2A5EA

Solution nmr structure of tumor suppressor p16ink4a, restrained minimized mean structure
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
156
structure length
156
Chain Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Anti-oncogene
molecule keywords TUMOR SUPPRESSOR P16INK4A
publication title Tumor suppressor p16INK4A: determination of solution structure and analyses of its interaction with cyclin-dependent kinase 4.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2a5eA00
3NOGD 3T9KA 4Z68A 1SW6A 4K5CA 1N0QA 5AN8A 4BESA 2XEHA 5ITZF 5AARA 2ETBA 1G3NB 1WDYA 1K3ZD 3D9HA 3KEAA 4G8KA 4QFVA 5AQAA 4LG6A 4G8LA 4CYMD 1TR4A 3EHRA 2F8XK 4U96D 2ETAA 4O1OA 1NFIE 5EIDA 2Y0BG 4RLYA 4DUIA 2J8SD 3DEOA 5AQ7A 4U8YD 4HLLA 4ZHBA 5CEDB 3TWSA 3JXIA 2L6BA 1S70B 2ZGGA 4DX1A 2A5EA 5CERB 5EILA 5D66A 5KNGA 4YDYA 3T8KA 1AWCB 2MYOA 4HI9A 4JB8P 1IKND 4HRNA 4DX7D 1K1AA 5CBOA 3TWQA 3EHQA 4K5AB 4DX2A 4BETA 2RFAA 3JXJA 4HQDA 5EYLA 4ATZD 5CEAA 5KWDA 2V5QC 3W9GA 2B0OE 2PNNA 3F6QA 5HS0A 5JMND 4F6RD 4J8YA 3C5RA 3NBNB 4DX5D 3TWWA 3EU9A 5EN5D 4N5QA 5EIBE 2F8YA 3J5QB 1AP7A 5FIOA 3V79K 3HG0D 5ENOD 2HE0A 2KBXA 1YCSB 3TWUA 3ZUVB 4OAUC 4ZFHA 1BLXB 1BD8A 3TWXA 5CECB 2XZDG 1BI8B 4HB5A 1QYMA 4J7WA 5AQBA 2XEEA 1SVXA 2VGEA 4BEPA 2Y1LE 2ZGDA 4BSZB 2DZNA 3HRAA 5BXUA 4UUCA 1N0RA 4DX6D 4QQIA 5ENRD 1MX2A 1BU9A 3V30A 1OT8A 2KXPC 1IXVA 3Q9NC 3B7BA 3UXGA 3LJNA 1D9SA 5ENTD 1MX6A 4F1PA 5BXOA 4DRXE 5AAOA 1IHBA 1UOHA 3V2OA 3J5PA 4HNAD 1A5EA 3NOCD 2F37A 3W9FA 1YMPA 3V31A 3Q9UC 5KNHD 3IXEA 4BERA 2FO1E 5CBNA 4NIKA 2BKKB 3TWRA 2RFMA 1MJ0A 2QYJA 2P2CP 3ZNGA 5AQ9A 4TUMA 1N11A 1WG0A 4YDWA 3ZKJA 2XZTG 4O1PA 3SO8A 5ENSD 3UTMA 4K5BA 4U95D 4LSZE 2JABA 3TWTA 3DEPA 3UI2A 1BI7B 2ETCA 4CZ2D 4OAVB 5HRYA 5HKPA 1K1BA 2DZOA 2QC9A 2NYJA 2AJAA 1DCQA 3B95A 2XENA 4GMRA 2BKGA 4HBDA 5FINA 1YYHA 4C48B 5EYPF 4B93B 2DVWA 4O60A 4HI8A 4GPMA 4A63B 4LNUD 3ZU7B 1OY3D 3V2XA 1MX4A 3AJIA 4U8VD 1DC2A 4HRLA 3TWVA 5JA4D 3AAAC 4HRMB 5KBAA 1MYOA 2V4HC 5ENPD 2DWZA 3JUEA 5ENQD
chains in the Genus database with same CATH superfamily
1DNPA 3CHMA 4U63A 4K5CA 5ARFA 5KJLA 1UJKA 3UKRG 3D9LA 4G8KA 3EHRA 2P9SG 2XRYA 2ETAA 2I9CA 2NXPA 3FUMA 1UW4B 4DPRA 1E7UA 3SGHA 3T5VA 2JEKA 3KEZA 3JUIA 5KWDA 3RU0A 4L7TA 5JMND 3JCKC 3R9MA 2LO6A 3ZHEB 2P58C 2VGXA 3QOUA 1X5BA 5AQBA 3CVPA 3SNXA 4GTPA 3OXGA 5ENRD 3UT8A 3RO3A 3Q15A 3PZ3A 1IHBA 3TJPA 2X6KA 3L17A 5FQ7A 3FTYA 4I9EA 2MOWA 2YNQA 3OAWA 4B8CB 4GCNA 3PREA 3CHPA 1UG3A 2QFCA 5BW8C 4O1PA 2ETCA 4LERA 1ZBPA 1DCQA 2XENA 3Q7FA 1HZ4A 1OWOA 2DIWA 3ASOE 4LNUD 3QNKA 4CGVA 3CVNA 4PS8A 3AS5A 3AU4A 4URKA 4ABNA 4WWPA 4JZYA 4U0UA 4FP7A 3R7RA 1LTXA 1NL4A 4U04A 3DWLG 3KEAA 2XS8A 2F8XK 4U96D 4HOUA 4Q94A 5AQ7A 4FHKA 4BX8A 3SBSA 3CVVA 2KATA 5KNGA 1AWCB 3BG1B 1N9AA 4L2YA 4HQDA 2R59A 4U7EB 3PZ1A 2VTBB 2AXVA 4F6RD 3CQCB 2WXJA 3TWWA 1AP7A 3SF4A 4A1GA 4ANVA 2Y69E 4BSXA 3U3WA 2FEZA 2FULA 4C9BB 2BUGA 2LXMA 4JA7A 4KT6B 2KCLA 1E8XA 1TNYA 2AXZA 4YDOA 2WXPA 2IY0C 4HLEA 3CK7A 5CBNA 2RFMA 2YQ8A 1S63A 3LCAA 4APFA 4EZJA 4Y6CA 4H7XA 5ENSD 1E8ZA 2WXGA 3ZYQA 2VYIA 5FINA 3RRUA 2P9NG 2XEVA 3AAAC 4J8EA 4HRMB 3OXFA 5A6CA 4GTRA 4WUYA 5BUZA 3NOGD 3D3MA 3MA5A 4O6FA 4UI9J 2BF0X 5B1AE 4DI3A 3BQOA 1WY6A 4HLLA 3TWSA 2DBAA 5CERB 4HI9A 3UPVA 3B7TA 4UQXA 4I6JA 3URZA 4KXKB 2WPVA 2OV8A 3LVRE 1H6OA 3I3NA 2X3MA 3L22A 5DIZA 4G23A 4RSYA 3ZHEA 3FUEA 3TWXA 3SBTB 5J08A 3T8MA 3CKBA 4E6HA 2ZGDA 3HRAA 4ATGA 4FU3A 5G05C 3FULA 4NACA 4OVUA 4NRHB 5ENTD 2R2LA 4BT8A 2P9IG 4K03A 3NOCD 2BTDA 3DXMG 3ULEG 5ENNA 5KNHD 2BKKB 2IEJA 3ZKJA 1IYGA 4PS7A 1N4SA 3DSSA 3L6AA 1HU3A 4GMRA 2V4LA 3UM3A 1E8WA 2DVWA 3SQVA 3ML8A 4GPMA 1OY3D 2NC9A 2QZAA 4GZ5A 3CVUA 3ZVVA 2CHXA 4GCOA 3AU5A 4LRZA 1HF8A 1UN8A 1WDYA 1K3ZD 1OWPA 2VGYA 1H0AA 3LPZA 2WQ7A 3L9TA 5D66A 3RSEG 3C3QA 4KMOA 2KCKA 3TXMA 2R03A 4GTOA 3CVXA 4MRUA 4XIFA 4GTMA 3EU9A 2XGMA 3ONKA 5BT1A 5C2YA 1LD8A 4CT4A 3ESKA 4D10C 4AV7A 1N4PA 4AP2A 4QQIA 1BPOA 4UWKA 2UY1A 4M3OA 3FP3A 3RO2A 4M7CA 1D9SA 2WXMA 5BXOA 3D9KA 3Q75A 2VGXB 3FTXA 1QZ2A 1UOHA 4HVBA 3AS4A 3SFZA 3RKVA 3PH0C 3EIJA 4GMJA 3Q49B 1JWGA 3KD7A 3DSXA 4F3VA 4YDEA 4CGWA 4UWHA 1SA4A 2P9LG 3JQ1A 3Q78A 3PE3A 1N11A 3AG3E 4U95D 3DEPA 2NYJA 5CMWA 5EYPF 5T8IA 5E76A 5AENA 4GAAA 1MYOA 3Q4AB 4L2LA 3ASFA 2J07A 4I17A 4EECA 3NQPA 4NQ0A 3MYVA 5ITZF 5AARA 4QFVA 5EIDA 2Y3AA 2J9QA 5CEDB 1S70B 3G2WA 2NSZA 4HRNA 3HXFA 4FA6A 3KAEA 3TWQA 2OCCE 1A17A 4XX5A 1NA3A 2HR2A 3LS8A 2B0OE 4P29A 2PNNA 3F6QA 3W9GA 4KZCA 1OCRE 3C5RA 5H7PA 2IOLA 3CVWA 3C3RA 4N39A 3TWUA 3ULQA 3E33A 1VDYA 2XZDG 1EF1C 3B7SA 4A55A 4BX9A 1E8YA 3Q73A 4BEPA 3I5PA 2EINE 1HO8A 4UQYA 4IULA 2FI7A 4AJWA 5CRUA 1N52A 4PH4B 3QWVA 4CCAA 1JCQA 1TNOA 1N95A 2AXUA 4GB9A 1SQMA 3ZN3A 3ZRHA 4WWOA 1YMPA 4B0ZA 1OCCE 5LCWC 3MGBA 1KT1A 4TRQA 1MJ0A 2QYJA 3EHNA 3FUHA 4AY6A 5D0QD 4OAVB 3LYAA 4ACKA 3AG4E 2IJGX 3AS8A 4N3CA 4ANUA 3CQGB 5B1BE 4ACLA 4LNBA 3DXKG 2V4HC 4RG9A 3DRAA 3QWPA 5JJ6A 3QC1A 2LSVA 3Q79A 1JPLA 4MKTA 1IQUA 3UX4A 3T5XA 2Q7FA 5E75A 5FQ8A 2ONDA 4IRUA 3GZ2A 5G05J 3OXLA 2I6HA 3EHQA 4WNFA 3TGOA 4JHJA 3WXXA 4LCTA 2FF4A 2R05A 5ENOD 3UIPC 2IO3C 2C0MA 4MS6A 3GZSA 3ZYMA 1DCEA 1XNFA 3CGHA 2XPIA 4DX6D 1U2VG 1FT2A 3C72A 1IXVA 2WVIA 3UM1A 2KZTB 5AAOA 1WAO1 4BT9A 2F37A 3PUKA 3LY9A 3LJ3A 1WG0A 3FUIA 1XGWA 4AEZC 2H6FA 3HDXA 2QY7A 3FTUA 1BI7B 4JW1A 2AJAA 2KC7A 2BKGA 4BTBA 4N2SA 4K0RA 4HI8A 2X6HA 3AJIA 3VLEA 2H6GA 2GRRB 2J4BA 5FZSA 4G25A 3UT4A 4HNAD 4GTTA 3C3OA 2L0IA 3KSQA 5AQAA 1HG5A 3UMVA 2Y0BG 2WM9A 4ZHBA 3JXIA 2LNIA 3CHSA 3HXEA 4U07A 4I9CA 3O4ZA 4JXTA 2H6IA 4BETA 4ILGA 3PS6A 4J8FA 4JL0A 1MHQA 5JJTA 1N4RA 2IF4A 1LF8A 3RIBA 4ME2A 3Q7AA 1Q2ZA 4HOQA 4HOSA 4CDRA 4HB5A 4J7WA 2CFUA 2XEEA 3GYZA 3PUJA 2Y1LE 1EDUA 3CLJA 3D9PA 1N4QA 4G26A 3FHEA 5AIJA 4GMLA 2LXLA 1MZCA 3LXUX 4GA1A 3TAXA 1A5EA 1O1RA 3CEQA 3EDTB 3IV0A 3E4BA 2UY1B 2WXOA 4YVOA 2WMNA 2J4DA 2XZTG 4GTQA 4K5BA 3UI2A 2XS1A 5HKPA 1K1BA 3D9OA 4UI9K 2LUHA 4C48B 5G55A 4O60A 4L23A 4B89A 3QJZA 5IY5E 3PVLA 5ENPD 1KZOA 4Z68A 5D0OD 3UKUG 1HS6A 4AM9A 3FU3A 1S0PA 4LG6A 4HFGA 2HO1A 4FC8A 4I1OB 3ZFWA 3PZDA 4I43A 4U8YD 1JCRA 3R9AB 2X6FA 2I1JA 1K1AA 2VQ2A 3FTZA 4K5AB 4A3TA 2XCCA 2V5QC 3E32A 1V55E 3SI5A 1NZNA 1PAQA 3NBNB 1TJFA 4OAUC 4MLPA 3RRMB 4A1SA 1NA0A 2DZNA 3ASGA 4UUCA 3UIOC 3CIAA 3ZXPA 1N0RA 3CVLA 4Q96A 3DSVA 2WXQA 4JD2G 3UINC 4WNGA 4GA0A 5C1DA 2KZTA 2Y4TA 3QDNA 1Z3XA 1NP7A 2GRNB 4BWRA 2R5SA 2KM4A 3MJWA 4YDWA 3MV2B 1S64A 4CZ2D 3CKCA 3ONLA 3ABKE 2RG8A 3K9IA 2XCBA 2OOEA 1JWFA 5CMYA 2VSXE 3G2VA 3D9IA 1Z3YA 4BFRA 1SZAA 3MCXA 3EUVA 4N3AA 2WXLA 2GW1A 3JUEA 5AJLA 4G1TA 3KSLA 4YNDA 3CVYA 2C0LA 2ETBA 3BEEA 1N94A 4GZ6A 3MZLB 1FVHA 1Y6IA 4I1MA 4OVVA 5AYWD 1SA5A 4KVOA 1Z6TA 1JUQA 2L6BA 2IFUA 4GTVA 3VLFA 1RZ4A 2DCPA 1IKND 3HXCA 4DX7D 4U8HA 3UM0A 3DBSA 4ATZD 3PNTB 1KPSB 4GA2A 1H2UA 5HS0A 1TNUA 4J0UA 2A5UA 5EN5D 3SY2A 5FJYA 2HYZA 3U66A 2ZU6B 5J90A 4FLHA 5G04C 5B3SE 1ZB1A 3SZ7A 3HXDA 4BY6A 2XGOA 2WXKA 3PZ4A 1H2TC 3Q9NC 2IOSA 3MKRA 1EYHA 1U3DA 3LEWA 5FT9A 1Z5SC 3VTYA 3R7QA 3IXEA 4BERA 2FO1E 1OUVA 3TWRA 4FJYA 3ZNGA 4FJZA 3SO8A 5FZRA 1D8EA 4E85A 1OWMA 2ZIRA 2YHCA 3LKUA 3FH7A 4HRLA 2FBNA 1UJJA 3MEKA 4Y6WA 2KCVA 1HX8A 3PNLB 3PZ2A 3FTWA 3FEXA 1ELRA 2L6JA 3NZUA 1OXJA 3FUJA 3FUFA 4V3IA 5BPPA 3FH8A 1TNZA 4EBAA 5KJKA 2XQ0A 1ELKA 3EIQC 2ZGGA 2PQNA 4CEMA 3IKOB 2MYOA 3QK0A 4JB8P 3NAWA 5D2MC 3CV0A 2X38A 2WXRA 3ISMC 2VSYA 2F0YA 4DX5D 5EDSA 3D9JA 5DBKA 3J5QB 5M72A 2RD0A 3FDHA 3AG1E 3ZUVB 4I6GA 1H19A 3ZXSA 1KT0A 3CK8A 3HYMB 3O48A 2VGEA 4BSZB 4BTAA 5BXUA 4A3VA 4PDXA 3ZYLA 3V30A 1OT8A 1UN9A 2HM8A 3PEVB 3P1UA 3E37A 2WXHA 1U3CA 3E34A 4UWGA 2J08A 4NIKA 5FZQA 3EHMA 5LX8A 3OTNA 4JEHA 3RAUA 2AWIA 1EPUA 2JLBA 1QBQA 2LAIA 3TL5A 3FTSA 5HQ8A 5FWQA 5CCMA 3Q47B 2MHKA 4JA9A 5KCMA 1PY1A 1MX4A 3EJNA 5LOZA 4I6EA 2IQCA 4JEUA 1SW6A 3IBEA 4FHJA 5AN8A 4CT0A 3UT7A 1G3NB 3D9HA 1E90A 3DSWA 1IHGA 1TN8A 2EILE 3TG5A 2CG3A 4DUIA 1E7VA 4UI9C 4UWFA 3RJVA 3AG2E 3CSFA 3QKYA 4AIFA 4R7LA 3PDNA 2P9PG 3RK6A 1QQEA 1OCOE 4FULA 4CDMA 3HG0D 4GZ3A 4I2WA 5T4YA 3FH5A 2XGSA 3KS2A 4G24A 3SFXA 3U64A 2X6JA 4KVMA 1X81A 2CHWA 4GU5A 4XKBA 2A4ZA 2DYRE 5FTPA 2OVFA 4EZLA 3WG7E 1TN6A 2R17C 5AJDA 3V31A 3CSTA 3HVEA 4OYSA 5JJ7A 1PC2A 2EQXA 3BG0B 5EX3A 5JHAA 3ZPJA 4PS3A 2VSOE 4J8DA 5HI7A 1NI1A 3GW4A 2DWZA 4F7AA 5ENQD 2E0IA 3FY4A 3SHFA 2XEHA 1E96B 2X6IA 3ASNE 3VTXA 4G8LA 1H2VC 1TR4A 3APFA 2ZISA 4O1OA 5G04J 4DX1A 2J49A 2A5EA 5EILA 1QNFA 3T8KA 2CFZA 4JC8A 5CBOA 3S7BA 1HFAA 2I1KA 2QYUA 5ANRA 2RFAA 2OEVA 2P9UG 4TUUA 1Y8MA 3P2BA 2WXIA 3S7FA 4ZFHA 1BD8A 3EU5A 3SD5A 3U9WA 1GW6A 5ANLA 4B94A 1QYMA 3B7RL 3ZW3A 3CHOA 4AXHA 4LNGA 3DPDA 1HG2A 4GYYA 4C0EA 5A23A 2PM7A 4KYOB 3CR3A 4EZKA 2GRPB 1MX6A 3ESLA 3B13A 3D9MA 3FUKA 3ENEA 3JYSA 3J5PA 3IEGA 4U0SA 4CDNA 3W9FA 4H7YA 3FFLA 1YA0A 5AQ9A 4UWLA 5KJNA 3C98A 4EHMA 3ZGQA 5LP0A 2DZOA 2QC9A 4GZDA 1HH8A 4XEIG 2EIKE 3D9NA 3V2XA 4JPSA 4WAFA 3ASDA 2GRQB 3HXBA 3PE4A 4WNDA 3LVQE 3X2QE 3TG4A 4PUCA 3LY7A 3T9KA 4GYWA 3DSUA 4HORA 3FUDA 4CYMD 3U4TA 1NFIE 3B7UX 2LAHA 3FU5A 3ZIMA 2XRZA 4AY5A 5EX0A 4MBGA 4XKCA 3GZ1A 4GYOA 3FEYA 2OVBA 2F8YA 3V79K 2HE0A 2DYSE 3ML9A 1JCSA 2V8SE 1KLXA 5FQ6A 4DLQA 4GZCA 2Y4UA 2C2LA 3CK9A 5CCLA 2ZXWE 5BV1A 1MX2A 3UM2A 2MRIA 4APOA 4F1PA 1L5JA 4DI4A 5BV0A 5LCWJ 3ASHA 4DJAA 2V5FA 4DLOA 5T3RA 2FO7A 5LFAA 4AOFA 4W9RA 4GTSA 4TUMA 4JHKA 3L16A 4DK5A 4GPKA 4CRWA 3VLDA 1LD7A 5EKQD 4A63B 3UQ3A 3ABLE 1FPPA 1TEZA 2PQRA 3APDA 3HIZA 4L1BA 1FT1A 4RVBA 2YHEA 1OCZE 2GROB 1TNBA 4TV3A 5BNWA 2E2EA 4EPZA 4F1SA 4RQIA 1OWLA 1WM5A 1OWNA 3PRZA 4J8YA 3MV3B 3HHMA 4N5QA 1W3BA 1INZA 5CHEE 3FU0A 3QARA 4LUNU 1YCSB 3MKQB 2H6HA 5CECB 2L9BA 2VJ8A 3S7DA 3IHVA 4HS2A 5ARGA 3CHQA 3S2AA 2KXPC 3BU8A 1P5QA 4DRXE 4JHRA 3V2OA 2WQ6A 2CHZA 2GRLA 4XE0A 2PM6A 5CRVA 3NZSA 2R02A 2J09A 4NURA 3L54A 3PEUB 1SZ9A 3LY8A 3G2TA 3FTVA 2V0PA 3FWVA 1D8DA 5KJMA 3ZEFA 2BEDA 3Q5MA 2YINA 4WWNA 3ZU7B 3HVEB 1DC2A 4U8VD 3UUXA 3TWVA 2M63A 3QB2A 4N3BA 4HOTA 4TXPA 3APCA 2VTBA 3RRNB 2WB2A 4FLBA 2WQHA 4F53A 3DSTA 4ANXA 4ILHB 2GGFA 3QWWA 2UWJG 2EIME 2LSUA 4HXIA 4WNEA 4ILIA 3SFYA 3G2SA 1MQSA 2XPYA 2KBXA 2AVPA 3IHYA 4U0ZA 3BUAA 4IN3B 2L0TB 3E30A 2IO2C 4I1AA 1HXIA 1SVXA 1N54A 1O1SA 4UQZA 4LEUA 2WXFA 4TXQA 1TN7A 1BU9A 3ULYA 3LJNA 5JHBA 4ANWA 4L9PA 3CVQA 2EIJE 2I2OA 3Q9UC 2OEWA 3UTMA 1HE8A 2GRMA 3G2UA 1ELWA 3CHRA 2P9KG 1KZPA 1H6PA 1YYHA 3JQ0A 2WXNA 3TXNA 4N2QA 4N5CA 1DVPA 5A7DB 3DPYA 3FUNA 2VSNA 4XI9A 4B8AA 1K8KG 4J8SA 1N0QA 2XHEA 4BESA 1TYQG 4C0MA 4RLYA 2PZIA 2J8SD 3DEOA 4G11A 2ILRA 3L08A 1IQRA 4YDYA 4J6IA 4JVSA 3ZYKA 4RG6A 3JXJA 3S7JA 5EYLA 5CEAA 2AW6A 2IONA 4AVXA 2PL2A 1H6KA 3LDZA 1TJCA 5EIBE 5FIOA 3N71A 5FQ4A 1O5MA 2WMOA 1BLXB 1BI8B 1FVFA 4X8QA 5G2NA 2XPZA 3MKQA 3QAQA 3I4GA 4KZ0A 1V54E 1RW2A 4EQFA 3NF1A 3MX3A 3L13A 2RKKA 1O1TA 4Q69A 3B7BA 3UXGA 3L82A 3FU6A 2CG2A 4IYPA 4XI0A 3NB2A 1FCHA 4EBAG 3ABME 2IU1A 4YVQC 2P2CP 4I2ZA 2B6CA 4LSZE 2JABA 3TWTA 4FADA 4G2VA 5HRYA 1ZU2A 1B89A 4DX2A 3B95A 4HBDA 4KBQA 4XZ4A 4B93B 4TXRA 5JA4D 5KBAA 3I4RB
chains in the Genus database with same CATH topology
3NOGD 3T9KA 4Z68A 1SW6A 4K5CA 1N0QA 5AN8A 4BESA 2XEHA 5ITZF 5AARA 2ETBA 1G3NB 1WDYA 1K3ZD 3D9HA 3KEAA 4G8KA 4QFVA 5AQAA 4LG6A 4G8LA 4CYMD 1TR4A 3EHRA 2F8XK 4U96D 2ETAA 4O1OA 1NFIE 5EIDA 2Y0BG 4RLYA 4DUIA 2J8SD 3DEOA 5AQ7A 4U8YD 4HLLA 4ZHBA 5CEDB 3TWSA 3JXIA 2L6BA 1S70B 2ZGGA 4DX1A 2A5EA 5CERB 5EILA 5D66A 5KNGA 4YDYA 3T8KA 1AWCB 2MYOA 4HI9A 4JB8P 1IKND 4HRNA 4DX7D 1K1AA 5CBOA 3TWQA 3EHQA 4K5AB 4DX2A 4BETA 2RFAA 3JXJA 4HQDA 5EYLA 4ATZD 5CEAA 5KWDA 2V5QC 3W9GA 2B0OE 2PNNA 3F6QA 5HS0A 5JMND 4F6RD 4J8YA 3C5RA 3NBNB 4DX5D 3TWWA 3EU9A 5EN5D 4N5QA 5EIBE 2F8YA 3J5QB 1AP7A 5FIOA 3V79K 3HG0D 5ENOD 2HE0A 2KBXA 1YCSB 3TWUA 3ZUVB 4OAUC 4ZFHA 1BLXB 1BD8A 3TWXA 5CECB 2XZDG 1BI8B 4HB5A 1QYMA 4J7WA 5AQBA 2XEEA 1SVXA 2VGEA 4BEPA 2Y1LE 2ZGDA 4BSZB 2DZNA 3HRAA 5BXUA 4UUCA 1N0RA 4DX6D 4QQIA 5ENRD 1MX2A 1BU9A 3V30A 1OT8A 2KXPC 1IXVA 3Q9NC 3B7BA 3UXGA 3LJNA 1D9SA 5ENTD 1MX6A 4F1PA 5BXOA 4DRXE 5AAOA 1IHBA 1UOHA 3V2OA 3J5PA 4HNAD 1A5EA 3NOCD 2F37A 3W9FA 1YMPA 3V31A 3Q9UC 5KNHD 3IXEA 4BERA 2FO1E 5CBNA 4NIKA 2BKKB 3TWRA 2RFMA 1MJ0A 2QYJA 2P2CP 3ZNGA 5AQ9A 4TUMA 1N11A 1WG0A 4YDWA 3ZKJA 2XZTG 4O1PA 3SO8A 5ENSD 3UTMA 4K5BA 4U95D 4LSZE 2JABA 3TWTA 3DEPA 3UI2A 1BI7B 2ETCA 4CZ2D 4OAVB 5HRYA 5HKPA 1K1BA 2DZOA 2QC9A 2NYJA 2AJAA 1DCQA 3B95A 2XENA 4GMRA 2BKGA 4HBDA 5FINA 1YYHA 4C48B 5EYPF 4B93B 2DVWA 4O60A 4HI8A 4GPMA 4A63B 4LNUD 3ZU7B 1OY3D 3V2XA 1MX4A 3AJIA 4U8VD 1DC2A 4HRLA 3TWVA 5JA4D 3AAAC 4HRMB 5KBAA 1MYOA 2V4HC 5ENPD 2DWZA 3JUEA 5ENQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOG D;  3T9K A;  4Z68 A;  1SW6 A;  4K5C A;  1N0Q A;  5AN8 A;  4BES A;  2XEH A;  5ITZ F;  5AAR A;  2ETB A;  1G3N B;  1WDY A;  1K3Z D;  3D9H A;  3KEA A;  4G8K A;  4QFV A;  5AQA A;  4LG6 A;  4G8L A;  4CYM D;  1TR4 A;  3EHR A;  2F8X K;  4U96 D;  2ETA A;  4O1O A;  1NFI E;  5EID A;  2Y0B G;  4RLY A;  4DUI A;  2J8S D;  3DEO A;  5AQ7 A;  4U8Y D;  4HLL A;  4ZHB A;  5CED B;  3TWS A;  3JXI A;  2L6B A;  1S70 B;  2ZGG A;  4DX1 A;  2A5E A;  5CER B;  5EIL A;  5D66 A;  5KNG A;  4YDY A;  3T8K A;  1AWC B;  2MYO A;  4HI9 A;  4JB8 P;  1IKN D;  4HRN A;  4DX7 D;  1K1A A;  5CBO A;  3TWQ A;  3EHQ A;  4K5A B;  4DX2 A;  4BET A;  2RFA A;  3JXJ A;  4HQD A;  5EYL A;  4ATZ D;  5CEA A;  5KWD A;  2V5Q C;  3W9G A;  2B0O E;  2PNN A;  3F6Q A;  5HS0 A;  5JMN D;  4F6R D;  4J8Y A;  3C5R A;  3NBN B;  4DX5 D;  3TWW A;  3EU9 A;  5EN5 D;  4N5Q A;  5EIB E;  2F8Y A;  3J5Q B;  1AP7 A;  5FIO A;  3V79 K;  3HG0 D;  5ENO D;  2HE0 A;  2KBX A;  1YCS B;  3TWU A;  3ZUV B;  4OAU C;  4ZFH A;  1BLX B;  1BD8 A;  3TWX A;  5CEC B;  2XZD G;  1BI8 B;  4HB5 A;  1QYM A;  4J7W A;  5AQB A;  2XEE A;  1SVX A;  2VGE A;  4BEP A;  2Y1L E;  2ZGD A;  4BSZ B;  2DZN A;  3HRA A;  5BXU A;  4UUC A;  1N0R A;  4DX6 D;  4QQI A;  5ENR D;  1MX2 A;  1BU9 A;  3V30 A;  1OT8 A;  2KXP C;  1IXV A;  3Q9N C;  3B7B A;  3UXG A;  3LJN A;  1D9S A;  5ENT D;  1MX6 A;  4F1P A;  5BXO A;  4DRX E;  5AAO A;  1IHB A;  1UOH A;  3V2O A;  3J5P A;  4HNA D;  1A5E A;  3NOC D;  2F37 A;  3W9F A;  1YMP A;  3V31 A;  3Q9U C;  5KNH D;  3IXE A;  4BER A;  2FO1 E;  5CBN A;  4NIK A;  2BKK B;  3TWR A;  2RFM A;  1MJ0 A;  2QYJ A;  2P2C P;  3ZNG A;  5AQ9 A;  4TUM A;  1N11 A;  1WG0 A;  4YDW A;  3ZKJ A;  2XZT G;  4O1P A;  3SO8 A;  5ENS D;  3UTM A;  4K5B A;  4U95 D;  4LSZ E;  2JAB A;  3TWT A;  3DEP A;  3UI2 A;  1BI7 B;  2ETC A;  4CZ2 D;  4OAV B;  5HRY A;  5HKP A;  1K1B A;  2DZO A;  2QC9 A;  2NYJ A;  2AJA A;  1DCQ A;  3B95 A;  2XEN A;  4GMR A;  2BKG A;  4HBD A;  5FIN A;  1YYH A;  4C48 B;  5EYP F;  4B93 B;  2DVW A;  4O60 A;  4HI8 A;  4GPM A;  4A63 B;  4LNU D;  3ZU7 B;  1OY3 D;  3V2X A;  1MX4 A;  3AJI A;  4U8V D;  1DC2 A;  4HRL A;  3TWV A;  5JA4 D;  3AAA C;  4HRM B;  5KBA A;  1MYO A;  2V4H C;  5ENP D;  2DWZ A;  3JUE A;  5ENQ D; 
#chains in the Genus database with same CATH topology
 1DNP A;  3CHM A;  4U63 A;  4K5C A;  5ARF A;  5KJL A;  1UJK A;  3UKR G;  3D9L A;  4G8K A;  3EHR A;  2P9S G;  2XRY A;  2ETA A;  2I9C A;  2NXP A;  3FUM A;  1UW4 B;  4DPR A;  1E7U A;  3SGH A;  3T5V A;  2JEK A;  3KEZ A;  3JUI A;  5KWD A;  3RU0 A;  4L7T A;  5JMN D;  3JCK C;  3R9M A;  2LO6 A;  3ZHE B;  2P58 C;  2VGX A;  3QOU A;  1X5B A;  5AQB A;  3CVP A;  3SNX A;  4GTP A;  3OXG A;  5ENR D;  3UT8 A;  3RO3 A;  3Q15 A;  3PZ3 A;  1IHB A;  3TJP A;  2X6K A;  3L17 A;  5FQ7 A;  3FTY A;  4I9E A;  2MOW A;  2YNQ A;  3OAW A;  4B8C B;  4GCN A;  3PRE A;  3CHP A;  1UG3 A;  2QFC A;  5BW8 C;  4O1P A;  2ETC A;  4LER A;  1ZBP A;  1DCQ A;  2XEN A;  3Q7F A;  1HZ4 A;  1OWO A;  2DIW A;  3ASO E;  4LNU D;  3QNK A;  4CGV A;  3CVN A;  4PS8 A;  3AS5 A;  3AU4 A;  4URK A;  4ABN A;  4WWP A;  4JZY A;  4U0U A;  4FP7 A;  3R7R A;  1LTX A;  1NL4 A;  4U04 A;  3DWL G;  3KEA A;  2XS8 A;  2F8X K;  4U96 D;  4HOU A;  4Q94 A;  5AQ7 A;  4FHK A;  4BX8 A;  3SBS A;  3CVV A;  2KAT A;  5KNG A;  1AWC B;  3BG1 B;  1N9A A;  4L2Y A;  4HQD A;  2R59 A;  4U7E B;  3PZ1 A;  2VTB B;  2AXV A;  4F6R D;  3CQC B;  2WXJ A;  3TWW A;  1AP7 A;  3SF4 A;  4A1G A;  4ANV A;  2Y69 E;  4BSX A;  3U3W A;  2FEZ A;  2FUL A;  4C9B B;  2BUG A;  2LXM A;  4JA7 A;  4KT6 B;  2KCL A;  1E8X A;  1TNY A;  2AXZ A;  4YDO A;  2WXP A;  2IY0 C;  4HLE A;  3CK7 A;  5CBN A;  2RFM A;  2YQ8 A;  1S63 A;  3LCA A;  4APF A;  4EZJ A;  4Y6C A;  4H7X A;  5ENS D;  1E8Z A;  2WXG A;  3ZYQ A;  2VYI A;  5FIN A;  3RRU A;  2P9N G;  2XEV A;  3AAA C;  4J8E A;  4HRM B;  3OXF A;  5A6C A;  4GTR A;  4WUY A;  5BUZ A;  3NOG D;  3D3M A;  3MA5 A;  4O6F A;  4UI9 J;  2BF0 X;  5B1A E;  4DI3 A;  3BQO A;  1WY6 A;  4HLL A;  3TWS A;  2DBA A;  5CER B;  4HI9 A;  3UPV A;  3B7T A;  4UQX A;  4I6J A;  3URZ A;  4KXK B;  2WPV A;  2OV8 A;  3LVR E;  1H6O A;  3I3N A;  2X3M A;  3L22 A;  5DIZ A;  4G23 A;  4RSY A;  3ZHE A;  3FUE A;  3TWX A;  3SBT B;  5J08 A;  3T8M A;  3CKB A;  4E6H A;  2ZGD A;  3HRA A;  4ATG A;  4FU3 A;  5G05 C;  3FUL A;  4NAC A;  4OVU A;  4NRH B;  5ENT D;  2R2L A;  4BT8 A;  2P9I G;  4K03 A;  3NOC D;  2BTD A;  3DXM G;  3ULE G;  5ENN A;  5KNH D;  2BKK B;  2IEJ A;  3ZKJ A;  1IYG A;  4PS7 A;  1N4S A;  3DSS A;  3L6A A;  1HU3 A;  4GMR A;  2V4L A;  3UM3 A;  1E8W A;  2DVW A;  3SQV A;  3ML8 A;  4GPM A;  1OY3 D;  2NC9 A;  2QZA A;  4GZ5 A;  3CVU A;  3ZVV A;  2CHX A;  4GCO A;  3AU5 A;  4LRZ A;  1HF8 A;  1UN8 A;  1WDY A;  1K3Z D;  1OWP A;  2VGY A;  1H0A A;  3LPZ A;  2WQ7 A;  3L9T A;  5D66 A;  3RSE G;  3C3Q A;  4KMO A;  2KCK A;  3TXM A;  2R03 A;  4GTO A;  3CVX A;  4MRU A;  4XIF A;  4GTM A;  3EU9 A;  2XGM A;  3ONK A;  5BT1 A;  5C2Y A;  1LD8 A;  4CT4 A;  3ESK A;  4D10 C;  4AV7 A;  1N4P A;  4AP2 A;  4QQI A;  1BPO A;  4UWK A;  2UY1 A;  4M3O A;  3FP3 A;  3RO2 A;  4M7C A;  1D9S A;  2WXM A;  5BXO A;  3D9K A;  3Q75 A;  2VGX B;  3FTX A;  1QZ2 A;  1UOH A;  4HVB A;  3AS4 A;  3SFZ A;  3RKV A;  3PH0 C;  3EIJ A;  4GMJ A;  3Q49 B;  1JWG A;  3KD7 A;  3DSX A;  4F3V A;  4YDE A;  4CGW A;  4UWH A;  1SA4 A;  2P9L G;  3JQ1 A;  3Q78 A;  3PE3 A;  1N11 A;  3AG3 E;  4U95 D;  3DEP A;  2NYJ A;  5CMW A;  5EYP F;  5T8I A;  5E76 A;  5AEN A;  4GAA A;  1MYO A;  3Q4A B;  4L2L A;  3ASF A;  2J07 A;  4I17 A;  4EEC A;  3NQP A;  4NQ0 A;  3MYV A;  5ITZ F;  5AAR A;  4QFV A;  5EID A;  2Y3A A;  2J9Q A;  5CED B;  1S70 B;  3G2W A;  2NSZ A;  4HRN A;  3HXF A;  4FA6 A;  3KAE A;  3TWQ A;  2OCC E;  1A17 A;  4XX5 A;  1NA3 A;  2HR2 A;  3LS8 A;  2B0O E;  4P29 A;  2PNN A;  3F6Q A;  3W9G A;  4KZC A;  1OCR E;  3C5R A;  5H7P A;  2IOL A;  3CVW A;  3C3R A;  4N39 A;  3TWU A;  3ULQ A;  3E33 A;  1VDY A;  2XZD G;  1EF1 C;  3B7S A;  4A55 A;  4BX9 A;  1E8Y A;  3Q73 A;  4BEP A;  3I5P A;  2EIN E;  1HO8 A;  4UQY A;  4IUL A;  2FI7 A;  4AJW A;  5CRU A;  1N52 A;  4PH4 B;  3QWV A;  4CCA A;  1JCQ A;  1TNO A;  1N95 A;  2AXU A;  4GB9 A;  1SQM A;  3ZN3 A;  3ZRH A;  4WWO A;  1YMP A;  4B0Z A;  1OCC E;  5LCW C;  3MGB A;  1KT1 A;  4TRQ A;  1MJ0 A;  2QYJ A;  3EHN A;  3FUH A;  4AY6 A;  5D0Q D;  4OAV B;  3LYA A;  4ACK A;  3AG4 E;  2IJG X;  3AS8 A;  4N3C A;  4ANU A;  3CQG B;  5B1B E;  4ACL A;  4LNB A;  3DXK G;  2V4H C;  4RG9 A;  3DRA A;  3QWP A;  5JJ6 A;  3QC1 A;  2LSV A;  3Q79 A;  1JPL A;  4MKT A;  1IQU A;  3UX4 A;  3T5X A;  2Q7F A;  5E75 A;  5FQ8 A;  2OND A;  4IRU A;  3GZ2 A;  5G05 J;  3OXL A;  2I6H A;  3EHQ A;  4WNF A;  3TGO A;  4JHJ A;  3WXX A;  4LCT A;  2FF4 A;  2R05 A;  5ENO D;  3UIP C;  2IO3 C;  2C0M A;  4MS6 A;  3GZS A;  3ZYM A;  1DCE A;  1XNF A;  3CGH A;  2XPI A;  4DX6 D;  1U2V G;  1FT2 A;  3C72 A;  1IXV A;  2WVI A;  3UM1 A;  2KZT B;  5AAO A;  1WAO 1;  4BT9 A;  2F37 A;  3PUK A;  3LY9 A;  3LJ3 A;  1WG0 A;  3FUI A;  1XGW A;  4AEZ C;  2H6F A;  3HDX A;  2QY7 A;  3FTU A;  1BI7 B;  4JW1 A;  2AJA A;  2KC7 A;  2BKG A;  4BTB A;  4N2S A;  4K0R A;  4HI8 A;  2X6H A;  3AJI A;  3VLE A;  2H6G A;  2GRR B;  2J4B A;  5FZS A;  4G25 A;  3UT4 A;  4HNA D;  4GTT A;  3C3O A;  2L0I A;  3KSQ A;  5AQA A;  1HG5 A;  3UMV A;  2Y0B G;  2WM9 A;  4ZHB A;  3JXI A;  2LNI A;  3CHS A;  3HXE A;  4U07 A;  4I9C A;  3O4Z A;  4JXT A;  2H6I A;  4BET A;  4ILG A;  3PS6 A;  4J8F A;  4JL0 A;  1MHQ A;  5JJT A;  1N4R A;  2IF4 A;  1LF8 A;  3RIB A;  4ME2 A;  3Q7A A;  1Q2Z A;  4HOQ A;  4HOS A;  4CDR A;  4HB5 A;  4J7W A;  2CFU A;  2XEE A;  3GYZ A;  3PUJ A;  2Y1L E;  1EDU A;  3CLJ A;  3D9P A;  1N4Q A;  4G26 A;  3FHE A;  5AIJ A;  4GML A;  2LXL A;  1MZC A;  3LXU X;  4GA1 A;  3TAX A;  1A5E A;  1O1R A;  3CEQ A;  3EDT B;  3IV0 A;  3E4B A;  2UY1 B;  2WXO A;  4YVO A;  2WMN A;  2J4D A;  2XZT G;  4GTQ A;  4K5B A;  3UI2 A;  2XS1 A;  5HKP A;  1K1B A;  3D9O A;  4UI9 K;  2LUH A;  4C48 B;  5G55 A;  4O60 A;  4L23 A;  4B89 A;  3QJZ A;  5IY5 E;  3PVL A;  5ENP D;  1KZO A;  4Z68 A;  5D0O D;  3UKU G;  1HS6 A;  4AM9 A;  3FU3 A;  1S0P A;  4LG6 A;  4HFG A;  2HO1 A;  4FC8 A;  4I1O B;  3ZFW A;  3PZD A;  4I43 A;  4U8Y D;  1JCR A;  3R9A B;  2X6F A;  2I1J A;  1K1A A;  2VQ2 A;  3FTZ A;  4K5A B;  4A3T A;  2XCC A;  2V5Q C;  3E32 A;  1V55 E;  3SI5 A;  1NZN A;  1PAQ A;  3NBN B;  1TJF A;  4OAU C;  4MLP A;  3RRM B;  4A1S A;  1NA0 A;  2DZN A;  3ASG A;  4UUC A;  3UIO C;  3CIA A;  3ZXP A;  1N0R A;  3CVL A;  4Q96 A;  3DSV A;  2WXQ A;  4JD2 G;  3UIN C;  4WNG A;  4GA0 A;  5C1D A;  2KZT A;  2Y4T A;  3QDN A;  1Z3X A;  1NP7 A;  2GRN B;  4BWR A;  2R5S A;  2KM4 A;  3MJW A;  4YDW A;  3MV2 B;  1S64 A;  4CZ2 D;  3CKC A;  3ONL A;  3ABK E;  2RG8 A;  3K9I A;  2XCB A;  2OOE A;  1JWF A;  5CMY A;  2VSX E;  3G2V A;  3D9I A;  1Z3Y A;  4BFR A;  1SZA A;  3MCX A;  3EUV A;  4N3A A;  2WXL A;  2GW1 A;  3JUE A;  5AJL A;  4G1T A;  3KSL A;  4YND A;  3CVY A;  2C0L A;  2ETB A;  3BEE A;  1N94 A;  4GZ6 A;  3MZL B;  1FVH A;  1Y6I A;  4I1M A;  4OVV A;  5AYW D;  1SA5 A;  4KVO A;  1Z6T A;  1JUQ A;  2L6B A;  2IFU A;  4GTV A;  3VLF A;  1RZ4 A;  2DCP A;  1IKN D;  3HXC A;  4DX7 D;  4U8H A;  3UM0 A;  3DBS A;  4ATZ D;  3PNT B;  1KPS B;  4GA2 A;  1H2U A;  5HS0 A;  1TNU A;  4J0U A;  2A5U A;  5EN5 D;  3SY2 A;  5FJY A;  2HYZ A;  3U66 A;  2ZU6 B;  5J90 A;  4FLH A;  5G04 C;  5B3S E;  1ZB1 A;  3SZ7 A;  3HXD A;  4BY6 A;  2XGO A;  2WXK A;  3PZ4 A;  1H2T C;  3Q9N C;  2IOS A;  3MKR A;  1EYH A;  1U3D A;  3LEW A;  5FT9 A;  1Z5S C;  3VTY A;  3R7Q A;  3IXE A;  4BER A;  2FO1 E;  1OUV A;  3TWR A;  4FJY A;  3ZNG A;  4FJZ A;  3SO8 A;  5FZR A;  1D8E A;  4E85 A;  1OWM A;  2ZIR A;  2YHC A;  3LKU A;  3FH7 A;  4HRL A;  2FBN A;  1UJJ A;  3MEK A;  4Y6W A;  2KCV A;  1HX8 A;  3PNL B;  3PZ2 A;  3FTW A;  3FEX A;  1ELR A;  2L6J A;  3NZU A;  1OXJ A;  3FUJ A;  3FUF A;  4V3I A;  5BPP A;  3FH8 A;  1TNZ A;  4EBA A;  5KJK A;  2XQ0 A;  1ELK A;  3EIQ C;  2ZGG A;  2PQN A;  4CEM A;  3IKO B;  2MYO A;  3QK0 A;  4JB8 P;  3NAW A;  5D2M C;  3CV0 A;  2X38 A;  2WXR A;  3ISM C;  2VSY A;  2F0Y A;  4DX5 D;  5EDS A;  3D9J A;  5DBK A;  3J5Q B;  5M72 A;  2RD0 A;  3FDH A;  3AG1 E;  3ZUV B;  4I6G A;  1H19 A;  3ZXS A;  1KT0 A;  3CK8 A;  3HYM B;  3O48 A;  2VGE A;  4BSZ B;  4BTA A;  5BXU A;  4A3V A;  4PDX A;  3ZYL A;  3V30 A;  1OT8 A;  1UN9 A;  2HM8 A;  3PEV B;  3P1U A;  3E37 A;  2WXH A;  1U3C A;  3E34 A;  4UWG A;  2J08 A;  4NIK A;  5FZQ A;  3EHM A;  5LX8 A;  3OTN A;  4JEH A;  3RAU A;  2AWI A;  1EPU A;  2JLB A;  1QBQ A;  2LAI A;  3TL5 A;  3FTS A;  5HQ8 A;  5FWQ A;  5CCM A;  3Q47 B;  2MHK A;  4JA9 A;  5KCM A;  1PY1 A;  1MX4 A;  3EJN A;  5LOZ A;  4I6E A;  2IQC A;  4JEU A;  1SW6 A;  3IBE A;  4FHJ A;  5AN8 A;  4CT0 A;  3UT7 A;  1G3N B;  3D9H A;  1E90 A;  3DSW A;  1IHG A;  1TN8 A;  2EIL E;  3TG5 A;  2CG3 A;  4DUI A;  1E7V A;  4UI9 C;  4UWF A;  3RJV A;  3AG2 E;  3CSF A;  3QKY A;  4AIF A;  4R7L A;  3PDN A;  2P9P G;  3RK6 A;  1QQE A;  1OCO E;  4FUL A;  4CDM A;  3HG0 D;  4GZ3 A;  4I2W A;  5T4Y A;  3FH5 A;  2XGS A;  3KS2 A;  4G24 A;  3SFX A;  3U64 A;  2X6J A;  4KVM A;  1X81 A;  2CHW A;  4GU5 A;  4XKB A;  2A4Z A;  2DYR E;  5FTP A;  2OVF A;  4EZL A;  3WG7 E;  1TN6 A;  2R17 C;  5AJD A;  3V31 A;  3CST A;  3HVE A;  4OYS A;  5JJ7 A;  1PC2 A;  2EQX A;  3BG0 B;  5EX3 A;  5JHA A;  3ZPJ A;  4PS3 A;  2VSO E;  4J8D A;  5HI7 A;  1NI1 A;  3GW4 A;  2DWZ A;  4F7A A;  5ENQ D;  2E0I A;  3FY4 A;  3SHF A;  2XEH A;  1E96 B;  2X6I A;  3ASN E;  3VTX A;  4G8L A;  1H2V C;  1TR4 A;  3APF A;  2ZIS A;  4O1O A;  5G04 J;  4DX1 A;  2J49 A;  2A5E A;  5EIL A;  1QNF A;  3T8K A;  2CFZ A;  4JC8 A;  5CBO A;  3S7B A;  1HFA A;  2I1K A;  2QYU A;  5ANR A;  2RFA A;  2OEV A;  2P9U G;  4TUU A;  1Y8M A;  3P2B A;  2WXI A;  3S7F A;  4ZFH A;  1BD8 A;  3EU5 A;  3SD5 A;  3U9W A;  1GW6 A;  5ANL A;  4B94 A;  1QYM A;  3B7R L;  3ZW3 A;  3CHO A;  4AXH A;  4LNG A;  3DPD A;  1HG2 A;  4GYY A;  4C0E A;  5A23 A;  2PM7 A;  4KYO B;  3CR3 A;  4EZK A;  2GRP B;  1MX6 A;  3ESL A;  3B13 A;  3D9M A;  3FUK A;  3ENE A;  3JYS A;  3J5P A;  3IEG A;  4U0S A;  4CDN A;  3W9F A;  4H7Y A;  3FFL A;  1YA0 A;  5AQ9 A;  4UWL A;  5KJN A;  3C98 A;  4EHM A;  3ZGQ A;  5LP0 A;  2DZO A;  2QC9 A;  4GZD A;  1HH8 A;  4XEI G;  2EIK E;  3D9N A;  3V2X A;  4JPS A;  4WAF A;  3ASD A;  2GRQ B;  3HXB A;  3PE4 A;  4WND A;  3LVQ E;  3X2Q E;  3TG4 A;  4PUC A;  3LY7 A;  3T9K A;  4GYW A;  3DSU A;  4HOR A;  3FUD A;  4CYM D;  3U4T A;  1NFI E;  3B7U X;  2LAH A;  3FU5 A;  3ZIM A;  2XRZ A;  4AY5 A;  5EX0 A;  4MBG A;  4XKC A;  3GZ1 A;  4GYO A;  3FEY A;  2OVB A;  2F8Y A;  3V79 K;  2HE0 A;  2DYS E;  3ML9 A;  1JCS A;  2V8S E;  1KLX A;  5FQ6 A;  4DLQ A;  4GZC A;  2Y4U A;  2C2L A;  3CK9 A;  5CCL A;  2ZXW E;  5BV1 A;  1MX2 A;  3UM2 A;  2MRI A;  4APO A;  4F1P A;  1L5J A;  4DI4 A;  5BV0 A;  5LCW J;  3ASH A;  4DJA A;  2V5F A;  4DLO A;  5T3R A;  2FO7 A;  5LFA A;  4AOF A;  4W9R A;  4GTS A;  4TUM A;  4JHK A;  3L16 A;  4DK5 A;  4GPK A;  4CRW A;  3VLD A;  1LD7 A;  5EKQ D;  4A63 B;  3UQ3 A;  3ABL E;  1FPP A;  1TEZ A;  2PQR A;  3APD A;  3HIZ A;  4L1B A;  1FT1 A;  4RVB A;  2YHE A;  1OCZ E;  2GRO B;  1TNB A;  4TV3 A;  5BNW A;  2E2E A;  4EPZ A;  4F1S A;  4RQI A;  1OWL A;  1WM5 A;  1OWN A;  3PRZ A;  4J8Y A;  3MV3 B;  3HHM A;  4N5Q A;  1W3B A;  1INZ A;  5CHE E;  3FU0 A;  3QAR A;  4LUN U;  1YCS B;  3MKQ B;  2H6H A;  5CEC B;  2L9B A;  2VJ8 A;  3S7D A;  3IHV A;  4HS2 A;  5ARG A;  3CHQ A;  3S2A A;  2KXP C;  3BU8 A;  1P5Q A;  4DRX E;  4JHR A;  3V2O A;  2WQ6 A;  2CHZ A;  2GRL A;  4XE0 A;  2PM6 A;  5CRV A;  3NZS A;  2R02 A;  2J09 A;  4NUR A;  3L54 A;  3PEU B;  1SZ9 A;  3LY8 A;  3G2T A;  3FTV A;  2V0P A;  3FWV A;  1D8D A;  5KJM A;  3ZEF A;  2BED A;  3Q5M A;  2YIN A;  4WWN A;  3ZU7 B;  3HVE B;  1DC2 A;  4U8V D;  3UUX A;  3TWV A;  2M63 A;  3QB2 A;  4N3B A;  4HOT A;  4TXP A;  3APC A;  2VTB A;  3RRN B;  2WB2 A;  4FLB A;  2WQH A;  4F53 A;  3DST A;  4ANX A;  4ILH B;  2GGF A;  3QWW A;  2UWJ G;  2EIM E;  2LSU A;  4HXI A;  4WNE A;  4ILI A;  3SFY A;  3G2S A;  1MQS A;  2XPY A;  2KBX A;  2AVP A;  3IHY A;  4U0Z A;  3BUA A;  4IN3 B;  2L0T B;  3E30 A;  2IO2 C;  4I1A A;  1HXI A;  1SVX A;  1N54 A;  1O1S A;  4UQZ A;  4LEU A;  2WXF A;  4TXQ A;  1TN7 A;  1BU9 A;  3ULY A;  3LJN A;  5JHB A;  4ANW A;  4L9P A;  3CVQ A;  2EIJ E;  2I2O A;  3Q9U C;  2OEW A;  3UTM A;  1HE8 A;  2GRM A;  3G2U A;  1ELW A;  3CHR A;  2P9K G;  1KZP A;  1H6P A;  1YYH A;  3JQ0 A;  2WXN A;  3TXN A;  4N2Q A;  4N5C A;  1DVP A;  5A7D B;  3DPY A;  3FUN A;  2VSN A;  4XI9 A;  4B8A A;  1K8K G;  4J8S A;  1N0Q A;  2XHE A;  4BES A;  1TYQ G;  4C0M A;  4RLY A;  2PZI A;  2J8S D;  3DEO A;  4G11 A;  2ILR A;  3L08 A;  1IQR A;  4YDY A;  4J6I A;  4JVS A;  3ZYK A;  4RG6 A;  3JXJ A;  3S7J A;  5EYL A;  5CEA A;  2AW6 A;  2ION A;  4AVX A;  2PL2 A;  1H6K A;  3LDZ A;  1TJC A;  5EIB E;  5FIO A;  3N71 A;  5FQ4 A;  1O5M A;  2WMO A;  1BLX B;  1BI8 B;  1FVF A;  4X8Q A;  5G2N A;  2XPZ A;  3MKQ A;  3QAQ A;  3I4G A;  4KZ0 A;  1V54 E;  1RW2 A;  4EQF A;  3NF1 A;  3MX3 A;  3L13 A;  2RKK A;  1O1T A;  4Q69 A;  3B7B A;  3UXG A;  3L82 A;  3FU6 A;  2CG2 A;  4IYP A;  4XI0 A;  3NB2 A;  1FCH A;  4EBA G;  3ABM E;  2IU1 A;  4YVQ C;  2P2C P;  4I2Z A;  2B6C A;  4LSZ E;  2JAB A;  3TWT A;  4FAD A;  4G2V A;  5HRY A;  1ZU2 A;  1B89 A;  4DX2 A;  3B95 A;  4HBD A;  4KBQ A;  4XZ4 A;  4B93 B;  4TXR A;  5JA4 D;  5KBA A;  3I4R B; 
#chains in the Genus database with same CATH homology
 3NOG D;  3T9K A;  4Z68 A;  1SW6 A;  4K5C A;  1N0Q A;  5AN8 A;  4BES A;  2XEH A;  5ITZ F;  5AAR A;  2ETB A;  1G3N B;  1WDY A;  1K3Z D;  3D9H A;  3KEA A;  4G8K A;  4QFV A;  5AQA A;  4LG6 A;  4G8L A;  4CYM D;  1TR4 A;  3EHR A;  2F8X K;  4U96 D;  2ETA A;  4O1O A;  1NFI E;  5EID A;  2Y0B G;  4RLY A;  4DUI A;  2J8S D;  3DEO A;  5AQ7 A;  4U8Y D;  4HLL A;  4ZHB A;  5CED B;  3TWS A;  3JXI A;  2L6B A;  1S70 B;  2ZGG A;  4DX1 A;  2A5E A;  5CER B;  5EIL A;  5D66 A;  5KNG A;  4YDY A;  3T8K A;  1AWC B;  2MYO A;  4HI9 A;  4JB8 P;  1IKN D;  4HRN A;  4DX7 D;  1K1A A;  5CBO A;  3TWQ A;  3EHQ A;  4K5A B;  4DX2 A;  4BET A;  2RFA A;  3JXJ A;  4HQD A;  5EYL A;  4ATZ D;  5CEA A;  5KWD A;  2V5Q C;  3W9G A;  2B0O E;  2PNN A;  3F6Q A;  5HS0 A;  5JMN D;  4F6R D;  4J8Y A;  3C5R A;  3NBN B;  4DX5 D;  3TWW A;  3EU9 A;  5EN5 D;  4N5Q A;  5EIB E;  2F8Y A;  3J5Q B;  1AP7 A;  5FIO A;  3V79 K;  3HG0 D;  5ENO D;  2HE0 A;  2KBX A;  1YCS B;  3TWU A;  3ZUV B;  4OAU C;  4ZFH A;  1BLX B;  1BD8 A;  3TWX A;  5CEC B;  2XZD G;  1BI8 B;  4HB5 A;  1QYM A;  4J7W A;  5AQB A;  2XEE A;  1SVX A;  2VGE A;  4BEP A;  2Y1L E;  2ZGD A;  4BSZ B;  2DZN A;  3HRA A;  5BXU A;  4UUC A;  1N0R A;  4DX6 D;  4QQI A;  5ENR D;  1MX2 A;  1BU9 A;  3V30 A;  1OT8 A;  2KXP C;  1IXV A;  3Q9N C;  3B7B A;  3UXG A;  3LJN A;  1D9S A;  5ENT D;  1MX6 A;  4F1P A;  5BXO A;  4DRX E;  5AAO A;  1IHB A;  1UOH A;  3V2O A;  3J5P A;  4HNA D;  1A5E A;  3NOC D;  2F37 A;  3W9F A;  1YMP A;  3V31 A;  3Q9U C;  5KNH D;  3IXE A;  4BER A;  2FO1 E;  5CBN A;  4NIK A;  2BKK B;  3TWR A;  2RFM A;  1MJ0 A;  2QYJ A;  2P2C P;  3ZNG A;  5AQ9 A;  4TUM A;  1N11 A;  1WG0 A;  4YDW A;  3ZKJ A;  2XZT G;  4O1P A;  3SO8 A;  5ENS D;  3UTM A;  4K5B A;  4U95 D;  4LSZ E;  2JAB A;  3TWT A;  3DEP A;  3UI2 A;  1BI7 B;  2ETC A;  4CZ2 D;  4OAV B;  5HRY A;  5HKP A;  1K1B A;  2DZO A;  2QC9 A;  2NYJ A;  2AJA A;  1DCQ A;  3B95 A;  2XEN A;  4GMR A;  2BKG A;  4HBD A;  5FIN A;  1YYH A;  4C48 B;  5EYP F;  4B93 B;  2DVW A;  4O60 A;  4HI8 A;  4GPM A;  4A63 B;  4LNU D;  3ZU7 B;  1OY3 D;  3V2X A;  1MX4 A;  3AJI A;  4U8V D;  1DC2 A;  4HRL A;  3TWV A;  5JA4 D;  3AAA C;  4HRM B;  5KBA A;  1MYO A;  2V4H C;  5ENP D;  2DWZ A;  3JUE A;  5ENQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...