2ETAA

Crystal structure of the ankyrin repeat domain of the trpv2
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
245
structure length
239
Chain Sequence
FDRDRLFSVVSRGVPEELTGLLEYLRWNSKYLTDSAYTEGSTGKTCLMKAVLNLQDGVNACIMPLLQIDKDSGNPKPLVNAQCTDEFYQGHSALHIAIEKRSLQCVKLLVENGADVHLRACGRFFQFYFGELPLSLAACTKQWDVVTYLLENPHQPASLEATDSLGNTVLHALVMIADNSPENSALVIHMYDGLLQMGARLCPTVQLEEISNHQGLTPLKLAAKEGKIEIFRHILQREF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal Ankyrin Repeat Domain of the TRPV2 Ion Channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords Transient receptor potential cation channel subfamily V memb
total genus 85
structure length 239
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2etaA00
5KBAA 2P2CP 4K5BA 1A5EA 3HG0D 5D66A 2QC9A 3UTMA 2DWZA 3C5RA 2Y1LE 5ENQD 2V4HC 2NYJA 5KWDA 5EYLA 4G8KA 4LG6A 2L6BA 1SVXA 3Q9UC 2ZGDA 4QFVA 4DX1A 5AQBA 3D9HA 3LJNA 4DX7D 1BU9A 4OAVB 4BSZB 4CZ2D 2F37A 5JA4D 2BKGA 4ZFHA 5BXOA 4DUIA 3AJIA 4NIKA 4F6RD 1UOHA 4Z68A 5ENTD 1DC2A 3AAAC 2QYJA 3V30A 3TWRA 5KNHD 1SW6A 5ENPD 1D9SA 5CEAA 4J8YA 1N11A 5EIDA 4B93B 4DRXE 4OAUC 2KXPC 4HQDA 2ETAA 4HLLA 3TWSA 4N5QA 1WDYA 3IXEA 4GPMA 5ITZF 1TR4A 2DVWA 5AQ7A 5HKPA 3V31A 1YCSB 3ZNGA 4A63B 5EIBE 2J8SD 3F6QA 2A5EA 1MYOA 2B0OE 3EHQA 4UUCA 1OY3D 4YDWA 3W9FA 3EHRA 4ZHBA 4HRNA 1BI7B 2VGEA 3T9KA 3DEOA 4K5AB 2XENA 3KEAA 3J5QB 3EU9A 4U95D 1K3ZD 2KBXA 4GMRA 2V5QC 3ZU7B 2ETCA 5CEDB 2BKKB 4HB5A 4RLYA 3TWWA 2MYOA 2JABA 4DX2A 3V79K 5KNGA 1AWCB 3TWTA 4CYMD 4K5CA 5AN8A 3JXJA 5AQAA 2AJAA 3TWXA 4U8VD 2DZOA 4HRLA 4ATZD 1IHBA 5CERB 3J5PA 5AQ9A 3JUEA 1YYHA 5CBNA 3UXGA 4HI9A 1MJ0A 4TUMA 4F1PA 1K1BA 1MX6A 4U96D 2DZNA 4YDYA 1QYMA 4QQIA 1MX2A 1IKND 5FINA 1BLXB 1K1AA 4LSZE 1OT8A 5AAOA 4DX5D 5BXUA 5EILA 2HE0A 1MX4A 4BETA 1IXVA 5AARA 1BI8B 4G8LA 3TWVA 4O1PA 2XZDG 5CBOA 4BEPA 4O1OA 4HNAD 4BERA 4O60A 5HS0A 1WG0A 3ZKJA 1BD8A 1DCQA 1N0QA 2RFAA 2RFMA 4HBDA 4JB8P 3V2XA 4DX6D 3B95A 3JXIA 2XZTG 3B7BA 3ZUVB 5FIOA 4J7WA 2XEEA 4BESA 1NFIE 4U8YD 2F8XK 3SO8A 2ZGGA 5ENOD 2F8YA 3Q9NC 4HI8A 5EN5D 3NOGD 4HRMB 5HRYA 5JMND 5ENRD 1S70B 5EYPF 3TWQA 3W9GA 4C48B 3T8KA 1G3NB 2Y0BG 3UI2A 2FO1E 2PNNA 3V2OA 1N0RA 4LNUD 3NOCD 1AP7A 3HRAA 5CECB 3NBNB 2ETBA 1YMPA 5ENSD 2XEHA 3TWUA 3DEPA
chains in the Genus database with same CATH superfamily
5KBAA 4FADA 4G24A 3QARA 3UM3A 2VJ8A 1DVPA 4LG6A 4GZCA 2P9PG 4E85A 3CVYA 3GW4A 5JA4D 5BXOA 1OUVA 1UOHA 4LEUA 2IONA 1D9SA 4C9BB 2DCPA 1UJKA 2UY1B 2XEVA 3Q7AA 3EUVA 4HS2A 4XE0A 2X6FA 5KNGA 3JXJA 2R59A 4O6FA 5CERB 3TL5A 3SHFA 4AY5A 4U07A 4DK5A 2FBNA 1UN8A 4XI9A 2X38A 4GYOA 4AIFA 2HE0A 3FP3A 5AARA 3OTNA 4BEPA 4AEZC 4HNAD 1YA0A 3HXCA 3ZKJA 3B7UX 4PS3A 3UQ3A 1WY6A 4KMOA 4TV3A 3FUMA 3BQOA 4BSXA 3DWLG 2F8XK 2YNQA 2J49A 3NOGD 3S7BA 1XGWA 2J4BA 1VDYA 1QZ2A 1N4QA 4JL0A 2IOSA 2PM7A 3UM0A 4L2YA 4CGWA 2VYIA 2LXLA 3L16A 4GTMA 4LNBA 4ACLA 2KZTB 3E34A 1DC2A 3MJWA 3NF1A 2RKKA 3TG5A 4C0MA 4HVBA 4PUCA 1OWNA 2A5EA 1OY3D 3AG1E 1IHGA 2WXJA 3C3OA 3L54A 4APOA 4I1AA 2V5QC 1EDUA 3U64A 2JABA 2KZTA 5B3SE 4XZ4A 3D9LA 3ASDA 4CT0A 4GB9A 1H6KA 4N2QA 1XNFA 4NRHB 4U0UA 2DZNA 1W3BA 3AG3E 3CHOA 1IKND 2OCCE 1LD7A 4DX5D 1RW2A 4BETA 4LNGA 3LVRE 3Q5MA 4BERA 1TJCA 1RZ4A 4UWLA 4JB8P 1FT1A 2R17C 1N54A 1KT1A 2IJGX 3KAEA 4GA0A 3CVWA 4JVSA 3ZYMA 2PL2A 1FPPA 3I3NA 3BUAA 3TWUA 2EINE 4TXRA 1NZNA 4FJZA 2I1KA 2H6FA 1KZOA 4HOSA 2KCKA 3LJNA 4DX7D 5E76A 4UWFA 3L08A 2HYZA 3DSUA 5C1DA 4U63A 2XPZA 3FU3A 4F6RD 2WXHA 3MCXA 4DI4A 2BEDA 5EIDA 4JW1A 2VSXE 3ASHA 2QZAA 4AV7A 3D9OA 4YVOA 4AY6A 4IULA 2ILRA 2XGMA 4ATGA 2MOWA 3FTYA 2OOEA 4BTAA 2ETCA 2KATA 5CEDB 3LYAA 3FUEA 3UINC 4IRUA 3S7FA 4GA2A 3HXEA 3ULQA 1HG2A 4MLPA 5KCMA 2H6IA 1EPUA 5AQ9A 2FI7A 3URZA 5CBNA 3FUDA 2WXRA 4MS6A 4HOUA 5A7DB 4YDYA 1BPOA 3NB2A 4QQIA 3ABME 1O1RA 4N3AA 3RRNB 3RRUA 1X5BA 2WXGA 4GYWA 2MHKA 3AS5A 4F53A 3C72A 2CFZA 1PC2A 3V2XA 5LP0A 3ZUVB 3T5VA 3MEKA 3Q73A 2F8YA 3WG7E 1TNBA 2AXVA 1HO8A 3LXUX 3T8KA 3AS4A 3LEWA 3GZ1A 5CRVA 1D8EA 2YHCA 2P58C 4K5BA 3VLFA 3HXDA 3MKRA 2XCBA 5ENQD 1E8ZA 4WWOA 5JJTA 2GRPB 3AG4E 4DX1A 4BFRA 3B7SA 4KXKB 3BEEA 3PE4A 3FH8A 1WAO1 5T4YA 1QBQA 5EKQD 1SW6A 4HFGA 3HVEB 4OAUC 3CKCA 3PREA 3BU8A 4UUCA 4UWKA 3CVNA 3L9TA 5T8IA 4WWPA 3ZU7B 3VLDA 1Y6IA 3L13A 3EIQC 5C2YA 2WXLA 5HQ8A 3RAUA 2QFCA 3CHRA 3PZ1A 3ML8A 2L6JA 3I5PA 1QYMA 4PS8A 5FINA 2NXPA 1K1AA 4XX5A 4UI9K 4W9RA 3LY8A 2XZDG 1OCZE 3CV0A 2C0LA 1FVHA 1U3CA 4PS7A 4M7CA 4GTRA 4UI9J 4L9PA 2CHWA 3E33A 4AXHA 4GPKA 4LNUD 2C0MA 3EJNA 3FUIA 2XEHA 3O4ZA 4G26A 2F0YA 4GTQA 3CVVA 3WXXA 2V5FA 1BU9A 2EILE 5ARGA 4CZ2D 2IU1A 2JEKA 2L9BA 3K9IA 5DIZA 4I2ZA 3TWRA 3IEGA 1GW6A 4B93B 3CSFA 2LAIA 2AWIA 3NZSA 3JYSA 4I6JA 5LX8A 4KZCA 3UM1A 2I6HA 4HOTA 4K5AB 4GA1A 4U95D 2EIME 4GMRA 3LY7A 4G25A 3PDNA 3TWWA 3CVXA 3PS6A 2L0TB 3B7RL 2PZIA 2H6GA 3VTYA 4U8VD 1X81A 2WQHA 1NA0A 2X6JA 2KC7A 4JHKA 2L0IA 3ZEFA 3CQCB 1TNZA 4JEHA 1OWMA 2HM8A 4A1SA 3B95A 1DCEA 2I2OA 4GCOA 1NFIE 3DSXA 1MHQA 3ONKA 2YINA 3KD7A 2VTBA 2ZGGA 3U9WA 1MZCA 3QNKA 3ZHEA 5FQ6A 4DJAA 3RJVA 3IV0A 3BG1B 1SZAA 2P2CP 3APFA 4GTVA 3OXLA 2X3MA 4XKCA 1JCSA 4JC8A 3DPYA 1E8YA 5G05C 2R2LA 2CHZA 3T5XA 1KZPA 2I1JA 3RIBA 2XS1A 2XPYA 4L1BA 1UW4B 1NP7A 2LAHA 1U2VG 3CSTA 4DRXE 4WWNA 1V55E 3CVUA 3G2WA 4F3VA 5KJMA 3ASOE 4JXTA 4WNGA 3PE3A 5FT9A 3LCAA 2GROB 3U3WA 3P1UA 1OCRE 3CGHA 4FLBA 4J0UA 3TG4A 5AN8A 4LERA 4L7TA 1JUQA 4JZYA 1JWFA 4J8FA 2WB2A 5FTPA 2IF4A 5G04C 1MJ0A 3G2UA 4APFA 4I9EA 3GYZA 1S0PA 2GW1A 2OV8A 2ZIRA 3CK7A 3TWVA 5A23A 3ISMC 4O60A 4EHMA 4DLOA 2XHEA 2XEEA 2GRQB 1Z6TA 1O1SA 5EN5D 1N52A 2CFUA 3KEZA 1AP7A 3ASNE 2DBAA 4ILGA 3B7TA 1ELKA 1TN6A 4KVOA 5FZRA 3SY2A 4WNFA 2R5SA 4G8KA 1PAQA 3PZ3A 4QFVA 2H6HA 4L23A 3EU5A 4NIKA 3T8MA 2QYJA 5ANRA 2WVIA 5KNHD 3UPVA 2KXPC 4GMLA 2AW6A 4GPMA 3QB2A 5EIBE 2XQ0A 3W9FA 4DI3A 2VQ2A 3JQ1A 4I1OB 3EU9A 4ABNA 4U8HA 3B13A 2LNIA 4CYMD 2A4ZA 1E7UA 3HDXA 4G1TA 4ACKA 1H2UA 3NAWA 4FULA 4HOQA 4BWRA 1NA3A 5G55A 5EILA 3ZHEB 2HO1A 2NC9A 1OCCE 5ARFA 4IN3B 4MKTA 3IHVA 2IEJA 3JXIA 3I4GA 2CG2A 3IKOB 3ZRHA 1Z3YA 4Q69A 4U8YD 4J8DA 4JEUA 4KYOB 3Q9NC 2IO3C 4GYYA 4EECA 1U3DA 2WPVA 3CLJA 4UQZA 4OYSA 3CQGB 4LCTA 3CR3A 5G05J 5CECB 1ZBPA 5H7PA 2GRLA 2NYJA 5KWDA 2P9SG 1H6PA 3CIAA 2F37A 3S2AA 3ESLA 3E30A 4KZ0A 3PNTB 3E37A 4YDEA 1Z5SC 3VLEA 2DIWA 4YNDA 1TR4A 3ZNGA 3ZIMA 1Y8MA 3APCA 4FA6A 4DPRA 2JLBA 3R9MA 2J08A 2PM6A 2OVBA 3MV3B 2B6CA 3LVQE 2MYOA 5AIJA 1EYHA 3UMVA 1OWLA 2XCCA 4J8EA 5FZQA 4GAAA 5FQ8A 4R7LA 4TUMA 1ZB1A 5D0OD 3BG0B 2P9UG 4GZ5A 2IO2C 1ELRA 4A3TA 5CBOA 4CCAA 2I9CA 3FU5A 4YDOA 1EF1C 3QWWA 2RFMA 5LOZA 4GCNA 1H2VC 4ME2A 4I2WA 4A55A 3Q15A 1JPLA 4EZKA 2KCVA 5EYPF 5J08A 5LFAA 4GMJA 2IFUA 3P2BA 3SBTB 3V2OA 2FO7A 3DSSA 1WM5A 5BV0A 3NBNB 3QKYA 4U0SA 1TNYA 4AJWA 3TXNA 3Q9UC 3FDHA 4U04A 4BX9A 3SBSA 3ZYKA 3GZSA 4I17A 4CDMA 3AAAC 4RG9A 4UI9C 3RO2A 3FHEA 4EQFA 3HHMA 4Q96A 1KT0A 4PDXA 3I4RB 4UWGA 2P9KG 5AQ7A 4AOFA 3RKVA 4HRNA 2VGEA 3ZXSA 4UQYA 2X6HA 3LJ3A 2EIJE 3OXGA 4AP2A 1LD8A 4FHJA 2AVPA 3Q78A 5AJDA 1SA4A 3MV2B 5CMYA 4GTSA 4GZ6A 4BT9A 3CVPA 1MX6A 4U96D 5IY5E 4BY6A 4FU3A 1S63A 1ELWA 1OT8A 3MKQB 1BI8B 4JD2G 4RSYA 3QWPA 4FHKA 4DX6D 1HX8A 2LSUA 4U0ZA 2XGSA 4J7WA 2GRRB 1O5MA 5BUZA 5KJNA 2VTBB 4HRMB 1B89A 3TWQA 2IOLA 4C48B 5FJYA 4N39A 4G11A 4ANXA 3Q47B 1Z3XA 3HRAA 4HXIA 3DEPA 1N4RA 4CDNA 1A5EA 3RU0A 3SGHA 3UTMA 3HXBA 3QAQA 3UUXA 3D9IA 5CRUA 4G2VA 2QY7A 4XI0A 2HR2A 3C3RA 1DNPA 4Z68A 3LS8A 3ZYQA 3CHMA 2AXZA 5HI7A 4OVVA 5FQ7A 2ETAA 4HLLA 4N5QA 2FF4A 4A63B 1YCSB 2DYRE 3AU5A 4Y6WA 3PZ4A 4ZHBA 2E0IA 2RG8A 1TNOA 3NZUA 5AYWD 3FUFA 4HB5A 2EQXA 5D0QD 4B94A 3TJPA 3TWTA 3SF4A 2DZOA 4J8SA 4F1SA 3QDNA 1YYHA 2M63A 4MRUA 4GZ3A 2QYUA 3UXGA 4F1PA 2XGOA 4JHRA 4A1GA 3TAXA 3LY9A 4G8LA 1TNUA 2EIKE 2WM9A 5FQ4A 2XS8A 3RK6A 3CEQA 1A17A 1UG3A 2WXKA 5KJLA 5T3RA 3AS8A 1MQSA 1TYQG 5EDSA 5JMND 2GGFA 3QK0A 2UWJG 2WXOA 1FT2A 4E6HA 5BPPA 1TN7A 4L2LA 2KCLA 1KLXA 4GTPA 1YMPA 1NL4A 3KS2A 1K8KG 3D3MA 5D66A 5EX0A 4URKA 2Y1LE 2L6BA 4CT4A 3UKRG 4OAVB 2BKGA 2BUGA 3SFXA 3AJIA 3FTVA 2XPIA 2GRNB 1HS6A 4V3IA 2P9NG 5CEAA 3DXMG 2J9QA 2WXPA 4XIFA 1L5JA 3DSTA 3Q49B 4YDWA 4I1MA 3FTZA 3T9KA 3DEOA 3OXFA 5EX3A 4RG6A 3DXKG 3ULYA 4AVXA 4NQ0A 3EHMA 2ZISA 3FFLA 1UJJA 1N95A 1IHBA 3D9MA 3D9PA 5FWQA 4JA9A 4UWHA 1K1BA 5BV1A 2E2EA 4Y6CA 2WQ6A 4GTTA 3LPZA 2KM4A 3LKUA 3DSWA 3UM2A 4N2SA 5HS0A 1N0QA 4D10C 2FULA 4PH4B 5FIOA 3KSLA 3UIOC 3UT7A 4GTOA 3W9GA 2FO1E 2Y0BG 3Q4AB 2PNNA 3HVEA 1JCQA 2ETBA 5ENSD 2WXQA 3HYMB 1HXIA 2V4HC 5EYLA 2P9LG 3MX3A 3FEYA 3SD5A 3N71A 3ML9A 4TUUA 4X8QA 3S7JA 3L6AA 4DUIA 5ENNA 3FY4A 3PH0C 5ANLA 2WMOA 1NI1A 3EDTB 5G2NA 4WAFA 1E96B 3V31A 5HKPA 5JHBA 4JPSA 3F6QA 3PEVB 1MYOA 2B0OE 2PQNA 2KBXA 5FZSA 2WXMA 3HXFA 2LUHA 4K5CA 2IQCA 1JWGA 4HI9A 3ZFWA 1IYGA 3PUKA 3TXMA 3ONLA 4HORA 3UKUG 4GZDA 1BD8A 3FH5A 3NQPA 4ANUA 2A5UA 5BT1A 4CGVA 4I6EA 2ZXWE 4B89A 2OEVA 4EPZA 3PNLB 4HI8A 1IQUA 5ENRD 3MYVA 3ULEG 3JUIA 2VSNA 5AENA 3FTWA 3CHQA 4RQIA 4LRZA 1HH8A 2UY1A 3D9HA 5CHEE 3QC1A 2P9IG 3ZGQA 3QWVA 2R05A 3Q79A 4ZFHA 3RRMB 2V0PA 2CG3A 5ENTD 4FJYA 2BTDA 5ENPD 3PRZA 3L22A 3L82A 4WNEA 4EZLA 1E8XA 1HU3A 1HE8A 5D2MC 3ZW3A 3SFYA 1N9AA 4AM9A 4RVBA 2BKKB 4RLYA 2VSYA 4DX2A 3MKQA 4I43A 3FU0A 3DPDA 2CHXA 2ONDA 4HRLA 1H2TC 3GZ2A 3J5PA 3ZVVA 3ESKA 5LCWJ 2WMNA 4N3CA 3SZ7A 2XRYA 4KVMA 5AAOA 3SFZA 1OCOE 5BXUA 1OWOA 4YVQC 3ZYLA 3G2SA 3ZXPA 4C0EA 3IBEA 3FH7A 2RFAA 3G2VA 4LUNU 3R9AB 2XZTG 4XKBA 1FCHA 1HFAA 1S64A 1OWPA 1PY1A 2OVFA 5HRYA 3U66A 4H7XA 2FEZA 1G3NB 5BW8C 2R02A 3R7QA 3UX4A 3HG0D 3S7DA 2ZGDA 3CK9A 5AQBA 4ILHB 2X6IA 4K03A 4H7YA 2PQRA 1Q2ZA 2LSVA 3FTUA 1N11A 2DYSE 5CCMA 2AXUA 4HQDA 3TWSA 5CMWA 3KSQA 5ITZF 2DVWA 2OEWA 2YQ8A 5LCWC 3EHNA 3EHRA 4G23A 1FVFA 3E32A 4TRQA 1ZU2A 3FUJA 4DLQA 1K3ZD 3D9KA 4I9CA 1TJFA 4MBGA 3SQVA 4I6GA 1N94A 1O1TA 3UT4A 4ATZD 3U4TA 4JHJA 5G04J 4A3VA 2WXNA 1SA5A 1HF8A 1P5QA 4OVUA 3RO3A 4CRWA 1BLXB 3CKBA 3CHSA 4Q94A 3ZN3A 4TXQA 1OXJA 4O1PA 3MZLB 4CDRA 4HBDA 4J6IA 2BF0X 3PVLA 3ABKE 3SO8A 5ENOD 2VGYA 4WUYA 3FU6A 5B1AE 3QJZA 4FP7A 2RD0A 3Q75A 4B8AA 5AJLA 2Y3AA 4XEIG 2QC9A 1IQRA 4KT6B 3IHYA 4B8CB 3C5RA 2X6KA 2XRZA 1SVXA 3AG2E 1SQMA 3E4BA 4BSZB 5JJ7A 4NURA 4KBQA 3G2TA 3HIZA 5JHAA 2LO6A 2WXFA 4U7EB 1LF8A 2V8SE 1WDYA 3PZDA 3IXEA 4ANVA 3AU4A 1N4SA 3KEAA 3J5QB 1INZA 3CHPA 5JJ6A 1KPSB 3LDZA 3V79K 1AWCB 1QQEA 2Y69E 3ASFA 5AQAA 2AJAA 2VSOE 4JA7A 4M3OA 3SI5A 4WNDA 1E8WA 3UT8A 3FTSA 3ZPJA 1LTXA 3R7RA 2J09A 3MGBA 4N3BA 2V4LA 3ENEA 2VGXB 4LSZE 1TN8A 4FC8A 2J4DA 1MX4A 1IXVA 2Y4UA 4EZJA 4O1OA 3RSEG 5J90A 4GU5A 4BT8A 1WG0A 3ABLE 4EBAG 2GRMA 3B7BA 3PEUB 4TXPA 2NSZA 3C98A 3TGOA 2ZU6B 1V54E 1TEZA 1S70B 4UQXA 1JCRA 4ANWA 3FUHA 3NOCD 2VGXA 3CVLA 2DWZA 3QOUA 3MA5A 3JQ0A 4BX8A 4IYPA 4HLEA 3ASGA 5KJKA 1H0AA 2YHEA 3APDA 4N5CA 3V30A 3D9JA 4BTBA 3DBSA 4J8YA 4F7AA 4EBAA 1QNFA 3PUJA 2Q7FA 5DBKA 5CCLA 2J8SD 3EHQA 3SNXA 2J07A 3DSVA 1BI7B 3FULA 3EIJA 5M72A 2XENA 3FUNA 3PZ2A 3VTXA 3TWXA 4B0ZA 3UIPC 3Q7FA 3OAWA 3JUEA 4FLHA 1H19A 2WQ7A 3C3QA 1H6OA 3CVQA 4ILIA 3CK8A 1MX2A 2C2LA 3FUKA 5E75A 2IY0C 1E7VA 1UN9A 2Y4TA 4P29A 3FEXA 3FTXA 1HZ4A 2LXMA 3X2QE 1DCQA 3FWVA 3D9NA 1N4PA 1E90A 4NACA 4BESA 2R03A 5A6CA 3DRAA 5BNWA 5B1BE 4CEMA 1SZ9A 2WXIA 1N0RA 2MRIA 3O48A 1D8DA 3L17A 4K0RA 3UI2A 1HG5A 3JCKC
chains in the Genus database with same CATH topology
5KBAA 2P2CP 4K5BA 1A5EA 3HG0D 5D66A 2QC9A 3UTMA 2DWZA 3C5RA 2Y1LE 5ENQD 2V4HC 2NYJA 5KWDA 5EYLA 4G8KA 4LG6A 2L6BA 1SVXA 3Q9UC 2ZGDA 4QFVA 4DX1A 5AQBA 3D9HA 3LJNA 4DX7D 1BU9A 4OAVB 4BSZB 4CZ2D 2F37A 5JA4D 2BKGA 4ZFHA 5BXOA 4DUIA 3AJIA 4NIKA 4F6RD 1UOHA 4Z68A 5ENTD 1DC2A 3AAAC 2QYJA 3V30A 3TWRA 5KNHD 1SW6A 5ENPD 1D9SA 5CEAA 4J8YA 1N11A 5EIDA 4B93B 4DRXE 4OAUC 2KXPC 4HQDA 2ETAA 4HLLA 3TWSA 4N5QA 1WDYA 3IXEA 4GPMA 5ITZF 1TR4A 2DVWA 5AQ7A 5HKPA 3V31A 1YCSB 3ZNGA 4A63B 5EIBE 2J8SD 3F6QA 2A5EA 1MYOA 2B0OE 3EHQA 4UUCA 1OY3D 4YDWA 3W9FA 3EHRA 4ZHBA 4HRNA 1BI7B 2VGEA 3T9KA 3DEOA 4K5AB 2XENA 3KEAA 3J5QB 3EU9A 4U95D 1K3ZD 2KBXA 4GMRA 2V5QC 3ZU7B 2ETCA 5CEDB 2BKKB 4HB5A 4RLYA 3TWWA 2MYOA 2JABA 4DX2A 3V79K 5KNGA 1AWCB 3TWTA 4CYMD 4K5CA 5AN8A 3JXJA 5AQAA 2AJAA 3TWXA 4U8VD 2DZOA 4HRLA 4ATZD 1IHBA 5CERB 3J5PA 5AQ9A 3JUEA 1YYHA 5CBNA 3UXGA 4HI9A 1MJ0A 4TUMA 4F1PA 1K1BA 1MX6A 4U96D 2DZNA 4YDYA 1QYMA 4QQIA 1MX2A 1IKND 5FINA 1BLXB 1K1AA 4LSZE 1OT8A 5AAOA 4DX5D 5BXUA 5EILA 2HE0A 1MX4A 4BETA 1IXVA 5AARA 1BI8B 4G8LA 3TWVA 4O1PA 2XZDG 5CBOA 4BEPA 4O1OA 4HNAD 4BERA 4O60A 5HS0A 1WG0A 3ZKJA 1BD8A 1DCQA 1N0QA 2RFAA 2RFMA 4HBDA 4JB8P 3V2XA 4DX6D 3B95A 3JXIA 2XZTG 3B7BA 3ZUVB 5FIOA 4J7WA 2XEEA 4BESA 1NFIE 4U8YD 2F8XK 3SO8A 2ZGGA 5ENOD 2F8YA 3Q9NC 4HI8A 5EN5D 3NOGD 4HRMB 5HRYA 5JMND 5ENRD 1S70B 5EYPF 3TWQA 3W9GA 4C48B 3T8KA 1G3NB 2Y0BG 3UI2A 2FO1E 2PNNA 3V2OA 1N0RA 4LNUD 3NOCD 1AP7A 3HRAA 5CECB 3NBNB 2ETBA 1YMPA 5ENSD 2XEHA 3TWUA 3DEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KBA A;  2P2C P;  4K5B A;  1A5E A;  3HG0 D;  5D66 A;  2QC9 A;  3UTM A;  2DWZ A;  3C5R A;  2Y1L E;  5ENQ D;  2V4H C;  2NYJ A;  5KWD A;  5EYL A;  4G8K A;  4LG6 A;  2L6B A;  1SVX A;  3Q9U C;  2ZGD A;  4QFV A;  4DX1 A;  5AQB A;  3D9H A;  3LJN A;  4DX7 D;  1BU9 A;  4OAV B;  4BSZ B;  4CZ2 D;  2F37 A;  5JA4 D;  2BKG A;  4ZFH A;  5BXO A;  4DUI A;  3AJI A;  4NIK A;  4F6R D;  1UOH A;  4Z68 A;  5ENT D;  1DC2 A;  3AAA C;  2QYJ A;  3V30 A;  3TWR A;  5KNH D;  1SW6 A;  5ENP D;  1D9S A;  5CEA A;  4J8Y A;  1N11 A;  5EID A;  4B93 B;  4DRX E;  4OAU C;  2KXP C;  4HQD A;  2ETA A;  4HLL A;  3TWS A;  4N5Q A;  1WDY A;  3IXE A;  4GPM A;  5ITZ F;  1TR4 A;  2DVW A;  5AQ7 A;  5HKP A;  3V31 A;  1YCS B;  3ZNG A;  4A63 B;  5EIB E;  2J8S D;  3F6Q A;  2A5E A;  1MYO A;  2B0O E;  3EHQ A;  4UUC A;  1OY3 D;  4YDW A;  3W9F A;  3EHR A;  4ZHB A;  4HRN A;  1BI7 B;  2VGE A;  3T9K A;  3DEO A;  4K5A B;  2XEN A;  3KEA A;  3J5Q B;  3EU9 A;  4U95 D;  1K3Z D;  2KBX A;  4GMR A;  2V5Q C;  3ZU7 B;  2ETC A;  5CED B;  2BKK B;  4HB5 A;  4RLY A;  3TWW A;  2MYO A;  2JAB A;  4DX2 A;  3V79 K;  5KNG A;  1AWC B;  3TWT A;  4CYM D;  4K5C A;  5AN8 A;  3JXJ A;  5AQA A;  2AJA A;  3TWX A;  4U8V D;  2DZO A;  4HRL A;  4ATZ D;  1IHB A;  5CER B;  3J5P A;  5AQ9 A;  3JUE A;  1YYH A;  5CBN A;  3UXG A;  4HI9 A;  1MJ0 A;  4TUM A;  4F1P A;  1K1B A;  1MX6 A;  4U96 D;  2DZN A;  4YDY A;  1QYM A;  4QQI A;  1MX2 A;  1IKN D;  5FIN A;  1BLX B;  1K1A A;  4LSZ E;  1OT8 A;  5AAO A;  4DX5 D;  5BXU A;  5EIL A;  2HE0 A;  1MX4 A;  4BET A;  1IXV A;  5AAR A;  1BI8 B;  4G8L A;  3TWV A;  4O1P A;  2XZD G;  5CBO A;  4BEP A;  4O1O A;  4HNA D;  4BER A;  4O60 A;  5HS0 A;  1WG0 A;  3ZKJ A;  1BD8 A;  1DCQ A;  1N0Q A;  2RFA A;  2RFM A;  4HBD A;  4JB8 P;  3V2X A;  4DX6 D;  3B95 A;  3JXI A;  2XZT G;  3B7B A;  3ZUV B;  5FIO A;  4J7W A;  2XEE A;  4BES A;  1NFI E;  4U8Y D;  2F8X K;  3SO8 A;  2ZGG A;  5ENO D;  2F8Y A;  3Q9N C;  4HI8 A;  5EN5 D;  3NOG D;  4HRM B;  5HRY A;  5JMN D;  5ENR D;  1S70 B;  5EYP F;  3TWQ A;  3W9G A;  4C48 B;  3T8K A;  1G3N B;  2Y0B G;  3UI2 A;  2FO1 E;  2PNN A;  3V2O A;  1N0R A;  4LNU D;  3NOC D;  1AP7 A;  3HRA A;  5CEC B;  3NBN B;  2ETB A;  1YMP A;  5ENS D;  2XEH A;  3TWU A;  3DEP A; 
#chains in the Genus database with same CATH topology
 5KBA A;  4FAD A;  4G24 A;  3QAR A;  3UM3 A;  2VJ8 A;  1DVP A;  4LG6 A;  4GZC A;  2P9P G;  4E85 A;  3CVY A;  3GW4 A;  5JA4 D;  5BXO A;  1OUV A;  1UOH A;  4LEU A;  2ION A;  1D9S A;  4C9B B;  2DCP A;  1UJK A;  2UY1 B;  2XEV A;  3Q7A A;  3EUV A;  4HS2 A;  4XE0 A;  2X6F A;  5KNG A;  3JXJ A;  2R59 A;  4O6F A;  5CER B;  3TL5 A;  3SHF A;  4AY5 A;  4U07 A;  4DK5 A;  2FBN A;  1UN8 A;  4XI9 A;  2X38 A;  4GYO A;  4AIF A;  2HE0 A;  3FP3 A;  5AAR A;  3OTN A;  4BEP A;  4AEZ C;  4HNA D;  1YA0 A;  3HXC A;  3ZKJ A;  3B7U X;  4PS3 A;  3UQ3 A;  1WY6 A;  4KMO A;  4TV3 A;  3FUM A;  3BQO A;  4BSX A;  3DWL G;  2F8X K;  2YNQ A;  2J49 A;  3NOG D;  3S7B A;  1XGW A;  2J4B A;  1VDY A;  1QZ2 A;  1N4Q A;  4JL0 A;  2IOS A;  2PM7 A;  3UM0 A;  4L2Y A;  4CGW A;  2VYI A;  2LXL A;  3L16 A;  4GTM A;  4LNB A;  4ACL A;  2KZT B;  3E34 A;  1DC2 A;  3MJW A;  3NF1 A;  2RKK A;  3TG5 A;  4C0M A;  4HVB A;  4PUC A;  1OWN A;  2A5E A;  1OY3 D;  3AG1 E;  1IHG A;  2WXJ A;  3C3O A;  3L54 A;  4APO A;  4I1A A;  2V5Q C;  1EDU A;  3U64 A;  2JAB A;  2KZT A;  5B3S E;  4XZ4 A;  3D9L A;  3ASD A;  4CT0 A;  4GB9 A;  1H6K A;  4N2Q A;  1XNF A;  4NRH B;  4U0U A;  2DZN A;  1W3B A;  3AG3 E;  3CHO A;  1IKN D;  2OCC E;  1LD7 A;  4DX5 D;  1RW2 A;  4BET A;  4LNG A;  3LVR E;  3Q5M A;  4BER A;  1TJC A;  1RZ4 A;  4UWL A;  4JB8 P;  1FT1 A;  2R17 C;  1N54 A;  1KT1 A;  2IJG X;  3KAE A;  4GA0 A;  3CVW A;  4JVS A;  3ZYM A;  2PL2 A;  1FPP A;  3I3N A;  3BUA A;  3TWU A;  2EIN E;  4TXR A;  1NZN A;  4FJZ A;  2I1K A;  2H6F A;  1KZO A;  4HOS A;  2KCK A;  3LJN A;  4DX7 D;  5E76 A;  4UWF A;  3L08 A;  2HYZ A;  3DSU A;  5C1D A;  4U63 A;  2XPZ A;  3FU3 A;  4F6R D;  2WXH A;  3MCX A;  4DI4 A;  2BED A;  5EID A;  4JW1 A;  2VSX E;  3ASH A;  2QZA A;  4AV7 A;  3D9O A;  4YVO A;  4AY6 A;  4IUL A;  2ILR A;  2XGM A;  4ATG A;  2MOW A;  3FTY A;  2OOE A;  4BTA A;  2ETC A;  2KAT A;  5CED B;  3LYA A;  3FUE A;  3UIN C;  4IRU A;  3S7F A;  4GA2 A;  3HXE A;  3ULQ A;  1HG2 A;  4MLP A;  5KCM A;  2H6I A;  1EPU A;  5AQ9 A;  2FI7 A;  3URZ A;  5CBN A;  3FUD A;  2WXR A;  4MS6 A;  4HOU A;  5A7D B;  4YDY A;  1BPO A;  3NB2 A;  4QQI A;  3ABM E;  1O1R A;  4N3A A;  3RRN B;  3RRU A;  1X5B A;  2WXG A;  4GYW A;  2MHK A;  3AS5 A;  4F53 A;  3C72 A;  2CFZ A;  1PC2 A;  3V2X A;  5LP0 A;  3ZUV B;  3T5V A;  3MEK A;  3Q73 A;  2F8Y A;  3WG7 E;  1TNB A;  2AXV A;  1HO8 A;  3LXU X;  3T8K A;  3AS4 A;  3LEW A;  3GZ1 A;  5CRV A;  1D8E A;  2YHC A;  2P58 C;  4K5B A;  3VLF A;  3HXD A;  3MKR A;  2XCB A;  5ENQ D;  1E8Z A;  4WWO A;  5JJT A;  2GRP B;  3AG4 E;  4DX1 A;  4BFR A;  3B7S A;  4KXK B;  3BEE A;  3PE4 A;  3FH8 A;  1WAO 1;  5T4Y A;  1QBQ A;  5EKQ D;  1SW6 A;  4HFG A;  3HVE B;  4OAU C;  3CKC A;  3PRE A;  3BU8 A;  4UUC A;  4UWK A;  3CVN A;  3L9T A;  5T8I A;  4WWP A;  3ZU7 B;  3VLD A;  1Y6I A;  3L13 A;  3EIQ C;  5C2Y A;  2WXL A;  5HQ8 A;  3RAU A;  2QFC A;  3CHR A;  3PZ1 A;  3ML8 A;  2L6J A;  3I5P A;  1QYM A;  4PS8 A;  5FIN A;  2NXP A;  1K1A A;  4XX5 A;  4UI9 K;  4W9R A;  3LY8 A;  2XZD G;  1OCZ E;  3CV0 A;  2C0L A;  1FVH A;  1U3C A;  4PS7 A;  4M7C A;  4GTR A;  4UI9 J;  4L9P A;  2CHW A;  3E33 A;  4AXH A;  4GPK A;  4LNU D;  2C0M A;  3EJN A;  3FUI A;  2XEH A;  3O4Z A;  4G26 A;  2F0Y A;  4GTQ A;  3CVV A;  3WXX A;  2V5F A;  1BU9 A;  2EIL E;  5ARG A;  4CZ2 D;  2IU1 A;  2JEK A;  2L9B A;  3K9I A;  5DIZ A;  4I2Z A;  3TWR A;  3IEG A;  1GW6 A;  4B93 B;  3CSF A;  2LAI A;  2AWI A;  3NZS A;  3JYS A;  4I6J A;  5LX8 A;  4KZC A;  3UM1 A;  2I6H A;  4HOT A;  4K5A B;  4GA1 A;  4U95 D;  2EIM E;  4GMR A;  3LY7 A;  4G25 A;  3PDN A;  3TWW A;  3CVX A;  3PS6 A;  2L0T B;  3B7R L;  2PZI A;  2H6G A;  3VTY A;  4U8V D;  1X81 A;  2WQH A;  1NA0 A;  2X6J A;  2KC7 A;  4JHK A;  2L0I A;  3ZEF A;  3CQC B;  1TNZ A;  4JEH A;  1OWM A;  2HM8 A;  4A1S A;  3B95 A;  1DCE A;  2I2O A;  4GCO A;  1NFI E;  3DSX A;  1MHQ A;  3ONK A;  2YIN A;  3KD7 A;  2VTB A;  2ZGG A;  3U9W A;  1MZC A;  3QNK A;  3ZHE A;  5FQ6 A;  4DJA A;  3RJV A;  3IV0 A;  3BG1 B;  1SZA A;  2P2C P;  3APF A;  4GTV A;  3OXL A;  2X3M A;  4XKC A;  1JCS A;  4JC8 A;  3DPY A;  1E8Y A;  5G05 C;  2R2L A;  2CHZ A;  3T5X A;  1KZP A;  2I1J A;  3RIB A;  2XS1 A;  2XPY A;  4L1B A;  1UW4 B;  1NP7 A;  2LAH A;  1U2V G;  3CST A;  4DRX E;  4WWN A;  1V55 E;  3CVU A;  3G2W A;  4F3V A;  5KJM A;  3ASO E;  4JXT A;  4WNG A;  3PE3 A;  5FT9 A;  3LCA A;  2GRO B;  3U3W A;  3P1U A;  1OCR E;  3CGH A;  4FLB A;  4J0U A;  3TG4 A;  5AN8 A;  4LER A;  4L7T A;  1JUQ A;  4JZY A;  1JWF A;  4J8F A;  2WB2 A;  5FTP A;  2IF4 A;  5G04 C;  1MJ0 A;  3G2U A;  4APF A;  4I9E A;  3GYZ A;  1S0P A;  2GW1 A;  2OV8 A;  2ZIR A;  3CK7 A;  3TWV A;  5A23 A;  3ISM C;  4O60 A;  4EHM A;  4DLO A;  2XHE A;  2XEE A;  2GRQ B;  1Z6T A;  1O1S A;  5EN5 D;  1N52 A;  2CFU A;  3KEZ A;  1AP7 A;  3ASN E;  2DBA A;  4ILG A;  3B7T A;  1ELK A;  1TN6 A;  4KVO A;  5FZR A;  3SY2 A;  4WNF A;  2R5S A;  4G8K A;  1PAQ A;  3PZ3 A;  4QFV A;  2H6H A;  4L23 A;  3EU5 A;  4NIK A;  3T8M A;  2QYJ A;  5ANR A;  2WVI A;  5KNH D;  3UPV A;  2KXP C;  4GML A;  2AW6 A;  4GPM A;  3QB2 A;  5EIB E;  2XQ0 A;  3W9F A;  4DI3 A;  2VQ2 A;  3JQ1 A;  4I1O B;  3EU9 A;  4ABN A;  4U8H A;  3B13 A;  2LNI A;  4CYM D;  2A4Z A;  1E7U A;  3HDX A;  4G1T A;  4ACK A;  1H2U A;  3NAW A;  4FUL A;  4HOQ A;  4BWR A;  1NA3 A;  5G55 A;  5EIL A;  3ZHE B;  2HO1 A;  2NC9 A;  1OCC E;  5ARF A;  4IN3 B;  4MKT A;  3IHV A;  2IEJ A;  3JXI A;  3I4G A;  2CG2 A;  3IKO B;  3ZRH A;  1Z3Y A;  4Q69 A;  4U8Y D;  4J8D A;  4JEU A;  4KYO B;  3Q9N C;  2IO3 C;  4GYY A;  4EEC A;  1U3D A;  2WPV A;  3CLJ A;  4UQZ A;  4OYS A;  3CQG B;  4LCT A;  3CR3 A;  5G05 J;  5CEC B;  1ZBP A;  5H7P A;  2GRL A;  2NYJ A;  5KWD A;  2P9S G;  1H6P A;  3CIA A;  2F37 A;  3S2A A;  3ESL A;  3E30 A;  4KZ0 A;  3PNT B;  3E37 A;  4YDE A;  1Z5S C;  3VLE A;  2DIW A;  4YND A;  1TR4 A;  3ZNG A;  3ZIM A;  1Y8M A;  3APC A;  4FA6 A;  4DPR A;  2JLB A;  3R9M A;  2J08 A;  2PM6 A;  2OVB A;  3MV3 B;  2B6C A;  3LVQ E;  2MYO A;  5AIJ A;  1EYH A;  3UMV A;  1OWL A;  2XCC A;  4J8E A;  5FZQ A;  4GAA A;  5FQ8 A;  4R7L A;  4TUM A;  1ZB1 A;  5D0O D;  3BG0 B;  2P9U G;  4GZ5 A;  2IO2 C;  1ELR A;  4A3T A;  5CBO A;  4CCA A;  2I9C A;  3FU5 A;  4YDO A;  1EF1 C;  3QWW A;  2RFM A;  5LOZ A;  4GCN A;  1H2V C;  4ME2 A;  4I2W A;  4A55 A;  3Q15 A;  1JPL A;  4EZK A;  2KCV A;  5EYP F;  5J08 A;  5LFA A;  4GMJ A;  2IFU A;  3P2B A;  3SBT B;  3V2O A;  2FO7 A;  3DSS A;  1WM5 A;  5BV0 A;  3NBN B;  3QKY A;  4U0S A;  1TNY A;  4AJW A;  3TXN A;  3Q9U C;  3FDH A;  4U04 A;  4BX9 A;  3SBS A;  3ZYK A;  3GZS A;  4I17 A;  4CDM A;  3AAA C;  4RG9 A;  4UI9 C;  3RO2 A;  3FHE A;  4EQF A;  3HHM A;  4Q96 A;  1KT0 A;  4PDX A;  3I4R B;  4UWG A;  2P9K G;  5AQ7 A;  4AOF A;  3RKV A;  4HRN A;  2VGE A;  3ZXS A;  4UQY A;  2X6H A;  3LJ3 A;  2EIJ E;  3OXG A;  4AP2 A;  1LD8 A;  4FHJ A;  2AVP A;  3Q78 A;  5AJD A;  1SA4 A;  3MV2 B;  5CMY A;  4GTS A;  4GZ6 A;  4BT9 A;  3CVP A;  1MX6 A;  4U96 D;  5IY5 E;  4BY6 A;  4FU3 A;  1S63 A;  1ELW A;  1OT8 A;  3MKQ B;  1BI8 B;  4JD2 G;  4RSY A;  3QWP A;  4FHK A;  4DX6 D;  1HX8 A;  2LSU A;  4U0Z A;  2XGS A;  4J7W A;  2GRR B;  1O5M A;  5BUZ A;  5KJN A;  2VTB B;  4HRM B;  1B89 A;  3TWQ A;  2IOL A;  4C48 B;  5FJY A;  4N39 A;  4G11 A;  4ANX A;  3Q47 B;  1Z3X A;  3HRA A;  4HXI A;  3DEP A;  1N4R A;  4CDN A;  1A5E A;  3RU0 A;  3SGH A;  3UTM A;  3HXB A;  3QAQ A;  3UUX A;  3D9I A;  5CRU A;  4G2V A;  2QY7 A;  4XI0 A;  2HR2 A;  3C3R A;  1DNP A;  4Z68 A;  3LS8 A;  3ZYQ A;  3CHM A;  2AXZ A;  5HI7 A;  4OVV A;  5FQ7 A;  2ETA A;  4HLL A;  4N5Q A;  2FF4 A;  4A63 B;  1YCS B;  2DYR E;  3AU5 A;  4Y6W A;  3PZ4 A;  4ZHB A;  2E0I A;  2RG8 A;  1TNO A;  3NZU A;  5AYW D;  3FUF A;  4HB5 A;  2EQX A;  5D0Q D;  4B94 A;  3TJP A;  3TWT A;  3SF4 A;  2DZO A;  4J8S A;  4F1S A;  3QDN A;  1YYH A;  2M63 A;  4MRU A;  4GZ3 A;  2QYU A;  3UXG A;  4F1P A;  2XGO A;  4JHR A;  4A1G A;  3TAX A;  3LY9 A;  4G8L A;  1TNU A;  2EIK E;  2WM9 A;  5FQ4 A;  2XS8 A;  3RK6 A;  3CEQ A;  1A17 A;  1UG3 A;  2WXK A;  5KJL A;  5T3R A;  3AS8 A;  1MQS A;  1TYQ G;  5EDS A;  5JMN D;  2GGF A;  3QK0 A;  2UWJ G;  2WXO A;  1FT2 A;  4E6H A;  5BPP A;  1TN7 A;  4L2L A;  2KCL A;  1KLX A;  4GTP A;  1YMP A;  1NL4 A;  3KS2 A;  1K8K G;  3D3M A;  5D66 A;  5EX0 A;  4URK A;  2Y1L E;  2L6B A;  4CT4 A;  3UKR G;  4OAV B;  2BKG A;  2BUG A;  3SFX A;  3AJI A;  3FTV A;  2XPI A;  2GRN B;  1HS6 A;  4V3I A;  2P9N G;  5CEA A;  3DXM G;  2J9Q A;  2WXP A;  4XIF A;  1L5J A;  3DST A;  3Q49 B;  4YDW A;  4I1M A;  3FTZ A;  3T9K A;  3DEO A;  3OXF A;  5EX3 A;  4RG6 A;  3DXK G;  3ULY A;  4AVX A;  4NQ0 A;  3EHM A;  2ZIS A;  3FFL A;  1UJJ A;  1N95 A;  1IHB A;  3D9M A;  3D9P A;  5FWQ A;  4JA9 A;  4UWH A;  1K1B A;  5BV1 A;  2E2E A;  4Y6C A;  2WQ6 A;  4GTT A;  3LPZ A;  2KM4 A;  3LKU A;  3DSW A;  3UM2 A;  4N2S A;  5HS0 A;  1N0Q A;  4D10 C;  2FUL A;  4PH4 B;  5FIO A;  3KSL A;  3UIO C;  3UT7 A;  4GTO A;  3W9G A;  2FO1 E;  2Y0B G;  3Q4A B;  2PNN A;  3HVE A;  1JCQ A;  2ETB A;  5ENS D;  2WXQ A;  3HYM B;  1HXI A;  2V4H C;  5EYL A;  2P9L G;  3MX3 A;  3FEY A;  3SD5 A;  3N71 A;  3ML9 A;  4TUU A;  4X8Q A;  3S7J A;  3L6A A;  4DUI A;  5ENN A;  3FY4 A;  3PH0 C;  5ANL A;  2WMO A;  1NI1 A;  3EDT B;  5G2N A;  4WAF A;  1E96 B;  3V31 A;  5HKP A;  5JHB A;  4JPS A;  3F6Q A;  3PEV B;  1MYO A;  2B0O E;  2PQN A;  2KBX A;  5FZS A;  2WXM A;  3HXF A;  2LUH A;  4K5C A;  2IQC A;  1JWG A;  4HI9 A;  3ZFW A;  1IYG A;  3PUK A;  3TXM A;  3ONL A;  4HOR A;  3UKU G;  4GZD A;  1BD8 A;  3FH5 A;  3NQP A;  4ANU A;  2A5U A;  5BT1 A;  4CGV A;  4I6E A;  2ZXW E;  4B89 A;  2OEV A;  4EPZ A;  3PNL B;  4HI8 A;  1IQU A;  5ENR D;  3MYV A;  3ULE G;  3JUI A;  2VSN A;  5AEN A;  3FTW A;  3CHQ A;  4RQI A;  4LRZ A;  1HH8 A;  2UY1 A;  3D9H A;  5CHE E;  3QC1 A;  2P9I G;  3ZGQ A;  3QWV A;  2R05 A;  3Q79 A;  4ZFH A;  3RRM B;  2V0P A;  2CG3 A;  5ENT D;  4FJY A;  2BTD A;  5ENP D;  3PRZ A;  3L22 A;  3L82 A;  4WNE A;  4EZL A;  1E8X A;  1HU3 A;  1HE8 A;  5D2M C;  3ZW3 A;  3SFY A;  1N9A A;  4AM9 A;  4RVB A;  2BKK B;  4RLY A;  2VSY A;  4DX2 A;  3MKQ A;  4I43 A;  3FU0 A;  3DPD A;  2CHX A;  2OND A;  4HRL A;  1H2T C;  3GZ2 A;  3J5P A;  3ZVV A;  3ESK A;  5LCW J;  2WMN A;  4N3C A;  3SZ7 A;  2XRY A;  4KVM A;  5AAO A;  3SFZ A;  1OCO E;  5BXU A;  1OWO A;  4YVQ C;  3ZYL A;  3G2S A;  3ZXP A;  4C0E A;  3IBE A;  3FH7 A;  2RFA A;  3G2V A;  4LUN U;  3R9A B;  2XZT G;  4XKB A;  1FCH A;  1HFA A;  1S64 A;  1OWP A;  1PY1 A;  2OVF A;  5HRY A;  3U66 A;  4H7X A;  2FEZ A;  1G3N B;  5BW8 C;  2R02 A;  3R7Q A;  3UX4 A;  3HG0 D;  3S7D A;  2ZGD A;  3CK9 A;  5AQB A;  4ILH B;  2X6I A;  4K03 A;  4H7Y A;  2PQR A;  1Q2Z A;  2LSV A;  3FTU A;  1N11 A;  2DYS E;  5CCM A;  2AXU A;  4HQD A;  3TWS A;  5CMW A;  3KSQ A;  5ITZ F;  2DVW A;  2OEW A;  2YQ8 A;  5LCW C;  3EHN A;  3EHR A;  4G23 A;  1FVF A;  3E32 A;  4TRQ A;  1ZU2 A;  3FUJ A;  4DLQ A;  1K3Z D;  3D9K A;  4I9C A;  1TJF A;  4MBG A;  3SQV A;  4I6G A;  1N94 A;  1O1T A;  3UT4 A;  4ATZ D;  3U4T A;  4JHJ A;  5G04 J;  4A3V A;  2WXN A;  1SA5 A;  1HF8 A;  1P5Q A;  4OVU A;  3RO3 A;  4CRW A;  1BLX B;  3CKB A;  3CHS A;  4Q94 A;  3ZN3 A;  4TXQ A;  1OXJ A;  4O1P A;  3MZL B;  4CDR A;  4HBD A;  4J6I A;  2BF0 X;  3PVL A;  3ABK E;  3SO8 A;  5ENO D;  2VGY A;  4WUY A;  3FU6 A;  5B1A E;  3QJZ A;  4FP7 A;  2RD0 A;  3Q75 A;  4B8A A;  5AJL A;  2Y3A A;  4XEI G;  2QC9 A;  1IQR A;  4KT6 B;  3IHY A;  4B8C B;  3C5R A;  2X6K A;  2XRZ A;  1SVX A;  3AG2 E;  1SQM A;  3E4B A;  4BSZ B;  5JJ7 A;  4NUR A;  4KBQ A;  3G2T A;  3HIZ A;  5JHA A;  2LO6 A;  2WXF A;  4U7E B;  1LF8 A;  2V8S E;  1WDY A;  3PZD A;  3IXE A;  4ANV A;  3AU4 A;  1N4S A;  3KEA A;  3J5Q B;  1INZ A;  3CHP A;  5JJ6 A;  1KPS B;  3LDZ A;  3V79 K;  1AWC B;  1QQE A;  2Y69 E;  3ASF A;  5AQA A;  2AJA A;  2VSO E;  4JA7 A;  4M3O A;  3SI5 A;  4WND A;  1E8W A;  3UT8 A;  3FTS A;  3ZPJ A;  1LTX A;  3R7R A;  2J09 A;  3MGB A;  4N3B A;  2V4L A;  3ENE A;  2VGX B;  4LSZ E;  1TN8 A;  4FC8 A;  2J4D A;  1MX4 A;  1IXV A;  2Y4U A;  4EZJ A;  4O1O A;  3RSE G;  5J90 A;  4GU5 A;  4BT8 A;  1WG0 A;  3ABL E;  4EBA G;  2GRM A;  3B7B A;  3PEU B;  4TXP A;  2NSZ A;  3C98 A;  3TGO A;  2ZU6 B;  1V54 E;  1TEZ A;  1S70 B;  4UQX A;  1JCR A;  4ANW A;  3FUH A;  3NOC D;  2VGX A;  3CVL A;  2DWZ A;  3QOU A;  3MA5 A;  3JQ0 A;  4BX8 A;  4IYP A;  4HLE A;  3ASG A;  5KJK A;  1H0A A;  2YHE A;  3APD A;  4N5C A;  3V30 A;  3D9J A;  4BTB A;  3DBS A;  4J8Y A;  4F7A A;  4EBA A;  1QNF A;  3PUJ A;  2Q7F A;  5DBK A;  5CCL A;  2J8S D;  3EHQ A;  3SNX A;  2J07 A;  3DSV A;  1BI7 B;  3FUL A;  3EIJ A;  5M72 A;  2XEN A;  3FUN A;  3PZ2 A;  3VTX A;  3TWX A;  4B0Z A;  3UIP C;  3Q7F A;  3OAW A;  3JUE A;  4FLH A;  1H19 A;  2WQ7 A;  3C3Q A;  1H6O A;  3CVQ A;  4ILI A;  3CK8 A;  1MX2 A;  2C2L A;  3FUK A;  5E75 A;  2IY0 C;  1E7V A;  1UN9 A;  2Y4T A;  4P29 A;  3FEX A;  3FTX A;  1HZ4 A;  2LXM A;  3X2Q E;  1DCQ A;  3FWV A;  3D9N A;  1N4P A;  1E90 A;  4NAC A;  4BES A;  2R03 A;  5A6C A;  3DRA A;  5BNW A;  5B1B E;  4CEM A;  1SZ9 A;  2WXI A;  1N0R A;  2MRI A;  3O48 A;  1D8D A;  3L17 A;  4K0R A;  3UI2 A;  1HG5 A;  3JCK C; 
#chains in the Genus database with same CATH homology
 5KBA A;  2P2C P;  4K5B A;  1A5E A;  3HG0 D;  5D66 A;  2QC9 A;  3UTM A;  2DWZ A;  3C5R A;  2Y1L E;  5ENQ D;  2V4H C;  2NYJ A;  5KWD A;  5EYL A;  4G8K A;  4LG6 A;  2L6B A;  1SVX A;  3Q9U C;  2ZGD A;  4QFV A;  4DX1 A;  5AQB A;  3D9H A;  3LJN A;  4DX7 D;  1BU9 A;  4OAV B;  4BSZ B;  4CZ2 D;  2F37 A;  5JA4 D;  2BKG A;  4ZFH A;  5BXO A;  4DUI A;  3AJI A;  4NIK A;  4F6R D;  1UOH A;  4Z68 A;  5ENT D;  1DC2 A;  3AAA C;  2QYJ A;  3V30 A;  3TWR A;  5KNH D;  1SW6 A;  5ENP D;  1D9S A;  5CEA A;  4J8Y A;  1N11 A;  5EID A;  4B93 B;  4DRX E;  4OAU C;  2KXP C;  4HQD A;  2ETA A;  4HLL A;  3TWS A;  4N5Q A;  1WDY A;  3IXE A;  4GPM A;  5ITZ F;  1TR4 A;  2DVW A;  5AQ7 A;  5HKP A;  3V31 A;  1YCS B;  3ZNG A;  4A63 B;  5EIB E;  2J8S D;  3F6Q A;  2A5E A;  1MYO A;  2B0O E;  3EHQ A;  4UUC A;  1OY3 D;  4YDW A;  3W9F A;  3EHR A;  4ZHB A;  4HRN A;  1BI7 B;  2VGE A;  3T9K A;  3DEO A;  4K5A B;  2XEN A;  3KEA A;  3J5Q B;  3EU9 A;  4U95 D;  1K3Z D;  2KBX A;  4GMR A;  2V5Q C;  3ZU7 B;  2ETC A;  5CED B;  2BKK B;  4HB5 A;  4RLY A;  3TWW A;  2MYO A;  2JAB A;  4DX2 A;  3V79 K;  5KNG A;  1AWC B;  3TWT A;  4CYM D;  4K5C A;  5AN8 A;  3JXJ A;  5AQA A;  2AJA A;  3TWX A;  4U8V D;  2DZO A;  4HRL A;  4ATZ D;  1IHB A;  5CER B;  3J5P A;  5AQ9 A;  3JUE A;  1YYH A;  5CBN A;  3UXG A;  4HI9 A;  1MJ0 A;  4TUM A;  4F1P A;  1K1B A;  1MX6 A;  4U96 D;  2DZN A;  4YDY A;  1QYM A;  4QQI A;  1MX2 A;  1IKN D;  5FIN A;  1BLX B;  1K1A A;  4LSZ E;  1OT8 A;  5AAO A;  4DX5 D;  5BXU A;  5EIL A;  2HE0 A;  1MX4 A;  4BET A;  1IXV A;  5AAR A;  1BI8 B;  4G8L A;  3TWV A;  4O1P A;  2XZD G;  5CBO A;  4BEP A;  4O1O A;  4HNA D;  4BER A;  4O60 A;  5HS0 A;  1WG0 A;  3ZKJ A;  1BD8 A;  1DCQ A;  1N0Q A;  2RFA A;  2RFM A;  4HBD A;  4JB8 P;  3V2X A;  4DX6 D;  3B95 A;  3JXI A;  2XZT G;  3B7B A;  3ZUV B;  5FIO A;  4J7W A;  2XEE A;  4BES A;  1NFI E;  4U8Y D;  2F8X K;  3SO8 A;  2ZGG A;  5ENO D;  2F8Y A;  3Q9N C;  4HI8 A;  5EN5 D;  3NOG D;  4HRM B;  5HRY A;  5JMN D;  5ENR D;  1S70 B;  5EYP F;  3TWQ A;  3W9G A;  4C48 B;  3T8K A;  1G3N B;  2Y0B G;  3UI2 A;  2FO1 E;  2PNN A;  3V2O A;  1N0R A;  4LNU D;  3NOC D;  1AP7 A;  3HRA A;  5CEC B;  3NBN B;  2ETB A;  1YMP A;  5ENS D;  2XEH A;  3TWU A;  3DEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...