2ETAA

Crystal structure of the ankyrin repeat domain of the trpv2
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
245
structure length
239
Chain Sequence
FDRDRLFSVVSRGVPEELTGLLEYLRWNSKYLTDSAYTEGSTGKTCLMKAVLNLQDGVNACIMPLLQIDKDSGNPKPLVNAQCTDEFYQGHSALHIAIEKRSLQCVKLLVENGADVHLRACGRFFQFYFGELPLSLAACTKQWDVVTYLLENPHQPASLEATDSLGNTVLHALVMIADNSPENSALVIHMYDGLLQMGARLCPTVQLEEISNHQGLTPLKLAAKEGKIEIFRHILQREF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Transient receptor potential cation channel subfamily V memb
publication title Structure of the N-terminal Ankyrin Repeat Domain of the TRPV2 Ion Channel.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 85
structure length 239
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2etaA00
2AJAA 3TWRA 4DX1A 3SO8A 5AAOA 3J5QB 3TWSA 5AQ9A 1BLXB 4GPMA 4UUCA 4DRXE 4YDYA 1MX2A 1UOHA 5ENSD 1N11A 1YYHA 3DEPA 4K5BA 4U8YD 4OAVB 1SVXA 4LSZE 1BD8A 5HRYA 5FIOA 2DWZA 2VGEA 4O1PA 4HNAD 5ENRD 2DVWA 2ETAA 4U96D 1MJ0A 4BESA 1N0RA 2HE0A 4K5AB 4U95D 4ZFHA 3W9FA 4F6RD 4F1PA 4BSZB 3AAAC 1DC2A 2ETBA 3IXEA 4U8VD 5FINA 3TWVA 4CZ2D 1K3ZD 4QQIA 3TWUA 5ITZF 2FO1E 3NOGD 1BU9A 3LJNA 4TUMA 5EIBE 2DZOA 4LNUD 3UTMA 3V2XA 1BI8B 2A5EA 3ZNGA 2F8YA 2KXPC 4DX6D 2QYJA 3DEOA 2J8SD 2XZDG 4QFVA 3ZKJA 3JXIA 5KWDA 2BKGA 2JABA 3TWQA 3AJIA 5CEDB 2DZNA 4ATZD 4O1OA 5ENQD 4YDWA 4DX5D 3TWTA 5AQAA 3T8KA 1MYOA 2XZTG 2B0OE 1NFIE 3EHQA 1BI7B 1YMPA 1QYMA 4DX7D 3JXJA 3C5RA 3KEAA 1OT8A 3J5PA 4BEPA 4OAUC 1N0QA 3UI2A 3Q9UC 5EYPF 4BERA 2F37A 3HG0D 5KNGA 1D9SA 1OY3D 1K1BA 5ENTD 2PNNA 1IXVA 3W9GA 5BXOA 1SW6A 2XENA 3TWWA 4G8LA 4O60A 2V5QC 5EN5D 5ENOD 1DCQA 3T9KA 1IHBA 3B7BA 4HRNA 1TR4A 1G3NB 4HB5A 3NOCD 4RLYA 1AP7A 1MX6A 4GMRA 5AN8A 4HQDA 2F8XK 5AQ7A 4C48B 3ZU7B 4K5CA 3V2OA 5ENPD 3ZUVB 4LG6A 3Q9NC 1YCSB 5D66A 5JMND 4NIKA 2ZGGA 4G8KA 4A63B 1WG0A 5CBNA 3UXGA 2MYOA 2XEEA 1MX4A 4B93B 2ZGDA 4DX2A 3NBNB 2NYJA 5BXUA 2QC9A 4N5QA 5EIDA 4HI8A 2ETCA 3B95A 3F6QA 5CERB 1IKND 4J7WA 5CEAA 4HRMB 2BKKB 4BETA 4HBDA 5KNHD 1A5EA 1AWCB 3V30A 3TWXA 5KBAA 5EILA 2Y0BG 4HI9A 5AARA 5AQBA 4Z68A 5HS0A 3D9HA 3V31A 5JA4D 4HLLA 4J8YA 4DUIA 3V79K 2V4HC 4HRLA 4ZHBA 1K1AA 1WDYA 2RFAA 2Y1LE 4CYMD 5HKPA 5CBOA 2KBXA 3EHRA 1S70B 3JUEA 5EYLA 3EU9A 4JB8P 2L6BA 2P2CP 3HRAA 2RFMA 2XEHA 5CECB
chains in the Genus database with same CATH superfamily
4DX1A 3J5QB 3TWSA 3T5XA 1N94A 3S7BA 4OAVB 2UY1B 4TRQA 1BD8A 4RG9A 5HRYA 3RK6A 2DWZA 4URKA 5EX0A 4ME2A 5G04C 4BSXA 2A5UA 4XX5A 3RKVA 4U95D 4JA7A 4WUYA 4F1PA 2WXQA 3SZ7A 3IXEA 4QQIA 3ZRHA 4JD2G 3APDA 4N3AA 4QFVA 2BKGA 4FJZA 3AJIA 2XGMA 3HVEA 2WQ6A 3T5VA 1O1SA 5AQAA 3D9LA 1NFIE 3AU4A 2JLBA 2WMNA 4L1BA 4GMLA 1N0QA 3U64A 3Q9UC 5T3RA 1ZBPA 4PDXA 3TWWA 2LO6A 4B8AA 2P9IG 3CVUA 3UKUG 3MCXA 4U8HA 5AN8A 5FQ6A 4J8SA 3ESLA 4G2VA 2XGSA 3O48A 3CVWA 3FY4A 2WXRA 4B89A 3FUJA 4OVVA 5EIDA 3PZ3A 1HG5A 2WXIA 1SZ9A 2V4LA 2VSOE 1A5EA 3JCKC 3FU6A 2I1JA 3L17A 4DUIA 4NRHB 3LCAA 2YHCA 3HXDA 2EIME 2ONDA 4D10C 4ANVA 3TWRA 4FADA 4JXTA 3RSEG 2AXUA 4UQYA 5ENSD 1N11A 4U8YD 3LEWA 3MKRA 3RIBA 4FHJA 3FP3A 2AW6A 3ZPJA 5J08A 4BESA 1DVPA 4GTSA 2FULA 4HVBA 3AAAC 2OEVA 3SNXA 4G1TA 1N95A 3L13A 3SFZA 3MV2B 3QAQA 5KWDA 3QNKA 5G2NA 1X81A 3QJZA 3CVPA 4RG6A 4OAUC 3IV0A 2F37A 3CLJA 1OY3D 3LKUA 4V3IA 2P58C 2KATA 1TN7A 3PDNA 3SQVA 2VTBA 4N2QA 3NB2A 3NF1A 2AXVA 4GYWA 1OWLA 5D66A 3T8MA 3CQCB 3QC1A 1K8KG 1U2VG 2NYJA 2IONA 3JQ1A 1IKND 1N52A 5AYWD 5KNHD 3SHFA 4HOTA 5AARA 3APFA 2X6KA 4TV3A 4HRLA 4MLPA 2VGXA 2Y1LE 4M3OA 4BFRA 3B13A 1H2VC 3S7FA 4XIFA 4JW1A 5G05C 4NQ0A 3DWLG 2LSUA 2KCLA 1MX2A 4XEIG 3DEPA 1HX8A 5BNWA 4GYOA 1SA4A 4FU3A 5LCWJ 3NZUA 2WXKA 3U66A 4OVUA 5T8IA 4UI9J 4F6RD 4U8VD 5ITZF 1NI1A 3DXKG 3VLFA 1H19A 3V2XA 1TNZA 3PUJA 4I1OB 1N4SA 4J8EA 3JXIA 5IY5E 2DZNA 1S64A 4O1OA 3RRNB 3Q47B 3MV3B 2VSXE 5B3SE 2Y4TA 2VSNA 5JJ6A 2OV8A 3I3NA 5G55A 3RO3A 2R17C 2J09A 3RAUA 4PH4B 3ASOE 3CHOA 3ASNE 2WQHA 3DPDA 2FEZA 3ISMC 4K03A 3Q9NC 2X6FA 2ZIRA 1JWGA 4GTMA 4GTQA 2QC9A 1LF8A 2ETCA 3TGOA 3CQGB 2P9SG 3PEVB 5EILA 4WWOA 5CMWA 4GA2A 4BTBA 3S2AA 1IQUA 3CGHA 4EQFA 2AJAA 2YQ8A 3UT4A 5ARFA 4KVMA 2ZISA 2IFUA 1ZU2A 1UOHA 1HG2A 2PQNA 4GTRA 2IOSA 3TJPA 4JEHA 3FUIA 3X2QE 1LTXA 2XGOA 4I1AA 3LJNA 4Q69A 4LNUD 2X6HA 4ILIA 4H7YA 2YINA 2C2LA 5KJNA 3UT8A 1E7VA 4UI9K 3CVYA 2CFZA 4YVOA 3W9GA 4BX8A 2XENA 1O1TA 4Y6CA 3DSXA 4FA6A 3FEYA 2V0PA 1DCQA 4HQDA 2FO7A 2GROB 3IHYA 3FHEA 1OCZE 3MKQA 3FU3A 2H6GA 1HO8A 4F1SA 4DX2A 4BY6A 3GZ1A 2LAHA 4F3VA 1XNFA 4TXQA 3Q5MA 4PS7A 1OCOE 4HOQA 3I4GA 3HIZA 3D9NA 3FUDA 1Q2ZA 3AS8A 5KJLA 3CHSA 1TNYA 2PL2A 4JHKA 3G2SA 4LUNU 3FUFA 3UKRG 1RW2A 5LP0A 2P2CP 2I2OA 4J8FA 3D9IA 2PM7A 3SO8A 5EDSA 5CRUA 5AQ9A 3U3WA 1HZ4A 3PZ1A 4HNAD 2IY0C 4ILHB 1NL4A 4BT8A 1OCRE 4A55A 3CVNA 3W9FA 3Q15A 3HVEB 2EINE 3E33A 2ZXWE 2Y69E 3CHPA 5JJ7A 1OWMA 1SA5A 4WNFA 2LNIA 4I1MA 3TWQA 3FUEA 3TWTA 1UG3A 3T8KA 3CK7A 2L6JA 3D9OA 5ARGA 3RO2A 3EU5A 2WXLA 3AG1E 3IKOB 5KNGA 4LNBA 3BU8A 3AU5A 4KXKB 4HRNA 3SY2A 1KPSB 1P5QA 2P9NG 1JWFA 2PM6A 2GRRB 4LG6A 1TEZA 3MA5A 5CBNA 3UXGA 5AENA 3Q78A 4B93B 3PNLB 4EZKA 3CHRA 2GRNB 4I43A 3NQPA 4F7AA 1AWCB 4DLOA 1DNPA 3OXLA 1JUQA 2I6HA 3L54A 3CVXA 5CBOA 3DPYA 2KBXA 4WNEA 5LFAA 3KAEA 4ANUA 3HXFA 4F53A 3SFYA 4C0EA 4DRXE 4YDYA 3GZ2A 3FTZA 2L9BA 4KZCA 3PRZA 3OAWA 4CRWA 1N4RA 3FTSA 3ZEFA 2IO3C 4U0ZA 4EBAA 1TN6A 4HXIA 5T4YA 4EZLA 2GGFA 3FWVA 4DX6D 2JABA 4U0SA 3QARA 1Z6TA 4FHKA 5ENQD 5C2YA 2WXMA 3KEZA 3P2BA 2IF4A 5C1DA 2EIJE 2LXLA 2VTBB 3CVLA 3UX4A 1K1BA 5ENTD 4K0RA 3UT7A 3OXFA 1GW6A 5EX3A 5FZSA 1S63A 3HHMA 5D0OD 4GMJA 3ZU7B 1E8WA 3ZUVB 1YCSB 4NIKA 4EZJA 4GZ6A 3D9JA 1HH8A 2H6IA 4AY6A 3TG5A 1WAO1 3EIQC 4HS2A 4BTAA 2BKKB 4XI0A 5G05J 4I2WA 3UM1A 1HF8A 2XPZA 3CV0A 3ZFWA 3AG4E 4HLEA 3N71A 2GRPB 2AVPA 4I17A 3TG4A 1S70B 4OYSA 3BUAA 4M7CA 3UQ3A 5HI7A 3AG3E 3Q73A 4GPMA 2WPVA 1LD8A 2LUHA 2MRIA 4Q94A 2CFUA 1DCEA 3CVQA 3SF4A 5FINA 2FO1E 4IYPA 4A1GA 4GYYA 2J08A 3ZW3A 3G2UA 2MHKA 3LXUX 5CEDB 4KMOA 2B0OE 4GA0A 1KLXA 3JQ0A 3DSTA 3JUIA 3FUHA 3PEUB 4O6FA 5KCMA 2WXJA 3SFXA 1TR4A 2GW1A 3LDZA 2CHXA 3CSTA 3ABLE 5AQ7A 2F8XK 3LS8A 3FU5A 5JMND 1IYGA 3VLEA 3KS2A 2IO2C 3R9AB 1V54E 1Z3XA 3ABME 4BWRA 5ENNA 3PE3A 2XRZA 3B95A 4J7WA 2WVIA 4WNGA 3QWWA 3U9WA 3V30A 1H0AA 1QQEA 2P9KG 3FH5A 2CG2A 3V31A 5JA4D 4UWKA 4AJWA 2J9QA 3E4BA 1SQMA 5CCMA 2XEHA 3BG0B 3CKCA 4LEUA 2X3MA 4C0MA 3EJNA 1N0RA 1KZPA 2MOWA 1FVFA 2C0LA 5B1AE 1DC2A 4UWHA 3FFLA 3ASDA 2WM9A 2WXGA 1UN8A 2A4ZA 4APOA 4CEMA 3DEOA 2XZDG 1KT0A 3C3QA 3ONKA 2DIWA 3E34A 1NZNA 1MYOA 3EHQA 2LXMA 1QYMA 3I4RB 2L0IA 2XEVA 3ZGQA 4U07A 3MKQB 3ZXPA 4G8LA 1H6KA 5ENOD 3FH7A 4R7LA 1FVHA 3MEKA 4RLYA 3SD5A 4C48B 2L0TB 2YNQA 4J6IA 3DXMG 3B7TA 3C98A 4GCOA 4NURA 1SZAA 3TL5A 4AXHA 1KT1A 4TUUA 4YNDA 3IHVA 1UJJA 4HBDA 2EQXA 3D3MA 3ZHEA 4UQXA 4CGWA 4CDRA 3Q79A 1TJFA 1Z5SC 2KM4A 5EYLA 2L6BA 4B0ZA 1ELRA 2Y4UA 4CCAA 4Q96A 4KYOB 4JL0A 4AIFA 1YYHA 3KSLA 3FDHA 2E2EA 1FT2A 3LYAA 3Q7FA 2DVWA 3TAXA 4UWFA 4DLQA 1WY6A 4RSYA 1INZA 2HE0A 4IRUA 1H6PA 3VTYA 2QZAA 2ETBA 2NXPA 2NSZA 4P29A 5AJLA 5CMYA 3AS5A 3DSVA 1H6OA 1N9AA 1U3CA 3RU0A 3URZA 2XZTG 2XQ0A 3TXNA 1OT8A 5KJMA 5DBKA 4BEPA 1OXJA 2J07A 4FULA 1FPPA 2P9LG 3D9MA 3FTXA 5EN5D 4ANXA 3FU0A 3NOCD 1AP7A 3HXCA 3FTUA 3EDTB 3IBEA 4G11A 3SBSA 4U0UA 2I9CA 3GW4A 4GU5A 2BUGA 1A17A 5LOZA 2J4DA 3L82A 4HRMB 4BETA 2IU1A 4I6GA 5AIJA 2Y0BG 3NZSA 4HI9A 4Z68A 3PVLA 1TJCA 4J8YA 3R7QA 3V79K 3UIPC 4Y6WA 3ZXSA 4FLBA 1UW4B 4ABNA 2XCBA 3HRAA 4LNGA 4WWPA 1E8YA 3U4TA 1UJKA 5BT1A 3RRMB 3ASGA 3FTVA 2XS1A 4MBGA 5FJYA 5FIOA 4ANWA 3ZYQA 3FEXA 5M72A 3CHQA 5CCLA 4CDNA 2JEKA 3P1UA 1OCCE 4L7TA 3ZKJA 4G23A 4JHJA 1ZB1A 2HO1A 4L2YA 2VYIA 5J90A 3L16A 2WB2A 1BI7B 2PQRA 1O5MA 5FT9A 4AVXA 3HG0D 3FUMA 2AWIA 3L6AA 4FP7A 3PZ2A 2BEDA 3PZDA 5A23A 3WXXA 2XHEA 1G3NB 1B89A 1TYQG 4AM9A 3ASFA 3V2OA 5CRVA 4CGVA 2ZGGA 2UWJG 2R59A 3HYMB 1Y8MA 4W9RA 3DRAA 4AP2A 3ZVVA 4A1SA 2E0IA 3D9KA 4MRUA 3SGHA 1L5JA 3S7DA 4JA9A 4KZ0A 4ZHBA 2RFAA 2WXNA 3EHRA 3E37A 4GCNA 5BW8C 3PREA 5AAOA 3G2TA 3WG7E 4NACA 4K5BA 4U7EB 2CHZA 3FTWA 3CK9A 4N3CA 2X6IA 4PS8A 4A3VA 4UQZA 2DYSE 3MYVA 4ZFHA 2ILRA 2R03A 1JCQA 4N3BA 3QK0A 1V55E 2QYJA 4GZCA 4ATZD 3EIJA 3ULYA 1D8DA 4AEZC 3C5RA 1W3BA 3J5PA 4DK5A 3ZYLA 3R9MA 1E7UA 3ML9A 3GZSA 3ULQA 2J49A 4HB5A 4YVQC 4DPRA 4GMRA 2X38A 3LY7A 2WXPA 1JCRA 4ILGA 2Y3AA 5JHAA 2XEEA 2OVFA 2R02A 5CERB 4G24A 1U3DA 4DJAA 2IEJA 3KSQA 5A7DB 3L9TA 4EBAG 2LSVA 3QWPA 4FLHA 2DCPA 5ANLA 4DI4A 1Z3YA 5D0QD 4JVSA 4KT6B 3E30A 2XRYA 1HFAA 4L2LA 2XS8A 2GRQB 1QZ2A 4UWGA 2VGXB 1BLXB 3QWVA 2BTDA 5D2MC 3LY9A 4O1PA 3ZYMA 3Q75A 4PS3A 4K5AB 1JPLA 3TWVA 4N39A 1OWPA 3NOGD 4GPKA 2F8YA 3ONLA 1N4QA 3HXEA 2H6FA 3GYZA 2KCVA 4YDWA 4DX5D 2M63A 4CDMA 1EYHA 4U04A 2EIKE 3PUKA 3EHMA 4FC8A 3CR3A 1D9SA 3CKBA 4HOUA 4GZ5A 1IXVA 1MHQA 4GA1A 2KZTA 3K9IA 4GZ3A 3FTYA 3B7BA 1IHGA 1MX6A 3FULA 4PUCA 5ENPD 2QFCA 5A6CA 3B7SA 3B7RL 1NA0A 3ZHEB 3BQOA 3RJVA 1N54A 3EHNA 4N5QA 4EPZA 1PY1A 3CIAA 1S0PA 2F0YA 2OOEA 2C0MA 4ATGA 2HM8A 3CSFA 3QDNA 5FQ8A 2DBAA 1KZOA 3B7UX 3ENEA 5CECB 2V5FA 4UUCA 3ZN3A 4YDEA 2VGEA 4HORA 1YA0A 4I6JA 5BV0A 1RZ4A 4XI9A 1EF1C 2UY1A 1K3ZD 5E76A 2XPIA 3UM2A 3HDXA 1NA3A 2DZOA 1BI8B 3LJ3A 3BG1B 3R7RA 2VQ2A 4GB9A 4MS6A 2P9PG 4G25A 1VDYA 4TXPA 3OXGA 1BPOA 3IEGA 2HYZA 2IQCA 2FF4A 1FCHA 1EDUA 4EECA 5FZRA 3T9KA 1IHBA 5H7PA 2NC9A 4K5CA 2OCCE 4GTVA 5BUZA 1TNOA 3QB2A 3SBTB 3MZLB 2ZU6B 1QNFA 5CEAA 4TXRA 4JZYA 1EPUA 4BT9A 1H2TC 3TWXA 4B94A 3KD7A 3BEEA 3DSWA 3HXBA 2LAIA 2V4HC 3CK8A 3PE4A 3D9PA 3L22A 3FH8A 3EU9A 1FT1A 5FZQA 3ASHA 4HFGA 2KCKA 3E32A 1N4PA 3RRUA 2I1KA 4MKTA 4XKBA 2QY7A 5ENRD 1HE8A 1HXIA 2OVBA 2KC7A 4BSZB 4BX9A 1E8ZA 3MX3A 4E85A 1BU9A 4TUMA 5CHEE 3ESKA 2BF0X 2J8SD 3FUKA 4GTTA 3Q49B 3QOUA 4CT0A 1LD7A 3UI2A 2PNNA 3I5PA 4XE0A 4O60A 2V5QC 1O1RA 4WAFA 3DSSA 4I6EA 3ZIMA 4XKCA 4YDOA 4G8KA 4A3TA 1WG0A 1E96B 2B6CA 1MX4A 2ZGDA 2RD0A 3MJWA 2RG8A 4AOFA 3UM0A 4HI8A 3F6QA 3PZ4A 4WNDA 1E90A 2FI7A 3CEQA 5FQ7A 2WQ7A 4G26A 1TN8A 2CHWA 3C72A 4LCTA 5FTPA 5HS0A 2GRLA 2YHEA 3AG2E 1WDYA 4CYMD 4L9PA 5HKPA 3UPVA 2WXHA 2R5SA 2Q7FA 3L08A 2H6HA 3G2WA 1QBQA 2R2LA 4JEUA 4CT4A 4DI3A 1NP7A 1SVXA 4LSZE 3AS4A 1E8XA 3VLDA 4GZDA 3UMVA 1OWNA 3OTNA 4HOSA 3VTXA 4H7XA 4U96D 3Q7AA 1OUVA 1JCSA 2VGYA 1UN9A 4U63A 5EIBE 2A5EA 3ZNGA 1WM5A 3PH0C 1TNBA 4AV7A 4KVOA 2OEWA 4RQIA 5E75A 1PC2A 3EUVA 5LCWC 1XGWA 4N2SA 2R05A 1YMPA 1ELWA 3KEAA 5JJTA 4UI9C 5BV1A 5FWQA 4GTOA 1IQRA 2AXZA 2RKKA 1SW6A 2X6JA 4AY5A 4ACKA 3ZYKA 2WXOA 5G04J 4JC8A 3LY8A 3FUNA 4IN3B 5FQ4A 3LPZA 3UM3A 5LX8A 1MZCA 2MYOA 1D8EA 4E6HA 4J8DA 2VJ8A 5KJKA 3UINC 2J4BA 4GTPA 2P9UG 2DYRE 3MGBA 5AQBA 4X8QA 1Y6IA 4HLLA 2VSYA 5EKQD 3QKYA 5B1BE 5BPPA 2GRMA 3JUEA 4JB8P 1PAQA 3ULEG 3S7JA 2RFMA 4I9EA 4EHMA 3TXMA 4KBQA 5AJDA 4GAAA 2IOLA 2WMOA 4APFA 2ETAA 1MJ0A 4B8CB 3Q4AB 3C3OA 2CG3A 3APCA 2PZIA 4CZ2D 3TWUA 4UWLA 4ACLA 3UTMA 5JHBA 2KXPC 3G2VA 5ANRA 3UIOC 1ELKA 4WWNA 3C3RA 2HR2A 3PNTB 2KZTB 3LVQE 4DX7D 3JXJA 2V8SE 4JPSA 3DBSA 4BERA 5EYPF 3ABKE 5BXOA 3ML8A 3NAWA 1MQSA 4N5CA 5DIZA 4LERA 2EILE 2WXFA 3PS6A 4I9CA 4LRZA 4A63B 4FJYA 3NBNB 4RVBA 5BXUA 1OWOA 4J0UA 3LVRE 2IJGX 3CVVA 4L23A 1HU3A 3CHMA 4I2ZA 3O4ZA 1TNUA 2XCCA 1HS6A 3JYSA 5KBAA 5HQ8A 1X5BA 3D9HA 4XZ4A 2XPYA 3DSUA 2QYUA 3SI5A 1K1AA 4C9BB 4JHRA 2FBNA 4IULA 3UUXA 1H2UA
chains in the Genus database with same CATH topology
2AJAA 3TWRA 4DX1A 3SO8A 5AAOA 3J5QB 3TWSA 5AQ9A 1BLXB 4GPMA 4UUCA 4DRXE 4YDYA 1MX2A 1UOHA 5ENSD 1N11A 1YYHA 3DEPA 4K5BA 4U8YD 4OAVB 1SVXA 4LSZE 1BD8A 5HRYA 5FIOA 2DWZA 2VGEA 4O1PA 4HNAD 5ENRD 2DVWA 2ETAA 4U96D 1MJ0A 4BESA 1N0RA 2HE0A 4K5AB 4U95D 4ZFHA 3W9FA 4F6RD 4F1PA 4BSZB 3AAAC 1DC2A 2ETBA 3IXEA 4U8VD 5FINA 3TWVA 4CZ2D 1K3ZD 4QQIA 3TWUA 5ITZF 2FO1E 3NOGD 1BU9A 3LJNA 4TUMA 5EIBE 2DZOA 4LNUD 3UTMA 3V2XA 1BI8B 2A5EA 3ZNGA 2F8YA 2KXPC 4DX6D 2QYJA 3DEOA 2J8SD 2XZDG 4QFVA 3ZKJA 3JXIA 5KWDA 2BKGA 2JABA 3TWQA 3AJIA 5CEDB 2DZNA 4ATZD 4O1OA 5ENQD 4YDWA 4DX5D 3TWTA 5AQAA 3T8KA 1MYOA 2XZTG 2B0OE 1NFIE 3EHQA 1BI7B 1YMPA 1QYMA 4DX7D 3JXJA 3C5RA 3KEAA 1OT8A 3J5PA 4BEPA 4OAUC 1N0QA 3UI2A 3Q9UC 5EYPF 4BERA 2F37A 3HG0D 5KNGA 1D9SA 1OY3D 1K1BA 5ENTD 2PNNA 1IXVA 3W9GA 5BXOA 1SW6A 2XENA 3TWWA 4G8LA 4O60A 2V5QC 5EN5D 5ENOD 1DCQA 3T9KA 1IHBA 3B7BA 4HRNA 1TR4A 1G3NB 4HB5A 3NOCD 4RLYA 1AP7A 1MX6A 4GMRA 5AN8A 4HQDA 2F8XK 5AQ7A 4C48B 3ZU7B 4K5CA 3V2OA 5ENPD 3ZUVB 4LG6A 3Q9NC 1YCSB 5D66A 5JMND 4NIKA 2ZGGA 4G8KA 4A63B 1WG0A 5CBNA 3UXGA 2MYOA 2XEEA 1MX4A 4B93B 2ZGDA 4DX2A 3NBNB 2NYJA 5BXUA 2QC9A 4N5QA 5EIDA 4HI8A 2ETCA 3B95A 3F6QA 5CERB 1IKND 4J7WA 5CEAA 4HRMB 2BKKB 4BETA 4HBDA 5KNHD 1A5EA 1AWCB 3V30A 3TWXA 5KBAA 5EILA 2Y0BG 4HI9A 5AARA 5AQBA 4Z68A 5HS0A 3D9HA 3V31A 5JA4D 4HLLA 4J8YA 4DUIA 3V79K 2V4HC 4HRLA 4ZHBA 1K1AA 1WDYA 2RFAA 2Y1LE 4CYMD 5HKPA 5CBOA 2KBXA 3EHRA 1S70B 3JUEA 5EYLA 3EU9A 4JB8P 2L6BA 2P2CP 3HRAA 2RFMA 2XEHA 5CECB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AJA A;  3TWR A;  4DX1 A;  3SO8 A;  5AAO A;  3J5Q B;  3TWS A;  5AQ9 A;  1BLX B;  4GPM A;  4UUC A;  4DRX E;  4YDY A;  1MX2 A;  1UOH A;  5ENS D;  1N11 A;  1YYH A;  3DEP A;  4K5B A;  4U8Y D;  4OAV B;  1SVX A;  4LSZ E;  1BD8 A;  5HRY A;  5FIO A;  2DWZ A;  2VGE A;  4O1P A;  4HNA D;  5ENR D;  2DVW A;  2ETA A;  4U96 D;  1MJ0 A;  4BES A;  1N0R A;  2HE0 A;  4K5A B;  4U95 D;  4ZFH A;  3W9F A;  4F6R D;  4F1P A;  4BSZ B;  3AAA C;  1DC2 A;  2ETB A;  3IXE A;  4U8V D;  5FIN A;  3TWV A;  4CZ2 D;  1K3Z D;  4QQI A;  3TWU A;  5ITZ F;  2FO1 E;  3NOG D;  1BU9 A;  3LJN A;  4TUM A;  5EIB E;  2DZO A;  4LNU D;  3UTM A;  3V2X A;  1BI8 B;  2A5E A;  3ZNG A;  2F8Y A;  2KXP C;  4DX6 D;  2QYJ A;  3DEO A;  2J8S D;  2XZD G;  4QFV A;  3ZKJ A;  3JXI A;  5KWD A;  2BKG A;  2JAB A;  3TWQ A;  3AJI A;  5CED B;  2DZN A;  4ATZ D;  4O1O A;  5ENQ D;  4YDW A;  4DX5 D;  3TWT A;  5AQA A;  3T8K A;  1MYO A;  2XZT G;  2B0O E;  1NFI E;  3EHQ A;  1BI7 B;  1YMP A;  1QYM A;  4DX7 D;  3JXJ A;  3C5R A;  3KEA A;  1OT8 A;  3J5P A;  4BEP A;  4OAU C;  1N0Q A;  3UI2 A;  3Q9U C;  5EYP F;  4BER A;  2F37 A;  3HG0 D;  5KNG A;  1D9S A;  1OY3 D;  1K1B A;  5ENT D;  2PNN A;  1IXV A;  3W9G A;  5BXO A;  1SW6 A;  2XEN A;  3TWW A;  4G8L A;  4O60 A;  2V5Q C;  5EN5 D;  5ENO D;  1DCQ A;  3T9K A;  1IHB A;  3B7B A;  4HRN A;  1TR4 A;  1G3N B;  4HB5 A;  3NOC D;  4RLY A;  1AP7 A;  1MX6 A;  4GMR A;  5AN8 A;  4HQD A;  2F8X K;  5AQ7 A;  4C48 B;  3ZU7 B;  4K5C A;  3V2O A;  5ENP D;  3ZUV B;  4LG6 A;  3Q9N C;  1YCS B;  5D66 A;  5JMN D;  4NIK A;  2ZGG A;  4G8K A;  4A63 B;  1WG0 A;  5CBN A;  3UXG A;  2MYO A;  2XEE A;  1MX4 A;  4B93 B;  2ZGD A;  4DX2 A;  3NBN B;  2NYJ A;  5BXU A;  2QC9 A;  4N5Q A;  5EID A;  4HI8 A;  2ETC A;  3B95 A;  3F6Q A;  5CER B;  1IKN D;  4J7W A;  5CEA A;  4HRM B;  2BKK B;  4BET A;  4HBD A;  5KNH D;  1A5E A;  1AWC B;  3V30 A;  3TWX A;  5KBA A;  5EIL A;  2Y0B G;  4HI9 A;  5AAR A;  5AQB A;  4Z68 A;  5HS0 A;  3D9H A;  3V31 A;  5JA4 D;  4HLL A;  4J8Y A;  4DUI A;  3V79 K;  2V4H C;  4HRL A;  4ZHB A;  1K1A A;  1WDY A;  2RFA A;  2Y1L E;  4CYM D;  5HKP A;  5CBO A;  2KBX A;  3EHR A;  1S70 B;  3JUE A;  5EYL A;  3EU9 A;  4JB8 P;  2L6B A;  2P2C P;  3HRA A;  2RFM A;  2XEH A;  5CEC B; 
#chains in the Genus database with same CATH topology
 4DX1 A;  3J5Q B;  3TWS A;  3T5X A;  1N94 A;  3S7B A;  4OAV B;  2UY1 B;  4TRQ A;  1BD8 A;  4RG9 A;  5HRY A;  3RK6 A;  2DWZ A;  4URK A;  5EX0 A;  4ME2 A;  5G04 C;  4BSX A;  2A5U A;  4XX5 A;  3RKV A;  4U95 D;  4JA7 A;  4WUY A;  4F1P A;  2WXQ A;  3SZ7 A;  3IXE A;  4QQI A;  3ZRH A;  4JD2 G;  3APD A;  4N3A A;  4QFV A;  2BKG A;  4FJZ A;  3AJI A;  2XGM A;  3HVE A;  2WQ6 A;  3T5V A;  1O1S A;  5AQA A;  3D9L A;  1NFI E;  3AU4 A;  2JLB A;  2WMN A;  4L1B A;  4GML A;  1N0Q A;  3U64 A;  3Q9U C;  5T3R A;  1ZBP A;  4PDX A;  3TWW A;  2LO6 A;  4B8A A;  2P9I G;  3CVU A;  3UKU G;  3MCX A;  4U8H A;  5AN8 A;  5FQ6 A;  4J8S A;  3ESL A;  4G2V A;  2XGS A;  3O48 A;  3CVW A;  3FY4 A;  2WXR A;  4B89 A;  3FUJ A;  4OVV A;  5EID A;  3PZ3 A;  1HG5 A;  2WXI A;  1SZ9 A;  2V4L A;  2VSO E;  1A5E A;  3JCK C;  3FU6 A;  2I1J A;  3L17 A;  4DUI A;  4NRH B;  3LCA A;  2YHC A;  3HXD A;  2EIM E;  2OND A;  4D10 C;  4ANV A;  3TWR A;  4FAD A;  4JXT A;  3RSE G;  2AXU A;  4UQY A;  5ENS D;  1N11 A;  4U8Y D;  3LEW A;  3MKR A;  3RIB A;  4FHJ A;  3FP3 A;  2AW6 A;  3ZPJ A;  5J08 A;  4BES A;  1DVP A;  4GTS A;  2FUL A;  4HVB A;  3AAA C;  2OEV A;  3SNX A;  4G1T A;  1N95 A;  3L13 A;  3SFZ A;  3MV2 B;  3QAQ A;  5KWD A;  3QNK A;  5G2N A;  1X81 A;  3QJZ A;  3CVP A;  4RG6 A;  4OAU C;  3IV0 A;  2F37 A;  3CLJ A;  1OY3 D;  3LKU A;  4V3I A;  2P58 C;  2KAT A;  1TN7 A;  3PDN A;  3SQV A;  2VTB A;  4N2Q A;  3NB2 A;  3NF1 A;  2AXV A;  4GYW A;  1OWL A;  5D66 A;  3T8M A;  3CQC B;  3QC1 A;  1K8K G;  1U2V G;  2NYJ A;  2ION A;  3JQ1 A;  1IKN D;  1N52 A;  5AYW D;  5KNH D;  3SHF A;  4HOT A;  5AAR A;  3APF A;  2X6K A;  4TV3 A;  4HRL A;  4MLP A;  2VGX A;  2Y1L E;  4M3O A;  4BFR A;  3B13 A;  1H2V C;  3S7F A;  4XIF A;  4JW1 A;  5G05 C;  4NQ0 A;  3DWL G;  2LSU A;  2KCL A;  1MX2 A;  4XEI G;  3DEP A;  1HX8 A;  5BNW A;  4GYO A;  1SA4 A;  4FU3 A;  5LCW J;  3NZU A;  2WXK A;  3U66 A;  4OVU A;  5T8I A;  4UI9 J;  4F6R D;  4U8V D;  5ITZ F;  1NI1 A;  3DXK G;  3VLF A;  1H19 A;  3V2X A;  1TNZ A;  3PUJ A;  4I1O B;  1N4S A;  4J8E A;  3JXI A;  5IY5 E;  2DZN A;  1S64 A;  4O1O A;  3RRN B;  3Q47 B;  3MV3 B;  2VSX E;  5B3S E;  2Y4T A;  2VSN A;  5JJ6 A;  2OV8 A;  3I3N A;  5G55 A;  3RO3 A;  2R17 C;  2J09 A;  3RAU A;  4PH4 B;  3ASO E;  3CHO A;  3ASN E;  2WQH A;  3DPD A;  2FEZ A;  3ISM C;  4K03 A;  3Q9N C;  2X6F A;  2ZIR A;  1JWG A;  4GTM A;  4GTQ A;  2QC9 A;  1LF8 A;  2ETC A;  3TGO A;  3CQG B;  2P9S G;  3PEV B;  5EIL A;  4WWO A;  5CMW A;  4GA2 A;  4BTB A;  3S2A A;  1IQU A;  3CGH A;  4EQF A;  2AJA A;  2YQ8 A;  3UT4 A;  5ARF A;  4KVM A;  2ZIS A;  2IFU A;  1ZU2 A;  1UOH A;  1HG2 A;  2PQN A;  4GTR A;  2IOS A;  3TJP A;  4JEH A;  3FUI A;  3X2Q E;  1LTX A;  2XGO A;  4I1A A;  3LJN A;  4Q69 A;  4LNU D;  2X6H A;  4ILI A;  4H7Y A;  2YIN A;  2C2L A;  5KJN A;  3UT8 A;  1E7V A;  4UI9 K;  3CVY A;  2CFZ A;  4YVO A;  3W9G A;  4BX8 A;  2XEN A;  1O1T A;  4Y6C A;  3DSX A;  4FA6 A;  3FEY A;  2V0P A;  1DCQ A;  4HQD A;  2FO7 A;  2GRO B;  3IHY A;  3FHE A;  1OCZ E;  3MKQ A;  3FU3 A;  2H6G A;  1HO8 A;  4F1S A;  4DX2 A;  4BY6 A;  3GZ1 A;  2LAH A;  4F3V A;  1XNF A;  4TXQ A;  3Q5M A;  4PS7 A;  1OCO E;  4HOQ A;  3I4G A;  3HIZ A;  3D9N A;  3FUD A;  1Q2Z A;  3AS8 A;  5KJL A;  3CHS A;  1TNY A;  2PL2 A;  4JHK A;  3G2S A;  4LUN U;  3FUF A;  3UKR G;  1RW2 A;  5LP0 A;  2P2C P;  2I2O A;  4J8F A;  3D9I A;  2PM7 A;  3SO8 A;  5EDS A;  5CRU A;  5AQ9 A;  3U3W A;  1HZ4 A;  3PZ1 A;  4HNA D;  2IY0 C;  4ILH B;  1NL4 A;  4BT8 A;  1OCR E;  4A55 A;  3CVN A;  3W9F A;  3Q15 A;  3HVE B;  2EIN E;  3E33 A;  2ZXW E;  2Y69 E;  3CHP A;  5JJ7 A;  1OWM A;  1SA5 A;  4WNF A;  2LNI A;  4I1M A;  3TWQ A;  3FUE A;  3TWT A;  1UG3 A;  3T8K A;  3CK7 A;  2L6J A;  3D9O A;  5ARG A;  3RO2 A;  3EU5 A;  2WXL A;  3AG1 E;  3IKO B;  5KNG A;  4LNB A;  3BU8 A;  3AU5 A;  4KXK B;  4HRN A;  3SY2 A;  1KPS B;  1P5Q A;  2P9N G;  1JWF A;  2PM6 A;  2GRR B;  4LG6 A;  1TEZ A;  3MA5 A;  5CBN A;  3UXG A;  5AEN A;  3Q78 A;  4B93 B;  3PNL B;  4EZK A;  3CHR A;  2GRN B;  4I43 A;  3NQP A;  4F7A A;  1AWC B;  4DLO A;  1DNP A;  3OXL A;  1JUQ A;  2I6H A;  3L54 A;  3CVX A;  5CBO A;  3DPY A;  2KBX A;  4WNE A;  5LFA A;  3KAE A;  4ANU A;  3HXF A;  4F53 A;  3SFY A;  4C0E A;  4DRX E;  4YDY A;  3GZ2 A;  3FTZ A;  2L9B A;  4KZC A;  3PRZ A;  3OAW A;  4CRW A;  1N4R A;  3FTS A;  3ZEF A;  2IO3 C;  4U0Z A;  4EBA A;  1TN6 A;  4HXI A;  5T4Y A;  4EZL A;  2GGF A;  3FWV A;  4DX6 D;  2JAB A;  4U0S A;  3QAR A;  1Z6T A;  4FHK A;  5ENQ D;  5C2Y A;  2WXM A;  3KEZ A;  3P2B A;  2IF4 A;  5C1D A;  2EIJ E;  2LXL A;  2VTB B;  3CVL A;  3UX4 A;  1K1B A;  5ENT D;  4K0R A;  3UT7 A;  3OXF A;  1GW6 A;  5EX3 A;  5FZS A;  1S63 A;  3HHM A;  5D0O D;  4GMJ A;  3ZU7 B;  1E8W A;  3ZUV B;  1YCS B;  4NIK A;  4EZJ A;  4GZ6 A;  3D9J A;  1HH8 A;  2H6I A;  4AY6 A;  3TG5 A;  1WAO 1;  3EIQ C;  4HS2 A;  4BTA A;  2BKK B;  4XI0 A;  5G05 J;  4I2W A;  3UM1 A;  1HF8 A;  2XPZ A;  3CV0 A;  3ZFW A;  3AG4 E;  4HLE A;  3N71 A;  2GRP B;  2AVP A;  4I17 A;  3TG4 A;  1S70 B;  4OYS A;  3BUA A;  4M7C A;  3UQ3 A;  5HI7 A;  3AG3 E;  3Q73 A;  4GPM A;  2WPV A;  1LD8 A;  2LUH A;  2MRI A;  4Q94 A;  2CFU A;  1DCE A;  3CVQ A;  3SF4 A;  5FIN A;  2FO1 E;  4IYP A;  4A1G A;  4GYY A;  2J08 A;  3ZW3 A;  3G2U A;  2MHK A;  3LXU X;  5CED B;  4KMO A;  2B0O E;  4GA0 A;  1KLX A;  3JQ0 A;  3DST A;  3JUI A;  3FUH A;  3PEU B;  4O6F A;  5KCM A;  2WXJ A;  3SFX A;  1TR4 A;  2GW1 A;  3LDZ A;  2CHX A;  3CST A;  3ABL E;  5AQ7 A;  2F8X K;  3LS8 A;  3FU5 A;  5JMN D;  1IYG A;  3VLE A;  3KS2 A;  2IO2 C;  3R9A B;  1V54 E;  1Z3X A;  3ABM E;  4BWR A;  5ENN A;  3PE3 A;  2XRZ A;  3B95 A;  4J7W A;  2WVI A;  4WNG A;  3QWW A;  3U9W A;  3V30 A;  1H0A A;  1QQE A;  2P9K G;  3FH5 A;  2CG2 A;  3V31 A;  5JA4 D;  4UWK A;  4AJW A;  2J9Q A;  3E4B A;  1SQM A;  5CCM A;  2XEH A;  3BG0 B;  3CKC A;  4LEU A;  2X3M A;  4C0M A;  3EJN A;  1N0R A;  1KZP A;  2MOW A;  1FVF A;  2C0L A;  5B1A E;  1DC2 A;  4UWH A;  3FFL A;  3ASD A;  2WM9 A;  2WXG A;  1UN8 A;  2A4Z A;  4APO A;  4CEM A;  3DEO A;  2XZD G;  1KT0 A;  3C3Q A;  3ONK A;  2DIW A;  3E34 A;  1NZN A;  1MYO A;  3EHQ A;  2LXM A;  1QYM A;  3I4R B;  2L0I A;  2XEV A;  3ZGQ A;  4U07 A;  3MKQ B;  3ZXP A;  4G8L A;  1H6K A;  5ENO D;  3FH7 A;  4R7L A;  1FVH A;  3MEK A;  4RLY A;  3SD5 A;  4C48 B;  2L0T B;  2YNQ A;  4J6I A;  3DXM G;  3B7T A;  3C98 A;  4GCO A;  4NUR A;  1SZA A;  3TL5 A;  4AXH A;  1KT1 A;  4TUU A;  4YND A;  3IHV A;  1UJJ A;  4HBD A;  2EQX A;  3D3M A;  3ZHE A;  4UQX A;  4CGW A;  4CDR A;  3Q79 A;  1TJF A;  1Z5S C;  2KM4 A;  5EYL A;  2L6B A;  4B0Z A;  1ELR A;  2Y4U A;  4CCA A;  4Q96 A;  4KYO B;  4JL0 A;  4AIF A;  1YYH A;  3KSL A;  3FDH A;  2E2E A;  1FT2 A;  3LYA A;  3Q7F A;  2DVW A;  3TAX A;  4UWF A;  4DLQ A;  1WY6 A;  4RSY A;  1INZ A;  2HE0 A;  4IRU A;  1H6P A;  3VTY A;  2QZA A;  2ETB A;  2NXP A;  2NSZ A;  4P29 A;  5AJL A;  5CMY A;  3AS5 A;  3DSV A;  1H6O A;  1N9A A;  1U3C A;  3RU0 A;  3URZ A;  2XZT G;  2XQ0 A;  3TXN A;  1OT8 A;  5KJM A;  5DBK A;  4BEP A;  1OXJ A;  2J07 A;  4FUL A;  1FPP A;  2P9L G;  3D9M A;  3FTX A;  5EN5 D;  4ANX A;  3FU0 A;  3NOC D;  1AP7 A;  3HXC A;  3FTU A;  3EDT B;  3IBE A;  4G11 A;  3SBS A;  4U0U A;  2I9C A;  3GW4 A;  4GU5 A;  2BUG A;  1A17 A;  5LOZ A;  2J4D A;  3L82 A;  4HRM B;  4BET A;  2IU1 A;  4I6G A;  5AIJ A;  2Y0B G;  3NZS A;  4HI9 A;  4Z68 A;  3PVL A;  1TJC A;  4J8Y A;  3R7Q A;  3V79 K;  3UIP C;  4Y6W A;  3ZXS A;  4FLB A;  1UW4 B;  4ABN A;  2XCB A;  3HRA A;  4LNG A;  4WWP A;  1E8Y A;  3U4T A;  1UJK A;  5BT1 A;  3RRM B;  3ASG A;  3FTV A;  2XS1 A;  4MBG A;  5FJY A;  5FIO A;  4ANW A;  3ZYQ A;  3FEX A;  5M72 A;  3CHQ A;  5CCL A;  4CDN A;  2JEK A;  3P1U A;  1OCC E;  4L7T A;  3ZKJ A;  4G23 A;  4JHJ A;  1ZB1 A;  2HO1 A;  4L2Y A;  2VYI A;  5J90 A;  3L16 A;  2WB2 A;  1BI7 B;  2PQR A;  1O5M A;  5FT9 A;  4AVX A;  3HG0 D;  3FUM A;  2AWI A;  3L6A A;  4FP7 A;  3PZ2 A;  2BED A;  3PZD A;  5A23 A;  3WXX A;  2XHE A;  1G3N B;  1B89 A;  1TYQ G;  4AM9 A;  3ASF A;  3V2O A;  5CRV A;  4CGV A;  2ZGG A;  2UWJ G;  2R59 A;  3HYM B;  1Y8M A;  4W9R A;  3DRA A;  4AP2 A;  3ZVV A;  4A1S A;  2E0I A;  3D9K A;  4MRU A;  3SGH A;  1L5J A;  3S7D A;  4JA9 A;  4KZ0 A;  4ZHB A;  2RFA A;  2WXN A;  3EHR A;  3E37 A;  4GCN A;  5BW8 C;  3PRE A;  5AAO A;  3G2T A;  3WG7 E;  4NAC A;  4K5B A;  4U7E B;  2CHZ A;  3FTW A;  3CK9 A;  4N3C A;  2X6I A;  4PS8 A;  4A3V A;  4UQZ A;  2DYS E;  3MYV A;  4ZFH A;  2ILR A;  2R03 A;  1JCQ A;  4N3B A;  3QK0 A;  1V55 E;  2QYJ A;  4GZC A;  4ATZ D;  3EIJ A;  3ULY A;  1D8D A;  4AEZ C;  3C5R A;  1W3B A;  3J5P A;  4DK5 A;  3ZYL A;  3R9M A;  1E7U A;  3ML9 A;  3GZS A;  3ULQ A;  2J49 A;  4HB5 A;  4YVQ C;  4DPR A;  4GMR A;  2X38 A;  3LY7 A;  2WXP A;  1JCR A;  4ILG A;  2Y3A A;  5JHA A;  2XEE A;  2OVF A;  2R02 A;  5CER B;  4G24 A;  1U3D A;  4DJA A;  2IEJ A;  3KSQ A;  5A7D B;  3L9T A;  4EBA G;  2LSV A;  3QWP A;  4FLH A;  2DCP A;  5ANL A;  4DI4 A;  1Z3Y A;  5D0Q D;  4JVS A;  4KT6 B;  3E30 A;  2XRY A;  1HFA A;  4L2L A;  2XS8 A;  2GRQ B;  1QZ2 A;  4UWG A;  2VGX B;  1BLX B;  3QWV A;  2BTD A;  5D2M C;  3LY9 A;  4O1P A;  3ZYM A;  3Q75 A;  4PS3 A;  4K5A B;  1JPL A;  3TWV A;  4N39 A;  1OWP A;  3NOG D;  4GPK A;  2F8Y A;  3ONL A;  1N4Q A;  3HXE A;  2H6F A;  3GYZ A;  2KCV A;  4YDW A;  4DX5 D;  2M63 A;  4CDM A;  1EYH A;  4U04 A;  2EIK E;  3PUK A;  3EHM A;  4FC8 A;  3CR3 A;  1D9S A;  3CKB A;  4HOU A;  4GZ5 A;  1IXV A;  1MHQ A;  4GA1 A;  2KZT A;  3K9I A;  4GZ3 A;  3FTY A;  3B7B A;  1IHG A;  1MX6 A;  3FUL A;  4PUC A;  5ENP D;  2QFC A;  5A6C A;  3B7S A;  3B7R L;  1NA0 A;  3ZHE B;  3BQO A;  3RJV A;  1N54 A;  3EHN A;  4N5Q A;  4EPZ A;  1PY1 A;  3CIA A;  1S0P A;  2F0Y A;  2OOE A;  2C0M A;  4ATG A;  2HM8 A;  3CSF A;  3QDN A;  5FQ8 A;  2DBA A;  1KZO A;  3B7U X;  3ENE A;  5CEC B;  2V5F A;  4UUC A;  3ZN3 A;  4YDE A;  2VGE A;  4HOR A;  1YA0 A;  4I6J A;  5BV0 A;  1RZ4 A;  4XI9 A;  1EF1 C;  2UY1 A;  1K3Z D;  5E76 A;  2XPI A;  3UM2 A;  3HDX A;  1NA3 A;  2DZO A;  1BI8 B;  3LJ3 A;  3BG1 B;  3R7R A;  2VQ2 A;  4GB9 A;  4MS6 A;  2P9P G;  4G25 A;  1VDY A;  4TXP A;  3OXG A;  1BPO A;  3IEG A;  2HYZ A;  2IQC A;  2FF4 A;  1FCH A;  1EDU A;  4EEC A;  5FZR A;  3T9K A;  1IHB A;  5H7P A;  2NC9 A;  4K5C A;  2OCC E;  4GTV A;  5BUZ A;  1TNO A;  3QB2 A;  3SBT B;  3MZL B;  2ZU6 B;  1QNF A;  5CEA A;  4TXR A;  4JZY A;  1EPU A;  4BT9 A;  1H2T C;  3TWX A;  4B94 A;  3KD7 A;  3BEE A;  3DSW A;  3HXB A;  2LAI A;  2V4H C;  3CK8 A;  3PE4 A;  3D9P A;  3L22 A;  3FH8 A;  3EU9 A;  1FT1 A;  5FZQ A;  3ASH A;  4HFG A;  2KCK A;  3E32 A;  1N4P A;  3RRU A;  2I1K A;  4MKT A;  4XKB A;  2QY7 A;  5ENR D;  1HE8 A;  1HXI A;  2OVB A;  2KC7 A;  4BSZ B;  4BX9 A;  1E8Z A;  3MX3 A;  4E85 A;  1BU9 A;  4TUM A;  5CHE E;  3ESK A;  2BF0 X;  2J8S D;  3FUK A;  4GTT A;  3Q49 B;  3QOU A;  4CT0 A;  1LD7 A;  3UI2 A;  2PNN A;  3I5P A;  4XE0 A;  4O60 A;  2V5Q C;  1O1R A;  4WAF A;  3DSS A;  4I6E A;  3ZIM A;  4XKC A;  4YDO A;  4G8K A;  4A3T A;  1WG0 A;  1E96 B;  2B6C A;  1MX4 A;  2ZGD A;  2RD0 A;  3MJW A;  2RG8 A;  4AOF A;  3UM0 A;  4HI8 A;  3F6Q A;  3PZ4 A;  4WND A;  1E90 A;  2FI7 A;  3CEQ A;  5FQ7 A;  2WQ7 A;  4G26 A;  1TN8 A;  2CHW A;  3C72 A;  4LCT A;  5FTP A;  5HS0 A;  2GRL A;  2YHE A;  3AG2 E;  1WDY A;  4CYM D;  4L9P A;  5HKP A;  3UPV A;  2WXH A;  2R5S A;  2Q7F A;  3L08 A;  2H6H A;  3G2W A;  1QBQ A;  2R2L A;  4JEU A;  4CT4 A;  4DI3 A;  1NP7 A;  1SVX A;  4LSZ E;  3AS4 A;  1E8X A;  3VLD A;  4GZD A;  3UMV A;  1OWN A;  3OTN A;  4HOS A;  3VTX A;  4H7X A;  4U96 D;  3Q7A A;  1OUV A;  1JCS A;  2VGY A;  1UN9 A;  4U63 A;  5EIB E;  2A5E A;  3ZNG A;  1WM5 A;  3PH0 C;  1TNB A;  4AV7 A;  4KVO A;  2OEW A;  4RQI A;  5E75 A;  1PC2 A;  3EUV A;  5LCW C;  1XGW A;  4N2S A;  2R05 A;  1YMP A;  1ELW A;  3KEA A;  5JJT A;  4UI9 C;  5BV1 A;  5FWQ A;  4GTO A;  1IQR A;  2AXZ A;  2RKK A;  1SW6 A;  2X6J A;  4AY5 A;  4ACK A;  3ZYK A;  2WXO A;  5G04 J;  4JC8 A;  3LY8 A;  3FUN A;  4IN3 B;  5FQ4 A;  3LPZ A;  3UM3 A;  5LX8 A;  1MZC A;  2MYO A;  1D8E A;  4E6H A;  4J8D A;  2VJ8 A;  5KJK A;  3UIN C;  2J4B A;  4GTP A;  2P9U G;  2DYR E;  3MGB A;  5AQB A;  4X8Q A;  1Y6I A;  4HLL A;  2VSY A;  5EKQ D;  3QKY A;  5B1B E;  5BPP A;  2GRM A;  3JUE A;  4JB8 P;  1PAQ A;  3ULE G;  3S7J A;  2RFM A;  4I9E A;  4EHM A;  3TXM A;  4KBQ A;  5AJD A;  4GAA A;  2IOL A;  2WMO A;  4APF A;  2ETA A;  1MJ0 A;  4B8C B;  3Q4A B;  3C3O A;  2CG3 A;  3APC A;  2PZI A;  4CZ2 D;  3TWU A;  4UWL A;  4ACL A;  3UTM A;  5JHB A;  2KXP C;  3G2V A;  5ANR A;  3UIO C;  1ELK A;  4WWN A;  3C3R A;  2HR2 A;  3PNT B;  2KZT B;  3LVQ E;  4DX7 D;  3JXJ A;  2V8S E;  4JPS A;  3DBS A;  4BER A;  5EYP F;  3ABK E;  5BXO A;  3ML8 A;  3NAW A;  1MQS A;  4N5C A;  5DIZ A;  4LER A;  2EIL E;  2WXF A;  3PS6 A;  4I9C A;  4LRZ A;  4A63 B;  4FJY A;  3NBN B;  4RVB A;  5BXU A;  1OWO A;  4J0U A;  3LVR E;  2IJG X;  3CVV A;  4L23 A;  1HU3 A;  3CHM A;  4I2Z A;  3O4Z A;  1TNU A;  2XCC A;  1HS6 A;  3JYS A;  5KBA A;  5HQ8 A;  1X5B A;  3D9H A;  4XZ4 A;  2XPY A;  3DSU A;  2QYU A;  3SI5 A;  1K1A A;  4C9B B;  4JHR A;  2FBN A;  4IUL A;  3UUX A;  1H2U A; 
#chains in the Genus database with same CATH homology
 2AJA A;  3TWR A;  4DX1 A;  3SO8 A;  5AAO A;  3J5Q B;  3TWS A;  5AQ9 A;  1BLX B;  4GPM A;  4UUC A;  4DRX E;  4YDY A;  1MX2 A;  1UOH A;  5ENS D;  1N11 A;  1YYH A;  3DEP A;  4K5B A;  4U8Y D;  4OAV B;  1SVX A;  4LSZ E;  1BD8 A;  5HRY A;  5FIO A;  2DWZ A;  2VGE A;  4O1P A;  4HNA D;  5ENR D;  2DVW A;  2ETA A;  4U96 D;  1MJ0 A;  4BES A;  1N0R A;  2HE0 A;  4K5A B;  4U95 D;  4ZFH A;  3W9F A;  4F6R D;  4F1P A;  4BSZ B;  3AAA C;  1DC2 A;  2ETB A;  3IXE A;  4U8V D;  5FIN A;  3TWV A;  4CZ2 D;  1K3Z D;  4QQI A;  3TWU A;  5ITZ F;  2FO1 E;  3NOG D;  1BU9 A;  3LJN A;  4TUM A;  5EIB E;  2DZO A;  4LNU D;  3UTM A;  3V2X A;  1BI8 B;  2A5E A;  3ZNG A;  2F8Y A;  2KXP C;  4DX6 D;  2QYJ A;  3DEO A;  2J8S D;  2XZD G;  4QFV A;  3ZKJ A;  3JXI A;  5KWD A;  2BKG A;  2JAB A;  3TWQ A;  3AJI A;  5CED B;  2DZN A;  4ATZ D;  4O1O A;  5ENQ D;  4YDW A;  4DX5 D;  3TWT A;  5AQA A;  3T8K A;  1MYO A;  2XZT G;  2B0O E;  1NFI E;  3EHQ A;  1BI7 B;  1YMP A;  1QYM A;  4DX7 D;  3JXJ A;  3C5R A;  3KEA A;  1OT8 A;  3J5P A;  4BEP A;  4OAU C;  1N0Q A;  3UI2 A;  3Q9U C;  5EYP F;  4BER A;  2F37 A;  3HG0 D;  5KNG A;  1D9S A;  1OY3 D;  1K1B A;  5ENT D;  2PNN A;  1IXV A;  3W9G A;  5BXO A;  1SW6 A;  2XEN A;  3TWW A;  4G8L A;  4O60 A;  2V5Q C;  5EN5 D;  5ENO D;  1DCQ A;  3T9K A;  1IHB A;  3B7B A;  4HRN A;  1TR4 A;  1G3N B;  4HB5 A;  3NOC D;  4RLY A;  1AP7 A;  1MX6 A;  4GMR A;  5AN8 A;  4HQD A;  2F8X K;  5AQ7 A;  4C48 B;  3ZU7 B;  4K5C A;  3V2O A;  5ENP D;  3ZUV B;  4LG6 A;  3Q9N C;  1YCS B;  5D66 A;  5JMN D;  4NIK A;  2ZGG A;  4G8K A;  4A63 B;  1WG0 A;  5CBN A;  3UXG A;  2MYO A;  2XEE A;  1MX4 A;  4B93 B;  2ZGD A;  4DX2 A;  3NBN B;  2NYJ A;  5BXU A;  2QC9 A;  4N5Q A;  5EID A;  4HI8 A;  2ETC A;  3B95 A;  3F6Q A;  5CER B;  1IKN D;  4J7W A;  5CEA A;  4HRM B;  2BKK B;  4BET A;  4HBD A;  5KNH D;  1A5E A;  1AWC B;  3V30 A;  3TWX A;  5KBA A;  5EIL A;  2Y0B G;  4HI9 A;  5AAR A;  5AQB A;  4Z68 A;  5HS0 A;  3D9H A;  3V31 A;  5JA4 D;  4HLL A;  4J8Y A;  4DUI A;  3V79 K;  2V4H C;  4HRL A;  4ZHB A;  1K1A A;  1WDY A;  2RFA A;  2Y1L E;  4CYM D;  5HKP A;  5CBO A;  2KBX A;  3EHR A;  1S70 B;  3JUE A;  5EYL A;  3EU9 A;  4JB8 P;  2L6B A;  2P2C P;  3HRA A;  2RFM A;  2XEH A;  5CEC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...