2R5SA

The crystal structure of a domain of protein vp0806 (unknown function) from vibrio parahaemolyticus rimd 2210633
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
171
structure length
171
Chain Sequence
DEQLLKQVSELLQQGEHAQALNVIQTLSDELQSRGDVKLAKADCLLETKQFELAQELLATIPLEYQDNSYKSLIAKLELHQQAAESPELKRLEQELAANPDNFELACELAVQYNQVGRDEEALELLWNILKVNLGAQDGEVKKTFMDILSALGQGNAIASKYRRQLYSILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a domain of protein VP0806 (unknown function) from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein VP0806
total genus 69
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
A PF14561 TPR_20 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2r5sA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2r5sA01
3OXFA 4GZ5A 4RG9A 3TGOA 5G04C 3RU0A 3ZPJA 2XGMA 5G04J 5CCLA 3QKYA 1NZNA 4CGWA 2C0MA 2J9QA 3CVPA 2FF4A 3KD7A 4GYYA 4KYOB 4LEUA 4Y6WA 5FZQA 4WNEA 1P5QA 4YNDA 5G05C 3LY7A 2UWJG 5JJ6A 3LCAA 2KCLA 4GYWA 1YA0A 4JA7A 4UI9K 3S7JA 3ZHEB 2XPIA 2XGOA 4ME2A 4N39A 5FZSA 5EX3A 3PDNA 1A17A 2AVPA 3MV3B 1OUVA 3ZFWA 2HO1A 2WPVA 4N3BA 3ZN3A 2OOEA 3ZGQA 4APOA 5BW8C 5BT1A 3CVLA 3ASDA 4G25A 4J8DA 2JLBA 2VGYA 3Q4AB 4O6FA 2KCKA 4WUYA 4YVOA 4BTAA 2I6HA 3CKCA 4U0ZA 2IFUA 3RKVA 1QQEA 3IEGA 3CEQA 1PC2A 3LKUA 4H7XA 2VGXA 2E2EA 3N71A 3ASFA 5D0OD 4UI9C 1HZ4A 4CGVA 3UQ3A 4I17A 5JJ7A 1FCHA 2XCCA 3Q5MA 5DBKA 3RJVA 1WAO1 4J8FA 2VYIA 2VSNA 5DIZA 2BUGA 3RIBA 3SZ7A 3CKBA 3VTXA 4BT9A 4HORA 3CV0A 3LY9A 4YVQC 1ZBPA 2KCVA 1ZU2A 5FT9A 1KLXA 3QWWA 4GZ3A 2HYZA 3LYAA 4N3AA 3Q47B 4UQYA 1KT0A 5AYWD 3AS5A 4WNGA 2NC9A 3GZ1A 5A7DB 4U04A 3ULQA 2FI7A 3UUXA 2GW1A 2HR2A 2LSUA 3FFLA 3LPZA 4G1TA 3ESKA 5EKQD 3LY8A 2WQHA 4KBQA 1IHGA 4CDRA 3E4BA 2XGSA 2ONDA 4I1AA 2PQNA 4BT8A 5D0QD 3AS8A 4BTBA 2IF4A 3MA5A 5KJMA 4EQFA 5CHEE 4F3VA 5KJNA 3BEEA 2Y4TA 1HH8A 4I2ZA 4N2QA 3PE4A 3QDNA 3WXXA 4BWRA 1QZ2A 3R9AB 2UY1A 2VGXB 4U0UA 4UI9J 4AY5A 3Q15A 4N2SA 2UY1B 5A6CA 3OXGA 3EDTB 1NA0A 4G26A 4UQXA 5FJYA 3RO3A 4HOSA 3S7DA 4H7YA 4ABNA 3UPVA 3TAXA 3QOUA 3QWPA 4I2WA 1ELRA 3OXLA 3GW4A 4J8EA 4UQZA 3U4TA 2MHKA 2R5SA 2P58C 3CK8A 4JA9A 4J0UA 5ARGA 1TJCA 3URZA 1B89A 2LNIA 5BNWA 4HOTA 2XCBA 1KT1A 5LCWJ 1IYGA 4GCOA 4JHRA 5KJKA 1W3BA 5EX0A 5JJTA 3U3WA 5CCMA 3K9IA 1HXIA 5HQ8A 4AY6A 2C0LA 1ELWA 2PL2A 4HOQA 2QFCA 1E96B 3QWVA 5FZRA 3S7FA 2KATA 3ASHA 2YQ8A 2Q7FA 3FP3A 3CVNA 3S7BA 4AM9A 2L6JA 3TG4A 1XNFA 3HYMB 4U0SA 3VTYA 4B94A 3MEKA 2Y4UA 3PE3A 4GA0A 2DBAA 4N5CA 3FWVA 4Y6CA 5G05J 3MV2B 2PQRA 4N3CA 3ZHEA 4AIFA 4G23A 4XIFA 5LCWC 4GPKA 2PZIA 4G2VA 3AS4A 3NF1A 3RO2A 4GA2A 4NQ0A 4U07A 5M72A 2FEZA 3KAEA 3CVQA 1NA3A 1WM5A 2FBNA 4GZ6A 3GYZA 4JL0A 4KXKB 2VSYA 4GCNA 4RG6A 4WNDA 3O48A 2V5FA 5FTPA 3KS2A 2KC7A 3MKRA 1Y8MA 2VQ2A 2YHCA 5C1DA 4G24A 2XEVA 3SF4A 4I9CA 4A1SA 4I9EA 3CK7A 4W9RA 3TG5A 2C2LA 3ASGA 4GA1A 4NRHB 4XI9A 5ARFA 5HI7A 5KJLA 4HOUA 3Q49B 4WNFA 2LSVA 3GZ2A 2FO7A 3JYSA 4IN3B 3CK9A 4GYOA 4XI0A
chains in the Genus database with same CATH superfamily
3IXEA 3DXKG 5ENTD 1N0RA 1GW6A 2C0MA 1S0PA 4KYOB 4Y6WA 2LXMA 3I4GA 4XE0A 1FT2A 3J5QB 4DX7D 1OXJA 4CZ2D 4N3BA 2X6FA 3BG1B 3AG4E 4J8DA 4ACLA 2KCKA 3CKCA 3UI2A 3V2OA 2R17C 1EF1C 4U96D 5AJDA 5E75A 4JEUA 3DEOA 3QARA 1DNPA 4HLLA 3ONLA 4OYSA 3AS5A 2QYUA 3ZXSA 4QQIA 5EKQD 3CQCB 3LY8A 1H2TC 4HI9A 2BKGA 3LS8A 2PNNA 4BETA 2VGXB 4PUCA 1HE8A 1QBQA 3EDTB 3TWWA 1Y6IA 1TJCA 4DX1A 3G2UA 2WM9A 4U8HA 3ASHA 2GGFA 3NB2A 3CVNA 5ENPD 4AM9A 3IBEA 1U2VG 3D3MA 4LUNU 2ZGGA 3RO2A 4NQ0A 3I3NA 3MKRA 5T3RA 4FA6A 3E37A 3JYSA 3TWRA 3PZDA 1ZB1A 2WXOA 1HF8A 1DVPA 3ZUVB 3G2WA 2KCLA 3S7JA 1N95A 1OT8A 5CRUA 1L5JA 4O6FA 3PEVB 1N4QA 3NAWA 4LCTA 3FH8A 4U95D 1DCEA 4LERA 5IY5E 1BU9A 2QYJA 3FTSA 4TV3A 4KBQA 4FULA 1EYHA 5KWDA 2JABA 3O4ZA 3PE4A 3WXXA 2DYSE 3C3QA 3UM0A 4ATGA 2ILRA 3FTZA 3S7DA 2P2CP 3QWPA 2B0OE 1IXVA 3SI5A 2R5SA 2P58C 4MBGA 2LNIA 2V4LA 4A1GA 4XX5A 1FVFA 4CT0A 2OVBA 3L13A 1XNFA 4EBAG 3OTNA 2Y4UA 5BXOA 3L82A 3ZHEA 2IO3C 3FULA 1BLXB 1UW4B 4TXQA 3O48A 4CEMA 3T8MA 4EZKA 4FLHA 4RQIA 3L9TA 3DSWA 4W9RA 5ARFA 2WXNA 2J08A 2DWZA 4JHKA 3HXCA 4GYWA 3UT8A 3L54A 5EX3A 2I1JA 2AWIA 3KEZA 4XZ4A 4U0ZA 4AP2A 4PH4B 4AXHA 4CCAA 5D0OD 1SQMA 3Q5MA 4B8CB 4KT6B 4N3AA 3ZYMA 2JEKA 3APFA 1N4RA 3SQVA 5AN8A 2VTBA 3U9WA 3DPYA 2CFUA 1NP7A 2GROB 5HRYA 2NXPA 2OVFA 3TXNA 4AY5A 2CG2A 1G3NB 3L17A 2DCPA 3NBNB 4TRQA 2CHXA 4I2WA 3B7UX 4HRMB 2LUHA 4PS3A 4JHRA 1ELWA 1MHQA 1TEZA 3PUJA 3UT7A 3EIQC 5E76A 4YDYA 3AG3E 3ML9A 3BUAA 4GPKA 3AU5A 2KBXA 2FBNA 4WNDA 2VQ2A 2YHCA 3C3RA 2WB2A 4I9EA 2C2LA 2FO1E 4OAUC 1Z6TA 2FO7A 4F7AA 3OXFA 3SHFA 4GYYA 3VLFA 3BG0B 5G05C 2WXFA 4XKCA 1TNBA 2XRZA 4KZCA 4TUUA 4J8YA 1IQUA 1OUVA 4C9BB 4LNBA 2VGXA 2E2EA 4K5CA 3PRZA 1WY6A 4HS2A 4OAVB 2Y69E 3ZW3A 1ZU2A 3TWVA 3QWWA 5AYWD 3B7BA 1DC2A 1H19A 5KNGA 4EBAA 3FUJA 2R59A 1MX4A 3MA5A 1H6OA 3V79K 5BXUA 3CIAA 3EU5A 3BQOA 3DSVA 5FINA 4G26A 5FJYA 3UKUG 2EQXA 2ETCA 2MHKA 2M63A 3UTMA 2IO2C 4X8QA 4GZCA 5AIJA 1HU3A 2CFZA 2P9UG 1FVHA 3JCKC 5LCWC 5BPPA 2J49A 2XQ0A 4C0EA 4GA2A 5KCMA 3CSFA 3CVQA 2VSOE 4GCNA 1UG3A 3NOGD 4XI9A 2WMOA 3HVEB 5HI7A 3PEUB 3QJZA 1JPLA 4KZ0A 2XGMA 5G04J 4ATZD 4DX6D 2J4DA 4HXIA 5B1AE 5FIOA 4RLYA 1N94A 5BW8C 3ASDA 3PUKA 1OCOE 4MLPA 5JMND 2ETBA 1INZA 2IJGX 4FJYA 1HZ4A 4I17A 5BUZA 5DBKA 4J8FA 4I43A 4WWNA 1N11A 4YVQC 2EIKE 4N5QA 3LPZA 3D9IA 1X81A 4ANXA 3D9NA 4EQFA 4GZDA 3E33A 4O1OA 5J90A 4PS8A 2ZISA 1O1TA 3HXFA 3FUEA 3GW4A 5BT1A 3URZA 2XENA 5KJKA 3DEPA 1TN6A 4GMJA 4UWFA 3SO8A 5LX8A 3FWVA 2CG3A 3NF1A 3AG2E 4L9PA 2FEZA 2AXVA 4JD2G 2V5FA 1OWLA 1QNFA 4WAFA 4G24A 5CEAA 4IYPA 4NRHB 5KJLA 1JWGA 2PM6A 3CK9A 5AQ7A 2GRMA 1VDYA 4K5AB 4RG9A 3TXMA 4CGWA 4NIKA 5ENOD 3MCXA 5T8IA 4I1OB 1YA0A 2EIJE 1IHBA 4JA7A 3CHQA 1TNUA 1H2VC 3ABLE 2XHEA 3LXUX 5FQ4A 1H6KA 3T5VA 4L2YA 2WXMA 4J6IA 2A4ZA 3CVLA 3LDZA 4BTAA 5FQ7A 1PC2A 3Q9UC 1BPOA 4HLEA 5CMYA 5JJ7A 4ILHB 2F37A 2DIWA 2VSNA 1YMPA 2VJ8A 3FUFA 2HE0A 1KLXA 3SGHA 5A7DB 5C2YA 3FEYA 4UUCA 2IOLA 1UN8A 3FUDA 2A5EA 4BTBA 5EDSA 4PDXA 3QDNA 4U0UA 3CHMA 5FQ8A 3CVYA 3QOUA 3EHMA 5ARGA 1E7UA 4G8LA 1HG2A 2EIME 3QNKA 5HQ8A 3ZYKA 1O5MA 3QWVA 3HDXA 1YYHA 2WXIA 4BSXA 4EHMA 3VTYA 3ZRHA 4ANVA 1UJKA 4G2VA 3FTWA 3SFYA 3R7QA 5AQAA 4JL0A 4GZ6A 3MZLB 2KC7A 1Y8MA 1OWNA 4GAAA 5LOZA 3ULYA 3UMVA 4GTOA 3Q79A 4HOUA 4IN3B 3JXJA 4GMRA 3CVWA 1TNOA 3C5RA 3KD7A 4P29A 2Y3AA 2ZU6B 3LY7A 3SNXA 4EPZA 1OWMA 5FZSA 4AV7A 4HVBA 3PREA 1TJFA 4BESA 1S63A 2VGYA 4WUYA 2J8SD 2ETAA 4B93B 2IOSA 4RSYA 4ZFHA 1N54A 1RW2A 3KSLA 3RJVA 3C3OA 2EINE 4GZ3A 3EU9A 3UIOC 2IQCA 3L08A 4DI4A 3FFLA 4G1TA 2H6IA 4PS7A 3APDA 2WXGA 3BEEA 1O1RA 4MS6A 4C48B 3PH0C 3C72A 3L6AA 4DJAA 1MYOA 3CLJA 4ANUA 3ABME 5D2MC 1TYQG 1MQSA 3UIPC 5LCWJ 4HRLA 1OCZE 5CCMA 3QB2A 3MKQA 2PL2A 3UX4A 2IONA 4O60A 3TWQA 3D9KA 3AAAC 1IQRA 4LRZA 3TWSA 4B94A 2DBAA 3AS4A 3DSXA 4C0MA 2KZTA 2R05A 4JHJA 3TG5A 3B95A 1E90A 3ZVVA 4GZ5A 3ZPJA 2AXUA 2WXKA 1P5QA 2P9NG 3ASOE 2XPZA 3TWUA 1UJJA 4YDOA 5A23A 4ILGA 4AJWA 5CRVA 4ZHBA 3P1UA 3PS6A 3T5XA 2OEWA 4JW1A 4ANWA 1HG5A 3SZ7A 1KZOA 3VTXA 3QK0A 4ILIA 1NL4A 3JUEA 3D9JA 4A3TA 2LSUA 3SFZA 2DZNA 4UWLA 3AS8A 3W9FA 3R9AB 5T4YA 1X5BA 1OWOA 1TN7A 4HNAD 5A6CA 3RO3A 3FTUA 4E85A 4TXRA 3PNLB 3FTVA 4HBDA 2WXJA 4GTMA 1E8XA 2R02A 3PZ2A 4AVXA 3ENEA 3J5PA 2GRRB 3D9OA 3LEWA 4N3CA 3DSSA 2KXPC 4U7EB 2RFAA 3B7SA 5C1DA 4Q96A 4GTTA 1K8KG 1HS6A 3PVLA 1D9SA 4WNFA 3GZ2A 2QZAA 1U3DA 1NZNA 4DX5D 2J9QA 5FZQA 4KMOA 3CGHA 2LXLA 4ME2A 4F1SA 5AJLA 3TJPA 3MV3B 4BSZB 4APOA 4G25A 3ZYQA 1V54E 2I6HA 3HRAA 2EILE 4UI9C 3AG1E 4AOFA 3DSUA 1LTXA 4WNGA 2P9IG 5AENA 3E4BA 2H6FA 3EJNA 3NOCD 4BT8A 4DX2A 3FY4A 4F3VA 3QC1A 4N2QA 4BWRA 2VTBB 4UI9J 3Q15A 5FWQA 2VGEA 4Q94A 4L7TA 1Z5SC 5EX0A 2WQ6A 3K9IA 4AY6A 3C98A 4TXPA 5CERB 3LVRE 3EHNA 4HI8A 1E96B 2X3MA 2Q7FA 2DZOA 2L6JA 2CHZA 1JCRA 3NQPA 4MRUA 3SD5A 3MV2B 3TWTA 4APFA 3SBSA 5EIBE 4QFVA 1PAQA 3KAEA 4LSZE 3E34A 2BTDA 2IU1A 3BU8A 4A1SA 3CSTA 4L1BA 5ANLA 2F8YA 2XS1A 3RKVA 4U8VD 3TGOA 3CVXA 1TN8A 2WXLA 4K5BA 2ZGDA 2XGOA 4CYMD 1IKND 2WMNA 4Z68A 3D9LA 4HRNA 4DRXE 1BD8A 1QQEA 2V5QC 5KBAA 3ASFA 4CDNA 1XGWA 2XCCA 2I9CA 4BY6A 2RKKA 3CKBA 5FT9A 2RG8A 3U66A 2WXHA 3ESKA 4YDWA 3L22A 5B3SE 4I6JA 4U8YD 1N4PA 4WWPA 4I1AA 4HFGA 5LFAA 5G55A 2UY1A 1SA5A 4FC8A 4N2SA 3OXGA 4TUMA 1NFIE 1K3ZD 4J7WA 4J0UA 1KT1A 3CHPA 4GCOA 5LP0A 4KVOA 1HXIA 3S7FA 2KATA 3D9MA 3T9KA 4IULA 1N9AA 4D10C 3S7BA 3CVVA 2RFMA 3P2BA 3L16A 4FLBA 3PNTB 1AWCB 3KS2A 1MZCA 3D9PA 2IY0C 2L6BA 4OVUA 2XEVA 4GA1A 4V3IA 1WDYA 2H6HA 2UWJG 4UI9K 4DLQA 4M3OA 2WVIA 1JUQA 2AVPA 2WPVA 2AXZA 4XKBA 5AQ9A 3HG0D 3UINC 2X6KA 2IFUA 3B13A 4H7XA 3HXEA 3E32A 3IHYA 3JUIA 3IKOB 1WAO1 2BEDA 4HORA 5HKPA 2LAHA 4GTRA 3DRAA 3DXMG 4U04A 1N0QA 3FUMA 2H6GA 5BV0A 2J07A 2HM8A 3RK6A 4F6RD 1HH8A 4URKA 3DSTA 3EUVA 2Y0BG 3FUNA 1QYMA 2BF0X 4DI3A 4HOTA 2XCBA 1YCSB 1E7VA 4GU5A 3UKRG 2C0LA 4BX8A 3ZEFA 3Q78A 5B1BE 3RRMB 3MEKA 3PE3A 2R2LA 4NACA 5D66A 4J8SA 5G05J 5BV1A 3LJNA 3ML8A 3UXGA 5AARA 3V2XA 4KXKB 1WM5A 3OAWA 4JPSA 3MKQB 3FU5A 3HXDA 3ZXPA 3HHMA 2ZIRA 3V30A 4GYOA 2WXPA 5G04C 1OCCE 1OWPA 4F1PA 2GRLA 5CCLA 3CVPA 2FF4A 3LVQE 4WNEA 3D9HA 2MRIA 3LJ3A 4N39A 2P9LG 4UWKA 2NYJA 2HO1A 3Q4AB 3W9GA 4YVOA 3N71A 4CGVA 1LF8A 4G8KA 2XZTG 2VYIA 2V4HC 3ZIMA 3LY9A 3KSQA 4BEPA 2R03A 2PM7A 1BI8B 3G2SA 3ISMC 1IHGA 4CDRA 2ONDA 2IF4A 2YHEA 1A5EA 4JC8A 1ELKA 5CMWA 3ZNGA 3SY2A 1MX6A 3TAXA 4J8EA 3U4TA 4JA9A 4DUIA 4FADA 1Z3YA 1IYGA 4B0ZA 1W3BA 1BI7B 3I5PA 3ZKJA 2IEJA 4EECA 4JXTA 4MKTA 4B8AA 3B7RL 1HFAA 3FUKA 4N5CA 4DPRA 4AIFA 2PZIA 5M72A 1MJ0A 1NA3A 2J4BA 2XEHA 3UM2A 3FTYA 2OCCE 5FTPA 1JCSA 4EZLA 3SF4A 1JWFA 2GRQB 2WQ7A 2LO6A 4AEZC 4ACKA 3PZ1A 5JJ6A 2B6CA 3U64A 5EYPF 1A17A 4A3VA 3MX3A 3UM1A 4RVBA 5EILA 3IEGA 3LKUA 4GTQA 3GZSA 4DK5A 1FCHA 4K03A 3CHRA 3S2AA 4CT4A 3RIBA 1ZBPA 3MGBA 3IV0A 3LYAA 4BERA 2WXRA 2FI7A 4JVSA 2X6IA 1K1BA 3ONKA 5D0QD 3G2TA 5KJMA 3FHEA 2X6HA 3ASNE 2Y4TA 3KEAA 4A55A 1KPSB 1E8YA 4FJZA 2X6JA 1NA0A 4UWGA 5CECB 2CHWA 4UQZA 4GTSA 4IRUA 2P9SG 1EPUA 2XEEA 3JQ0A 4FHJA 3DWLG 4M7CA 3F6QA 3NZUA 4XEIG 1SVXA 2XRYA 1RZ4A 2YQ8A 3FP3A 1SZ9A 3SBTB 2I2OA 2X38A 3FU6A 1FT1A 3DBSA 2P9KG 4K0RA 2NSZA 4Y6CA 5JA4D 2PQRA 1O1SA 4U07A 3I4RB 4CDMA 4UWHA 3GYZA 3MJWA 4RG6A 4GTVA 1S64A 3NZSA 2I1KA 2KZTB 4I9CA 3ASGA 5J08A 2YINA 1KZPA 1E8ZA 1Q2ZA 3QKYA 2AJAA 4EZJA 3PZ4A 2DVWA 4YNDA 4GMLA 2XPIA 1H2UA 5ENSD 1K1AA 3ZFWA 3ZN3A 3ZGQA 2L0IA 4R7LA 1EDUA 2OV8A 3CEQA 4LNGA 1TNYA 1UOHA 2J09A 4U63A 5ANRA 3HIZA 3EHQA 4GB9A 2HYZA 5FQ6A 4UQYA 4OVVA 1TR4A 2NC9A 3ULQA 2GW1A 2HR2A 4LG6A 4JB8P 2P9PG 2WQHA 4FU3A 3TWXA 2PQNA 3Q7AA 4JZYA 2XPYA 4I2ZA 1QZ2A 4BFRA 3PZ3A 5EYLA 1LD8A 3AJIA 4I1MA 4UQXA 1PY1A 4H7YA 3MYVA 3RSEG 1ELRA 3OXLA 2F8XK 5BNWA 1NI1A 3ABKE 5KNHD 3FEXA 2MYOA 3VLEA 2LAIA 3HYMB 5AAOA 4GA0A 4CRWA 4G23A 4XIFA 1UN9A 3CR3A 2GRPB 3JXIA 4G11A 3R9MA 1H6PA 3T8KA 2E0IA 3HXBA 5ENNA 4DLOA 2YNQA 2LSVA 3FUHA 3RU0A 3ULEG 4Q69A 1D8DA 2FULA 3LCAA 1H0AA 5CBOA 3RRNB 4JEHA 2OOEA 1JCQA 2JLBA 1WG0A 3VLDA 1N4SA 3QAQA 1MX2A 4A63B 1SA4A 4HB5A 3ZU7B 1D8EA 2BUGA 4BT9A 3FUIA 2KCVA 2KM4A 4FHKA 2L9BA 2V8SE 3Q47B 1KT0A 3GZ1A 2BKKB 3TL5A 5CEDB 2AW6A 5JHAA 4I6GA 3FH7A 4O1PA 4YDEA 1HX8A 1OCRE 3DPDA 3Q7FA 5CBNA 3CHOA 3FU0A 3UT4A 5EN5D 1B89A 5HS0A 3CHSA 1AP7A 5JJTA 1U3CA 3U3WA 4B89A 4HOQA 2QFCA 5FZRA 2L0TB 2OEVA 3ESLA 4WWOA 3TG4A 3APCA 3FTXA 1N52A 3FH5A 4BX9A 4F53A 1E8WA 5JHBA 1FPPA 1SZAA 5ENQD 3CK7A 4E6HA 3B7TA 3IHVA 1Z3XA 3CQGB 4LEUA 2VSXE 5AQBA 4LNUD 3ZHEB 4NURA 3FU3A 3RAUA 3PDNA 3V31A 3R7RA 4L2LA 2XZDG 3ZYLA 2DYRE 1DCQA 1HO8A 5G2NA 3UQ3A 3X2QE 2WXQA 5DIZA 3CV0A 3EHRA 3Q75A 3RRUA 3UUXA 1SW6A 3WG7E 2GRNB 2XGSA 3SFXA 2RD0A 4I6EA 5CHEE 5KJNA 2Y1LE 3EIJA 3Q73A 3CVUA 2UY1B 1OY3D 4GPMA 4HOSA 4ABNA 3UPVA 3CK8A 3AU4A 3JQ1A 4GTPA 2QY7A 3G2VA 4KVMA 3Q9NC 3UM3A 3HVEA 2F0YA 5EIDA 3FDHA 1S70B 4U0SA 5ITZF 3E30A 1V55E 2XS8A 4FP7A 2QC9A 2A5UA 4HQDA 2VSYA 4L23A 2ZXWE 2MOWA 5ENRD 1TNZA 1LD7A 3Q49B 5H7PA 2V0PA 4XI0A
chains in the Genus database with same CATH topology
2WQ7A 2LO6A 4AEZC 1JPLA 4ACKA 4KZ0A 1U3DA 2XGMA 5G04J 1GW6A 1NZNA 2C0MA 2J9QA 1S0PA 4KYOB 4Y6WA 5FZQA 2J4DA 4KMOA 3CGHA 5JJ6A 4HXIA 4ME2A 3I4GA 4XE0A 5AJLA 4F1SA 3U64A 3TJPA 1A17A 4A3VA 3MV3B 4N3BA 2X6FA 3BG1B 5BW8C 4APOA 3ASDA 3PUKA 3MX3A 4G25A 4J8DA 3ZYQA 4ACLA 2KCKA 4MLPA 4RVBA 2I6HA 3CKCA 3IEGA 3LKUA 1INZA 2IJGX 4FJYA 3GZSA 4UI9C 1HZ4A 2R17C 1EF1C 4I17A 4DK5A 1FCHA 5AJDA 5BUZA 5DBKA 4J8FA 4I43A 4K03A 3CHRA 4JEUA 5E75A 3RIBA 4WWNA 3S2AA 4CT4A 4YVQC 1ZBPA 3QARA 3MGBA 4AOFA 1DNPA 3IV0A 3ONLA 3LYAA 4OYSA 3AS5A 4WNGA 3ZXSA 2WXRA 2FI7A 3LPZA 4JVSA 3D9IA 2X6IA 5EKQD 5AENA 3CQCB 3LY8A 4ANXA 1H2TC 3D9NA 3E4BA 3ONKA 3EJNA 4BT8A 5D0QD 3G2TA 3FY4A 3FHEA 4EQFA 4F3VA 4GZDA 3QC1A 2X6HA 3LS8A 5KJMA 2Y4TA 4A55A 4N2QA 5J90A 4PS8A 4BWRA 2VTBB 2VGXB 4UI9J 1E8YA 3Q15A 4FJZA 4PUCA 1HE8A 5FWQA 2X6JA 3EDTB 1NA0A 4UWGA 4Q94A 3FUEA 2CHWA 1Y6IA 4L7TA 3GW4A 4UQZA 5BT1A 4IRUA 1TJCA 3URZA 1EPUA 3G2UA 5KJKA 4FHJA 3JQ0A 4GMJA 5EX0A 2WM9A 2WQ6A 3K9IA 3NZUA 4AY6A 3C98A 4UWFA 4U8HA 3LVRE 3EHNA 1E96B 2X3MA 2XRYA 2GGFA 2YQ8A 2Q7FA 3ASHA 3FP3A 5LX8A 1SZ9A 3SBTB 3CVNA 2I2OA 4AM9A 2L6JA 2X38A 3FU6A 2CHZA 3IBEA 3DBSA 4K0RA 3NQPA 2NSZA 3D3MA 4MRUA 3FWVA 4Y6CA 2CG3A 3MV2B 2PQRA 4LUNU 3SD5A 4APFA 3SBSA 3NF1A 3RO2A 4NQ0A 3I4RB 4QFVA 4U07A 1PAQA 2FEZA 3KAEA 4CDMA 3I3NA 2AXVA 3GYZA 4UWHA 3MJWA 4RG6A 2V5FA 2BTDA 2IU1A 1OWLA 1QNFA 3MKRA 3NZSA 4WAFA 4G24A 5T3RA 2I1KA 4FA6A 2KZTB 4I9CA 4IYPA 4A1SA 3CSTA 3ASGA 4L1BA 5J08A 4NRHB 5ANLA 2YINA 5KJLA 4XI0A 1JWGA 2PM6A 3JYSA 3RKVA 1E8ZA 3CK9A 2GRMA 1VDYA 3PZDA 4RG9A 3TGOA 3TXMA 2WXOA 1HF8A 3QKYA 4CGWA 4EZJA 1DVPA 3CVXA 3MCXA 5T8IA 4YNDA 2WXLA 3G2WA 4I1OB 2KCLA 4GMLA 1YA0A 4JA7A 3S7JA 2XPIA 1H2UA 2XGOA 3CHQA 1H2VC 2XHEA 2WMNA 3LXUX 1H6KA 5FQ4A 3T5VA 3ZFWA 3D9LA 4L2YA 3ZN3A 2WXMA 4J6IA 3ZGQA 2A4ZA 3CVLA 1L5JA 2L0IA 3LDZA 4O6FA 4R7LA 4BTAA 1EDUA 3PEVB 2OV8A 5FQ7A 1QQEA 3CEQA 1PC2A 4LCTA 1BPOA 3ASFA 4HLEA 4CDNA 5CMYA 2J09A 4U63A 1XGWA 5JJ7A 2XCCA 4ILHB 3FH8A 2DIWA 2I9CA 5ANRA 4BY6A 2VSNA 2VJ8A 3CKBA 4LERA 3FUFA 3HIZA 4GB9A 5FT9A 1KLXA 2HYZA 5FQ6A 3SGHA 2RG8A 4UQYA 4OVVA 3U66A 2NC9A 3FTSA 2WXHA 5A7DB 3ULQA 2GW1A 2HR2A 5C2YA 4TV3A 3ESKA 3FEYA 3L22A 4I6JA 2WQHA 4FU3A 4KBQA 2IOLA 1UN8A 3FUDA 4WWPA 4I1AA 2PQNA 4BTBA 4FULA 1EYHA 5EDSA 4HFGA 4JZYA 2XPYA 4PDXA 4I2ZA 5LFAA 5G55A 3O4ZA 3PE4A 3QDNA 3WXXA 1QZ2A 2UY1A 4U0UA 4FC8A 4BFRA 4N2SA 2ILRA 3OXGA 3FTZA 4I1MA 3CHMA 4UQXA 1PY1A 4ATGA 5FQ8A 3S7DA 4H7YA 3CVYA 3QOUA 3QWPA 3MYVA 3EHMA 1ELRA 3OXLA 3SI5A 2R5SA 2P58C 4J0UA 5ARGA 5BNWA 2LNIA 2V4LA 4A1GA 1KT1A 3CHPA 1E7UA 4GCOA 4XX5A 5LP0A 1HG2A 1FVFA 3QNKA 4KVOA 1HXIA 5HQ8A 3ZYKA 3FEXA 3QWVA 3S7FA 2KATA 3D9MA 3HDXA 2OVBA 4CT0A 4IULA 3VLEA 2LAIA 2WXIA 3L13A 3S7BA 4D10C 4BSXA 1XNFA 3HYMB 4EBAG 3OTNA 3VTYA 3CVVA 2Y4UA 3ZRHA 3P2BA 4GA0A 4ANVA 4CRWA 3ZHEA 1UJKA 4G23A 4XIFA 1UN9A 4G2VA 3FULA 1UW4B 3CR3A 3FTWA 3L16A 3R7QA 4FLBA 4JL0A 4G11A 4GZ6A 3MZLB 3PNTB 3O48A 4CEMA 3T8MA 2E0IA 3KS2A 2KC7A 4EZKA 1Y8MA 3D9PA 4OVUA 1OWNA 4FLHA 4GAAA 5LOZA 2XEVA 3UMVA 4W9RA 4GA1A 5ENNA 4DLOA 5ARFA 2YNQA 4V3IA 4HOUA 2WXNA 2LSVA 2J08A 4IN3B 3CVWA 3FUHA 3RU0A 3KD7A 4P29A 2Y3AA 2ZU6B 4JHKA 4Q69A 3LY7A 2UWJG 2FULA 3SNXA 3LCAA 1H0AA 4GYWA 4UI9K 4EPZA 1OWMA 4DLQA 4M3OA 3RRNB 2WVIA 3L54A 5FZSA 3UT8A 5EX3A 1JUQA 4AV7A 4HVBA 2I1JA 2AWIA 3PREA 2AVPA 3KEZA 4JEHA 2WPVA 2AXZA 2OOEA 4XKBA 1TJFA 2JLBA 2VGYA 2X6KA 4WUYA 3VLDA 4XZ4A 4U0ZA 2IFUA 3B13A 2IOSA 4PH4B 4AP2A 4AXHA 4CCAA 3QAQA 4H7XA 4RSYA 5D0OD 3IHYA 1SQMA 1N54A 3JUIA 3IKOB 3Q5MA 3RJVA 1WAO1 2BUGA 4BT9A 4B8CB 4HORA 3FUIA 2LAHA 2KCVA 4KT6B 2KM4A 4FHKA 2L9BA 4GZ3A 4N3AA 2V8SE 3ZYMA 3Q47B 1KT0A 3GZ1A 2JEKA 2IQCA 4U04A 3L08A 3TL5A 4DI4A 3FFLA 4G1TA 2AW6A 3FUMA 5JHAA 3APFA 4I6GA 3FH7A 4PS7A 3APDA 5BV0A 2J07A 2HM8A 3RK6A 2WXGA 1HX8A 2VTBA 3U9WA 3BEEA 1HH8A 4URKA 2CFUA 1NP7A 3DPDA 2NXPA 4MS6A 2OVFA 3TXNA 4AY5A 2CG2A 3CHOA 3FUNA 3L17A 3PH0C 2DCPA 3FU0A 3L6AA 4DJAA 3UT4A 4TRQA 2BF0X 2CHXA 4I2WA 3CLJA 4ANUA 3B7UX 4PS3A 1B89A 4DI3A 1MQSA 4HOTA 2XCBA 5LCWJ 3CHSA 4JHRA 5JJTA 1U3CA 3U3WA 5CCMA 1E7VA 3QB2A 4B89A 3MKQA 4GU5A 4BX8A 2C0LA 1ELWA 2PL2A 3UX4A 4HOQA 2QFCA 5FZRA 2L0TB 1MHQA 1TEZA 2IONA 3ESLA 3PUJA 3UT7A 3ZEFA 3D9KA 3RRMB 4WWOA 1IQRA 3EIQC 4LRZA 3TG4A 5E76A 3APCA 4B94A 3MEKA 3PE3A 3FTXA 2DBAA 4NACA 1N52A 3ML9A 4J8SA 5G05J 5BV1A 4GPKA 3AU5A 3ML8A 3FH5A 3AS4A 4BX9A 4F53A 1E8WA 1WM5A 2FBNA 3OAWA 4KXKB 5JHBA 4C0MA 4WNDA 4JPSA 2KZTA 3MKQB 2VQ2A 2YHCA 2WB2A 3FU5A 1SZAA 4I9EA 3CK7A 4JHJA 3TG5A 2C2LA 3HHMA 4E6HA 3B7TA 1Z6TA 2FO7A 1E90A 3ZVVA 4F7AA 4GYOA 3IHVA 2WXPA 3OXFA 4GZ5A 5G04C 3SHFA 3ZPJA 1OWPA 2GRLA 5CCLA 2AXUA 1Z3XA 3CQGB 2FF4A 3CVPA 4GYYA 4LEUA 2WXKA 3VLFA 2VSXE 3LVQE 4WNEA 1P5QA 3BG0B 5G05C 2WXFA 4XKCA 2XRZA 2XPZA 3ZHEB 2MRIA 4KZCA 4NURA 1UJJA 3LJ3A 4TUUA 4N39A 4UWKA 3FU3A 5A23A 1IQUA 3PDNA 1OUVA 2HO1A 4ILGA 4C9BB 3R7RA 4AJWA 4L2LA 3Q4AB 4YVOA 3P1UA 3PS6A 3T5XA 3ZYLA 4JW1A 2VGXA 2E2EA 3N71A 4ANWA 1HG5A 4CGVA 1HO8A 5G2NA 3UQ3A 1LF8A 3PRZA 2WXQA 1WY6A 2VYIA 5DIZA 3SZ7A 4HS2A 3VTXA 3CV0A 3LY9A 3QK0A 3ZIMA 3ZW3A 1ZU2A 3QWWA 4ILIA 3RRUA 2PM7A 5AYWD 3UUXA 3D9JA 4A3TA 2LSUA 3G2SA 1H19A 3SFZA 1IHGA 4CDRA 4EBAA 2XGSA 2ONDA 3FUJA 4UWLA 2RD0A 3AS8A 2IF4A 2R59A 3MA5A 4I6EA 5CHEE 5KJNA 2YHEA 3EIJA 3CIAA 4JC8A 3R9AB 5T4YA 3CVUA 1ELKA 1X5BA 5CMWA 1OWOA 2UY1B 5A6CA 4G26A 3RO3A 3FTUA 5FJYA 4E85A 4HOSA 4ABNA 3UPVA 3TAXA 3PNLB 2EQXA 4J8EA 3U4TA 2MHKA 3CK8A 4JA9A 2M63A 3AU4A 4FADA 1Z3YA 3FTVA 2WXJA 1IYGA 1E8XA 4B0ZA 1W3BA 3JQ1A 3I5PA 4EECA 2QY7A 4GZCA 4JXTA 4MKTA 4AVXA 3G2VA 4B8AA 5AIJA 3B7RL 4KVMA 1HFAA 3ENEA 3HVEA 3FDHA 1HU3A 4U0SA 3D9OA 2CFZA 3FUKA 3LEWA 4N5CA 1FVHA 4DPRA 4N3CA 3JCKC 5LCWC 4AIFA 5BPPA 2PZIA 4FP7A 2J49A 2XQ0A 4C0EA 4GA2A 5M72A 2A5UA 3CSFA 5KCMA 3B7SA 1NA3A 3CVQA 2J4BA 2VSOE 2VSYA 3FTYA 4GCNA 5FTPA 1UG3A 4L23A 5C1DA 4Q96A 4EZLA 2MOWA 3SF4A 4XI9A 1HS6A 2WMOA 3HVEB 3PVLA 5HI7A 1JWFA 3Q49B 3PEUB 4WNFA 3GZ2A 2V0PA 3QJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXF A;  4GZ5 A;  4RG9 A;  3TGO A;  5G04 C;  3RU0 A;  3ZPJ A;  2XGM A;  5G04 J;  5CCL A;  3QKY A;  1NZN A;  4CGW A;  2C0M A;  2J9Q A;  3CVP A;  2FF4 A;  3KD7 A;  4GYY A;  4KYO B;  4LEU A;  4Y6W A;  5FZQ A;  4WNE A;  1P5Q A;  4YND A;  5G05 C;  3LY7 A;  2UWJ G;  5JJ6 A;  3LCA A;  2KCL A;  4GYW A;  1YA0 A;  4JA7 A;  4UI9 K;  3S7J A;  3ZHE B;  2XPI A;  2XGO A;  4ME2 A;  4N39 A;  5FZS A;  5EX3 A;  3PDN A;  1A17 A;  2AVP A;  3MV3 B;  1OUV A;  3ZFW A;  2HO1 A;  2WPV A;  4N3B A;  3ZN3 A;  2OOE A;  3ZGQ A;  4APO A;  5BW8 C;  5BT1 A;  3CVL A;  3ASD A;  4G25 A;  4J8D A;  2JLB A;  2VGY A;  3Q4A B;  4O6F A;  2KCK A;  4WUY A;  4YVO A;  4BTA A;  2I6H A;  3CKC A;  4U0Z A;  2IFU A;  3RKV A;  1QQE A;  3IEG A;  3CEQ A;  1PC2 A;  3LKU A;  4H7X A;  2VGX A;  2E2E A;  3N71 A;  3ASF A;  5D0O D;  4UI9 C;  1HZ4 A;  4CGV A;  3UQ3 A;  4I17 A;  5JJ7 A;  1FCH A;  2XCC A;  3Q5M A;  5DBK A;  3RJV A;  1WAO 1;  4J8F A;  2VYI A;  2VSN A;  5DIZ A;  2BUG A;  3RIB A;  3SZ7 A;  3CKB A;  3VTX A;  4BT9 A;  4HOR A;  3CV0 A;  3LY9 A;  4YVQ C;  1ZBP A;  2KCV A;  1ZU2 A;  5FT9 A;  1KLX A;  3QWW A;  4GZ3 A;  2HYZ A;  3LYA A;  4N3A A;  3Q47 B;  4UQY A;  1KT0 A;  5AYW D;  3AS5 A;  4WNG A;  2NC9 A;  3GZ1 A;  5A7D B;  4U04 A;  3ULQ A;  2FI7 A;  3UUX A;  2GW1 A;  2HR2 A;  2LSU A;  3FFL A;  3LPZ A;  4G1T A;  3ESK A;  5EKQ D;  3LY8 A;  2WQH A;  4KBQ A;  1IHG A;  4CDR A;  3E4B A;  2XGS A;  2OND A;  4I1A A;  2PQN A;  4BT8 A;  5D0Q D;  3AS8 A;  4BTB A;  2IF4 A;  3MA5 A;  5KJM A;  4EQF A;  5CHE E;  4F3V A;  5KJN A;  3BEE A;  2Y4T A;  1HH8 A;  4I2Z A;  4N2Q A;  3PE4 A;  3QDN A;  3WXX A;  4BWR A;  1QZ2 A;  3R9A B;  2UY1 A;  2VGX B;  4U0U A;  4UI9 J;  4AY5 A;  3Q15 A;  4N2S A;  2UY1 B;  5A6C A;  3OXG A;  3EDT B;  1NA0 A;  4G26 A;  4UQX A;  5FJY A;  3RO3 A;  4HOS A;  3S7D A;  4H7Y A;  4ABN A;  3UPV A;  3TAX A;  3QOU A;  3QWP A;  4I2W A;  1ELR A;  3OXL A;  3GW4 A;  4J8E A;  4UQZ A;  3U4T A;  2MHK A;  2R5S A;  2P58 C;  3CK8 A;  4JA9 A;  4J0U A;  5ARG A;  1TJC A;  3URZ A;  1B89 A;  2LNI A;  5BNW A;  4HOT A;  2XCB A;  1KT1 A;  5LCW J;  1IYG A;  4GCO A;  4JHR A;  5KJK A;  1W3B A;  5EX0 A;  5JJT A;  3U3W A;  5CCM A;  3K9I A;  1HXI A;  5HQ8 A;  4AY6 A;  2C0L A;  1ELW A;  2PL2 A;  4HOQ A;  2QFC A;  1E96 B;  3QWV A;  5FZR A;  3S7F A;  2KAT A;  3ASH A;  2YQ8 A;  2Q7F A;  3FP3 A;  3CVN A;  3S7B A;  4AM9 A;  2L6J A;  3TG4 A;  1XNF A;  3HYM B;  4U0S A;  3VTY A;  4B94 A;  3MEK A;  2Y4U A;  3PE3 A;  4GA0 A;  2DBA A;  4N5C A;  3FWV A;  4Y6C A;  5G05 J;  3MV2 B;  2PQR A;  4N3C A;  3ZHE A;  4AIF A;  4G23 A;  4XIF A;  5LCW C;  4GPK A;  2PZI A;  4G2V A;  3AS4 A;  3NF1 A;  3RO2 A;  4GA2 A;  4NQ0 A;  4U07 A;  5M72 A;  2FEZ A;  3KAE A;  3CVQ A;  1NA3 A;  1WM5 A;  2FBN A;  4GZ6 A;  3GYZ A;  4JL0 A;  4KXK B;  2VSY A;  4GCN A;  4RG6 A;  4WND A;  3O48 A;  2V5F A;  5FTP A;  3KS2 A;  2KC7 A;  3MKR A;  1Y8M A;  2VQ2 A;  2YHC A;  5C1D A;  4G24 A;  2XEV A;  3SF4 A;  4I9C A;  4A1S A;  4I9E A;  3CK7 A;  4W9R A;  3TG5 A;  2C2L A;  3ASG A;  4GA1 A;  4NRH B;  4XI9 A;  5ARF A;  5HI7 A;  5KJL A;  4HOU A;  3Q49 B;  4WNF A;  2LSV A;  3GZ2 A;  2FO7 A;  3JYS A;  4IN3 B;  3CK9 A;  4GYO A;  4XI0 A; 
#chains in the Genus database with same CATH topology
 3IXE A;  3DXK G;  5ENT D;  1N0R A;  1GW6 A;  2C0M A;  1S0P A;  4KYO B;  4Y6W A;  2LXM A;  3I4G A;  4XE0 A;  1FT2 A;  3J5Q B;  4DX7 D;  1OXJ A;  4CZ2 D;  4N3B A;  2X6F A;  3BG1 B;  3AG4 E;  4J8D A;  4ACL A;  2KCK A;  3CKC A;  3UI2 A;  3V2O A;  2R17 C;  1EF1 C;  4U96 D;  5AJD A;  5E75 A;  4JEU A;  3DEO A;  3QAR A;  1DNP A;  4HLL A;  3ONL A;  4OYS A;  3AS5 A;  2QYU A;  3ZXS A;  4QQI A;  5EKQ D;  3CQC B;  3LY8 A;  1H2T C;  4HI9 A;  2BKG A;  3LS8 A;  2PNN A;  4BET A;  2VGX B;  4PUC A;  1HE8 A;  1QBQ A;  3EDT B;  3TWW A;  1Y6I A;  1TJC A;  4DX1 A;  3G2U A;  2WM9 A;  4U8H A;  3ASH A;  2GGF A;  3NB2 A;  3CVN A;  5ENP D;  4AM9 A;  3IBE A;  1U2V G;  3D3M A;  4LUN U;  2ZGG A;  3RO2 A;  4NQ0 A;  3I3N A;  3MKR A;  5T3R A;  4FA6 A;  3E37 A;  3JYS A;  3TWR A;  3PZD A;  1ZB1 A;  2WXO A;  1HF8 A;  1DVP A;  3ZUV B;  3G2W A;  2KCL A;  3S7J A;  1N95 A;  1OT8 A;  5CRU A;  1L5J A;  4O6F A;  3PEV B;  1N4Q A;  3NAW A;  4LCT A;  3FH8 A;  4U95 D;  1DCE A;  4LER A;  5IY5 E;  1BU9 A;  2QYJ A;  3FTS A;  4TV3 A;  4KBQ A;  4FUL A;  1EYH A;  5KWD A;  2JAB A;  3O4Z A;  3PE4 A;  3WXX A;  2DYS E;  3C3Q A;  3UM0 A;  4ATG A;  2ILR A;  3FTZ A;  3S7D A;  2P2C P;  3QWP A;  2B0O E;  1IXV A;  3SI5 A;  2R5S A;  2P58 C;  4MBG A;  2LNI A;  2V4L A;  4A1G A;  4XX5 A;  1FVF A;  4CT0 A;  2OVB A;  3L13 A;  1XNF A;  4EBA G;  3OTN A;  2Y4U A;  5BXO A;  3L82 A;  3ZHE A;  2IO3 C;  3FUL A;  1BLX B;  1UW4 B;  4TXQ A;  3O48 A;  4CEM A;  3T8M A;  4EZK A;  4FLH A;  4RQI A;  3L9T A;  3DSW A;  4W9R A;  5ARF A;  2WXN A;  2J08 A;  2DWZ A;  4JHK A;  3HXC A;  4GYW A;  3UT8 A;  3L54 A;  5EX3 A;  2I1J A;  2AWI A;  3KEZ A;  4XZ4 A;  4U0Z A;  4AP2 A;  4PH4 B;  4AXH A;  4CCA A;  5D0O D;  1SQM A;  3Q5M A;  4B8C B;  4KT6 B;  4N3A A;  3ZYM A;  2JEK A;  3APF A;  1N4R A;  3SQV A;  5AN8 A;  2VTB A;  3U9W A;  3DPY A;  2CFU A;  1NP7 A;  2GRO B;  5HRY A;  2NXP A;  2OVF A;  3TXN A;  4AY5 A;  2CG2 A;  1G3N B;  3L17 A;  2DCP A;  3NBN B;  4TRQ A;  2CHX A;  4I2W A;  3B7U X;  4HRM B;  2LUH A;  4PS3 A;  4JHR A;  1ELW A;  1MHQ A;  1TEZ A;  3PUJ A;  3UT7 A;  3EIQ C;  5E76 A;  4YDY A;  3AG3 E;  3ML9 A;  3BUA A;  4GPK A;  3AU5 A;  2KBX A;  2FBN A;  4WND A;  2VQ2 A;  2YHC A;  3C3R A;  2WB2 A;  4I9E A;  2C2L A;  2FO1 E;  4OAU C;  1Z6T A;  2FO7 A;  4F7A A;  3OXF A;  3SHF A;  4GYY A;  3VLF A;  3BG0 B;  5G05 C;  2WXF A;  4XKC A;  1TNB A;  2XRZ A;  4KZC A;  4TUU A;  4J8Y A;  1IQU A;  1OUV A;  4C9B B;  4LNB A;  2VGX A;  2E2E A;  4K5C A;  3PRZ A;  1WY6 A;  4HS2 A;  4OAV B;  2Y69 E;  3ZW3 A;  1ZU2 A;  3TWV A;  3QWW A;  5AYW D;  3B7B A;  1DC2 A;  1H19 A;  5KNG A;  4EBA A;  3FUJ A;  2R59 A;  1MX4 A;  3MA5 A;  1H6O A;  3V79 K;  5BXU A;  3CIA A;  3EU5 A;  3BQO A;  3DSV A;  5FIN A;  4G26 A;  5FJY A;  3UKU G;  2EQX A;  2ETC A;  2MHK A;  2M63 A;  3UTM A;  2IO2 C;  4X8Q A;  4GZC A;  5AIJ A;  1HU3 A;  2CFZ A;  2P9U G;  1FVH A;  3JCK C;  5LCW C;  5BPP A;  2J49 A;  2XQ0 A;  4C0E A;  4GA2 A;  5KCM A;  3CSF A;  3CVQ A;  2VSO E;  4GCN A;  1UG3 A;  3NOG D;  4XI9 A;  2WMO A;  3HVE B;  5HI7 A;  3PEU B;  3QJZ A;  1JPL A;  4KZ0 A;  2XGM A;  5G04 J;  4ATZ D;  4DX6 D;  2J4D A;  4HXI A;  5B1A E;  5FIO A;  4RLY A;  1N94 A;  5BW8 C;  3ASD A;  3PUK A;  1OCO E;  4MLP A;  5JMN D;  2ETB A;  1INZ A;  2IJG X;  4FJY A;  1HZ4 A;  4I17 A;  5BUZ A;  5DBK A;  4J8F A;  4I43 A;  4WWN A;  1N11 A;  4YVQ C;  2EIK E;  4N5Q A;  3LPZ A;  3D9I A;  1X81 A;  4ANX A;  3D9N A;  4EQF A;  4GZD A;  3E33 A;  4O1O A;  5J90 A;  4PS8 A;  2ZIS A;  1O1T A;  3HXF A;  3FUE A;  3GW4 A;  5BT1 A;  3URZ A;  2XEN A;  5KJK A;  3DEP A;  1TN6 A;  4GMJ A;  4UWF A;  3SO8 A;  5LX8 A;  3FWV A;  2CG3 A;  3NF1 A;  3AG2 E;  4L9P A;  2FEZ A;  2AXV A;  4JD2 G;  2V5F A;  1OWL A;  1QNF A;  4WAF A;  4G24 A;  5CEA A;  4IYP A;  4NRH B;  5KJL A;  1JWG A;  2PM6 A;  3CK9 A;  5AQ7 A;  2GRM A;  1VDY A;  4K5A B;  4RG9 A;  3TXM A;  4CGW A;  4NIK A;  5ENO D;  3MCX A;  5T8I A;  4I1O B;  1YA0 A;  2EIJ E;  1IHB A;  4JA7 A;  3CHQ A;  1TNU A;  1H2V C;  3ABL E;  2XHE A;  3LXU X;  5FQ4 A;  1H6K A;  3T5V A;  4L2Y A;  2WXM A;  4J6I A;  2A4Z A;  3CVL A;  3LDZ A;  4BTA A;  5FQ7 A;  1PC2 A;  3Q9U C;  1BPO A;  4HLE A;  5CMY A;  5JJ7 A;  4ILH B;  2F37 A;  2DIW A;  2VSN A;  1YMP A;  2VJ8 A;  3FUF A;  2HE0 A;  1KLX A;  3SGH A;  5A7D B;  5C2Y A;  3FEY A;  4UUC A;  2IOL A;  1UN8 A;  3FUD A;  2A5E A;  4BTB A;  5EDS A;  4PDX A;  3QDN A;  4U0U A;  3CHM A;  5FQ8 A;  3CVY A;  3QOU A;  3EHM A;  5ARG A;  1E7U A;  4G8L A;  1HG2 A;  2EIM E;  3QNK A;  5HQ8 A;  3ZYK A;  1O5M A;  3QWV A;  3HDX A;  1YYH A;  2WXI A;  4BSX A;  4EHM A;  3VTY A;  3ZRH A;  4ANV A;  1UJK A;  4G2V A;  3FTW A;  3SFY A;  3R7Q A;  5AQA A;  4JL0 A;  4GZ6 A;  3MZL B;  2KC7 A;  1Y8M A;  1OWN A;  4GAA A;  5LOZ A;  3ULY A;  3UMV A;  4GTO A;  3Q79 A;  4HOU A;  4IN3 B;  3JXJ A;  4GMR A;  3CVW A;  1TNO A;  3C5R A;  3KD7 A;  4P29 A;  2Y3A A;  2ZU6 B;  3LY7 A;  3SNX A;  4EPZ A;  1OWM A;  5FZS A;  4AV7 A;  4HVB A;  3PRE A;  1TJF A;  4BES A;  1S63 A;  2VGY A;  4WUY A;  2J8S D;  2ETA A;  4B93 B;  2IOS A;  4RSY A;  4ZFH A;  1N54 A;  1RW2 A;  3KSL A;  3RJV A;  3C3O A;  2EIN E;  4GZ3 A;  3EU9 A;  3UIO C;  2IQC A;  3L08 A;  4DI4 A;  3FFL A;  4G1T A;  2H6I A;  4PS7 A;  3APD A;  2WXG A;  3BEE A;  1O1R A;  4MS6 A;  4C48 B;  3PH0 C;  3C72 A;  3L6A A;  4DJA A;  1MYO A;  3CLJ A;  4ANU A;  3ABM E;  5D2M C;  1TYQ G;  1MQS A;  3UIP C;  5LCW J;  4HRL A;  1OCZ E;  5CCM A;  3QB2 A;  3MKQ A;  2PL2 A;  3UX4 A;  2ION A;  4O60 A;  3TWQ A;  3D9K A;  3AAA C;  1IQR A;  4LRZ A;  3TWS A;  4B94 A;  2DBA A;  3AS4 A;  3DSX A;  4C0M A;  2KZT A;  2R05 A;  4JHJ A;  3TG5 A;  3B95 A;  1E90 A;  3ZVV A;  4GZ5 A;  3ZPJ A;  2AXU A;  2WXK A;  1P5Q A;  2P9N G;  3ASO E;  2XPZ A;  3TWU A;  1UJJ A;  4YDO A;  5A23 A;  4ILG A;  4AJW A;  5CRV A;  4ZHB A;  3P1U A;  3PS6 A;  3T5X A;  2OEW A;  4JW1 A;  4ANW A;  1HG5 A;  3SZ7 A;  1KZO A;  3VTX A;  3QK0 A;  4ILI A;  1NL4 A;  3JUE A;  3D9J A;  4A3T A;  2LSU A;  3SFZ A;  2DZN A;  4UWL A;  3AS8 A;  3W9F A;  3R9A B;  5T4Y A;  1X5B A;  1OWO A;  1TN7 A;  4HNA D;  5A6C A;  3RO3 A;  3FTU A;  4E85 A;  4TXR A;  3PNL B;  3FTV A;  4HBD A;  2WXJ A;  4GTM A;  1E8X A;  2R02 A;  3PZ2 A;  4AVX A;  3ENE A;  3J5P A;  2GRR B;  3D9O A;  3LEW A;  4N3C A;  3DSS A;  2KXP C;  4U7E B;  2RFA A;  3B7S A;  5C1D A;  4Q96 A;  4GTT A;  1K8K G;  1HS6 A;  3PVL A;  1D9S A;  4WNF A;  3GZ2 A;  2QZA A;  1U3D A;  1NZN A;  4DX5 D;  2J9Q A;  5FZQ A;  4KMO A;  3CGH A;  2LXL A;  4ME2 A;  4F1S A;  5AJL A;  3TJP A;  3MV3 B;  4BSZ B;  4APO A;  4G25 A;  3ZYQ A;  1V54 E;  2I6H A;  3HRA A;  2EIL E;  4UI9 C;  3AG1 E;  4AOF A;  3DSU A;  1LTX A;  4WNG A;  2P9I G;  5AEN A;  3E4B A;  2H6F A;  3EJN A;  3NOC D;  4BT8 A;  4DX2 A;  3FY4 A;  4F3V A;  3QC1 A;  4N2Q A;  4BWR A;  2VTB B;  4UI9 J;  3Q15 A;  5FWQ A;  2VGE A;  4Q94 A;  4L7T A;  1Z5S C;  5EX0 A;  2WQ6 A;  3K9I A;  4AY6 A;  3C98 A;  4TXP A;  5CER B;  3LVR E;  3EHN A;  4HI8 A;  1E96 B;  2X3M A;  2Q7F A;  2DZO A;  2L6J A;  2CHZ A;  1JCR A;  3NQP A;  4MRU A;  3SD5 A;  3MV2 B;  3TWT A;  4APF A;  3SBS A;  5EIB E;  4QFV A;  1PAQ A;  3KAE A;  4LSZ E;  3E34 A;  2BTD A;  2IU1 A;  3BU8 A;  4A1S A;  3CST A;  4L1B A;  5ANL A;  2F8Y A;  2XS1 A;  3RKV A;  4U8V D;  3TGO A;  3CVX A;  1TN8 A;  2WXL A;  4K5B A;  2ZGD A;  2XGO A;  4CYM D;  1IKN D;  2WMN A;  4Z68 A;  3D9L A;  4HRN A;  4DRX E;  1BD8 A;  1QQE A;  2V5Q C;  5KBA A;  3ASF A;  4CDN A;  1XGW A;  2XCC A;  2I9C A;  4BY6 A;  2RKK A;  3CKB A;  5FT9 A;  2RG8 A;  3U66 A;  2WXH A;  3ESK A;  4YDW A;  3L22 A;  5B3S E;  4I6J A;  4U8Y D;  1N4P A;  4WWP A;  4I1A A;  4HFG A;  5LFA A;  5G55 A;  2UY1 A;  1SA5 A;  4FC8 A;  4N2S A;  3OXG A;  4TUM A;  1NFI E;  1K3Z D;  4J7W A;  4J0U A;  1KT1 A;  3CHP A;  4GCO A;  5LP0 A;  4KVO A;  1HXI A;  3S7F A;  2KAT A;  3D9M A;  3T9K A;  4IUL A;  1N9A A;  4D10 C;  3S7B A;  3CVV A;  2RFM A;  3P2B A;  3L16 A;  4FLB A;  3PNT B;  1AWC B;  3KS2 A;  1MZC A;  3D9P A;  2IY0 C;  2L6B A;  4OVU A;  2XEV A;  4GA1 A;  4V3I A;  1WDY A;  2H6H A;  2UWJ G;  4UI9 K;  4DLQ A;  4M3O A;  2WVI A;  1JUQ A;  2AVP A;  2WPV A;  2AXZ A;  4XKB A;  5AQ9 A;  3HG0 D;  3UIN C;  2X6K A;  2IFU A;  3B13 A;  4H7X A;  3HXE A;  3E32 A;  3IHY A;  3JUI A;  3IKO B;  1WAO 1;  2BED A;  4HOR A;  5HKP A;  2LAH A;  4GTR A;  3DRA A;  3DXM G;  4U04 A;  1N0Q A;  3FUM A;  2H6G A;  5BV0 A;  2J07 A;  2HM8 A;  3RK6 A;  4F6R D;  1HH8 A;  4URK A;  3DST A;  3EUV A;  2Y0B G;  3FUN A;  1QYM A;  2BF0 X;  4DI3 A;  4HOT A;  2XCB A;  1YCS B;  1E7V A;  4GU5 A;  3UKR G;  2C0L A;  4BX8 A;  3ZEF A;  3Q78 A;  5B1B E;  3RRM B;  3MEK A;  3PE3 A;  2R2L A;  4NAC A;  5D66 A;  4J8S A;  5G05 J;  5BV1 A;  3LJN A;  3ML8 A;  3UXG A;  5AAR A;  3V2X A;  4KXK B;  1WM5 A;  3OAW A;  4JPS A;  3MKQ B;  3FU5 A;  3HXD A;  3ZXP A;  3HHM A;  2ZIR A;  3V30 A;  4GYO A;  2WXP A;  5G04 C;  1OCC E;  1OWP A;  4F1P A;  2GRL A;  5CCL A;  3CVP A;  2FF4 A;  3LVQ E;  4WNE A;  3D9H A;  2MRI A;  3LJ3 A;  4N39 A;  2P9L G;  4UWK A;  2NYJ A;  2HO1 A;  3Q4A B;  3W9G A;  4YVO A;  3N71 A;  4CGV A;  1LF8 A;  4G8K A;  2XZT G;  2VYI A;  2V4H C;  3ZIM A;  3LY9 A;  3KSQ A;  4BEP A;  2R03 A;  2PM7 A;  1BI8 B;  3G2S A;  3ISM C;  1IHG A;  4CDR A;  2OND A;  2IF4 A;  2YHE A;  1A5E A;  4JC8 A;  1ELK A;  5CMW A;  3ZNG A;  3SY2 A;  1MX6 A;  3TAX A;  4J8E A;  3U4T A;  4JA9 A;  4DUI A;  4FAD A;  1Z3Y A;  1IYG A;  4B0Z A;  1W3B A;  1BI7 B;  3I5P A;  3ZKJ A;  2IEJ A;  4EEC A;  4JXT A;  4MKT A;  4B8A A;  3B7R L;  1HFA A;  3FUK A;  4N5C A;  4DPR A;  4AIF A;  2PZI A;  5M72 A;  1MJ0 A;  1NA3 A;  2J4B A;  2XEH A;  3UM2 A;  3FTY A;  2OCC E;  5FTP A;  1JCS A;  4EZL A;  3SF4 A;  1JWF A;  2GRQ B;  2WQ7 A;  2LO6 A;  4AEZ C;  4ACK A;  3PZ1 A;  5JJ6 A;  2B6C A;  3U64 A;  5EYP F;  1A17 A;  4A3V A;  3MX3 A;  3UM1 A;  4RVB A;  5EIL A;  3IEG A;  3LKU A;  4GTQ A;  3GZS A;  4DK5 A;  1FCH A;  4K03 A;  3CHR A;  3S2A A;  4CT4 A;  3RIB A;  1ZBP A;  3MGB A;  3IV0 A;  3LYA A;  4BER A;  2WXR A;  2FI7 A;  4JVS A;  2X6I A;  1K1B A;  3ONK A;  5D0Q D;  3G2T A;  5KJM A;  3FHE A;  2X6H A;  3ASN E;  2Y4T A;  3KEA A;  4A55 A;  1KPS B;  1E8Y A;  4FJZ A;  2X6J A;  1NA0 A;  4UWG A;  5CEC B;  2CHW A;  4UQZ A;  4GTS A;  4IRU A;  2P9S G;  1EPU A;  2XEE A;  3JQ0 A;  4FHJ A;  3DWL G;  4M7C A;  3F6Q A;  3NZU A;  4XEI G;  1SVX A;  2XRY A;  1RZ4 A;  2YQ8 A;  3FP3 A;  1SZ9 A;  3SBT B;  2I2O A;  2X38 A;  3FU6 A;  1FT1 A;  3DBS A;  2P9K G;  4K0R A;  2NSZ A;  4Y6C A;  5JA4 D;  2PQR A;  1O1S A;  4U07 A;  3I4R B;  4CDM A;  4UWH A;  3GYZ A;  3MJW A;  4RG6 A;  4GTV A;  1S64 A;  3NZS A;  2I1K A;  2KZT B;  4I9C A;  3ASG A;  5J08 A;  2YIN A;  1KZP A;  1E8Z A;  1Q2Z A;  3QKY A;  2AJA A;  4EZJ A;  3PZ4 A;  2DVW A;  4YND A;  4GML A;  2XPI A;  1H2U A;  5ENS D;  1K1A A;  3ZFW A;  3ZN3 A;  3ZGQ A;  2L0I A;  4R7L A;  1EDU A;  2OV8 A;  3CEQ A;  4LNG A;  1TNY A;  1UOH A;  2J09 A;  4U63 A;  5ANR A;  3HIZ A;  3EHQ A;  4GB9 A;  2HYZ A;  5FQ6 A;  4UQY A;  4OVV A;  1TR4 A;  2NC9 A;  3ULQ A;  2GW1 A;  2HR2 A;  4LG6 A;  4JB8 P;  2P9P G;  2WQH A;  4FU3 A;  3TWX A;  2PQN A;  3Q7A A;  4JZY A;  2XPY A;  4I2Z A;  1QZ2 A;  4BFR A;  3PZ3 A;  5EYL A;  1LD8 A;  3AJI A;  4I1M A;  4UQX A;  1PY1 A;  4H7Y A;  3MYV A;  3RSE G;  1ELR A;  3OXL A;  2F8X K;  5BNW A;  1NI1 A;  3ABK E;  5KNH D;  3FEX A;  2MYO A;  3VLE A;  2LAI A;  3HYM B;  5AAO A;  4GA0 A;  4CRW A;  4G23 A;  4XIF A;  1UN9 A;  3CR3 A;  2GRP B;  3JXI A;  4G11 A;  3R9M A;  1H6P A;  3T8K A;  2E0I A;  3HXB A;  5ENN A;  4DLO A;  2YNQ A;  2LSV A;  3FUH A;  3RU0 A;  3ULE G;  4Q69 A;  1D8D A;  2FUL A;  3LCA A;  1H0A A;  5CBO A;  3RRN B;  4JEH A;  2OOE A;  1JCQ A;  2JLB A;  1WG0 A;  3VLD A;  1N4S A;  3QAQ A;  1MX2 A;  4A63 B;  1SA4 A;  4HB5 A;  3ZU7 B;  1D8E A;  2BUG A;  4BT9 A;  3FUI A;  2KCV A;  2KM4 A;  4FHK A;  2L9B A;  2V8S E;  3Q47 B;  1KT0 A;  3GZ1 A;  2BKK B;  3TL5 A;  5CED B;  2AW6 A;  5JHA A;  4I6G A;  3FH7 A;  4O1P A;  4YDE A;  1HX8 A;  1OCR E;  3DPD A;  3Q7F A;  5CBN A;  3CHO A;  3FU0 A;  3UT4 A;  5EN5 D;  1B89 A;  5HS0 A;  3CHS A;  1AP7 A;  5JJT A;  1U3C A;  3U3W A;  4B89 A;  4HOQ A;  2QFC A;  5FZR A;  2L0T B;  2OEV A;  3ESL A;  4WWO A;  3TG4 A;  3APC A;  3FTX A;  1N52 A;  3FH5 A;  4BX9 A;  4F53 A;  1E8W A;  5JHB A;  1FPP A;  1SZA A;  5ENQ D;  3CK7 A;  4E6H A;  3B7T A;  3IHV A;  1Z3X A;  3CQG B;  4LEU A;  2VSX E;  5AQB A;  4LNU D;  3ZHE B;  4NUR A;  3FU3 A;  3RAU A;  3PDN A;  3V31 A;  3R7R A;  4L2L A;  2XZD G;  3ZYL A;  2DYR E;  1DCQ A;  1HO8 A;  5G2N A;  3UQ3 A;  3X2Q E;  2WXQ A;  5DIZ A;  3CV0 A;  3EHR A;  3Q75 A;  3RRU A;  3UUX A;  1SW6 A;  3WG7 E;  2GRN B;  2XGS A;  3SFX A;  2RD0 A;  4I6E A;  5CHE E;  5KJN A;  2Y1L E;  3EIJ A;  3Q73 A;  3CVU A;  2UY1 B;  1OY3 D;  4GPM A;  4HOS A;  4ABN A;  3UPV A;  3CK8 A;  3AU4 A;  3JQ1 A;  4GTP A;  2QY7 A;  3G2V A;  4KVM A;  3Q9N C;  3UM3 A;  3HVE A;  2F0Y A;  5EID A;  3FDH A;  1S70 B;  4U0S A;  5ITZ F;  3E30 A;  1V55 E;  2XS8 A;  4FP7 A;  2QC9 A;  2A5U A;  4HQD A;  2VSY A;  4L23 A;  2ZXW E;  2MOW A;  5ENR D;  1TNZ A;  1LD7 A;  3Q49 B;  5H7P A;  2V0P A;  4XI0 A; 
#chains in the Genus database with same CATH homology
 2WQ7 A;  2LO6 A;  4AEZ C;  1JPL A;  4ACK A;  4KZ0 A;  1U3D A;  2XGM A;  5G04 J;  1GW6 A;  1NZN A;  2C0M A;  2J9Q A;  1S0P A;  4KYO B;  4Y6W A;  5FZQ A;  2J4D A;  4KMO A;  3CGH A;  5JJ6 A;  4HXI A;  4ME2 A;  3I4G A;  4XE0 A;  5AJL A;  4F1S A;  3U64 A;  3TJP A;  1A17 A;  4A3V A;  3MV3 B;  4N3B A;  2X6F A;  3BG1 B;  5BW8 C;  4APO A;  3ASD A;  3PUK A;  3MX3 A;  4G25 A;  4J8D A;  3ZYQ A;  4ACL A;  2KCK A;  4MLP A;  4RVB A;  2I6H A;  3CKC A;  3IEG A;  3LKU A;  1INZ A;  2IJG X;  4FJY A;  3GZS A;  4UI9 C;  1HZ4 A;  2R17 C;  1EF1 C;  4I17 A;  4DK5 A;  1FCH A;  5AJD A;  5BUZ A;  5DBK A;  4J8F A;  4I43 A;  4K03 A;  3CHR A;  4JEU A;  5E75 A;  3RIB A;  4WWN A;  3S2A A;  4CT4 A;  4YVQ C;  1ZBP A;  3QAR A;  3MGB A;  4AOF A;  1DNP A;  3IV0 A;  3ONL A;  3LYA A;  4OYS A;  3AS5 A;  4WNG A;  3ZXS A;  2WXR A;  2FI7 A;  3LPZ A;  4JVS A;  3D9I A;  2X6I A;  5EKQ D;  5AEN A;  3CQC B;  3LY8 A;  4ANX A;  1H2T C;  3D9N A;  3E4B A;  3ONK A;  3EJN A;  4BT8 A;  5D0Q D;  3G2T A;  3FY4 A;  3FHE A;  4EQF A;  4F3V A;  4GZD A;  3QC1 A;  2X6H A;  3LS8 A;  5KJM A;  2Y4T A;  4A55 A;  4N2Q A;  5J90 A;  4PS8 A;  4BWR A;  2VTB B;  2VGX B;  4UI9 J;  1E8Y A;  3Q15 A;  4FJZ A;  4PUC A;  1HE8 A;  5FWQ A;  2X6J A;  3EDT B;  1NA0 A;  4UWG A;  4Q94 A;  3FUE A;  2CHW A;  1Y6I A;  4L7T A;  3GW4 A;  4UQZ A;  5BT1 A;  4IRU A;  1TJC A;  3URZ A;  1EPU A;  3G2U A;  5KJK A;  4FHJ A;  3JQ0 A;  4GMJ A;  5EX0 A;  2WM9 A;  2WQ6 A;  3K9I A;  3NZU A;  4AY6 A;  3C98 A;  4UWF A;  4U8H A;  3LVR E;  3EHN A;  1E96 B;  2X3M A;  2XRY A;  2GGF A;  2YQ8 A;  2Q7F A;  3ASH A;  3FP3 A;  5LX8 A;  1SZ9 A;  3SBT B;  3CVN A;  2I2O A;  4AM9 A;  2L6J A;  2X38 A;  3FU6 A;  2CHZ A;  3IBE A;  3DBS A;  4K0R A;  3NQP A;  2NSZ A;  3D3M A;  4MRU A;  3FWV A;  4Y6C A;  2CG3 A;  3MV2 B;  2PQR A;  4LUN U;  3SD5 A;  4APF A;  3SBS A;  3NF1 A;  3RO2 A;  4NQ0 A;  3I4R B;  4QFV A;  4U07 A;  1PAQ A;  2FEZ A;  3KAE A;  4CDM A;  3I3N A;  2AXV A;  3GYZ A;  4UWH A;  3MJW A;  4RG6 A;  2V5F A;  2BTD A;  2IU1 A;  1OWL A;  1QNF A;  3MKR A;  3NZS A;  4WAF A;  4G24 A;  5T3R A;  2I1K A;  4FA6 A;  2KZT B;  4I9C A;  4IYP A;  4A1S A;  3CST A;  3ASG A;  4L1B A;  5J08 A;  4NRH B;  5ANL A;  2YIN A;  5KJL A;  4XI0 A;  1JWG A;  2PM6 A;  3JYS A;  3RKV A;  1E8Z A;  3CK9 A;  2GRM A;  1VDY A;  3PZD A;  4RG9 A;  3TGO A;  3TXM A;  2WXO A;  1HF8 A;  3QKY A;  4CGW A;  4EZJ A;  1DVP A;  3CVX A;  3MCX A;  5T8I A;  4YND A;  2WXL A;  3G2W A;  4I1O B;  2KCL A;  4GML A;  1YA0 A;  4JA7 A;  3S7J A;  2XPI A;  1H2U A;  2XGO A;  3CHQ A;  1H2V C;  2XHE A;  2WMN A;  3LXU X;  1H6K A;  5FQ4 A;  3T5V A;  3ZFW A;  3D9L A;  4L2Y A;  3ZN3 A;  2WXM A;  4J6I A;  3ZGQ A;  2A4Z A;  3CVL A;  1L5J A;  2L0I A;  3LDZ A;  4O6F A;  4R7L A;  4BTA A;  1EDU A;  3PEV B;  2OV8 A;  5FQ7 A;  1QQE A;  3CEQ A;  1PC2 A;  4LCT A;  1BPO A;  3ASF A;  4HLE A;  4CDN A;  5CMY A;  2J09 A;  4U63 A;  1XGW A;  5JJ7 A;  2XCC A;  4ILH B;  3FH8 A;  2DIW A;  2I9C A;  5ANR A;  4BY6 A;  2VSN A;  2VJ8 A;  3CKB A;  4LER A;  3FUF A;  3HIZ A;  4GB9 A;  5FT9 A;  1KLX A;  2HYZ A;  5FQ6 A;  3SGH A;  2RG8 A;  4UQY A;  4OVV A;  3U66 A;  2NC9 A;  3FTS A;  2WXH A;  5A7D B;  3ULQ A;  2GW1 A;  2HR2 A;  5C2Y A;  4TV3 A;  3ESK A;  3FEY A;  3L22 A;  4I6J A;  2WQH A;  4FU3 A;  4KBQ A;  2IOL A;  1UN8 A;  3FUD A;  4WWP A;  4I1A A;  2PQN A;  4BTB A;  4FUL A;  1EYH A;  5EDS A;  4HFG A;  4JZY A;  2XPY A;  4PDX A;  4I2Z A;  5LFA A;  5G55 A;  3O4Z A;  3PE4 A;  3QDN A;  3WXX A;  1QZ2 A;  2UY1 A;  4U0U A;  4FC8 A;  4BFR A;  4N2S A;  2ILR A;  3OXG A;  3FTZ A;  4I1M A;  3CHM A;  4UQX A;  1PY1 A;  4ATG A;  5FQ8 A;  3S7D A;  4H7Y A;  3CVY A;  3QOU A;  3QWP A;  3MYV A;  3EHM A;  1ELR A;  3OXL A;  3SI5 A;  2R5S A;  2P58 C;  4J0U A;  5ARG A;  5BNW A;  2LNI A;  2V4L A;  4A1G A;  1KT1 A;  3CHP A;  1E7U A;  4GCO A;  4XX5 A;  5LP0 A;  1HG2 A;  1FVF A;  3QNK A;  4KVO A;  1HXI A;  5HQ8 A;  3ZYK A;  3FEX A;  3QWV A;  3S7F A;  2KAT A;  3D9M A;  3HDX A;  2OVB A;  4CT0 A;  4IUL A;  3VLE A;  2LAI A;  2WXI A;  3L13 A;  3S7B A;  4D10 C;  4BSX A;  1XNF A;  3HYM B;  4EBA G;  3OTN A;  3VTY A;  3CVV A;  2Y4U A;  3ZRH A;  3P2B A;  4GA0 A;  4ANV A;  4CRW A;  3ZHE A;  1UJK A;  4G23 A;  4XIF A;  1UN9 A;  4G2V A;  3FUL A;  1UW4 B;  3CR3 A;  3FTW A;  3L16 A;  3R7Q A;  4FLB A;  4JL0 A;  4G11 A;  4GZ6 A;  3MZL B;  3PNT B;  3O48 A;  4CEM A;  3T8M A;  2E0I A;  3KS2 A;  2KC7 A;  4EZK A;  1Y8M A;  3D9P A;  4OVU A;  1OWN A;  4FLH A;  4GAA A;  5LOZ A;  2XEV A;  3UMV A;  4W9R A;  4GA1 A;  5ENN A;  4DLO A;  5ARF A;  2YNQ A;  4V3I A;  4HOU A;  2WXN A;  2LSV A;  2J08 A;  4IN3 B;  3CVW A;  3FUH A;  3RU0 A;  3KD7 A;  4P29 A;  2Y3A A;  2ZU6 B;  4JHK A;  4Q69 A;  3LY7 A;  2UWJ G;  2FUL A;  3SNX A;  3LCA A;  1H0A A;  4GYW A;  4UI9 K;  4EPZ A;  1OWM A;  4DLQ A;  4M3O A;  3RRN B;  2WVI A;  3L54 A;  5FZS A;  3UT8 A;  5EX3 A;  1JUQ A;  4AV7 A;  4HVB A;  2I1J A;  2AWI A;  3PRE A;  2AVP A;  3KEZ A;  4JEH A;  2WPV A;  2AXZ A;  2OOE A;  4XKB A;  1TJF A;  2JLB A;  2VGY A;  2X6K A;  4WUY A;  3VLD A;  4XZ4 A;  4U0Z A;  2IFU A;  3B13 A;  2IOS A;  4PH4 B;  4AP2 A;  4AXH A;  4CCA A;  3QAQ A;  4H7X A;  4RSY A;  5D0O D;  3IHY A;  1SQM A;  1N54 A;  3JUI A;  3IKO B;  3Q5M A;  3RJV A;  1WAO 1;  2BUG A;  4BT9 A;  4B8C B;  4HOR A;  3FUI A;  2LAH A;  2KCV A;  4KT6 B;  2KM4 A;  4FHK A;  2L9B A;  4GZ3 A;  4N3A A;  2V8S E;  3ZYM A;  3Q47 B;  1KT0 A;  3GZ1 A;  2JEK A;  2IQC A;  4U04 A;  3L08 A;  3TL5 A;  4DI4 A;  3FFL A;  4G1T A;  2AW6 A;  3FUM A;  5JHA A;  3APF A;  4I6G A;  3FH7 A;  4PS7 A;  3APD A;  5BV0 A;  2J07 A;  2HM8 A;  3RK6 A;  2WXG A;  1HX8 A;  2VTB A;  3U9W A;  3BEE A;  1HH8 A;  4URK A;  2CFU A;  1NP7 A;  3DPD A;  2NXP A;  4MS6 A;  2OVF A;  3TXN A;  4AY5 A;  2CG2 A;  3CHO A;  3FUN A;  3L17 A;  3PH0 C;  2DCP A;  3FU0 A;  3L6A A;  4DJA A;  3UT4 A;  4TRQ A;  2BF0 X;  2CHX A;  4I2W A;  3CLJ A;  4ANU A;  3B7U X;  4PS3 A;  1B89 A;  4DI3 A;  1MQS A;  4HOT A;  2XCB A;  5LCW J;  3CHS A;  4JHR A;  5JJT A;  1U3C A;  3U3W A;  5CCM A;  1E7V A;  3QB2 A;  4B89 A;  3MKQ A;  4GU5 A;  4BX8 A;  2C0L A;  1ELW A;  2PL2 A;  3UX4 A;  4HOQ A;  2QFC A;  5FZR A;  2L0T B;  1MHQ A;  1TEZ A;  2ION A;  3ESL A;  3PUJ A;  3UT7 A;  3ZEF A;  3D9K A;  3RRM B;  4WWO A;  1IQR A;  3EIQ C;  4LRZ A;  3TG4 A;  5E76 A;  3APC A;  4B94 A;  3MEK A;  3PE3 A;  3FTX A;  2DBA A;  4NAC A;  1N52 A;  3ML9 A;  4J8S A;  5G05 J;  5BV1 A;  4GPK A;  3AU5 A;  3ML8 A;  3FH5 A;  3AS4 A;  4BX9 A;  4F53 A;  1E8W A;  1WM5 A;  2FBN A;  3OAW A;  4KXK B;  5JHB A;  4C0M A;  4WND A;  4JPS A;  2KZT A;  3MKQ B;  2VQ2 A;  2YHC A;  2WB2 A;  3FU5 A;  1SZA A;  4I9E A;  3CK7 A;  4JHJ A;  3TG5 A;  2C2L A;  3HHM A;  4E6H A;  3B7T A;  1Z6T A;  2FO7 A;  1E90 A;  3ZVV A;  4F7A A;  4GYO A;  3IHV A;  2WXP A;  3OXF A;  4GZ5 A;  5G04 C;  3SHF A;  3ZPJ A;  1OWP A;  2GRL A;  5CCL A;  2AXU A;  1Z3X A;  3CQG B;  2FF4 A;  3CVP A;  4GYY A;  4LEU A;  2WXK A;  3VLF A;  2VSX E;  3LVQ E;  4WNE A;  1P5Q A;  3BG0 B;  5G05 C;  2WXF A;  4XKC A;  2XRZ A;  2XPZ A;  3ZHE B;  2MRI A;  4KZC A;  4NUR A;  1UJJ A;  3LJ3 A;  4TUU A;  4N39 A;  4UWK A;  3FU3 A;  5A23 A;  1IQU A;  3PDN A;  1OUV A;  2HO1 A;  4ILG A;  4C9B B;  3R7R A;  4AJW A;  4L2L A;  3Q4A B;  4YVO A;  3P1U A;  3PS6 A;  3T5X A;  3ZYL A;  4JW1 A;  2VGX A;  2E2E A;  3N71 A;  4ANW A;  1HG5 A;  4CGV A;  1HO8 A;  5G2N A;  3UQ3 A;  1LF8 A;  3PRZ A;  2WXQ A;  1WY6 A;  2VYI A;  5DIZ A;  3SZ7 A;  4HS2 A;  3VTX A;  3CV0 A;  3LY9 A;  3QK0 A;  3ZIM A;  3ZW3 A;  1ZU2 A;  3QWW A;  4ILI A;  3RRU A;  2PM7 A;  5AYW D;  3UUX A;  3D9J A;  4A3T A;  2LSU A;  3G2S A;  1H19 A;  3SFZ A;  1IHG A;  4CDR A;  4EBA A;  2XGS A;  2OND A;  3FUJ A;  4UWL A;  2RD0 A;  3AS8 A;  2IF4 A;  2R59 A;  3MA5 A;  4I6E A;  5CHE E;  5KJN A;  2YHE A;  3EIJ A;  3CIA A;  4JC8 A;  3R9A B;  5T4Y A;  3CVU A;  1ELK A;  1X5B A;  5CMW A;  1OWO A;  2UY1 B;  5A6C A;  4G26 A;  3RO3 A;  3FTU A;  5FJY A;  4E85 A;  4HOS A;  4ABN A;  3UPV A;  3TAX A;  3PNL B;  2EQX A;  4J8E A;  3U4T A;  2MHK A;  3CK8 A;  4JA9 A;  2M63 A;  3AU4 A;  4FAD A;  1Z3Y A;  3FTV A;  2WXJ A;  1IYG A;  1E8X A;  4B0Z A;  1W3B A;  3JQ1 A;  3I5P A;  4EEC A;  2QY7 A;  4GZC A;  4JXT A;  4MKT A;  4AVX A;  3G2V A;  4B8A A;  5AIJ A;  3B7R L;  4KVM A;  1HFA A;  3ENE A;  3HVE A;  3FDH A;  1HU3 A;  4U0S A;  3D9O A;  2CFZ A;  3FUK A;  3LEW A;  4N5C A;  1FVH A;  4DPR A;  4N3C A;  3JCK C;  5LCW C;  4AIF A;  5BPP A;  2PZI A;  4FP7 A;  2J49 A;  2XQ0 A;  4C0E A;  4GA2 A;  5M72 A;  2A5U A;  3CSF A;  5KCM A;  3B7S A;  1NA3 A;  3CVQ A;  2J4B A;  2VSO E;  2VSY A;  3FTY A;  4GCN A;  5FTP A;  1UG3 A;  4L23 A;  5C1D A;  4Q96 A;  4EZL A;  2MOW A;  3SF4 A;  4XI9 A;  1HS6 A;  2WMO A;  3HVE B;  3PVL A;  5HI7 A;  1JWF A;  3Q49 B;  3PEU B;  4WNF A;  3GZ2 A;  2V0P A;  3QJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...