5LCWJ

Cryo-em structure of the anaphase-promoting complex/cyclosome, in complex with the mitotic checkpoint complex (apc/c-mcc) at 4.2 angstrom resolution
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of APC/C regulation by the spindle assembly checkpoint.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Anaphase-promoting complex subunit 1
total genus 179
structure length 504
sequence length 532
chains with identical sequence K
ec nomenclature
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lcwJ00
3S7FA 2Y4TA 3BEEA 3MV3B 2L6JA 2C2LA 4Y6CA 5A6CA 4KYOB 2XCBA 3CVLA 3QKYA 3PE4A 4GCOA 4EQFA 3CKCA 4CGVA 3QWWA 4J8DA 4GYOA 2V5FA 2FEZA 3GZ1A 4HOUA 2XPIA 3CK9A 4XIFA 1XNFA 3ZFWA 5C1DA 1QQEA 4O6FA 4KXKB 3TG5A 5KJLA 1ELWA 2XGOA 3N71A 4HORA 4U0ZA 4HOTA 5KJKA 4UQXA 4BTBA 4KBQA 5EX3A 4AY5A 1KT0A 2WPVA 4JHRA 3CVQA 2PQRA 4LEUA 5FTPA 5FJYA 3KS2A 3S7DA 3CVNA 3TG4A 3TAXA 4AIFA 2JLBA 2VGYA 3ESKA 4J0UA 1NA3A 1NA0A 3MKRA 4G1TA 4I2ZA 1HH8A 4UI9J 2VQ2A 3GZ2A 3OXLA 3ZHEB 2BUGA 1KLXA 2I6HA 2KCLA 2HR2A 4I2WA 4N3BA 4B94A 5A7DB 2XGMA 4N2SA 4WNEA 3Q49B 1HXIA 4F3VA 3CKBA 3PE3A 2NC9A 5KJNA 1TJCA 3LCAA 4G24A 4I1AA 3VTXA 3UPVA 4GPKA 3AS5A 3ASHA 5JJ7A 2KCVA 4AM9A 3CK7A 2FI7A 2FBNA 2QFCA 2ONDA 2WQHA 3LY8A 2KATA 4BTAA 3Q4AB 3AS4A 5JJ6A 4W9RA 4J8FA 3ZN3A 3LPZA 4IN3B 5M72A 4GCNA 3Q5MA 1QZ2A 3ASFA 2XGSA 4JA7A 2IF4A 3JYSA 5HI7A 3URZA 4BWRA 1ELRA 3CEQA 3EDTB 1NZNA 4RG9A 5EX0A 3MEKA 4GA2A 4GA1A 5G05C 5BW8C 2C0MA 4I9CA 1PC2A 4NQ0A 3AS8A 1YA0A 2XCCA 1A17A 4YNDA 3SZ7A 3OXGA 3Q47B 4WNDA 4XI9A 4YVQC 5D0QD 3ASGA 4BT9A 2Y4UA 5HQ8A 4N3AA 2GW1A 4U0SA 2PZIA 4N5CA 2E2EA 2VGXA 4N2QA 4WNFA 2PQNA 5FT9A 5FZRA 5CCLA 5KJMA 1KT1A 4GYWA 4JA9A 5LCWC 1B89A 5DIZA 3O48A 1IYGA 3RO2A 3LY7A 3OXFA 3S7JA 1WM5A 3R9AB 3HYMB 3MV2B 2C0LA 3E4BA 5G04C 4APOA 1E96B 2UY1B 5FZQA 3FFLA 3ZPJA 3KAEA 4RG6A 4G23A 3NF1A 2VSNA 3IEGA 4ME2A 1WAO1 4HOQA 4N3CA 4U0UA 2HYZA 5G04J 4A1SA 2OOEA 3QOUA 3FP3A 4JL0A 4H7XA 2UY1A 3PDNA 5CHEE 1P5QA 5EKQD 1Y8MA 2HO1A 3LKUA 5LCWJ 2VYIA 1ZBPA 2MHKA 5ARFA 3MA5A 4H7YA 3U4TA 4XI0A 4I17A 3WXXA 3CV0A 3FWVA 2UWJG 2R5SA 3RU0A 4AY6A 3LY9A 3VTYA 3K9IA 4UQZA 5AYWD 4J8EA 3RKVA 4GZ6A 3QDNA 3ULQA 1W3BA 3ZHEA 3S7BA 2PL2A 1OUVA 2KCKA 4G2VA 5BNWA 2Q7FA 1FCHA 3RIBA 4NRHB 2LNIA 3Q15A 4N39A 4CGWA 4HOSA 4UI9C 1ZU2A 4G25A 2YHCA 2FF4A 2YQ8A 4GA0A 5ARGA 2LSUA 5JJTA 2AVPA 4Y6WA 3RJVA 3LYAA 4U07A 3CK8A 2XEVA 4GYYA 4UI9K 3ZGQA 5D0OD 4GZ5A 2DBAA 3QWVA 4YVOA 5DBKA 5FZSA 4ABNA 4CDRA 4GZ3A 4WNGA 3UQ3A 3SF4A 4BT8A 3GYZA 5G05J 4G26A 3RO3A 4U04A 4UQYA 3KD7A 2VSYA 4WUYA 4I9EA 3QWPA 3U3WA 2FO7A 2IFUA 2LSVA 3ASDA 3CVPA 3GW4A 2VGXB 2KC7A 3UUXA 1HZ4A 5CCMA 3TGOA 2P58C 1IHGA 2J9QA 5BT1A
chains in the Genus database with same CATH superfamily
1FPPA 4KYOB 3QWWA 1OWNA 2FEZA 1HF8A 4O6FA 4U8VD 2L0IA 1KT0A 3CVNA 2VGYA 3L6AA 1HH8A 4DK5A 2V0PA 1MX2A 1SZAA 5HKPA 5ENNA 2KXPC 3EU5A 4I1AA 3AG3E 4CT4A 3PUKA 5BUZA 3ZN3A 4GTTA 2QZAA 2XPYA 3URZA 3JYSA 1N54A 3D9NA 4EPZA 4U96D 1Z3XA 2F0YA 3UM2A 1EDUA 2CFUA 4JPSA 5D0QD 5HQ8A 4BSXA 2OEWA 1JCSA 3JCKC 4ANWA 3IXEA 5DIZA 1WM5A 5LP0A 2ILRA 3CQCB 4RG6A 2VSNA 1WAO1 2CHWA 3MZLB 4B8AA 3ZFWA 2WQ6A 1VDYA 3UI2A 4WWNA 3L22A 1H6KA 3TWTA 2QY7A 1OXJA 4UUCA 3OTNA 3VLEA 3CK8A 3L82A 4GZ5A 5FZSA 1UJJA 1SZ9A 3LJNA 2IFUA 2VGXB 4CZ2D 4N5QA 2VSOE 5CECB 2YINA 4LNUD 1NL4A 1S0PA 3AG1E 4IRUA 4U63A 1OWPA 4KVOA 4KVMA 4XKBA 1TNZA 2WPVA 4R7LA 5FJYA 3TXNA 1E8ZA 4GAAA 4K0RA 2X6IA 2ETCA 5KJNA 3DPYA 5KNHD 2JEKA 4OYSA 4ILGA 3ABKE 3FTWA 2A5UA 5CRUA 5JJ6A 2RG8A 3BG0B 3ASFA 2X6HA 1NZNA 4UWHA 1TN7A 1YA0A 2XCCA 3HXFA 1AWCB 4HLEA 3BQOA 4FHJA 4YNDA 3VLDA 4O60A 2Y4UA 2OV8A 3FTYA 3MYVA 3HG0D 3PVLA 3R9AB 3E33A 3HYMB 4L2LA 4APOA 2UY1B 3X2QE 3UPVA 4N3CA 4C0EA 2CG3A 4YDWA 3B95A 1QNFA 3D9HA 3LKUA 4CYMD 2WQ7A 4AY6A 2LO6A 1S70B 1H2VC 2PL2A 3EIQC 5D2MC 4NRHB 2FF4A 3G2SA 3JQ1A 2DBAA 4BY6A 1K1AA 4P29A 1U3DA 2X38A 1MHQA 4E6HA 2KC7A 1TNBA 1SVXA 2GRNB 1IHBA 1XNFA 4HORA 5FQ6A 3TG5A 3ZNGA 4X8QA 3ZW3A 3L17A 3LVRE 2MRIA 2WXLA 2X6KA 3MCXA 3L54A 2L0TB 4XE0A 2XS1A 2VSXE 3CVYA 3IHYA 3CHOA 3CQGB 3U9WA 2QFCA 3TWXA 2WB2A 4NIKA 2RFMA 2A5EA 2AXZA 2Y1LE 3J5PA 3MX3A 2WXNA 3SZ7A 3NBNB 4WNDA 3I4GA 4Q96A 3PZ3A 4C9BB 4N5CA 5FINA 2XS8A 4LNBA 4PS3A 4AEZC 1N9AA 1O1RA 4U0UA 3ZRHA 1N4SA 3FP3A 3UINC 5CEAA 3ZXPA 1P5QA 3CGHA 2E0IA 2LAHA 3SFZA 4GZ6A 4F1SA 3Q15A 4HOSA 3NOGD 3LDZA 3ONKA 3J5QB 3HIZA 1HE8A 4ATZD 3UQ3A 3FTZA 3C3QA 3HXCA 4TUMA 2R03A 2J9QA 1N52A 1XGWA 1QQEA 2BKKB 5KJKA 3PZ2A 1E7UA 4HRMB 4J0UA 1NA0A 4I2ZA 2LXMA 4Z68A 1E8WA 3SQVA 4F53A 2HR2A 4DJAA 1FVHA 3TWSA 3CKBA 4AVXA 3TJPA 1OWLA 4I1MA 3AS4A 4GU5A 5B1AE 5HI7A 3FU3A 5BW8C 1TN8A 3LS8A 4ANVA 4KZCA 3FH7A 4APFA 1SA5A 2P9SG 3QC1A 2BF0X 3QAQA 4BFRA 2I1KA 3D3MA 1WY6A 1TN6A 2QC9A 1UN8A 2JABA 4A1SA 1E8YA 4IULA 2HYZA 4B93B 3FHEA 4JL0A 4MS6A 4Q94A 5EDSA 5EKQD 1FVFA 3PZ1A 4V3IA 5AQ9A 2P9KG 3FUJA 1W3BA 3ULQA 1FCHA 5H7PA 2AVPA 4KZ0A 4ANUA 5KCMA 1E90A 4GZ3A 2KZTA 4GTSA 2WXKA 4CDNA 3RO3A 2VSYA 1N4PA 3FEXA 4KMOA 5KJLA 1IHGA 1LD7A 5AN8A 4DLQA 2R05A 1JCRA 3Q7AA 3PZ4A 3FTUA 3TXMA 4GMLA 2CHXA 4LEUA 3S7DA 4I6JA 5AQBA 4A63B 4HRNA 4ILHB 3ZU7B 2B0OE 4DUIA 4QQIA 3CVVA 3CHSA 3KEZA 3IKOB 4UWLA 3CK7A 3NZSA 4DX6D 4OAVB 4W9RA 2X6FA 4DX1A 5T8IA 3FDHA 2IO2C 3NB2A 4GA1A 2NYJA 4PS7A 4TUUA 2YHEA 3C5RA 1A17A 4PH4B 1UG3A 2NXPA 3V31A 3T5VA 3JUEA 4E85A 3FY4A 3GZSA 4LNGA 3DXKG 4K5CA 4RVBA 1E96B 2IQCA 3ZPJA 3Q9NC 3V79K 4G8LA 3DSUA 5D66A 2GRQB 2Y3AA 3ZHEB 3U4TA 3SFYA 4B89A 3PZDA 4UQZA 3W9FA 4FJYA 3UIPC 2KCKA 4DX7D 2EIJE 1V55E 1BI7B 2YHCA 5ARGA 3ONLA 4Y6WA 4U07A 4GYYA 4AP2A 2R17C 2R02A 2FO7A 2ZGGA 3ASDA 3JUIA 3JXJA 2IONA 2IJGX 3BEEA 3S7FA 3QKYA 4CGVA 3FU6A 3Q9UC 3ABLE 3N71A 4HS2A 1E7VA 2B6CA 3PNTB 2IU1A 3R7RA 4WWPA 4F6RD 3ZEFA 4HNAD 4CEMA 3FUKA 3KSLA 4U8HA 4ACLA 2KCVA 4AV7A 4I43A 4AM9A 3Q4AB 1N94A 4BWRA 3DWLG 5FWQA 2ETBA 5C2YA 4I9CA 4WWOA 2P9LG 1YMPA 4O1OA 4YVQC 2P9UG 2MYOA 4GTVA 2E2EA 2WXQA 4WNFA 3SI5A 3APCA 4IYPA 3KSQA 4TRQA 4JEUA 5ENOD 1TNOA 1O1SA 2VTBB 2ZU6B 1OCZE 2VYIA 2MHKA 2VGEA 4HFGA 3DSTA 1IXVA 1K8KG 3QDNA 3RSEG 4G2VA 5AJLA 1QYMA 5DBKA 4XZ4A 3IBEA 3NOCD 3TGOA 1QBQA 5BXOA 1SW6A 1OCCE 3D9MA 1H2UA 4U0ZA 4UWKA 2R59A 3C72A 3EU9A 5AQ7A 3PUJA 3RRUA 4NURA 1PAQA 2KCLA 4I2WA 5KBAA 3FEYA 4I6GA 3UM3A 4RLYA 2MOWA 2FI7A 2FBNA 2EIKE 2IOSA 5EIDA 3SY2A 4KT6B 4BEPA 2IO3C 2FULA 2J8SD 2WXMA 1EPUA 2GW1A 2WXJA 2VGXA 3UM1A 4HVBA 5FZRA 3PH0C 3DSVA 3RO2A 5CBOA 4J8YA 4CDMA 1INZA 4G23A 4PUCA 3ZYLA 2XHEA 3FUFA 5KNGA 2UY1A 2RD0A 2DCPA 4FP7A 5AARA 4XI0A 3EHNA 3EUVA 5AYWD 1FT2A 3V2OA 2J08A 4UWFA 4HXIA 4CDRA 4GTRA 2ETAA 2GRPB 4JHJA 5JHAA 4GB9A 5CCMA 1X81A 2P58C 5E75A 2H6IA 5B3SE 3CVUA 1OT8A 3FTSA 3CVLA 4EQFA 5A6CA 1H2TC 3Q78A 4ATGA 5BV0A 1TJFA 4HI8A 1HFAA 1NP7A 1NA3A 4OVUA 4UI9J 1IQUA 4HLLA 5ENTD 3Q7FA 2X6JA 3NAWA 1LF8A 4F3VA 3O4ZA 1MQSA 3LCAA 3VTXA 3ASHA 1OCRE 4L23A 3ZYMA 3LPZA 4GCNA 5ANRA 3C3RA 5EX0A 1ELRA 4LCTA 3G2TA 3E34A 4DI3A 1Y6IA 3AG2E 2C0MA 4DX2A 3QJZA 4XI9A 4U0SA 4N2QA 1Z5SC 5BPPA 3FUHA 4JA9A 2P9IG 1N4RA 4YDOA 2R2LA 3ZIMA 5FQ8A 1Q2ZA 4ME2A 2F8XK 5CHEE 1Y8MA 4BSZB 4ZFHA 5CMYA 5ANLA 3T8KA 2EIME 2Q7FA 4CGWA 2YQ8A 1OWOA 2J4DA 4LG6A 2IOLA 1MX6A 4PS8A 3GW4A 5HS0A 2EINE 3FUNA 3C98A 1DC2A 3ZXSA 2AW6A 4LSZE 3CK9A 1HG5A 1OWMA 4BTBA 4KBQA 3FH5A 3HVEA 5FTPA 4AIFA 1GW6A 2OVBA 5CBNA 2EILE 2Y69E 4U8YD 2VQ2A 4FJZA 3UX4A 2V4HC 4K03A 1RW2A 2WQHA 4OAUC 4FU3A 4JA7A 4I1OB 2IF4A 4U7EB 4K5AB 1LTXA 1JCQA 4GYWA 3ISMC 2J09A 3EJNA 2C0LA 4JVSA 3V2XA 5G04C 4JW1A 5ENRD 4LRZA 4BETA 3DSWA 4L7TA 4H7YA 3MJWA 4EECA 3WG7E 3AU5A 3APDA 5G55A 4UI9C 2F37A 4EHMA 5JJTA 2LSUA 2I2OA 2X3MA 1D9SA 3CVXA 3TL5A 4G26A 1TNUA 3B7UX 4FADA 4JZYA 2C2LA 4Y6CA 2XCBA 4FHKA 4YDYA 2BTDA 2V5FA 4HOUA 4XIFA 2XRYA 3ZUVB 4XX5A 1BI8B 2F8YA 4J8SA 3DEOA 2GRMA 5ENQD 2WMNA 4AJWA 4G8KA 4WNEA 3Q49B 3UTMA 4GZCA 1NI1A 2OEVA 5JJ7A 2AXVA 1UOHA 3MGBA 4DX5D 4TXPA 3EDTB 2KM4A 3PEUB 2IEJA 4GTQA 2RKKA 4QFVA 4NQ0A 3AS8A 3G2VA 4BESA 3ML8A 4A3TA 1HU3A 1H0AA 3EHQA 2PZIA 2WXGA 1B89A 3NZUA 2WXHA 1N95A 5CEDB 5B1BE 5LCWC 1BLXB 1PY1A 3WXXA 2ZIRA 3R9MA 3ZKJA 5EILA 1Z3YA 1BPOA 2ZXWE 4D10C 1ZU2A 2XEVA 5D0OD 2M63A 4G11A 3SF4A 2DYSE 4DRXE 3GYZA 2DZNA 1UN9A 3JQ0A 4UQYA 3KD7A 1HS6A 2HE0A 3CVWA 1DNPA 3E37A 3ENEA 2Y4TA 4C48B 2DVWA 4GCOA 1TEZA 3B7RL 3P2BA 1ELWA 5AIJA 1N0RA 2H6GA 1UJKA 3MKQA 2OVFA 2P9PG 2A4ZA 2CHZA 3AS5A 5JHBA 4EBAG 4HRLA 4IN3B 2Y0BG 4GA2A 5EYLA 3Q47B 3ESLA 2XRZA 3UXGA 4LUNU 3SGHA 5CCLA 3LY7A 2WVIA 3MV2B 5J08A 3SD5A 5FZQA 3FFLA 3IHVA 3JXIA 3I3NA 1HX8A 3UMVA 3TWVA 1KZOA 1TR4A 2P2CP 3E30A 3LY9A 4L1BA 3VTYA 3RRMB 2QYUA 2L6BA 4G25A 5AQAA 1DVPA 3KEAA 3LYAA 4UI9K 4U95D 4RQIA 2GRLA 3EHRA 3QK0A 3RRNB 3NQPA 3D9LA 4BX8A 5ITZF 2DYRE 2EQXA 3AAAC 4WUYA 2OCCE 3D9KA 4I9EA 4HQDA 4GMJA 1HZ4A 4F1PA 4WAFA 1AP7A 4URKA 3FUDA 1ZB1A 2YNQA 1SA4A 3GZ1A 4FC8A 4EZKA 1N11A 4JHRA 3W9GA 3TG4A 2JLBA 3ESKA 1SQMA 4G1TA 3OXLA 2BUGA 2XZTG 1KLXA 1A5EA 2QYJA 4N3BA 1JWFA 4NACA 3QB2A 1K3ZD 1O5MA 4AXHA 3ZVVA 4J7WA 4BTAA 1JPLA 5M72A 4GTMA 2XGSA 5FQ4A 2H6FA 2PM7A 3FULA 3HDXA 3E32A 3MEKA 2RFAA 1MZCA 4DI4A 5AJDA 1H19A 1L5JA 3LXUX 1H6PA 1HG2A 4DLOA 3AG4E 1UW4B 3CHQA 3UIOC 3E4BA 4M7CA 3FUIA 4BX9A 4EBAA 3QOUA 2VJ8A 3FU0A 4ZHBA 3FWVA 2ZGDA 4CT0A 1V54E 2J4BA 3S7BA 1OUVA 3RIBA 3FH8A 4A55A 5EYPF 3LJ3A 1RZ4A 2KZTB 3S2AA 4HB5A 4ABNA 1G3NB 3PREA 4OVVA 3U3WA 2LSVA 3UUXA 2WM9A 3Q73A 3UM0A 3MV3B 2CG2A 1H6OA 2L6JA 4J8DA 1E8XA 2XQ0A 4HOTA 3IV0A 1ELKA 5EX3A 3CVQA 3SBTB 2XEEA 4MKTA 3L16A 1O1TA 2WXIA 3CHPA 5LX8A 5A7DB 4M3OA 2BKGA 3DEPA 1HXIA 2NC9A 1TJCA 4A1GA 4MRUA 4GPKA 2IY0C 3DSSA 3DXMG 5FQ7A 4B8CB 3CSTA 4FLHA 1X5BA 2DWZA 1YYHA 3OXGA 4UWGA 2FO1E 2I1JA 4J6IA 3OAWA 3DBSA 2PQNA 3QARA 4TXRA 5ENPD 3T5XA 2HM8A 2AJAA 5KWDA 4YDEA 4JHKA 3IEGA 4HOQA 3CHRA 1LD8A 3MA5A 4MBGA 2UWJG 2R5SA 1DCQA 1MX4A 3APFA 2WXFA 3ZHEA 3LEWA 3HXDA 4N39A 3T9KA 3ZGQA 5EN5D 4B0ZA 4WNGA 3FUMA 4PDXA 4GTPA 4TXQA 2I9CA 4ILIA 3UKRG 3SNXA 3BUAA 4MLPA 2PM6A 5LFAA 5BXUA 4ACKA 4XEIG 5C1DA 2XPIA 3I4RB 3HVEB 4KXKB 5CRVA 1DCEA 1N4QA 3B7BA 3TAXA 3D9JA 3GZ2A 3AJIA 3P1UA 5EIBE 1TYQG 3L13A 4G24A 3TWRA 3BG1B 3ULYA 1EYHA 2AWIA 4J8FA 3Q5MA 3HHMA 3PNLB 3ZYKA 1IKND 2ZISA 4F7AA 3Q79A 4BT9A 5JMND 4N3AA 5FIOA 5FT9A 1IYGA 3S7JA 5A23A 1BU9A 3FUEA 3CLJA 1WG0A 4ANXA 3UKUG 3HXBA 1YCSB 3NF1A 3D9OA 3UT4A 3PDNA 1WDYA 2XZDG 4FA6A 2DIWA 2VTBA 2WXPA 3RU0A 1HO8A 4EZJA 3EHMA 2H6HA 3RKVA 3L08A 2LNIA 2V5QC 4AOFA 5BV1A 2XEHA 5CMWA 3CR3A 4JXTA 3QWVA 4O1PA 3ASOE 4XKCA 3U66A 2P9NG 4BT8A 3HRAA 3CHMA 5LOZA 4U04A 2XPZA 3PS6A 3CVPA 2KBXA 3ML9A 3ULEG 1FT1A 3AU4A 3UT7A 5E76A 3SFXA 3EIJA 3SBSA 4UQXA 5HRYA 4AY5A 5JA4D 3RAUA 1U3CA 3KS2A 1D8DA 3MKRA 2V8SE 5G2NA 1TNYA 2I6HA 2XGMA 4N2SA 3PE3A 3CSFA 2WXOA 3B7SA 3DSXA 5ENSD 3Q75A 3FU5A 3LY8A 2KATA 5IY5E 3TWQA 3U64A 1EF1C 3BU8A 2J49A 3ABME 3ZYQA 1PC2A 1IQRA 3ASGA 3T8MA 4DPRA 2NSZA 4TV3A 5KJMA 2XENA 4GZDA 3KAEA 4EZLA 5G04J 3B13A 2OOEA 4HBDA 1Z6TA 4H7XA 5LCWJ 3R7QA 3I5PA 1K1BA 3K9IA 4J8EA 3PEVB 3FTXA 1S64A 3TWUA 4GPMA 3RJVA 4JC8A 4YVOA 2GRRB 1OY3D 4JD2G 3PRZA 5T3RA 1KPSB 4A3VA 5AENA 2L9BA 3D9IA 4BERA 1JWGA 2GGFA 2LAIA 2LXLA 3UT8A 3PE4A 3CKCA 4GYOA 2XGOA 3V30A 1BD8A 4C0MA 3CIAA 3MKQB 1OCOE 3FTVA 1KZPA 2PQRA 5J90A 3QNKA 4CRWA 3SO8A 1MJ0A 3F6QA 4Q69A 4FLBA 3VLFA 3B7TA 3L9TA 3SHFA 4B94A 2J07A 3C3OA 3G2WA 1N0QA 4FULA 2WXRA 3RK6A 2ONDA 1QZ2A 3HXEA 4RG9A 3CEQA 5G05C 4HI9A 3TWWA 2WMOA 3LVQE 2LUHA 1MYOA 4K5BA 3D9PA 1KT1A 3O48A 2CFZA 2PNNA 3OXFA 4RSYA 1S63A 3ASNE 5T4YA 1JUQA 4GTOA 1U2VG 2AXUA 4LERA 2HO1A 1ZBPA 5ARFA 4I17A 3CV0A 2GROB 4GMRA 5BNWA 3DRAA 5CERB 4GA0A 3G2UA 4L2YA 4I6EA 3DPDA 2V4LA 2DZOA 5G05J 4JB8P 1NFIE 2BEDA 3QWPA 4L9PA 1D8EA 5AAOA 4CCAA 4JEHA 5BT1A
chains in the Genus database with same CATH topology
3FUNA 3MV3B 4DLQA 2CG2A 2L6JA 3C98A 4KYOB 3ZXSA 3QWWA 4J8DA 1OWNA 2AW6A 2FEZA 1HF8A 3CK9A 1HG5A 1E8XA 1OWMA 2XQ0A 4O6FA 4HOTA 3FTUA 3IV0A 4BTBA 4KBQA 1ELKA 3FH5A 5EX3A 3TXMA 2L0IA 1KT0A 4GMLA 2CHXA 3CVQA 3HVEA 4LEUA 5FTPA 3S7DA 4I6JA 3CVNA 4AIFA 1GW6A 2OVBA 3SBTB 2VGYA 4MKTA 3L6AA 4ILHB 3L16A 1HH8A 2VQ2A 4DK5A 2V0PA 4FJZA 2WXIA 3CHPA 5LX8A 3UX4A 1SZAA 5A7DB 4M3OA 5ENNA 3CVVA 1HXIA 2NC9A 1TJCA 4I1AA 4A1GA 4MRUA 3CHSA 3KEZA 4GPKA 3IKOB 4CT4A 4K03A 4UWLA 5FQ7A 4B8CB 3CK7A 2WQHA 3CSTA 3PUKA 3NZSA 4FU3A 5BUZA 3ZN3A 4FLHA 4W9RA 2X6FA 1X5BA 2XPYA 4JA7A 3FDHA 5T8IA 4I1OB 2IF4A 3JYSA 3URZA 1N54A 3D9NA 4EPZA 1Z3XA 4GA1A 1EDUA 2CFUA 4PS7A 4TUUA 4JPSA 2YHEA 1A17A 4PH4B 3OXGA 1UG3A 2NXPA 4UWGA 5D0QD 5HQ8A 2I1JA 4BSXA 3T5VA 4J6IA 3OAWA 3DBSA 2PQNA 3JCKC 3QARA 4ANWA 4GYWA 5DIZA 4E85A 3FY4A 1WM5A 5LP0A 3GZSA 3T5XA 2HM8A 2J09A 2C0LA 3EJNA 4JVSA 5G04C 4RVBA 1E96B 2ILRA 2IQCA 3ZPJA 3CQCB 4JHKA 4RG6A 4JW1A 2VSNA 3IEGA 4LRZA 1WAO1 4HOQA 2CHWA 3MZLB 3CHRA 4B8AA 2Y3AA 4L7TA 3ZFWA 3ZHEB 2WQ6A 3MA5A 4H7YA 3U4TA 1VDYA 3MJWA 4WWNA 2UWJG 2R5SA 1H6KA 3L22A 4B89A 3PZDA 3APFA 2WXFA 4UQZA 2QY7A 4EECA 3AU5A 4FJYA 3ZHEA 3APDA 2KCKA 3LEWA 5G55A 4N39A 3OTNA 4UI9C 2YHCA 5ARGA 3VLEA 5JJTA 2LSUA 3ONLA 4Y6WA 2I2OA 2X3MA 4U07A 3CK8A 4GYYA 3ZGQA 4AP2A 4GZ5A 5FZSA 3CVXA 1UJJA 2R17C 3TL5A 1SZ9A 4WNGA 4B0ZA 3FUMA 4PDXA 4G26A 2I9CA 2FO7A 2IFUA 3ASDA 3JUIA 2VGXB 4ILIA 3B7UX 3SNXA 2IONA 2IJGX 3BEEA 4MLPA 2VSOE 3S7FA 4JZYA 2PM6A 4FADA 2C2LA 2YINA 4Y6CA 2XCBA 3QKYA 4FHKA 5LFAA 4CGVA 3FU6A 2BTDA 1S0PA 2V5FA 4HOUA 4ACKA 5C1DA 2XPIA 3I4RB 4XIFA 5KJLA 4IRUA 2XRYA 3HVEB 4U63A 4KXKB 3N71A 1OWPA 4XX5A 4KVOA 4KVMA 4HS2A 1E7VA 4XKBA 2WPVA 4R7LA 5FJYA 3PNTB 4J8SA 2IU1A 3TAXA 2GRMA 3R7RA 3TXNA 2WMNA 4AJWA 3D9JA 1E8ZA 3GZ2A 4GAAA 4K0RA 4WWPA 2X6IA 3P1UA 3ZEFA 4WNEA 3Q49B 5KJNA 3L13A 4CEMA 4G24A 4GZCA 3FUKA 4U8HA 2JEKA 4ACLA 5JJ7A 2KCVA 4OYSA 4AV7A 4ILGA 4I43A 2AXVA 4AM9A 3FTWA 3BG1B 2A5UA 3MGBA 3Q4AB 1EYHA 5JJ6A 2AWIA 2RG8A 3BG0B 4J8FA 3Q5MA 3ASFA 2X6HA 4BWRA 5FWQA 3HHMA 3EDTB 3PNLB 1NZNA 2KM4A 3PEUB 3ZYKA 5C2YA 4UWHA 4F7AA 4I9CA 4QFVA 4NQ0A 3AS8A 1YA0A 2XCCA 3G2VA 3ML8A 4WWOA 4HLEA 4A3TA 4FHJA 4YNDA 3VLDA 1HU3A 4YVQC 1H0AA 4BT9A 2Y4UA 2OV8A 3FTYA 3MYVA 4N3AA 2PZIA 2E2EA 2WXQA 4WNFA 5FT9A 2WXGA 1B89A 1IYGA 3SI5A 3S7JA 3APCA 5A23A 3PVLA 3NZUA 4IYPA 3HYMB 3R9AB 3FUEA 3CLJA 4L2LA 2WXHA 4APOA 4ANXA 2UY1B 4TRQA 3NF1A 4JEUA 3D9OA 3UT4A 5LCWC 4N3CA 4C0EA 1PY1A 3UPVA 2CG3A 2VTBB 2ZU6B 3PDNA 1QNFA 2WQ7A 3LKUA 2VYIA 2MHKA 3WXXA 4FA6A 4HFGA 2DIWA 2VTBA 2WXPA 2LO6A 3RU0A 1HO8A 4AY6A 4EZJA 3EHMA 3RKVA 1H2VC 3QDNA 2PL2A 4G2VA 1Z3YA 1BPOA 3EIQC 3L08A 4D10C 4NRHB 2LNIA 1ZU2A 4AOFA 5BV1A 2FF4A 5CMWA 3G2SA 3CR3A 5AJLA 3JQ1A 4JXTA 2XEVA 5D0OD 5DBKA 2DBAA 3QWVA 2M63A 4G11A 4BY6A 4XKCA 3U66A 4P29A 4XZ4A 3SF4A 4BT8A 3GYZA 1UN9A 3CHMA 3IBEA 3JQ0A 4U04A 1U3DA 3KD7A 2X38A 1HS6A 4UQYA 5LOZA 2XPZA 1MHQA 3PS6A 4E6HA 3CVPA 1DNPA 3CVWA 2KC7A 3ENEA 3TGOA 3ML9A 2Y4TA 3AU4A 4GCOA 3UT7A 1TEZA 3B7RL 5E76A 3EIJA 1XNFA 3P2BA 4HORA 5FQ6A 3TG5A 1ELWA 1H2UA 3D9MA 4U0ZA 3ZW3A 3L17A 3LVRE 4UQXA 3SBSA 4UWKA 2MRIA 5AIJA 4AY5A 2R59A 1U3CA 3KS2A 1UJKA 2WXLA 3PUJA 3MKRA 3MKQA 2V8SE 2X6KA 3RRUA 2OVFA 3MCXA 4NURA 5G2NA 1PAQA 2I6HA 2KCLA 3L54A 4I2WA 2L0TB 4XE0A 2A4ZA 2XGMA 4N2SA 3PE3A 3FEYA 2CHZA 2VSXE 3CSFA 4I6GA 2WXOA 3CVYA 3IHYA 3B7SA 3CHOA 3AS5A 3CQGB 3U9WA 3FU5A 2MOWA 5JHBA 2FI7A 2FBNA 2QFCA 3LY8A 4EBAG 2KATA 3U64A 2WB2A 1EF1C 4IN3B 2IOSA 2J49A 2AXZA 3ZYQA 4GA2A 3MX3A 4KT6B 1PC2A 2WXNA 1IQRA 3SZ7A 3Q47B 4WNDA 3I4GA 2FULA 4Q96A 2WXMA 3ESLA 4C9BB 3ASGA 3T8MA 1EPUA 2GW1A 2WXJA 4N5CA 2VGXA 4DPRA 2XRZA 4HVBA 2NSZA 4TV3A 4LUNU 5FZRA 3SGHA 3PH0C 5CCLA 5KJMA 3RO2A 3LY7A 2WVIA 4CDMA 3MV2B 5J08A 3SD5A 4GZDA 4PS3A 4AEZC 1INZA 5FZQA 3FFLA 3KAEA 4G23A 4PUCA 3ZYLA 4EZLA 3IHVA 2XHEA 5G04J 3B13A 3FUFA 4U0UA 3ZRHA 2OOEA 3FP3A 1Z6TA 3I3NA 4H7XA 2UY1A 1P5QA 3CGHA 1HX8A 2E0IA 2RD0A 3R7QA 3UMVA 2DCPA 4FP7A 5LCWJ 3I5PA 4XI0A 2LAHA 3EHNA 3SFZA 3LY9A 4L1BA 3VTYA 3K9IA 5AYWD 4J8EA 4GZ6A 3PEVB 4F1SA 3FTXA 3RRMB 3Q15A 4HOSA 4G25A 3LDZA 1DVPA 3RJVA 3LYAA 3ONKA 4UI9K 4JC8A 4YVOA 3HIZA 2J08A 1HE8A 4HXIA 4UWFA 4CDRA 2GRLA 3UQ3A 3FTZA 3PRZA 3QK0A 5T3RA 3RRNB 3NQPA 3D9LA 4BX8A 2EQXA 4WUYA 4A3VA 2L9BA 4I9EA 3D9KA 4JHJA 5AENA 5JHAA 3D9IA 4GB9A 5CCMA 4GMJA 1HZ4A 2P58C 4WAFA 2J9QA 1JWGA 5E75A 1N52A 4URKA 3CVUA 3FUDA 2GGFA 2LAIA 3FTSA 3CVLA 3UT8A 3PE4A 4EQFA 2YNQA 3CKCA 1XGWA 4GYOA 5A6CA 3GZ1A 1H2TC 4FC8A 1QQEA 4EZKA 2XGOA 4ATGA 5KJKA 4C0MA 5BV0A 3CIAA 1TJFA 1E7UA 3MKQB 4JHRA 3FTVA 2PQRA 3TG4A 5J90A 3QNKA 4CRWA 2JLBA 3ESKA 1HFAA 1NP7A 1NA3A 4J0UA 4OVUA 1NA0A 1SQMA 4G1TA 4I2ZA 4UI9J 1IQUA 3OXLA 2BUGA 1KLXA 4Q69A 4FLBA 3VLFA 1E8WA 2X6JA 3B7TA 2HR2A 3SHFA 4F53A 4N3BA 2J07A 4B94A 4DJAA 1FVHA 1JWFA 4NACA 1LF8A 3G2WA 4F3VA 3CKBA 3O4ZA 3QB2A 1MQSA 3LCAA 3VTXA 4AXHA 3ZVVA 3ASHA 4FULA 4AVXA 4L23A 2WXRA 3RK6A 3TJPA 2ONDA 1OWLA 4I1MA 4BTAA 1JPLA 3AS4A 3ZYMA 5M72A 3LPZA 4GU5A 4GCNA 1QZ2A 2XGSA 5HI7A 3FU3A 5ANRA 1ELRA 3CEQA 4LCTA 4RG9A 5EX0A 2PM7A 3G2TA 3FULA 3HDXA 3MEKA 5FQ4A 5G05C 1Y6IA 4DI3A 5BW8C 2C0MA 2WMOA 3LVQE 3LS8A 4DI4A 3QJZA 5AJDA 4ANVA 4XI9A 1H19A 1L5JA 4KZCA 3FH7A 4U0SA 4N2QA 4APFA 3D9PA 3LXUX 1KT1A 3FUHA 4JA9A 5BPPA 1HG2A 3O48A 4DLOA 2CFZA 3OXFA 1UW4B 4RSYA 3CHQA 3QC1A 2BF0X 3QAQA 3E4BA 3ZIMA 3FUIA 4BFRA 2I1KA 5FQ8A 3D3MA 4BX9A 1WY6A 5T4YA 1UN8A 4ME2A 4A1SA 1E8YA 1JUQA 4IULA 4EBAA 2HYZA 3QOUA 3FHEA 4JL0A 4MS6A 2AXUA 4Q94A 5EDSA 4LERA 5CHEE 5EKQD 1Y8MA 2HO1A 1FVFA 2VJ8A 1ZBPA 5ARFA 3FU0A 4I17A 3CV0A 3FWVA 4CT0A 4V3IA 5CMYA 5ANLA 2J4BA 3FUJA 1W3BA 3ULQA 3S7BA 1OUVA 5BNWA 2Q7FA 1FCHA 3RIBA 3FH8A 4A55A 4CGWA 2YQ8A 3G2UA 3LJ3A 1OWOA 2KZTB 4GA0A 3S2AA 2AVPA 4KZ0A 4ANUA 2J4DA 4L2YA 4ABNA 5KCMA 2IOLA 4I6EA 3DPDA 2V4LA 1E90A 4GZ3A 2KZTA 4PS8A 2WXKA 5G05J 4CDNA 3RO3A 3PREA 2VSYA 4OVVA 3QWPA 3U3WA 2LSVA 3GW4A 3UUXA 2WM9A 3FEXA 4KMOA 1IHGA 4CCAA 4JEHA 5BT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7F A;  2Y4T A;  3BEE A;  3MV3 B;  2L6J A;  2C2L A;  4Y6C A;  5A6C A;  4KYO B;  2XCB A;  3CVL A;  3QKY A;  3PE4 A;  4GCO A;  4EQF A;  3CKC A;  4CGV A;  3QWW A;  4J8D A;  4GYO A;  2V5F A;  2FEZ A;  3GZ1 A;  4HOU A;  2XPI A;  3CK9 A;  4XIF A;  1XNF A;  3ZFW A;  5C1D A;  1QQE A;  4O6F A;  4KXK B;  3TG5 A;  5KJL A;  1ELW A;  2XGO A;  3N71 A;  4HOR A;  4U0Z A;  4HOT A;  5KJK A;  4UQX A;  4BTB A;  4KBQ A;  5EX3 A;  4AY5 A;  1KT0 A;  2WPV A;  4JHR A;  3CVQ A;  2PQR A;  4LEU A;  5FTP A;  5FJY A;  3KS2 A;  3S7D A;  3CVN A;  3TG4 A;  3TAX A;  4AIF A;  2JLB A;  2VGY A;  3ESK A;  4J0U A;  1NA3 A;  1NA0 A;  3MKR A;  4G1T A;  4I2Z A;  1HH8 A;  4UI9 J;  2VQ2 A;  3GZ2 A;  3OXL A;  3ZHE B;  2BUG A;  1KLX A;  2I6H A;  2KCL A;  2HR2 A;  4I2W A;  4N3B A;  4B94 A;  5A7D B;  2XGM A;  4N2S A;  4WNE A;  3Q49 B;  1HXI A;  4F3V A;  3CKB A;  3PE3 A;  2NC9 A;  5KJN A;  1TJC A;  3LCA A;  4G24 A;  4I1A A;  3VTX A;  3UPV A;  4GPK A;  3AS5 A;  3ASH A;  5JJ7 A;  2KCV A;  4AM9 A;  3CK7 A;  2FI7 A;  2FBN A;  2QFC A;  2OND A;  2WQH A;  3LY8 A;  2KAT A;  4BTA A;  3Q4A B;  3AS4 A;  5JJ6 A;  4W9R A;  4J8F A;  3ZN3 A;  3LPZ A;  4IN3 B;  5M72 A;  4GCN A;  3Q5M A;  1QZ2 A;  3ASF A;  2XGS A;  4JA7 A;  2IF4 A;  3JYS A;  5HI7 A;  3URZ A;  4BWR A;  1ELR A;  3CEQ A;  3EDT B;  1NZN A;  4RG9 A;  5EX0 A;  3MEK A;  4GA2 A;  4GA1 A;  5G05 C;  5BW8 C;  2C0M A;  4I9C A;  1PC2 A;  4NQ0 A;  3AS8 A;  1YA0 A;  2XCC A;  1A17 A;  4YND A;  3SZ7 A;  3OXG A;  3Q47 B;  4WND A;  4XI9 A;  4YVQ C;  5D0Q D;  3ASG A;  4BT9 A;  2Y4U A;  5HQ8 A;  4N3A A;  2GW1 A;  4U0S A;  2PZI A;  4N5C A;  2E2E A;  2VGX A;  4N2Q A;  4WNF A;  2PQN A;  5FT9 A;  5FZR A;  5CCL A;  5KJM A;  1KT1 A;  4GYW A;  4JA9 A;  5LCW C;  1B89 A;  5DIZ A;  3O48 A;  1IYG A;  3RO2 A;  3LY7 A;  3OXF A;  3S7J A;  1WM5 A;  3R9A B;  3HYM B;  3MV2 B;  2C0L A;  3E4B A;  5G04 C;  4APO A;  1E96 B;  2UY1 B;  5FZQ A;  3FFL A;  3ZPJ A;  3KAE A;  4RG6 A;  4G23 A;  3NF1 A;  2VSN A;  3IEG A;  4ME2 A;  1WAO 1;  4HOQ A;  4N3C A;  4U0U A;  2HYZ A;  5G04 J;  4A1S A;  2OOE A;  3QOU A;  3FP3 A;  4JL0 A;  4H7X A;  2UY1 A;  3PDN A;  5CHE E;  1P5Q A;  5EKQ D;  1Y8M A;  2HO1 A;  3LKU A;  5LCW J;  2VYI A;  1ZBP A;  2MHK A;  5ARF A;  3MA5 A;  4H7Y A;  3U4T A;  4XI0 A;  4I17 A;  3WXX A;  3CV0 A;  3FWV A;  2UWJ G;  2R5S A;  3RU0 A;  4AY6 A;  3LY9 A;  3VTY A;  3K9I A;  4UQZ A;  5AYW D;  4J8E A;  3RKV A;  4GZ6 A;  3QDN A;  3ULQ A;  1W3B A;  3ZHE A;  3S7B A;  2PL2 A;  1OUV A;  2KCK A;  4G2V A;  5BNW A;  2Q7F A;  1FCH A;  3RIB A;  4NRH B;  2LNI A;  3Q15 A;  4N39 A;  4CGW A;  4HOS A;  4UI9 C;  1ZU2 A;  4G25 A;  2YHC A;  2FF4 A;  2YQ8 A;  4GA0 A;  5ARG A;  2LSU A;  5JJT A;  2AVP A;  4Y6W A;  3RJV A;  3LYA A;  4U07 A;  3CK8 A;  2XEV A;  4GYY A;  4UI9 K;  3ZGQ A;  5D0O D;  4GZ5 A;  2DBA A;  3QWV A;  4YVO A;  5DBK A;  5FZS A;  4ABN A;  4CDR A;  4GZ3 A;  4WNG A;  3UQ3 A;  3SF4 A;  4BT8 A;  3GYZ A;  5G05 J;  4G26 A;  3RO3 A;  4U04 A;  4UQY A;  3KD7 A;  2VSY A;  4WUY A;  4I9E A;  3QWP A;  3U3W A;  2FO7 A;  2IFU A;  2LSV A;  3ASD A;  3CVP A;  3GW4 A;  2VGX B;  2KC7 A;  3UUX A;  1HZ4 A;  5CCM A;  3TGO A;  2P58 C;  1IHG A;  2J9Q A;  5BT1 A; 
#chains in the Genus database with same CATH topology
 1FPP A;  4KYO B;  3QWW A;  1OWN A;  2FEZ A;  1HF8 A;  4O6F A;  4U8V D;  2L0I A;  1KT0 A;  3CVN A;  2VGY A;  3L6A A;  1HH8 A;  4DK5 A;  2V0P A;  1MX2 A;  1SZA A;  5HKP A;  5ENN A;  2KXP C;  3EU5 A;  4I1A A;  3AG3 E;  4CT4 A;  3PUK A;  5BUZ A;  3ZN3 A;  4GTT A;  2QZA A;  2XPY A;  3URZ A;  3JYS A;  1N54 A;  3D9N A;  4EPZ A;  4U96 D;  1Z3X A;  2F0Y A;  3UM2 A;  1EDU A;  2CFU A;  4JPS A;  5D0Q D;  5HQ8 A;  4BSX A;  2OEW A;  1JCS A;  3JCK C;  4ANW A;  3IXE A;  5DIZ A;  1WM5 A;  5LP0 A;  2ILR A;  3CQC B;  4RG6 A;  2VSN A;  1WAO 1;  2CHW A;  3MZL B;  4B8A A;  3ZFW A;  2WQ6 A;  1VDY A;  3UI2 A;  4WWN A;  3L22 A;  1H6K A;  3TWT A;  2QY7 A;  1OXJ A;  4UUC A;  3OTN A;  3VLE A;  3CK8 A;  3L82 A;  4GZ5 A;  5FZS A;  1UJJ A;  1SZ9 A;  3LJN A;  2IFU A;  2VGX B;  4CZ2 D;  4N5Q A;  2VSO E;  5CEC B;  2YIN A;  4LNU D;  1NL4 A;  1S0P A;  3AG1 E;  4IRU A;  4U63 A;  1OWP A;  4KVO A;  4KVM A;  4XKB A;  1TNZ A;  2WPV A;  4R7L A;  5FJY A;  3TXN A;  1E8Z A;  4GAA A;  4K0R A;  2X6I A;  2ETC A;  5KJN A;  3DPY A;  5KNH D;  2JEK A;  4OYS A;  4ILG A;  3ABK E;  3FTW A;  2A5U A;  5CRU A;  5JJ6 A;  2RG8 A;  3BG0 B;  3ASF A;  2X6H A;  1NZN A;  4UWH A;  1TN7 A;  1YA0 A;  2XCC A;  3HXF A;  1AWC B;  4HLE A;  3BQO A;  4FHJ A;  4YND A;  3VLD A;  4O60 A;  2Y4U A;  2OV8 A;  3FTY A;  3MYV A;  3HG0 D;  3PVL A;  3R9A B;  3E33 A;  3HYM B;  4L2L A;  4APO A;  2UY1 B;  3X2Q E;  3UPV A;  4N3C A;  4C0E A;  2CG3 A;  4YDW A;  3B95 A;  1QNF A;  3D9H A;  3LKU A;  4CYM D;  2WQ7 A;  4AY6 A;  2LO6 A;  1S70 B;  1H2V C;  2PL2 A;  3EIQ C;  5D2M C;  4NRH B;  2FF4 A;  3G2S A;  3JQ1 A;  2DBA A;  4BY6 A;  1K1A A;  4P29 A;  1U3D A;  2X38 A;  1MHQ A;  4E6H A;  2KC7 A;  1TNB A;  1SVX A;  2GRN B;  1IHB A;  1XNF A;  4HOR A;  5FQ6 A;  3TG5 A;  3ZNG A;  4X8Q A;  3ZW3 A;  3L17 A;  3LVR E;  2MRI A;  2WXL A;  2X6K A;  3MCX A;  3L54 A;  2L0T B;  4XE0 A;  2XS1 A;  2VSX E;  3CVY A;  3IHY A;  3CHO A;  3CQG B;  3U9W A;  2QFC A;  3TWX A;  2WB2 A;  4NIK A;  2RFM A;  2A5E A;  2AXZ A;  2Y1L E;  3J5P A;  3MX3 A;  2WXN A;  3SZ7 A;  3NBN B;  4WND A;  3I4G A;  4Q96 A;  3PZ3 A;  4C9B B;  4N5C A;  5FIN A;  2XS8 A;  4LNB A;  4PS3 A;  4AEZ C;  1N9A A;  1O1R A;  4U0U A;  3ZRH A;  1N4S A;  3FP3 A;  3UIN C;  5CEA A;  3ZXP A;  1P5Q A;  3CGH A;  2E0I A;  2LAH A;  3SFZ A;  4GZ6 A;  4F1S A;  3Q15 A;  4HOS A;  3NOG D;  3LDZ A;  3ONK A;  3J5Q B;  3HIZ A;  1HE8 A;  4ATZ D;  3UQ3 A;  3FTZ A;  3C3Q A;  3HXC A;  4TUM A;  2R03 A;  2J9Q A;  1N52 A;  1XGW A;  1QQE A;  2BKK B;  5KJK A;  3PZ2 A;  1E7U A;  4HRM B;  4J0U A;  1NA0 A;  4I2Z A;  2LXM A;  4Z68 A;  1E8W A;  3SQV A;  4F53 A;  2HR2 A;  4DJA A;  1FVH A;  3TWS A;  3CKB A;  4AVX A;  3TJP A;  1OWL A;  4I1M A;  3AS4 A;  4GU5 A;  5B1A E;  5HI7 A;  3FU3 A;  5BW8 C;  1TN8 A;  3LS8 A;  4ANV A;  4KZC A;  3FH7 A;  4APF A;  1SA5 A;  2P9S G;  3QC1 A;  2BF0 X;  3QAQ A;  4BFR A;  2I1K A;  3D3M A;  1WY6 A;  1TN6 A;  2QC9 A;  1UN8 A;  2JAB A;  4A1S A;  1E8Y A;  4IUL A;  2HYZ A;  4B93 B;  3FHE A;  4JL0 A;  4MS6 A;  4Q94 A;  5EDS A;  5EKQ D;  1FVF A;  3PZ1 A;  4V3I A;  5AQ9 A;  2P9K G;  3FUJ A;  1W3B A;  3ULQ A;  1FCH A;  5H7P A;  2AVP A;  4KZ0 A;  4ANU A;  5KCM A;  1E90 A;  4GZ3 A;  2KZT A;  4GTS A;  2WXK A;  4CDN A;  3RO3 A;  2VSY A;  1N4P A;  3FEX A;  4KMO A;  5KJL A;  1IHG A;  1LD7 A;  5AN8 A;  4DLQ A;  2R05 A;  1JCR A;  3Q7A A;  3PZ4 A;  3FTU A;  3TXM A;  4GML A;  2CHX A;  4LEU A;  3S7D A;  4I6J A;  5AQB A;  4A63 B;  4HRN A;  4ILH B;  3ZU7 B;  2B0O E;  4DUI A;  4QQI A;  3CVV A;  3CHS A;  3KEZ A;  3IKO B;  4UWL A;  3CK7 A;  3NZS A;  4DX6 D;  4OAV B;  4W9R A;  2X6F A;  4DX1 A;  5T8I A;  3FDH A;  2IO2 C;  3NB2 A;  4GA1 A;  2NYJ A;  4PS7 A;  4TUU A;  2YHE A;  3C5R A;  1A17 A;  4PH4 B;  1UG3 A;  2NXP A;  3V31 A;  3T5V A;  3JUE A;  4E85 A;  3FY4 A;  3GZS A;  4LNG A;  3DXK G;  4K5C A;  4RVB A;  1E96 B;  2IQC A;  3ZPJ A;  3Q9N C;  3V79 K;  4G8L A;  3DSU A;  5D66 A;  2GRQ B;  2Y3A A;  3ZHE B;  3U4T A;  3SFY A;  4B89 A;  3PZD A;  4UQZ A;  3W9F A;  4FJY A;  3UIP C;  2KCK A;  4DX7 D;  2EIJ E;  1V55 E;  1BI7 B;  2YHC A;  5ARG A;  3ONL A;  4Y6W A;  4U07 A;  4GYY A;  4AP2 A;  2R17 C;  2R02 A;  2FO7 A;  2ZGG A;  3ASD A;  3JUI A;  3JXJ A;  2ION A;  2IJG X;  3BEE A;  3S7F A;  3QKY A;  4CGV A;  3FU6 A;  3Q9U C;  3ABL E;  3N71 A;  4HS2 A;  1E7V A;  2B6C A;  3PNT B;  2IU1 A;  3R7R A;  4WWP A;  4F6R D;  3ZEF A;  4HNA D;  4CEM A;  3FUK A;  3KSL A;  4U8H A;  4ACL A;  2KCV A;  4AV7 A;  4I43 A;  4AM9 A;  3Q4A B;  1N94 A;  4BWR A;  3DWL G;  5FWQ A;  2ETB A;  5C2Y A;  4I9C A;  4WWO A;  2P9L G;  1YMP A;  4O1O A;  4YVQ C;  2P9U G;  2MYO A;  4GTV A;  2E2E A;  2WXQ A;  4WNF A;  3SI5 A;  3APC A;  4IYP A;  3KSQ A;  4TRQ A;  4JEU A;  5ENO D;  1TNO A;  1O1S A;  2VTB B;  2ZU6 B;  1OCZ E;  2VYI A;  2MHK A;  2VGE A;  4HFG A;  3DST A;  1IXV A;  1K8K G;  3QDN A;  3RSE G;  4G2V A;  5AJL A;  1QYM A;  5DBK A;  4XZ4 A;  3IBE A;  3NOC D;  3TGO A;  1QBQ A;  5BXO A;  1SW6 A;  1OCC E;  3D9M A;  1H2U A;  4U0Z A;  4UWK A;  2R59 A;  3C72 A;  3EU9 A;  5AQ7 A;  3PUJ A;  3RRU A;  4NUR A;  1PAQ A;  2KCL A;  4I2W A;  5KBA A;  3FEY A;  4I6G A;  3UM3 A;  4RLY A;  2MOW A;  2FI7 A;  2FBN A;  2EIK E;  2IOS A;  5EID A;  3SY2 A;  4KT6 B;  4BEP A;  2IO3 C;  2FUL A;  2J8S D;  2WXM A;  1EPU A;  2GW1 A;  2WXJ A;  2VGX A;  3UM1 A;  4HVB A;  5FZR A;  3PH0 C;  3DSV A;  3RO2 A;  5CBO A;  4J8Y A;  4CDM A;  1INZ A;  4G23 A;  4PUC A;  3ZYL A;  2XHE A;  3FUF A;  5KNG A;  2UY1 A;  2RD0 A;  2DCP A;  4FP7 A;  5AAR A;  4XI0 A;  3EHN A;  3EUV A;  5AYW D;  1FT2 A;  3V2O A;  2J08 A;  4UWF A;  4HXI A;  4CDR A;  4GTR A;  2ETA A;  2GRP B;  4JHJ A;  5JHA A;  4GB9 A;  5CCM A;  1X81 A;  2P58 C;  5E75 A;  2H6I A;  5B3S E;  3CVU A;  1OT8 A;  3FTS A;  3CVL A;  4EQF A;  5A6C A;  1H2T C;  3Q78 A;  4ATG A;  5BV0 A;  1TJF A;  4HI8 A;  1HFA A;  1NP7 A;  1NA3 A;  4OVU A;  4UI9 J;  1IQU A;  4HLL A;  5ENT D;  3Q7F A;  2X6J A;  3NAW A;  1LF8 A;  4F3V A;  3O4Z A;  1MQS A;  3LCA A;  3VTX A;  3ASH A;  1OCR E;  4L23 A;  3ZYM A;  3LPZ A;  4GCN A;  5ANR A;  3C3R A;  5EX0 A;  1ELR A;  4LCT A;  3G2T A;  3E34 A;  4DI3 A;  1Y6I A;  3AG2 E;  2C0M A;  4DX2 A;  3QJZ A;  4XI9 A;  4U0S A;  4N2Q A;  1Z5S C;  5BPP A;  3FUH A;  4JA9 A;  2P9I G;  1N4R A;  4YDO A;  2R2L A;  3ZIM A;  5FQ8 A;  1Q2Z A;  4ME2 A;  2F8X K;  5CHE E;  1Y8M A;  4BSZ B;  4ZFH A;  5CMY A;  5ANL A;  3T8K A;  2EIM E;  2Q7F A;  4CGW A;  2YQ8 A;  1OWO A;  2J4D A;  4LG6 A;  2IOL A;  1MX6 A;  4PS8 A;  3GW4 A;  5HS0 A;  2EIN E;  3FUN A;  3C98 A;  1DC2 A;  3ZXS A;  2AW6 A;  4LSZ E;  3CK9 A;  1HG5 A;  1OWM A;  4BTB A;  4KBQ A;  3FH5 A;  3HVE A;  5FTP A;  4AIF A;  1GW6 A;  2OVB A;  5CBN A;  2EIL E;  2Y69 E;  4U8Y D;  2VQ2 A;  4FJZ A;  3UX4 A;  2V4H C;  4K03 A;  1RW2 A;  2WQH A;  4OAU C;  4FU3 A;  4JA7 A;  4I1O B;  2IF4 A;  4U7E B;  4K5A B;  1LTX A;  1JCQ A;  4GYW A;  3ISM C;  2J09 A;  3EJN A;  2C0L A;  4JVS A;  3V2X A;  5G04 C;  4JW1 A;  5ENR D;  4LRZ A;  4BET A;  3DSW A;  4L7T A;  4H7Y A;  3MJW A;  4EEC A;  3WG7 E;  3AU5 A;  3APD A;  5G55 A;  4UI9 C;  2F37 A;  4EHM A;  5JJT A;  2LSU A;  2I2O A;  2X3M A;  1D9S A;  3CVX A;  3TL5 A;  4G26 A;  1TNU A;  3B7U X;  4FAD A;  4JZY A;  2C2L A;  4Y6C A;  2XCB A;  4FHK A;  4YDY A;  2BTD A;  2V5F A;  4HOU A;  4XIF A;  2XRY A;  3ZUV B;  4XX5 A;  1BI8 B;  2F8Y A;  4J8S A;  3DEO A;  2GRM A;  5ENQ D;  2WMN A;  4AJW A;  4G8K A;  4WNE A;  3Q49 B;  3UTM A;  4GZC A;  1NI1 A;  2OEV A;  5JJ7 A;  2AXV A;  1UOH A;  3MGB A;  4DX5 D;  4TXP A;  3EDT B;  2KM4 A;  3PEU B;  2IEJ A;  4GTQ A;  2RKK A;  4QFV A;  4NQ0 A;  3AS8 A;  3G2V A;  4BES A;  3ML8 A;  4A3T A;  1HU3 A;  1H0A A;  3EHQ A;  2PZI A;  2WXG A;  1B89 A;  3NZU A;  2WXH A;  1N95 A;  5CED B;  5B1B E;  5LCW C;  1BLX B;  1PY1 A;  3WXX A;  2ZIR A;  3R9M A;  3ZKJ A;  5EIL A;  1Z3Y A;  1BPO A;  2ZXW E;  4D10 C;  1ZU2 A;  2XEV A;  5D0O D;  2M63 A;  4G11 A;  3SF4 A;  2DYS E;  4DRX E;  3GYZ A;  2DZN A;  1UN9 A;  3JQ0 A;  4UQY A;  3KD7 A;  1HS6 A;  2HE0 A;  3CVW A;  1DNP A;  3E37 A;  3ENE A;  2Y4T A;  4C48 B;  2DVW A;  4GCO A;  1TEZ A;  3B7R L;  3P2B A;  1ELW A;  5AIJ A;  1N0R A;  2H6G A;  1UJK A;  3MKQ A;  2OVF A;  2P9P G;  2A4Z A;  2CHZ A;  3AS5 A;  5JHB A;  4EBA G;  4HRL A;  4IN3 B;  2Y0B G;  4GA2 A;  5EYL A;  3Q47 B;  3ESL A;  2XRZ A;  3UXG A;  4LUN U;  3SGH A;  5CCL A;  3LY7 A;  2WVI A;  3MV2 B;  5J08 A;  3SD5 A;  5FZQ A;  3FFL A;  3IHV A;  3JXI A;  3I3N A;  1HX8 A;  3UMV A;  3TWV A;  1KZO A;  1TR4 A;  2P2C P;  3E30 A;  3LY9 A;  4L1B A;  3VTY A;  3RRM B;  2QYU A;  2L6B A;  4G25 A;  5AQA A;  1DVP A;  3KEA A;  3LYA A;  4UI9 K;  4U95 D;  4RQI A;  2GRL A;  3EHR A;  3QK0 A;  3RRN B;  3NQP A;  3D9L A;  4BX8 A;  5ITZ F;  2DYR E;  2EQX A;  3AAA C;  4WUY A;  2OCC E;  3D9K A;  4I9E A;  4HQD A;  4GMJ A;  1HZ4 A;  4F1P A;  4WAF A;  1AP7 A;  4URK A;  3FUD A;  1ZB1 A;  2YNQ A;  1SA4 A;  3GZ1 A;  4FC8 A;  4EZK A;  1N11 A;  4JHR A;  3W9G A;  3TG4 A;  2JLB A;  3ESK A;  1SQM A;  4G1T A;  3OXL A;  2BUG A;  2XZT G;  1KLX A;  1A5E A;  2QYJ A;  4N3B A;  1JWF A;  4NAC A;  3QB2 A;  1K3Z D;  1O5M A;  4AXH A;  3ZVV A;  4J7W A;  4BTA A;  1JPL A;  5M72 A;  4GTM A;  2XGS A;  5FQ4 A;  2H6F A;  2PM7 A;  3FUL A;  3HDX A;  3E32 A;  3MEK A;  2RFA A;  1MZC A;  4DI4 A;  5AJD A;  1H19 A;  1L5J A;  3LXU X;  1H6P A;  1HG2 A;  4DLO A;  3AG4 E;  1UW4 B;  3CHQ A;  3UIO C;  3E4B A;  4M7C A;  3FUI A;  4BX9 A;  4EBA A;  3QOU A;  2VJ8 A;  3FU0 A;  4ZHB A;  3FWV A;  2ZGD A;  4CT0 A;  1V54 E;  2J4B A;  3S7B A;  1OUV A;  3RIB A;  3FH8 A;  4A55 A;  5EYP F;  3LJ3 A;  1RZ4 A;  2KZT B;  3S2A A;  4HB5 A;  4ABN A;  1G3N B;  3PRE A;  4OVV A;  3U3W A;  2LSV A;  3UUX A;  2WM9 A;  3Q73 A;  3UM0 A;  3MV3 B;  2CG2 A;  1H6O A;  2L6J A;  4J8D A;  1E8X A;  2XQ0 A;  4HOT A;  3IV0 A;  1ELK A;  5EX3 A;  3CVQ A;  3SBT B;  2XEE A;  4MKT A;  3L16 A;  1O1T A;  2WXI A;  3CHP A;  5LX8 A;  5A7D B;  4M3O A;  2BKG A;  3DEP A;  1HXI A;  2NC9 A;  1TJC A;  4A1G A;  4MRU A;  4GPK A;  2IY0 C;  3DSS A;  3DXM G;  5FQ7 A;  4B8C B;  3CST A;  4FLH A;  1X5B A;  2DWZ A;  1YYH A;  3OXG A;  4UWG A;  2FO1 E;  2I1J A;  4J6I A;  3OAW A;  3DBS A;  2PQN A;  3QAR A;  4TXR A;  5ENP D;  3T5X A;  2HM8 A;  2AJA A;  5KWD A;  4YDE A;  4JHK A;  3IEG A;  4HOQ A;  3CHR A;  1LD8 A;  3MA5 A;  4MBG A;  2UWJ G;  2R5S A;  1DCQ A;  1MX4 A;  3APF A;  2WXF A;  3ZHE A;  3LEW A;  3HXD A;  4N39 A;  3T9K A;  3ZGQ A;  5EN5 D;  4B0Z A;  4WNG A;  3FUM A;  4PDX A;  4GTP A;  4TXQ A;  2I9C A;  4ILI A;  3UKR G;  3SNX A;  3BUA A;  4MLP A;  2PM6 A;  5LFA A;  5BXU A;  4ACK A;  4XEI G;  5C1D A;  2XPI A;  3I4R B;  3HVE B;  4KXK B;  5CRV A;  1DCE A;  1N4Q A;  3B7B A;  3TAX A;  3D9J A;  3GZ2 A;  3AJI A;  3P1U A;  5EIB E;  1TYQ G;  3L13 A;  4G24 A;  3TWR A;  3BG1 B;  3ULY A;  1EYH A;  2AWI A;  4J8F A;  3Q5M A;  3HHM A;  3PNL B;  3ZYK A;  1IKN D;  2ZIS A;  4F7A A;  3Q79 A;  4BT9 A;  5JMN D;  4N3A A;  5FIO A;  5FT9 A;  1IYG A;  3S7J A;  5A23 A;  1BU9 A;  3FUE A;  3CLJ A;  1WG0 A;  4ANX A;  3UKU G;  3HXB A;  1YCS B;  3NF1 A;  3D9O A;  3UT4 A;  3PDN A;  1WDY A;  2XZD G;  4FA6 A;  2DIW A;  2VTB A;  2WXP A;  3RU0 A;  1HO8 A;  4EZJ A;  3EHM A;  2H6H A;  3RKV A;  3L08 A;  2LNI A;  2V5Q C;  4AOF A;  5BV1 A;  2XEH A;  5CMW A;  3CR3 A;  4JXT A;  3QWV A;  4O1P A;  3ASO E;  4XKC A;  3U66 A;  2P9N G;  4BT8 A;  3HRA A;  3CHM A;  5LOZ A;  4U04 A;  2XPZ A;  3PS6 A;  3CVP A;  2KBX A;  3ML9 A;  3ULE G;  1FT1 A;  3AU4 A;  3UT7 A;  5E76 A;  3SFX A;  3EIJ A;  3SBS A;  4UQX A;  5HRY A;  4AY5 A;  5JA4 D;  3RAU A;  1U3C A;  3KS2 A;  1D8D A;  3MKR A;  2V8S E;  5G2N A;  1TNY A;  2I6H A;  2XGM A;  4N2S A;  3PE3 A;  3CSF A;  2WXO A;  3B7S A;  3DSX A;  5ENS D;  3Q75 A;  3FU5 A;  3LY8 A;  2KAT A;  5IY5 E;  3TWQ A;  3U64 A;  1EF1 C;  3BU8 A;  2J49 A;  3ABM E;  3ZYQ A;  1PC2 A;  1IQR A;  3ASG A;  3T8M A;  4DPR A;  2NSZ A;  4TV3 A;  5KJM A;  2XEN A;  4GZD A;  3KAE A;  4EZL A;  5G04 J;  3B13 A;  2OOE A;  4HBD A;  1Z6T A;  4H7X A;  5LCW J;  3R7Q A;  3I5P A;  1K1B A;  3K9I A;  4J8E A;  3PEV B;  3FTX A;  1S64 A;  3TWU A;  4GPM A;  3RJV A;  4JC8 A;  4YVO A;  2GRR B;  1OY3 D;  4JD2 G;  3PRZ A;  5T3R A;  1KPS B;  4A3V A;  5AEN A;  2L9B A;  3D9I A;  4BER A;  1JWG A;  2GGF A;  2LAI A;  2LXL A;  3UT8 A;  3PE4 A;  3CKC A;  4GYO A;  2XGO A;  3V30 A;  1BD8 A;  4C0M A;  3CIA A;  3MKQ B;  1OCO E;  3FTV A;  1KZP A;  2PQR A;  5J90 A;  3QNK A;  4CRW A;  3SO8 A;  1MJ0 A;  3F6Q A;  4Q69 A;  4FLB A;  3VLF A;  3B7T A;  3L9T A;  3SHF A;  4B94 A;  2J07 A;  3C3O A;  3G2W A;  1N0Q A;  4FUL A;  2WXR A;  3RK6 A;  2OND A;  1QZ2 A;  3HXE A;  4RG9 A;  3CEQ A;  5G05 C;  4HI9 A;  3TWW A;  2WMO A;  3LVQ E;  2LUH A;  1MYO A;  4K5B A;  3D9P A;  1KT1 A;  3O48 A;  2CFZ A;  2PNN A;  3OXF A;  4RSY A;  1S63 A;  3ASN E;  5T4Y A;  1JUQ A;  4GTO A;  1U2V G;  2AXU A;  4LER A;  2HO1 A;  1ZBP A;  5ARF A;  4I17 A;  3CV0 A;  2GRO B;  4GMR A;  5BNW A;  3DRA A;  5CER B;  4GA0 A;  3G2U A;  4L2Y A;  4I6E A;  3DPD A;  2V4L A;  2DZO A;  5G05 J;  4JB8 P;  1NFI E;  2BED A;  3QWP A;  4L9P A;  1D8E A;  5AAO A;  4CCA A;  4JEH A;  5BT1 A; 
#chains in the Genus database with same CATH homology
 3FUN A;  3MV3 B;  4DLQ A;  2CG2 A;  2L6J A;  3C98 A;  4KYO B;  3ZXS A;  3QWW A;  4J8D A;  1OWN A;  2AW6 A;  2FEZ A;  1HF8 A;  3CK9 A;  1HG5 A;  1E8X A;  1OWM A;  2XQ0 A;  4O6F A;  4HOT A;  3FTU A;  3IV0 A;  4BTB A;  4KBQ A;  1ELK A;  3FH5 A;  5EX3 A;  3TXM A;  2L0I A;  1KT0 A;  4GML A;  2CHX A;  3CVQ A;  3HVE A;  4LEU A;  5FTP A;  3S7D A;  4I6J A;  3CVN A;  4AIF A;  1GW6 A;  2OVB A;  3SBT B;  2VGY A;  4MKT A;  3L6A A;  4ILH B;  3L16 A;  1HH8 A;  2VQ2 A;  4DK5 A;  2V0P A;  4FJZ A;  2WXI A;  3CHP A;  5LX8 A;  3UX4 A;  1SZA A;  5A7D B;  4M3O A;  5ENN A;  3CVV A;  1HXI A;  2NC9 A;  1TJC A;  4I1A A;  4A1G A;  4MRU A;  3CHS A;  3KEZ A;  4GPK A;  3IKO B;  4CT4 A;  4K03 A;  4UWL A;  5FQ7 A;  4B8C B;  3CK7 A;  2WQH A;  3CST A;  3PUK A;  3NZS A;  4FU3 A;  5BUZ A;  3ZN3 A;  4FLH A;  4W9R A;  2X6F A;  1X5B A;  2XPY A;  4JA7 A;  3FDH A;  5T8I A;  4I1O B;  2IF4 A;  3JYS A;  3URZ A;  1N54 A;  3D9N A;  4EPZ A;  1Z3X A;  4GA1 A;  1EDU A;  2CFU A;  4PS7 A;  4TUU A;  4JPS A;  2YHE A;  1A17 A;  4PH4 B;  3OXG A;  1UG3 A;  2NXP A;  4UWG A;  5D0Q D;  5HQ8 A;  2I1J A;  4BSX A;  3T5V A;  4J6I A;  3OAW A;  3DBS A;  2PQN A;  3JCK C;  3QAR A;  4ANW A;  4GYW A;  5DIZ A;  4E85 A;  3FY4 A;  1WM5 A;  5LP0 A;  3GZS A;  3T5X A;  2HM8 A;  2J09 A;  2C0L A;  3EJN A;  4JVS A;  5G04 C;  4RVB A;  1E96 B;  2ILR A;  2IQC A;  3ZPJ A;  3CQC B;  4JHK A;  4RG6 A;  4JW1 A;  2VSN A;  3IEG A;  4LRZ A;  1WAO 1;  4HOQ A;  2CHW A;  3MZL B;  3CHR A;  4B8A A;  2Y3A A;  4L7T A;  3ZFW A;  3ZHE B;  2WQ6 A;  3MA5 A;  4H7Y A;  3U4T A;  1VDY A;  3MJW A;  4WWN A;  2UWJ G;  2R5S A;  1H6K A;  3L22 A;  4B89 A;  3PZD A;  3APF A;  2WXF A;  4UQZ A;  2QY7 A;  4EEC A;  3AU5 A;  4FJY A;  3ZHE A;  3APD A;  2KCK A;  3LEW A;  5G55 A;  4N39 A;  3OTN A;  4UI9 C;  2YHC A;  5ARG A;  3VLE A;  5JJT A;  2LSU A;  3ONL A;  4Y6W A;  2I2O A;  2X3M A;  4U07 A;  3CK8 A;  4GYY A;  3ZGQ A;  4AP2 A;  4GZ5 A;  5FZS A;  3CVX A;  1UJJ A;  2R17 C;  3TL5 A;  1SZ9 A;  4WNG A;  4B0Z A;  3FUM A;  4PDX A;  4G26 A;  2I9C A;  2FO7 A;  2IFU A;  3ASD A;  3JUI A;  2VGX B;  4ILI A;  3B7U X;  3SNX A;  2ION A;  2IJG X;  3BEE A;  4MLP A;  2VSO E;  3S7F A;  4JZY A;  2PM6 A;  4FAD A;  2C2L A;  2YIN A;  4Y6C A;  2XCB A;  3QKY A;  4FHK A;  5LFA A;  4CGV A;  3FU6 A;  2BTD A;  1S0P A;  2V5F A;  4HOU A;  4ACK A;  5C1D A;  2XPI A;  3I4R B;  4XIF A;  5KJL A;  4IRU A;  2XRY A;  3HVE B;  4U63 A;  4KXK B;  3N71 A;  1OWP A;  4XX5 A;  4KVO A;  4KVM A;  4HS2 A;  1E7V A;  4XKB A;  2WPV A;  4R7L A;  5FJY A;  3PNT B;  4J8S A;  2IU1 A;  3TAX A;  2GRM A;  3R7R A;  3TXN A;  2WMN A;  4AJW A;  3D9J A;  1E8Z A;  3GZ2 A;  4GAA A;  4K0R A;  4WWP A;  2X6I A;  3P1U A;  3ZEF A;  4WNE A;  3Q49 B;  5KJN A;  3L13 A;  4CEM A;  4G24 A;  4GZC A;  3FUK A;  4U8H A;  2JEK A;  4ACL A;  5JJ7 A;  2KCV A;  4OYS A;  4AV7 A;  4ILG A;  4I43 A;  2AXV A;  4AM9 A;  3FTW A;  3BG1 B;  2A5U A;  3MGB A;  3Q4A B;  1EYH A;  5JJ6 A;  2AWI A;  2RG8 A;  3BG0 B;  4J8F A;  3Q5M A;  3ASF A;  2X6H A;  4BWR A;  5FWQ A;  3HHM A;  3EDT B;  3PNL B;  1NZN A;  2KM4 A;  3PEU B;  3ZYK A;  5C2Y A;  4UWH A;  4F7A A;  4I9C A;  4QFV A;  4NQ0 A;  3AS8 A;  1YA0 A;  2XCC A;  3G2V A;  3ML8 A;  4WWO A;  4HLE A;  4A3T A;  4FHJ A;  4YND A;  3VLD A;  1HU3 A;  4YVQ C;  1H0A A;  4BT9 A;  2Y4U A;  2OV8 A;  3FTY A;  3MYV A;  4N3A A;  2PZI A;  2E2E A;  2WXQ A;  4WNF A;  5FT9 A;  2WXG A;  1B89 A;  1IYG A;  3SI5 A;  3S7J A;  3APC A;  5A23 A;  3PVL A;  3NZU A;  4IYP A;  3HYM B;  3R9A B;  3FUE A;  3CLJ A;  4L2L A;  2WXH A;  4APO A;  4ANX A;  2UY1 B;  4TRQ A;  3NF1 A;  4JEU A;  3D9O A;  3UT4 A;  5LCW C;  4N3C A;  4C0E A;  1PY1 A;  3UPV A;  2CG3 A;  2VTB B;  2ZU6 B;  3PDN A;  1QNF A;  2WQ7 A;  3LKU A;  2VYI A;  2MHK A;  3WXX A;  4FA6 A;  4HFG A;  2DIW A;  2VTB A;  2WXP A;  2LO6 A;  3RU0 A;  1HO8 A;  4AY6 A;  4EZJ A;  3EHM A;  3RKV A;  1H2V C;  3QDN A;  2PL2 A;  4G2V A;  1Z3Y A;  1BPO A;  3EIQ C;  3L08 A;  4D10 C;  4NRH B;  2LNI A;  1ZU2 A;  4AOF A;  5BV1 A;  2FF4 A;  5CMW A;  3G2S A;  3CR3 A;  5AJL A;  3JQ1 A;  4JXT A;  2XEV A;  5D0O D;  5DBK A;  2DBA A;  3QWV A;  2M63 A;  4G11 A;  4BY6 A;  4XKC A;  3U66 A;  4P29 A;  4XZ4 A;  3SF4 A;  4BT8 A;  3GYZ A;  1UN9 A;  3CHM A;  3IBE A;  3JQ0 A;  4U04 A;  1U3D A;  3KD7 A;  2X38 A;  1HS6 A;  4UQY A;  5LOZ A;  2XPZ A;  1MHQ A;  3PS6 A;  4E6H A;  3CVP A;  1DNP A;  3CVW A;  2KC7 A;  3ENE A;  3TGO A;  3ML9 A;  2Y4T A;  3AU4 A;  4GCO A;  3UT7 A;  1TEZ A;  3B7R L;  5E76 A;  3EIJ A;  1XNF A;  3P2B A;  4HOR A;  5FQ6 A;  3TG5 A;  1ELW A;  1H2U A;  3D9M A;  4U0Z A;  3ZW3 A;  3L17 A;  3LVR E;  4UQX A;  3SBS A;  4UWK A;  2MRI A;  5AIJ A;  4AY5 A;  2R59 A;  1U3C A;  3KS2 A;  1UJK A;  2WXL A;  3PUJ A;  3MKR A;  3MKQ A;  2V8S E;  2X6K A;  3RRU A;  2OVF A;  3MCX A;  4NUR A;  5G2N A;  1PAQ A;  2I6H A;  2KCL A;  3L54 A;  4I2W A;  2L0T B;  4XE0 A;  2A4Z A;  2XGM A;  4N2S A;  3PE3 A;  3FEY A;  2CHZ A;  2VSX E;  3CSF A;  4I6G A;  2WXO A;  3CVY A;  3IHY A;  3B7S A;  3CHO A;  3AS5 A;  3CQG B;  3U9W A;  3FU5 A;  2MOW A;  5JHB A;  2FI7 A;  2FBN A;  2QFC A;  3LY8 A;  4EBA G;  2KAT A;  3U64 A;  2WB2 A;  1EF1 C;  4IN3 B;  2IOS A;  2J49 A;  2AXZ A;  3ZYQ A;  4GA2 A;  3MX3 A;  4KT6 B;  1PC2 A;  2WXN A;  1IQR A;  3SZ7 A;  3Q47 B;  4WND A;  3I4G A;  2FUL A;  4Q96 A;  2WXM A;  3ESL A;  4C9B B;  3ASG A;  3T8M A;  1EPU A;  2GW1 A;  2WXJ A;  4N5C A;  2VGX A;  4DPR A;  2XRZ A;  4HVB A;  2NSZ A;  4TV3 A;  4LUN U;  5FZR A;  3SGH A;  3PH0 C;  5CCL A;  5KJM A;  3RO2 A;  3LY7 A;  2WVI A;  4CDM A;  3MV2 B;  5J08 A;  3SD5 A;  4GZD A;  4PS3 A;  4AEZ C;  1INZ A;  5FZQ A;  3FFL A;  3KAE A;  4G23 A;  4PUC A;  3ZYL A;  4EZL A;  3IHV A;  2XHE A;  5G04 J;  3B13 A;  3FUF A;  4U0U A;  3ZRH A;  2OOE A;  3FP3 A;  1Z6T A;  3I3N A;  4H7X A;  2UY1 A;  1P5Q A;  3CGH A;  1HX8 A;  2E0I A;  2RD0 A;  3R7Q A;  3UMV A;  2DCP A;  4FP7 A;  5LCW J;  3I5P A;  4XI0 A;  2LAH A;  3EHN A;  3SFZ A;  3LY9 A;  4L1B A;  3VTY A;  3K9I A;  5AYW D;  4J8E A;  4GZ6 A;  3PEV B;  4F1S A;  3FTX A;  3RRM B;  3Q15 A;  4HOS A;  4G25 A;  3LDZ A;  1DVP A;  3RJV A;  3LYA A;  3ONK A;  4UI9 K;  4JC8 A;  4YVO A;  3HIZ A;  2J08 A;  1HE8 A;  4HXI A;  4UWF A;  4CDR A;  2GRL A;  3UQ3 A;  3FTZ A;  3PRZ A;  3QK0 A;  5T3R A;  3RRN B;  3NQP A;  3D9L A;  4BX8 A;  2EQX A;  4WUY A;  4A3V A;  2L9B A;  4I9E A;  3D9K A;  4JHJ A;  5AEN A;  5JHA A;  3D9I A;  4GB9 A;  5CCM A;  4GMJ A;  1HZ4 A;  2P58 C;  4WAF A;  2J9Q A;  1JWG A;  5E75 A;  1N52 A;  4URK A;  3CVU A;  3FUD A;  2GGF A;  2LAI A;  3FTS A;  3CVL A;  3UT8 A;  3PE4 A;  4EQF A;  2YNQ A;  3CKC A;  1XGW A;  4GYO A;  5A6C A;  3GZ1 A;  1H2T C;  4FC8 A;  1QQE A;  4EZK A;  2XGO A;  4ATG A;  5KJK A;  4C0M A;  5BV0 A;  3CIA A;  1TJF A;  1E7U A;  3MKQ B;  4JHR A;  3FTV A;  2PQR A;  3TG4 A;  5J90 A;  3QNK A;  4CRW A;  2JLB A;  3ESK A;  1HFA A;  1NP7 A;  1NA3 A;  4J0U A;  4OVU A;  1NA0 A;  1SQM A;  4G1T A;  4I2Z A;  4UI9 J;  1IQU A;  3OXL A;  2BUG A;  1KLX A;  4Q69 A;  4FLB A;  3VLF A;  1E8W A;  2X6J A;  3B7T A;  2HR2 A;  3SHF A;  4F53 A;  4N3B A;  2J07 A;  4B94 A;  4DJA A;  1FVH A;  1JWF A;  4NAC A;  1LF8 A;  3G2W A;  4F3V A;  3CKB A;  3O4Z A;  3QB2 A;  1MQS A;  3LCA A;  3VTX A;  4AXH A;  3ZVV A;  3ASH A;  4FUL A;  4AVX A;  4L23 A;  2WXR A;  3RK6 A;  3TJP A;  2OND A;  1OWL A;  4I1M A;  4BTA A;  1JPL A;  3AS4 A;  3ZYM A;  5M72 A;  3LPZ A;  4GU5 A;  4GCN A;  1QZ2 A;  2XGS A;  5HI7 A;  3FU3 A;  5ANR A;  1ELR A;  3CEQ A;  4LCT A;  4RG9 A;  5EX0 A;  2PM7 A;  3G2T A;  3FUL A;  3HDX A;  3MEK A;  5FQ4 A;  5G05 C;  1Y6I A;  4DI3 A;  5BW8 C;  2C0M A;  2WMO A;  3LVQ E;  3LS8 A;  4DI4 A;  3QJZ A;  5AJD A;  4ANV A;  4XI9 A;  1H19 A;  1L5J A;  4KZC A;  3FH7 A;  4U0S A;  4N2Q A;  4APF A;  3D9P A;  3LXU X;  1KT1 A;  3FUH A;  4JA9 A;  5BPP A;  1HG2 A;  3O48 A;  4DLO A;  2CFZ A;  3OXF A;  1UW4 B;  4RSY A;  3CHQ A;  3QC1 A;  2BF0 X;  3QAQ A;  3E4B A;  3ZIM A;  3FUI A;  4BFR A;  2I1K A;  5FQ8 A;  3D3M A;  4BX9 A;  1WY6 A;  5T4Y A;  1UN8 A;  4ME2 A;  4A1S A;  1E8Y A;  1JUQ A;  4IUL A;  4EBA A;  2HYZ A;  3QOU A;  3FHE A;  4JL0 A;  4MS6 A;  2AXU A;  4Q94 A;  5EDS A;  4LER A;  5CHE E;  5EKQ D;  1Y8M A;  2HO1 A;  1FVF A;  2VJ8 A;  1ZBP A;  5ARF A;  3FU0 A;  4I17 A;  3CV0 A;  3FWV A;  4CT0 A;  4V3I A;  5CMY A;  5ANL A;  2J4B A;  3FUJ A;  1W3B A;  3ULQ A;  3S7B A;  1OUV A;  5BNW A;  2Q7F A;  1FCH A;  3RIB A;  3FH8 A;  4A55 A;  4CGW A;  2YQ8 A;  3G2U A;  3LJ3 A;  1OWO A;  2KZT B;  4GA0 A;  3S2A A;  2AVP A;  4KZ0 A;  4ANU A;  2J4D A;  4L2Y A;  4ABN A;  5KCM A;  2IOL A;  4I6E A;  3DPD A;  2V4L A;  1E90 A;  4GZ3 A;  2KZT A;  4PS8 A;  2WXK A;  5G05 J;  4CDN A;  3RO3 A;  3PRE A;  2VSY A;  4OVV A;  3QWP A;  3U3W A;  2LSV A;  3GW4 A;  3UUX A;  2WM9 A;  3FEX A;  4KMO A;  1IHG A;  4CCA A;  4JEH A;  5BT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...