG 4I1OB 1D8EA 1N94A 4XIFA 3S7FA 5ITZF 1HX8A 1UN8A 2H6FA 4XI9A 1SW6A 1Z6TA 3AG4E 1S0PA 4RQIA 5AIJA 5ANLA 3TWVA 4CZ2D 4GZ3A 4BERA 1SQMA 3NZSA 1NA3A 3B13A 1SZAA 4GTPA 3CVUA 1JCQA 4XE0A 4FJYA 2CFZA 3ZXSA 3UM0A 5JHBA 3L08A 4H7YA 3E32A 4IULA 3UX4A 4AM9A 4UI9C 3BQOA 3FFLA 1LF8A 4NACA 3PZ3A 3R9MA 3JUIA 2J49A 2XS8A 1DC2A 2IO2C 5KNGA 3PH0C 3CSFA 2X6KA 3ONKA 5ENNA 1EYHA 2NYJA 3FTZA 1E90A 2OEVA 2WXHA 5G04J 3E37A 1HG5A 3FUHA 3PS6A 4GCOA 5ENSD 3URZA 4KVMA 1N4QA 3SI5A 1IHBA 1MJ0A 4RG9A 3PVLA 3UTMA 3UM3A 1K1BA 5HS0A 5LOZA 5BV0A 4F1PA 3SD5A 2VSYA 1H19A 3CVYA 1WM5A 1N54A 3FUMA 2A4ZA 2FO7A 1U3DA 2FBNA 2R5SA 3DSWA 4I1AA 4MRUA 3D9HA 3CVPA 4BSXA 4BX9A 1NZNA 4R7LA 4D10C 2GRQB 4LNGA 3HVEA 3ZHEA 4WNDA 3FU6A 5KJNA 3BG1B 4HVBA 3EDTB 3RIBA 3PUJA 3F6QA 4U7EB 3FH7A 3IBEA 4BX8A 3KS2A 3PZ2A 1N4RA 3MKRA 2JEKA 3DRAA 2J8SD 3EU9A 3LXUX 2VTBB 3MKQA 2I1KA 3ASGA 3IXEA 3L9TA 4Q69A 4J6IA 2RFMA 3L17A 4GA0A 4G26A 1X81A 2WXNA 5KJMA 3CK8A 4CEMA 3Q9UC 3T8MA 3ZRHA 2Y4UA 4XX5A 2AXZA 4ACKA 3CVVA 2EILE 4X8QA 3D9OA 4AV7A 4JEUA 1N0QA 4EZJA 1H2VC 2WPVA 2CHXA 2DZNA 5FINA 3ZGQA 1X5BA 4G25A 5JMND 1YA0A 3SQVA 2FEZA 1HU3A 3SF4A 3L13A 4C0EA 1DCQA 2KZTB 1IHGA 4ANUA 4CGVA 4LUNU 2VGEA 3HXDA 3GYZA 2JABA 1HFAA 3IKOB 3S7JA 3DEPA 4EECA 1BD8A 2YNQA 3MA5A 5JJTA 2R05A 1EDUA 2F0YA 1WDYA 3CVWA 1PY1A 3IV0A 2IFUA 3QWVA 3CVNA 3LKUA 2F37A 2DYSE 5D0QD 2VSXE 4G1TA 5A7DB 4AY5A 3PZDA 4FLHA 3V31A 4ANXA 5G05C 4O1PA 1TNOA 2CG3A 2ONDA 4G8KA 3W9FA 1Z5SC 4U0SA 1QYMA 3CIAA 3SFXA 3HG0D 2YHEA 5FT9A 2VSOE 2AWIA 3T9KA 4BT9A 4ATZD 3D9PA 3OTNA 3I4GA 2X6JA 2R2LA 1E96B 4LCTA 4QFVA 2BKKB 4CT4A 2XRZA 3HXEA 4G8LA 2WB2A 2DVWA 3V2OA 3V79K 3D9MA 4EZLA 4ILGA 4AIFA 4YVQC 2XRYA 5CHEE 2A5UA 4NQ0A 4L1BA 3CHMA 4RG6A 3EHRA 1TN7A 1N0RA 4UQZA 4BFRA 2LSUA 3AU5A 4HQDA 2L6JA 4TXRA 5FWQA 4DX5D 4B8AA 5JJ6A 3D9IA 3DPDA 3EJNA 4U95D 2ILRA 2EQXA 2C2LA 4UWKA 2L9BA 4AY6A 3NOCD 5CCLA 4WNFA 2JLBA 2OVFA 4FULA 1FT1A 2C0LA 3JCKC 2H6GA 3RJVA 2R17C 4ABNA 3CGHA 2IONA 1FT2A 4L7TA 3TWQA 4PDXA 3IHVA 4N2QA 3AG3E 2IOLA 5CMYA 3X2QE 2EIJE 3CK9A 2PQRA 2DBAA 2E2EA 4JEHA 2Q7FA 2CFUA 4L2LA 4OVVA 3PZ4A 3BUAA 4JC8A 2GRMA 3TWRA 3LVQE 4JA9A 3LPZA 4B94A 3FTSA 3PEVB 3HVEB 2ETCA 1SZ9A 3MYVA 3ZHEB 3HXBA 3FULA 3V2XA 3JQ0A 3CV0A 3I5PA 2VQ2A 1S64A 3EHNA 1TNUA 5JJ7A 3AS4A 3JXIA 4I9EA 2RD0A 3NQPA 3ZYMA 4ZHBA 2I9CA 4E85A 4CRWA 2NC9A 3MKQB 3IEGA 3FU0A 2VTBA 2X6IA 4G2VA 3OXLA 2KATA 4K5BA 3SFYA 1ZU2A 3SBTB 4CGWA 3TG4A 3Q47B 4I1MA 2ZIRA 3FHEA 3FEYA 3VLFA 3T8KA 4KBQA 3Q73A 3ISMC 4AVXA 2KCVA 3Q15A 5B1BE 3Q75A 3FUNA 3U64A 4C48B 3QKYA 4LEUA 3C5RA 2LNIA 4J8YA 5BUZA 4UWFA 2LAHA 3FUJA 4TV3A 5LCWC 5AENA 1MX2A 4WNGA 2KZTA 1TN8A 2WQ7A 4J8SA 4JHJA 4YDOA 3LVRE 5ARGA 3J5PA 2OCCE 2V5FA 3I3NA 1E8WA 3E30A 5KCMA 2PQNA 2Y69E 2WXPA 3AJIA 5LP0A 3P1UA 3UT7A 3LDZA 5E76A 3L16A 2ZGGA 3R7RA 3OXFA 3APFA 2LSVA 5B3SE 1HF8A 5EKQD 4P29A 2H6HA 3L6AA 4OVUA 3SO8A 1SVXA 1QZ2A 3FUEA 4OYSA 4CT0A 5CMWA 3CQGB 3FTWA 2HYZA 3CVXA 2IO3C 4A1SA 4URKA 2WVIA 2DIWA 2ZGDA 1ELRA 3HXCA 2XCCA 3AU4A 4GTQA 1YYHA 2IY0C 4A3VA 3ZUVB 3HYMB 3FUFA 1TNZA 2C0MA 2WXMA 3JQ1A 4FC8A 4GTTA 3HXFA 4GA2A 2J08A 3J5QB 3V30A 4U96D 4I17A 4PS8A 4GTMA 4GPKA 2VSNA 4BTBA 3Q7AA 1RW2A 3UT4A 2V0PA 3B7SA 3MEKA 5CECB 5HKPA 4J0UA 5AAOA 2J9QA 4KXKB 1WY6A 5FTPA 3UUXA 4U04A 4RLYA 1MQSA 2XQ0A 3OXGA 2OOEA 4LERA 4U8HA 4CCAA 4N2SA 1EPUA 3O4ZA 4L9PA 3FH8A 3MCXA 2WMOA 2P58C 3Q79A 1E8XA 4WWOA 5ENPD 5G05J 2VGYA 4ZFHA 2ETBA 4I9CA 2HM8A 1IQRA 2E0IA 4M3OA 3FY4A 3HHMA 1BPOA 1O5MA 2L0TB 4J8EA 2XGMA 3TGOA 4YDYA 1KZOA 5A23A 4UWHA 3UKUG 4G23A 4HLEA 3KEAA 4MKTA 2P9NG 1OCZE 4JA7A 5CRVA 5G2NA 2P9PG 2OV8A 4ANVA 3PRZA 3B7RL 4APOA 2XS1A 3CHOA 3SBSA 1S63A 3LJ3A 1FVHA 3KSQA 3C3QA 4Z68A 3SNXA 2XZTG 4J8DA 4B8CB 2P9KG 3QJZA 1NL4A 4AOFA 4AEZC 3LS8A 3B7TA 3D9NA 3B95A 4HLLA 3AG2E 4KVOA 3ONLA 2QC9A 1HE8A 2YQ8A 4B93B 2NSZA 3UKRG 2EIME 1NFIE 4JVSA 1N9AA 5LX8A 2VJ8A 3E33A 5AN8A 3CHSA 2CG2A 1AP7A 3TWSA 5B1AE 3AG1E 3SY2A 3GZ2A 4YNDA 1OT8A 3BEEA 1JWGA 3ZYLA 3HIZA 2IOSA 4JPSA 3HDXA 3PDNA 4DLQA 5FIOA 1Z3XA 2J4DA 4XI0A 3B7UX 2XHEA 3BU8A 1H6OA 1NI1A 3APDA 5FZQA 4TRQA 2QFCA 5ENTD 5CBOA 3MV2B 3Q7FA 1BI8B 5HRYA 2ETAA 3NAWA 4J8FA 5DBKA 3ESKA 1OCRE 4GZDA 4U0ZA 5ENRD 3TWTA 2KCLA 5IY5E 1OWNA 4BTAA 5C1DA 2WXGA 3UT8A 5EX0A 5AYWD 3WG7E 1JUQA 3ENEA 2DWZA 2IJGX 3ULQA 5EIBE 2Y1LE 4KZ0A 2YHCA 5G04C 5ENQD 1E7VA 2GROB 4AJWA 4BESA 2PM7A 1A5EA 2LAIA 2QZAA 4CDNA 2WQ6A 2Y0BG 4UI9K 3PNLB 3CHPA 5FQ6A 3AS8A 1IYGA 2YINA 5BPPA 4PUCA 5FZSA 2BF0X 4DX1A 4DRXE 3ML9A 2MYOA 4OAVB 2UWJG 1MYOA 2PNNA 1HH8A 3AAAC 1IQUA 4GTOA 2GW1A 4PH4B 2XZDG 4MBGA 3SFZA 2F8XK 4WUYA 3GZ1A 4Y6CA 5AQ7A 3ASOE 5BNWA 2WXFA 3TL5A 1TN6A 5A6CA 4FHKA 3KAEA 1H2TC 4G24A 3Q78A 1TNYA 4HNAD 2WXKA 2XCBA 2XGOA 4BT8A 1YCSB 2QY7A 3NOGD 3G2VA 3NB2A 4F1SA 2DYRE 4GMLA 4HOSA 5FQ8A 2A5EA 1B89A 4DPRA 3U66A 1TNBA 3NF1A 5M72A 3LYAA 1EF1C 3C72A 3UMVA 3ML8A 3DXMG 3SHFA 2OVBA 2X6FA 2R59A 3DSVA 3LY7A 4DI4A 3TWXA 4FADA 3VLDA 5DIZA 2FO1E 2F8YA 1JPLA 5EYLA 3DWLG 1H0AA 3U9WA 3CLJA 5HQ8A 2WXOA 3CHRA 3RRMB 3L82A 5CEDB 4KYOB 3ZYKA 4NRHB 3FTXA 4AXHA 4F6RD 4TXQA 2XEEA 3EU5A 4HI9A 5EDSA 1TJCA 3DSSA 1BI7B 4HOUA 4A55A 3RSEG 3ZW3A 3ASDA 4PS7A 3ABME 4GZ6A 4FJZA 2XENA 3Q9NC 3ZPJA 3G2TA 5FJYA 4UI9J 5AQ9A 3ASFA 2LUHA 5LFAA 3ASNE 2ZISA 2M63A 1OWMA 3ZIMA 2I1JA 2MRIA 3LJNA 2Y3AA 4U8VD 2LXLA 1V55E 1A17A 3E4BA 1ZBPA 1FCHA 4I6JA 1N4SA 3KSLA 5EIDA 2IEJA 3T5VA 2LXMA 1Q2ZA 4TUUA 4EBAA 4DX6D 4UQYA 2IQCA 3U3WA 3FH5A 1VDYA 4XKCA 2AW6A 4BETA 1MX4A 1MX6A 4EPZA 1OWLA 5T8IA 3KEZA 3ABKE 3U4TA 4HXIA 2X3MA 5D2MC 1OWPA 3S7DA 1UG3A 5JA4D 3NZUA 3ULYA 3UM1A 3PNTB 1OY3D 2WM9A 4LNBA 3WXXA 2I2OA 3TXNA 4I6EA 3EHMA 3MZLB 1GW6A 3TG5A 1O1RA 5CCMA 5CBNA 4GTRA 1QNFA 3UXGA 4E6HA 3QDNA 3I4RB 2P9LG 1U2VG 3ZEFA 2EIKE 5CERB 5EN5D 5AJLA 2RFAA 1XGWA 3PZ1A 4JW1A 3R7QA 3FUIA 4WWPA 2KXPC 2AXVA 4MLPA 3MX3A 3O48A 3ZXPA 4JZYA 4TXPA 2P9SG 2V4HC 4DJAA 3VTYA 2AXUA 4N39A 5FZRA 4DI3A 3LY8A 3UINC 5BT1A 4NURA 3CHQA 4W9RA 2FI7A 4YDEA 4BY6A 5AARA 3PREA 3MGBA 3UIPC 4H7XA 1P5QA 2GGFA 3BG0B 2GRRB 4OAUC 4C9BB 4J7WA 1AWCB 1LD7A
chains in the Genus database with same CATH topology
1KT1A 1HE8A 2X6JA 3I4GA 2FF4A 2YQ8A 1E96B 5T3RA 2WMNA 4LCTA 2HR2A 4F3VA 2XPIA 3FTYA 4I2WA 4HOTA 4A1GA 4QFVA 3FTUA 4CT4A 3ESLA 4N3BA 2NSZA 3D9JA 4LRZA 2XRZA 3LCAA 4JVSA 2WB2A 2AVPA 4U0UA 4UWGA 3D9MA 1HXIA 3KD7A 4ILGA 2VJ8A 4AIFA 4EZLA 5LX8A 3FUDA 3MV3B 4YVQC 1UN9A 2XRYA 3CHSA 4B89A 2CG2A 4ILIA 5CHEE 3RRUA 3C98A 2A5UA 1L5JA 3CR3A 3Q5MA 4L1BA 3CHMA 4IYPA 4NQ0A 2XEVA 4RG6A 3TJPA 4EQFA 1PAQA 3FU3A 3P2BA 4GA1A 4K0RA 2IF4A 5BW8C 5ANRA 3GZ2A 4YNDA 4UQZA 4BFRA 2LSUA 3AU5A 5KJLA 2L6JA 2J4BA 2CHWA 5FWQA 4UQXA 4B8AA 3BEEA 1JWGA 5JJ6A 3D9IA 3ZYLA 3HIZA 1E8YA 4C0MA 2IOSA 3DPDA 3D9KA 4JPSA 3HDXA 3EJNA 5J08A 2ILRA 3PDNA 4DLQA 3CVLA 1UJKA 4A3TA 1NP7A 2EQXA 1KLXA 1Z3XA 2J4DA 4ILHB 5J90A 4XI0A 2C2LA 3PE3A 4UWKA 4WNEA 3VLEA 3PUKA 2L9BA 3TXMA 4XKBA 4AY6A 3B7UX 2XHEA 4KT6B 5CCLA 3UPVA 4WNFA 3CEQA 2JLBA 2OVFA 3APDA 3QC1A 5FZQA 4FULA 4TRQA 3PEUB 5EX3A 2QFCA 2J07A 2C0LA 3JCKC 3MV2B 2PM6A 3AS5A 3IHYA 4F53A 5G55A 3GZSA 4N3CA 3RJVA 2R17C 4Q94A 3QWPA 4EBAG 5C2YA 4ABNA 3RU0A 3CGHA 2IONA 4L7TA 2PL2A 4EZKA 4PDXA 1OUVA 4J8FA 3ESKA 2RG8A 5DBKA 4GZDA 3IHVA 4N2QA 4U0ZA 1TJFA 2IOLA 2KCLA 5CMYA 4YVOA 5BV1A 1OWNA 2NXPA 3ZYQA 3CK9A 4BTAA 2PQRA 5C1DA 2DBAA 2E2EA 4JEHA 3FU5A 1UJJA 3QWWA 3PE4A 4N5CA 2WXGA 3R9AB 3UT8A 2Q7FA 1ELKA 2CFUA 4L2LA 4Q96A 4OVVA 4FP7A 4JC8A 5EX0A 5KJKA 5AYWD 4G11A 3G2SA 3EIJA 3G2UA 1JUQA 2GRMA 1NA0A 3ENEA 4GYOA 3ZVVA 3CKBA 1WAO1 2IJGX 2UY1A 3ULQA 3LVQE 4FA6A 4L23A 4JA9A 3LPZA 3D3MA 1OWOA 4B94A 1DVPA 3FTSA 4FHJA 4KZ0A 4GYWA 5E75A 2YHCA 2MHKA 5G04C 2WXQA 3PEVB 4ATGA 1E7VA 4AJWA 3HVEB 1PC2A 4N3AA 2PM7A 4V3IA 1SZ9A 5D0OD 3GW4A 3MYVA 4KMOA 3ZHEB 4FU3A 2I6HA 5FQ4A 2LAIA 4MS6A 4I1OB 2VGXA 4CDNA 3FULA 2WQ6A 4UI9K 4WWNA 4XIFA 3PNLB 3JQ0A 3S7FA 3OAWA 3CV0A 3CHPA 4JHKA 1HX8A 1UN8A 3LY9A 4JXTA 4XI9A 5FQ6A 3I5PA 1Z6TA 1HZ4A 2VQ2A 3Q4AB 3AS8A 3EHNA 3QOUA 4CDMA 1IYGA 4ACLA 5JJ7A 1S0PA 3AS4A 2IU1A 5ARFA 2YINA 4I9EA 5BPPA 2LO6A 4PUCA 2WXLA 2RD0A 4ME2A 4APFA 5AIJA 5FZSA 2BF0X 5ANLA 3NQPA 4GZ3A 1SQMA 3ZYMA 3DBSA 3ML9A 3NZSA 1NA3A 3B13A 2CHZA 2I9CA 2UWJG 4GMJA 3QK0A 1SZAA 1HH8A 3VTXA 2NC9A 4CRWA 1IQUA 4E85A 3CVUA 3MKQB 2V4LA 4XE0A 2GW1A 3IEGA 4FJYA 4PH4B 3FU0A 2VTBA 3SFZA 2X6IA 4WUYA 3GZ1A 2CFZA 3OXLA 1U3CA 4G2VA 3ZXSA 2KATA 4Y6CA 1ZU2A 5JHBA 3SBTB 5BNWA 2WXFA 4CGWA 3L08A 3TG4A 4H7YA 3TL5A 3Q47B 4IULA 2HO1A 5A6CA 4FHKA 3KAEA 3UX4A 4AM9A 3FWVA 4I1MA 2WXRA 1H2TC 3FFLA 2KC7A 4UI9C 2GRLA 4G24A 4GZCA 3FHEA 3FEYA 3VLFA 1LF8A 3RKVA 4NACA 4KBQA 1W3BA 2WXKA 2XCBA 2XGOA 4BT8A 2QY7A 4GCNA 3JUIA 4AVXA 3G2VA 2J49A 4GAAA 2KCVA 4F1SA 4GMLA 4HOSA 3Q15A 5FQ8A 1B89A 3PH0C 4I43A 4DPRA 2L0IA 3CSFA 3U66A 1ELWA 1KT0A 2X6KA 4Y6WA 2XPYA 3ONKA 5ENNA 1EYHA 3FUNA 3NF1A 5M72A 3LYAA 3U64A 1EF1C 3UMVA 4GYYA 1DNPA 3QKYA 3ML8A 3FTZA 1E90A 2BTDA 4LEUA 3SGHA 3SHFA 2OVBA 2LNIA 2X6FA 2R59A 2WXHA 4K03A 5G04J 1HG5A 5BUZA 3FUHA 3LY7A 3PS6A 3RRNB 4GCOA 3URZA 3FUKA 4DLOA 4DI4A 4KVMA 4FADA 3SI5A 1H2UA 3VLDA 4UWFA 5DIZA 5FQ7A 2LAHA 3FUJA 4TV3A 5LCWC 5AENA 2X6HA 4WNGA 2XPZA 2KZTA 4RG9A 3PVLA 1JPLA 2WQ7A 4J8SA 4JHJA 1H0AA 3LVRE 5ARGA 3U9WA 3CLJA 5LOZA 5HQ8A 5BV0A 2WQHA 3FTVA 3QAQA 4IN3B 4F7AA 3SZ7A 2WXOA 3CHRA 3RRMB 3SD5A 2VSYA 2V5FA 4RSYA 1H19A 3I3NA 3RO3A 3CVYA 1E8WA 3S7BA 1WM5A 5KCMA 2PQNA 4KYOB 3ZYKA 4NRHB 1UW4B 1N54A 3FUMA 2WXPA 3S2AA 3FTXA 2A4ZA 4PS3A 4AXHA 4B0ZA 5LP0A 2FO7A 3U3WA 2KM4A 5EDSA 1U3DA 1TJCA 2FBNA 2R5SA 4HOUA 2UY1B 4A55A 4I1AA 4MRUA 3P1UA 3UT7A 3ZW3A 1E8ZA 3ASDA 1INZA 3LDZA 3CVPA 4PS7A 5E76A 3L16A 3RK6A 4GZ6A 2XGSA 4BSXA 4BX9A 1NZNA 4R7LA 4FJZA 4D10C 2FULA 3R7RA 3OXFA 3ZPJA 1FVFA 3HVEA 3APFA 2LSVA 3ZHEA 3G2TA 4WNDA 5FJYA 3FU6A 4UI9J 1HF8A 5EKQD 4P29A 5KJNA 3BG1B 3ASFA 3L6AA 4OVUA 4HVBA 5LFAA 3EDTB 2M63A 3RIBA 1Z3YA 3QB2A 3PUJA 1OWMA 3ZIMA 1QZ2A 3FUEA 2I1JA 4OYSA 3MJWA 4CT0A 2MRIA 5CMWA 2Y3AA 3CQGB 3FH7A 3FTWA 4UWLA 2HYZA 1A17A 3E4BA 3CSTA 1ZBPA 3CVQA 3IBEA 3ZFWA 1JWFA 3CVXA 4BX8A 1FCHA 4I6JA 4A1SA 2ZU6B 3FEXA 3TAXA 2WVIA 2DIWA 3KS2A 4URKA 3MKRA 2JEKA 2PZIA 3T5VA 1ELRA 2XCCA 3AU4A 3LXUX 4TUUA 4EBAA 2VTBB 4A3VA 3MKQA 2I1KA 3HYMB 3FUFA 3ASGA 4UQYA 2C0MA 2J09A 4O6FA 2WXMA 2IQCA 3JQ1A 3FH5A 4FC8A 4I2ZA 4Q69A 4J6IA 4GA0A 3L17A 4GA2A 2WXIA 1E7UA 2J08A 4G26A 5LCWJ 1VDYA 2WXNA 5KJMA 4JL0A 3EIQC 4I17A 4XKCA 1Y6IA 2AW6A 4PS8A 4EPZA 1OWLA 3QNKA 3CK8A 4I6GA 3CKCA 3KEZA 4IRUA 5T8IA 2VSNA 4BTBA 4CEMA 4GPKA 4FLBA 3UT4A 3T8MA 2WXJA 3U4TA 3ZRHA 2Y4UA 3B7SA 2V0PA 4HXIA 2X3MA 4WAFA 3UQ3A 1XNFA 2VYIA 3MEKA 4XX5A 3APCA 2AXZA 4ACKA 3CVVA 1HS6A 4J0UA 3ASHA 2Y4TA 1OWPA 2J9QA 4KXKB 3S7DA 1MHQA 1UG3A 3NZUA 4BWRA 2V8SE 1WY6A 3L22A 3PNTB 5FTPA 3UUXA 2WM9A 3D9OA 4AV7A 4JEUA 4U04A 4EZJA 3WXXA 4CDRA 1HO8A 1H2VC 2I2OA 1QQEA 3TXNA 4I6EA 3EHMA 2WPVA 2CHXA 1MQSA 3MZLB 2XQ0A 4KZCA 3ZGQA 1GW6A 1H6KA 4RVBA 3OXGA 1Y8MA 3JYSA 3TG5A 1X5BA 2OOEA 4G25A 4LERA 5AJDA 4U8HA 1YA0A 4CCAA 1TEZA 4GU5A 5CCMA 5JHAA 4N2SA 2FEZA 1EPUA 3O4ZA 1HU3A 4L2YA 3SF4A 4AP2A 3FH8A 3L13A 4C0EA 4JHRA 1QNFA 3MCXA 4E6HA 2KZTB 1IHGA 3I4RB 3QDNA 4ANUA 4CGVA 2WMOA 2P58C 4LUNU 1E8XA 4HS2A 4ANWA 3GYZA 4WWOA 3ZEFA 4HFGA 4XZ4A 5G05J 2VGYA 3N71A 4HORA 5AJLA 1HFAA 4GB9A 3IKOB 4I9CA 2HM8A 3S7JA 1N52A 3LEWA 4EECA 3FP3A 1IQRA 2E0IA 1XGWA 2YNQA 2X38A 3MA5A 5JJTA 4JW1A 1EDUA 3FDHA 4M3OA 3FY4A 3HHMA 1BPOA 3R7QA 4U63A 2L0TB 3FUIA 4J8EA 4WWPA 2XGMA 3TGOA 3T5XA 3CVWA 5A23A 4UWHA 1PY1A 2AXVA 3IV0A 4G23A 3MX3A 4MLPA 5T4YA 4HLEA 3O48A 3QARA 4MKTA 3L54A 4JZYA 3K9IA 4GZ5A 2KCKA 2IFUA 4DJAA 4JA7A 2VGXB 3CVNA 3QWVA 3VTYA 2AXUA 3LKUA 2DCPA 4N39A 5G2NA 4DK5A 2OV8A 4ANVA 3CQCB 3D9LA 5FZRA 5D0QD 4DI3A 3PRZA 2VSXE 3CK7A 3B7RL 4APOA 4G1TA 3LY8A 5A7DB 4AY5A 3CHOA 5BT1A 3PZDA 3SBSA 4NURA 3LJ3A 4FLHA 1FVHA 3CHQA 4ANXA 4W9RA 5G05C 2CG3A 2FI7A 3ZN3A 4BY6A 2ONDA 5HI7A 3PREA 3MGBA 4U0SA 3SNXA 3CIAA 4U07A 4J8DA 3Q49B 4B8CB 2YHEA 5FT9A 3QJZA 4H7XA 1P5QA 4HOQA 2BUGA 3BG0B 2GGFA 2MOWA 2VSOE 1HG2A 2AWIA 3G2WA 4BT9A 4AOFA 4AEZC 4C9BB 3LS8A 3B7TA 3D9NA 3RO2A 3D9PA 4KVOA 3OTNA 3ONLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT1 A;  2FF4 A;  2YQ8 A;  1E96 B;  2HR2 A;  4F3V A;  2XPI A;  4I2W A;  4HOT A;  4N3B A;  3LCA A;  2AVP A;  4U0U A;  1HXI A;  3KD7 A;  4AIF A;  3MV3 B;  4YVQ C;  5CHE E;  3Q5M A;  4NQ0 A;  4RG6 A;  2XEV A;  4EQF A;  4GA1 A;  2IF4 A;  5BW8 C;  3GZ2 A;  4YND A;  4UQZ A;  2LSU A;  5KJL A;  2L6J A;  4UQX A;  3BEE A;  5JJ6 A;  3PDN A;  3CVL A;  1KLX A;  4XI0 A;  2C2L A;  3PE3 A;  4WNE A;  4AY6 A;  5CCL A;  3UPV A;  4WNF A;  3CEQ A;  2JLB A;  5FZQ A;  5EX3 A;  2QFC A;  2C0L A;  3MV2 B;  3AS5 A;  4N3C A;  3RJV A;  3QWP A;  4ABN A;  3RU0 A;  2PL2 A;  1OUV A;  4J8F A;  3ESK A;  5DBK A;  4N2Q A;  4U0Z A;  2KCL A;  4YVO A;  3CK9 A;  4BTA A;  2PQR A;  5C1D A;  2DBA A;  2E2E A;  3R9A B;  3QWW A;  3PE4 A;  4N5C A;  2Q7F A;  5EX0 A;  5KJK A;  5AYW D;  1NA0 A;  4GYO A;  3CKB A;  1WAO 1;  2UY1 A;  3ULQ A;  4JA9 A;  3LPZ A;  4B94 A;  4GYW A;  2YHC A;  2MHK A;  5G04 C;  1PC2 A;  4N3A A;  5D0O D;  3GW4 A;  3ZHE B;  2I6H A;  2VGX A;  4UI9 K;  4XIF A;  3S7F A;  3CV0 A;  3LY9 A;  4XI9 A;  1HZ4 A;  2VQ2 A;  3Q4A B;  3AS8 A;  3QOU A;  1IYG A;  5JJ7 A;  3AS4 A;  5ARF A;  4I9E A;  4ME2 A;  5FZS A;  4GZ3 A;  1NA3 A;  2UWJ G;  3VTX A;  1HH8 A;  2NC9 A;  2GW1 A;  3IEG A;  4WUY A;  3GZ1 A;  4G2V A;  3OXL A;  2KAT A;  4Y6C A;  1ZU2 A;  5BNW A;  4CGW A;  3TG4 A;  4H7Y A;  3Q47 B;  5A6C A;  2HO1 A;  3KAE A;  4AM9 A;  3FWV A;  4UI9 C;  3FFL A;  2KC7 A;  4G24 A;  3RKV A;  4KBQ A;  1W3B A;  2XCB A;  2XGO A;  4BT8 A;  4GCN A;  2KCV A;  4HOS A;  3Q15 A;  1B89 A;  1ELW A;  1KT0 A;  4Y6W A;  3NF1 A;  5M72 A;  3LYA A;  4GYY A;  3QKY A;  4LEU A;  2LNI A;  5G04 J;  3LY7 A;  4GCO A;  3URZ A;  5DIZ A;  5LCW C;  4WNG A;  4RG9 A;  5ARG A;  5HQ8 A;  2WQH A;  4IN3 B;  3SZ7 A;  2VSY A;  2V5F A;  3RO3 A;  3S7B A;  1WM5 A;  2PQN A;  4KYO B;  4NRH B;  2FO7 A;  1TJC A;  2FBN A;  2R5S A;  4HOU A;  2UY1 B;  4I1A A;  3ASD A;  3CVP A;  4GZ6 A;  2XGS A;  1NZN A;  3OXF A;  3ZPJ A;  2LSV A;  3ZHE A;  5FJY A;  4WND A;  4UI9 J;  5EKQ D;  5KJN A;  3ASF A;  3EDT B;  3RIB A;  1QZ2 A;  2HYZ A;  1A17 A;  3E4B A;  1ZBP A;  3CVQ A;  3ZFW A;  1FCH A;  4A1S A;  3TAX A;  3KS2 A;  3MKR A;  2PZI A;  1ELR A;  2XCC A;  3HYM B;  3ASG A;  4UQY A;  2C0M A;  4O6F A;  3U3W A;  4I2Z A;  4GA0 A;  4GA2 A;  4G26 A;  5LCW J;  5KJM A;  4JL0 A;  4I17 A;  3CK8 A;  3CKC A;  4GPK A;  2VSN A;  4BTB A;  3U4T A;  2Y4U A;  3UQ3 A;  1XNF A;  2VYI A;  3MEK A;  4J0U A;  3ASH A;  2Y4T A;  3S7D A;  2J9Q A;  4KXK B;  4BWR A;  5FTP A;  3UUX A;  4U04 A;  3WXX A;  4CDR A;  1QQE A;  2WPV A;  3ZGQ A;  3OXG A;  1Y8M A;  3JYS A;  3TG5 A;  2OOE A;  4G25 A;  1YA0 A;  5CCM A;  4N2S A;  2FEZ A;  3SF4 A;  4JHR A;  3QDN A;  1IHG A;  4CGV A;  2P58 C;  3GYZ A;  5G05 J;  2VGY A;  3N71 A;  4HOR A;  4I9C A;  3S7J A;  3FP3 A;  5JJT A;  3MA5 A;  4J8E A;  2XGM A;  3TGO A;  4G23 A;  3O48 A;  3K9I A;  4GZ5 A;  2KCK A;  2IFU A;  4JA7 A;  2VGX B;  3CVN A;  3QWV A;  3VTY A;  3LKU A;  4N39 A;  5FZR A;  5D0Q D;  3CK7 A;  4APO A;  4G1T A;  3LY8 A;  5A7D B;  4AY5 A;  5BT1 A;  4W9R A;  5G05 C;  2FI7 A;  3ZN3 A;  2OND A;  5HI7 A;  4U0S A;  4U07 A;  4J8D A;  3Q49 B;  5FT9 A;  4HOQ A;  4H7X A;  1P5Q A;  2BUG A;  4BT9 A;  3RO2 A; 
#chains in the Genus database with same CATH topology
 1KT1 A;  5T3R A;  2WMN A;  2HR2 A;  2XPI A;  4A1G A;  4LSZ E;  3DPY A;  3ESL A;  3D9J A;  4LRZ A;  3LCA A;  4O60 A;  2AVP A;  1FPP A;  1HXI A;  1BLX B;  1OXJ A;  3MV3 B;  1UN9 A;  4M7C A;  3B7B A;  3C98 A;  4JD2 G;  4IYP A;  2XEV A;  3FU3 A;  5D66 A;  4U8Y D;  2CHW A;  2BED A;  3JUE A;  1E8Y A;  4C0M A;  1KPS B;  3ZKJ A;  3CVL A;  1UJK A;  1V54 E;  4A3T A;  1NP7 A;  1KLX A;  5J90 A;  3VLE A;  1WG0 A;  3PUK A;  1OCC E;  2DZO A;  4YDW A;  3PEU B;  5EX3 A;  1LD8 A;  4HRM B;  1N95 A;  2PM6 A;  3AS5 A;  5G55 A;  4N3C A;  4Q94 A;  2AJA A;  4EBA G;  3RU0 A;  2L6B A;  1OUV A;  2RG8 A;  1TJF A;  5BV1 A;  1O1T A;  3PE4 A;  1ELK A;  4FP7 A;  5KJK A;  1N4P A;  2B6C A;  4GYO A;  4N5Q A;  4HI8 A;  4FA6 A;  3C3O A;  1OWO A;  5E75 A;  4GYW A;  5CEA A;  2WXQ A;  4DX7 D;  3ZU7 B;  4N3A A;  5D0O D;  4V3I A;  3GW4 A;  4KMO A;  4GTV A;  4FU3 A;  1S70 B;  4MS6 A;  2VGX A;  3EUV A;  5EIL A;  4WWN A;  3OAW A;  4JHK A;  3LY9 A;  3C3R A;  4JXT A;  1HZ4 A;  3Q4A B;  3QOU A;  4CDM A;  4ACL A;  5ARF A;  2IU1 A;  2LO6 A;  2WXL A;  1TR4 A;  4ME2 A;  4APF A;  1IXV A;  2XEH A;  3DBS A;  2CHZ A;  4GMJ A;  3QK0 A;  3VTX A;  5EYP F;  2V4L A;  5BXO A;  5KWD A;  2GRN B;  1U3C A;  5H7P A;  3RAU A;  2HO1 A;  3DXK G;  3FWV A;  2WXR A;  4QQI A;  2KC7 A;  2GRL A;  4GZC A;  2KBX A;  3RKV A;  3EHQ A;  1O1S A;  1W3B A;  4EHM A;  3DSX A;  1RZ4 A;  4GCN A;  4GAA A;  4I43 A;  2L0I A;  1ELW A;  1KT0 A;  4Y6W A;  2XPY A;  2H6I A;  4GYY A;  1DNP A;  3W9G A;  2BTD A;  3SGH A;  1LTX A;  4K03 A;  3RRN B;  4DLO A;  3FUK A;  3JXJ A;  4XEI G;  1H2U A;  5FQ7 A;  2X6H A;  2XPZ A;  4JB8 P;  5AQB A;  2WQH A;  3FTV A;  3QAQ A;  4IN3 B;  4F7A A;  3SZ7 A;  4RSY A;  2V5Q C;  3RO3 A;  1N11 A;  3S7B A;  1H6P A;  1UW4 B;  1KZP A;  3S2A A;  4PS3 A;  4B0Z A;  2P2C P;  3NBN B;  2KM4 A;  2UY1 B;  1E8Z A;  1INZ A;  2QYU A;  3RK6 A;  2XGS A;  2FUL A;  4LNU D;  1FVF A;  3DSU A;  1YMP A;  4LG6 A;  4NIK A;  1Z3Y A;  3QB2 A;  4O1O A;  4DX2 A;  2QYJ A;  3MJW A;  2HE0 A;  3UI2 A;  4UWL A;  3CST A;  3CVQ A;  3ZFW A;  1JWF A;  3E34 A;  2P9I G;  1IKN D;  2ZU6 B;  2R02 A;  3FEX A;  3TAX A;  2PZI A;  3ULE G;  4HB5 A;  1K1A A;  4BEP A;  2J09 A;  4O6F A;  4I2Z A;  2WXI A;  1E7U A;  5LCW J;  5KBA A;  4JL0 A;  3EIQ C;  1Y6I A;  3QNK A;  4I6G A;  3CKC A;  4IRU A;  4FLB A;  2WXJ A;  3UQ3 A;  4WAF A;  1XNF A;  2VYI A;  3ABL E;  3APC A;  1HS6 A;  3ASH A;  2Y4T A;  4GTS A;  1MHQ A;  2GRP B;  4BWR A;  2V8S E;  3L22 A;  4CDR A;  1HO8 A;  3ZNG A;  1QQE A;  4KZC A;  4HBD A;  1ZB1 A;  1H6K A;  4RVB A;  1Y8M A;  3JYS A;  5AJD A;  1TEZ A;  2RKK A;  4GU5 A;  5JHA A;  4L2Y A;  3TWU A;  3UIO C;  4AP2 A;  4JHR A;  1D9S A;  1SA4 A;  1JCR A;  1TYQ G;  4K5A B;  4HS2 A;  4ANW A;  4HFG A;  4DUI A;  4XZ4 A;  3N71 A;  2OEW A;  4HOR A;  4GB9 A;  1N52 A;  3LEW A;  3FP3 A;  1BU9 A;  2X38 A;  3FDH A;  2B0O E;  4U63 A;  3T5X A;  5T4Y A;  3QAR A;  3L54 A;  3K9I A;  4TUM A;  4GZ5 A;  2KCK A;  2VGX B;  2DCP A;  4DK5 A;  3CQC B;  3D9L A;  3CK7 A;  1QBQ A;  3ZN3 A;  5HI7 A;  1SA5 A;  4U07 A;  3Q49 B;  4HOQ A;  2BUG A;  2MOW A;  3G2W A;  1HG2 A;  4GMR A;  3HRA A;  3RO2 A;  1MZC A;  2EIN E;  2FF4 A;  4HOT A;  4F3V A;  4I2W A;  3FTY A;  1K3Z D;  5BXU A;  3FTU A;  4N3B A;  3DST A;  4U0U A;  4UWG A;  2R03 A;  3KD7 A;  3FUD A;  4HRN A;  1OCO E;  4B89 A;  4ILI A;  1D8D A;  3RRU A;  3CR3 A;  3Q5M A;  1L5J A;  4CYM D;  3TJP A;  4EQF A;  1PAQ A;  3P2B A;  4GA1 A;  4K0R A;  2IF4 A;  5BW8 C;  5ANR A;  4BSZ B;  5KJL A;  2J4B A;  2ZXW E;  4UQX A;  3UM2 A;  3D9K A;  5KNH D;  4UUC A;  5J08 A;  4ILH B;  3PE3 A;  4WNE A;  3TWW A;  3TXM A;  4XKB A;  3UPV A;  4KT6 B;  5CRU A;  3CEQ A;  5AQA A;  3QC1 A;  2J07 A;  1JCS A;  3IHY A;  4F53 A;  1G3N B;  3GZS A;  2BKG A;  3QWP A;  5C2Y A;  2PL2 A;  4EZK A;  4YVO A;  2NXP A;  3ZYQ A;  3FU5 A;  4K5C A;  1UJJ A;  3QWW A;  4N5C A;  4HRL A;  3R9A B;  4Q96 A;  4A63 B;  4G11 A;  3G2S A;  3DEO A;  3EIJ A;  3G2U A;  1NA0 A;  3ZVV A;  3CKB A;  1WAO 1;  2UY1 A;  4GPM A;  4L23 A;  5ENO D;  3D3M A;  1DVP A;  4FHJ A;  1UOH A;  2MHK A;  4ATG A;  1PC2 A;  1DCE A;  2P9U G;  2I6H A;  5FQ4 A;  1K8K G;  4I1O B;  1D8E A;  1N94 A;  4XIF A;  3S7F A;  5ITZ F;  1HX8 A;  1UN8 A;  2H6F A;  4XI9 A;  1SW6 A;  1Z6T A;  3AG4 E;  1S0P A;  4RQI A;  5AIJ A;  5ANL A;  3TWV A;  4CZ2 D;  4GZ3 A;  4BER A;  1SQM A;  3NZS A;  1NA3 A;  3B13 A;  1SZA A;  4GTP A;  3CVU A;  1JCQ A;  4XE0 A;  4FJY A;  2CFZ A;  3ZXS A;  3UM0 A;  5JHB A;  3L08 A;  4H7Y A;  3E32 A;  4IUL A;  3UX4 A;  4AM9 A;  4UI9 C;  3BQO A;  3FFL A;  1LF8 A;  4NAC A;  3PZ3 A;  3R9M A;  3JUI A;  2J49 A;  2XS8 A;  1DC2 A;  2IO2 C;  5KNG A;  3PH0 C;  3CSF A;  2X6K A;  3ONK A;  5ENN A;  1EYH A;  2NYJ A;  3FTZ A;  1E90 A;  2OEV A;  2WXH A;  5G04 J;  3E37 A;  1HG5 A;  3FUH A;  3PS6 A;  4GCO A;  5ENS D;  3URZ A;  4KVM A;  1N4Q A;  3SI5 A;  1IHB A;  1MJ0 A;  4RG9 A;  3PVL A;  3UTM A;  3UM3 A;  1K1B A;  5HS0 A;  5LOZ A;  5BV0 A;  4F1P A;  3SD5 A;  2VSY A;  1H19 A;  3CVY A;  1WM5 A;  1N54 A;  3FUM A;  2A4Z A;  2FO7 A;  1U3D A;  2FBN A;  2R5S A;  3DSW A;  4I1A A;  4MRU A;  3D9H A;  3CVP A;  4BSX A;  4BX9 A;  1NZN A;  4R7L A;  4D10 C;  2GRQ B;  4LNG A;  3HVE A;  3ZHE A;  4WND A;  3FU6 A;  5KJN A;  3BG1 B;  4HVB A;  3EDT B;  3RIB A;  3PUJ A;  3F6Q A;  4U7E B;  3FH7 A;  3IBE A;  4BX8 A;  3KS2 A;  3PZ2 A;  1N4R A;  3MKR A;  2JEK A;  3DRA A;  2J8S D;  3EU9 A;  3LXU X;  2VTB B;  3MKQ A;  2I1K A;  3ASG A;  3IXE A;  3L9T A;  4Q69 A;  4J6I A;  2RFM A;  3L17 A;  4GA0 A;  4G26 A;  1X81 A;  2WXN A;  5KJM A;  3CK8 A;  4CEM A;  3Q9U C;  3T8M A;  3ZRH A;  2Y4U A;  4XX5 A;  2AXZ A;  4ACK A;  3CVV A;  2EIL E;  4X8Q A;  3D9O A;  4AV7 A;  4JEU A;  1N0Q A;  4EZJ A;  1H2V C;  2WPV A;  2CHX A;  2DZN A;  5FIN A;  3ZGQ A;  1X5B A;  4G25 A;  5JMN D;  1YA0 A;  3SQV A;  2FEZ A;  1HU3 A;  3SF4 A;  3L13 A;  4C0E A;  1DCQ A;  2KZT B;  1IHG A;  4ANU A;  4CGV A;  4LUN U;  2VGE A;  3HXD A;  3GYZ A;  2JAB A;  1HFA A;  3IKO B;  3S7J A;  3DEP A;  4EEC A;  1BD8 A;  2YNQ A;  3MA5 A;  5JJT A;  2R05 A;  1EDU A;  2F0Y A;  1WDY A;  3CVW A;  1PY1 A;  3IV0 A;  2IFU A;  3QWV A;  3CVN A;  3LKU A;  2F37 A;  2DYS E;  5D0Q D;  2VSX E;  4G1T A;  5A7D B;  4AY5 A;  3PZD A;  4FLH A;  3V31 A;  4ANX A;  5G05 C;  4O1P A;  1TNO A;  2CG3 A;  2OND A;  4G8K A;  3W9F A;  1Z5S C;  4U0S A;  1QYM A;  3CIA A;  3SFX A;  3HG0 D;  2YHE A;  5FT9 A;  2VSO E;  2AWI A;  3T9K A;  4BT9 A;  4ATZ D;  3D9P A;  3OTN A;  3I4G A;  2X6J A;  2R2L A;  1E96 B;  4LCT A;  4QFV A;  2BKK B;  4CT4 A;  2XRZ A;  3HXE A;  4G8L A;  2WB2 A;  2DVW A;  3V2O A;  3V79 K;  3D9M A;  4EZL A;  4ILG A;  4AIF A;  4YVQ C;  2XRY A;  5CHE E;  2A5U A;  4NQ0 A;  4L1B A;  3CHM A;  4RG6 A;  3EHR A;  1TN7 A;  1N0R A;  4UQZ A;  4BFR A;  2LSU A;  3AU5 A;  4HQD A;  2L6J A;  4TXR A;  5FWQ A;  4DX5 D;  4B8A A;  5JJ6 A;  3D9I A;  3DPD A;  3EJN A;  4U95 D;  2ILR A;  2EQX A;  2C2L A;  4UWK A;  2L9B A;  4AY6 A;  3NOC D;  5CCL A;  4WNF A;  2JLB A;  2OVF A;  4FUL A;  1FT1 A;  2C0L A;  3JCK C;  2H6G A;  3RJV A;  2R17 C;  4ABN A;  3CGH A;  2ION A;  1FT2 A;  4L7T A;  3TWQ A;  4PDX A;  3IHV A;  4N2Q A;  3AG3 E;  2IOL A;  5CMY A;  3X2Q E;  2EIJ E;  3CK9 A;  2PQR A;  2DBA A;  2E2E A;  4JEH A;  2Q7F A;  2CFU A;  4L2L A;  4OVV A;  3PZ4 A;  3BUA A;  4JC8 A;  2GRM A;  3TWR A;  3LVQ E;  4JA9 A;  3LPZ A;  4B94 A;  3FTS A;  3PEV B;  3HVE B;  2ETC A;  1SZ9 A;  3MYV A;  3ZHE B;  3HXB A;  3FUL A;  3V2X A;  3JQ0 A;  3CV0 A;  3I5P A;  2VQ2 A;  1S64 A;  3EHN A;  1TNU A;  5JJ7 A;  3AS4 A;  3JXI A;  4I9E A;  2RD0 A;  3NQP A;  3ZYM A;  4ZHB A;  2I9C A;  4E85 A;  4CRW A;  2NC9 A;  3MKQ B;  3IEG A;  3FU0 A;  2VTB A;  2X6I A;  4G2V A;  3OXL A;  2KAT A;  4K5B A;  3SFY A;  1ZU2 A;  3SBT B;  4CGW A;  3TG4 A;  3Q47 B;  4I1M A;  2ZIR A;  3FHE A;  3FEY A;  3VLF A;  3T8K A;  4KBQ A;  3Q73 A;  3ISM C;  4AVX A;  2KCV A;  3Q15 A;  5B1B E;  3Q75 A;  3FUN A;  3U64 A;  4C48 B;  3QKY A;  4LEU A;  3C5R A;  2LNI A;  4J8Y A;  5BUZ A;  4UWF A;  2LAH A;  3FUJ A;  4TV3 A;  5LCW C;  5AEN A;  1MX2 A;  4WNG A;  2KZT A;  1TN8 A;  2WQ7 A;  4J8S A;  4JHJ A;  4YDO A;  3LVR E;  5ARG A;  3J5P A;  2OCC E;  2V5F A;  3I3N A;  1E8W A;  3E30 A;  5KCM A;  2PQN A;  2Y69 E;  2WXP A;  3AJI A;  5LP0 A;  3P1U A;  3UT7 A;  3LDZ A;  5E76 A;  3L16 A;  2ZGG A;  3R7R A;  3OXF A;  3APF A;  2LSV A;  5B3S E;  1HF8 A;  5EKQ D;  4P29 A;  2H6H A;  3L6A A;  4OVU A;  3SO8 A;  1SVX A;  1QZ2 A;  3FUE A;  4OYS A;  4CT0 A;  5CMW A;  3CQG B;  3FTW A;  2HYZ A;  3CVX A;  2IO3 C;  4A1S A;  4URK A;  2WVI A;  2DIW A;  2ZGD A;  1ELR A;  3HXC A;  2XCC A;  3AU4 A;  4GTQ A;  1YYH A;  2IY0 C;  4A3V A;  3ZUV B;  3HYM B;  3FUF A;  1TNZ A;  2C0M A;  2WXM A;  3JQ1 A;  4FC8 A;  4GTT A;  3HXF A;  4GA2 A;  2J08 A;  3J5Q B;  3V30 A;  4U96 D;  4I17 A;  4PS8 A;  4GTM A;  4GPK A;  2VSN A;  4BTB A;  3Q7A A;  1RW2 A;  3UT4 A;  2V0P A;  3B7S A;  3MEK A;  5CEC B;  5HKP A;  4J0U A;  5AAO A;  2J9Q A;  4KXK B;  1WY6 A;  5FTP A;  3UUX A;  4U04 A;  4RLY A;  1MQS A;  2XQ0 A;  3OXG A;  2OOE A;  4LER A;  4U8H A;  4CCA A;  4N2S A;  1EPU A;  3O4Z A;  4L9P A;  3FH8 A;  3MCX A;  2WMO A;  2P58 C;  3Q79 A;  1E8X A;  4WWO A;  5ENP D;  5G05 J;  2VGY A;  4ZFH A;  2ETB A;  4I9C A;  2HM8 A;  1IQR A;  2E0I A;  4M3O A;  3FY4 A;  3HHM A;  1BPO A;  1O5M A;  2L0T B;  4J8E A;  2XGM A;  3TGO A;  4YDY A;  1KZO A;  5A23 A;  4UWH A;  3UKU G;  4G23 A;  4HLE A;  3KEA A;  4MKT A;  2P9N G;  1OCZ E;  4JA7 A;  5CRV A;  5G2N A;  2P9P G;  2OV8 A;  4ANV A;  3PRZ A;  3B7R L;  4APO A;  2XS1 A;  3CHO A;  3SBS A;  1S63 A;  3LJ3 A;  1FVH A;  3KSQ A;  3C3Q A;  4Z68 A;  3SNX A;  2XZT G;  4J8D A;  4B8C B;  2P9K G;  3QJZ A;  1NL4 A;  4AOF A;  4AEZ C;  3LS8 A;  3B7T A;  3D9N A;  3B95 A;  4HLL A;  3AG2 E;  4KVO A;  3ONL A;  2QC9 A;  1HE8 A;  2YQ8 A;  4B93 B;  2NSZ A;  3UKR G;  2EIM E;  1NFI E;  4JVS A;  1N9A A;  5LX8 A;  2VJ8 A;  3E33 A;  5AN8 A;  3CHS A;  2CG2 A;  1AP7 A;  3TWS A;  5B1A E;  3AG1 E;  3SY2 A;  3GZ2 A;  4YND A;  1OT8 A;  3BEE A;  1JWG A;  3ZYL A;  3HIZ A;  2IOS A;  4JPS A;  3HDX A;  3PDN A;  4DLQ A;  5FIO A;  1Z3X A;  2J4D A;  4XI0 A;  3B7U X;  2XHE A;  3BU8 A;  1H6O A;  1NI1 A;  3APD A;  5FZQ A;  4TRQ A;  2QFC A;  5ENT D;  5CBO A;  3MV2 B;  3Q7F A;  1BI8 B;  5HRY A;  2ETA A;  3NAW A;  4J8F A;  5DBK A;  3ESK A;  1OCR E;  4GZD A;  4U0Z A;  5ENR D;  3TWT A;  2KCL A;  5IY5 E;  1OWN A;  4BTA A;  5C1D A;  2WXG A;  3UT8 A;  5EX0 A;  5AYW D;  3WG7 E;  1JUQ A;  3ENE A;  2DWZ A;  2IJG X;  3ULQ A;  5EIB E;  2Y1L E;  4KZ0 A;  2YHC A;  5G04 C;  5ENQ D;  1E7V A;  2GRO B;  4AJW A;  4BES A;  2PM7 A;  1A5E A;  2LAI A;  2QZA A;  4CDN A;  2WQ6 A;  2Y0B G;  4UI9 K;  3PNL B;  3CHP A;  5FQ6 A;  3AS8 A;  1IYG A;  2YIN A;  5BPP A;  4PUC A;  5FZS A;  2BF0 X;  4DX1 A;  4DRX E;  3ML9 A;  2MYO A;  4OAV B;  2UWJ G;  1MYO A;  2PNN A;  1HH8 A;  3AAA C;  1IQU A;  4GTO A;  2GW1 A;  4PH4 B;  2XZD G;  4MBG A;  3SFZ A;  2F8X K;  4WUY A;  3GZ1 A;  4Y6C A;  5AQ7 A;  3ASO E;  5BNW A;  2WXF A;  3TL5 A;  1TN6 A;  5A6C A;  4FHK A;  3KAE A;  1H2T C;  4G24 A;  3Q78 A;  1TNY A;  4HNA D;  2WXK A;  2XCB A;  2XGO A;  4BT8 A;  1YCS B;  2QY7 A;  3NOG D;  3G2V A;  3NB2 A;  4F1S A;  2DYR E;  4GML A;  4HOS A;  5FQ8 A;  2A5E A;  1B89 A;  4DPR A;  3U66 A;  1TNB A;  3NF1 A;  5M72 A;  3LYA A;  1EF1 C;  3C72 A;  3UMV A;  3ML8 A;  3DXM G;  3SHF A;  2OVB A;  2X6F A;  2R59 A;  3DSV A;  3LY7 A;  4DI4 A;  3TWX A;  4FAD A;  3VLD A;  5DIZ A;  2FO1 E;  2F8Y A;  1JPL A;  5EYL A;  3DWL G;  1H0A A;  3U9W A;  3CLJ A;  5HQ8 A;  2WXO A;  3CHR A;  3RRM B;  3L82 A;  5CED B;  4KYO B;  3ZYK A;  4NRH B;  3FTX A;  4AXH A;  4F6R D;  4TXQ A;  2XEE A;  3EU5 A;  4HI9 A;  5EDS A;  1TJC A;  3DSS A;  1BI7 B;  4HOU A;  4A55 A;  3RSE G;  3ZW3 A;  3ASD A;  4PS7 A;  3ABM E;  4GZ6 A;  4FJZ A;  2XEN A;  3Q9N C;  3ZPJ A;  3G2T A;  5FJY A;  4UI9 J;  5AQ9 A;  3ASF A;  2LUH A;  5LFA A;  3ASN E;  2ZIS A;  2M63 A;  1OWM A;  3ZIM A;  2I1J A;  2MRI A;  3LJN A;  2Y3A A;  4U8V D;  2LXL A;  1V55 E;  1A17 A;  3E4B A;  1ZBP A;  1FCH A;  4I6J A;  1N4S A;  3KSL A;  5EID A;  2IEJ A;  3T5V A;  2LXM A;  1Q2Z A;  4TUU A;  4EBA A;  4DX6 D;  4UQY A;  2IQC A;  3U3W A;  3FH5 A;  1VDY A;  4XKC A;  2AW6 A;  4BET A;  1MX4 A;  1MX6 A;  4EPZ A;  1OWL A;  5T8I A;  3KEZ A;  3ABK E;  3U4T A;  4HXI A;  2X3M A;  5D2M C;  1OWP A;  3S7D A;  1UG3 A;  5JA4 D;  3NZU A;  3ULY A;  3UM1 A;  3PNT B;  1OY3 D;  2WM9 A;  4LNB A;  3WXX A;  2I2O A;  3TXN A;  4I6E A;  3EHM A;  3MZL B;  1GW6 A;  3TG5 A;  1O1R A;  5CCM A;  5CBN A;  4GTR A;  1QNF A;  3UXG A;  4E6H A;  3QDN A;  3I4R B;  2P9L G;  1U2V G;  3ZEF A;  2EIK E;  5CER B;  5EN5 D;  5AJL A;  2RFA A;  1XGW A;  3PZ1 A;  4JW1 A;  3R7Q A;  3FUI A;  4WWP A;  2KXP C;  2AXV A;  4MLP A;  3MX3 A;  3O48 A;  3ZXP A;  4JZY A;  4TXP A;  2P9S G;  2V4H C;  4DJA A;  3VTY A;  2AXU A;  4N39 A;  5FZR A;  4DI3 A;  3LY8 A;  3UIN C;  5BT1 A;  4NUR A;  3CHQ A;  4W9R A;  2FI7 A;  4YDE A;  4BY6 A;  5AAR A;  3PRE A;  3MGB A;  3UIP C;  4H7X A;  1P5Q A;  2GGF A;  3BG0 B;  2GRR B;  4OAU C;  4C9B B;  4J7W A;  1AWC B;  1LD7 A; 
#chains in the Genus database with same CATH homology
 1KT1 A;  1HE8 A;  2X6J A;  3I4G A;  2FF4 A;  2YQ8 A;  1E96 B;  5T3R A;  2WMN A;  4LCT A;  2HR2 A;  4F3V A;  2XPI A;  3FTY A;  4I2W A;  4HOT A;  4A1G A;  4QFV A;  3FTU A;  4CT4 A;  3ESL A;  4N3B A;  2NSZ A;  3D9J A;  4LRZ A;  2XRZ A;  3LCA A;  4JVS A;  2WB2 A;  2AVP A;  4U0U A;  4UWG A;  3D9M A;  1HXI A;  3KD7 A;  4ILG A;  2VJ8 A;  4AIF A;  4EZL A;  5LX8 A;  3FUD A;  3MV3 B;  4YVQ C;  1UN9 A;  2XRY A;  3CHS A;  4B89 A;  2CG2 A;  4ILI A;  5CHE E;  3RRU A;  3C98 A;  2A5U A;  1L5J A;  3CR3 A;  3Q5M A;  4L1B A;  3CHM A;  4IYP A;  4NQ0 A;  2XEV A;  4RG6 A;  3TJP A;  4EQF A;  1PAQ A;  3FU3 A;  3P2B A;  4GA1 A;  4K0R A;  2IF4 A;  5BW8 C;  5ANR A;  3GZ2 A;  4YND A;  4UQZ A;  4BFR A;  2LSU A;  3AU5 A;  5KJL A;  2L6J A;  2J4B A;  2CHW A;  5FWQ A;  4UQX A;  4B8A A;  3BEE A;  1JWG A;  5JJ6 A;  3D9I A;  3ZYL A;  3HIZ A;  1E8Y A;  4C0M A;  2IOS A;  3DPD A;  3D9K A;  4JPS A;  3HDX A;  3EJN A;  5J08 A;  2ILR A;  3PDN A;  4DLQ A;  3CVL A;  1UJK A;  4A3T A;  1NP7 A;  2EQX A;  1KLX A;  1Z3X A;  2J4D A;  4ILH B;  5J90 A;  4XI0 A;  2C2L A;  3PE3 A;  4UWK A;  4WNE A;  3VLE A;  3PUK A;  2L9B A;  3TXM A;  4XKB A;  4AY6 A;  3B7U X;  2XHE A;  4KT6 B;  5CCL A;  3UPV A;  4WNF A;  3CEQ A;  2JLB A;  2OVF A;  3APD A;  3QC1 A;  5FZQ A;  4FUL A;  4TRQ A;  3PEU B;  5EX3 A;  2QFC A;  2J07 A;  2C0L A;  3JCK C;  3MV2 B;  2PM6 A;  3AS5 A;  3IHY A;  4F53 A;  5G55 A;  3GZS A;  4N3C A;  3RJV A;  2R17 C;  4Q94 A;  3QWP A;  4EBA G;  5C2Y A;  4ABN A;  3RU0 A;  3CGH A;  2ION A;  4L7T A;  2PL2 A;  4EZK A;  4PDX A;  1OUV A;  4J8F A;  3ESK A;  2RG8 A;  5DBK A;  4GZD A;  3IHV A;  4N2Q A;  4U0Z A;  1TJF A;  2IOL A;  2KCL A;  5CMY A;  4YVO A;  5BV1 A;  1OWN A;  2NXP A;  3ZYQ A;  3CK9 A;  4BTA A;  2PQR A;  5C1D A;  2DBA A;  2E2E A;  4JEH A;  3FU5 A;  1UJJ A;  3QWW A;  3PE4 A;  4N5C A;  2WXG A;  3R9A B;  3UT8 A;  2Q7F A;  1ELK A;  2CFU A;  4L2L A;  4Q96 A;  4OVV A;  4FP7 A;  4JC8 A;  5EX0 A;  5KJK A;  5AYW D;  4G11 A;  3G2S A;  3EIJ A;  3G2U A;  1JUQ A;  2GRM A;  1NA0 A;  3ENE A;  4GYO A;  3ZVV A;  3CKB A;  1WAO 1;  2IJG X;  2UY1 A;  3ULQ A;  3LVQ E;  4FA6 A;  4L23 A;  4JA9 A;  3LPZ A;  3D3M A;  1OWO A;  4B94 A;  1DVP A;  3FTS A;  4FHJ A;  4KZ0 A;  4GYW A;  5E75 A;  2YHC A;  2MHK A;  5G04 C;  2WXQ A;  3PEV B;  4ATG A;  1E7V A;  4AJW A;  3HVE B;  1PC2 A;  4N3A A;  2PM7 A;  4V3I A;  1SZ9 A;  5D0O D;  3GW4 A;  3MYV A;  4KMO A;  3ZHE B;  4FU3 A;  2I6H A;  5FQ4 A;  2LAI A;  4MS6 A;  4I1O B;  2VGX A;  4CDN A;  3FUL A;  2WQ6 A;  4UI9 K;  4WWN A;  4XIF A;  3PNL B;  3JQ0 A;  3S7F A;  3OAW A;  3CV0 A;  3CHP A;  4JHK A;  1HX8 A;  1UN8 A;  3LY9 A;  4JXT A;  4XI9 A;  5FQ6 A;  3I5P A;  1Z6T A;  1HZ4 A;  2VQ2 A;  3Q4A B;  3AS8 A;  3EHN A;  3QOU A;  4CDM A;  1IYG A;  4ACL A;  5JJ7 A;  1S0P A;  3AS4 A;  2IU1 A;  5ARF A;  2YIN A;  4I9E A;  5BPP A;  2LO6 A;  4PUC A;  2WXL A;  2RD0 A;  4ME2 A;  4APF A;  5AIJ A;  5FZS A;  2BF0 X;  5ANL A;  3NQP A;  4GZ3 A;  1SQM A;  3ZYM A;  3DBS A;  3ML9 A;  3NZS A;  1NA3 A;  3B13 A;  2CHZ A;  2I9C A;  2UWJ G;  4GMJ A;  3QK0 A;  1SZA A;  1HH8 A;  3VTX A;  2NC9 A;  4CRW A;  1IQU A;  4E85 A;  3CVU A;  3MKQ B;  2V4L A;  4XE0 A;  2GW1 A;  3IEG A;  4FJY A;  4PH4 B;  3FU0 A;  2VTB A;  3SFZ A;  2X6I A;  4WUY A;  3GZ1 A;  2CFZ A;  3OXL A;  1U3C A;  4G2V A;  3ZXS A;  2KAT A;  4Y6C A;  1ZU2 A;  5JHB A;  3SBT B;  5BNW A;  2WXF A;  4CGW A;  3L08 A;  3TG4 A;  4H7Y A;  3TL5 A;  3Q47 B;  4IUL A;  2HO1 A;  5A6C A;  4FHK A;  3KAE A;  3UX4 A;  4AM9 A;  3FWV A;  4I1M A;  2WXR A;  1H2T C;  3FFL A;  2KC7 A;  4UI9 C;  2GRL A;  4G24 A;  4GZC A;  3FHE A;  3FEY A;  3VLF A;  1LF8 A;  3RKV A;  4NAC A;  4KBQ A;  1W3B A;  2WXK A;  2XCB A;  2XGO A;  4BT8 A;  2QY7 A;  4GCN A;  3JUI A;  4AVX A;  3G2V A;  2J49 A;  4GAA A;  2KCV A;  4F1S A;  4GML A;  4HOS A;  3Q15 A;  5FQ8 A;  1B89 A;  3PH0 C;  4I43 A;  4DPR A;  2L0I A;  3CSF A;  3U66 A;  1ELW A;  1KT0 A;  2X6K A;  4Y6W A;  2XPY A;  3ONK A;  5ENN A;  1EYH A;  3FUN A;  3NF1 A;  5M72 A;  3LYA A;  3U64 A;  1EF1 C;  3UMV A;  4GYY A;  1DNP A;  3QKY A;  3ML8 A;  3FTZ A;  1E90 A;  2BTD A;  4LEU A;  3SGH A;  3SHF A;  2OVB A;  2LNI A;  2X6F A;  2R59 A;  2WXH A;  4K03 A;  5G04 J;  1HG5 A;  5BUZ A;  3FUH A;  3LY7 A;  3PS6 A;  3RRN B;  4GCO A;  3URZ A;  3FUK A;  4DLO A;  4DI4 A;  4KVM A;  4FAD A;  3SI5 A;  1H2U A;  3VLD A;  4UWF A;  5DIZ A;  5FQ7 A;  2LAH A;  3FUJ A;  4TV3 A;  5LCW C;  5AEN A;  2X6H A;  4WNG A;  2XPZ A;  2KZT A;  4RG9 A;  3PVL A;  1JPL A;  2WQ7 A;  4J8S A;  4JHJ A;  1H0A A;  3LVR E;  5ARG A;  3U9W A;  3CLJ A;  5LOZ A;  5HQ8 A;  5BV0 A;  2WQH A;  3FTV A;  3QAQ A;  4IN3 B;  4F7A A;  3SZ7 A;  2WXO A;  3CHR A;  3RRM B;  3SD5 A;  2VSY A;  2V5F A;  4RSY A;  1H19 A;  3I3N A;  3RO3 A;  3CVY A;  1E8W A;  3S7B A;  1WM5 A;  5KCM A;  2PQN A;  4KYO B;  3ZYK A;  4NRH B;  1UW4 B;  1N54 A;  3FUM A;  2WXP A;  3S2A A;  3FTX A;  2A4Z A;  4PS3 A;  4AXH A;  4B0Z A;  5LP0 A;  2FO7 A;  3U3W A;  2KM4 A;  5EDS A;  1U3D A;  1TJC A;  2FBN A;  2R5S A;  4HOU A;  2UY1 B;  4A55 A;  4I1A A;  4MRU A;  3P1U A;  3UT7 A;  3ZW3 A;  1E8Z A;  3ASD A;  1INZ A;  3LDZ A;  3CVP A;  4PS7 A;  5E76 A;  3L16 A;  3RK6 A;  4GZ6 A;  2XGS A;  4BSX A;  4BX9 A;  1NZN A;  4R7L A;  4FJZ A;  4D10 C;  2FUL A;  3R7R A;  3OXF A;  3ZPJ A;  1FVF A;  3HVE A;  3APF A;  2LSV A;  3ZHE A;  3G2T A;  4WND A;  5FJY A;  3FU6 A;  4UI9 J;  1HF8 A;  5EKQ D;  4P29 A;  5KJN A;  3BG1 B;  3ASF A;  3L6A A;  4OVU A;  4HVB A;  5LFA A;  3EDT B;  2M63 A;  3RIB A;  1Z3Y A;  3QB2 A;  3PUJ A;  1OWM A;  3ZIM A;  1QZ2 A;  3FUE A;  2I1J A;  4OYS A;  3MJW A;  4CT0 A;  2MRI A;  5CMW A;  2Y3A A;  3CQG B;  3FH7 A;  3FTW A;  4UWL A;  2HYZ A;  1A17 A;  3E4B A;  3CST A;  1ZBP A;  3CVQ A;  3IBE A;  3ZFW A;  1JWF A;  3CVX A;  4BX8 A;  1FCH A;  4I6J A;  4A1S A;  2ZU6 B;  3FEX A;  3TAX A;  2WVI A;  2DIW A;  3KS2 A;  4URK A;  3MKR A;  2JEK A;  2PZI A;  3T5V A;  1ELR A;  2XCC A;  3AU4 A;  3LXU X;  4TUU A;  4EBA A;  2VTB B;  4A3V A;  3MKQ A;  2I1K A;  3HYM B;  3FUF A;  3ASG A;  4UQY A;  2C0M A;  2J09 A;  4O6F A;  2WXM A;  2IQC A;  3JQ1 A;  3FH5 A;  4FC8 A;  4I2Z A;  4Q69 A;  4J6I A;  4GA0 A;  3L17 A;  4GA2 A;  2WXI A;  1E7U A;  2J08 A;  4G26 A;  5LCW J;  1VDY A;  2WXN A;  5KJM A;  4JL0 A;  3EIQ C;  4I17 A;  4XKC A;  1Y6I A;  2AW6 A;  4PS8 A;  4EPZ A;  1OWL A;  3QNK A;  3CK8 A;  4I6G A;  3CKC A;  3KEZ A;  4IRU A;  5T8I A;  2VSN A;  4BTB A;  4CEM A;  4GPK A;  4FLB A;  3UT4 A;  3T8M A;  2WXJ A;  3U4T A;  3ZRH A;  2Y4U A;  3B7S A;  2V0P A;  4HXI A;  2X3M A;  4WAF A;  3UQ3 A;  1XNF A;  2VYI A;  3MEK A;  4XX5 A;  3APC A;  2AXZ A;  4ACK A;  3CVV A;  1HS6 A;  4J0U A;  3ASH A;  2Y4T A;  1OWP A;  2J9Q A;  4KXK B;  3S7D A;  1MHQ A;  1UG3 A;  3NZU A;  4BWR A;  2V8S E;  1WY6 A;  3L22 A;  3PNT B;  5FTP A;  3UUX A;  2WM9 A;  3D9O A;  4AV7 A;  4JEU A;  4U04 A;  4EZJ A;  3WXX A;  4CDR A;  1HO8 A;  1H2V C;  2I2O A;  1QQE A;  3TXN A;  4I6E A;  3EHM A;  2WPV A;  2CHX A;  1MQS A;  3MZL B;  2XQ0 A;  4KZC A;  3ZGQ A;  1GW6 A;  1H6K A;  4RVB A;  3OXG A;  1Y8M A;  3JYS A;  3TG5 A;  1X5B A;  2OOE A;  4G25 A;  4LER A;  5AJD A;  4U8H A;  1YA0 A;  4CCA A;  1TEZ A;  4GU5 A;  5CCM A;  5JHA A;  4N2S A;  2FEZ A;  1EPU A;  3O4Z A;  1HU3 A;  4L2Y A;  3SF4 A;  4AP2 A;  3FH8 A;  3L13 A;  4C0E A;  4JHR A;  1QNF A;  3MCX A;  4E6H A;  2KZT B;  1IHG A;  3I4R B;  3QDN A;  4ANU A;  4CGV A;  2WMO A;  2P58 C;  4LUN U;  1E8X A;  4HS2 A;  4ANW A;  3GYZ A;  4WWO A;  3ZEF A;  4HFG A;  4XZ4 A;  5G05 J;  2VGY A;  3N71 A;  4HOR A;  5AJL A;  1HFA A;  4GB9 A;  3IKO B;  4I9C A;  2HM8 A;  3S7J A;  1N52 A;  3LEW A;  4EEC A;  3FP3 A;  1IQR A;  2E0I A;  1XGW A;  2YNQ A;  2X38 A;  3MA5 A;  5JJT A;  4JW1 A;  1EDU A;  3FDH A;  4M3O A;  3FY4 A;  3HHM A;  1BPO A;  3R7Q A;  4U63 A;  2L0T B;  3FUI A;  4J8E A;  4WWP A;  2XGM A;  3TGO A;  3T5X A;  3CVW A;  5A23 A;  4UWH A;  1PY1 A;  2AXV A;  3IV0 A;  4G23 A;  3MX3 A;  4MLP A;  5T4Y A;  4HLE A;  3O48 A;  3QAR A;  4MKT A;  3L54 A;  4JZY A;  3K9I A;  4GZ5 A;  2KCK A;  2IFU A;  4DJA A;  4JA7 A;  2VGX B;  3CVN A;  3QWV A;  3VTY A;  2AXU A;  3LKU A;  2DCP A;  4N39 A;  5G2N A;  4DK5 A;  2OV8 A;  4ANV A;  3CQC B;  3D9L A;  5FZR A;  5D0Q D;  4DI3 A;  3PRZ A;  2VSX E;  3CK7 A;  3B7R L;  4APO A;  4G1T A;  3LY8 A;  5A7D B;  4AY5 A;  3CHO A;  5BT1 A;  3PZD A;  3SBS A;  4NUR A;  3LJ3 A;  4FLH A;  1FVH A;  3CHQ A;  4ANX A;  4W9R A;  5G05 C;  2CG3 A;  2FI7 A;  3ZN3 A;  4BY6 A;  2OND A;  5HI7 A;  3PRE A;  3MGB A;  4U0S A;  3SNX A;  3CIA A;  4U07 A;  4J8D A;  3Q49 B;  4B8C B;  2YHE A;  5FT9 A;  3QJZ A;  4H7X A;  1P5Q A;  4HOQ A;  2BUG A;  3BG0 B;  2GGF A;  2MOW A;  2VSO E;  1HG2 A;  2AWI A;  3G2W A;  4BT9 A;  4AOF A;  4AEZ C;  4C9B B;  3LS8 A;  3B7T A;  3D9N A;  3RO2 A;  3D9P A;  4KVO A;  3OTN A;  3ONL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...