2A5EA

Solution nmr structure of tumor suppressor p16ink4a, restrained minimized mean structure
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
156
structure length
156
Chain Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR SUPPRESSOR P16INK4A
publication title Tumor suppressor p16INK4A: determination of solution structure and analyses of its interaction with cyclin-dependent kinase 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Anti-oncogene
total genus 25
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2a5eA00
1A5EA 2RFAA 2PNNA 4HNAD 1OY3D 3NOGD 1YMPA 5EIBE 4F1PA 3TWUA 3W9FA 5AARA 1BI8B 3W9GA 4DX2A 3B95A 2DVWA 5EILA 1N0QA 4UUCA 1AWCB 4OAVB 4HI8A 2DZOA 3HG0D 4ZHBA 1TR4A 4BERA 4U8VD 4Z68A 2B0OE 3TWXA 4ATZD 1YYHA 3IXEA 4HRLA 1YCSB 1K1BA 1MX4A 5EN5D 3TWWA 2F37A 3V30A 5BXOA 5ENQD 2J8SD 5ENSD 2P2CP 1MX6A 4HRMB 5AQBA 4C48B 1S70B 5CEDB 2F8XK 3KEAA 2FO1E 5HKPA 1K1AA 1SW6A 3T9KA 4BSZB 4GPMA 4U96D 5AQ7A 2DWZA 2ZGDA 2V4HC 5CECB 4O60A 5CEAA 2A5EA 5CERB 1K3ZD 4QQIA 3B7BA 4HLLA 5FINA 4HQDA 3EHQA 3NBNB 1WDYA 1SVXA 3J5QB 4J7WA 1AP7A 4B93B 5AAOA 2QYJA 1NFIE 3AJIA 5AQ9A 1N0RA 4U95D 3DEOA 3TWTA 5CBNA 4O1PA 2XZTG 4BESA 3LJNA 4LSZE 3UTMA 2XENA 1UOHA 2Y1LE 3SO8A 3ZUVB 1QYMA 4K5AB 3Q9NC 2NYJA 5ITZF 5ENTD 4TUMA 1IXVA 3EU9A 3V79K 3TWSA 4K5BA 4HRNA 4YDWA 5ENPD 4JB8P 2XEHA 4BETA 1D9SA 2KXPC 4DX6D 4OAUC 1MYOA 4J8YA 4ZFHA 2RFMA 3J5PA 2BKGA 2KBXA 5D66A 5HS0A 2AJAA 3TWVA 2F8YA 5KNHD 1DCQA 4CZ2D 2L6BA 4NIKA 5ENOD 5KWDA 1OT8A 3AAAC 4A63B 4GMRA 5CBOA 4YDYA 5KBAA 2XZDG 3D9HA 5FIOA 4DRXE 3Q9UC 4G8LA 3EHRA 3ZU7B 4BEPA 5EIDA 4G8KA 1DC2A 1BD8A 3JUEA 4QFVA 2ETAA 4K5CA 3JXJA 4HB5A 2HE0A 3HRAA 5JMND 4U8YD 3DEPA 5KNGA 3JXIA 4N5QA 3C5RA 5AQAA 3V2OA 2ETBA 1IHBA 4RLYA 4DX5D 4LNUD 4HBDA 3ZNGA 2QC9A 1MX2A 2JABA 5ENRD 3TWQA 5HRYA 5JA4D 3TWRA 2DZNA 3UXGA 2V5QC 4CYMD 5BXUA 1BI7B 4DX1A 5AN8A 5EYPF 3V2XA 4DUIA 3T8KA 1MJ0A 1N11A 1BU9A 1WG0A 1G3NB 3UI2A 3ZKJA 1IKND 1BLXB 2BKKB 4HI9A 3V31A 2Y0BG 4O1OA 2VGEA 2XEEA 2ETCA 3F6QA 2MYOA 4DX7D 3NOCD 5EYLA 4LG6A 2ZGGA 4F6RD
chains in the Genus database with same CATH superfamily
1LD8A 3FUFA 3SGHA 4ANVA 4DLOA 4JHRA 4BSXA 3DSUA 4GZDA 2WXPA 2BF0X 4GMLA 2FF4A 1XGWA 1YA0A 5T8IA 4G25A 4CT0A 4GMJA 3UT8A 4YNDA 4A1GA 1K1AA 5CECB 1PC2A 4WNGA 4EECA 2BEDA 5FQ7A 4LNBA 3UKUG 3C3OA 5AQ9A 3D9OA 2WXNA 3CHOA 2LSVA 3BG0B 4IYPA 3U66A 1E8WA 1FT1A 1KZOA 3DXMG 1TN6A 3FUIA 2BKGA 3S7FA 3PVLA 4NIKA 2XEVA 1V55E 3MZLB 3LXUX 5ARFA 4H7YA 3FDHA 1HFAA 1TJFA 3G2UA 4BEPA 3FEYA 2ETAA 2I1JA 5JMND 3RSEG 1Z3YA 1TNYA 4LNUD 4JEHA 4GTRA 4CT4A 4XI0A 2MRIA 4WUYA 1OCOE 3D9IA 2QYUA 2WXIA 1G3NB 2BKKB 2GRQB 2XEEA 3DSTA 1QBQA 1QZ2A 4I9EA 4FLHA 3CSTA 3ONLA 1WY6A 2H6HA 4DX2A 2IONA 4CDRA 2GRPB 2EILE 4BERA 3TWXA 4GA0A 5G05J 4U0SA 3PNTB 1JCQA 1E7VA 4GYWA 5ANLA 2QY7A 1UG3A 3G2WA 1U2VG 3EIJA 2WXHA 4HQDA 3FH8A 4KZ0A 2PM6A 4AP2A 3MGBA 3TWTA 4AY6A 1B89A 3ZUVB 2XRYA 1OWNA 4MKTA 4U0ZA 3QC1A 4J8SA 4KVMA 3EU9A 3PZ2A 3C72A 4APOA 5BPPA 4OAUC 2KBXA 4J0UA 3CSFA 5CMWA 1EDUA 1H6PA 2A5UA 4B0ZA 3FTXA 5G04C 2VSXE 3B7SA 3ZU7B 4PH4B 3ULQA 3ZXSA 3Q15A 2ETBA 2Y4UA 3LKUA 2FBNA 1FT2A 5AN8A 2F0YA 3UT7A 2XRZA 5JJ6A 3B7TA 4NRHB 3RU0A 1IKND 3PZDA 4J8EA 2WB2A 4B94A 2WQHA 3I5PA 4AM9A 1BI8B 3NF1A 3W9GA 4RSYA 3T5VA 1JPLA 3DPDA 4HLEA 1FVHA 3Q73A 1NZNA 4TXQA 4C48B 5AQBA 3BG1B 2KZTA 5B1BE 2ZGDA 4JXTA 5LCWJ 5AJLA 4J7WA 3QWWA 2J4BA 4O1PA 4MLPA 4AOFA 3UINC 1KT0A 4L2LA 4GZ6A 2XCCA 3FY4A 3KD7A 4I6EA 4JB8P 2KXPC 1SZAA 2RFMA 3VTYA 3MV2B 4M7CA 3MYVA 2P9LG 4I43A 4QFVA 3AS8A 3CVXA 4U07A 2Y69E 3APFA 1E8XA 4PS8A 4C9BB 4RLYA 4G11A 3G2VA 4MS6A 2WXFA 2ILRA 3V2XA 3CK9A 4A55A 4U7EB 2EQXA 4N3AA 2DBAA 1OWOA 2VGEA 2H6IA 5BV1A 4ANXA 4PUCA 2HYZA 4KMOA 4HNAD 1TYQG 2X6KA 2PZIA 2XS1A 2DZOA 4F7AA 3D3MA 1N4SA 1K1BA 3RRMB 5A7DB 2FI7A 3UM0A 4UWLA 2F37A 3RK6A 3HHMA 1MX6A 2J07A 4GPMA 4MBGA 1HX8A 3ESLA 5KJNA 1SZ9A 3B7BA 4E85A 2GROB 5DBKA 3EHQA 2PL2A 3TG5A 2XCBA 2CG2A 5EDSA 2YHEA 4YVQC 4BTAA 2OVBA 3V79K 1D9SA 3U9WA 2Y4TA 3J5PA 3ZYMA 5FQ6A 5KNHD 1INZA 3AAAC 4U0UA 3Q49B 3CVQA 3Q9UC 3MKQB 4G8KA 2AWIA 4K03A 1SA4A 3E32A 3FWVA 2L0IA 4F53A 3DRAA 3UUXA 4OYSA 4IULA 3MV3B 4GYYA 3U3WA 4XZ4A 4DUIA 2HO1A 4WNFA 4F1SA 3AG4E 4GAAA 4BT8A 1KLXA 3EJNA 3VLDA 2EINE 5BV0A 1A5EA 2PNNA 4KT6B 1OY3D 4AEZC 1XNFA 3APCA 2WQ6A 2AXZA 1AWCB 3Q5MA 3R7QA 1OWLA 3DSVA 4N3BA 1TNBA 2XQ0A 3CLJA 1MX4A 4XKBA 3KEAA 2FO1E 1S64A 3ZYQA 2YNQA 1ZBPA 5CHEE 3AS4A 4BTBA 3SNXA 4LEUA 2J09A 4HFGA 4XIFA 2I2OA 4LCTA 4F3VA 2VJ8A 2UY1A 2CHZA 3DSWA 3G2SA 3RO3A 4YVOA 4M3OA 4Q96A 5E76A 2XEHA 5BNWA 4DX6D 3LVQE 3NZSA 2VQ2A 2WM9A 4X8QA 3PS6A 3R9MA 1O1TA 3I4RB 3HXFA 4CGVA 2C2LA 5KBAA 2H6FA 3ZN3A 4BY6A 4MRUA 4GZCA 5LOZA 5J08A 4DX5D 1SQMA 3ZNGA 5D0QD 1Z3XA 3JQ1A 4JL0A 3RRUA 4WNEA 4FHKA 4BT9A 2YQ8A 3ZKJA 1SA5A 3UPVA 4F6RD 3JUIA 2PQRA 2X6FA 3W9FA 4I9CA 3ZHEB 5A23A 3AS5A 2JLBA 1N0QA 5EILA 3AG2E 4BFRA 2GRNB 1JCSA 3L17A 1ZB1A 1X5BA 3QKYA 3P2BA 3CHQA 4UI9C 1W3BA 4ACKA 4AXHA 2J4DA 4NURA 2V8SE 3PREA 2WXJA 1SW6A 5FZRA 3IKOB 4O60A 2CG3A 1K3ZD 4QQIA 4BWRA 5BT1A 3NB2A 4EZKA 2XPZA 1MZCA 1H19A 1TNOA 1UOHA 2ONDA 2Y1LE 3ASFA 5CRVA 4GTQA 4HOTA 2YHCA 4HRNA 2WXRA 2XGSA 4HOQA 1X81A 4C0EA 3AG1E 4I17A 2VGXB 2XZDG 3CK8A 3EHRA 3L9TA 3ZW3A 3NAWA 4HB5A 4G2VA 1N94A 4XKCA 3PNLB 4H7XA 2XS8A 3ABME 4E6HA 1O1RA 2VSNA 5KJKA 3CKCA 5EX0A 1MQSA 1NL4A 4ATZD 4B8CB 4JHKA 1FPPA 2AXUA 3FEXA 1EYHA 4GZ3A 5FJYA 3B95A 3ZFWA 3PDNA 3HVEA 3NQPA 1BPOA 3PE3A 3S7JA 3FU6A 3OXFA 1TNUA 3FUHA 5ENSD 4R7LA 3URZA 3G2TA 4NQ0A 4GU5A 2I9CA 3C3QA 4CGWA 1UN8A 3SBSA 3SHFA 4AV7A 1H2TC 1OCZE 4JD2G 3DXKG 4XI9A 1HG2A 1N0RA 3HYMB 4RG6A 4OVUA 3T5XA 2CFUA 3SO8A 2XPYA 3R9AB 3SFYA 2F8YA 5ENOD 4L2YA 4ATGA 3QOUA 3ULEG 1HS6A 4DI4A 3ML9A 3ZEFA 3TG4A 1HO8A 5IY5E 3JXJA 2IO3C 2XGOA 3O4ZA 3IBEA 3L13A 3PE4A 3RO2A 4BX8A 3O48A 1OCCE 4PDXA 5EYPF 2NXPA 1N4RA 3HVEB 3Q7FA 3CVUA 3QK0A 2RG8A 4DPRA 3F6QA 5G2NA 2FO7A 1Y8MA 4JVSA 2RFAA 3D9JA 3Q78A 3LY7A 3RAUA 2DVWA 3ENEA 3CVLA 3ZXPA 4KVOA 2A4ZA 3SF4A 4HS2A 4RVBA 1TEZA 2OEVA 4IRUA 1JCRA 2P9IG 4UWGA 1E8YA 1H2UA 1LD7A 3DPYA 2P2CP 3MKRA 1JUQA 4BSZB 3FH7A 5CEAA 3P1UA 5FINA 2LSUA 1NP7A 1SVXA 3SD5A 3VTXA 4U95D 5CBNA 3EHMA 4LSZE 2CHWA 2J49A 2AW6A 2UWJG 5ENPD 4JA7A 4XX5A 5LX8A 4YDOA 1EPUA 4JW1A 5A6CA 2R03A 1OT8A 4URKA 5CBOA 3MA5A 3D9HA 4DRXE 1RW2A 3S7DA 3ASDA 4FULA 5EIDA 3HXDA 2C0MA 4JZYA 3E4BA 1IYGA 1VDYA 4I1OB 4U04A 2WPVA 1UJKA 4HBDA 1Q2ZA 4KYOB 2P9NG 1NA0A 5G05C 4DX1A 4APFA 2H6GA 4ILGA 1IQRA 1HH8A 1NI1A 4TUUA 5EYLA 2ZGGA 4ANWA 4XE0A 1U3DA 3ZIMA 2V0PA 2P9UG 2R02A 2IOLA 3PUKA 3Q47B 2DYRE 1TN7A 4ZHBA 3LS8A 3PH0C 4U8VD 4UWFA 3PUJA 2P9SG 3MJWA 2KM4A 3JCKC 3V30A 3PZ1A 4ACLA 1ELRA 3L6AA 5CERB 1OWMA 2KCVA 1KT1A 3OXLA 1H6OA 2KZTB 3FTWA 1N54A 4JPSA 2MHKA 1Z5SC 2AXVA 3TGOA 3WG7E 2KC7A 3TWSA 5CCMA 4LUNU 3FUDA 4ZFHA 4J8YA 3CHRA 4B89A 4DLQA 1TNZA 3ASNE 3GYZA 4GMRA 2RD0A 3CVNA 2ZIRA 1DC2A 1A17A 3C3RA 2GRLA 4K5CA 3EDTB 2ZISA 1HF8A 1IQUA 3OAWA 3LJ3A 5KJMA 1E90A 2DZNA 4CYMD 2ZXWE 4W9RA 3V31A 2ETCA 4GPKA 3NOCD 3RRNB 1RZ4A 3IHVA 1S0PA 3FULA 5LCWC 3TWUA 4AIFA 4TRQA 3U4TA 4UUCA 2BTDA 3HG0D 5FT9A 3CKBA 3S7BA 1D8EA 1HE8A 2X3MA 3Q7AA 4HRLA 4HORA 4A1SA 4ABNA 4Q94A 5ENQD 3FUNA 3ASHA 1HXIA 5HKPA 2XPIA 4EPZA 4FHJA 1DCEA 3HIZA 3EIQC 3E37A 3J5QB 1OCRE 3ZGQA 3DEOA 2GW1A 1KZPA 3B7RL 1QYMA 1FVFA 2VSOE 3CVWA 1IXVA 4AJWA 5FQ4A 2NC9A 1DCQA 4CZ2D 3EU5A 1N52A 1ZU2A 4JEUA 5E75A 3DSXA 5FIOA 4G8LA 4HOSA 3PRZA 2EIME 3FTZA 3L54A 4I6JA 2OV8A 2VGYA 2MOWA 1D8DA 3QAQA 2CFZA 3R7RA 3TWRA 3GZSA 2V5QC 4GCOA 1BI7B 3T8KA 2EIKE 4AVXA 3OTNA 2Q7FA 3ZVVA 4EHMA 5AIJA 2R59A 5EIBE 1K8KG 1OXJA 4ANUA 5FQ8A 1TR4A 2IFUA 3BQOA 3UM3A 3IXEA 4CRWA 4I6GA 2WXGA 5M72A 4WWOA 5CEDB 2IY0C 4CDNA 3FTSA 2DYSE 3K9IA 3FUKA 4EZJA 2QYJA 3AJIA 3FUEA 2LXLA 3CEQA 4BESA 3QARA 4N2SA 2XENA 3UIOC 1JWGA 5KJLA 3ESKA 4TUMA 2OCCE 1UJJA 2UY1B 3LY8A 3ABLE 5HS0A 1P5QA 2IO2C 5BW8C 4A63B 3UM2A 2GGFA 3UIPC 3ISMC 1WAO1 4Y6CA 3I4GA 3SI5A 3HXEA 2CHXA 4JC8A 5DIZA 4XEIG 3EUVA 3E30A 3N71A 4PS3A 4N5QA 2HM8A 1IHBA 3ONKA 2JABA 5EX3A 5C2YA 2ZU6B 3UXGA 2VTBA 3KSQA 5G04J 2WXQA 3PEUB 2AVPA 2JEKA 2MYOA 3UT4A 3QNKA 3NOGD 3SQVA 3LCAA 2OEWA 2LXMA 2LAIA 5HI7A 3ZRHA 2DIWA 3SZ7A 3QJZA 5JJ7A 3FHEA 4Z68A 3E33A 3UKRG 2WMOA 3JYSA 4WAFA 1DVPA 4G24A 4GZ5A 3D9NA 3I3NA 1YCSB 1PY1A 4Q69A 3LDZA 3LY9A 3CVYA 4L1BA 4D10C 5JHBA 1HZ4A 2IJGX 1H2VC 4DK5A 1PAQA 2PQNA 1AP7A 1V54E 1NFIE 3CR3A 4FP7A 4NACA 3LJNA 2KCKA 5ITZF 5ENTD 2YINA 2IEJA 2AJAA 3MEKA 4J8DA 4V3IA 4N3CA 4WNDA 3E34A 4YDEA 1OWPA 2VTBB 3LVRE 3QWPA 4HXIA 2WXOA 2V4LA 4CDMA 4CCAA 3PEVB 4KXKB 3KAEA 4I1MA 3TWQA 1MX2A 1ELWA 4FC8A 1O5MA 5JA4D 5ARGA 3CHSA 3FU5A 1N11A 2GRRB 1BLXB 4ILIA 4WWNA 5D2MC 2L0TB 4G1TA 4CEMA 1Z6TA 4PS7A 4GA1A 3Q4AB 5CCLA 5T4YA 1N4QA 4L23A 1O1SA 3BEEA 4OAVB 4LNGA 4U63A 4TXRA 3SBTB 2B6CA 1IHGA 2OOEA 1E7UA 2J8SD 5BUZA 4C0MA 1S63A 3ZYLA 3KSLA 3MCXA 4GYOA 4TV3A 4HLLA 2XGMA 3NBNB 1GW6A 5CRUA 4KBQA 4K0RA 3TJPA 3ABKE 3GZ1A 3FTUA 1TJCA 3L16A 4LERA 3D9MA 4JHJA 4P29A 3ASGA 3AU4A 4YDWA 3EHNA 1WM5A 3DSSA 3GZ2A 3CGHA 4N5CA 1LF8A 4UWHA 4HOUA 2L6BA 2WQ7A 2R5SA 4U8HA 3FTYA 5J90A 3CHMA 1E8ZA 5LFAA 2L9BA 3RIBA 3RKVA 4B8AA 3C98A 5KNGA 4KZCA 2QC9A 5ENRD 1FCHA 4EQFA 2FULA 4EBAG 4GA2A 5ENNA 2KCLA 2Y3AA 3CK7A 3BUAA 4HVBA 4EZLA 4AY5A 1L5JA 1WG0A 2QFCA 4IN3B 3UI2A 4L7TA 4L9PA 3CHPA 4O1OA 5FWQA 3Q79A 4LG6A 2WXMA 4FADA 5JJTA 1YMPA 4N39A 4HI8A 3L22A 3LYAA 2FEZA 1N4PA 5B3SE 1H6KA 3FU0A 3CQCB 2P9PG 2F8XK 3VLEA 3X2QE 4FJZA 3MX3A 3T9KA 3IEGA 5B1AE 5AQ7A 2BUGA 3ZYKA 3PZ4A 2A5EA 1H0AA 4FLBA 3NZUA 1WDYA 2L6JA 4B93B 3DBSA 3VLFA 5C1DA 2LAHA 5LP0A 3HXCA 5H7PA 3FUMA 4K5AB 2NYJA 4UQXA 4TXPA 3CVPA 5CMYA 3UQ3A 3FP3A 3APDA 4WWPA 5FZQA 5G55A 3ULYA 3MKQA 5KWDA 4GB9A 2R2LA 5FTPA 2DCPA 3OXGA 4O6FA 4DJAA 3TAXA 1BD8A 4G23A 4I2WA 4GTSA 4UWKA 1HG5A 4FA6A 2GRMA 2V5FA 4EBAA 1NA3A 3V2OA 2WXLA 4A3VA 1Y6IA 5ANRA 5HRYA 3ASOE 2KATA 3T8MA 5BXUA 1QQEA 2PM7A 4DX7D 3CV0A 2QZAA 3LEWA 4GCNA 1N9AA 4GTMA 4FU3A 3SFZA 4ILHB 2HR2A 2J9QA 4DI3A 2OVFA 1HU3A 2B0OE 2I6HA 1KPSB 4JA9A 3Q75A 3KS2A 4UI9K 1TN8A 3SY2A 2V4HC 3UX4A 3RJVA 3UMVA 3JQ0A 2J08A 3LPZA 3HXBA 5EKQD 5AAOA 3CVVA 4FJYA 2X6JA 2XZTG 3UTMA 4LRZA 5KCMA 4GTOA 4UI9J 3Q9NC 3D9KA 3D9PA 2X6HA 3ML8A 4A3TA 1ELKA 3GW4A 3B13A 5D66A 2RKKA 4RG9A 3TWVA 1JWFA 4YDYA 3HDXA 5AJDA 3TXMA 3JUEA 4GTVA 2E2EA 1DNPA 1OUVA 3HRAA 3IV0A 4U8YD 3DEPA 5FZSA 4N2QA 2E0IA 4UQYA 2NSZA 2XHEA 1MJ0A 1BU9A 3D9LA 3BU8A 2LNIA 1N95A 1MHQA 3ZHEA 2P9KG 2R17C 1U3CA 3UM1A 3FTVA 4F1PA 3QB2A 5AARA 4G26A 5HQ8A 3CIAA 3QWVA 2M63A 5AENA 3AU5A 1YYHA 2R05A 4J6IA 3TL5A 4RQIA 5EN5D 3TWWA 5BXOA 3FUJA 4HRMB 1S70B 2X38A 1QNFA 2LUHA 3L82A 4U96D 3AG3E 2DWZA 3L08A 2IF4A 3CQGB 3IHYA 4I1AA 2IQCA 3DWLG 3SFXA 2IU1A 3ZPJA 5T3RA 1LTXA 2WMNA 3B7UX 4ME2A 2LO6A 4K5BA 3FFLA 4BETA 1MYOA 5D0OD 3WXXA 2EIJE 4J8FA 2VGXA 2IOSA 2X6IA 2I1KA 3QDNA 4I2ZA 3TXNA 2C0LA 1EF1C 2VSYA 4BX9A 3S2AA 4UQZA 2HE0A 2WXKA 1UN9A 4GTPA 3JXIA 5AQAA 3C5RA 2WVIA 4OVVA 1UW4B 3U64A 2P58C 1E96B 5AYWD 4GTTA 3KEZA 3FH5A 3PZ3A 4HI9A 2Y0BG 3FU3A 4Y6WA 2VYIA 5JHAA
chains in the Genus database with same CATH topology
1A5EA 2RFAA 2PNNA 4HNAD 1OY3D 3NOGD 1YMPA 5EIBE 4F1PA 3TWUA 3W9FA 5AARA 1BI8B 3W9GA 4DX2A 3B95A 2DVWA 5EILA 1N0QA 4UUCA 1AWCB 4OAVB 4HI8A 2DZOA 3HG0D 4ZHBA 1TR4A 4BERA 4U8VD 4Z68A 2B0OE 3TWXA 4ATZD 1YYHA 3IXEA 4HRLA 1YCSB 1K1BA 1MX4A 5EN5D 3TWWA 2F37A 3V30A 5BXOA 5ENQD 2J8SD 5ENSD 2P2CP 1MX6A 4HRMB 5AQBA 4C48B 1S70B 5CEDB 2F8XK 3KEAA 2FO1E 5HKPA 1K1AA 1SW6A 3T9KA 4BSZB 4GPMA 4U96D 5AQ7A 2DWZA 2ZGDA 2V4HC 5CECB 4O60A 5CEAA 2A5EA 5CERB 1K3ZD 4QQIA 3B7BA 4HLLA 5FINA 4HQDA 3EHQA 3NBNB 1WDYA 1SVXA 3J5QB 4J7WA 1AP7A 4B93B 5AAOA 2QYJA 1NFIE 3AJIA 5AQ9A 1N0RA 4U95D 3DEOA 3TWTA 5CBNA 4O1PA 2XZTG 4BESA 3LJNA 4LSZE 3UTMA 2XENA 1UOHA 2Y1LE 3SO8A 3ZUVB 1QYMA 4K5AB 3Q9NC 2NYJA 5ITZF 5ENTD 4TUMA 1IXVA 3EU9A 3V79K 3TWSA 4K5BA 4HRNA 4YDWA 5ENPD 4JB8P 2XEHA 4BETA 1D9SA 2KXPC 4DX6D 4OAUC 1MYOA 4J8YA 4ZFHA 2RFMA 3J5PA 2BKGA 2KBXA 5D66A 5HS0A 2AJAA 3TWVA 2F8YA 5KNHD 1DCQA 4CZ2D 2L6BA 4NIKA 5ENOD 5KWDA 1OT8A 3AAAC 4A63B 4GMRA 5CBOA 4YDYA 5KBAA 2XZDG 3D9HA 5FIOA 4DRXE 3Q9UC 4G8LA 3EHRA 3ZU7B 4BEPA 5EIDA 4G8KA 1DC2A 1BD8A 3JUEA 4QFVA 2ETAA 4K5CA 3JXJA 4HB5A 2HE0A 3HRAA 5JMND 4U8YD 3DEPA 5KNGA 3JXIA 4N5QA 3C5RA 5AQAA 3V2OA 2ETBA 1IHBA 4RLYA 4DX5D 4LNUD 4HBDA 3ZNGA 2QC9A 1MX2A 2JABA 5ENRD 3TWQA 5HRYA 5JA4D 3TWRA 2DZNA 3UXGA 2V5QC 4CYMD 5BXUA 1BI7B 4DX1A 5AN8A 5EYPF 3V2XA 4DUIA 3T8KA 1MJ0A 1N11A 1BU9A 1WG0A 1G3NB 3UI2A 3ZKJA 1IKND 1BLXB 2BKKB 4HI9A 3V31A 2Y0BG 4O1OA 2VGEA 2XEEA 2ETCA 3F6QA 2MYOA 4DX7D 3NOCD 5EYLA 4LG6A 2ZGGA 4F6RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5E A;  2RFA A;  2PNN A;  4HNA D;  1OY3 D;  3NOG D;  1YMP A;  5EIB E;  4F1P A;  3TWU A;  3W9F A;  5AAR A;  1BI8 B;  3W9G A;  4DX2 A;  3B95 A;  2DVW A;  5EIL A;  1N0Q A;  4UUC A;  1AWC B;  4OAV B;  4HI8 A;  2DZO A;  3HG0 D;  4ZHB A;  1TR4 A;  4BER A;  4U8V D;  4Z68 A;  2B0O E;  3TWX A;  4ATZ D;  1YYH A;  3IXE A;  4HRL A;  1YCS B;  1K1B A;  1MX4 A;  5EN5 D;  3TWW A;  2F37 A;  3V30 A;  5BXO A;  5ENQ D;  2J8S D;  5ENS D;  2P2C P;  1MX6 A;  4HRM B;  5AQB A;  4C48 B;  1S70 B;  5CED B;  2F8X K;  3KEA A;  2FO1 E;  5HKP A;  1K1A A;  1SW6 A;  3T9K A;  4BSZ B;  4GPM A;  4U96 D;  5AQ7 A;  2DWZ A;  2ZGD A;  2V4H C;  5CEC B;  4O60 A;  5CEA A;  2A5E A;  5CER B;  1K3Z D;  4QQI A;  3B7B A;  4HLL A;  5FIN A;  4HQD A;  3EHQ A;  3NBN B;  1WDY A;  1SVX A;  3J5Q B;  4J7W A;  1AP7 A;  4B93 B;  5AAO A;  2QYJ A;  1NFI E;  3AJI A;  5AQ9 A;  1N0R A;  4U95 D;  3DEO A;  3TWT A;  5CBN A;  4O1P A;  2XZT G;  4BES A;  3LJN A;  4LSZ E;  3UTM A;  2XEN A;  1UOH A;  2Y1L E;  3SO8 A;  3ZUV B;  1QYM A;  4K5A B;  3Q9N C;  2NYJ A;  5ITZ F;  5ENT D;  4TUM A;  1IXV A;  3EU9 A;  3V79 K;  3TWS A;  4K5B A;  4HRN A;  4YDW A;  5ENP D;  4JB8 P;  2XEH A;  4BET A;  1D9S A;  2KXP C;  4DX6 D;  4OAU C;  1MYO A;  4J8Y A;  4ZFH A;  2RFM A;  3J5P A;  2BKG A;  2KBX A;  5D66 A;  5HS0 A;  2AJA A;  3TWV A;  2F8Y A;  5KNH D;  1DCQ A;  4CZ2 D;  2L6B A;  4NIK A;  5ENO D;  5KWD A;  1OT8 A;  3AAA C;  4A63 B;  4GMR A;  5CBO A;  4YDY A;  5KBA A;  2XZD G;  3D9H A;  5FIO A;  4DRX E;  3Q9U C;  4G8L A;  3EHR A;  3ZU7 B;  4BEP A;  5EID A;  4G8K A;  1DC2 A;  1BD8 A;  3JUE A;  4QFV A;  2ETA A;  4K5C A;  3JXJ A;  4HB5 A;  2HE0 A;  3HRA A;  5JMN D;  4U8Y D;  3DEP A;  5KNG A;  3JXI A;  4N5Q A;  3C5R A;  5AQA A;  3V2O A;  2ETB A;  1IHB A;  4RLY A;  4DX5 D;  4LNU D;  4HBD A;  3ZNG A;  2QC9 A;  1MX2 A;  2JAB A;  5ENR D;  3TWQ A;  5HRY A;  5JA4 D;  3TWR A;  2DZN A;  3UXG A;  2V5Q C;  4CYM D;  5BXU A;  1BI7 B;  4DX1 A;  5AN8 A;  5EYP F;  3V2X A;  4DUI A;  3T8K A;  1MJ0 A;  1N11 A;  1BU9 A;  1WG0 A;  1G3N B;  3UI2 A;  3ZKJ A;  1IKN D;  1BLX B;  2BKK B;  4HI9 A;  3V31 A;  2Y0B G;  4O1O A;  2VGE A;  2XEE A;  2ETC A;  3F6Q A;  2MYO A;  4DX7 D;  3NOC D;  5EYL A;  4LG6 A;  2ZGG A;  4F6R D; 
#chains in the Genus database with same CATH topology
 1LD8 A;  3FUF A;  3SGH A;  4ANV A;  4DLO A;  4JHR A;  4BSX A;  3DSU A;  4GZD A;  2WXP A;  2BF0 X;  4GML A;  2FF4 A;  1XGW A;  1YA0 A;  5T8I A;  4G25 A;  4CT0 A;  4GMJ A;  3UT8 A;  4YND A;  4A1G A;  1K1A A;  5CEC B;  1PC2 A;  4WNG A;  4EEC A;  2BED A;  5FQ7 A;  4LNB A;  3UKU G;  3C3O A;  5AQ9 A;  3D9O A;  2WXN A;  3CHO A;  2LSV A;  3BG0 B;  4IYP A;  3U66 A;  1E8W A;  1FT1 A;  1KZO A;  3DXM G;  1TN6 A;  3FUI A;  2BKG A;  3S7F A;  3PVL A;  4NIK A;  2XEV A;  1V55 E;  3MZL B;  3LXU X;  5ARF A;  4H7Y A;  3FDH A;  1HFA A;  1TJF A;  3G2U A;  4BEP A;  3FEY A;  2ETA A;  2I1J A;  5JMN D;  3RSE G;  1Z3Y A;  1TNY A;  4LNU D;  4JEH A;  4GTR A;  4CT4 A;  4XI0 A;  2MRI A;  4WUY A;  1OCO E;  3D9I A;  2QYU A;  2WXI A;  1G3N B;  2BKK B;  2GRQ B;  2XEE A;  3DST A;  1QBQ A;  1QZ2 A;  4I9E A;  4FLH A;  3CST A;  3ONL A;  1WY6 A;  2H6H A;  4DX2 A;  2ION A;  4CDR A;  2GRP B;  2EIL E;  4BER A;  3TWX A;  4GA0 A;  5G05 J;  4U0S A;  3PNT B;  1JCQ A;  1E7V A;  4GYW A;  5ANL A;  2QY7 A;  1UG3 A;  3G2W A;  1U2V G;  3EIJ A;  2WXH A;  4HQD A;  3FH8 A;  4KZ0 A;  2PM6 A;  4AP2 A;  3MGB A;  3TWT A;  4AY6 A;  1B89 A;  3ZUV B;  2XRY A;  1OWN A;  4MKT A;  4U0Z A;  3QC1 A;  4J8S A;  4KVM A;  3EU9 A;  3PZ2 A;  3C72 A;  4APO A;  5BPP A;  4OAU C;  2KBX A;  4J0U A;  3CSF A;  5CMW A;  1EDU A;  1H6P A;  2A5U A;  4B0Z A;  3FTX A;  5G04 C;  2VSX E;  3B7S A;  3ZU7 B;  4PH4 B;  3ULQ A;  3ZXS A;  3Q15 A;  2ETB A;  2Y4U A;  3LKU A;  2FBN A;  1FT2 A;  5AN8 A;  2F0Y A;  3UT7 A;  2XRZ A;  5JJ6 A;  3B7T A;  4NRH B;  3RU0 A;  1IKN D;  3PZD A;  4J8E A;  2WB2 A;  4B94 A;  2WQH A;  3I5P A;  4AM9 A;  1BI8 B;  3NF1 A;  3W9G A;  4RSY A;  3T5V A;  1JPL A;  3DPD A;  4HLE A;  1FVH A;  3Q73 A;  1NZN A;  4TXQ A;  4C48 B;  5AQB A;  3BG1 B;  2KZT A;  5B1B E;  2ZGD A;  4JXT A;  5LCW J;  5AJL A;  4J7W A;  3QWW A;  2J4B A;  4O1P A;  4MLP A;  4AOF A;  3UIN C;  1KT0 A;  4L2L A;  4GZ6 A;  2XCC A;  3FY4 A;  3KD7 A;  4I6E A;  4JB8 P;  2KXP C;  1SZA A;  2RFM A;  3VTY A;  3MV2 B;  4M7C A;  3MYV A;  2P9L G;  4I43 A;  4QFV A;  3AS8 A;  3CVX A;  4U07 A;  2Y69 E;  3APF A;  1E8X A;  4PS8 A;  4C9B B;  4RLY A;  4G11 A;  3G2V A;  4MS6 A;  2WXF A;  2ILR A;  3V2X A;  3CK9 A;  4A55 A;  4U7E B;  2EQX A;  4N3A A;  2DBA A;  1OWO A;  2VGE A;  2H6I A;  5BV1 A;  4ANX A;  4PUC A;  2HYZ A;  4KMO A;  4HNA D;  1TYQ G;  2X6K A;  2PZI A;  2XS1 A;  2DZO A;  4F7A A;  3D3M A;  1N4S A;  1K1B A;  3RRM B;  5A7D B;  2FI7 A;  3UM0 A;  4UWL A;  2F37 A;  3RK6 A;  3HHM A;  1MX6 A;  2J07 A;  4GPM A;  4MBG A;  1HX8 A;  3ESL A;  5KJN A;  1SZ9 A;  3B7B A;  4E85 A;  2GRO B;  5DBK A;  3EHQ A;  2PL2 A;  3TG5 A;  2XCB A;  2CG2 A;  5EDS A;  2YHE A;  4YVQ C;  4BTA A;  2OVB A;  3V79 K;  1D9S A;  3U9W A;  2Y4T A;  3J5P A;  3ZYM A;  5FQ6 A;  5KNH D;  1INZ A;  3AAA C;  4U0U A;  3Q49 B;  3CVQ A;  3Q9U C;  3MKQ B;  4G8K A;  2AWI A;  4K03 A;  1SA4 A;  3E32 A;  3FWV A;  2L0I A;  4F53 A;  3DRA A;  3UUX A;  4OYS A;  4IUL A;  3MV3 B;  4GYY A;  3U3W A;  4XZ4 A;  4DUI A;  2HO1 A;  4WNF A;  4F1S A;  3AG4 E;  4GAA A;  4BT8 A;  1KLX A;  3EJN A;  3VLD A;  2EIN E;  5BV0 A;  1A5E A;  2PNN A;  4KT6 B;  1OY3 D;  4AEZ C;  1XNF A;  3APC A;  2WQ6 A;  2AXZ A;  1AWC B;  3Q5M A;  3R7Q A;  1OWL A;  3DSV A;  4N3B A;  1TNB A;  2XQ0 A;  3CLJ A;  1MX4 A;  4XKB A;  3KEA A;  2FO1 E;  1S64 A;  3ZYQ A;  2YNQ A;  1ZBP A;  5CHE E;  3AS4 A;  4BTB A;  3SNX A;  4LEU A;  2J09 A;  4HFG A;  4XIF A;  2I2O A;  4LCT A;  4F3V A;  2VJ8 A;  2UY1 A;  2CHZ A;  3DSW A;  3G2S A;  3RO3 A;  4YVO A;  4M3O A;  4Q96 A;  5E76 A;  2XEH A;  5BNW A;  4DX6 D;  3LVQ E;  3NZS A;  2VQ2 A;  2WM9 A;  4X8Q A;  3PS6 A;  3R9M A;  1O1T A;  3I4R B;  3HXF A;  4CGV A;  2C2L A;  5KBA A;  2H6F A;  3ZN3 A;  4BY6 A;  4MRU A;  4GZC A;  5LOZ A;  5J08 A;  4DX5 D;  1SQM A;  3ZNG A;  5D0Q D;  1Z3X A;  3JQ1 A;  4JL0 A;  3RRU A;  4WNE A;  4FHK A;  4BT9 A;  2YQ8 A;  3ZKJ A;  1SA5 A;  3UPV A;  4F6R D;  3JUI A;  2PQR A;  2X6F A;  3W9F A;  4I9C A;  3ZHE B;  5A23 A;  3AS5 A;  2JLB A;  1N0Q A;  5EIL A;  3AG2 E;  4BFR A;  2GRN B;  1JCS A;  3L17 A;  1ZB1 A;  1X5B A;  3QKY A;  3P2B A;  3CHQ A;  4UI9 C;  1W3B A;  4ACK A;  4AXH A;  2J4D A;  4NUR A;  2V8S E;  3PRE A;  2WXJ A;  1SW6 A;  5FZR A;  3IKO B;  4O60 A;  2CG3 A;  1K3Z D;  4QQI A;  4BWR A;  5BT1 A;  3NB2 A;  4EZK A;  2XPZ A;  1MZC A;  1H19 A;  1TNO A;  1UOH A;  2OND A;  2Y1L E;  3ASF A;  5CRV A;  4GTQ A;  4HOT A;  2YHC A;  4HRN A;  2WXR A;  2XGS A;  4HOQ A;  1X81 A;  4C0E A;  3AG1 E;  4I17 A;  2VGX B;  2XZD G;  3CK8 A;  3EHR A;  3L9T A;  3ZW3 A;  3NAW A;  4HB5 A;  4G2V A;  1N94 A;  4XKC A;  3PNL B;  4H7X A;  2XS8 A;  3ABM E;  4E6H A;  1O1R A;  2VSN A;  5KJK A;  3CKC A;  5EX0 A;  1MQS A;  1NL4 A;  4ATZ D;  4B8C B;  4JHK A;  1FPP A;  2AXU A;  3FEX A;  1EYH A;  4GZ3 A;  5FJY A;  3B95 A;  3ZFW A;  3PDN A;  3HVE A;  3NQP A;  1BPO A;  3PE3 A;  3S7J A;  3FU6 A;  3OXF A;  1TNU A;  3FUH A;  5ENS D;  4R7L A;  3URZ A;  3G2T A;  4NQ0 A;  4GU5 A;  2I9C A;  3C3Q A;  4CGW A;  1UN8 A;  3SBS A;  3SHF A;  4AV7 A;  1H2T C;  1OCZ E;  4JD2 G;  3DXK G;  4XI9 A;  1HG2 A;  1N0R A;  3HYM B;  4RG6 A;  4OVU A;  3T5X A;  2CFU A;  3SO8 A;  2XPY A;  3R9A B;  3SFY A;  2F8Y A;  5ENO D;  4L2Y A;  4ATG A;  3QOU A;  3ULE G;  1HS6 A;  4DI4 A;  3ML9 A;  3ZEF A;  3TG4 A;  1HO8 A;  5IY5 E;  3JXJ A;  2IO3 C;  2XGO A;  3O4Z A;  3IBE A;  3L13 A;  3PE4 A;  3RO2 A;  4BX8 A;  3O48 A;  1OCC E;  4PDX A;  5EYP F;  2NXP A;  1N4R A;  3HVE B;  3Q7F A;  3CVU A;  3QK0 A;  2RG8 A;  4DPR A;  3F6Q A;  5G2N A;  2FO7 A;  1Y8M A;  4JVS A;  2RFA A;  3D9J A;  3Q78 A;  3LY7 A;  3RAU A;  2DVW A;  3ENE A;  3CVL A;  3ZXP A;  4KVO A;  2A4Z A;  3SF4 A;  4HS2 A;  4RVB A;  1TEZ A;  2OEV A;  4IRU A;  1JCR A;  2P9I G;  4UWG A;  1E8Y A;  1H2U A;  1LD7 A;  3DPY A;  2P2C P;  3MKR A;  1JUQ A;  4BSZ B;  3FH7 A;  5CEA A;  3P1U A;  5FIN A;  2LSU A;  1NP7 A;  1SVX A;  3SD5 A;  3VTX A;  4U95 D;  5CBN A;  3EHM A;  4LSZ E;  2CHW A;  2J49 A;  2AW6 A;  2UWJ G;  5ENP D;  4JA7 A;  4XX5 A;  5LX8 A;  4YDO A;  1EPU A;  4JW1 A;  5A6C A;  2R03 A;  1OT8 A;  4URK A;  5CBO A;  3MA5 A;  3D9H A;  4DRX E;  1RW2 A;  3S7D A;  3ASD A;  4FUL A;  5EID A;  3HXD A;  2C0M A;  4JZY A;  3E4B A;  1IYG A;  1VDY A;  4I1O B;  4U04 A;  2WPV A;  1UJK A;  4HBD A;  1Q2Z A;  4KYO B;  2P9N G;  1NA0 A;  5G05 C;  4DX1 A;  4APF A;  2H6G A;  4ILG A;  1IQR A;  1HH8 A;  1NI1 A;  4TUU A;  5EYL A;  2ZGG A;  4ANW A;  4XE0 A;  1U3D A;  3ZIM A;  2V0P A;  2P9U G;  2R02 A;  2IOL A;  3PUK A;  3Q47 B;  2DYR E;  1TN7 A;  4ZHB A;  3LS8 A;  3PH0 C;  4U8V D;  4UWF A;  3PUJ A;  2P9S G;  3MJW A;  2KM4 A;  3JCK C;  3V30 A;  3PZ1 A;  4ACL A;  1ELR A;  3L6A A;  5CER B;  1OWM A;  2KCV A;  1KT1 A;  3OXL A;  1H6O A;  2KZT B;  3FTW A;  1N54 A;  4JPS A;  2MHK A;  1Z5S C;  2AXV A;  3TGO A;  3WG7 E;  2KC7 A;  3TWS A;  5CCM A;  4LUN U;  3FUD A;  4ZFH A;  4J8Y A;  3CHR A;  4B89 A;  4DLQ A;  1TNZ A;  3ASN E;  3GYZ A;  4GMR A;  2RD0 A;  3CVN A;  2ZIR A;  1DC2 A;  1A17 A;  3C3R A;  2GRL A;  4K5C A;  3EDT B;  2ZIS A;  1HF8 A;  1IQU A;  3OAW A;  3LJ3 A;  5KJM A;  1E90 A;  2DZN A;  4CYM D;  2ZXW E;  4W9R A;  3V31 A;  2ETC A;  4GPK A;  3NOC D;  3RRN B;  1RZ4 A;  3IHV A;  1S0P A;  3FUL A;  5LCW C;  3TWU A;  4AIF A;  4TRQ A;  3U4T A;  4UUC A;  2BTD A;  3HG0 D;  5FT9 A;  3CKB A;  3S7B A;  1D8E A;  1HE8 A;  2X3M A;  3Q7A A;  4HRL A;  4HOR A;  4A1S A;  4ABN A;  4Q94 A;  5ENQ D;  3FUN A;  3ASH A;  1HXI A;  5HKP A;  2XPI A;  4EPZ A;  4FHJ A;  1DCE A;  3HIZ A;  3EIQ C;  3E37 A;  3J5Q B;  1OCR E;  3ZGQ A;  3DEO A;  2GW1 A;  1KZP A;  3B7R L;  1QYM A;  1FVF A;  2VSO E;  3CVW A;  1IXV A;  4AJW A;  5FQ4 A;  2NC9 A;  1DCQ A;  4CZ2 D;  3EU5 A;  1N52 A;  1ZU2 A;  4JEU A;  5E75 A;  3DSX A;  5FIO A;  4G8L A;  4HOS A;  3PRZ A;  2EIM E;  3FTZ A;  3L54 A;  4I6J A;  2OV8 A;  2VGY A;  2MOW A;  1D8D A;  3QAQ A;  2CFZ A;  3R7R A;  3TWR A;  3GZS A;  2V5Q C;  4GCO A;  1BI7 B;  3T8K A;  2EIK E;  4AVX A;  3OTN A;  2Q7F A;  3ZVV A;  4EHM A;  5AIJ A;  2R59 A;  5EIB E;  1K8K G;  1OXJ A;  4ANU A;  5FQ8 A;  1TR4 A;  2IFU A;  3BQO A;  3UM3 A;  3IXE A;  4CRW A;  4I6G A;  2WXG A;  5M72 A;  4WWO A;  5CED B;  2IY0 C;  4CDN A;  3FTS A;  2DYS E;  3K9I A;  3FUK A;  4EZJ A;  2QYJ A;  3AJI A;  3FUE A;  2LXL A;  3CEQ A;  4BES A;  3QAR A;  4N2S A;  2XEN A;  3UIO C;  1JWG A;  5KJL A;  3ESK A;  4TUM A;  2OCC E;  1UJJ A;  2UY1 B;  3LY8 A;  3ABL E;  5HS0 A;  1P5Q A;  2IO2 C;  5BW8 C;  4A63 B;  3UM2 A;  2GGF A;  3UIP C;  3ISM C;  1WAO 1;  4Y6C A;  3I4G A;  3SI5 A;  3HXE A;  2CHX A;  4JC8 A;  5DIZ A;  4XEI G;  3EUV A;  3E30 A;  3N71 A;  4PS3 A;  4N5Q A;  2HM8 A;  1IHB A;  3ONK A;  2JAB A;  5EX3 A;  5C2Y A;  2ZU6 B;  3UXG A;  2VTB A;  3KSQ A;  5G04 J;  2WXQ A;  3PEU B;  2AVP A;  2JEK A;  2MYO A;  3UT4 A;  3QNK A;  3NOG D;  3SQV A;  3LCA A;  2OEW A;  2LXM A;  2LAI A;  5HI7 A;  3ZRH A;  2DIW A;  3SZ7 A;  3QJZ A;  5JJ7 A;  3FHE A;  4Z68 A;  3E33 A;  3UKR G;  2WMO A;  3JYS A;  4WAF A;  1DVP A;  4G24 A;  4GZ5 A;  3D9N A;  3I3N A;  1YCS B;  1PY1 A;  4Q69 A;  3LDZ A;  3LY9 A;  3CVY A;  4L1B A;  4D10 C;  5JHB A;  1HZ4 A;  2IJG X;  1H2V C;  4DK5 A;  1PAQ A;  2PQN A;  1AP7 A;  1V54 E;  1NFI E;  3CR3 A;  4FP7 A;  4NAC A;  3LJN A;  2KCK A;  5ITZ F;  5ENT D;  2YIN A;  2IEJ A;  2AJA A;  3MEK A;  4J8D A;  4V3I A;  4N3C A;  4WND A;  3E34 A;  4YDE A;  1OWP A;  2VTB B;  3LVR E;  3QWP A;  4HXI A;  2WXO A;  2V4L A;  4CDM A;  4CCA A;  3PEV B;  4KXK B;  3KAE A;  4I1M A;  3TWQ A;  1MX2 A;  1ELW A;  4FC8 A;  1O5M A;  5JA4 D;  5ARG A;  3CHS A;  3FU5 A;  1N11 A;  2GRR B;  1BLX B;  4ILI A;  4WWN A;  5D2M C;  2L0T B;  4G1T A;  4CEM A;  1Z6T A;  4PS7 A;  4GA1 A;  3Q4A B;  5CCL A;  5T4Y A;  1N4Q A;  4L23 A;  1O1S A;  3BEE A;  4OAV B;  4LNG A;  4U63 A;  4TXR A;  3SBT B;  2B6C A;  1IHG A;  2OOE A;  1E7U A;  2J8S D;  5BUZ A;  4C0M A;  1S63 A;  3ZYL A;  3KSL A;  3MCX A;  4GYO A;  4TV3 A;  4HLL A;  2XGM A;  3NBN B;  1GW6 A;  5CRU A;  4KBQ A;  4K0R A;  3TJP A;  3ABK E;  3GZ1 A;  3FTU A;  1TJC A;  3L16 A;  4LER A;  3D9M A;  4JHJ A;  4P29 A;  3ASG A;  3AU4 A;  4YDW A;  3EHN A;  1WM5 A;  3DSS A;  3GZ2 A;  3CGH A;  4N5C A;  1LF8 A;  4UWH A;  4HOU A;  2L6B A;  2WQ7 A;  2R5S A;  4U8H A;  3FTY A;  5J90 A;  3CHM A;  1E8Z A;  5LFA A;  2L9B A;  3RIB A;  3RKV A;  4B8A A;  3C98 A;  5KNG A;  4KZC A;  2QC9 A;  5ENR D;  1FCH A;  4EQF A;  2FUL A;  4EBA G;  4GA2 A;  5ENN A;  2KCL A;  2Y3A A;  3CK7 A;  3BUA A;  4HVB A;  4EZL A;  4AY5 A;  1L5J A;  1WG0 A;  2QFC A;  4IN3 B;  3UI2 A;  4L7T A;  4L9P A;  3CHP A;  4O1O A;  5FWQ A;  3Q79 A;  4LG6 A;  2WXM A;  4FAD A;  5JJT A;  1YMP A;  4N39 A;  4HI8 A;  3L22 A;  3LYA A;  2FEZ A;  1N4P A;  5B3S E;  1H6K A;  3FU0 A;  3CQC B;  2P9P G;  2F8X K;  3VLE A;  3X2Q E;  4FJZ A;  3MX3 A;  3T9K A;  3IEG A;  5B1A E;  5AQ7 A;  2BUG A;  3ZYK A;  3PZ4 A;  2A5E A;  1H0A A;  4FLB A;  3NZU A;  1WDY A;  2L6J A;  4B93 B;  3DBS A;  3VLF A;  5C1D A;  2LAH A;  5LP0 A;  3HXC A;  5H7P A;  3FUM A;  4K5A B;  2NYJ A;  4UQX A;  4TXP A;  3CVP A;  5CMY A;  3UQ3 A;  3FP3 A;  3APD A;  4WWP A;  5FZQ A;  5G55 A;  3ULY A;  3MKQ A;  5KWD A;  4GB9 A;  2R2L A;  5FTP A;  2DCP A;  3OXG A;  4O6F A;  4DJA A;  3TAX A;  1BD8 A;  4G23 A;  4I2W A;  4GTS A;  4UWK A;  1HG5 A;  4FA6 A;  2GRM A;  2V5F A;  4EBA A;  1NA3 A;  3V2O A;  2WXL A;  4A3V A;  1Y6I A;  5ANR A;  5HRY A;  3ASO E;  2KAT A;  3T8M A;  5BXU A;  1QQE A;  2PM7 A;  4DX7 D;  3CV0 A;  2QZA A;  3LEW A;  4GCN A;  1N9A A;  4GTM A;  4FU3 A;  3SFZ A;  4ILH B;  2HR2 A;  2J9Q A;  4DI3 A;  2OVF A;  1HU3 A;  2B0O E;  2I6H A;  1KPS B;  4JA9 A;  3Q75 A;  3KS2 A;  4UI9 K;  1TN8 A;  3SY2 A;  2V4H C;  3UX4 A;  3RJV A;  3UMV A;  3JQ0 A;  2J08 A;  3LPZ A;  3HXB A;  5EKQ D;  5AAO A;  3CVV A;  4FJY A;  2X6J A;  2XZT G;  3UTM A;  4LRZ A;  5KCM A;  4GTO A;  4UI9 J;  3Q9N C;  3D9K A;  3D9P A;  2X6H A;  3ML8 A;  4A3T A;  1ELK A;  3GW4 A;  3B13 A;  5D66 A;  2RKK A;  4RG9 A;  3TWV A;  1JWF A;  4YDY A;  3HDX A;  5AJD A;  3TXM A;  3JUE A;  4GTV A;  2E2E A;  1DNP A;  1OUV A;  3HRA A;  3IV0 A;  4U8Y D;  3DEP A;  5FZS A;  4N2Q A;  2E0I A;  4UQY A;  2NSZ A;  2XHE A;  1MJ0 A;  1BU9 A;  3D9L A;  3BU8 A;  2LNI A;  1N95 A;  1MHQ A;  3ZHE A;  2P9K G;  2R17 C;  1U3C A;  3UM1 A;  3FTV A;  4F1P A;  3QB2 A;  5AAR A;  4G26 A;  5HQ8 A;  3CIA A;  3QWV A;  2M63 A;  5AEN A;  3AU5 A;  1YYH A;  2R05 A;  4J6I A;  3TL5 A;  4RQI A;  5EN5 D;  3TWW A;  5BXO A;  3FUJ A;  4HRM B;  1S70 B;  2X38 A;  1QNF A;  2LUH A;  3L82 A;  4U96 D;  3AG3 E;  2DWZ A;  3L08 A;  2IF4 A;  3CQG B;  3IHY A;  4I1A A;  2IQC A;  3DWL G;  3SFX A;  2IU1 A;  3ZPJ A;  5T3R A;  1LTX A;  2WMN A;  3B7U X;  4ME2 A;  2LO6 A;  4K5B A;  3FFL A;  4BET A;  1MYO A;  5D0O D;  3WXX A;  2EIJ E;  4J8F A;  2VGX A;  2IOS A;  2X6I A;  2I1K A;  3QDN A;  4I2Z A;  3TXN A;  2C0L A;  1EF1 C;  2VSY A;  4BX9 A;  3S2A A;  4UQZ A;  2HE0 A;  2WXK A;  1UN9 A;  4GTP A;  3JXI A;  5AQA A;  3C5R A;  2WVI A;  4OVV A;  1UW4 B;  3U64 A;  2P58 C;  1E96 B;  5AYW D;  4GTT A;  3KEZ A;  3FH5 A;  3PZ3 A;  4HI9 A;  2Y0B G;  3FU3 A;  4Y6W A;  2VYI A;  5JHA A; 
#chains in the Genus database with same CATH homology
 1A5E A;  2RFA A;  2PNN A;  4HNA D;  1OY3 D;  3NOG D;  1YMP A;  5EIB E;  4F1P A;  3TWU A;  3W9F A;  5AAR A;  1BI8 B;  3W9G A;  4DX2 A;  3B95 A;  2DVW A;  5EIL A;  1N0Q A;  4UUC A;  1AWC B;  4OAV B;  4HI8 A;  2DZO A;  3HG0 D;  4ZHB A;  1TR4 A;  4BER A;  4U8V D;  4Z68 A;  2B0O E;  3TWX A;  4ATZ D;  1YYH A;  3IXE A;  4HRL A;  1YCS B;  1K1B A;  1MX4 A;  5EN5 D;  3TWW A;  2F37 A;  3V30 A;  5BXO A;  5ENQ D;  2J8S D;  5ENS D;  2P2C P;  1MX6 A;  4HRM B;  5AQB A;  4C48 B;  1S70 B;  5CED B;  2F8X K;  3KEA A;  2FO1 E;  5HKP A;  1K1A A;  1SW6 A;  3T9K A;  4BSZ B;  4GPM A;  4U96 D;  5AQ7 A;  2DWZ A;  2ZGD A;  2V4H C;  5CEC B;  4O60 A;  5CEA A;  2A5E A;  5CER B;  1K3Z D;  4QQI A;  3B7B A;  4HLL A;  5FIN A;  4HQD A;  3EHQ A;  3NBN B;  1WDY A;  1SVX A;  3J5Q B;  4J7W A;  1AP7 A;  4B93 B;  5AAO A;  2QYJ A;  1NFI E;  3AJI A;  5AQ9 A;  1N0R A;  4U95 D;  3DEO A;  3TWT A;  5CBN A;  4O1P A;  2XZT G;  4BES A;  3LJN A;  4LSZ E;  3UTM A;  2XEN A;  1UOH A;  2Y1L E;  3SO8 A;  3ZUV B;  1QYM A;  4K5A B;  3Q9N C;  2NYJ A;  5ITZ F;  5ENT D;  4TUM A;  1IXV A;  3EU9 A;  3V79 K;  3TWS A;  4K5B A;  4HRN A;  4YDW A;  5ENP D;  4JB8 P;  2XEH A;  4BET A;  1D9S A;  2KXP C;  4DX6 D;  4OAU C;  1MYO A;  4J8Y A;  4ZFH A;  2RFM A;  3J5P A;  2BKG A;  2KBX A;  5D66 A;  5HS0 A;  2AJA A;  3TWV A;  2F8Y A;  5KNH D;  1DCQ A;  4CZ2 D;  2L6B A;  4NIK A;  5ENO D;  5KWD A;  1OT8 A;  3AAA C;  4A63 B;  4GMR A;  5CBO A;  4YDY A;  5KBA A;  2XZD G;  3D9H A;  5FIO A;  4DRX E;  3Q9U C;  4G8L A;  3EHR A;  3ZU7 B;  4BEP A;  5EID A;  4G8K A;  1DC2 A;  1BD8 A;  3JUE A;  4QFV A;  2ETA A;  4K5C A;  3JXJ A;  4HB5 A;  2HE0 A;  3HRA A;  5JMN D;  4U8Y D;  3DEP A;  5KNG A;  3JXI A;  4N5Q A;  3C5R A;  5AQA A;  3V2O A;  2ETB A;  1IHB A;  4RLY A;  4DX5 D;  4LNU D;  4HBD A;  3ZNG A;  2QC9 A;  1MX2 A;  2JAB A;  5ENR D;  3TWQ A;  5HRY A;  5JA4 D;  3TWR A;  2DZN A;  3UXG A;  2V5Q C;  4CYM D;  5BXU A;  1BI7 B;  4DX1 A;  5AN8 A;  5EYP F;  3V2X A;  4DUI A;  3T8K A;  1MJ0 A;  1N11 A;  1BU9 A;  1WG0 A;  1G3N B;  3UI2 A;  3ZKJ A;  1IKN D;  1BLX B;  2BKK B;  4HI9 A;  3V31 A;  2Y0B G;  4O1O A;  2VGE A;  2XEE A;  2ETC A;  3F6Q A;  2MYO A;  4DX7 D;  3NOC D;  5EYL A;  4LG6 A;  2ZGG A;  4F6R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...