2A5EA

Solution nmr structure of tumor suppressor p16ink4a, restrained minimized mean structure
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
156
structure length
156
Chain Sequence
b'MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR SUPPRESSOR P16INK4A
publication title Tumor suppressor p16INK4A: determination of solution structure and analyses of its interaction with cyclin-dependent kinase 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Anti-oncogene
total genus 25
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2a5eA00
2DVWA 3EHRA 4HQDA 5AQAA 3ZKJA 4DX7D 4GMRA 2JABA 5D66A 5BXUA 2XEHA 1D9SA 2Y0BG 2QYJA 3HRAA 3LJNA 1OT8A 1WG0A 3D9HA 4DUIA 4HRMB 1TR4A 4BESA 4F6RD 4U96D 5EYLA 3J5PA 4LG6A 2A5EA 3KEAA 4YDWA 2AJAA 3V2OA 5EIBE 2P2CP 1K1BA 4TUMA 4U8YD 4BETA 4HI9A 4DX5D 2ZGDA 2DZOA 2MYOA 4HB5A 3B7BA 4HLLA 4NIKA 1N0QA 2PNNA 5CEAA 1DCQA 5KBAA 4LNUD 5ENRD 5HS0A 4K5AB 1BI7B 4G8LA 1MX6A 4DRXE 4DX2A 2F8XK 4ZHBA 4OAUC 1BD8A 3JUEA 4OAVB 2XENA 5CEDB 4QFVA 5EIDA 2DZNA 4HBDA 5AARA 1YMPA 1G3NB 3AAAC 3TWWA 5KWDA 4U95D 2XEEA 4UUCA 4ZFHA 3W9FA 4ATZD 3V31A 5KNGA 4A63B 5ENQD 5EN5D 3W9GA 5JMND 4CYMD 1MJ0A 5AQ9A 2F8YA 1BI8B 1SVXA 2RFAA 1BLXB 4J7WA 2BKGA 4BERA 4BEPA 3B95A 1BU9A 1AP7A 3Q9NC 3HG0D 3TWXA 2HE0A 4HNAD 4DX1A 2V4HC 1SW6A 5EYPF 1AWCB 3TWQA 4HRNA 5AQBA 2QC9A 3J5QB 3ZUVB 4O60A 3UXGA 4F1PA 2XZDG 4J8YA 3V30A 1NFIE 2RFMA 5FIOA 2KBXA 3TWRA 3DEOA 3V79K 3NOCD 3T8KA 2Y1LE 5CBNA 2B0OE 1YCSB 3EU9A 3JXIA 4CZ2D 5CERB 1YYHA 4QQIA 1DC2A 3EHQA 5ENSD 5HKPA 2KXPC 5ENTD 1MX2A 1K3ZD 5CBOA 4N5QA 3ZNGA 2FO1E 4RLYA 2F37A 2VGEA 4BSZB 1N11A 4HRLA 5AN8A 1K1AA 1QYMA 3AJIA 5CECB 3DEPA 4G8KA 1IHBA 5KNHD 4B93B 4DX6D 3UTMA 1MYOA 3JXJA 2L6BA 3F6QA 4HI8A 2BKKB 2ETAA 4U8VD 4YDYA 5ENPD 3ZU7B 1OY3D 2ETCA 2XZTG 1UOHA 3UI2A 4O1OA 3V2XA 5ENOD 4K5CA 1S70B 3TWTA 5AAOA 3Q9UC 3IXEA 4K5BA 5HRYA 3TWUA 1A5EA 2DWZA 4O1PA 4Z68A 4C48B 4GPMA 5ITZF 2NYJA 1MX4A 2V5QC 5AQ7A 1N0RA 3TWVA 5FINA 2ETBA 3NBNB 3TWSA 2ZGGA 1IXVA 5EILA 4JB8P 1WDYA 3SO8A 5JA4D 4LSZE 1IKND 3T9KA 3C5RA 3NOGD 5BXOA 2J8SD
chains in the Genus database with same CATH superfamily
4GZ3A 4DLOA 2GRNB 3FH5A 3O4ZA 2Y3AA 2DCPA 2XRZA 4HB5A 4NIKA 2MRIA 4LNUD 3DRAA 3IHYA 4C0EA 4EBAG 4IN3B 3TG5A 3U66A 4I1AA 4Q96A 4U95D 4LEUA 3L22A 2B6CA 4GZDA 3LXUX 1Z3YA 3LDZA 3CVWA 2WXMA 2L0TB 1SW6A 4FLBA 1DVPA 4O60A 3ESLA 3C3OA 3JXIA 1X81A 2AXUA 1N11A 5CECB 3BG0B 4B93B 3NZSA 4JEHA 2PL2A 3F6QA 1NZNA 3L08A 1UOHA 4AVXA 3RAUA 3G2WA 3L9TA 3EHNA 3UIOC 4ACKA 3NBNB 3KAEA 3VTYA 5C1DA 2AWIA 3ZGQA 1HX8A 4UQXA 3ZKJA 5JHAA 4CGVA 3PZ1A 3SI5A 1HO8A 1WG0A 1TR4A 3PZ3A 3ASDA 2WXIA 3QB2A 4BT8A 4DLQA 4BETA 1SZAA 3JCKC 4LRZA 3SFYA 2XCBA 4DX5D 3SFXA 1JWGA 5J90A 1HZ4A 4AY5A 3D3MA 4KYOB 3FFLA 4XX5A 1RZ4A 2LAIA 5H7PA 3LJ3A 4GYYA 2QYUA 4U8HA 1WY6A 3Q4AB 4X8QA 3MGBA 1SVXA 4UI9K 1E8YA 3FTYA 4UWGA 2J07A 4DPRA 3B13A 1FT2A 2PZIA 3D9MA 3Q49B 3VTXA 3DSTA 2R05A 4JVSA 4E85A 3FUFA 4YDEA 2AXVA 2X6HA 4J8EA 3G2SA 3CV0A 1TN8A 3NB2A 4NACA 5LP0A 4G11A 2L6JA 5ENTD 3PZ4A 1HH8A 1U2VG 4WUYA 1S0PA 3FTWA 5BPPA 5J08A 3MCXA 3WXXA 1KT1A 5HQ8A 5ENPD 1OY3D 2ETCA 2XZTG 4ACLA 4FP7A 4AJWA 4OVVA 1L5JA 4UQYA 3HVEB 3Q75A 3G2TA 3DWLG 3CIAA 5A23A 2ZGGA 2RKKA 4GCOA 5EILA 3DSSA 3MA5A 2XS1A 4B8CB 5BXUA 2XEHA 4EPZA 4I43A 1N95A 4EHMA 2P2CP 4GU5A 4MS6A 4DJAA 5G55A 1IHGA 3DPYA 5HS0A 3T5VA 3JUEA 3FEXA 3UKUG 1W3BA 3CQGB 4HBDA 3KS2A 2XEEA 3QWWA 5FWQA 2GW1A 3IEGA 3B7TA 1NA0A 4P29A 2YQ8A 2PM6A 3CVVA 4EZLA 3OXGA 4HRNA 4HVBA 2QC9A 2P9IG 3QAQA 3ZUVB 3RRNB 4J8YA 3V30A 1OCZE 2KC7A 3NOCD 2MHKA 4GZCA 3NF1A 4DK5A 3OXFA 4U0ZA 2NC9A 1N4SA 3UTMA 3FUDA 2VSXE 2LSUA 2H6IA 3AS8A 2VQ2A 1INZA 2J49A 3MJWA 4DUIA 3AG2E 4YVOA 4I1OB 3OTNA 1QNFA 3DSWA 4AIFA 2NYJA 5ANLA 2WXPA 3ZHEB 3L13A 3TGOA 2OOEA 2XGOA 2J8SD 4HOUA 3Q47B 3FTZA 5BT1A 3KEZA 1O1TA 3SF4A 4E6HA 5FZQA 4U96D 4BX8A 1WM5A 1DCEA 3CHSA 4U8YD 2CHXA 2DZOA 5EKQD 5BNWA 3ZYKA 5LOZA 1E7UA 3OXLA 2C0MA 2XGSA 2CHWA 3PUKA 5LX8A 4YVQC 3LCAA 3EU5A 4G24A 2C0LA 2J9QA 1BLXB 1QBQA 3HXDA 1D8EA 1S64A 2ZISA 4HNAD 2QZAA 4WNEA 5EYPF 3PH0C 2OCCE 4ATGA 3Q5MA 1NFIE 2XQ0A 3DEOA 4CGWA 2Y1LE 3EUVA 1S63A 2E0IA 3ZEFA 3ULQA 1NI1A 3C72A 4A3VA 1MZCA 3SZ7A 2VYIA 4TXPA 5FJYA 3CVQA 4U0UA 2L6BA 3UT7A 4HI8A 3HIZA 2AXZA 5ENNA 2WXOA 2V0PA 3QJZA 1A5EA 4EZKA 2DWZA 4N39A 4Z68A 3UX4A 3L54A 5AQ7A 1N0RA 1IYGA 2ZXWE 3ZRHA 5EX0A 1OXJA 2VTBB 3FUMA 3FWVA 5BXOA 5EIBE 4J0UA 3APFA 3HRAA 4NRHB 3SD5A 2P9NG 5FQ8A 5EYLA 2AJAA 4TUMA 4J8SA 4EBAA 3KD7A 1XGWA 4BY6A 2IEJA 4M3OA 3JQ1A 1YMPA 3BEEA 4JEUA 4G26A 4K03A 5EN5D 3U4TA 4PS3A 4HOSA 4BEPA 1BU9A 3EHMA 1NP7A 1AWCB 1ELRA 2WQHA 5FQ6A 1FVHA 4JHKA 3ZIMA 2KBXA 4GA2A 3T8KA 2I2OA 5KJLA 5CRVA 4KMOA 4AP2A 2XPYA 1DC2A 5HKPA 1TN6A 1O1SA 3HVEA 2H6HA 4DX6D 1LD8A 4WWPA 2EQXA 4LNGA 4GA0A 3UI2A 3V2XA 3Q15A 1Z5SC 4GTPA 1IQRA 4Q69A 4HORA 4I17A 3R9AB 2V5QC 3ASNE 1FT1A 3Q7FA 3SNXA 4RQIA 4I9CA 4B0ZA 1IKND 4N5CA 4FJZA 5B1BE 4HQDA 3ONLA 4R7LA 4AOFA 1B89A 2CHZA 4CT4A 2R59A 3FUKA 4JZYA 2A5UA 2OV8A 3RJVA 2ZGDA 3AG4E 3PRZA 3ZXSA 3DSVA 1DCQA 3FTUA 3ENEA 3RU0A 4HLEA 4BSXA 1H0AA 2HYZA 4L9PA 3URZA 3GZ2A 2WXGA 2FF4A 2RFAA 3PEUB 1Y6IA 3AG1E 4UWLA 3UM3A 1LF8A 2X38A 5CHEE 2OEWA 3ESKA 2WVIA 3ZYQA 3EDTB 5CBNA 3SGHA 2H6FA 4U04A 3VLEA 3ZW3A 2JEKA 3DEPA 3S7FA 1TEZA 3ZHEA 1OWLA 4Y6CA 2ZU6B 3UM1A 3FUEA 3U3WA 1S70B 4HOTA 3D9JA 1TNBA 1TNUA 1JCRA 5JJTA 3MV2B 5CMYA 2I6HA 3LEWA 2GRMA 4LSZE 1Z3XA 1TN7A 1ZBPA 4GMRA 2QYJA 2JLBA 4G1TA 4LG6A 2GGFA 1TNOA 1FVFA 4KVMA 1U3DA 4FC8A 4B8AA 3TJPA 4ZHBA 4FHKA 3ZXPA 4GMLA 4OYSA 3TAXA 3JQ0A 2C2LA 5EDSA 3IV0A 3UUXA 4APFA 1HF8A 1KZPA 4A63B 4D10C 2R2LA 3AG3E 3G2VA 2I1KA 3C3RA 4MRUA 3SHFA 4FU3A 2EIJE 2VGYA 2XCCA 3V79K 2A4ZA 3S7JA 1IQUA 2QY7A 1KLXA 2PM7A 3NZUA 4BSZB 4HRLA 5AN8A 4JHRA 1ELWA 1QYMA 4V3IA 1U3CA 4ANWA 1MYOA 3UT8A 3PVLA 2V5FA 2VTBA 3ZYMA 3K9IA 3O48A 2EIME 3PNTB 2P9KG 5JHBA 5ITZF 1OUVA 3UM2A 2LXLA 3ONKA 4RVBA 3CHOA 3ZVVA 5B1AE 4DX7D 5AYWD 4NURA 3B7SA 2A5EA 2GROB 1K1BA 3D9IA 3L6AA 3I3NA 4G23A 4HI9A 2X6FA 3LVRE 2PNNA 3FTVA 5CEAA 1N52A 1FPPA 2YHCA 3BU8A 4L1BA 2L9BA 3T5XA 5AARA 4NQ0A 4IULA 1UG3A 1V54E 4GZ5A 4JC8A 1BI8B 4J7WA 3Q9NC 2LO6A 1E8ZA 2HE0A 3Q79A 3TG4A 4URKA 1SZ9A 3FUIA 4PS7A 3CHPA 2EIKE 3DPDA 1OWNA 3HHMA 3FTXA 1N4RA 5CERB 3PZ2A 1KZOA 3DSXA 1K3ZD 5BV0A 2IO3C 3LYAA 5CBOA 4IRUA 2FO1E 4N2QA 1MHQA 2KM4A 2XRYA 2BUGA 3RRUA 3RIBA 2ETAA 1TNZA 3CK8A 3TXMA 3TWTA 3TWUA 5AENA 4H7XA 3ASGA 4GPMA 1MX4A 4XI9A 3MYVA 5FINA 5CCLA 1IXVA 4ILIA 4WAFA 2WXRA 3SO8A 5BW8C 2ILRA 1XNFA 4KXKB 5KJMA 5DBKA 4MKTA 4GTMA 1OWMA 4H7YA 3CVUA 3RSEG 2XENA 5G05J 1UW4B 5BV1A 3PUJA 4CT0A 2VJ8A 3S7BA 2VSNA 3PE3A 3CSFA 4CYMD 5E75A 5FZRA 2FEZA 1AP7A 3HYMB 3TWXA 3SQVA 3UPVA 4ANXA 4JPSA 3AU4A 1EF1C 2EILE 5E76A 3CHQA 4BT9A 4F1PA 4XI0A 3GZ1A 1HU3A 1V55E 4I9EA 1OCOE 1YYHA 1ZU2A 3LPZA 3FP3A 4PH4B 4J6IA 2KXPC 1E90A 3N71A 1Z6TA 3U9WA 4FA6A 2R5SA 2VSOE 3QWPA 3GYZA 2X3MA 2RG8A 1H2TC 1OWOA 4GTQA 3ZU7B 4I1MA 3Q78A 2CG3A 2IQCA 4JHJA 4J8DA 4O1PA 4GTTA 2YNQA 3TL5A 1OCCE 3TWSA 3UKRG 4N2SA 1TNYA 4APOA 2WB2A 3QKYA 5AIJA 3T9KA 2DVWA 3D9HA 4HRMB 3P1UA 2VGXB 4HXIA 2GRQB 2AVPA 4Y6WA 2J4BA 4FHJA 5ENRD 5B3SE 3I4GA 3BG1B 4GYWA 4CCAA 5D0OD 3UMVA 2FO7A 1Y8MA 1TJCA 4N3BA 3AAAC 3W9FA 4JW1A 5LFAA 1EPUA 3QWVA 3QOUA 2AW6A 4B94A 3B95A 4A1SA 3SBSA 2V4HC 4UI9C 4JL0A 5FT9A 2YINA 5G04J 3ZYLA 1K8KG 2QFCA 1N94A 5FIOA 3MX3A 3RK6A 2IJGX 2EINE 4CZ2D 3Q7AA 2X6IA 4XKBA 1MX2A 3E34A 2HR2A 2E2EA 3ZNGA 1PAQA 4F1SA 2KATA 2H6GA 4GYOA 1LTXA 5D2MC 3EIJA 3FUJA 2P9UG 1PC2A 5DIZA 3IXEA 2DIWA 2CG2A 2LSVA 2XPZA 4C48B 2YHEA 4ABNA 2J4DA 1UN8A 3MEKA 1H2UA 2GRPB 2P9SG 4JA9A 1D9SA 1OT8A 1A17A 3KSLA 4YDWA 4XZ4A 3GZSA 3VLFA 4A3TA 5A7DB 4TV3A 3RRMB 3LY9A 2IO2C 4K5AB 1BI7B 4C0MA 1MX6A 1SA4A 4M7CA 4ANVA 5EIDA 3FEYA 3D9OA 5G05C 2Y69E 4MBGA 4JD2G 3TWWA 1OWPA 5KWDA 4K0RA 2R02A 4CDMA 3V31A 5ENQD 4AM9A 5JMND 3MKQB 4GTSA 2Y4TA 4BERA 3LY7A 3TWQA 3DSUA 3C98A 3IBEA 5JJ6A 2DYRE 3ASHA 3UT4A 2P9PG 2XPIA 2RFMA 3LY8A 4LCTA 3D9KA 4GA1A 2I9CA 5CRUA 1DNPA 4Q94A 2CFZA 3EHQA 5G2NA 2OVFA 2UWJG 5LCWJ 4G8KA 3UM0A 1E8XA 5T3RA 2KCLA 1UN9A 4EQFA 3FH7A 5CCMA 5HRYA 3CGHA 3NQPA 2OVBA 1JUQA 1QZ2A 3BUAA 1LD7A 1H2VC 3CVLA 4JB8P 1WDYA 2IY0C 3B7RL 4YDYA 4F3VA 5AQAA 3GW4A 1N54A 3PEVB 5D66A 5FQ7A 4U7EB 2UY1B 4F6RD 1O1RA 5A6CA 1HE8A 2FI7A 4FULA 4KVOA 4RG6A 3I5PA 3B7UX 3BQOA 3TXNA 4G8LA 4OAUC 4BTBA 1N4QA 1H6OA 5CEDB 4EECA 1KT0A 3FUHA 4UWFA 3UINC 3FU3A 4I6GA 4XIFA 4AV7A 4KBQA 2VSYA 3UIPC 1N9AA 2RD0A 3RO2A 4DX1A 2KCVA 2Q7FA 3EIQC 2WXKA 4A1GA 3DXKG 3X2QE 5G04C 2XZDG 3HXFA 1NA3A 3L17A 4TRQA 3EU9A 3L16A 2IFUA 4ILGA 2XGMA 4WNFA 4CDNA 3KSQA 4FADA 1IHBA 5KNHD 4GZ6A 4OVUA 5JJ7A 3ABKE 4U8VD 4O1OA 3FULA 4ILHB 3CVXA 1EYHA 2NXPA 3HXBA 4I6JA 3CVNA 4BX9A 2CFUA 2IOSA 2VGXA 3E32A 2DBAA 3Q73A 5JA4D 1GW6A 4ZFHA 3T8MA 1SQMA 3VLDA 5BUZA 2Y0BG 3EJNA 3RO3A 2KZTB 4I2WA 4AXHA 5T8IA 2WQ6A 3J5PA 3ZPJA 3FTSA 4TXRA 3KEAA 2IF4A 4HFGA 3APDA 2MYOA 1BPOA 4JA7A 3JUIA 2F8XK 2Y4UA 3LVQE 1BD8A 4FJYA 3SY2A 3CLJA 2WXHA 1G3NB 3CK7A 4A55A 4ATZD 1PY1A 4U0SA 4GTVA 3HG0D 4TXQA 3R7QA 4PS8A 3D9NA 3DBSA 3RKVA 1TJFA 3PNLB 3SFZA 3CHMA 3AS4A 4HOQA 1RW2A 4N3AA 5FQ4A 2KCKA 3TWRA 2FULA 4HS2A 2OEVA 1E96B 1JPLA 3L82A 4N5QA 4UI9J 2DYSE 4PUCA 3ASOE 2V8SE 3ZFWA 3S7DA 2PQNA 5LCWC 4WWNA 3R7RA 3PS6A 2P9LG 4UWHA 4B89A 3FUNA 5ENOD 4K5CA 4DI4A 3ABLE 4GCNA 3Q9UC 5KCMA 4F7AA 4XE0A 4WNGA 3PDNA 3PZDA 4GPKA 3LKUA 3R9MA 3HXCA 3CHRA 5ANRA 2JABA 4AEZC 3LJNA 4KZCA 2J09A 1NL4A 3HDXA 4GMJA 4L2YA 2MOWA 1HG5A 4GB9A 3DXMG 4L23A 3NAWA 1SA5A 3MKQA 3PE4A 3CSTA 4GTOA 4DRXE 4L7TA 3CVYA 3D9LA 4QFVA 3CKBA 3ULYA 1O5MA 3C3QA 2NSZA 5D0QD 3QDNA 3W9GA 1UJKA 5KJKA 1WAO1 2F0YA 3FDHA 3ML9A 1QQEA 2LUHA 3CQCB 5FTPA 3FU6A 1YA0A 5AQBA 4LUNU 2FBNA 2WXFA 3E33A 2BEDA 2L0IA 5ENSD 2F37A 3IHVA 4KZ0A 5HI7A 1K1AA 1TYQG 3MV3B 2XHEA 2PQRA 5T4YA 2HM8A 1HS6A 2HO1A 3CVPA 5AJLA 1JCSA 2J08A 1N4PA 3E30A 2GRLA 2IU1A 3ZN3A 2WM9A 5AAOA 2XEVA 3QNKA 4ANUA 3CKCA 4U63A 2UY1A 1P5QA 2XS8A 5ARGA 5CMWA 4IYPA 3CEQA 4YNDA 4G25A 2IONA 1JCQA 3C5RA 3NOGD 5FZSA 5AJDA 3EHRA 3JYSA 4DI3A 1HFAA 5C2YA 3ML8A 1E8WA 1H6KA 1E7VA 4HLLA 1N0QA 5KBAA 4C9BB 3OAWA 2R03A 4MLPA 3G2UA 4OAVB 4WNDA 4RG9A 5EX3A 3FH8A 5KNGA 2WXLA 4N3CA 1MJ0A 2X6JA 2F8YA 4UQZA 1HXIA 4RSYA 5M72A 4YDOA 3FU0A 4BWRA 3ABME 2WPVA 3SBTB 3QARA 3APCA 3PREA 4F53A 4FLHA 1H6PA 2B0OE 1YCSB 2M63A 2IOLA 2ZIRA 4QQIA 5IY5E 4BFRA 4J8FA 1H19A 4TUUA 2WMOA 3I4RB 4I6EA 3QC1A 3WG7E 2BKKB 3ULEG 2WMNA 2X6KA 4I2ZA 1D8DA 2V4LA 1ELKA 2KZTA 4GTRA 3D9PA 1ZB1A 3AU5A 2LNIA 2ETBA 3FY4A 1FCHA 3S2AA 4O6FA 4W9RA 3E37A 1JWFA 4BESA 3V2OA 5ARFA 3ISMC 3B7BA 2ONDA 3FU5A 4KT6B 4DX2A 4LNBA 4JXTA 1UJJA 3E4BA 4WWOA 3HXEA 4LERA 2DZNA 4PDXA 2LXMA 4UUCA 2WXJA 3CR3A 2WXNA 2LAHA 3FHEA 2R17C 5AQ9A 2BKGA 2BF0X 4CDRA 4EZJA 2I1JA 2WXQA 2GRRB 3MZLB 3J5QB 3UXGA 4CRWA 1OCRE 3IKOB 3MKRA 4U07A 1EDUA 1HG2A 3LS8A 3AS5A 4RLYA 2VGEA 3U64A 4GAAA 1X5BA 3AJIA 2BTDA 3JXJA 4AY6A 4ME2A 4CEMA 1KPSB 4XKCA 2WQ7A 5KJNA 1Q2ZA 4UWKA 3CK9A 4BTAA 4K5BA 3ASFA 4G2VA 3P2BA 4XEIG 3QK0A 3TWVA 2P58C 1MQSA 3UQ3A 1VDYA 4L2LA
chains in the Genus database with same CATH topology
2DVWA 3EHRA 4HQDA 5AQAA 3ZKJA 4DX7D 4GMRA 2JABA 5D66A 5BXUA 2XEHA 1D9SA 2Y0BG 2QYJA 3HRAA 3LJNA 1OT8A 1WG0A 3D9HA 4DUIA 4HRMB 1TR4A 4BESA 4F6RD 4U96D 5EYLA 3J5PA 4LG6A 2A5EA 3KEAA 4YDWA 2AJAA 3V2OA 5EIBE 2P2CP 1K1BA 4TUMA 4U8YD 4BETA 4HI9A 4DX5D 2ZGDA 2DZOA 2MYOA 4HB5A 3B7BA 4HLLA 4NIKA 1N0QA 2PNNA 5CEAA 1DCQA 5KBAA 4LNUD 5ENRD 5HS0A 4K5AB 1BI7B 4G8LA 1MX6A 4DRXE 4DX2A 2F8XK 4ZHBA 4OAUC 1BD8A 3JUEA 4OAVB 2XENA 5CEDB 4QFVA 5EIDA 2DZNA 4HBDA 5AARA 1YMPA 1G3NB 3AAAC 3TWWA 5KWDA 4U95D 2XEEA 4UUCA 4ZFHA 3W9FA 4ATZD 3V31A 5KNGA 4A63B 5ENQD 5EN5D 3W9GA 5JMND 4CYMD 1MJ0A 5AQ9A 2F8YA 1BI8B 1SVXA 2RFAA 1BLXB 4J7WA 2BKGA 4BERA 4BEPA 3B95A 1BU9A 1AP7A 3Q9NC 3HG0D 3TWXA 2HE0A 4HNAD 4DX1A 2V4HC 1SW6A 5EYPF 1AWCB 3TWQA 4HRNA 5AQBA 2QC9A 3J5QB 3ZUVB 4O60A 3UXGA 4F1PA 2XZDG 4J8YA 3V30A 1NFIE 2RFMA 5FIOA 2KBXA 3TWRA 3DEOA 3V79K 3NOCD 3T8KA 2Y1LE 5CBNA 2B0OE 1YCSB 3EU9A 3JXIA 4CZ2D 5CERB 1YYHA 4QQIA 1DC2A 3EHQA 5ENSD 5HKPA 2KXPC 5ENTD 1MX2A 1K3ZD 5CBOA 4N5QA 3ZNGA 2FO1E 4RLYA 2F37A 2VGEA 4BSZB 1N11A 4HRLA 5AN8A 1K1AA 1QYMA 3AJIA 5CECB 3DEPA 4G8KA 1IHBA 5KNHD 4B93B 4DX6D 3UTMA 1MYOA 3JXJA 2L6BA 3F6QA 4HI8A 2BKKB 2ETAA 4U8VD 4YDYA 5ENPD 3ZU7B 1OY3D 2ETCA 2XZTG 1UOHA 3UI2A 4O1OA 3V2XA 5ENOD 4K5CA 1S70B 3TWTA 5AAOA 3Q9UC 3IXEA 4K5BA 5HRYA 3TWUA 1A5EA 2DWZA 4O1PA 4Z68A 4C48B 4GPMA 5ITZF 2NYJA 1MX4A 2V5QC 5AQ7A 1N0RA 3TWVA 5FINA 2ETBA 3NBNB 3TWSA 2ZGGA 1IXVA 5EILA 4JB8P 1WDYA 3SO8A 5JA4D 4LSZE 1IKND 3T9KA 3C5RA 3NOGD 5BXOA 2J8SD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVW A;  3EHR A;  4HQD A;  5AQA A;  3ZKJ A;  4DX7 D;  4GMR A;  2JAB A;  5D66 A;  5BXU A;  2XEH A;  1D9S A;  2Y0B G;  2QYJ A;  3HRA A;  3LJN A;  1OT8 A;  1WG0 A;  3D9H A;  4DUI A;  4HRM B;  1TR4 A;  4BES A;  4F6R D;  4U96 D;  5EYL A;  3J5P A;  4LG6 A;  2A5E A;  3KEA A;  4YDW A;  2AJA A;  3V2O A;  5EIB E;  2P2C P;  1K1B A;  4TUM A;  4U8Y D;  4BET A;  4HI9 A;  4DX5 D;  2ZGD A;  2DZO A;  2MYO A;  4HB5 A;  3B7B A;  4HLL A;  4NIK A;  1N0Q A;  2PNN A;  5CEA A;  1DCQ A;  5KBA A;  4LNU D;  5ENR D;  5HS0 A;  4K5A B;  1BI7 B;  4G8L A;  1MX6 A;  4DRX E;  4DX2 A;  2F8X K;  4ZHB A;  4OAU C;  1BD8 A;  3JUE A;  4OAV B;  2XEN A;  5CED B;  4QFV A;  5EID A;  2DZN A;  4HBD A;  5AAR A;  1YMP A;  1G3N B;  3AAA C;  3TWW A;  5KWD A;  4U95 D;  2XEE A;  4UUC A;  4ZFH A;  3W9F A;  4ATZ D;  3V31 A;  5KNG A;  4A63 B;  5ENQ D;  5EN5 D;  3W9G A;  5JMN D;  4CYM D;  1MJ0 A;  5AQ9 A;  2F8Y A;  1BI8 B;  1SVX A;  2RFA A;  1BLX B;  4J7W A;  2BKG A;  4BER A;  4BEP A;  3B95 A;  1BU9 A;  1AP7 A;  3Q9N C;  3HG0 D;  3TWX A;  2HE0 A;  4HNA D;  4DX1 A;  2V4H C;  1SW6 A;  5EYP F;  1AWC B;  3TWQ A;  4HRN A;  5AQB A;  2QC9 A;  3J5Q B;  3ZUV B;  4O60 A;  3UXG A;  4F1P A;  2XZD G;  4J8Y A;  3V30 A;  1NFI E;  2RFM A;  5FIO A;  2KBX A;  3TWR A;  3DEO A;  3V79 K;  3NOC D;  3T8K A;  2Y1L E;  5CBN A;  2B0O E;  1YCS B;  3EU9 A;  3JXI A;  4CZ2 D;  5CER B;  1YYH A;  4QQI A;  1DC2 A;  3EHQ A;  5ENS D;  5HKP A;  2KXP C;  5ENT D;  1MX2 A;  1K3Z D;  5CBO A;  4N5Q A;  3ZNG A;  2FO1 E;  4RLY A;  2F37 A;  2VGE A;  4BSZ B;  1N11 A;  4HRL A;  5AN8 A;  1K1A A;  1QYM A;  3AJI A;  5CEC B;  3DEP A;  4G8K A;  1IHB A;  5KNH D;  4B93 B;  4DX6 D;  3UTM A;  1MYO A;  3JXJ A;  2L6B A;  3F6Q A;  4HI8 A;  2BKK B;  2ETA A;  4U8V D;  4YDY A;  5ENP D;  3ZU7 B;  1OY3 D;  2ETC A;  2XZT G;  1UOH A;  3UI2 A;  4O1O A;  3V2X A;  5ENO D;  4K5C A;  1S70 B;  3TWT A;  5AAO A;  3Q9U C;  3IXE A;  4K5B A;  5HRY A;  3TWU A;  1A5E A;  2DWZ A;  4O1P A;  4Z68 A;  4C48 B;  4GPM A;  5ITZ F;  2NYJ A;  1MX4 A;  2V5Q C;  5AQ7 A;  1N0R A;  3TWV A;  5FIN A;  2ETB A;  3NBN B;  3TWS A;  2ZGG A;  1IXV A;  5EIL A;  4JB8 P;  1WDY A;  3SO8 A;  5JA4 D;  4LSZ E;  1IKN D;  3T9K A;  3C5R A;  3NOG D;  5BXO A;  2J8S D; 
#chains in the Genus database with same CATH topology
 4GZ3 A;  4DLO A;  2GRN B;  3FH5 A;  3O4Z A;  2Y3A A;  2DCP A;  2XRZ A;  4HB5 A;  4NIK A;  2MRI A;  4LNU D;  3DRA A;  3IHY A;  4C0E A;  4EBA G;  4IN3 B;  3TG5 A;  3U66 A;  4I1A A;  4Q96 A;  4U95 D;  4LEU A;  3L22 A;  2B6C A;  4GZD A;  3LXU X;  1Z3Y A;  3LDZ A;  3CVW A;  2WXM A;  2L0T B;  1SW6 A;  4FLB A;  1DVP A;  4O60 A;  3ESL A;  3C3O A;  3JXI A;  1X81 A;  2AXU A;  1N11 A;  5CEC B;  3BG0 B;  4B93 B;  3NZS A;  4JEH A;  2PL2 A;  3F6Q A;  1NZN A;  3L08 A;  1UOH A;  4AVX A;  3RAU A;  3G2W A;  3L9T A;  3EHN A;  3UIO C;  4ACK A;  3NBN B;  3KAE A;  3VTY A;  5C1D A;  2AWI A;  3ZGQ A;  1HX8 A;  4UQX A;  3ZKJ A;  5JHA A;  4CGV A;  3PZ1 A;  3SI5 A;  1HO8 A;  1WG0 A;  1TR4 A;  3PZ3 A;  3ASD A;  2WXI A;  3QB2 A;  4BT8 A;  4DLQ A;  4BET A;  1SZA A;  3JCK C;  4LRZ A;  3SFY A;  2XCB A;  4DX5 D;  3SFX A;  1JWG A;  5J90 A;  1HZ4 A;  4AY5 A;  3D3M A;  4KYO B;  3FFL A;  4XX5 A;  1RZ4 A;  2LAI A;  5H7P A;  3LJ3 A;  4GYY A;  2QYU A;  4U8H A;  1WY6 A;  3Q4A B;  4X8Q A;  3MGB A;  1SVX A;  4UI9 K;  1E8Y A;  3FTY A;  4UWG A;  2J07 A;  4DPR A;  3B13 A;  1FT2 A;  2PZI A;  3D9M A;  3Q49 B;  3VTX A;  3DST A;  2R05 A;  4JVS A;  4E85 A;  3FUF A;  4YDE A;  2AXV A;  2X6H A;  4J8E A;  3G2S A;  3CV0 A;  1TN8 A;  3NB2 A;  4NAC A;  5LP0 A;  4G11 A;  2L6J A;  5ENT D;  3PZ4 A;  1HH8 A;  1U2V G;  4WUY A;  1S0P A;  3FTW A;  5BPP A;  5J08 A;  3MCX A;  3WXX A;  1KT1 A;  5HQ8 A;  5ENP D;  1OY3 D;  2ETC A;  2XZT G;  4ACL A;  4FP7 A;  4AJW A;  4OVV A;  1L5J A;  4UQY A;  3HVE B;  3Q75 A;  3G2T A;  3DWL G;  3CIA A;  5A23 A;  2ZGG A;  2RKK A;  4GCO A;  5EIL A;  3DSS A;  3MA5 A;  2XS1 A;  4B8C B;  5BXU A;  2XEH A;  4EPZ A;  4I43 A;  1N95 A;  4EHM A;  2P2C P;  4GU5 A;  4MS6 A;  4DJA A;  5G55 A;  1IHG A;  3DPY A;  5HS0 A;  3T5V A;  3JUE A;  3FEX A;  3UKU G;  1W3B A;  3CQG B;  4HBD A;  3KS2 A;  2XEE A;  3QWW A;  5FWQ A;  2GW1 A;  3IEG A;  3B7T A;  1NA0 A;  4P29 A;  2YQ8 A;  2PM6 A;  3CVV A;  4EZL A;  3OXG A;  4HRN A;  4HVB A;  2QC9 A;  2P9I G;  3QAQ A;  3ZUV B;  3RRN B;  4J8Y A;  3V30 A;  1OCZ E;  2KC7 A;  3NOC D;  2MHK A;  4GZC A;  3NF1 A;  4DK5 A;  3OXF A;  4U0Z A;  2NC9 A;  1N4S A;  3UTM A;  3FUD A;  2VSX E;  2LSU A;  2H6I A;  3AS8 A;  2VQ2 A;  1INZ A;  2J49 A;  3MJW A;  4DUI A;  3AG2 E;  4YVO A;  4I1O B;  3OTN A;  1QNF A;  3DSW A;  4AIF A;  2NYJ A;  5ANL A;  2WXP A;  3ZHE B;  3L13 A;  3TGO A;  2OOE A;  2XGO A;  2J8S D;  4HOU A;  3Q47 B;  3FTZ A;  5BT1 A;  3KEZ A;  1O1T A;  3SF4 A;  4E6H A;  5FZQ A;  4U96 D;  4BX8 A;  1WM5 A;  1DCE A;  3CHS A;  4U8Y D;  2CHX A;  2DZO A;  5EKQ D;  5BNW A;  3ZYK A;  5LOZ A;  1E7U A;  3OXL A;  2C0M A;  2XGS A;  2CHW A;  3PUK A;  5LX8 A;  4YVQ C;  3LCA A;  3EU5 A;  4G24 A;  2C0L A;  2J9Q A;  1BLX B;  1QBQ A;  3HXD A;  1D8E A;  1S64 A;  2ZIS A;  4HNA D;  2QZA A;  4WNE A;  5EYP F;  3PH0 C;  2OCC E;  4ATG A;  3Q5M A;  1NFI E;  2XQ0 A;  3DEO A;  4CGW A;  2Y1L E;  3EUV A;  1S63 A;  2E0I A;  3ZEF A;  3ULQ A;  1NI1 A;  3C72 A;  4A3V A;  1MZC A;  3SZ7 A;  2VYI A;  4TXP A;  5FJY A;  3CVQ A;  4U0U A;  2L6B A;  3UT7 A;  4HI8 A;  3HIZ A;  2AXZ A;  5ENN A;  2WXO A;  2V0P A;  3QJZ A;  1A5E A;  4EZK A;  2DWZ A;  4N39 A;  4Z68 A;  3UX4 A;  3L54 A;  5AQ7 A;  1N0R A;  1IYG A;  2ZXW E;  3ZRH A;  5EX0 A;  1OXJ A;  2VTB B;  3FUM A;  3FWV A;  5BXO A;  5EIB E;  4J0U A;  3APF A;  3HRA A;  4NRH B;  3SD5 A;  2P9N G;  5FQ8 A;  5EYL A;  2AJA A;  4TUM A;  4J8S A;  4EBA A;  3KD7 A;  1XGW A;  4BY6 A;  2IEJ A;  4M3O A;  3JQ1 A;  1YMP A;  3BEE A;  4JEU A;  4G26 A;  4K03 A;  5EN5 D;  3U4T A;  4PS3 A;  4HOS A;  4BEP A;  1BU9 A;  3EHM A;  1NP7 A;  1AWC B;  1ELR A;  2WQH A;  5FQ6 A;  1FVH A;  4JHK A;  3ZIM A;  2KBX A;  4GA2 A;  3T8K A;  2I2O A;  5KJL A;  5CRV A;  4KMO A;  4AP2 A;  2XPY A;  1DC2 A;  5HKP A;  1TN6 A;  1O1S A;  3HVE A;  2H6H A;  4DX6 D;  1LD8 A;  4WWP A;  2EQX A;  4LNG A;  4GA0 A;  3UI2 A;  3V2X A;  3Q15 A;  1Z5S C;  4GTP A;  1IQR A;  4Q69 A;  4HOR A;  4I17 A;  3R9A B;  2V5Q C;  3ASN E;  1FT1 A;  3Q7F A;  3SNX A;  4RQI A;  4I9C A;  4B0Z A;  1IKN D;  4N5C A;  4FJZ A;  5B1B E;  4HQD A;  3ONL A;  4R7L A;  4AOF A;  1B89 A;  2CHZ A;  4CT4 A;  2R59 A;  3FUK A;  4JZY A;  2A5U A;  2OV8 A;  3RJV A;  2ZGD A;  3AG4 E;  3PRZ A;  3ZXS A;  3DSV A;  1DCQ A;  3FTU A;  3ENE A;  3RU0 A;  4HLE A;  4BSX A;  1H0A A;  2HYZ A;  4L9P A;  3URZ A;  3GZ2 A;  2WXG A;  2FF4 A;  2RFA A;  3PEU B;  1Y6I A;  3AG1 E;  4UWL A;  3UM3 A;  1LF8 A;  2X38 A;  5CHE E;  2OEW A;  3ESK A;  2WVI A;  3ZYQ A;  3EDT B;  5CBN A;  3SGH A;  2H6F A;  4U04 A;  3VLE A;  3ZW3 A;  2JEK A;  3DEP A;  3S7F A;  1TEZ A;  3ZHE A;  1OWL A;  4Y6C A;  2ZU6 B;  3UM1 A;  3FUE A;  3U3W A;  1S70 B;  4HOT A;  3D9J A;  1TNB A;  1TNU A;  1JCR A;  5JJT A;  3MV2 B;  5CMY A;  2I6H A;  3LEW A;  2GRM A;  4LSZ E;  1Z3X A;  1TN7 A;  1ZBP A;  4GMR A;  2QYJ A;  2JLB A;  4G1T A;  4LG6 A;  2GGF A;  1TNO A;  1FVF A;  4KVM A;  1U3D A;  4FC8 A;  4B8A A;  3TJP A;  4ZHB A;  4FHK A;  3ZXP A;  4GML A;  4OYS A;  3TAX A;  3JQ0 A;  2C2L A;  5EDS A;  3IV0 A;  3UUX A;  4APF A;  1HF8 A;  1KZP A;  4A63 B;  4D10 C;  2R2L A;  3AG3 E;  3G2V A;  2I1K A;  3C3R A;  4MRU A;  3SHF A;  4FU3 A;  2EIJ E;  2VGY A;  2XCC A;  3V79 K;  2A4Z A;  3S7J A;  1IQU A;  2QY7 A;  1KLX A;  2PM7 A;  3NZU A;  4BSZ B;  4HRL A;  5AN8 A;  4JHR A;  1ELW A;  1QYM A;  4V3I A;  1U3C A;  4ANW A;  1MYO A;  3UT8 A;  3PVL A;  2V5F A;  2VTB A;  3ZYM A;  3K9I A;  3O48 A;  2EIM E;  3PNT B;  2P9K G;  5JHB A;  5ITZ F;  1OUV A;  3UM2 A;  2LXL A;  3ONK A;  4RVB A;  3CHO A;  3ZVV A;  5B1A E;  4DX7 D;  5AYW D;  4NUR A;  3B7S A;  2A5E A;  2GRO B;  1K1B A;  3D9I A;  3L6A A;  3I3N A;  4G23 A;  4HI9 A;  2X6F A;  3LVR E;  2PNN A;  3FTV A;  5CEA A;  1N52 A;  1FPP A;  2YHC A;  3BU8 A;  4L1B A;  2L9B A;  3T5X A;  5AAR A;  4NQ0 A;  4IUL A;  1UG3 A;  1V54 E;  4GZ5 A;  4JC8 A;  1BI8 B;  4J7W A;  3Q9N C;  2LO6 A;  1E8Z A;  2HE0 A;  3Q79 A;  3TG4 A;  4URK A;  1SZ9 A;  3FUI A;  4PS7 A;  3CHP A;  2EIK E;  3DPD A;  1OWN A;  3HHM A;  3FTX A;  1N4R A;  5CER B;  3PZ2 A;  1KZO A;  3DSX A;  1K3Z D;  5BV0 A;  2IO3 C;  3LYA A;  5CBO A;  4IRU A;  2FO1 E;  4N2Q A;  1MHQ A;  2KM4 A;  2XRY A;  2BUG A;  3RRU A;  3RIB A;  2ETA A;  1TNZ A;  3CK8 A;  3TXM A;  3TWT A;  3TWU A;  5AEN A;  4H7X A;  3ASG A;  4GPM A;  1MX4 A;  4XI9 A;  3MYV A;  5FIN A;  5CCL A;  1IXV A;  4ILI A;  4WAF A;  2WXR A;  3SO8 A;  5BW8 C;  2ILR A;  1XNF A;  4KXK B;  5KJM A;  5DBK A;  4MKT A;  4GTM A;  1OWM A;  4H7Y A;  3CVU A;  3RSE G;  2XEN A;  5G05 J;  1UW4 B;  5BV1 A;  3PUJ A;  4CT0 A;  2VJ8 A;  3S7B A;  2VSN A;  3PE3 A;  3CSF A;  4CYM D;  5E75 A;  5FZR A;  2FEZ A;  1AP7 A;  3HYM B;  3TWX A;  3SQV A;  3UPV A;  4ANX A;  4JPS A;  3AU4 A;  1EF1 C;  2EIL E;  5E76 A;  3CHQ A;  4BT9 A;  4F1P A;  4XI0 A;  3GZ1 A;  1HU3 A;  1V55 E;  4I9E A;  1OCO E;  1YYH A;  1ZU2 A;  3LPZ A;  3FP3 A;  4PH4 B;  4J6I A;  2KXP C;  1E90 A;  3N71 A;  1Z6T A;  3U9W A;  4FA6 A;  2R5S A;  2VSO E;  3QWP A;  3GYZ A;  2X3M A;  2RG8 A;  1H2T C;  1OWO A;  4GTQ A;  3ZU7 B;  4I1M A;  3Q78 A;  2CG3 A;  2IQC A;  4JHJ A;  4J8D A;  4O1P A;  4GTT A;  2YNQ A;  3TL5 A;  1OCC E;  3TWS A;  3UKR G;  4N2S A;  1TNY A;  4APO A;  2WB2 A;  3QKY A;  5AIJ A;  3T9K A;  2DVW A;  3D9H A;  4HRM B;  3P1U A;  2VGX B;  4HXI A;  2GRQ B;  2AVP A;  4Y6W A;  2J4B A;  4FHJ A;  5ENR D;  5B3S E;  3I4G A;  3BG1 B;  4GYW A;  4CCA A;  5D0O D;  3UMV A;  2FO7 A;  1Y8M A;  1TJC A;  4N3B A;  3AAA C;  3W9F A;  4JW1 A;  5LFA A;  1EPU A;  3QWV A;  3QOU A;  2AW6 A;  4B94 A;  3B95 A;  4A1S A;  3SBS A;  2V4H C;  4UI9 C;  4JL0 A;  5FT9 A;  2YIN A;  5G04 J;  3ZYL A;  1K8K G;  2QFC A;  1N94 A;  5FIO A;  3MX3 A;  3RK6 A;  2IJG X;  2EIN E;  4CZ2 D;  3Q7A A;  2X6I A;  4XKB A;  1MX2 A;  3E34 A;  2HR2 A;  2E2E A;  3ZNG A;  1PAQ A;  4F1S A;  2KAT A;  2H6G A;  4GYO A;  1LTX A;  5D2M C;  3EIJ A;  3FUJ A;  2P9U G;  1PC2 A;  5DIZ A;  3IXE A;  2DIW A;  2CG2 A;  2LSV A;  2XPZ A;  4C48 B;  2YHE A;  4ABN A;  2J4D A;  1UN8 A;  3MEK A;  1H2U A;  2GRP B;  2P9S G;  4JA9 A;  1D9S A;  1OT8 A;  1A17 A;  3KSL A;  4YDW A;  4XZ4 A;  3GZS A;  3VLF A;  4A3T A;  5A7D B;  4TV3 A;  3RRM B;  3LY9 A;  2IO2 C;  4K5A B;  1BI7 B;  4C0M A;  1MX6 A;  1SA4 A;  4M7C A;  4ANV A;  5EID A;  3FEY A;  3D9O A;  5G05 C;  2Y69 E;  4MBG A;  4JD2 G;  3TWW A;  1OWP A;  5KWD A;  4K0R A;  2R02 A;  4CDM A;  3V31 A;  5ENQ D;  4AM9 A;  5JMN D;  3MKQ B;  4GTS A;  2Y4T A;  4BER A;  3LY7 A;  3TWQ A;  3DSU A;  3C98 A;  3IBE A;  5JJ6 A;  2DYR E;  3ASH A;  3UT4 A;  2P9P G;  2XPI A;  2RFM A;  3LY8 A;  4LCT A;  3D9K A;  4GA1 A;  2I9C A;  5CRU A;  1DNP A;  4Q94 A;  2CFZ A;  3EHQ A;  5G2N A;  2OVF A;  2UWJ G;  5LCW J;  4G8K A;  3UM0 A;  1E8X A;  5T3R A;  2KCL A;  1UN9 A;  4EQF A;  3FH7 A;  5CCM A;  5HRY A;  3CGH A;  3NQP A;  2OVB A;  1JUQ A;  1QZ2 A;  3BUA A;  1LD7 A;  1H2V C;  3CVL A;  4JB8 P;  1WDY A;  2IY0 C;  3B7R L;  4YDY A;  4F3V A;  5AQA A;  3GW4 A;  1N54 A;  3PEV B;  5D66 A;  5FQ7 A;  4U7E B;  2UY1 B;  4F6R D;  1O1R A;  5A6C A;  1HE8 A;  2FI7 A;  4FUL A;  4KVO A;  4RG6 A;  3I5P A;  3B7U X;  3BQO A;  3TXN A;  4G8L A;  4OAU C;  4BTB A;  1N4Q A;  1H6O A;  5CED B;  4EEC A;  1KT0 A;  3FUH A;  4UWF A;  3UIN C;  3FU3 A;  4I6G A;  4XIF A;  4AV7 A;  4KBQ A;  2VSY A;  3UIP C;  1N9A A;  2RD0 A;  3RO2 A;  4DX1 A;  2KCV A;  2Q7F A;  3EIQ C;  2WXK A;  4A1G A;  3DXK G;  3X2Q E;  5G04 C;  2XZD G;  3HXF A;  1NA3 A;  3L17 A;  4TRQ A;  3EU9 A;  3L16 A;  2IFU A;  4ILG A;  2XGM A;  4WNF A;  4CDN A;  3KSQ A;  4FAD A;  1IHB A;  5KNH D;  4GZ6 A;  4OVU A;  5JJ7 A;  3ABK E;  4U8V D;  4O1O A;  3FUL A;  4ILH B;  3CVX A;  1EYH A;  2NXP A;  3HXB A;  4I6J A;  3CVN A;  4BX9 A;  2CFU A;  2IOS A;  2VGX A;  3E32 A;  2DBA A;  3Q73 A;  5JA4 D;  1GW6 A;  4ZFH A;  3T8M A;  1SQM A;  3VLD A;  5BUZ A;  2Y0B G;  3EJN A;  3RO3 A;  2KZT B;  4I2W A;  4AXH A;  5T8I A;  2WQ6 A;  3J5P A;  3ZPJ A;  3FTS A;  4TXR A;  3KEA A;  2IF4 A;  4HFG A;  3APD A;  2MYO A;  1BPO A;  4JA7 A;  3JUI A;  2F8X K;  2Y4U A;  3LVQ E;  1BD8 A;  4FJY A;  3SY2 A;  3CLJ A;  2WXH A;  1G3N B;  3CK7 A;  4A55 A;  4ATZ D;  1PY1 A;  4U0S A;  4GTV A;  3HG0 D;  4TXQ A;  3R7Q A;  4PS8 A;  3D9N A;  3DBS A;  3RKV A;  1TJF A;  3PNL B;  3SFZ A;  3CHM A;  3AS4 A;  4HOQ A;  1RW2 A;  4N3A A;  5FQ4 A;  2KCK A;  3TWR A;  2FUL A;  4HS2 A;  2OEV A;  1E96 B;  1JPL A;  3L82 A;  4N5Q A;  4UI9 J;  2DYS E;  4PUC A;  3ASO E;  2V8S E;  3ZFW A;  3S7D A;  2PQN A;  5LCW C;  4WWN A;  3R7R A;  3PS6 A;  2P9L G;  4UWH A;  4B89 A;  3FUN A;  5ENO D;  4K5C A;  4DI4 A;  3ABL E;  4GCN A;  3Q9U C;  5KCM A;  4F7A A;  4XE0 A;  4WNG A;  3PDN A;  3PZD A;  4GPK A;  3LKU A;  3R9M A;  3HXC A;  3CHR A;  5ANR A;  2JAB A;  4AEZ C;  3LJN A;  4KZC A;  2J09 A;  1NL4 A;  3HDX A;  4GMJ A;  4L2Y A;  2MOW A;  1HG5 A;  4GB9 A;  3DXM G;  4L23 A;  3NAW A;  1SA5 A;  3MKQ A;  3PE4 A;  3CST A;  4GTO A;  4DRX E;  4L7T A;  3CVY A;  3D9L A;  4QFV A;  3CKB A;  3ULY A;  1O5M A;  3C3Q A;  2NSZ A;  5D0Q D;  3QDN A;  3W9G A;  1UJK A;  5KJK A;  1WAO 1;  2F0Y A;  3FDH A;  3ML9 A;  1QQE A;  2LUH A;  3CQC B;  5FTP A;  3FU6 A;  1YA0 A;  5AQB A;  4LUN U;  2FBN A;  2WXF A;  3E33 A;  2BED A;  2L0I A;  5ENS D;  2F37 A;  3IHV A;  4KZ0 A;  5HI7 A;  1K1A A;  1TYQ G;  3MV3 B;  2XHE A;  2PQR A;  5T4Y A;  2HM8 A;  1HS6 A;  2HO1 A;  3CVP A;  5AJL A;  1JCS A;  2J08 A;  1N4P A;  3E30 A;  2GRL A;  2IU1 A;  3ZN3 A;  2WM9 A;  5AAO A;  2XEV A;  3QNK A;  4ANU A;  3CKC A;  4U63 A;  2UY1 A;  1P5Q A;  2XS8 A;  5ARG A;  5CMW A;  4IYP A;  3CEQ A;  4YND A;  4G25 A;  2ION A;  1JCQ A;  3C5R A;  3NOG D;  5FZS A;  5AJD A;  3EHR A;  3JYS A;  4DI3 A;  1HFA A;  5C2Y A;  3ML8 A;  1E8W A;  1H6K A;  1E7V A;  4HLL A;  1N0Q A;  5KBA A;  4C9B B;  3OAW A;  2R03 A;  4MLP A;  3G2U A;  4OAV B;  4WND A;  4RG9 A;  5EX3 A;  3FH8 A;  5KNG A;  2WXL A;  4N3C A;  1MJ0 A;  2X6J A;  2F8Y A;  4UQZ A;  1HXI A;  4RSY A;  5M72 A;  4YDO A;  3FU0 A;  4BWR A;  3ABM E;  2WPV A;  3SBT B;  3QAR A;  3APC A;  3PRE A;  4F53 A;  4FLH A;  1H6P A;  2B0O E;  1YCS B;  2M63 A;  2IOL A;  2ZIR A;  4QQI A;  5IY5 E;  4BFR A;  4J8F A;  1H19 A;  4TUU A;  2WMO A;  3I4R B;  4I6E A;  3QC1 A;  3WG7 E;  2BKK B;  3ULE G;  2WMN A;  2X6K A;  4I2Z A;  1D8D A;  2V4L A;  1ELK A;  2KZT A;  4GTR A;  3D9P A;  1ZB1 A;  3AU5 A;  2LNI A;  2ETB A;  3FY4 A;  1FCH A;  3S2A A;  4O6F A;  4W9R A;  3E37 A;  1JWF A;  4BES A;  3V2O A;  5ARF A;  3ISM C;  3B7B A;  2OND A;  3FU5 A;  4KT6 B;  4DX2 A;  4LNB A;  4JXT A;  1UJJ A;  3E4B A;  4WWO A;  3HXE A;  4LER A;  2DZN A;  4PDX A;  2LXM A;  4UUC A;  2WXJ A;  3CR3 A;  2WXN A;  2LAH A;  3FHE A;  2R17 C;  5AQ9 A;  2BKG A;  2BF0 X;  4CDR A;  4EZJ A;  2I1J A;  2WXQ A;  2GRR B;  3MZL B;  3J5Q B;  3UXG A;  4CRW A;  1OCR E;  3IKO B;  3MKR A;  4U07 A;  1EDU A;  1HG2 A;  3LS8 A;  3AS5 A;  4RLY A;  2VGE A;  3U64 A;  4GAA A;  1X5B A;  3AJI A;  2BTD A;  3JXJ A;  4AY6 A;  4ME2 A;  4CEM A;  1KPS B;  4XKC A;  2WQ7 A;  5KJN A;  1Q2Z A;  4UWK A;  3CK9 A;  4BTA A;  4K5B A;  3ASF A;  4G2V A;  3P2B A;  4XEI G;  3QK0 A;  3TWV A;  2P58 C;  1MQS A;  3UQ3 A;  1VDY A;  4L2L A; 
#chains in the Genus database with same CATH homology
 2DVW A;  3EHR A;  4HQD A;  5AQA A;  3ZKJ A;  4DX7 D;  4GMR A;  2JAB A;  5D66 A;  5BXU A;  2XEH A;  1D9S A;  2Y0B G;  2QYJ A;  3HRA A;  3LJN A;  1OT8 A;  1WG0 A;  3D9H A;  4DUI A;  4HRM B;  1TR4 A;  4BES A;  4F6R D;  4U96 D;  5EYL A;  3J5P A;  4LG6 A;  2A5E A;  3KEA A;  4YDW A;  2AJA A;  3V2O A;  5EIB E;  2P2C P;  1K1B A;  4TUM A;  4U8Y D;  4BET A;  4HI9 A;  4DX5 D;  2ZGD A;  2DZO A;  2MYO A;  4HB5 A;  3B7B A;  4HLL A;  4NIK A;  1N0Q A;  2PNN A;  5CEA A;  1DCQ A;  5KBA A;  4LNU D;  5ENR D;  5HS0 A;  4K5A B;  1BI7 B;  4G8L A;  1MX6 A;  4DRX E;  4DX2 A;  2F8X K;  4ZHB A;  4OAU C;  1BD8 A;  3JUE A;  4OAV B;  2XEN A;  5CED B;  4QFV A;  5EID A;  2DZN A;  4HBD A;  5AAR A;  1YMP A;  1G3N B;  3AAA C;  3TWW A;  5KWD A;  4U95 D;  2XEE A;  4UUC A;  4ZFH A;  3W9F A;  4ATZ D;  3V31 A;  5KNG A;  4A63 B;  5ENQ D;  5EN5 D;  3W9G A;  5JMN D;  4CYM D;  1MJ0 A;  5AQ9 A;  2F8Y A;  1BI8 B;  1SVX A;  2RFA A;  1BLX B;  4J7W A;  2BKG A;  4BER A;  4BEP A;  3B95 A;  1BU9 A;  1AP7 A;  3Q9N C;  3HG0 D;  3TWX A;  2HE0 A;  4HNA D;  4DX1 A;  2V4H C;  1SW6 A;  5EYP F;  1AWC B;  3TWQ A;  4HRN A;  5AQB A;  2QC9 A;  3J5Q B;  3ZUV B;  4O60 A;  3UXG A;  4F1P A;  2XZD G;  4J8Y A;  3V30 A;  1NFI E;  2RFM A;  5FIO A;  2KBX A;  3TWR A;  3DEO A;  3V79 K;  3NOC D;  3T8K A;  2Y1L E;  5CBN A;  2B0O E;  1YCS B;  3EU9 A;  3JXI A;  4CZ2 D;  5CER B;  1YYH A;  4QQI A;  1DC2 A;  3EHQ A;  5ENS D;  5HKP A;  2KXP C;  5ENT D;  1MX2 A;  1K3Z D;  5CBO A;  4N5Q A;  3ZNG A;  2FO1 E;  4RLY A;  2F37 A;  2VGE A;  4BSZ B;  1N11 A;  4HRL A;  5AN8 A;  1K1A A;  1QYM A;  3AJI A;  5CEC B;  3DEP A;  4G8K A;  1IHB A;  5KNH D;  4B93 B;  4DX6 D;  3UTM A;  1MYO A;  3JXJ A;  2L6B A;  3F6Q A;  4HI8 A;  2BKK B;  2ETA A;  4U8V D;  4YDY A;  5ENP D;  3ZU7 B;  1OY3 D;  2ETC A;  2XZT G;  1UOH A;  3UI2 A;  4O1O A;  3V2X A;  5ENO D;  4K5C A;  1S70 B;  3TWT A;  5AAO A;  3Q9U C;  3IXE A;  4K5B A;  5HRY A;  3TWU A;  1A5E A;  2DWZ A;  4O1P A;  4Z68 A;  4C48 B;  4GPM A;  5ITZ F;  2NYJ A;  1MX4 A;  2V5Q C;  5AQ7 A;  1N0R A;  3TWV A;  5FIN A;  2ETB A;  3NBN B;  3TWS A;  2ZGG A;  1IXV A;  5EIL A;  4JB8 P;  1WDY A;  3SO8 A;  5JA4 D;  4LSZ E;  1IKN D;  3T9K A;  3C5R A;  3NOG D;  5BXO A;  2J8S D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...