2ETAA

Crystal structure of the ankyrin repeat domain of the trpv2
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
245
structure length
239
Chain Sequence
b'FDRDRLFSVVSRGVPEELTGLLEYLRWNSKYLTDSAYTEGSTGKTCLMKAVLNLQDGVNACIMPLLQIDKDSGNPKPLVNAQCTDEFYQGHSALHIAIEKRSLQCVKLLVENGADVHLRACGRFFQFYFGELPLSLAACTKQWDVVTYLLENPHQPASLEATDSLGNTVLHALVMIADNSPENSALVIHMYDGLLQMGARLCPTVQLEEISNHQGLTPLKLAAKEGKIEIFRHILQREF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transient receptor potential cation channel subfamily V memb
publication title Structure of the N-terminal Ankyrin Repeat Domain of the TRPV2 Ion Channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 85
structure length 239
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2etaA00
3UI2A 4N5QA 3NBNB 5AAOA 4DX5D 5CEAA 2KXPC 5AARA 4BESA 2P2CP 3TWXA 4C48B 5AQBA 4K5CA 5ENPD 5EILA 5AQ7A 2L6BA 3TWQA 5EIBE 1A5EA 1BLXB 5AQAA 2ETBA 5KBAA 3TWUA 1D9SA 4HB5A 2A5EA 4U96D 3F6QA 4B93B 2F8XK 1DCQA 3ZKJA 4TUMA 1OT8A 5HRYA 3UTMA 2QC9A 1NFIE 4GPMA 1K1AA 1K1BA 1WDYA 4U8YD 4YDWA 1S70B 5CECB 4O60A 2ETCA 3V2OA 5CEDB 2ZGDA 3TWSA 4OAUC 4QQIA 4BETA 1MX6A 5ENRD 2DVWA 3TWVA 2XZTG 1AP7A 3EHRA 4JB8P 4HRLA 5AN8A 4G8LA 3V2XA 4LG6A 1IKND 5ENSD 5JMND 3LJNA 5HKPA 3T9KA 2ETAA 1MYOA 4LSZE 4DUIA 3D9HA 3W9FA 3J5PA 3NOGD 1IHBA 5ENOD 4BSZB 2Y1LE 5ENTD 4Z68A 4HBDA 5EIDA 4HRNA 4ZHBA 2Y0BG 2BKGA 1BI8B 2PNNA 1N11A 5KNHD 5BXOA 3KEAA 4O1PA 4CYMD 4G8KA 3AAAC 3EU9A 4CZ2D 4U8VD 1N0QA 5KWDA 1SVXA 3JXJA 4HI9A 5BXUA 1IXVA 3Q9NC 2DZOA 1AWCB 2HE0A 3B7BA 4K5AB 3J5QB 1BD8A 1OY3D 2B0OE 3AJIA 2RFAA 3T8KA 4QFVA 5AQ9A 4OAVB 2ZGGA 2XEHA 3TWTA 4HNAD 1UOHA 2F37A 1YMPA 3TWWA 4A63B 1MJ0A 4ATZD 2RFMA 3B95A 4F1PA 3ZU7B 5JA4D 3JUEA 5ITZF 4LNUD 3IXEA 3V79K 2V4HC 5FIOA 2XZDG 3NOCD 4NIKA 1MX2A 3JXIA 3V31A 4GMRA 2DZNA 3W9GA 1K3ZD 5EYLA 1G3NB 4K5BA 1BU9A 2J8SD 3SO8A 5CERB 3V30A 4BEPA 5EN5D 4HI8A 4HRMB 4DX1A 4YDYA 2NYJA 2MYOA 1MX4A 1QYMA 3DEOA 2DWZA 2AJAA 1YCSB 3UXGA 3TWRA 5KNGA 4J8YA 5CBOA 2KBXA 2XENA 5CBNA 2JABA 3DEPA 4DRXE 4F6RD 4DX2A 4O1OA 5EYPF 5ENQD 2VGEA 2F8YA 4HLLA 3Q9UC 1DC2A 4BERA 1SW6A 4UUCA 5D66A 5HS0A 2V5QC 5FINA 1TR4A 4HQDA 1YYHA 4RLYA 3EHQA 4J7WA 1N0RA 1BI7B 3HG0D 4DX6D 4ZFHA 1WG0A 2QYJA 3C5RA 4U95D 3ZUVB 2BKKB 4DX7D 2XEEA 3HRAA 2FO1E 3ZNGA
chains in the Genus database with same CATH superfamily
3RK6A 1D8EA 2L0TB 1HG5A 3BUAA 2H6GA 2WXOA 2A5EA 1BPOA 2VSOE 4B93B 2WPVA 4X8QA 1TYQG 2OEVA 3QJZA 5CECB 2R2LA 2WMNA 2WQHA 4N2SA 4BETA 3IV0A 3GZSA 2XRYA 4CGWA 3OTNA 3KSQA 3E33A 3SD5A 4AP2A 1HH8A 1LD7A 3TG4A 4ANWA 3AAAC 4BT9A 4ILGA 4PDXA 1AWCB 2M63A 3PS6A 1UOHA 2P9SG 3C98A 4A1GA 4F7AA 4U0SA 4GA2A 3V79K 3QOUA 2XZDG 3R9MA 3NOCD 1VDYA 4JC8A 4GU5A 3TL5A 2OV8A 4AOFA 2IOLA 3L22A 4U07A 1BU9A 4BEPA 2YNQA 1OCRE 4MBGA 4JZYA 2H6HA 3EDTB 3R7RA 3CR3A 5EYPF 2XS8A 2VGEA 3C3RA 2GRNB 1IYGA 4HQDA 3EHQA 2EQXA 3U66A 4D10C 1N54A 2UY1A 5G2NA 4CDMA 3NZUA 3HYMB 3FUDA 4I6EA 5LCWC 4FHJA 5ENPD 3HDXA 3HXCA 4AM9A 5G05C 1SQMA 4H7XA 3KEZA 3AS8A 3VTYA 3URZA 4KVOA 4FP7A 3T5VA 1WM5A 3UTMA 1HG2A 1PC2A 4GTMA 4JEHA 3SFZA 2R05A 1LD8A 2IO2C 4HRLA 3U3WA 3FTWA 4PS3A 2DYRE 1Y8MA 2IOSA 1OUVA 4GYWA 4F1SA 3L13A 4G8KA 5JHBA 5B3SE 4RSYA 3QWPA 5CRUA 3KSLA 2XPZA 3DXMG 2H6IA 1Z6TA 2RFAA 3FUMA 2ZGGA 4I1AA 3RO2A 2V4HC 3JXIA 2CG3A 1ZU2A 2IF4A 2X6HA 3B7TA 1E7VA 5EYLA 4J8SA 2DWZA 2R59A 2E2EA 2IO3C 3CVWA 4HLLA 3I3NA 3LPZA 2QYUA 2KZTA 4XKCA 4I2ZA 1BI7B 3Q4AB 4BTAA 3FHEA 2FO1E 3ZHEA 2OVFA 5AAOA 3I4RB 1E7UA 3ASHA 3Q47B 5FTPA 2V5FA 3UMVA 2WQ6A 4KXKB 2FULA 1EYHA 3MV3B 3ABME 1QNFA 4I17A 4UI9J 1K1AA 1K1BA 1WDYA 3CVQA 2PQNA 3ZXPA 2ZGDA 4G25A 1E8ZA 4AVXA 3FP3A 2L0IA 4OVVA 3TWVA 3SZ7A 3LVRE 4JL0A 1SZAA 4A1SA 4JXTA 1IHGA 2Y0BG 4YVOA 4AEZC 4APFA 3EU5A 3CHQA 5CCMA 1MHQA 1MZCA 2C0LA 2ILRA 3U4TA 2LO6A 2P9NG 2Y4UA 3B7SA 2NXPA 1OCOE 3T8MA 3ONKA 4NIKA 5AJLA 2ZXWE 3ABKE 1WY6A 2AXUA 2I2OA 3CHOA 3TAXA 3D9NA 4PH4B 4NURA 3ISMC 2KCLA 2F8YA 3FTXA 2P58C 1TR4A 3MJWA 2BUGA 3LEWA 1E8YA 3HVEB 2CFUA 1X81A 4UQYA 3EJNA 3AS5A 5HI7A 1N9AA 2DYSE 5CCLA 2P2CP 3S7DA 2I6HA 3TWQA 3MX3A 4Y6CA 2GRMA 3CQCB 3EUVA 1H19A 2VJ8A 4M3OA 4MS6A 4OYSA 3E37A 3K9IA 4L1BA 2VTBB 1Z5SC 4HS2A 4EBAG 3HHMA 3ML8A 3W9FA 2WXPA 4FHKA 2FBNA 3DRAA 3CQGB 3PNTB 4HXIA 4WNDA 1OXJA 1SVXA 3LYAA 5FZSA 3T8KA 1KT0A 4FA6A 4OAVB 3TWTA 3NAWA 4ATZD 2RFMA 5J08A 3V31A 4I6JA 4FLHA 4E6HA 4UI9K 3PRZA 5CERB 4KMOA 3L54A 4L2LA 1S64A 1TNUA 3BG0B 2A5UA 3FY4A 3DEPA 3L17A 4ACKA 3ZIMA 3LCAA 4L2YA 3SQVA 4YDEA 2LAIA 3IEGA 4J7WA 2GRPB 3ZUVB 2XEEA 5FQ6A 2IJGX 3UI2A 1SA5A 3Q78A 4J0UA 4AIFA 3JUIA 4LERA 3CVNA 4GZDA 1ELWA 3BQOA 4L23A 3BU8A 1D9SA 3ZEFA 5G04J 1OWNA 3SBSA 1KLXA 4JA9A 2RKKA 3UKRG 4JW1A 1OWLA 4QQIA 3CKBA 4JB8P 5AN8A 4YVQC 1HE8A 2ETAA 3ULQA 1OCZE 4MRUA 4CT4A 3ULEG 1U2VG 3FUFA 3CVUA 3FUHA 1S0PA 4CZ2D 5D0QD 3HXFA 3OXLA 3J5QB 3VLEA 3ENEA 2VYIA 1JCRA 4KT6B 5BUZA 4OVUA 4XI0A 4RG6A 2HO1A 3UT7A 5EDSA 3RKVA 2J8SD 4J8DA 4UWFA 4FJYA 1QYMA 3PUJA 2WXRA 4HVBA 3SI5A 4WWNA 2WM9A 2BTDA 1HFAA 3D3MA 1GW6A 1B89A 2VSNA 3Q15A 2GROB 2OCCE 4EZLA 3VLDA 3ZNGA 3Q79A 1JUQA 3KAEA 3GZ2A 3JQ1A 3GZ1A 4BWRA 3FTSA 5DIZA 3MKRA 3L9TA 3G2WA 3I5PA 3NQPA 3Q5MA 1DCQA 1DVPA 3QAQA 5AYWD 1X5BA 3E34A 2WQ7A 2FF4A 3TWSA 4B8AA 2XZTG 3UIOC 2DBAA 4LG6A 4DLOA 2QZAA 3T9KA 4LSZE 3NOGD 1NP7A 2MHKA 2VSYA 3MKQA 5BV0A 1IQRA 4CEMA 2WXNA 2QFCA 3SHFA 1H2TC 3U9WA 4ACLA 1OY3D 2BEDA 4BT8A 1H6OA 3LJ3A 2KC7A 5AQ9A 3TWWA 4HNAD 4GYOA 3FEYA 4DI4A 2I1KA 2XCBA 3CIAA 3CK9A 4ANVA 1UN8A 1K3ZD 3ZYQA 1FVHA 4NRHB 4O6FA 4HRMB 1INZA 4HOUA 2A4ZA 4GCOA 3VTXA 4JEUA 4F6RD 1O1TA 4N3CA 4G24A 3ZRHA 2V5QC 2IEJA 4BTBA 3ML9A 1HXIA 3Q49B 4GTQA 4U95D 4ANUA 1ZBPA 4DX5D 4BESA 3CK8A 2Y3AA 3TWUA 1EDUA 2UY1B 1V55E 3CHPA 2F8XK 3D9OA 4AY5A 3DWLG 2WXIA 3FULA 3IBEA 4LNBA 3V2OA 1OWPA 3MZLB 4B94A 4I1MA 2XEVA 4CRWA 3TGOA 3FUEA 5ENOD 3IHVA 1UW4B 2Y1LE 4G2VA 4ZHBA 3KD7A 3SFYA 1HZ4A 2WB2A 3JXJA 3ZYMA 2HE0A 2DIWA 2CHXA 3ASFA 4FC8A 1MJ0A 3PEUB 3QWVA 3B95A 4XE0A 3JUEA 2VGYA 5FIOA 1FVFA 2LAHA 3EIQC 4DPRA 4GMRA 2P9LG 5CHEE 2XRZA 4M7CA 2PZIA 1G3NB 1TNBA 4XI9A 4U7EB 2HYZA 1FT2A 5KNGA 4Q69A 3D9IA 4R7LA 3LY8A 4KBQA 5FQ8A 3NF1A 2I9CA 2NC9A 3UM3A 3HG0D 4CT0A 2E0IA 3RRMB 4GTPA 2KCVA 3IHYA 4KYOB 3C3OA 2KZTB 3Q7AA 4UWGA 4K5CA 3FUJA 5EILA 4LRZA 3G2SA 3ZHEB 1OWOA 4HB5A 1HF8A 4U96D 4MKTA 3ZKJA 4P29A 1EPUA 5M72A 4UWKA 5CEDB 3T5XA 1O5MA 4J8EA 2IONA 3UX4A 2OEWA 3DSXA 5ENSD 3UQ3A 3R7QA 2BKGA 4C0EA 1N4RA 5LP0A 3KEAA 3QC1A 4N3BA 1N0QA 1IXVA 3RAUA 4CDRA 4BX8A 5D0OD 3GW4A 3CVPA 4FADA 2VSXE 3AS4A 2AXZA 2X6IA 1N52A 3MV2B 1N4SA 2MYOA 2LNIA 3BEEA 1YCSB 1JWGA 4J8YA 2EIME 4DX2A 2R02A 1HU3A 3D9LA 5FJYA 3UT8A 1H6PA 3DSTA 5FT9A 2QYJA 5E75A 5ENNA 3PZ3A 1OWMA 2KXPC 5AQBA 2V4LA 4KZCA 4GMJA 3CSFA 4B8CB 3CHMA 3B7UX 4EHMA 1N4QA 2QC9A 5BV1A 3B13A 2B6CA 3OAWA 2L6JA 2V8SE 4ATGA 3R9AB 1U3DA 3L82A 4AY6A 1FPPA 4APOA 2CG2A 3D9JA 3PEVB 5JMND 5HKPA 4IN3B 4LCTA 2JLBA 2YHCA 3FU5A 4HRNA 4GTSA 2WXMA 4HLEA 1ZB1A 1TJFA 3CVLA 3ZFWA 1K8KG 4LEUA 4NACA 4C0MA 4JD2G 3O48A 2Y4TA 4AXHA 3EIJA 3CEQA 2GGFA 4H7YA 4WWOA 3TG5A 3UM1A 1JWFA 1H6KA 3FU3A 3S7FA 5T4YA 5KCMA 3SO8A 3UIPC 4JHKA 1NI1A 5EX3A 5B1BE 2NYJA 2Q7FA 4RG9A 2I1JA 4EECA 4JPSA 3UINC 2UWJG 3CKCA 4L9PA 1H2UA 3UUXA 4XX5A 1P5QA 1TEZA 3LXUX 2AVPA 5G55A 1WG0A 2AXVA 3ZGQA 3FTYA 3SNXA 1KZOA 3C72A 3LS8A 3QB2A 5A7DB 1UJKA 5IY5E 2EIKE 2VGXA 2R17C 1PY1A 3DBSA 3I4GA 4TUMA 2KCKA 4U8YD 4FJZA 3PREA 5BW8C 1KPSB 1TN7A 3RIBA 2ZISA 2DVWA 2WMOA 3FTZA 1V54E 4TXQA 4PUCA 5LCWJ 1S63A 5AIJA 3QNKA 4HBDA 5G05J 5EKQD 4TV3A 2HR2A 1BI8B 4YNDA 3LY9A 4TXRA 4G11A 1N95A 1E96B 4HI9A 3RRNB 3G2UA 2RD0A 5A6CA 1JCSA 4LUNU 3PUKA 5LFAA 2DCPA 4U63A 1MX2A 2ONDA 2DZNA 3JQ0A 3FEXA 2ZIRA 2IU1A 4F3VA 3O4ZA 3IKOB 4BSXA 4I43A 2RG8A 4BX9A 5C2YA 3DSUA 1TNYA 3E30A 5ENQD 1JPLA 3LDZA 2KATA 4EZJA 5JHAA 1SW6A 1MQSA 5D66A 4C9BB 2AWIA 1FCHA 4DX6D 5LX8A 1N94A 3DSSA 4GA1A 1H2VC 3CHSA 3MGBA 3PE4A 3TXMA 3PH0C 4N5QA 3KS2A 4J8FA 4IYPA 4HOTA 1TN6A 2P9IG 4KZ0A 3Q73A 2XQ0A 3AU5A 4N39A 3SF4A 4GZ6A 3E4BA 1TNZA 1OT8A 2X3MA 3MA5A 2C0MA 4W9RA 4I2WA 4MLPA 2LXMA 1PAQA 4OAUC 3G2VA 1XGWA 2WXJA 1HO8A 4XKBA 1O1SA 4AJWA 3LJNA 3NB2A 1IHBA 3CLJA 3HXDA 4LNGA 1DNPA 3L6AA 5KNHD 4GTOA 4GA0A 2Y69E 4TXPA 3B7BA 4HOQA 2WVIA 2PQRA 2VQ2A 3MKQB 2IFUA 2WXFA 5ITZF 1YA0A 3IXEA 5FZRA 2YHEA 2EINE 3SGHA 3ASOE 3ZVVA 2R03A 3OXGA 4UWHA 3TJPA 2R5SA 1Z3XA 2X6KA 2AJAA 5CBOA 2JABA 2P9PG 3QARA 3Q9UC 1KT1A 1TN8A 2FEZA 4UUCA 3EHMA 4RLYA 4WNFA 1N0RA 4ZFHA 3PZDA 2BKKB 3LY7A 4CCAA 4WUYA 4G23A 4N3AA 3LVQE 3S7BA 4I6GA 3TWXA 4CDNA 1QQEA 2XPIA 3DXKG 2L6BA 4JHRA 2LSVA 4JHJA 1XNFA 1JCQA 3PE3A 4I9EA 2GRRB 2P9UG 1RZ4A 4FLBA 5J90A 4XEIG 4EZKA 1S70B 3TXNA 2ETCA 2BF0X 1MX6A 4GAAA 5ENRD 4DI3A 5C1DA 5FWQA 4G8LA 4L7TA 1O1RA 1IKND 2KM4A 3FFLA 1E8WA 2CFZA 3Q75A 2X6FA 4Z68A 4BSZB 3P2BA 3HXEA 1FT1A 3X2QE 3ASDA 4Q96A 2PNNA 1Q2ZA 4GTTA 2C2LA 3PZ2A 4EPZA 4U8VD 4A3TA 2J49A 5AENA 2GW1A 5LOZA 1H0AA 3FH5A 2F37A 3AG4E 3D9MA 2EILE 2XGSA 3FTVA 1LTXA 4NQ0A 3APDA 3VLFA 1EF1C 4HI8A 3ZN3A 2OOEA 1MX4A 4U04A 5JJ6A 3S2AA 4I1OB 4ILIA 3DSWA 2F0YA 3FH8A 1DC2A 4GMLA 5G04C 5FINA 2P9KG 2PM7A 3HRAA 3MEKA 1N4PA 2XHEA 3NBNB 1HX8A 2CHZA 5FZQA 5AARA 1U3CA 2XGMA 2YQ8A 5EX0A 4DLQA 5EIBE 1D8DA 4FULA 3ZPJA 5AQAA 2ETBA 2JEKA 4TUUA 5T8IA 2J09A 1LF8A 2XCCA 3ZYLA 3JYSA 2MRIA 5ANLA 1KZPA 3CSTA 4ANXA 1AP7A 3G2TA 5D2MC 2CHWA 3V2XA 2X6JA 3ESKA 5EIDA 2J9QA 2IY0C 4A3VA 4PS8A 4GZCA 3DSVA 4CYMD 2WXHA 2PL2A 5KWDA 4ABNA 5FQ4A 3CV0A 5BXUA 3FU0A 5HQ8A 2XS1A 1BD8A 3C3QA 2EIJE 1L5JA 1E90A 3AG1E 1NA3A 3HXBA 4K5BA 3PNLB 4WAFA 3ZYKA 4DX1A 4E85A 3ULYA 5B1AE 3SFXA 2XENA 4RQIA 5CBNA 3OXFA 2LXLA 1SZ9A 5AJDA 4CGVA 1DCEA 1RW2A 4EQFA 1YYHA 4UQZA 4I9CA 3DPYA 1IQUA 3ZW3A 5FQ7A 4BY6A 3ONLA 4WWPA 1BLXB 4XZ4A 3UPVA 5KBAA 2J08A 4JA7A 4EBAA 5BT1A 4GPKA 3AU4A 4Y6WA 3UKUG 5JJTA 3ABLE 4J6IA 4U0UA 2LUHA 3EHRA 5H7PA 4DUIA 2J07A 2HM8A 3LKUA 2WXKA 2ZU6B 5KJMA 3AG3E 5T3RA 2J4BA 2DZOA 3QKYA 4K5AB 3AJIA 3N71A 2XEHA 1YMPA 2NSZA 4GB9A 5A23A 4F1PA 4YDOA 4GCNA 3QDNA 4GYYA 3V30A 5EN5D 3PZ4A 4YDYA 4N2QA 3DEOA 3UXGA 3TWRA 3FWVA 2KBXA 2X38A 4FU3A 3HVEA 5CMWA 4O1OA 1ELKA 2FI7A 3MCXA 3FUIA 1NL4A 1QBQA 5KJNA 4HOSA 4U0ZA 4Q94A 3C5RA 3FDHA 3WXXA 3ZXSA 5CRVA 3CGHA 5CEAA 2FO7A 4DK5A 3RJVA 3JCKC 1NA0A 5AQ7A 2VTBA 4IRUA 1A5EA 5KJLA 3CK7A 3ASGA 2IQCA 3CVXA 3F6QA 3PDNA 5HRYA 2WXLA 3RSEG 2J4DA 4GPMA 1Y6IA 4BFRA 2GRQB 2VGXB 4UWLA 1Z3YA 3L08A 3RO3A 3DPDA 2WXQA 2QY7A 2GRLA 5ARGA 1ELRA 3UM2A 3APCA 5BNWA 2YINA 1N11A 3PVLA 1UN9A 3ESLA 3WG7E 3UM0A 3Q9NC 4GTVA 2B0OE 1W3BA 2AW6A 3FTUA 4WNEA 4GTRA 4QFVA 4U8HA 4A63B 3MYVA 3RRUA 5KJKA 4JVSA 1UG3A 1QZ2A 4LNUD 4N5CA 3U64A 3S7JA 4WNGA 4RVBA 3CVVA 1A17A 3P1UA 3HIZA 5ANRA 4ILHB 4K03A 3AG2E 3E32A 1WAO1 3QWWA 4K0RA 3NZSA 4URKA 2H6FA 2XGOA 5HS0A 4DJAA 3APFA 3FUKA 4A55A 2PM6A 4DX7D 4G26A 4B89A 3SY2A 3ASNE 5JJ7A 3CVYA 2OVBA 4C48B 1NZNA 3Q7FA 5DBKA 3FUNA 4V3IA 2L9BA 4UI9C 3PZ1A 2WXGA 1NFIE 4HORA 4YDWA 3D9KA 4O60A 4KVMA 4G1TA 4HFGA 1UJJA 4IULA 4XIFA 5BPPA 1MYOA 2MOWA 3D9HA 3J5PA 5ENTD 1HS6A 2LSUA 5E76A 5BXOA 3GYZA 3L16A 5CMYA 4O1PA 1OCCE 4ME2A 3EU9A 3D9PA 4B0ZA 1E8XA 3B7RL 4UQXA 5JA4D 3ZU7B 1TNOA 3EHNA 2XPYA 3FH7A 3SBTB 3W9GA 3BG1B 4GZ3A 4AV7A 5ARFA 4DRXE 4TRQA 4GZ5A 3QK0A 1SA4A 4BERA 4F53A 3CHRA 4PS7A 1TJCA 3RU0A 3FU6A 3UT4A 2V0PA
chains in the Genus database with same CATH topology
3UI2A 4N5QA 3NBNB 5AAOA 4DX5D 5CEAA 2KXPC 5AARA 4BESA 2P2CP 3TWXA 4C48B 5AQBA 4K5CA 5ENPD 5EILA 5AQ7A 2L6BA 3TWQA 5EIBE 1A5EA 1BLXB 5AQAA 2ETBA 5KBAA 3TWUA 1D9SA 4HB5A 2A5EA 4U96D 3F6QA 4B93B 2F8XK 1DCQA 3ZKJA 4TUMA 1OT8A 5HRYA 3UTMA 2QC9A 1NFIE 4GPMA 1K1AA 1K1BA 1WDYA 4U8YD 4YDWA 1S70B 5CECB 4O60A 2ETCA 3V2OA 5CEDB 2ZGDA 3TWSA 4OAUC 4QQIA 4BETA 1MX6A 5ENRD 2DVWA 3TWVA 2XZTG 1AP7A 3EHRA 4JB8P 4HRLA 5AN8A 4G8LA 3V2XA 4LG6A 1IKND 5ENSD 5JMND 3LJNA 5HKPA 3T9KA 2ETAA 1MYOA 4LSZE 4DUIA 3D9HA 3W9FA 3J5PA 3NOGD 1IHBA 5ENOD 4BSZB 2Y1LE 5ENTD 4Z68A 4HBDA 5EIDA 4HRNA 4ZHBA 2Y0BG 2BKGA 1BI8B 2PNNA 1N11A 5KNHD 5BXOA 3KEAA 4O1PA 4CYMD 4G8KA 3AAAC 3EU9A 4CZ2D 4U8VD 1N0QA 5KWDA 1SVXA 3JXJA 4HI9A 5BXUA 1IXVA 3Q9NC 2DZOA 1AWCB 2HE0A 3B7BA 4K5AB 3J5QB 1BD8A 1OY3D 2B0OE 3AJIA 2RFAA 3T8KA 4QFVA 5AQ9A 4OAVB 2ZGGA 2XEHA 3TWTA 4HNAD 1UOHA 2F37A 1YMPA 3TWWA 4A63B 1MJ0A 4ATZD 2RFMA 3B95A 4F1PA 3ZU7B 5JA4D 3JUEA 5ITZF 4LNUD 3IXEA 3V79K 2V4HC 5FIOA 2XZDG 3NOCD 4NIKA 1MX2A 3JXIA 3V31A 4GMRA 2DZNA 3W9GA 1K3ZD 5EYLA 1G3NB 4K5BA 1BU9A 2J8SD 3SO8A 5CERB 3V30A 4BEPA 5EN5D 4HI8A 4HRMB 4DX1A 4YDYA 2NYJA 2MYOA 1MX4A 1QYMA 3DEOA 2DWZA 2AJAA 1YCSB 3UXGA 3TWRA 5KNGA 4J8YA 5CBOA 2KBXA 2XENA 5CBNA 2JABA 3DEPA 4DRXE 4F6RD 4DX2A 4O1OA 5EYPF 5ENQD 2VGEA 2F8YA 4HLLA 3Q9UC 1DC2A 4BERA 1SW6A 4UUCA 5D66A 5HS0A 2V5QC 5FINA 1TR4A 4HQDA 1YYHA 4RLYA 3EHQA 4J7WA 1N0RA 1BI7B 3HG0D 4DX6D 4ZFHA 1WG0A 2QYJA 3C5RA 4U95D 3ZUVB 2BKKB 4DX7D 2XEEA 3HRAA 2FO1E 3ZNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI2 A;  4N5Q A;  3NBN B;  5AAO A;  4DX5 D;  5CEA A;  2KXP C;  5AAR A;  4BES A;  2P2C P;  3TWX A;  4C48 B;  5AQB A;  4K5C A;  5ENP D;  5EIL A;  5AQ7 A;  2L6B A;  3TWQ A;  5EIB E;  1A5E A;  1BLX B;  5AQA A;  2ETB A;  5KBA A;  3TWU A;  1D9S A;  4HB5 A;  2A5E A;  4U96 D;  3F6Q A;  4B93 B;  2F8X K;  1DCQ A;  3ZKJ A;  4TUM A;  1OT8 A;  5HRY A;  3UTM A;  2QC9 A;  1NFI E;  4GPM A;  1K1A A;  1K1B A;  1WDY A;  4U8Y D;  4YDW A;  1S70 B;  5CEC B;  4O60 A;  2ETC A;  3V2O A;  5CED B;  2ZGD A;  3TWS A;  4OAU C;  4QQI A;  4BET A;  1MX6 A;  5ENR D;  2DVW A;  3TWV A;  2XZT G;  1AP7 A;  3EHR A;  4JB8 P;  4HRL A;  5AN8 A;  4G8L A;  3V2X A;  4LG6 A;  1IKN D;  5ENS D;  5JMN D;  3LJN A;  5HKP A;  3T9K A;  2ETA A;  1MYO A;  4LSZ E;  4DUI A;  3D9H A;  3W9F A;  3J5P A;  3NOG D;  1IHB A;  5ENO D;  4BSZ B;  2Y1L E;  5ENT D;  4Z68 A;  4HBD A;  5EID A;  4HRN A;  4ZHB A;  2Y0B G;  2BKG A;  1BI8 B;  2PNN A;  1N11 A;  5KNH D;  5BXO A;  3KEA A;  4O1P A;  4CYM D;  4G8K A;  3AAA C;  3EU9 A;  4CZ2 D;  4U8V D;  1N0Q A;  5KWD A;  1SVX A;  3JXJ A;  4HI9 A;  5BXU A;  1IXV A;  3Q9N C;  2DZO A;  1AWC B;  2HE0 A;  3B7B A;  4K5A B;  3J5Q B;  1BD8 A;  1OY3 D;  2B0O E;  3AJI A;  2RFA A;  3T8K A;  4QFV A;  5AQ9 A;  4OAV B;  2ZGG A;  2XEH A;  3TWT A;  4HNA D;  1UOH A;  2F37 A;  1YMP A;  3TWW A;  4A63 B;  1MJ0 A;  4ATZ D;  2RFM A;  3B95 A;  4F1P A;  3ZU7 B;  5JA4 D;  3JUE A;  5ITZ F;  4LNU D;  3IXE A;  3V79 K;  2V4H C;  5FIO A;  2XZD G;  3NOC D;  4NIK A;  1MX2 A;  3JXI A;  3V31 A;  4GMR A;  2DZN A;  3W9G A;  1K3Z D;  5EYL A;  1G3N B;  4K5B A;  1BU9 A;  2J8S D;  3SO8 A;  5CER B;  3V30 A;  4BEP A;  5EN5 D;  4HI8 A;  4HRM B;  4DX1 A;  4YDY A;  2NYJ A;  2MYO A;  1MX4 A;  1QYM A;  3DEO A;  2DWZ A;  2AJA A;  1YCS B;  3UXG A;  3TWR A;  5KNG A;  4J8Y A;  5CBO A;  2KBX A;  2XEN A;  5CBN A;  2JAB A;  3DEP A;  4DRX E;  4F6R D;  4DX2 A;  4O1O A;  5EYP F;  5ENQ D;  2VGE A;  2F8Y A;  4HLL A;  3Q9U C;  1DC2 A;  4BER A;  1SW6 A;  4UUC A;  5D66 A;  5HS0 A;  2V5Q C;  5FIN A;  1TR4 A;  4HQD A;  1YYH A;  4RLY A;  3EHQ A;  4J7W A;  1N0R A;  1BI7 B;  3HG0 D;  4DX6 D;  4ZFH A;  1WG0 A;  2QYJ A;  3C5R A;  4U95 D;  3ZUV B;  2BKK B;  4DX7 D;  2XEE A;  3HRA A;  2FO1 E;  3ZNG A; 
#chains in the Genus database with same CATH topology
 3RK6 A;  1D8E A;  2L0T B;  1HG5 A;  3BUA A;  2H6G A;  2WXO A;  2A5E A;  1BPO A;  2VSO E;  4B93 B;  2WPV A;  4X8Q A;  1TYQ G;  2OEV A;  3QJZ A;  5CEC B;  2R2L A;  2WMN A;  2WQH A;  4N2S A;  4BET A;  3IV0 A;  3GZS A;  2XRY A;  4CGW A;  3OTN A;  3KSQ A;  3E33 A;  3SD5 A;  4AP2 A;  1HH8 A;  1LD7 A;  3TG4 A;  4ANW A;  3AAA C;  4BT9 A;  4ILG A;  4PDX A;  1AWC B;  2M63 A;  3PS6 A;  1UOH A;  2P9S G;  3C98 A;  4A1G A;  4F7A A;  4U0S A;  4GA2 A;  3V79 K;  3QOU A;  2XZD G;  3R9M A;  3NOC D;  1VDY A;  4JC8 A;  4GU5 A;  3TL5 A;  2OV8 A;  4AOF A;  2IOL A;  3L22 A;  4U07 A;  1BU9 A;  4BEP A;  2YNQ A;  1OCR E;  4MBG A;  4JZY A;  2H6H A;  3EDT B;  3R7R A;  3CR3 A;  5EYP F;  2XS8 A;  2VGE A;  3C3R A;  2GRN B;  1IYG A;  4HQD A;  3EHQ A;  2EQX A;  3U66 A;  4D10 C;  1N54 A;  2UY1 A;  5G2N A;  4CDM A;  3NZU A;  3HYM B;  3FUD A;  4I6E A;  5LCW C;  4FHJ A;  5ENP D;  3HDX A;  3HXC A;  4AM9 A;  5G05 C;  1SQM A;  4H7X A;  3KEZ A;  3AS8 A;  3VTY A;  3URZ A;  4KVO A;  4FP7 A;  3T5V A;  1WM5 A;  3UTM A;  1HG2 A;  1PC2 A;  4GTM A;  4JEH A;  3SFZ A;  2R05 A;  1LD8 A;  2IO2 C;  4HRL A;  3U3W A;  3FTW A;  4PS3 A;  2DYR E;  1Y8M A;  2IOS A;  1OUV A;  4GYW A;  4F1S A;  3L13 A;  4G8K A;  5JHB A;  5B3S E;  4RSY A;  3QWP A;  5CRU A;  3KSL A;  2XPZ A;  3DXM G;  2H6I A;  1Z6T A;  2RFA A;  3FUM A;  2ZGG A;  4I1A A;  3RO2 A;  2V4H C;  3JXI A;  2CG3 A;  1ZU2 A;  2IF4 A;  2X6H A;  3B7T A;  1E7V A;  5EYL A;  4J8S A;  2DWZ A;  2R59 A;  2E2E A;  2IO3 C;  3CVW A;  4HLL A;  3I3N A;  3LPZ A;  2QYU A;  2KZT A;  4XKC A;  4I2Z A;  1BI7 B;  3Q4A B;  4BTA A;  3FHE A;  2FO1 E;  3ZHE A;  2OVF A;  5AAO A;  3I4R B;  1E7U A;  3ASH A;  3Q47 B;  5FTP A;  2V5F A;  3UMV A;  2WQ6 A;  4KXK B;  2FUL A;  1EYH A;  3MV3 B;  3ABM E;  1QNF A;  4I17 A;  4UI9 J;  1K1A A;  1K1B A;  1WDY A;  3CVQ A;  2PQN A;  3ZXP A;  2ZGD A;  4G25 A;  1E8Z A;  4AVX A;  3FP3 A;  2L0I A;  4OVV A;  3TWV A;  3SZ7 A;  3LVR E;  4JL0 A;  1SZA A;  4A1S A;  4JXT A;  1IHG A;  2Y0B G;  4YVO A;  4AEZ C;  4APF A;  3EU5 A;  3CHQ A;  5CCM A;  1MHQ A;  1MZC A;  2C0L A;  2ILR A;  3U4T A;  2LO6 A;  2P9N G;  2Y4U A;  3B7S A;  2NXP A;  1OCO E;  3T8M A;  3ONK A;  4NIK A;  5AJL A;  2ZXW E;  3ABK E;  1WY6 A;  2AXU A;  2I2O A;  3CHO A;  3TAX A;  3D9N A;  4PH4 B;  4NUR A;  3ISM C;  2KCL A;  2F8Y A;  3FTX A;  2P58 C;  1TR4 A;  3MJW A;  2BUG A;  3LEW A;  1E8Y A;  3HVE B;  2CFU A;  1X81 A;  4UQY A;  3EJN A;  3AS5 A;  5HI7 A;  1N9A A;  2DYS E;  5CCL A;  2P2C P;  3S7D A;  2I6H A;  3TWQ A;  3MX3 A;  4Y6C A;  2GRM A;  3CQC B;  3EUV A;  1H19 A;  2VJ8 A;  4M3O A;  4MS6 A;  4OYS A;  3E37 A;  3K9I A;  4L1B A;  2VTB B;  1Z5S C;  4HS2 A;  4EBA G;  3HHM A;  3ML8 A;  3W9F A;  2WXP A;  4FHK A;  2FBN A;  3DRA A;  3CQG B;  3PNT B;  4HXI A;  4WND A;  1OXJ A;  1SVX A;  3LYA A;  5FZS A;  3T8K A;  1KT0 A;  4FA6 A;  4OAV B;  3TWT A;  3NAW A;  4ATZ D;  2RFM A;  5J08 A;  3V31 A;  4I6J A;  4FLH A;  4E6H A;  4UI9 K;  3PRZ A;  5CER B;  4KMO A;  3L54 A;  4L2L A;  1S64 A;  1TNU A;  3BG0 B;  2A5U A;  3FY4 A;  3DEP A;  3L17 A;  4ACK A;  3ZIM A;  3LCA A;  4L2Y A;  3SQV A;  4YDE A;  2LAI A;  3IEG A;  4J7W A;  2GRP B;  3ZUV B;  2XEE A;  5FQ6 A;  2IJG X;  3UI2 A;  1SA5 A;  3Q78 A;  4J0U A;  4AIF A;  3JUI A;  4LER A;  3CVN A;  4GZD A;  1ELW A;  3BQO A;  4L23 A;  3BU8 A;  1D9S A;  3ZEF A;  5G04 J;  1OWN A;  3SBS A;  1KLX A;  4JA9 A;  2RKK A;  3UKR G;  4JW1 A;  1OWL A;  4QQI A;  3CKB A;  4JB8 P;  5AN8 A;  4YVQ C;  1HE8 A;  2ETA A;  3ULQ A;  1OCZ E;  4MRU A;  4CT4 A;  3ULE G;  1U2V G;  3FUF A;  3CVU A;  3FUH A;  1S0P A;  4CZ2 D;  5D0Q D;  3HXF A;  3OXL A;  3J5Q B;  3VLE A;  3ENE A;  2VYI A;  1JCR A;  4KT6 B;  5BUZ A;  4OVU A;  4XI0 A;  4RG6 A;  2HO1 A;  3UT7 A;  5EDS A;  3RKV A;  2J8S D;  4J8D A;  4UWF A;  4FJY A;  1QYM A;  3PUJ A;  2WXR A;  4HVB A;  3SI5 A;  4WWN A;  2WM9 A;  2BTD A;  1HFA A;  3D3M A;  1GW6 A;  1B89 A;  2VSN A;  3Q15 A;  2GRO B;  2OCC E;  4EZL A;  3VLD A;  3ZNG A;  3Q79 A;  1JUQ A;  3KAE A;  3GZ2 A;  3JQ1 A;  3GZ1 A;  4BWR A;  3FTS A;  5DIZ A;  3MKR A;  3L9T A;  3G2W A;  3I5P A;  3NQP A;  3Q5M A;  1DCQ A;  1DVP A;  3QAQ A;  5AYW D;  1X5B A;  3E34 A;  2WQ7 A;  2FF4 A;  3TWS A;  4B8A A;  2XZT G;  3UIO C;  2DBA A;  4LG6 A;  4DLO A;  2QZA A;  3T9K A;  4LSZ E;  3NOG D;  1NP7 A;  2MHK A;  2VSY A;  3MKQ A;  5BV0 A;  1IQR A;  4CEM A;  2WXN A;  2QFC A;  3SHF A;  1H2T C;  3U9W A;  4ACL A;  1OY3 D;  2BED A;  4BT8 A;  1H6O A;  3LJ3 A;  2KC7 A;  5AQ9 A;  3TWW A;  4HNA D;  4GYO A;  3FEY A;  4DI4 A;  2I1K A;  2XCB A;  3CIA A;  3CK9 A;  4ANV A;  1UN8 A;  1K3Z D;  3ZYQ A;  1FVH A;  4NRH B;  4O6F A;  4HRM B;  1INZ A;  4HOU A;  2A4Z A;  4GCO A;  3VTX A;  4JEU A;  4F6R D;  1O1T A;  4N3C A;  4G24 A;  3ZRH A;  2V5Q C;  2IEJ A;  4BTB A;  3ML9 A;  1HXI A;  3Q49 B;  4GTQ A;  4U95 D;  4ANU A;  1ZBP A;  4DX5 D;  4BES A;  3CK8 A;  2Y3A A;  3TWU A;  1EDU A;  2UY1 B;  1V55 E;  3CHP A;  2F8X K;  3D9O A;  4AY5 A;  3DWL G;  2WXI A;  3FUL A;  3IBE A;  4LNB A;  3V2O A;  1OWP A;  3MZL B;  4B94 A;  4I1M A;  2XEV A;  4CRW A;  3TGO A;  3FUE A;  5ENO D;  3IHV A;  1UW4 B;  2Y1L E;  4G2V A;  4ZHB A;  3KD7 A;  3SFY A;  1HZ4 A;  2WB2 A;  3JXJ A;  3ZYM A;  2HE0 A;  2DIW A;  2CHX A;  3ASF A;  4FC8 A;  1MJ0 A;  3PEU B;  3QWV A;  3B95 A;  4XE0 A;  3JUE A;  2VGY A;  5FIO A;  1FVF A;  2LAH A;  3EIQ C;  4DPR A;  4GMR A;  2P9L G;  5CHE E;  2XRZ A;  4M7C A;  2PZI A;  1G3N B;  1TNB A;  4XI9 A;  4U7E B;  2HYZ A;  1FT2 A;  5KNG A;  4Q69 A;  3D9I A;  4R7L A;  3LY8 A;  4KBQ A;  5FQ8 A;  3NF1 A;  2I9C A;  2NC9 A;  3UM3 A;  3HG0 D;  4CT0 A;  2E0I A;  3RRM B;  4GTP A;  2KCV A;  3IHY A;  4KYO B;  3C3O A;  2KZT B;  3Q7A A;  4UWG A;  4K5C A;  3FUJ A;  5EIL A;  4LRZ A;  3G2S A;  3ZHE B;  1OWO A;  4HB5 A;  1HF8 A;  4U96 D;  4MKT A;  3ZKJ A;  4P29 A;  1EPU A;  5M72 A;  4UWK A;  5CED B;  3T5X A;  1O5M A;  4J8E A;  2ION A;  3UX4 A;  2OEW A;  3DSX A;  5ENS D;  3UQ3 A;  3R7Q A;  2BKG A;  4C0E A;  1N4R A;  5LP0 A;  3KEA A;  3QC1 A;  4N3B A;  1N0Q A;  1IXV A;  3RAU A;  4CDR A;  4BX8 A;  5D0O D;  3GW4 A;  3CVP A;  4FAD A;  2VSX E;  3AS4 A;  2AXZ A;  2X6I A;  1N52 A;  3MV2 B;  1N4S A;  2MYO A;  2LNI A;  3BEE A;  1YCS B;  1JWG A;  4J8Y A;  2EIM E;  4DX2 A;  2R02 A;  1HU3 A;  3D9L A;  5FJY A;  3UT8 A;  1H6P A;  3DST A;  5FT9 A;  2QYJ A;  5E75 A;  5ENN A;  3PZ3 A;  1OWM A;  2KXP C;  5AQB A;  2V4L A;  4KZC A;  4GMJ A;  3CSF A;  4B8C B;  3CHM A;  3B7U X;  4EHM A;  1N4Q A;  2QC9 A;  5BV1 A;  3B13 A;  2B6C A;  3OAW A;  2L6J A;  2V8S E;  4ATG A;  3R9A B;  1U3D A;  3L82 A;  4AY6 A;  1FPP A;  4APO A;  2CG2 A;  3D9J A;  3PEV B;  5JMN D;  5HKP A;  4IN3 B;  4LCT A;  2JLB A;  2YHC A;  3FU5 A;  4HRN A;  4GTS A;  2WXM A;  4HLE A;  1ZB1 A;  1TJF A;  3CVL A;  3ZFW A;  1K8K G;  4LEU A;  4NAC A;  4C0M A;  4JD2 G;  3O48 A;  2Y4T A;  4AXH A;  3EIJ A;  3CEQ A;  2GGF A;  4H7Y A;  4WWO A;  3TG5 A;  3UM1 A;  1JWF A;  1H6K A;  3FU3 A;  3S7F A;  5T4Y A;  5KCM A;  3SO8 A;  3UIP C;  4JHK A;  1NI1 A;  5EX3 A;  5B1B E;  2NYJ A;  2Q7F A;  4RG9 A;  2I1J A;  4EEC A;  4JPS A;  3UIN C;  2UWJ G;  3CKC A;  4L9P A;  1H2U A;  3UUX A;  4XX5 A;  1P5Q A;  1TEZ A;  3LXU X;  2AVP A;  5G55 A;  1WG0 A;  2AXV A;  3ZGQ A;  3FTY A;  3SNX A;  1KZO A;  3C72 A;  3LS8 A;  3QB2 A;  5A7D B;  1UJK A;  5IY5 E;  2EIK E;  2VGX A;  2R17 C;  1PY1 A;  3DBS A;  3I4G A;  4TUM A;  2KCK A;  4U8Y D;  4FJZ A;  3PRE A;  5BW8 C;  1KPS B;  1TN7 A;  3RIB A;  2ZIS A;  2DVW A;  2WMO A;  3FTZ A;  1V54 E;  4TXQ A;  4PUC A;  5LCW J;  1S63 A;  5AIJ A;  3QNK A;  4HBD A;  5G05 J;  5EKQ D;  4TV3 A;  2HR2 A;  1BI8 B;  4YND A;  3LY9 A;  4TXR A;  4G11 A;  1N95 A;  1E96 B;  4HI9 A;  3RRN B;  3G2U A;  2RD0 A;  5A6C A;  1JCS A;  4LUN U;  3PUK A;  5LFA A;  2DCP A;  4U63 A;  1MX2 A;  2OND A;  2DZN A;  3JQ0 A;  3FEX A;  2ZIR A;  2IU1 A;  4F3V A;  3O4Z A;  3IKO B;  4BSX A;  4I43 A;  2RG8 A;  4BX9 A;  5C2Y A;  3DSU A;  1TNY A;  3E30 A;  5ENQ D;  1JPL A;  3LDZ A;  2KAT A;  4EZJ A;  5JHA A;  1SW6 A;  1MQS A;  5D66 A;  4C9B B;  2AWI A;  1FCH A;  4DX6 D;  5LX8 A;  1N94 A;  3DSS A;  4GA1 A;  1H2V C;  3CHS A;  3MGB A;  3PE4 A;  3TXM A;  3PH0 C;  4N5Q A;  3KS2 A;  4J8F A;  4IYP A;  4HOT A;  1TN6 A;  2P9I G;  4KZ0 A;  3Q73 A;  2XQ0 A;  3AU5 A;  4N39 A;  3SF4 A;  4GZ6 A;  3E4B A;  1TNZ A;  1OT8 A;  2X3M A;  3MA5 A;  2C0M A;  4W9R A;  4I2W A;  4MLP A;  2LXM A;  1PAQ A;  4OAU C;  3G2V A;  1XGW A;  2WXJ A;  1HO8 A;  4XKB A;  1O1S A;  4AJW A;  3LJN A;  3NB2 A;  1IHB A;  3CLJ A;  3HXD A;  4LNG A;  1DNP A;  3L6A A;  5KNH D;  4GTO A;  4GA0 A;  2Y69 E;  4TXP A;  3B7B A;  4HOQ A;  2WVI A;  2PQR A;  2VQ2 A;  3MKQ B;  2IFU A;  2WXF A;  5ITZ F;  1YA0 A;  3IXE A;  5FZR A;  2YHE A;  2EIN E;  3SGH A;  3ASO E;  3ZVV A;  2R03 A;  3OXG A;  4UWH A;  3TJP A;  2R5S A;  1Z3X A;  2X6K A;  2AJA A;  5CBO A;  2JAB A;  2P9P G;  3QAR A;  3Q9U C;  1KT1 A;  1TN8 A;  2FEZ A;  4UUC A;  3EHM A;  4RLY A;  4WNF A;  1N0R A;  4ZFH A;  3PZD A;  2BKK B;  3LY7 A;  4CCA A;  4WUY A;  4G23 A;  4N3A A;  3LVQ E;  3S7B A;  4I6G A;  3TWX A;  4CDN A;  1QQE A;  2XPI A;  3DXK G;  2L6B A;  4JHR A;  2LSV A;  4JHJ A;  1XNF A;  1JCQ A;  3PE3 A;  4I9E A;  2GRR B;  2P9U G;  1RZ4 A;  4FLB A;  5J90 A;  4XEI G;  4EZK A;  1S70 B;  3TXN A;  2ETC A;  2BF0 X;  1MX6 A;  4GAA A;  5ENR D;  4DI3 A;  5C1D A;  5FWQ A;  4G8L A;  4L7T A;  1O1R A;  1IKN D;  2KM4 A;  3FFL A;  1E8W A;  2CFZ A;  3Q75 A;  2X6F A;  4Z68 A;  4BSZ B;  3P2B A;  3HXE A;  1FT1 A;  3X2Q E;  3ASD A;  4Q96 A;  2PNN A;  1Q2Z A;  4GTT A;  2C2L A;  3PZ2 A;  4EPZ A;  4U8V D;  4A3T A;  2J49 A;  5AEN A;  2GW1 A;  5LOZ A;  1H0A A;  3FH5 A;  2F37 A;  3AG4 E;  3D9M A;  2EIL E;  2XGS A;  3FTV A;  1LTX A;  4NQ0 A;  3APD A;  3VLF A;  1EF1 C;  4HI8 A;  3ZN3 A;  2OOE A;  1MX4 A;  4U04 A;  5JJ6 A;  3S2A A;  4I1O B;  4ILI A;  3DSW A;  2F0Y A;  3FH8 A;  1DC2 A;  4GML A;  5G04 C;  5FIN A;  2P9K G;  2PM7 A;  3HRA A;  3MEK A;  1N4P A;  2XHE A;  3NBN B;  1HX8 A;  2CHZ A;  5FZQ A;  5AAR A;  1U3C A;  2XGM A;  2YQ8 A;  5EX0 A;  4DLQ A;  5EIB E;  1D8D A;  4FUL A;  3ZPJ A;  5AQA A;  2ETB A;  2JEK A;  4TUU A;  5T8I A;  2J09 A;  1LF8 A;  2XCC A;  3ZYL A;  3JYS A;  2MRI A;  5ANL A;  1KZP A;  3CST A;  4ANX A;  1AP7 A;  3G2T A;  5D2M C;  2CHW A;  3V2X A;  2X6J A;  3ESK A;  5EID A;  2J9Q A;  2IY0 C;  4A3V A;  4PS8 A;  4GZC A;  3DSV A;  4CYM D;  2WXH A;  2PL2 A;  5KWD A;  4ABN A;  5FQ4 A;  3CV0 A;  5BXU A;  3FU0 A;  5HQ8 A;  2XS1 A;  1BD8 A;  3C3Q A;  2EIJ E;  1L5J A;  1E90 A;  3AG1 E;  1NA3 A;  3HXB A;  4K5B A;  3PNL B;  4WAF A;  3ZYK A;  4DX1 A;  4E85 A;  3ULY A;  5B1A E;  3SFX A;  2XEN A;  4RQI A;  5CBN A;  3OXF A;  2LXL A;  1SZ9 A;  5AJD A;  4CGV A;  1DCE A;  1RW2 A;  4EQF A;  1YYH A;  4UQZ A;  4I9C A;  3DPY A;  1IQU A;  3ZW3 A;  5FQ7 A;  4BY6 A;  3ONL A;  4WWP A;  1BLX B;  4XZ4 A;  3UPV A;  5KBA A;  2J08 A;  4JA7 A;  4EBA A;  5BT1 A;  4GPK A;  3AU4 A;  4Y6W A;  3UKU G;  5JJT A;  3ABL E;  4J6I A;  4U0U A;  2LUH A;  3EHR A;  5H7P A;  4DUI A;  2J07 A;  2HM8 A;  3LKU A;  2WXK A;  2ZU6 B;  5KJM A;  3AG3 E;  5T3R A;  2J4B A;  2DZO A;  3QKY A;  4K5A B;  3AJI A;  3N71 A;  2XEH A;  1YMP A;  2NSZ A;  4GB9 A;  5A23 A;  4F1P A;  4YDO A;  4GCN A;  3QDN A;  4GYY A;  3V30 A;  5EN5 D;  3PZ4 A;  4YDY A;  4N2Q A;  3DEO A;  3UXG A;  3TWR A;  3FWV A;  2KBX A;  2X38 A;  4FU3 A;  3HVE A;  5CMW A;  4O1O A;  1ELK A;  2FI7 A;  3MCX A;  3FUI A;  1NL4 A;  1QBQ A;  5KJN A;  4HOS A;  4U0Z A;  4Q94 A;  3C5R A;  3FDH A;  3WXX A;  3ZXS A;  5CRV A;  3CGH A;  5CEA A;  2FO7 A;  4DK5 A;  3RJV A;  3JCK C;  1NA0 A;  5AQ7 A;  2VTB A;  4IRU A;  1A5E A;  5KJL A;  3CK7 A;  3ASG A;  2IQC A;  3CVX A;  3F6Q A;  3PDN A;  5HRY A;  2WXL A;  3RSE G;  2J4D A;  4GPM A;  1Y6I A;  4BFR A;  2GRQ B;  2VGX B;  4UWL A;  1Z3Y A;  3L08 A;  3RO3 A;  3DPD A;  2WXQ A;  2QY7 A;  2GRL A;  5ARG A;  1ELR A;  3UM2 A;  3APC A;  5BNW A;  2YIN A;  1N11 A;  3PVL A;  1UN9 A;  3ESL A;  3WG7 E;  3UM0 A;  3Q9N C;  4GTV A;  2B0O E;  1W3B A;  2AW6 A;  3FTU A;  4WNE A;  4GTR A;  4QFV A;  4U8H A;  4A63 B;  3MYV A;  3RRU A;  5KJK A;  4JVS A;  1UG3 A;  1QZ2 A;  4LNU D;  4N5C A;  3U64 A;  3S7J A;  4WNG A;  4RVB A;  3CVV A;  1A17 A;  3P1U A;  3HIZ A;  5ANR A;  4ILH B;  4K03 A;  3AG2 E;  3E32 A;  1WAO 1;  3QWW A;  4K0R A;  3NZS A;  4URK A;  2H6F A;  2XGO A;  5HS0 A;  4DJA A;  3APF A;  3FUK A;  4A55 A;  2PM6 A;  4DX7 D;  4G26 A;  4B89 A;  3SY2 A;  3ASN E;  5JJ7 A;  3CVY A;  2OVB A;  4C48 B;  1NZN A;  3Q7F A;  5DBK A;  3FUN A;  4V3I A;  2L9B A;  4UI9 C;  3PZ1 A;  2WXG A;  1NFI E;  4HOR A;  4YDW A;  3D9K A;  4O60 A;  4KVM A;  4G1T A;  4HFG A;  1UJJ A;  4IUL A;  4XIF A;  5BPP A;  1MYO A;  2MOW A;  3D9H A;  3J5P A;  5ENT D;  1HS6 A;  2LSU A;  5E76 A;  5BXO A;  3GYZ A;  3L16 A;  5CMY A;  4O1P A;  1OCC E;  4ME2 A;  3EU9 A;  3D9P A;  4B0Z A;  1E8X A;  3B7R L;  4UQX A;  5JA4 D;  3ZU7 B;  1TNO A;  3EHN A;  2XPY A;  3FH7 A;  3SBT B;  3W9G A;  3BG1 B;  4GZ3 A;  4AV7 A;  5ARF A;  4DRX E;  4TRQ A;  4GZ5 A;  3QK0 A;  1SA4 A;  4BER A;  4F53 A;  3CHR A;  4PS7 A;  1TJC A;  3RU0 A;  3FU6 A;  3UT4 A;  2V0P A; 
#chains in the Genus database with same CATH homology
 3UI2 A;  4N5Q A;  3NBN B;  5AAO A;  4DX5 D;  5CEA A;  2KXP C;  5AAR A;  4BES A;  2P2C P;  3TWX A;  4C48 B;  5AQB A;  4K5C A;  5ENP D;  5EIL A;  5AQ7 A;  2L6B A;  3TWQ A;  5EIB E;  1A5E A;  1BLX B;  5AQA A;  2ETB A;  5KBA A;  3TWU A;  1D9S A;  4HB5 A;  2A5E A;  4U96 D;  3F6Q A;  4B93 B;  2F8X K;  1DCQ A;  3ZKJ A;  4TUM A;  1OT8 A;  5HRY A;  3UTM A;  2QC9 A;  1NFI E;  4GPM A;  1K1A A;  1K1B A;  1WDY A;  4U8Y D;  4YDW A;  1S70 B;  5CEC B;  4O60 A;  2ETC A;  3V2O A;  5CED B;  2ZGD A;  3TWS A;  4OAU C;  4QQI A;  4BET A;  1MX6 A;  5ENR D;  2DVW A;  3TWV A;  2XZT G;  1AP7 A;  3EHR A;  4JB8 P;  4HRL A;  5AN8 A;  4G8L A;  3V2X A;  4LG6 A;  1IKN D;  5ENS D;  5JMN D;  3LJN A;  5HKP A;  3T9K A;  2ETA A;  1MYO A;  4LSZ E;  4DUI A;  3D9H A;  3W9F A;  3J5P A;  3NOG D;  1IHB A;  5ENO D;  4BSZ B;  2Y1L E;  5ENT D;  4Z68 A;  4HBD A;  5EID A;  4HRN A;  4ZHB A;  2Y0B G;  2BKG A;  1BI8 B;  2PNN A;  1N11 A;  5KNH D;  5BXO A;  3KEA A;  4O1P A;  4CYM D;  4G8K A;  3AAA C;  3EU9 A;  4CZ2 D;  4U8V D;  1N0Q A;  5KWD A;  1SVX A;  3JXJ A;  4HI9 A;  5BXU A;  1IXV A;  3Q9N C;  2DZO A;  1AWC B;  2HE0 A;  3B7B A;  4K5A B;  3J5Q B;  1BD8 A;  1OY3 D;  2B0O E;  3AJI A;  2RFA A;  3T8K A;  4QFV A;  5AQ9 A;  4OAV B;  2ZGG A;  2XEH A;  3TWT A;  4HNA D;  1UOH A;  2F37 A;  1YMP A;  3TWW A;  4A63 B;  1MJ0 A;  4ATZ D;  2RFM A;  3B95 A;  4F1P A;  3ZU7 B;  5JA4 D;  3JUE A;  5ITZ F;  4LNU D;  3IXE A;  3V79 K;  2V4H C;  5FIO A;  2XZD G;  3NOC D;  4NIK A;  1MX2 A;  3JXI A;  3V31 A;  4GMR A;  2DZN A;  3W9G A;  1K3Z D;  5EYL A;  1G3N B;  4K5B A;  1BU9 A;  2J8S D;  3SO8 A;  5CER B;  3V30 A;  4BEP A;  5EN5 D;  4HI8 A;  4HRM B;  4DX1 A;  4YDY A;  2NYJ A;  2MYO A;  1MX4 A;  1QYM A;  3DEO A;  2DWZ A;  2AJA A;  1YCS B;  3UXG A;  3TWR A;  5KNG A;  4J8Y A;  5CBO A;  2KBX A;  2XEN A;  5CBN A;  2JAB A;  3DEP A;  4DRX E;  4F6R D;  4DX2 A;  4O1O A;  5EYP F;  5ENQ D;  2VGE A;  2F8Y A;  4HLL A;  3Q9U C;  1DC2 A;  4BER A;  1SW6 A;  4UUC A;  5D66 A;  5HS0 A;  2V5Q C;  5FIN A;  1TR4 A;  4HQD A;  1YYH A;  4RLY A;  3EHQ A;  4J7W A;  1N0R A;  1BI7 B;  3HG0 D;  4DX6 D;  4ZFH A;  1WG0 A;  2QYJ A;  3C5R A;  4U95 D;  3ZUV B;  2BKK B;  4DX7 D;  2XEE A;  3HRA A;  2FO1 E;  3ZNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...