2ETAA

Crystal structure of the ankyrin repeat domain of the trpv2
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
245
structure length
239
Chain Sequence
FDRDRLFSVVSRGVPEELTGLLEYLRWNSKYLTDSAYTEGSTGKTCLMKAVLNLQDGVNACIMPLLQIDKDSGNPKPLVNAQCTDEFYQGHSALHIAIEKRSLQCVKLLVENGADVHLRACGRFFQFYFGELPLSLAACTKQWDVVTYLLENPHQPASLEATDSLGNTVLHALVMIADNSPENSALVIHMYDGLLQMGARLCPTVQLEEISNHQGLTPLKLAAKEGKIEIFRHILQREF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transient receptor potential cation channel subfamily V memb
publication title Structure of the N-terminal Ankyrin Repeat Domain of the TRPV2 Ion Channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 85
structure length 239
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2etaA00
1DCQA 1MX6A 2QC9A 5ENOD 4DX6D 3TWRA 2AJAA 3J5QB 3TWUA 3NOGD 4BEPA 2J8SD 1YMPA 3NOCD 5AQAA 1MYOA 3TWSA 4O60A 1WG0A 4LG6A 3D9HA 4QQIA 2ZGGA 4LSZE 4HRMB 5HKPA 1IHBA 1DC2A 3ZNGA 5ITZF 5KBAA 1BI7B 2DWZA 2A5EA 4J7WA 4TUMA 2NYJA 1MX4A 3UTMA 1OY3D 2XZTG 4U8YD 4YDWA 1G3NB 3JXIA 2RFMA 3UXGA 2ZGDA 2F37A 4J8YA 5ENRD 5AQBA 3TWVA 5JA4D 3ZUVB 3DEPA 1D9SA 1BD8A 2PNNA 4GPMA 4B93B 2ETCA 1MX2A 4HRLA 2V5QC 2F8YA 4DRXE 4JB8P 2VGEA 4DX7D 4BERA 2DZOA 4BESA 5BXUA 5EIDA 4HNAD 4F6RD 4U96D 2V4HC 5ENQD 4C48B 4DUIA 1UOHA 2DZNA 2KXPC 3ZKJA 2XEEA 2L6BA 4BSZB 4K5AB 1AWCB 1N11A 1BLXB 2MYOA 4U8VD 1S70B 4GMRA 3UI2A 4O1PA 2RFAA 2XEHA 5ENPD 5CEDB 5KNHD 4N5QA 5ENSD 3IXEA 1K3ZD 3B95A 2XENA 5CBOA 2FO1E 3Q9UC 3AJIA 5CERB 1WDYA 3V2XA 5AARA 4K5BA 4G8KA 2JABA 3B7BA 4LNUD 4NIKA 4RLYA 3TWTA 1BU9A 4U95D 5CECB 2KBXA 4UUCA 4HI8A 1NFIE 2BKKB 5FIOA 4OAUC 2BKGA 2XZDG 5D66A 3V79K 3TWXA 4QFVA 3KEAA 4A63B 5BXOA 4HRNA 4Z68A 5HS0A 1MJ0A 4ZFHA 3C5RA 3DEOA 5HRYA 1AP7A 3LJNA 5EILA 4DX1A 1N0RA 1YYHA 1SVXA 3EU9A 3EHQA 5EN5D 5AQ7A 2F8XK 4HQDA 4DX2A 5EYPF 4CZ2D 3F6QA 2HE0A 5EYLA 5AAOA 4HI9A 3W9GA 3AAAC 5JMND 4HBDA 5ENTD 4CYMD 5CEAA 3NBNB 5FINA 3T9KA 4HB5A 3W9FA 4ZHBA 1BI8B 1K1BA 3Q9NC 1TR4A 5KNGA 3SO8A 3T8KA 1N0QA 3ZU7B 5CBNA 4OAVB 1SW6A 3HRAA 4O1OA 3TWQA 4G8LA 3V31A 2P2CP 3TWWA 5AQ9A 4ATZD 4K5CA 3JXJA 1QYMA 3V30A 2Y1LE 3JUEA 2B0OE 1IXVA 4F1PA 1A5EA 2Y0BG 5EIBE 3J5PA 1YCSB 1OT8A 4HLLA 3HG0D 2DVWA 2ETBA 1K1AA 2ETAA 4BETA 3EHRA 5AN8A 1IKND 4DX5D 3V2OA 5KWDA 4YDYA 2QYJA
chains in the Genus database with same CATH superfamily
5ENOD 4I1MA 1JWFA 5A23A 2BTDA 2XHEA 2EILE 3FDHA 4M3OA 4OVUA 5FTPA 2FI7A 3TWVA 4F7AA 3E30A 4RSYA 3CHPA 4GZ3A 1H6KA 5ENQD 2WQ7A 3R7QA 3IBEA 2UWJG 4URKA 4D10C 4N39A 1SA5A 2XEHA 5ENPD 2CFZA 3JQ1A 4LEUA 5CMYA 1E90A 3ML9A 1O1TA 3DSUA 1FPPA 3DSTA 5CECB 2KBXA 3G2WA 3BG0B 4KVOA 1JCSA 2IFUA 3DXMG 4TRQA 5HRYA 4XX5A 4U0SA 5FZSA 3MKQA 1NA0A 4A55A 5AQ7A 2LSUA 3FEYA 4Q69A 4CYMD 4XKCA 3C3RA 1RW2A 3JXJA 3V30A 1HG5A 2WXJA 3R7RA 3ONLA 1DCQA 4HOTA 4HRMB 4CEMA 4GB9A 1BI7B 1EF1C 4U8YD 3UKRG 3EUVA 2XS8A 4GPMA 4B93B 3NZUA 4DRXE 3QWVA 4L7TA 4AM9A 4BESA 3FHEA 1N94A 4K5AB 4U07A 2EINE 2VGYA 4HOSA 3KD7A 4Y6CA 3CVQA 4TXQA 3FTWA 3JYSA 3MGBA 2I9CA 4FHKA 1H0AA 1N52A 3O4ZA 3UX4A 5CRUA 3V79K 3HYMB 3UM1A 4GYOA 3AG1E 3CKCA 3EHNA 5BUZA 5IY5E 4N2SA 3B7UX 2M63A 2ILRA 4JC8A 4A3TA 3MZLB 4JW1A 1L5JA 4ANXA 2KZTA 1HF8A 4L2YA 4GTOA 1OWMA 4KYOB 3Q7AA 1IKND 3CK8A 3L6AA 3L13A 1FT2A 3HXFA 3MYVA 4R7LA 5G55A 1HU3A 2QYUA 3FUJA 3LVRE 1YMPA 1MQSA 5AQAA 1OCRE 1D8DA 1HZ4A 3CHSA 4QQIA 4UWKA 4XZ4A 4BY6A 4RQIA 1OCOE 4Y6WA 2WXQA 3KAEA 1GW6A 2WMOA 2IOLA 4U0ZA 3FUNA 1N4RA 3AS4A 3QOUA 3SF4A 4DUIA 1FCHA 3ENEA 3ZHEB 3LCAA 1NL4A 3RIBA 4I9CA 2L6JA 3QARA 3GZ2A 2QY7A 1D8EA 3CVXA 1H6PA 1HE8A 1IYGA 1IQUA 5EX0A 3MCXA 1NP7A 5AIJA 5AYWD 1E8WA 4JHJA 3E37A 2NSZA 4Z68A 4L9PA 5FZRA 4U8HA 2LAHA 1QZ2A 1MZCA 4RG6A 4ME2A 1SVXA 4L23A 5EKQD 5EN5D 4J6IA 4AJWA 3PZ3A 2OOEA 1ZB1A 5CBNA 1HXIA 2VJ8A 4UWHA 5AQ9A 3JUEA 4XIFA 1Z6TA 3EIJA 2LUHA 1SA4A 3L17A 2QC9A 2BF0X 4RVBA 3RAUA 3UMVA 3PH0C 2PM6A 4CT0A 1TJCA 2DIWA 1YA0A 4MBGA 2A5EA 3UTMA 4I1AA 4IN3B 4GAAA 2XPIA 3AS8A 3L9TA 3PNLB 3ASDA 4Q94A 3PUJA 4GZ5A 3UPVA 4KVMA 4HRLA 3C72A 1EPUA 2CG3A 3FTUA 2IQCA 3ZYKA 1U2VG 1E8XA 4U8VD 3ASHA 2WVIA 4KXKB 1DNPA 1XNFA 3ULQA 4YVQC 2XGMA 3AJIA 3D9MA 2J07A 2JLBA 3UT8A 3UM2A 5AENA 4RLYA 4CGWA 1HG2A 2KCKA 3SBTB 2OVBA 3CK7A 4OAUC 4E6HA 3GZ1A 2CFUA 1N95A 4G11A 3ZVVA 2V0PA 3DSVA 2E0IA 4GTRA 2BEDA 4CZ2D 3UM3A 4FP7A 4H7XA 3FH7A 2UY1A 1TR4A 5FQ8A 2P2CP 3L08A 2LXLA 3J5PA 4ILIA 3HG0D 4GTQA 2ETBA 3UIPC 1RZ4A 1UN9A 1B89A 2E2EA 4LRZA 3S2AA 3TWUA 3LVQE 3TG4A 3EU5A 4AY6A 4O60A 2H6GA 3ML8A 4BSXA 4TUMA 3D9KA 3S7DA 3TXNA 3CQCB 1BD8A 4GU5A 2Q7FA 4JB8P 3CKBA 4FADA 4AOFA 3AG2E 3Q7FA 2P9PG 3AS5A 1NI1A 4UI9J 4GTMA 1V54E 5JHBA 2XEVA 3TL5A 3JUIA 1FT1A 2J09A 2WXMA 3V2XA 3VLFA 3FU6A 3Q79A 3LKUA 3E32A 4MS6A 3ZXPA 2J4BA 5BXOA 2LNIA 4PUCA 4PDXA 2HM8A 4OVVA 1N0RA 5J08A 4NACA 3HXBA 1QBQA 5FT9A 3HVEA 3WG7E 1DCEA 4WWNA 4XEIG 3I3NA 2HE0A 4B0ZA 2AXZA 3AAAC 3OXGA 4ZHBA 4HB5A 1TNYA 5D0QD 1INZA 3TWWA 2P9NG 3T8MA 2GRNB 5EIBE 1OT8A 4F3VA 3ZYMA 4WUYA 3IHVA 3J5QB 5KJKA 2GRQB 4G1TA 4UI9K 2J8SD 3C3QA 3TWSA 1WG0A 2IO2C 3RO3A 1PY1A 1DC2A 2DWZA 4HVBA 2VGXA 1G3NB 2RFMA 4J8YA 2ETCA 2VSOE 2V4LA 1A17A 4BERA 5BXUA 4BT8A 4I6EA 1H6OA 2DYRE 3E33A 1TYQG 1JCQA 4JA9A 3FTYA 5ENSD 5H7PA 2R17C 1DVPA 3Q9UC 5AARA 2P9KG 1BU9A 1N4PA 4H7YA 4HI8A 2BKKB 3FULA 4EBAG 1MJ0A 1LF8A 4BT9A 4BWRA 4AXHA 5DIZA 5FJYA 3BEEA 3ZFWA 4AP2A 3DXKG 2XRZA 3FUEA 3F6QA 3SFYA 3W9GA 2V8SE 4DI3A 5G05J 3Q9NC 2WM9A 3TGOA 4UWLA 4F1SA 5D2MC 4AY5A 1ZU2A 1SZAA 2JEKA 2CHZA 5FZQA 5T3RA 5B1BE 1K1AA 2FBNA 4DJAA 3ZRHA 3PEVB 2X6IA 3ZYLA 1O1SA 3ISMC 4BEPA 4CDNA 1QNFA 3Q49B 1VDYA 4E85A 3NQPA 2MRIA 3UT4A 1KZOA 2Y3AA 4U63A 2YNQA 3SFXA 3I4RB 5ENRD 5FQ4A 2PQRA 3QC1A 4KT6B 4DX7D 4AV7A 1O1RA 2P58C 3QB2A 3FUIA 4KMOA 3UINC 5AJLA 3U3WA 3MKQB 4HXIA 2YQ8A 4NURA 3WXXA 2C0MA 5CERB 3CGHA 5G04J 3B7BA 5ANRA 2WXGA 2ZXWE 2L0TB 4CRWA 3Q73A 5E75A 3Q47B 4ZFHA 2X6HA 4KZCA 3D9NA 1Y8MA 2VTBB 2IO3C 2B6CA 4HI9A 4GA0A 3U4TA 5ENTD 3UM0A 3FUFA 3QWWA 5ARFA 4ACLA 2CHWA 3MV3B 4GYYA 4XE0A 1U3CA 2GROB 1U3DA 2HO1A 2XCBA 2LSVA 3PREA 1S0PA 2QYJA 4LNBA 5BV0A 2CG2A 1TNOA 5LX8A 4DK5A 2WMNA 2VSNA 2MOWA 3LYAA 3HIZA 1SQMA 4Q96A 2XZTG 4WNGA 3B7TA 2I1KA 4TXRA 3IV0A 1LD7A 1OWPA 4WWOA 3ABME 3ASFA 3MEKA 4GA2A 5M72A 2VGEA 4ANWA 3ZHEA 2OVFA 3ZXSA 5CCLA 3ULYA 1KT1A 4O1PA 1E96B 4IYPA 4WWPA 3HHMA 3AG3E 4JHKA 3U9WA 3ZIMA 3DSXA 4WNFA 4K5BA 3CQGB 4GA1A 4LNUD 3OXFA 3D9OA 1KPSB 3ESLA 2R59A 4UWGA 2WXPA 2KZTB 4GZ6A 5ARGA 3DPYA 5FWQA 4J0UA 1AP7A 3EU9A 4G25A 5AAOA 3C98A 3Q78A 5HQ8A 1Z3XA 3CVNA 3T9KA 3LPZA 3T8KA 4PS3A 4MRUA 1JPLA 4O1OA 1Q2ZA 4N2QA 4K5CA 2KCLA 3QNKA 1TNBA 3BQOA 2WPVA 3JCKC 1E8YA 4I17A 4XKBA 1WM5A 5AN8A 4NRHB 4GZDA 1O5MA 3MKRA 3PVLA 3NB2A 3C3OA 4LSZE 2AXUA 4K03A 5KBAA 4HS2A 3MV2B 3APFA 1SZ9A 3LY7A 3FTSA 2OEVA 3QK0A 2P9LG 4BX9A 3CHOA 4I43A 2DZOA 4HNAD 2BUGA 3L22A 2WXHA 1H2TC 3UKUG 2X6JA 3ZKJA 2XEEA 2L6BA 3ESKA 5BT1A 2MYOA 3SI5A 1S70B 5LCWJ 1Z3YA 5CEDB 4N5QA 2Y69E 2FO1E 1HS6A 5EX3A 2A5UA 1V55E 2NC9A 3CEQA 2WQ6A 2BKGA 5E76A 3DSSA 3B7SA 5BV1A 5ANLA 1P5QA 5LP0A 2PL2A 4A3VA 3L54A 2R05A 3MJWA 3ZYQA 3BG1B 3CHRA 1FVFA 3ZN3A 4IRUA 3SHFA 3D9LA 1ELKA 2IU1A 5JMND 3KEZA 5CEAA 3QJZA 5KNGA 3SO8A 5J90A 2QZAA 3O48A 4I6GA 4ATZD 2KM4A 5CHEE 3FTXA 2Y0BG 4HLLA 4AVXA 4APFA 4EZKA 3ONKA 2AWIA 3ABLE 4BFRA 3TWRA 3CV0A 1H2UA 2XPYA 4JXTA 2I2OA 2HYZA 2ZGGA 3HXDA 3RRNB 3ZNGA 3ZGQA 4XI9A 3D3MA 2ZISA 3UXGA 2ZGDA 2F37A 3EJNA 4FU3A 5BPPA 4I1OB 4NQ0A 3FUMA 5CRVA 2DZNA 4A1GA 4K0RA 4HOUA 4B94A 2KATA 3FU5A 1BLXB 1N4QA 4EQFA 3ZEFA 4PH4B 4FHJA 1K8KG 4DLQA 3IXEA 5CBOA 3ZW3A 3URZA 3G2SA 4ILHB 2ZU6B 2P9SG 1TN7A 3LS8A 2UY1B 3Q4AB 2X6KA 4YDEA 2AXVA 3OAWA 5HI7A 2XQ0A 4CDMA 3RK6A 5BW8C 4W9RA 3RRMB 3CLJA 4FJZA 2IONA 2LXMA 4HQDA 4FLBA 3CVVA 3CVUA 4HBDA 3PDNA 5BNWA 1K1BA 3FWVA 2FF4A 3S7BA 4JHRA 4G23A 3SZ7A 2DVWA 1S63A 3PE4A 1MX6A 3ABKE 4HFGA 3DWLG 4FLHA 4UI9C 5LFAA 2AJAA 2EQXA 2CHXA 1TEZA 3X2QE 3D9JA 1HH8A 4FJYA 2NXPA 2H6FA 2C2LA 1MX4A 1ELRA 3SGHA 4EECA 3ZUVB 3R9AB 2PNNA 3FH8A 2RD0A 3CIAA 2WXKA 4CGVA 2PQNA 3APCA 4U96D 4GYWA 1UOHA 2IOSA 2IF4A 2WXRA 2ONDA 5DBKA 4GCOA 3P1UA 3PZ4A 1IQRA 5KNHD 3LEWA 3GW4A 1MHQA 1OWLA 4M7CA 4OYSA 1WAO1 4HORA 2IEJA 5JJTA 4XI0A 2YHEA 4EPZA 4J8SA 1UW4B 5D66A 3QAQA 1ZBPA 5HS0A 3RRUA 2X38A 4ATGA 2EIJE 2QFCA 2J9QA 4EBAA 1FVHA 1QQEA 3VTYA 4LCTA 3D9IA 3FTVA 1BI8B 3PE3A 4JA7A 4G8LA 1X5BA 5C2YA 2VGXB 4LERA 4EZJA 1YCSB 4DPRA 4DX5D 1OXJA 3SY2A 2X3MA 4GPKA 2L9BA 3FU0A 2WXFA 3NOGD 3E34A 3FUKA 4JZYA 2PM7A 1UJKA 2NYJA 1JCRA 3PRZA 5G2NA 5JA4D 4JL0A 2KC7A 3CVPA 3T5XA 3AG4E 1NZNA 4F6RD 1E8ZA 1UG3A 5LOZA 3SFZA 3CHQA 4YDOA 3UI2A 4GTVA 2WXNA 2IJGX 5G05C 4MLPA 4J8DA 3APDA 3CSTA 1TNZA 3P2BA 4I9EA 1WDYA 2LAIA 2XPZA 3HXCA 3RO2A 4U95D 3QDNA 4A63B 3KEAA 3IHYA 2YINA 3EIQC 2ZIRA 1UN8A 1H19A 2R02A 5CCMA 4HOQA 2F8XK 2VTBA 2MHKA 2VYIA 4KBQA 5FQ7A 1PAQA 3FUDA 2AW6A 3W9FA 5KJNA 3ULEG 2XCCA 3PZDA 1N9AA 3TWQA 3CK9A 3HRAA 3V31A 3RKVA 3VLEA 3B13A 1KT0A 3CVYA 1X81A 4YDYA 3DSWA 4C9BB 4DX6D 3G2VA 2KCVA 3LJ3A 4EHMA 3L82A 3BU8A 4N3AA 2GGFA 4ANVA 4BTAA 4N3BA 5G04C 3JQ0A 4P29A 4ACKA 4TUUA 5A7DB 3Q75A 5AQBA 3SQVA 5A6CA 4PS8A 2XGOA 2EIME 2XRYA 3CVWA 3GZSA 4U04A 4BSZB 2XS1A 4CT4A 4UQXA 1W3BA 3PUKA 3FUHA 1JWGA 2WXOA 3NF1A 4L1BA 4UQYA 3HXEA 4JEUA 3Q5MA 2V5FA 4X8QA 3ASGA 3UIOC 3QKYA 3PEUB 4QFVA 2Y4TA 5EDSA 2GRLA 5EILA 4DX1A 4ANUA 3MA5A 2H6HA 4AEZC 4I2ZA 3HDXA 4FC8A 3NBNB 1HFAA 4GTSA 1N54A 1N0QA 1NA3A 1SW6A 4UQZA 4APOA 2PZIA 3NAWA 4G26A 1QYMA 3TAXA 4C0MA 2VQ2A 4A1SA 3E4BA 4BETA 3SBSA 2IY0C 3LY9A 2J08A 1N11A 5T8IA 2FEZA 3UT7A 3ASOE 3NOCD 3SNXA 1OWNA 4LG6A 3D9HA 3AU4A 3S7JA 3DBSA 5KJMA 4J7WA 3DPDA 3VLDA 4JEHA 4KZ0A 4ABNA 2VSXE 3DEPA 2AVPA 3UQ3A 5JHAA 2V5QC 2F8YA 4FULA 2V4HC 3ASNE 4EZLA 2KXPC 3DRAA 2I6HA 1PC2A 1AWCB 3CVLA 3RU0A 4WNDA 3NZSA 4B8CB 4TXPA 3B7RL 5CMWA 4N3CA 4RG9A 2J49A 4G8KA 3U64A 4AIFA 2GRPB 2GRRB 4HLEA 1Y6IA 2XZDG 2F0YA 3GYZA 4PS7A 2P9IG 3C5RA 3G2TA 3MX3A 4GMLA 1Z5SC 2DYSE 4U0UA 5B3SE 4FA6A 2OEWA 4B8AA 4GCNA 1TJFA 3AU5A 5EYLA 3T5VA 5AJDA 2WXLA 3PZ1A 4BX8A 5JJ6A 4OAVB 3KSLA 3EDTB 1A5EA 3PNTB 5D0OD 3EHRA 3PZ2A 3BUAA 1XGWA 3LY8A 5KCMA 3FU3A 4GMJA 5LCWC 5C1DA 4WNEA 2A4ZA 2R2LA 1JUQA 2L0IA 1KZPA 5ITZF 3N71A 2R5SA 2DCPA 1OY3D 3D9PA 4YDWA 3CR3A 4MKTA 3KS2A 3SD5A 3ZPJA 4LNGA 5FQ6A 3I5PA 3R9MA 1S64A 3LXUX 5EIDA 4CCAA 1OUVA 3CSFA 4C48B 4U7EB 3Q15A 5T4YA 1IHGA 4ILGA 3FH5A 3G2UA 1TN6A 4I6JA 4CDRA 3TJPA 4G2VA 2HR2A 2WQHA 4GTTA 4G24A 4V3IA 3QWPA 2EIKE 4WAFA 2JABA 4IULA 4NIKA 3TWTA 2H6IA 4UUCA 2RG8A 3OXLA 1NFIE 2XGSA 3FEXA 2OCCE 5FIOA 3L16A 2R03A 4HRNA 3UUXA 3DEOA 2OV8A 2YHCA 3S7FA 1YYHA 3EHQA 4DX2A 5EYPF 2WB2A 4BTBA 1BPOA 1OCZE 4JD2G 3TXMA 3ZU7B 3CHMA 3FFLA 3IKOB 5B1AE 3EHMA 1E7UA 1OWOA 4N5CA 2I1JA 4F1PA 4GTPA 4DI4A 5KWDA 3V2OA 1N4SA 4J8FA 2GRMA 2DBAA 3KSQA 2RKKA 1MYOA 3IEGA 1UJJA 1KLXA 5HKPA 1IHBA 5ENNA 3JXIA 1E7VA 1D9SA 4C0EA 3OTNA 3I4GA 1MX2A 4GZCA 3LDZA 3FTZA 3K9IA 5KJLA 3U66A 5JJ7A 2Y4UA 2WXIA 4I2WA 4GMRA 4O6FA 4TV3A 2RFAA 1LTXA 2C0LA 3PS6A 1K3ZD 3B95A 3RSEG 2XENA 4DLOA 3VTXA 1TNUA 1HX8A 4B89A 3FY4A 1H2VC 2FULA 2GW1A 1TN8A 2J4DA 1EYHA 3TWXA 1EDUA 4F53A 2LO6A 3LJNA 3FP3A 2FO7A 2X6FA 2P9UG 3HVEB 1HO8A 2VSYA 4YVOA 4LUNU 5FINA 1OCCE 3TG5A 4JPSA 1WY6A 2Y1LE 3RJVA 4YNDA 2B0OE 1IXVA 4L2LA 4J8EA 1LD8A 1ELWA 4JVSA 4UWFA 2ETAA
chains in the Genus database with same CATH topology
1DCQA 1MX6A 2QC9A 5ENOD 4DX6D 3TWRA 2AJAA 3J5QB 3TWUA 3NOGD 4BEPA 2J8SD 1YMPA 3NOCD 5AQAA 1MYOA 3TWSA 4O60A 1WG0A 4LG6A 3D9HA 4QQIA 2ZGGA 4LSZE 4HRMB 5HKPA 1IHBA 1DC2A 3ZNGA 5ITZF 5KBAA 1BI7B 2DWZA 2A5EA 4J7WA 4TUMA 2NYJA 1MX4A 3UTMA 1OY3D 2XZTG 4U8YD 4YDWA 1G3NB 3JXIA 2RFMA 3UXGA 2ZGDA 2F37A 4J8YA 5ENRD 5AQBA 3TWVA 5JA4D 3ZUVB 3DEPA 1D9SA 1BD8A 2PNNA 4GPMA 4B93B 2ETCA 1MX2A 4HRLA 2V5QC 2F8YA 4DRXE 4JB8P 2VGEA 4DX7D 4BERA 2DZOA 4BESA 5BXUA 5EIDA 4HNAD 4F6RD 4U96D 2V4HC 5ENQD 4C48B 4DUIA 1UOHA 2DZNA 2KXPC 3ZKJA 2XEEA 2L6BA 4BSZB 4K5AB 1AWCB 1N11A 1BLXB 2MYOA 4U8VD 1S70B 4GMRA 3UI2A 4O1PA 2RFAA 2XEHA 5ENPD 5CEDB 5KNHD 4N5QA 5ENSD 3IXEA 1K3ZD 3B95A 2XENA 5CBOA 2FO1E 3Q9UC 3AJIA 5CERB 1WDYA 3V2XA 5AARA 4K5BA 4G8KA 2JABA 3B7BA 4LNUD 4NIKA 4RLYA 3TWTA 1BU9A 4U95D 5CECB 2KBXA 4UUCA 4HI8A 1NFIE 2BKKB 5FIOA 4OAUC 2BKGA 2XZDG 5D66A 3V79K 3TWXA 4QFVA 3KEAA 4A63B 5BXOA 4HRNA 4Z68A 5HS0A 1MJ0A 4ZFHA 3C5RA 3DEOA 5HRYA 1AP7A 3LJNA 5EILA 4DX1A 1N0RA 1YYHA 1SVXA 3EU9A 3EHQA 5EN5D 5AQ7A 2F8XK 4HQDA 4DX2A 5EYPF 4CZ2D 3F6QA 2HE0A 5EYLA 5AAOA 4HI9A 3W9GA 3AAAC 5JMND 4HBDA 5ENTD 4CYMD 5CEAA 3NBNB 5FINA 3T9KA 4HB5A 3W9FA 4ZHBA 1BI8B 1K1BA 3Q9NC 1TR4A 5KNGA 3SO8A 3T8KA 1N0QA 3ZU7B 5CBNA 4OAVB 1SW6A 3HRAA 4O1OA 3TWQA 4G8LA 3V31A 2P2CP 3TWWA 5AQ9A 4ATZD 4K5CA 3JXJA 1QYMA 3V30A 2Y1LE 3JUEA 2B0OE 1IXVA 4F1PA 1A5EA 2Y0BG 5EIBE 3J5PA 1YCSB 1OT8A 4HLLA 3HG0D 2DVWA 2ETBA 1K1AA 2ETAA 4BETA 3EHRA 5AN8A 1IKND 4DX5D 3V2OA 5KWDA 4YDYA 2QYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCQ A;  1MX6 A;  2QC9 A;  5ENO D;  4DX6 D;  3TWR A;  2AJA A;  3J5Q B;  3TWU A;  3NOG D;  4BEP A;  2J8S D;  1YMP A;  3NOC D;  5AQA A;  1MYO A;  3TWS A;  4O60 A;  1WG0 A;  4LG6 A;  3D9H A;  4QQI A;  2ZGG A;  4LSZ E;  4HRM B;  5HKP A;  1IHB A;  1DC2 A;  3ZNG A;  5ITZ F;  5KBA A;  1BI7 B;  2DWZ A;  2A5E A;  4J7W A;  4TUM A;  2NYJ A;  1MX4 A;  3UTM A;  1OY3 D;  2XZT G;  4U8Y D;  4YDW A;  1G3N B;  3JXI A;  2RFM A;  3UXG A;  2ZGD A;  2F37 A;  4J8Y A;  5ENR D;  5AQB A;  3TWV A;  5JA4 D;  3ZUV B;  3DEP A;  1D9S A;  1BD8 A;  2PNN A;  4GPM A;  4B93 B;  2ETC A;  1MX2 A;  4HRL A;  2V5Q C;  2F8Y A;  4DRX E;  4JB8 P;  2VGE A;  4DX7 D;  4BER A;  2DZO A;  4BES A;  5BXU A;  5EID A;  4HNA D;  4F6R D;  4U96 D;  2V4H C;  5ENQ D;  4C48 B;  4DUI A;  1UOH A;  2DZN A;  2KXP C;  3ZKJ A;  2XEE A;  2L6B A;  4BSZ B;  4K5A B;  1AWC B;  1N11 A;  1BLX B;  2MYO A;  4U8V D;  1S70 B;  4GMR A;  3UI2 A;  4O1P A;  2RFA A;  2XEH A;  5ENP D;  5CED B;  5KNH D;  4N5Q A;  5ENS D;  3IXE A;  1K3Z D;  3B95 A;  2XEN A;  5CBO A;  2FO1 E;  3Q9U C;  3AJI A;  5CER B;  1WDY A;  3V2X A;  5AAR A;  4K5B A;  4G8K A;  2JAB A;  3B7B A;  4LNU D;  4NIK A;  4RLY A;  3TWT A;  1BU9 A;  4U95 D;  5CEC B;  2KBX A;  4UUC A;  4HI8 A;  1NFI E;  2BKK B;  5FIO A;  4OAU C;  2BKG A;  2XZD G;  5D66 A;  3V79 K;  3TWX A;  4QFV A;  3KEA A;  4A63 B;  5BXO A;  4HRN A;  4Z68 A;  5HS0 A;  1MJ0 A;  4ZFH A;  3C5R A;  3DEO A;  5HRY A;  1AP7 A;  3LJN A;  5EIL A;  4DX1 A;  1N0R A;  1YYH A;  1SVX A;  3EU9 A;  3EHQ A;  5EN5 D;  5AQ7 A;  2F8X K;  4HQD A;  4DX2 A;  5EYP F;  4CZ2 D;  3F6Q A;  2HE0 A;  5EYL A;  5AAO A;  4HI9 A;  3W9G A;  3AAA C;  5JMN D;  4HBD A;  5ENT D;  4CYM D;  5CEA A;  3NBN B;  5FIN A;  3T9K A;  4HB5 A;  3W9F A;  4ZHB A;  1BI8 B;  1K1B A;  3Q9N C;  1TR4 A;  5KNG A;  3SO8 A;  3T8K A;  1N0Q A;  3ZU7 B;  5CBN A;  4OAV B;  1SW6 A;  3HRA A;  4O1O A;  3TWQ A;  4G8L A;  3V31 A;  2P2C P;  3TWW A;  5AQ9 A;  4ATZ D;  4K5C A;  3JXJ A;  1QYM A;  3V30 A;  2Y1L E;  3JUE A;  2B0O E;  1IXV A;  4F1P A;  1A5E A;  2Y0B G;  5EIB E;  3J5P A;  1YCS B;  1OT8 A;  4HLL A;  3HG0 D;  2DVW A;  2ETB A;  1K1A A;  2ETA A;  4BET A;  3EHR A;  5AN8 A;  1IKN D;  4DX5 D;  3V2O A;  5KWD A;  4YDY A;  2QYJ A; 
#chains in the Genus database with same CATH topology
 5ENO D;  4I1M A;  1JWF A;  5A23 A;  2BTD A;  2XHE A;  2EIL E;  3FDH A;  4M3O A;  4OVU A;  5FTP A;  2FI7 A;  3TWV A;  4F7A A;  3E30 A;  4RSY A;  3CHP A;  4GZ3 A;  1H6K A;  5ENQ D;  2WQ7 A;  3R7Q A;  3IBE A;  2UWJ G;  4URK A;  4D10 C;  4N39 A;  1SA5 A;  2XEH A;  5ENP D;  2CFZ A;  3JQ1 A;  4LEU A;  5CMY A;  1E90 A;  3ML9 A;  1O1T A;  3DSU A;  1FPP A;  3DST A;  5CEC B;  2KBX A;  3G2W A;  3BG0 B;  4KVO A;  1JCS A;  2IFU A;  3DXM G;  4TRQ A;  5HRY A;  4XX5 A;  4U0S A;  5FZS A;  3MKQ A;  1NA0 A;  4A55 A;  5AQ7 A;  2LSU A;  3FEY A;  4Q69 A;  4CYM D;  4XKC A;  3C3R A;  1RW2 A;  3JXJ A;  3V30 A;  1HG5 A;  2WXJ A;  3R7R A;  3ONL A;  1DCQ A;  4HOT A;  4HRM B;  4CEM A;  4GB9 A;  1BI7 B;  1EF1 C;  4U8Y D;  3UKR G;  3EUV A;  2XS8 A;  4GPM A;  4B93 B;  3NZU A;  4DRX E;  3QWV A;  4L7T A;  4AM9 A;  4BES A;  3FHE A;  1N94 A;  4K5A B;  4U07 A;  2EIN E;  2VGY A;  4HOS A;  3KD7 A;  4Y6C A;  3CVQ A;  4TXQ A;  3FTW A;  3JYS A;  3MGB A;  2I9C A;  4FHK A;  1H0A A;  1N52 A;  3O4Z A;  3UX4 A;  5CRU A;  3V79 K;  3HYM B;  3UM1 A;  4GYO A;  3AG1 E;  3CKC A;  3EHN A;  5BUZ A;  5IY5 E;  4N2S A;  3B7U X;  2M63 A;  2ILR A;  4JC8 A;  4A3T A;  3MZL B;  4JW1 A;  1L5J A;  4ANX A;  2KZT A;  1HF8 A;  4L2Y A;  4GTO A;  1OWM A;  4KYO B;  3Q7A A;  1IKN D;  3CK8 A;  3L6A A;  3L13 A;  1FT2 A;  3HXF A;  3MYV A;  4R7L A;  5G55 A;  1HU3 A;  2QYU A;  3FUJ A;  3LVR E;  1YMP A;  1MQS A;  5AQA A;  1OCR E;  1D8D A;  1HZ4 A;  3CHS A;  4QQI A;  4UWK A;  4XZ4 A;  4BY6 A;  4RQI A;  1OCO E;  4Y6W A;  2WXQ A;  3KAE A;  1GW6 A;  2WMO A;  2IOL A;  4U0Z A;  3FUN A;  1N4R A;  3AS4 A;  3QOU A;  3SF4 A;  4DUI A;  1FCH A;  3ENE A;  3ZHE B;  3LCA A;  1NL4 A;  3RIB A;  4I9C A;  2L6J A;  3QAR A;  3GZ2 A;  2QY7 A;  1D8E A;  3CVX A;  1H6P A;  1HE8 A;  1IYG A;  1IQU A;  5EX0 A;  3MCX A;  1NP7 A;  5AIJ A;  5AYW D;  1E8W A;  4JHJ A;  3E37 A;  2NSZ A;  4Z68 A;  4L9P A;  5FZR A;  4U8H A;  2LAH A;  1QZ2 A;  1MZC A;  4RG6 A;  4ME2 A;  1SVX A;  4L23 A;  5EKQ D;  5EN5 D;  4J6I A;  4AJW A;  3PZ3 A;  2OOE A;  1ZB1 A;  5CBN A;  1HXI A;  2VJ8 A;  4UWH A;  5AQ9 A;  3JUE A;  4XIF A;  1Z6T A;  3EIJ A;  2LUH A;  1SA4 A;  3L17 A;  2QC9 A;  2BF0 X;  4RVB A;  3RAU A;  3UMV A;  3PH0 C;  2PM6 A;  4CT0 A;  1TJC A;  2DIW A;  1YA0 A;  4MBG A;  2A5E A;  3UTM A;  4I1A A;  4IN3 B;  4GAA A;  2XPI A;  3AS8 A;  3L9T A;  3PNL B;  3ASD A;  4Q94 A;  3PUJ A;  4GZ5 A;  3UPV A;  4KVM A;  4HRL A;  3C72 A;  1EPU A;  2CG3 A;  3FTU A;  2IQC A;  3ZYK A;  1U2V G;  1E8X A;  4U8V D;  3ASH A;  2WVI A;  4KXK B;  1DNP A;  1XNF A;  3ULQ A;  4YVQ C;  2XGM A;  3AJI A;  3D9M A;  2J07 A;  2JLB A;  3UT8 A;  3UM2 A;  5AEN A;  4RLY A;  4CGW A;  1HG2 A;  2KCK A;  3SBT B;  2OVB A;  3CK7 A;  4OAU C;  4E6H A;  3GZ1 A;  2CFU A;  1N95 A;  4G11 A;  3ZVV A;  2V0P A;  3DSV A;  2E0I A;  4GTR A;  2BED A;  4CZ2 D;  3UM3 A;  4FP7 A;  4H7X A;  3FH7 A;  2UY1 A;  1TR4 A;  5FQ8 A;  2P2C P;  3L08 A;  2LXL A;  3J5P A;  4ILI A;  3HG0 D;  4GTQ A;  2ETB A;  3UIP C;  1RZ4 A;  1UN9 A;  1B89 A;  2E2E A;  4LRZ A;  3S2A A;  3TWU A;  3LVQ E;  3TG4 A;  3EU5 A;  4AY6 A;  4O60 A;  2H6G A;  3ML8 A;  4BSX A;  4TUM A;  3D9K A;  3S7D A;  3TXN A;  3CQC B;  1BD8 A;  4GU5 A;  2Q7F A;  4JB8 P;  3CKB A;  4FAD A;  4AOF A;  3AG2 E;  3Q7F A;  2P9P G;  3AS5 A;  1NI1 A;  4UI9 J;  4GTM A;  1V54 E;  5JHB A;  2XEV A;  3TL5 A;  3JUI A;  1FT1 A;  2J09 A;  2WXM A;  3V2X A;  3VLF A;  3FU6 A;  3Q79 A;  3LKU A;  3E32 A;  4MS6 A;  3ZXP A;  2J4B A;  5BXO A;  2LNI A;  4PUC A;  4PDX A;  2HM8 A;  4OVV A;  1N0R A;  5J08 A;  4NAC A;  3HXB A;  1QBQ A;  5FT9 A;  3HVE A;  3WG7 E;  1DCE A;  4WWN A;  4XEI G;  3I3N A;  2HE0 A;  4B0Z A;  2AXZ A;  3AAA C;  3OXG A;  4ZHB A;  4HB5 A;  1TNY A;  5D0Q D;  1INZ A;  3TWW A;  2P9N G;  3T8M A;  2GRN B;  5EIB E;  1OT8 A;  4F3V A;  3ZYM A;  4WUY A;  3IHV A;  3J5Q B;  5KJK A;  2GRQ B;  4G1T A;  4UI9 K;  2J8S D;  3C3Q A;  3TWS A;  1WG0 A;  2IO2 C;  3RO3 A;  1PY1 A;  1DC2 A;  2DWZ A;  4HVB A;  2VGX A;  1G3N B;  2RFM A;  4J8Y A;  2ETC A;  2VSO E;  2V4L A;  1A17 A;  4BER A;  5BXU A;  4BT8 A;  4I6E A;  1H6O A;  2DYR E;  3E33 A;  1TYQ G;  1JCQ A;  4JA9 A;  3FTY A;  5ENS D;  5H7P A;  2R17 C;  1DVP A;  3Q9U C;  5AAR A;  2P9K G;  1BU9 A;  1N4P A;  4H7Y A;  4HI8 A;  2BKK B;  3FUL A;  4EBA G;  1MJ0 A;  1LF8 A;  4BT9 A;  4BWR A;  4AXH A;  5DIZ A;  5FJY A;  3BEE A;  3ZFW A;  4AP2 A;  3DXK G;  2XRZ A;  3FUE A;  3F6Q A;  3SFY A;  3W9G A;  2V8S E;  4DI3 A;  5G05 J;  3Q9N C;  2WM9 A;  3TGO A;  4UWL A;  4F1S A;  5D2M C;  4AY5 A;  1ZU2 A;  1SZA A;  2JEK A;  2CHZ A;  5FZQ A;  5T3R A;  5B1B E;  1K1A A;  2FBN A;  4DJA A;  3ZRH A;  3PEV B;  2X6I A;  3ZYL A;  1O1S A;  3ISM C;  4BEP A;  4CDN A;  1QNF A;  3Q49 B;  1VDY A;  4E85 A;  3NQP A;  2MRI A;  3UT4 A;  1KZO A;  2Y3A A;  4U63 A;  2YNQ A;  3SFX A;  3I4R B;  5ENR D;  5FQ4 A;  2PQR A;  3QC1 A;  4KT6 B;  4DX7 D;  4AV7 A;  1O1R A;  2P58 C;  3QB2 A;  3FUI A;  4KMO A;  3UIN C;  5AJL A;  3U3W A;  3MKQ B;  4HXI A;  2YQ8 A;  4NUR A;  3WXX A;  2C0M A;  5CER B;  3CGH A;  5G04 J;  3B7B A;  5ANR A;  2WXG A;  2ZXW E;  2L0T B;  4CRW A;  3Q73 A;  5E75 A;  3Q47 B;  4ZFH A;  2X6H A;  4KZC A;  3D9N A;  1Y8M A;  2VTB B;  2IO3 C;  2B6C A;  4HI9 A;  4GA0 A;  3U4T A;  5ENT D;  3UM0 A;  3FUF A;  3QWW A;  5ARF A;  4ACL A;  2CHW A;  3MV3 B;  4GYY A;  4XE0 A;  1U3C A;  2GRO B;  1U3D A;  2HO1 A;  2XCB A;  2LSV A;  3PRE A;  1S0P A;  2QYJ A;  4LNB A;  5BV0 A;  2CG2 A;  1TNO A;  5LX8 A;  4DK5 A;  2WMN A;  2VSN A;  2MOW A;  3LYA A;  3HIZ A;  1SQM A;  4Q96 A;  2XZT G;  4WNG A;  3B7T A;  2I1K A;  4TXR A;  3IV0 A;  1LD7 A;  1OWP A;  4WWO A;  3ABM E;  3ASF A;  3MEK A;  4GA2 A;  5M72 A;  2VGE A;  4ANW A;  3ZHE A;  2OVF A;  3ZXS A;  5CCL A;  3ULY A;  1KT1 A;  4O1P A;  1E96 B;  4IYP A;  4WWP A;  3HHM A;  3AG3 E;  4JHK A;  3U9W A;  3ZIM A;  3DSX A;  4WNF A;  4K5B A;  3CQG B;  4GA1 A;  4LNU D;  3OXF A;  3D9O A;  1KPS B;  3ESL A;  2R59 A;  4UWG A;  2WXP A;  2KZT B;  4GZ6 A;  5ARG A;  3DPY A;  5FWQ A;  4J0U A;  1AP7 A;  3EU9 A;  4G25 A;  5AAO A;  3C98 A;  3Q78 A;  5HQ8 A;  1Z3X A;  3CVN A;  3T9K A;  3LPZ A;  3T8K A;  4PS3 A;  4MRU A;  1JPL A;  4O1O A;  1Q2Z A;  4N2Q A;  4K5C A;  2KCL A;  3QNK A;  1TNB A;  3BQO A;  2WPV A;  3JCK C;  1E8Y A;  4I17 A;  4XKB A;  1WM5 A;  5AN8 A;  4NRH B;  4GZD A;  1O5M A;  3MKR A;  3PVL A;  3NB2 A;  3C3O A;  4LSZ E;  2AXU A;  4K03 A;  5KBA A;  4HS2 A;  3MV2 B;  3APF A;  1SZ9 A;  3LY7 A;  3FTS A;  2OEV A;  3QK0 A;  2P9L G;  4BX9 A;  3CHO A;  4I43 A;  2DZO A;  4HNA D;  2BUG A;  3L22 A;  2WXH A;  1H2T C;  3UKU G;  2X6J A;  3ZKJ A;  2XEE A;  2L6B A;  3ESK A;  5BT1 A;  2MYO A;  3SI5 A;  1S70 B;  5LCW J;  1Z3Y A;  5CED B;  4N5Q A;  2Y69 E;  2FO1 E;  1HS6 A;  5EX3 A;  2A5U A;  1V55 E;  2NC9 A;  3CEQ A;  2WQ6 A;  2BKG A;  5E76 A;  3DSS A;  3B7S A;  5BV1 A;  5ANL A;  1P5Q A;  5LP0 A;  2PL2 A;  4A3V A;  3L54 A;  2R05 A;  3MJW A;  3ZYQ A;  3BG1 B;  3CHR A;  1FVF A;  3ZN3 A;  4IRU A;  3SHF A;  3D9L A;  1ELK A;  2IU1 A;  5JMN D;  3KEZ A;  5CEA A;  3QJZ A;  5KNG A;  3SO8 A;  5J90 A;  2QZA A;  3O48 A;  4I6G A;  4ATZ D;  2KM4 A;  5CHE E;  3FTX A;  2Y0B G;  4HLL A;  4AVX A;  4APF A;  4EZK A;  3ONK A;  2AWI A;  3ABL E;  4BFR A;  3TWR A;  3CV0 A;  1H2U A;  2XPY A;  4JXT A;  2I2O A;  2HYZ A;  2ZGG A;  3HXD A;  3RRN B;  3ZNG A;  3ZGQ A;  4XI9 A;  3D3M A;  2ZIS A;  3UXG A;  2ZGD A;  2F37 A;  3EJN A;  4FU3 A;  5BPP A;  4I1O B;  4NQ0 A;  3FUM A;  5CRV A;  2DZN A;  4A1G A;  4K0R A;  4HOU A;  4B94 A;  2KAT A;  3FU5 A;  1BLX B;  1N4Q A;  4EQF A;  3ZEF A;  4PH4 B;  4FHJ A;  1K8K G;  4DLQ A;  3IXE A;  5CBO A;  3ZW3 A;  3URZ A;  3G2S A;  4ILH B;  2ZU6 B;  2P9S G;  1TN7 A;  3LS8 A;  2UY1 B;  3Q4A B;  2X6K A;  4YDE A;  2AXV A;  3OAW A;  5HI7 A;  2XQ0 A;  4CDM A;  3RK6 A;  5BW8 C;  4W9R A;  3RRM B;  3CLJ A;  4FJZ A;  2ION A;  2LXM A;  4HQD A;  4FLB A;  3CVV A;  3CVU A;  4HBD A;  3PDN A;  5BNW A;  1K1B A;  3FWV A;  2FF4 A;  3S7B A;  4JHR A;  4G23 A;  3SZ7 A;  2DVW A;  1S63 A;  3PE4 A;  1MX6 A;  3ABK E;  4HFG A;  3DWL G;  4FLH A;  4UI9 C;  5LFA A;  2AJA A;  2EQX A;  2CHX A;  1TEZ A;  3X2Q E;  3D9J A;  1HH8 A;  4FJY A;  2NXP A;  2H6F A;  2C2L A;  1MX4 A;  1ELR A;  3SGH A;  4EEC A;  3ZUV B;  3R9A B;  2PNN A;  3FH8 A;  2RD0 A;  3CIA A;  2WXK A;  4CGV A;  2PQN A;  3APC A;  4U96 D;  4GYW A;  1UOH A;  2IOS A;  2IF4 A;  2WXR A;  2OND A;  5DBK A;  4GCO A;  3P1U A;  3PZ4 A;  1IQR A;  5KNH D;  3LEW A;  3GW4 A;  1MHQ A;  1OWL A;  4M7C A;  4OYS A;  1WAO 1;  4HOR A;  2IEJ A;  5JJT A;  4XI0 A;  2YHE A;  4EPZ A;  4J8S A;  1UW4 B;  5D66 A;  3QAQ A;  1ZBP A;  5HS0 A;  3RRU A;  2X38 A;  4ATG A;  2EIJ E;  2QFC A;  2J9Q A;  4EBA A;  1FVH A;  1QQE A;  3VTY A;  4LCT A;  3D9I A;  3FTV A;  1BI8 B;  3PE3 A;  4JA7 A;  4G8L A;  1X5B A;  5C2Y A;  2VGX B;  4LER A;  4EZJ A;  1YCS B;  4DPR A;  4DX5 D;  1OXJ A;  3SY2 A;  2X3M A;  4GPK A;  2L9B A;  3FU0 A;  2WXF A;  3NOG D;  3E34 A;  3FUK A;  4JZY A;  2PM7 A;  1UJK A;  2NYJ A;  1JCR A;  3PRZ A;  5G2N A;  5JA4 D;  4JL0 A;  2KC7 A;  3CVP A;  3T5X A;  3AG4 E;  1NZN A;  4F6R D;  1E8Z A;  1UG3 A;  5LOZ A;  3SFZ A;  3CHQ A;  4YDO A;  3UI2 A;  4GTV A;  2WXN A;  2IJG X;  5G05 C;  4MLP A;  4J8D A;  3APD A;  3CST A;  1TNZ A;  3P2B A;  4I9E A;  1WDY A;  2LAI A;  2XPZ A;  3HXC A;  3RO2 A;  4U95 D;  3QDN A;  4A63 B;  3KEA A;  3IHY A;  2YIN A;  3EIQ C;  2ZIR A;  1UN8 A;  1H19 A;  2R02 A;  5CCM A;  4HOQ A;  2F8X K;  2VTB A;  2MHK A;  2VYI A;  4KBQ A;  5FQ7 A;  1PAQ A;  3FUD A;  2AW6 A;  3W9F A;  5KJN A;  3ULE G;  2XCC A;  3PZD A;  1N9A A;  3TWQ A;  3CK9 A;  3HRA A;  3V31 A;  3RKV A;  3VLE A;  3B13 A;  1KT0 A;  3CVY A;  1X81 A;  4YDY A;  3DSW A;  4C9B B;  4DX6 D;  3G2V A;  2KCV A;  3LJ3 A;  4EHM A;  3L82 A;  3BU8 A;  4N3A A;  2GGF A;  4ANV A;  4BTA A;  4N3B A;  5G04 C;  3JQ0 A;  4P29 A;  4ACK A;  4TUU A;  5A7D B;  3Q75 A;  5AQB A;  3SQV A;  5A6C A;  4PS8 A;  2XGO A;  2EIM E;  2XRY A;  3CVW A;  3GZS A;  4U04 A;  4BSZ B;  2XS1 A;  4CT4 A;  4UQX A;  1W3B A;  3PUK A;  3FUH A;  1JWG A;  2WXO A;  3NF1 A;  4L1B A;  4UQY A;  3HXE A;  4JEU A;  3Q5M A;  2V5F A;  4X8Q A;  3ASG A;  3UIO C;  3QKY A;  3PEU B;  4QFV A;  2Y4T A;  5EDS A;  2GRL A;  5EIL A;  4DX1 A;  4ANU A;  3MA5 A;  2H6H A;  4AEZ C;  4I2Z A;  3HDX A;  4FC8 A;  3NBN B;  1HFA A;  4GTS A;  1N54 A;  1N0Q A;  1NA3 A;  1SW6 A;  4UQZ A;  4APO A;  2PZI A;  3NAW A;  4G26 A;  1QYM A;  3TAX A;  4C0M A;  2VQ2 A;  4A1S A;  3E4B A;  4BET A;  3SBS A;  2IY0 C;  3LY9 A;  2J08 A;  1N11 A;  5T8I A;  2FEZ A;  3UT7 A;  3ASO E;  3NOC D;  3SNX A;  1OWN A;  4LG6 A;  3D9H A;  3AU4 A;  3S7J A;  3DBS A;  5KJM A;  4J7W A;  3DPD A;  3VLD A;  4JEH A;  4KZ0 A;  4ABN A;  2VSX E;  3DEP A;  2AVP A;  3UQ3 A;  5JHA A;  2V5Q C;  2F8Y A;  4FUL A;  2V4H C;  3ASN E;  4EZL A;  2KXP C;  3DRA A;  2I6H A;  1PC2 A;  1AWC B;  3CVL A;  3RU0 A;  4WND A;  3NZS A;  4B8C B;  4TXP A;  3B7R L;  5CMW A;  4N3C A;  4RG9 A;  2J49 A;  4G8K A;  3U64 A;  4AIF A;  2GRP B;  2GRR B;  4HLE A;  1Y6I A;  2XZD G;  2F0Y A;  3GYZ A;  4PS7 A;  2P9I G;  3C5R A;  3G2T A;  3MX3 A;  4GML A;  1Z5S C;  2DYS E;  4U0U A;  5B3S E;  4FA6 A;  2OEW A;  4B8A A;  4GCN A;  1TJF A;  3AU5 A;  5EYL A;  3T5V A;  5AJD A;  2WXL A;  3PZ1 A;  4BX8 A;  5JJ6 A;  4OAV B;  3KSL A;  3EDT B;  1A5E A;  3PNT B;  5D0O D;  3EHR A;  3PZ2 A;  3BUA A;  1XGW A;  3LY8 A;  5KCM A;  3FU3 A;  4GMJ A;  5LCW C;  5C1D A;  4WNE A;  2A4Z A;  2R2L A;  1JUQ A;  2L0I A;  1KZP A;  5ITZ F;  3N71 A;  2R5S A;  2DCP A;  1OY3 D;  3D9P A;  4YDW A;  3CR3 A;  4MKT A;  3KS2 A;  3SD5 A;  3ZPJ A;  4LNG A;  5FQ6 A;  3I5P A;  3R9M A;  1S64 A;  3LXU X;  5EID A;  4CCA A;  1OUV A;  3CSF A;  4C48 B;  4U7E B;  3Q15 A;  5T4Y A;  1IHG A;  4ILG A;  3FH5 A;  3G2U A;  1TN6 A;  4I6J A;  4CDR A;  3TJP A;  4G2V A;  2HR2 A;  2WQH A;  4GTT A;  4G24 A;  4V3I A;  3QWP A;  2EIK E;  4WAF A;  2JAB A;  4IUL A;  4NIK A;  3TWT A;  2H6I A;  4UUC A;  2RG8 A;  3OXL A;  1NFI E;  2XGS A;  3FEX A;  2OCC E;  5FIO A;  3L16 A;  2R03 A;  4HRN A;  3UUX A;  3DEO A;  2OV8 A;  2YHC A;  3S7F A;  1YYH A;  3EHQ A;  4DX2 A;  5EYP F;  2WB2 A;  4BTB A;  1BPO A;  1OCZ E;  4JD2 G;  3TXM A;  3ZU7 B;  3CHM A;  3FFL A;  3IKO B;  5B1A E;  3EHM A;  1E7U A;  1OWO A;  4N5C A;  2I1J A;  4F1P A;  4GTP A;  4DI4 A;  5KWD A;  3V2O A;  1N4S A;  4J8F A;  2GRM A;  2DBA A;  3KSQ A;  2RKK A;  1MYO A;  3IEG A;  1UJJ A;  1KLX A;  5HKP A;  1IHB A;  5ENN A;  3JXI A;  1E7V A;  1D9S A;  4C0E A;  3OTN A;  3I4G A;  1MX2 A;  4GZC A;  3LDZ A;  3FTZ A;  3K9I A;  5KJL A;  3U66 A;  5JJ7 A;  2Y4U A;  2WXI A;  4I2W A;  4GMR A;  4O6F A;  4TV3 A;  2RFA A;  1LTX A;  2C0L A;  3PS6 A;  1K3Z D;  3B95 A;  3RSE G;  2XEN A;  4DLO A;  3VTX A;  1TNU A;  1HX8 A;  4B89 A;  3FY4 A;  1H2V C;  2FUL A;  2GW1 A;  1TN8 A;  2J4D A;  1EYH A;  3TWX A;  1EDU A;  4F53 A;  2LO6 A;  3LJN A;  3FP3 A;  2FO7 A;  2X6F A;  2P9U G;  3HVE B;  1HO8 A;  2VSY A;  4YVO A;  4LUN U;  5FIN A;  1OCC E;  3TG5 A;  4JPS A;  1WY6 A;  2Y1L E;  3RJV A;  4YND A;  2B0O E;  1IXV A;  4L2L A;  4J8E A;  1LD8 A;  1ELW A;  4JVS A;  4UWF A;  2ETA A; 
#chains in the Genus database with same CATH homology
 1DCQ A;  1MX6 A;  2QC9 A;  5ENO D;  4DX6 D;  3TWR A;  2AJA A;  3J5Q B;  3TWU A;  3NOG D;  4BEP A;  2J8S D;  1YMP A;  3NOC D;  5AQA A;  1MYO A;  3TWS A;  4O60 A;  1WG0 A;  4LG6 A;  3D9H A;  4QQI A;  2ZGG A;  4LSZ E;  4HRM B;  5HKP A;  1IHB A;  1DC2 A;  3ZNG A;  5ITZ F;  5KBA A;  1BI7 B;  2DWZ A;  2A5E A;  4J7W A;  4TUM A;  2NYJ A;  1MX4 A;  3UTM A;  1OY3 D;  2XZT G;  4U8Y D;  4YDW A;  1G3N B;  3JXI A;  2RFM A;  3UXG A;  2ZGD A;  2F37 A;  4J8Y A;  5ENR D;  5AQB A;  3TWV A;  5JA4 D;  3ZUV B;  3DEP A;  1D9S A;  1BD8 A;  2PNN A;  4GPM A;  4B93 B;  2ETC A;  1MX2 A;  4HRL A;  2V5Q C;  2F8Y A;  4DRX E;  4JB8 P;  2VGE A;  4DX7 D;  4BER A;  2DZO A;  4BES A;  5BXU A;  5EID A;  4HNA D;  4F6R D;  4U96 D;  2V4H C;  5ENQ D;  4C48 B;  4DUI A;  1UOH A;  2DZN A;  2KXP C;  3ZKJ A;  2XEE A;  2L6B A;  4BSZ B;  4K5A B;  1AWC B;  1N11 A;  1BLX B;  2MYO A;  4U8V D;  1S70 B;  4GMR A;  3UI2 A;  4O1P A;  2RFA A;  2XEH A;  5ENP D;  5CED B;  5KNH D;  4N5Q A;  5ENS D;  3IXE A;  1K3Z D;  3B95 A;  2XEN A;  5CBO A;  2FO1 E;  3Q9U C;  3AJI A;  5CER B;  1WDY A;  3V2X A;  5AAR A;  4K5B A;  4G8K A;  2JAB A;  3B7B A;  4LNU D;  4NIK A;  4RLY A;  3TWT A;  1BU9 A;  4U95 D;  5CEC B;  2KBX A;  4UUC A;  4HI8 A;  1NFI E;  2BKK B;  5FIO A;  4OAU C;  2BKG A;  2XZD G;  5D66 A;  3V79 K;  3TWX A;  4QFV A;  3KEA A;  4A63 B;  5BXO A;  4HRN A;  4Z68 A;  5HS0 A;  1MJ0 A;  4ZFH A;  3C5R A;  3DEO A;  5HRY A;  1AP7 A;  3LJN A;  5EIL A;  4DX1 A;  1N0R A;  1YYH A;  1SVX A;  3EU9 A;  3EHQ A;  5EN5 D;  5AQ7 A;  2F8X K;  4HQD A;  4DX2 A;  5EYP F;  4CZ2 D;  3F6Q A;  2HE0 A;  5EYL A;  5AAO A;  4HI9 A;  3W9G A;  3AAA C;  5JMN D;  4HBD A;  5ENT D;  4CYM D;  5CEA A;  3NBN B;  5FIN A;  3T9K A;  4HB5 A;  3W9F A;  4ZHB A;  1BI8 B;  1K1B A;  3Q9N C;  1TR4 A;  5KNG A;  3SO8 A;  3T8K A;  1N0Q A;  3ZU7 B;  5CBN A;  4OAV B;  1SW6 A;  3HRA A;  4O1O A;  3TWQ A;  4G8L A;  3V31 A;  2P2C P;  3TWW A;  5AQ9 A;  4ATZ D;  4K5C A;  3JXJ A;  1QYM A;  3V30 A;  2Y1L E;  3JUE A;  2B0O E;  1IXV A;  4F1P A;  1A5E A;  2Y0B G;  5EIB E;  3J5P A;  1YCS B;  1OT8 A;  4HLL A;  3HG0 D;  2DVW A;  2ETB A;  1K1A A;  2ETA A;  4BET A;  3EHR A;  5AN8 A;  1IKN D;  4DX5 D;  3V2O A;  5KWD A;  4YDY A;  2QYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...