5LCWJ

Cryo-em structure of the anaphase-promoting complex/cyclosome, in complex with the mitotic checkpoint complex (apc/c-mcc) at 4.2 angstrom resolution
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anaphase-promoting complex subunit 1
publication title Molecular basis of APC/C regulation by the spindle assembly checkpoint.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 179
structure length 504
sequence length 532
chains with identical sequence K
ec nomenclature
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lcwJ00
2I6HA 3S7JA 4BT9A 3Q47B 3GZ1A 1ELWA 4XI0A 4UQXA 3QKYA 5BNWA 4JA9A 4BTBA 2IF4A 3LY7A 5G04C 5JJ7A 2MHKA 4GA1A 5LCWC 3LYAA 4UI9J 1YA0A 2FF4A 3UQ3A 4HOSA 3RIBA 2QFCA 4BT8A 3KS2A 4JL0A 4G25A 4N5CA 3RJVA 4KBQA 3ASFA 3ASDA 4RG9A 4NRHB 1P5QA 3CEQA 3RU0A 4GPKA 3LY8A 3MKRA 4O6FA 4U0SA 2XCBA 4Y6CA 4UQYA 4GZ5A 5A7DB 1FCHA 3FFLA 1NA3A 3E4BA 2WQHA 4HOTA 4XIFA 3ZN3A 2XPIA 4I1AA 1B89A 5JJTA 4BTAA 5M72A 1ELRA 3Q4AB 4I9CA 3CKCA 5BT1A 4A1SA 4I9EA 4G23A 3TG5A 2PL2A 4WNEA 2ONDA 5AYWD 5EX3A 4JHRA 2FEZA 2KCKA 2C0LA 2LSVA 4G2VA 3RKVA 3CV0A 3ZPJA 4U0ZA 5BW8C 4H7XA 3FP3A 1HH8A 4BWRA 3TG4A 3QWPA 5G05J 4AM9A 5HQ8A 4AIFA 1QQEA 2C2LA 4YVOA 5FTPA 4KXKB 4UI9C 3AS5A 3Q15A 5FZSA 4WNDA 3TAXA 3CVLA 1NA0A 4I2WA 4U0UA 3Q49B 3ESKA 3UPVA 1PC2A 4GZ6A 5CCLA 4YVQC 5KJLA 3GW4A 3ASGA 3UUXA 4UQZA 5CHEE 2GW1A 5D0OD 2VGYA 4GYOA 3NF1A 2UY1A 3MEKA 1QZ2A 5C1DA 4CGWA 2AVPA 1KT1A 5ARFA 4WNGA 4WUYA 2KATA 3R9AB 2VGXA 2OOEA 3MV3B 4NQ0A 3BEEA 2E2EA 3S7BA 2VYIA 3CKBA 3SZ7A 1HZ4A 3S7DA 4RG6A 3PE4A 1IYGA 2HO1A 5DIZA 3KAEA 2UY1B 2IFUA 4YNDA 4HORA 5A6CA 2VQ2A 4N2SA 2KC7A 4AY5A 4N3BA 2XEVA 2VGXB 5G05C 3CK8A 3JYSA 2VSNA 2L6JA 2BUGA 3MV2B 2LSUA 5KJMA 2FBNA 2HR2A 4XI9A 3OXFA 2KCLA 1XNFA 2FO7A 2Y4TA 3WXXA 4GA0A 3ZFWA 3ZGQA 1IHGA 4U07A 4JA7A 4N3AA 4W9RA 2PZIA 4I17A 4CDRA 2C0MA 4UI9K 2XGMA 3CVPA 1WAO1 1ZBPA 3O48A 3RO3A 3QDNA 4J8EA 3LKUA 5FZRA 3AS8A 3SF4A 2VSYA 2XGOA 3CVNA 1HXIA 4H7YA 5ARGA 4HOUA 4I2ZA 3GZ2A 4J8DA 3U4TA 3ASHA 5KJNA 1KLXA 3VTXA 3QOUA 2PQNA 3TGOA 3N71A 4AY6A 4ME2A 4EQFA 5D0QD 3LPZA 4IN3B 4GCOA 3FWVA 4J8FA 5CCMA 3U3WA 4GYWA 4N3CA 3EDTB 2XGSA 3CVQA 2HYZA 3IEGA 5EX0A 3GYZA 2JLBA 3ULQA 5FZQA 2J9QA 5FJYA 4HOQA 2YQ8A 4N2QA 1Y8MA 4KYOB 2R5SA 2V5FA 2FI7A 1ZU2A 3HYMB 4CGVA 1OUVA 3Q5MA 4GZ3A 5G04J 2WPVA 2Y4UA 2P58C 2DBAA 3ZHEA 5LCWJ 2NC9A 1TJCA 3LY9A 3CK7A 2UWJG 4GYYA 2Q7FA 3URZA 5KJKA 3CK9A 5DBKA 4WNFA 5FT9A 3MA5A 3AS4A 4G26A 4F3VA 3OXGA 2XCCA 4LEUA 4APOA 1A17A 5HI7A 1W3BA 4Y6WA 4N39A 4GCNA 4ABNA 5EKQD 3PE3A 3RO2A 3ZHEB 1KT0A 1NZNA 4J0UA 3OXLA 3QWVA 2PQRA 5JJ6A 3PDNA 4G24A 2KCVA 4U04A 3K9IA 1E96B 4B94A 1WM5A 3S7FA 3VTYA 2YHCA 3LCAA 4GA2A 4G1TA 3KD7A 3QWWA 2LNIA
chains in the Genus database with same CATH superfamily
2OCCE 3DEPA 4A63B 4GU5A 4DK5A 3FTXA 3R9MA 4ACKA 2DWZA 4CDNA 5A23A 1ELWA 5LOZA 3QKYA 4JA9A 2X38A 4AVXA 4DLOA 5G04C 4K5AB 5JJ7A 2XZDG 3NAWA 4GA1A 4JVSA 4UI9J 4APFA 5LX8A 3DSSA 4HOSA 5EIBE 2QFCA 1DVPA 4JL0A 3RJVA 4KBQA 2BKGA 4NRHB 4YDOA 5FQ6A 1EDUA 3CEQA 3JCKC 3MKRA 1PY1A 1S0PA 3HXEA 4U0SA 2WMOA 4LUNU 2KXPC 3UMVA 5A7DB 3CHPA 1NA3A 2QY7A 2AJAA 3ZYKA 3PVLA 4L2LA 4I6JA 5BXUA 2R17C 3TWUA 2XPIA 4CZ2D 1TNYA 2BKKB 5EDSA 5J90A 4I1OB 3SI5A 5M72A 2CHZA 4HFGA 2EILE 1QBQA 1IXVA 1SZ9A 3FUJA 3B13A 3PZ2A 3PZ3A 2DYSE 2LSVA 4FC8A 1OWPA 3AJIA 3RKVA 3CV0A 2WXKA 3ZPJA 4GTQA 1JUQA 3FP3A 4HI9A 2DZOA 4DX6D 3OAWA 4YDWA 5G05J 1RW2A 4HRNA 1JCQA 3B7UX 3EIQC 2AWIA 4KXKB 3AS5A 4WNDA 4JHJA 1WDYA 3CVLA 2WM9A 4BX9A 3FH7A 3ONKA 4EZJA 3ESKA 4C9BB 1PC2A 4GZ6A 5LP0A 1KPSB 5FQ7A 5ENPD 1SA5A 5T3RA 5D2MC 4NURA 5CMWA 2GGFA 1TYQG 2GW1A 4GTRA 5JHAA 3MEKA 2IEJA 2AVPA 3HVEA 1KT1A 2VGXA 3G2WA 4O1OA 3ZYMA 2QZAA 5JA4D 3DPDA 3CHQA 3UM0A 3CQGB 3Q79A 1NP7A 2WB2A 3APCA 4UWHA 1A5EA 2GRPB 4JEHA 2L6BA 4MRUA 4RSYA 5A6CA 2VQ2A 4ANVA 3HVEB 4N2SA 5H7PA 1BD8A 4N3BA 4FADA 2VGXB 2VSNA 1UJJA 2BUGA 3MV2B 2LSUA 2FBNA 2L0IA 1MJ0A 4KZ0A 1N9AA 2CG2A 2KCLA 2I1KA 3WXXA 2Y1LE 3RK6A 3SNXA 3EHQA 4JA7A 4I6EA 4N3AA 2VSXE 2F8XK 2XGMA 1ZBPA 3E34A 2ETCA 3FH8A 3I4GA 2R05A 5B3SE 4HOUA 5BV1A 3GZ2A 3C3RA 4BSZB 4GTSA 1MX4A 1DCQA 3HRAA 2R03A 5ENNA 3NQPA 3G2VA 4EQFA 2VSOE 3CR3A 2R2LA 4J8FA 4N3CA 3EDTB 1JCSA 2EIME 2HYZA 1IHBA 3UIPC 3CHOA 5FINA 3TXMA 3JUIA 4PS7A 2RFMA 3JUEA 1BPOA 3ABKE 3HXDA 4B0ZA 4AOFA 5ENOD 3ABLE 1ZU2A 2IOLA 3LEWA 3HYMB 3C72A 1H6OA 2P9SG 4U8YD 1TJCA 1INZA 5EILA 4C48B 1EF1C 2V8SE 2Q7FA 2XPYA 4CDMA 2R59A 1FT1A 5BV0A 2H6HA 2XPZA 4WNFA 4WWPA 3P1UA 3MA5A 5CBNA 1LF8A 1UW4B 4BETA 5AJLA 3R7RA 3UINC 5HKPA 3AU5A 5ENQD 1Q2ZA 3U9WA 4ABNA 4LERA 4UWKA 3W9GA 3PE3A 1N52A 5JMND 3SFZA 2A5UA 3D9IA 3LJNA 3QWVA 1N11A 3PDNA 1EYHA 3SFYA 2KCVA 4IRUA 4FHKA 4B8AA 3S7FA 2X6IA 3NOGD 3TWQA 5J08A 1KZOA 3ZIMA 5HRYA 3LCAA 3UT4A 4G1TA 4QFVA 3APFA 3UXGA 4DX1A 1SA4A 1VDYA 4FHJA 2I6HA 4BT9A 3TL5A 2NXPA 3QNKA 1UG3A 1G3NB 3Q47B 4Z68A 4UQXA 2RFAA 2GRNB 5BNWA 4L2YA 1E90A 2IF4A 4GB9A 2MOWA 5JHBA 4EPZA 1SQMA 5LCWC 2H6FA 3LS8A 3LXUX 3RRUA 2DYRE 3UQ3A 4JB8P 3RIBA 3UT7A 1AP7A 3KS2A 3PNLB 4G25A 4N5CA 2ETBA 3ASDA 2B0OE 3ZXPA 2X3MA 4LNUD 3UIOC 1P5QA 1ELKA 4E6HA 2AXUA 3NZUA 4GPKA 5BPPA 4MLPA 4UQYA 3BG0B 3FFLA 4K0RA 2WQHA 2CG3A 2WVIA 4EZKA 4BEPA 3ZN3A 1S64A 1TNUA 5KCMA 3L82A 3UKUG 3JQ1A 3UM3A 5JJTA 2KM4A 4BTAA 3DXKG 3T8KA 4I9CA 3CKCA 5BT1A 4G23A 4XE0A 4WNEA 3FUMA 4GTTA 1OCOE 4HLEA 4JHRA 4U7EB 2ZGGA 3Q73A 2C0LA 3MZLB 3BG1B 3B7RL 4U0ZA 3VLFA 4H7XA 5AJDA 2HM8A 4IYPA 3RSEG 2A4ZA 3RAUA 3CVVA 3C98A 1S63A 1UN8A 4BWRA 1BI8B 3TG4A 3KSLA 4LNGA 3FDHA 3PEVB 4AM9A 4U63A 5HQ8A 1Y6IA 2H6IA 4BESA 2WXIA 4YVOA 5FTPA 4YDEA 5FZSA 1OCRE 3TAXA 4R7LA 4I43A 4XEIG 3V79K 4TXQA 2BEDA 2V0PA 1HF8A 5EYPF 1SW6A 5KJLA 2IO2C 3ASGA 5E75A 3BU8A 3FEYA 2H6GA 3IV0A 4F53A 3DSWA 5D0OD 1U2VG 4GYOA 2UY1A 1WG0A 3PS6A 4ZHBA 1QZ2A 5C1DA 4L1BA 4D10C 4CGWA 3TWXA 1X81A 5CRVA 4WNGA 1N4QA 1E8XA 3DSUA 3ABME 5BXOA 2KATA 5FQ8A 3R9AB 1UJKA 2GRQB 3BEEA 3AG2E 2E2EA 2VYIA 2P9IG 4YDYA 3PUKA 4AP2A 4RG6A 4RQIA 1IYGA 3FEXA 2MYOA 4HI8A 3SGHA 3CSFA 2AXZA 5DIZA 3KAEA 1WY6A 3T5VA 2CHXA 4A1GA 2UY1B 5ITZF 3FU6A 1OWLA 4L9PA 4AY5A 3W9FA 3VLDA 4DJAA 2XENA 3QC1A 4ANWA 2J49A 2FO7A 2WXMA 1FT2A 3FUNA 3ML9A 4L7TA 3KSQA 4AV7A 1IHGA 5ENTD 4W9RA 4N5QA 2C0MA 3IXEA 4OVVA 2XRZA 5B1AE 3O48A 4OVUA 4UWLA 4A55A 3ZU7B 4X8QA 4GTVA 5ENRD 3RO3A 4J8EA 2IJGX 5KBAA 5FZRA 3AS8A 2VSYA 2P9LG 3CVNA 4H7YA 2WQ7A 4I2ZA 2X6HA 1N95A 2NYJA 1LTXA 3U4TA 5G55A 1KLXA 3VTXA 1SZAA 4C0EA 2PQNA 2OVFA 4HVBA 2E0IA 2CHWA 3FU0A 3T8MA 3N71A 4IULA 3ZUVB 2F8YA 3DSXA 1MYOA 5CRUA 3C3QA 4GTPA 1Z3XA 3EU5A 5EN5D 1DCEA 1RZ4A 1DNPA 5CMYA 1MX2A 4J6IA 5EX0A 3AG4E 3CQCB 5FZQA 3FU3A 2J9QA 4WAFA 3CVWA 4HBDA 4HOQA 4KYOB 2AW6A 1TNZA 2R5SA 2V5FA 2FI7A 4CCAA 3CGHA 1OUVA 5G04J 4WWNA 3KEAA 1N4RA 2DBAA 2KZTA 1H6KA 2WXLA 3RRMB 2UWJG 4GYYA 4CRWA 3IBEA 3F6QA 3ZKJA 4AJWA 3SD5A 5KJKA 2OVBA 3TWVA 4K5CA 5CERB 3J5PA 4EECA 2GRLA 3EJNA 1KZPA 3UKRG 2R02A 3PH0C 2V4HC 2Y3AA 3I4RB 3ZNGA 4LEUA 1Z6TA 4APOA 4AEZC 4PS8A 1QNFA 4FU3A 1O1SA 2OEVA 4Y6WA 4GCNA 2BTDA 2YHEA 4LG6A 3HXBA 2A5EA 2YNQA 1HX8A 3RO2A 2I9CA 4LCTA 4OAVB 1LD8A 3Q7AA 3LVRE 2GROB 4B94A 1WM5A 2IY0C 3Q9NC 3QK0A 4CT0A 4GA2A 1HS6A 3KD7A 4RLYA 1OWOA 3QWWA 3PZ1A 3AG3E 3S7JA 5AARA 3E37A 2I2OA 1H2VC 1TEZA 1OY3D 2F0YA 3GZ1A 3CLJA 3D9NA 3IHVA 5KNGA 4HRMB 4DX5D 3MKQA 1JWFA 3AU4A 3FUKA 3D3MA 1YCSB 3TWWA 1YA0A 5CEDB 3IKOB 2WXHA 2XZTG 4GTOA 4HNAD 4BT8A 3APDA 4JW1A 3VLEA 4JC8A 3ASFA 3T5XA 4A3VA 4TUUA 3RU0A 3CVUA 4UWGA 3LY8A 3EU9A 1U3DA 4DX2A 4Y6CA 3ZXSA 4E85A 1JWGA 3B95A 1IQUA 4U8HA 4BSXA 4DUIA 4I1MA 3MKQB 3E4BA 3FU5A 3ASNE 2MRIA 2VGEA 3C5RA 3RRNB 3OTNA 3CVXA 4I1AA 4F6RD 3MYVA 1E7VA 3CHSA 1B89A 4GPMA 4CEMA 3ZYLA 1H0AA 4TXPA 1ELRA 3Q4AB 2V4LA 4KT6B 3EHRA 3NOCD 2QYUA 3V30A 4A1SA 2J08A 2ONDA 3E32A 1JPLA 3L16A 1H19A 5EX3A 3FTSA 2FEZA 5KWDA 1UOHA 2KCKA 2WXOA 4LSZE 1OXJA 2WXRA 1E8WA 3G2SA 5BW8C 4KMOA 2XEEA 3WG7E 2ILRA 1HH8A 2ZU6B 4KVOA 1TN6A 3PZDA 1TJFA 4AIFA 3FUHA 4B89A 4Q69A 3IHYA 2C2LA 3SY2A 4C0MA 2VJ8A 4UI9C 4M3OA 3JXIA 1OT8A 4G11A 1EPUA 4I2WA 1MZCA 3Q49B 1FVHA 4URKA 3UPVA 3DSVA 5CCLA 3FUDA 4DRXE 4YVQC 4U8VD 3TWSA 2DZNA 3GW4A 3UUXA 4UQZA 3CIAA 3PNTB 5CHEE 1FPPA 1HG2A 3CVYA 4WUYA 2LXMA 4HQDA 2OOEA 3MV3B 3DSTA 4NQ0A 2J8SD 2P9UG 5C2YA 3S7BA 3TJPA 3SZ7A 3DEOA 4XX5A 3S7DA 1N94A 3PE4A 2HO1A 2DCPA 3L22A 4TXRA 5AQ9A 4GMLA 2Y0BG 3TWRA 2LXLA 2IFUA 1YYHA 3E33A 4YNDA 3HXCA 2L0TB 3EHMA 5EYLA 4HORA 2XEHA 2XEVA 3L9TA 1NFIE 2XS8A 4F1PA 5G05C 4Q96A 1H2TC 3CK8A 3JYSA 4XKBA 1OWMA 5KJMA 1HG5A 2HR2A 2Y4TA 4GA0A 3ZYQA 1O5MA 3PUJA 4DPRA 3ONLA 3ZGQA 2P9KG 5AAOA 4U07A 4ATZD 3LDZA 1YMPA 2QYJA 3P2BA 1BI7B 4L23A 1WAO1 1D9SA 1V55E 1XGWA 3SF4A 3FULA 4MKTA 4MBGA 4HLLA 1HXIA 5ARGA 3JXJA 4J8DA 2PM6A 5KJNA 4HB5A 3Q75A 1N0QA 5G2NA 1TNOA 3QOUA 3SO8A 3TGOA 2J4DA 2WXFA 3NB2A 3PEUB 4ME2A 4UUCA 4PDXA 2X6KA 3ML8A 3Q78A 3FUIA 5D0QD 3QAQA 4KZCA 4GCOA 5B1BE 1S70B 3U3WA 2XGSA 2EIKE 3CVQA 2WXGA 4BX8A 2LAIA 3TXNA 3UI2A 3GYZA 2WXQA 3HHMA 2JLBA 3ULQA 1TN8A 2NSZA 5KNHD 4TRQA 5ANRA 1HFAA 4CGVA 1V54E 3Q5MA 4GZ3A 2WPVA 4Q94A 4GMRA 2Y4UA 2IOSA 4JPSA 3B7SA 5LCWJ 3LY9A 4JZYA 1D8EA 1SVXA 2RKKA 2DVWA 3EHNA 5DBKA 4FJZA 2J07A 2RG8A 4FJYA 3AS4A 3SHFA 1O1TA 3BUAA 4ANUA 4AXHA 1U3CA 3MCXA 3QJZA 3OXGA 4B8CB 1GW6A 1W3BA 2B6CA 3D9JA 1QYMA 1MQSA 1KT0A 3SBSA 1O1RA 4F1SA 5AQBA 3V2OA 2PQRA 4G24A 4U04A 2FULA 1TR4A 3Q9UC 4B93B 1E96B 1K1BA 5D66A 3SBTB 4PUCA 3GZSA 4BFRA 3FTUA 1L5JA 4UWFA 3UM1A 4PS3A 2EIJE 5T4YA 2LNIA 2QC9A 1MX6A 4KVMA 3I5PA 4FP7A 1OCZE 4XI0A 4J8SA 4GMJA 2JABA 3BQOA 4BTBA 3DRAA 3CHRA 3LY7A 2FO1E 2MHKA 3LYAA 3D9KA 4CYMD 4ANXA 2FF4A 2IU1A 3L08A 2WQ6A 3HXFA 4HXIA 4RG9A 2XHEA 1TN7A 3DPYA 1N4SA 2LO6A 4O6FA 1H6PA 3KEZA 2XCBA 2JEKA 4GZ5A 4TV3A 1FCHA 2LUHA 2P2CP 1N0RA 4NIKA 3LVQE 2X6FA 4HOTA 4XIFA 2RD0A 3V2XA 3HDXA 2ZXWE 3L54A 3UTMA 3L17A 1D8DA 3UT8A 3ESLA 4I9EA 3TG5A 4GTMA 2PL2A 3LJ3A 2M63A 2KZTB 4DLQA 5AQ7A 1K3ZD 2L9BA 5AYWD 4ILGA 3FTZA 5ANLA 5CECB 2YINA 4G2VA 2ZGDA 3CSTA 3SFXA 3D9LA 4FULA 4JHKA 1Z3YA 4JEUA 3O4ZA 3PRZA 3QWPA 4JD2G 4FLBA 2OV8A 3QB2A 1QQEA 1UN9A 3DWLG 2AXVA 2DIWA 4O1PA 3Q15A 1FVFA 2WXNA 3AG1E 1NA0A 3C3OA 4U0UA 2Y69E 1PAQA 4ZFHA 3ZEFA 3HG0D 4G8LA 5CBOA 4ILIA 3ZVVA 3FUFA 2ZIRA 5E76A 1K8KG 5IY5E 3CHMA 1ZB1A 5BUZA 2J09A 2X6JA 3NBNB 1E7UA 4K03A 3MJWA 4F7AA 2VGYA 2LAHA 3NF1A 3G2UA 5ARFA 4FLHA 5HS0A 4DI3A 1LD7A 3U66A 3U64A 3UM2A 3ULEG 4TUMA 2KBXA 3CKBA 4J7WA 1HZ4A 1E8YA 2WXJA 3DXMG 2HE0A 4V3IA 2GRMA 1AWCB 5FQ4A 1X5BA 3L6AA 5AIJA 2WXPA 4BERA 2P9PG 2IO3C 5FWQA 4M7CA 2KC7A 3R7QA 3T9KA 4GAAA 3UX4A 2L6JA 2ZISA 3HIZA 2I1JA 4XI9A 4J8YA 3OXFA 1OCCE 1N54A 1XNFA 3ZFWA 3AAAC 3FTYA 3JQ0A 2IQCA 2CFUA 3J5QB 4MS6A 4O60A 2PZIA 3DBSA 4I17A 4CDRA 4UI9K 3CVPA 4NACA 4ACLA 1N4PA 3QDNA 3ULYA 5CEAA 2PM7A 3LKUA 2XQ0A 2XGOA 2EQXA 3Q7FA 4BY6A 5AQAA 3TWTA 1NI1A 2BF0X 1E8ZA 2IONA 3X2QE 3FY4A 4U95D 3MX3A 3L13A 3S2AA 3ASHA 1NL4A 4QQIA 2VTBA 5T8IA 3B7BA 3FTWA 4A3TA 3FHEA 3PREA 4AY6A 5AENA 3LPZA 3QARA 4IN3B 4HRLA 2CFZA 3FWVA 5CCMA 4GYWA 1MHQA 2XS1A 5FIOA 3IEGA 5LFAA 3D9HA 4OAUC 1IQRA 4FA6A 4CT4A 5EIDA 3B7TA 2XRYA 5FJYA 4N2QA 2YQ8A 1Y8MA 3PZ4A 2OEWA 2VTBB 1OWNA 3D9MA 1Z5SC 1BLXB 3I3NA 1IKND 3FUEA 3EUVA 4I6GA 2PNNA 3ZRHA 2ETAA 5AN8A 4XKCA 2EINE 3ASOE 4ATGA 4K5BA 3EIJA 3ISMC 2P58C 4HS2A 3ZHEA 4GZDA 4U96D 2NC9A 3CK7A 1HU3A 1TNBA 3ZW3A 1K1AA 2V5QC 4OYSA 4LNBA 3URZA 1HE8A 3CK9A 1BU9A 5FT9A 4G26A 3D9PA 4F3VA 2P9NG 4EZLA 4XZ4A 4EBAA 2J4BA 2WMNA 4PH4B 3SQVA 3NZSA 2F37A 2XCCA 1A17A 4DX7D 3G2TA 5HI7A 4EBAG 4G8KA 3D9OA 4ILHB 4N39A 4DI4A 1HO8A 1H2UA 5EKQD 4WWOA 3ZHEB 3E30A 5ENSD 4JXTA 1NZNA 4J0UA 3OXLA 5JJ6A 4EHMA 1DC2A 4P29A 3K9IA 3ENEA 3MGBA 4LRZA 1JCRA 3VTYA 2YHCA 2GRRB 3FTVA 3FH5A 4RVBA 3V31A 4GZCA
chains in the Genus database with same CATH topology
2I6HA 3S7JA 4BT9A 3TL5A 4GU5A 4DK5A 2I2OA 3FTXA 1H2VC 1TEZA 2NXPA 3QNKA 1UG3A 4KVMA 3Q47B 3GZ1A 3CLJA 3I5PA 3D9NA 3IHVA 4FP7A 4ACKA 4CDNA 5A23A 1ELWA 5LOZA 4XI0A 4J8SA 4UQXA 4GMJA 3QKYA 5BNWA 4JA9A 2X38A 4L2YA 4AVXA 4BTBA 1E90A 2IF4A 3CHRA 3LY7A 4DLOA 5G04C 4GB9A 2MOWA 5JHBA 5JJ7A 3MKQA 2MHKA 4EPZA 4GA1A 4A1SA 1SQMA 1JWFA 5LCWC 3AU4A 3LYAA 4JVSA 3LS8A 3FUKA 4UI9J 3D9KA 4APFA 3LXUX 3RRUA 3D3MA 4ANXA 1YA0A 2FF4A 3IKOB 2IU1A 3L08A 3UQ3A 2WXHA 5LX8A 2WQ6A 4HOSA 3RIBA 3UT7A 2QFCA 4BT8A 3KS2A 1DVPA 4JL0A 3PNLB 3APDA 4G25A 4N5CA 3RJVA 4KBQA 4JW1A 3VLEA 4JC8A 3ASFA 3ASDA 4HXIA 2X3MA 4RG9A 3T5XA 4NRHB 4A3VA 1P5QA 1ELKA 4TUUA 5FQ6A 1EDUA 2AXUA 3CEQA 3JCKC 3RU0A 4E6HA 2XHEA 3NZUA 3CVUA 4GPKA 4UWGA 3LY8A 3MKRA 1PY1A 1S0PA 5BPPA 2LO6A 4O6FA 4U0SA 2WMOA 2XCBA 3KEZA 1U3DA 4Y6CA 3ZXSA 4E85A 1JWGA 4LUNU 2JEKA 1IQUA 3UMVA 4MLPA 4UQYA 4GZ5A 5A7DB 4U8HA 3BG0B 3CHPA 1FCHA 3FFLA 4TV3A 4K0RA 1NA3A 4I1MA 4BSXA 3MKQB 3E4BA 2WQHA 2QY7A 3FU5A 3LVQE 2MRIA 2CG3A 2WVIA 4EZKA 3ZYKA 2X6FA 3PVLA 3RRNB 4L2LA 4I6JA 3OTNA 3CVXA 4HOTA 2R17C 4XIFA 3ZN3A 2RD0A 2XPIA 4I1AA 5KCMA 3MYVA 3HDXA 1E7VA 3CHSA 3JQ1A 5EDSA 1B89A 5J90A 5JJTA 2KM4A 4I1OB 4BTAA 4CEMA 3SI5A 3ZYLA 5M72A 3L54A 1H0AA 2CHZA 1ELRA 3Q4AB 4HFGA 2V4LA 4KT6B 3L17A 4I9CA 3CKCA 5BT1A 3UT8A 3ESLA 4I9EA 4G23A 4XE0A 3TG5A 1SZ9A 2J08A 2PL2A 4WNEA 3LJ3A 2M63A 3FUJA 3B13A 3FUMA 2KZTB 4DLQA 2ONDA 1JPLA 3L16A 4HLEA 2L9BA 5AYWD 1H19A 5EX3A 3FTSA 4JHRA 4ILGA 2FEZA 2KCKA 3FTZA 2WXOA 5ANLA 2C0LA 2LSVA 2WXRA 2YINA 3MZLB 1OWPA 4FC8A 3CSTA 4G2VA 3RKVA 3CV0A 1E8WA 2WXKA 3BG1B 3ZPJA 3D9LA 3G2SA 3B7RL 4U0ZA 5BW8C 4FULA 3VLFA 4JHKA 4H7XA 4KMOA 5AJDA 1Z3YA 2HM8A 2ILRA 1JUQA 4IYPA 2A4ZA 3FP3A 3CVVA 3C98A 1HH8A 1UN8A 4BWRA 3OAWA 2ZU6B 4JEUA 3O4ZA 3PRZA 3QWPA 4KVOA 3TG4A 3FDHA 3PZDA 5G05J 1TJFA 4FLBA 2OV8A 3PEVB 3QB2A 4U63A 4AM9A 5HQ8A 4AIFA 3FUHA 4B89A 4Q69A 1QQEA 3B7UX 3EIQC 1UN9A 1Y6IA 2AXVA 2C2LA 2WXIA 2AWIA 3IHYA 4YVOA 2DIWA 5FTPA 4C0MA 2VJ8A 4KXKB 4UI9C 3AS5A 3Q15A 5FZSA 4WNDA 1FVFA 4JHJA 4M3OA 2WXNA 4G11A 3TAXA 3CVLA 1NA0A 1EPUA 2WM9A 4I2WA 4U0UA 4BX9A 1PAQA 3SFZA 4R7LA 4I43A 3FH7A 3ONKA 1FVHA 3Q49B 3ZEFA 4EZJA 3ESKA 4URKA 3UPVA 4ILIA 2V0PA 4C9BB 3ZVVA 1PC2A 3FUFA 4GZ6A 5CCLA 3FUDA 5LP0A 1HF8A 5FQ7A 4YVQC 5KJLA 5T3RA 5E76A 4NURA 3CHMA 3GW4A 3ASGA 5E75A 3UUXA 5CMWA 4UQZA 5BUZA 2J09A 2X6JA 3FEYA 1E7UA 3CIAA 3IV0A 3PNTB 5CHEE 4F53A 4K03A 3MJWA 2GGFA 4F7AA 2GW1A 5D0OD 2VGYA 2LAHA 4GYOA 3NF1A 5JHAA 2UY1A 3PS6A 3MEKA 1QZ2A 5C1DA 4L1BA 4D10C 4CGWA 2AVPA 1HG2A 3CVYA 3HVEA 1KT1A 3G2UA 5ARFA 4WNGA 4WUYA 1E8XA 4FLHA 4DI3A 2KATA 5FQ8A 3U66A 3R9AB 1UJKA 2VGXA 2OOEA 3G2WA 3U64A 3MV3B 3ZYMA 4NQ0A 3BEEA 2E2EA 5C2YA 2VYIA 3S7BA 3CKBA 3TJPA 3SZ7A 4XX5A 1HZ4A 1E8YA 3S7DA 3PUKA 4AP2A 2WXJA 4RG6A 3PE4A 3DPDA 1IYGA 3FEXA 3CHQA 2HO1A 2DCPA 3CQGB 3L22A 1NP7A 2WB2A 4GMLA 3APCA 3SGHA 4V3IA 2GRMA 3CSFA 2AXZA 5DIZA 5FQ4A 1X5BA 3L6AA 5AIJA 3KAEA 2WXPA 1WY6A 4UWHA 3T5VA 2CHXA 4JEHA 4A1GA 2UY1B 2IFUA 4MRUA 3FU6A 4YNDA 4RSYA 2L0TB 3EHMA 1OWLA 5A6CA 4HORA 2VQ2A 4ANVA 3HVEB 4N2SA 5FWQA 2KC7A 4AY5A 3R7QA 4GAAA 4N3BA 2XEVA 4FADA 3UX4A 2VGXB 5G05C 3VLDA 4Q96A 1H2TC 3CK8A 3JYSA 4XKBA 4DJAA 2VSNA 1OWMA 1UJJA 2BUGA 2L6JA 3MV2B 3QC1A 3HIZA 2LSUA 5KJMA 1HG5A 2FBNA 2I1JA 2L0IA 2HR2A 4ANWA 4XI9A 2J49A 3OXFA 4KZ0A 2CG2A 2KCLA 1N54A 1XNFA 2WXMA 2FO7A 2I1KA 2Y4TA 4GA0A 3WXXA 3ZFWA 3ZYQA 3PUJA 3FTYA 4DPRA 3FUNA 3ML9A 3ONLA 3RK6A 4L7TA 3ZGQA 3JQ0A 2IQCA 4AV7A 2CFUA 1IHGA 4MS6A 3SNXA 4U07A 4JA7A 4I6EA 4N3AA 3LDZA 3P2BA 2VSXE 4W9RA 2PZIA 3DBSA 4I17A 4CDRA 2C0MA 4OVVA 4UI9K 2XGMA 3CVPA 1WAO1 1ZBPA 3O48A 4L23A 4NACA 4OVUA 4UWLA 3RO3A 3QDNA 4ACLA 4A55A 4J8EA 2PM7A 3LKUA 2IJGX 2XQ0A 1XGWA 5FZRA 3AS8A 3SF4A 2VSYA 2XGOA 2EQXA 3FULA 3FH8A 4BY6A 4MKTA 3CVNA 1HXIA 3I4GA 4H7YA 2BF0X 5ARGA 4HOUA 2WQ7A 1E8ZA 4I2ZA 2IONA 3FY4A 5BV1A 2X6HA 3GZ2A 4J8DA 3MX3A 3L13A 3S2AA 2PM6A 3U4TA 5G55A 3ASHA 5KJNA 1KLXA 3VTXA 5G2NA 1SZAA 2VTBA 3QOUA 4C0EA 2PQNA 2OVFA 4HVBA 3TGOA 2J4DA 2E0IA 2CHWA 2WXFA 5T8IA 3FTWA 4A3TA 3FHEA 3FU0A 3PREA 3T8MA 3PEUB 3N71A 4AY6A 4IULA 4ME2A 5ENNA 4PDXA 2X6KA 3G2VA 3ML8A 3NQPA 4EQFA 3FUIA 5AENA 5D0QD 2VSOE 3CR3A 3LPZA 3QAQA 4KZCA 3QARA 4IN3B 4GCOA 2CFZA 3FWVA 4J8FA 5CCMA 3U3WA 4GYWA 4N3CA 3EDTB 2XGSA 3CVQA 1Z3XA 2WXGA 1MHQA 4BX8A 1DNPA 2LAIA 2HYZA 3IEGA 5LFAA 3TXNA 5CMYA 1IQRA 4J6IA 5EX0A 3GYZA 2WXQA 3CQCB 3HHMA 4FA6A 2XRZA 2JLBA 3ULQA 5FZQA 4CT4A 3B7TA 2XRYA 3FU3A 2J9QA 3CHOA 4WAFA 5FJYA 3JUIA 2YQ8A 4HOQA 4PS7A 3TXMA 1Y8MA 4N2QA 2VTBB 4KYOB 2AW6A 3CVWA 1OWNA 3D9MA 1BPOA 3I3NA 4B0ZA 2NSZA 4AOFA 3FUEA 2R5SA 4I6GA 2V5FA 2FI7A 3ZRHA 1ZU2A 4TRQA 2IOLA 3LEWA 5ANRA 4CCAA 3HYMB 1HFAA 4CGVA 4XKCA 3CGHA 1OUVA 3Q5MA 4GZ3A 4ATGA 5G04J 4WWNA 2WPVA 3EIJA 4Q94A 2Y4UA 2P58C 2DBAA 2IOSA 4HS2A 4JPSA 3ZHEA 2KZTA 3B7SA 4GZDA 5LCWJ 2NC9A 1TJCA 1INZA 3LY9A 1H6KA 2WXLA 3CK7A 4JZYA 3RRMB 2UWJG 1EF1C 4GYYA 2V8SE 3IBEA 4CRWA 1HU3A 2Q7FA 2XPYA 3ZW3A 4CDMA 4OYSA 4AJWA 2R59A 3EHNA 3SD5A 2OVBA 3URZA 5BV0A 5KJKA 1HE8A 3CK9A 5DBKA 4FJZA 2XPZA 2J07A 2RG8A 4WNFA 4WWPA 4FJYA 5FT9A 4EECA 2GRLA 3MA5A 3P1UA 3AS4A 4G26A 3SHFA 3D9PA 3EJNA 4F3VA 1LF8A 1UW4B 4EZLA 4XZ4A 4ANUA 3PH0C 4EBAA 2J4BA 2WMNA 4PH4B 4AXHA 1U3CA 2Y3AA 3MCXA 3I4RB 3NZSA 3QJZA 3OXGA 2XCCA 4LEUA 1Z6TA 4APOA 1A17A 4AEZC 4B8CB 3G2TA 4PS8A 1GW6A 5AJLA 3R7RA 1QNFA 5HI7A 1W3BA 3AU5A 4FU3A 4EBAG 3U9WA 3D9OA 3D9JA 4Y6WA 4ILHB 4N39A 4GCNA 2BTDA 4DI4A 2YHEA 4ABNA 1HO8A 4LERA 4UWKA 1H2UA 2YNQA 5EKQD 1MQSA 4WWOA 1HX8A 3PE3A 3RO2A 1N52A 3ZHEB 1KT0A 2I9CA 4LCTA 3SBSA 4F1SA 4JXTA 1NZNA 4J0UA 2A5UA 3D9IA 2PQRA 3OXLA 3LVRE 3PDNA 3QWVA 1EYHA 5JJ6A 4G24A 2KCVA 4IRUA 2FULA 4P29A 4U04A 3K9IA 1E96B 4B94A 3ENEA 1WM5A 3MGBA 4FHKA 4B8AA 3S7FA 2X6IA 3SBTB 4LRZA 3VTYA 2YHCA 5J08A 4PUCA 3GZSA 3QK0A 3ZIMA 4BFRA 4CT0A 3FTUA 3LCAA 3UT4A 4GA2A 1L5JA 3FTVA 4UWFA 4G1TA 4QFVA 1HS6A 4PS3A 3FH5A 3KD7A 3APFA 4RVBA 1OWOA 3QWWA 5T4YA 4GZCA 1VDYA 4FHJA 2LNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6H A;  3S7J A;  4BT9 A;  3Q47 B;  3GZ1 A;  1ELW A;  4XI0 A;  4UQX A;  3QKY A;  5BNW A;  4JA9 A;  4BTB A;  2IF4 A;  3LY7 A;  5G04 C;  5JJ7 A;  2MHK A;  4GA1 A;  5LCW C;  3LYA A;  4UI9 J;  1YA0 A;  2FF4 A;  3UQ3 A;  4HOS A;  3RIB A;  2QFC A;  4BT8 A;  3KS2 A;  4JL0 A;  4G25 A;  4N5C A;  3RJV A;  4KBQ A;  3ASF A;  3ASD A;  4RG9 A;  4NRH B;  1P5Q A;  3CEQ A;  3RU0 A;  4GPK A;  3LY8 A;  3MKR A;  4O6F A;  4U0S A;  2XCB A;  4Y6C A;  4UQY A;  4GZ5 A;  5A7D B;  1FCH A;  3FFL A;  1NA3 A;  3E4B A;  2WQH A;  4HOT A;  4XIF A;  3ZN3 A;  2XPI A;  4I1A A;  1B89 A;  5JJT A;  4BTA A;  5M72 A;  1ELR A;  3Q4A B;  4I9C A;  3CKC A;  5BT1 A;  4A1S A;  4I9E A;  4G23 A;  3TG5 A;  2PL2 A;  4WNE A;  2OND A;  5AYW D;  5EX3 A;  4JHR A;  2FEZ A;  2KCK A;  2C0L A;  2LSV A;  4G2V A;  3RKV A;  3CV0 A;  3ZPJ A;  4U0Z A;  5BW8 C;  4H7X A;  3FP3 A;  1HH8 A;  4BWR A;  3TG4 A;  3QWP A;  5G05 J;  4AM9 A;  5HQ8 A;  4AIF A;  1QQE A;  2C2L A;  4YVO A;  5FTP A;  4KXK B;  4UI9 C;  3AS5 A;  3Q15 A;  5FZS A;  4WND A;  3TAX A;  3CVL A;  1NA0 A;  4I2W A;  4U0U A;  3Q49 B;  3ESK A;  3UPV A;  1PC2 A;  4GZ6 A;  5CCL A;  4YVQ C;  5KJL A;  3GW4 A;  3ASG A;  3UUX A;  4UQZ A;  5CHE E;  2GW1 A;  5D0O D;  2VGY A;  4GYO A;  3NF1 A;  2UY1 A;  3MEK A;  1QZ2 A;  5C1D A;  4CGW A;  2AVP A;  1KT1 A;  5ARF A;  4WNG A;  4WUY A;  2KAT A;  3R9A B;  2VGX A;  2OOE A;  3MV3 B;  4NQ0 A;  3BEE A;  2E2E A;  3S7B A;  2VYI A;  3CKB A;  3SZ7 A;  1HZ4 A;  3S7D A;  4RG6 A;  3PE4 A;  1IYG A;  2HO1 A;  5DIZ A;  3KAE A;  2UY1 B;  2IFU A;  4YND A;  4HOR A;  5A6C A;  2VQ2 A;  4N2S A;  2KC7 A;  4AY5 A;  4N3B A;  2XEV A;  2VGX B;  5G05 C;  3CK8 A;  3JYS A;  2VSN A;  2L6J A;  2BUG A;  3MV2 B;  2LSU A;  5KJM A;  2FBN A;  2HR2 A;  4XI9 A;  3OXF A;  2KCL A;  1XNF A;  2FO7 A;  2Y4T A;  3WXX A;  4GA0 A;  3ZFW A;  3ZGQ A;  1IHG A;  4U07 A;  4JA7 A;  4N3A A;  4W9R A;  2PZI A;  4I17 A;  4CDR A;  2C0M A;  4UI9 K;  2XGM A;  3CVP A;  1WAO 1;  1ZBP A;  3O48 A;  3RO3 A;  3QDN A;  4J8E A;  3LKU A;  5FZR A;  3AS8 A;  3SF4 A;  2VSY A;  2XGO A;  3CVN A;  1HXI A;  4H7Y A;  5ARG A;  4HOU A;  4I2Z A;  3GZ2 A;  4J8D A;  3U4T A;  3ASH A;  5KJN A;  1KLX A;  3VTX A;  3QOU A;  2PQN A;  3TGO A;  3N71 A;  4AY6 A;  4ME2 A;  4EQF A;  5D0Q D;  3LPZ A;  4IN3 B;  4GCO A;  3FWV A;  4J8F A;  5CCM A;  3U3W A;  4GYW A;  4N3C A;  3EDT B;  2XGS A;  3CVQ A;  2HYZ A;  3IEG A;  5EX0 A;  3GYZ A;  2JLB A;  3ULQ A;  5FZQ A;  2J9Q A;  5FJY A;  4HOQ A;  2YQ8 A;  4N2Q A;  1Y8M A;  4KYO B;  2R5S A;  2V5F A;  2FI7 A;  1ZU2 A;  3HYM B;  4CGV A;  1OUV A;  3Q5M A;  4GZ3 A;  5G04 J;  2WPV A;  2Y4U A;  2P58 C;  2DBA A;  3ZHE A;  5LCW J;  2NC9 A;  1TJC A;  3LY9 A;  3CK7 A;  2UWJ G;  4GYY A;  2Q7F A;  3URZ A;  5KJK A;  3CK9 A;  5DBK A;  4WNF A;  5FT9 A;  3MA5 A;  3AS4 A;  4G26 A;  4F3V A;  3OXG A;  2XCC A;  4LEU A;  4APO A;  1A17 A;  5HI7 A;  1W3B A;  4Y6W A;  4N39 A;  4GCN A;  4ABN A;  5EKQ D;  3PE3 A;  3RO2 A;  3ZHE B;  1KT0 A;  1NZN A;  4J0U A;  3OXL A;  3QWV A;  2PQR A;  5JJ6 A;  3PDN A;  4G24 A;  2KCV A;  4U04 A;  3K9I A;  1E96 B;  4B94 A;  1WM5 A;  3S7F A;  3VTY A;  2YHC A;  3LCA A;  4GA2 A;  4G1T A;  3KD7 A;  3QWW A;  2LNI A; 
#chains in the Genus database with same CATH topology
 2OCC E;  3DEP A;  4A63 B;  4GU5 A;  4DK5 A;  3FTX A;  3R9M A;  4ACK A;  2DWZ A;  4CDN A;  5A23 A;  1ELW A;  5LOZ A;  3QKY A;  4JA9 A;  2X38 A;  4AVX A;  4DLO A;  5G04 C;  4K5A B;  5JJ7 A;  2XZD G;  3NAW A;  4GA1 A;  4JVS A;  4UI9 J;  4APF A;  5LX8 A;  3DSS A;  4HOS A;  5EIB E;  2QFC A;  1DVP A;  4JL0 A;  3RJV A;  4KBQ A;  2BKG A;  4NRH B;  4YDO A;  5FQ6 A;  1EDU A;  3CEQ A;  3JCK C;  3MKR A;  1PY1 A;  1S0P A;  3HXE A;  4U0S A;  2WMO A;  4LUN U;  2KXP C;  3UMV A;  5A7D B;  3CHP A;  1NA3 A;  2QY7 A;  2AJA A;  3ZYK A;  3PVL A;  4L2L A;  4I6J A;  5BXU A;  2R17 C;  3TWU A;  2XPI A;  4CZ2 D;  1TNY A;  2BKK B;  5EDS A;  5J90 A;  4I1O B;  3SI5 A;  5M72 A;  2CHZ A;  4HFG A;  2EIL E;  1QBQ A;  1IXV A;  1SZ9 A;  3FUJ A;  3B13 A;  3PZ2 A;  3PZ3 A;  2DYS E;  2LSV A;  4FC8 A;  1OWP A;  3AJI A;  3RKV A;  3CV0 A;  2WXK A;  3ZPJ A;  4GTQ A;  1JUQ A;  3FP3 A;  4HI9 A;  2DZO A;  4DX6 D;  3OAW A;  4YDW A;  5G05 J;  1RW2 A;  4HRN A;  1JCQ A;  3B7U X;  3EIQ C;  2AWI A;  4KXK B;  3AS5 A;  4WND A;  4JHJ A;  1WDY A;  3CVL A;  2WM9 A;  4BX9 A;  3FH7 A;  3ONK A;  4EZJ A;  3ESK A;  4C9B B;  1PC2 A;  4GZ6 A;  5LP0 A;  1KPS B;  5FQ7 A;  5ENP D;  1SA5 A;  5T3R A;  5D2M C;  4NUR A;  5CMW A;  2GGF A;  1TYQ G;  2GW1 A;  4GTR A;  5JHA A;  3MEK A;  2IEJ A;  2AVP A;  3HVE A;  1KT1 A;  2VGX A;  3G2W A;  4O1O A;  3ZYM A;  2QZA A;  5JA4 D;  3DPD A;  3CHQ A;  3UM0 A;  3CQG B;  3Q79 A;  1NP7 A;  2WB2 A;  3APC A;  4UWH A;  1A5E A;  2GRP B;  4JEH A;  2L6B A;  4MRU A;  4RSY A;  5A6C A;  2VQ2 A;  4ANV A;  3HVE B;  4N2S A;  5H7P A;  1BD8 A;  4N3B A;  4FAD A;  2VGX B;  2VSN A;  1UJJ A;  2BUG A;  3MV2 B;  2LSU A;  2FBN A;  2L0I A;  1MJ0 A;  4KZ0 A;  1N9A A;  2CG2 A;  2KCL A;  2I1K A;  3WXX A;  2Y1L E;  3RK6 A;  3SNX A;  3EHQ A;  4JA7 A;  4I6E A;  4N3A A;  2VSX E;  2F8X K;  2XGM A;  1ZBP A;  3E34 A;  2ETC A;  3FH8 A;  3I4G A;  2R05 A;  5B3S E;  4HOU A;  5BV1 A;  3GZ2 A;  3C3R A;  4BSZ B;  4GTS A;  1MX4 A;  1DCQ A;  3HRA A;  2R03 A;  5ENN A;  3NQP A;  3G2V A;  4EQF A;  2VSO E;  3CR3 A;  2R2L A;  4J8F A;  4N3C A;  3EDT B;  1JCS A;  2EIM E;  2HYZ A;  1IHB A;  3UIP C;  3CHO A;  5FIN A;  3TXM A;  3JUI A;  4PS7 A;  2RFM A;  3JUE A;  1BPO A;  3ABK E;  3HXD A;  4B0Z A;  4AOF A;  5ENO D;  3ABL E;  1ZU2 A;  2IOL A;  3LEW A;  3HYM B;  3C72 A;  1H6O A;  2P9S G;  4U8Y D;  1TJC A;  1INZ A;  5EIL A;  4C48 B;  1EF1 C;  2V8S E;  2Q7F A;  2XPY A;  4CDM A;  2R59 A;  1FT1 A;  5BV0 A;  2H6H A;  2XPZ A;  4WNF A;  4WWP A;  3P1U A;  3MA5 A;  5CBN A;  1LF8 A;  1UW4 B;  4BET A;  5AJL A;  3R7R A;  3UIN C;  5HKP A;  3AU5 A;  5ENQ D;  1Q2Z A;  3U9W A;  4ABN A;  4LER A;  4UWK A;  3W9G A;  3PE3 A;  1N52 A;  5JMN D;  3SFZ A;  2A5U A;  3D9I A;  3LJN A;  3QWV A;  1N11 A;  3PDN A;  1EYH A;  3SFY A;  2KCV A;  4IRU A;  4FHK A;  4B8A A;  3S7F A;  2X6I A;  3NOG D;  3TWQ A;  5J08 A;  1KZO A;  3ZIM A;  5HRY A;  3LCA A;  3UT4 A;  4G1T A;  4QFV A;  3APF A;  3UXG A;  4DX1 A;  1SA4 A;  1VDY A;  4FHJ A;  2I6H A;  4BT9 A;  3TL5 A;  2NXP A;  3QNK A;  1UG3 A;  1G3N B;  3Q47 B;  4Z68 A;  4UQX A;  2RFA A;  2GRN B;  5BNW A;  4L2Y A;  1E90 A;  2IF4 A;  4GB9 A;  2MOW A;  5JHB A;  4EPZ A;  1SQM A;  5LCW C;  2H6F A;  3LS8 A;  3LXU X;  3RRU A;  2DYR E;  3UQ3 A;  4JB8 P;  3RIB A;  3UT7 A;  1AP7 A;  3KS2 A;  3PNL B;  4G25 A;  4N5C A;  2ETB A;  3ASD A;  2B0O E;  3ZXP A;  2X3M A;  4LNU D;  3UIO C;  1P5Q A;  1ELK A;  4E6H A;  2AXU A;  3NZU A;  4GPK A;  5BPP A;  4MLP A;  4UQY A;  3BG0 B;  3FFL A;  4K0R A;  2WQH A;  2CG3 A;  2WVI A;  4EZK A;  4BEP A;  3ZN3 A;  1S64 A;  1TNU A;  5KCM A;  3L82 A;  3UKU G;  3JQ1 A;  3UM3 A;  5JJT A;  2KM4 A;  4BTA A;  3DXK G;  3T8K A;  4I9C A;  3CKC A;  5BT1 A;  4G23 A;  4XE0 A;  4WNE A;  3FUM A;  4GTT A;  1OCO E;  4HLE A;  4JHR A;  4U7E B;  2ZGG A;  3Q73 A;  2C0L A;  3MZL B;  3BG1 B;  3B7R L;  4U0Z A;  3VLF A;  4H7X A;  5AJD A;  2HM8 A;  4IYP A;  3RSE G;  2A4Z A;  3RAU A;  3CVV A;  3C98 A;  1S63 A;  1UN8 A;  4BWR A;  1BI8 B;  3TG4 A;  3KSL A;  4LNG A;  3FDH A;  3PEV B;  4AM9 A;  4U63 A;  5HQ8 A;  1Y6I A;  2H6I A;  4BES A;  2WXI A;  4YVO A;  5FTP A;  4YDE A;  5FZS A;  1OCR E;  3TAX A;  4R7L A;  4I43 A;  4XEI G;  3V79 K;  4TXQ A;  2BED A;  2V0P A;  1HF8 A;  5EYP F;  1SW6 A;  5KJL A;  2IO2 C;  3ASG A;  5E75 A;  3BU8 A;  3FEY A;  2H6G A;  3IV0 A;  4F53 A;  3DSW A;  5D0O D;  1U2V G;  4GYO A;  2UY1 A;  1WG0 A;  3PS6 A;  4ZHB A;  1QZ2 A;  5C1D A;  4L1B A;  4D10 C;  4CGW A;  3TWX A;  1X81 A;  5CRV A;  4WNG A;  1N4Q A;  1E8X A;  3DSU A;  3ABM E;  5BXO A;  2KAT A;  5FQ8 A;  3R9A B;  1UJK A;  2GRQ B;  3BEE A;  3AG2 E;  2E2E A;  2VYI A;  2P9I G;  4YDY A;  3PUK A;  4AP2 A;  4RG6 A;  4RQI A;  1IYG A;  3FEX A;  2MYO A;  4HI8 A;  3SGH A;  3CSF A;  2AXZ A;  5DIZ A;  3KAE A;  1WY6 A;  3T5V A;  2CHX A;  4A1G A;  2UY1 B;  5ITZ F;  3FU6 A;  1OWL A;  4L9P A;  4AY5 A;  3W9F A;  3VLD A;  4DJA A;  2XEN A;  3QC1 A;  4ANW A;  2J49 A;  2FO7 A;  2WXM A;  1FT2 A;  3FUN A;  3ML9 A;  4L7T A;  3KSQ A;  4AV7 A;  1IHG A;  5ENT D;  4W9R A;  4N5Q A;  2C0M A;  3IXE A;  4OVV A;  2XRZ A;  5B1A E;  3O48 A;  4OVU A;  4UWL A;  4A55 A;  3ZU7 B;  4X8Q A;  4GTV A;  5ENR D;  3RO3 A;  4J8E A;  2IJG X;  5KBA A;  5FZR A;  3AS8 A;  2VSY A;  2P9L G;  3CVN A;  4H7Y A;  2WQ7 A;  4I2Z A;  2X6H A;  1N95 A;  2NYJ A;  1LTX A;  3U4T A;  5G55 A;  1KLX A;  3VTX A;  1SZA A;  4C0E A;  2PQN A;  2OVF A;  4HVB A;  2E0I A;  2CHW A;  3FU0 A;  3T8M A;  3N71 A;  4IUL A;  3ZUV B;  2F8Y A;  3DSX A;  1MYO A;  5CRU A;  3C3Q A;  4GTP A;  1Z3X A;  3EU5 A;  5EN5 D;  1DCE A;  1RZ4 A;  1DNP A;  5CMY A;  1MX2 A;  4J6I A;  5EX0 A;  3AG4 E;  3CQC B;  5FZQ A;  3FU3 A;  2J9Q A;  4WAF A;  3CVW A;  4HBD A;  4HOQ A;  4KYO B;  2AW6 A;  1TNZ A;  2R5S A;  2V5F A;  2FI7 A;  4CCA A;  3CGH A;  1OUV A;  5G04 J;  4WWN A;  3KEA A;  1N4R A;  2DBA A;  2KZT A;  1H6K A;  2WXL A;  3RRM B;  2UWJ G;  4GYY A;  4CRW A;  3IBE A;  3F6Q A;  3ZKJ A;  4AJW A;  3SD5 A;  5KJK A;  2OVB A;  3TWV A;  4K5C A;  5CER B;  3J5P A;  4EEC A;  2GRL A;  3EJN A;  1KZP A;  3UKR G;  2R02 A;  3PH0 C;  2V4H C;  2Y3A A;  3I4R B;  3ZNG A;  4LEU A;  1Z6T A;  4APO A;  4AEZ C;  4PS8 A;  1QNF A;  4FU3 A;  1O1S A;  2OEV A;  4Y6W A;  4GCN A;  2BTD A;  2YHE A;  4LG6 A;  3HXB A;  2A5E A;  2YNQ A;  1HX8 A;  3RO2 A;  2I9C A;  4LCT A;  4OAV B;  1LD8 A;  3Q7A A;  3LVR E;  2GRO B;  4B94 A;  1WM5 A;  2IY0 C;  3Q9N C;  3QK0 A;  4CT0 A;  4GA2 A;  1HS6 A;  3KD7 A;  4RLY A;  1OWO A;  3QWW A;  3PZ1 A;  3AG3 E;  3S7J A;  5AAR A;  3E37 A;  2I2O A;  1H2V C;  1TEZ A;  1OY3 D;  2F0Y A;  3GZ1 A;  3CLJ A;  3D9N A;  3IHV A;  5KNG A;  4HRM B;  4DX5 D;  3MKQ A;  1JWF A;  3AU4 A;  3FUK A;  3D3M A;  1YCS B;  3TWW A;  1YA0 A;  5CED B;  3IKO B;  2WXH A;  2XZT G;  4GTO A;  4HNA D;  4BT8 A;  3APD A;  4JW1 A;  3VLE A;  4JC8 A;  3ASF A;  3T5X A;  4A3V A;  4TUU A;  3RU0 A;  3CVU A;  4UWG A;  3LY8 A;  3EU9 A;  1U3D A;  4DX2 A;  4Y6C A;  3ZXS A;  4E85 A;  1JWG A;  3B95 A;  1IQU A;  4U8H A;  4BSX A;  4DUI A;  4I1M A;  3MKQ B;  3E4B A;  3FU5 A;  3ASN E;  2MRI A;  2VGE A;  3C5R A;  3RRN B;  3OTN A;  3CVX A;  4I1A A;  4F6R D;  3MYV A;  1E7V A;  3CHS A;  1B89 A;  4GPM A;  4CEM A;  3ZYL A;  1H0A A;  4TXP A;  1ELR A;  3Q4A B;  2V4L A;  4KT6 B;  3EHR A;  3NOC D;  2QYU A;  3V30 A;  4A1S A;  2J08 A;  2OND A;  3E32 A;  1JPL A;  3L16 A;  1H19 A;  5EX3 A;  3FTS A;  2FEZ A;  5KWD A;  1UOH A;  2KCK A;  2WXO A;  4LSZ E;  1OXJ A;  2WXR A;  1E8W A;  3G2S A;  5BW8 C;  4KMO A;  2XEE A;  3WG7 E;  2ILR A;  1HH8 A;  2ZU6 B;  4KVO A;  1TN6 A;  3PZD A;  1TJF A;  4AIF A;  3FUH A;  4B89 A;  4Q69 A;  3IHY A;  2C2L A;  3SY2 A;  4C0M A;  2VJ8 A;  4UI9 C;  4M3O A;  3JXI A;  1OT8 A;  4G11 A;  1EPU A;  4I2W A;  1MZC A;  3Q49 B;  1FVH A;  4URK A;  3UPV A;  3DSV A;  5CCL A;  3FUD A;  4DRX E;  4YVQ C;  4U8V D;  3TWS A;  2DZN A;  3GW4 A;  3UUX A;  4UQZ A;  3CIA A;  3PNT B;  5CHE E;  1FPP A;  1HG2 A;  3CVY A;  4WUY A;  2LXM A;  4HQD A;  2OOE A;  3MV3 B;  3DST A;  4NQ0 A;  2J8S D;  2P9U G;  5C2Y A;  3S7B A;  3TJP A;  3SZ7 A;  3DEO A;  4XX5 A;  3S7D A;  1N94 A;  3PE4 A;  2HO1 A;  2DCP A;  3L22 A;  4TXR A;  5AQ9 A;  4GML A;  2Y0B G;  3TWR A;  2LXL A;  2IFU A;  1YYH A;  3E33 A;  4YND A;  3HXC A;  2L0T B;  3EHM A;  5EYL A;  4HOR A;  2XEH A;  2XEV A;  3L9T A;  1NFI E;  2XS8 A;  4F1P A;  5G05 C;  4Q96 A;  1H2T C;  3CK8 A;  3JYS A;  4XKB A;  1OWM A;  5KJM A;  1HG5 A;  2HR2 A;  2Y4T A;  4GA0 A;  3ZYQ A;  1O5M A;  3PUJ A;  4DPR A;  3ONL A;  3ZGQ A;  2P9K G;  5AAO A;  4U07 A;  4ATZ D;  3LDZ A;  1YMP A;  2QYJ A;  3P2B A;  1BI7 B;  4L23 A;  1WAO 1;  1D9S A;  1V55 E;  1XGW A;  3SF4 A;  3FUL A;  4MKT A;  4MBG A;  4HLL A;  1HXI A;  5ARG A;  3JXJ A;  4J8D A;  2PM6 A;  5KJN A;  4HB5 A;  3Q75 A;  1N0Q A;  5G2N A;  1TNO A;  3QOU A;  3SO8 A;  3TGO A;  2J4D A;  2WXF A;  3NB2 A;  3PEU B;  4ME2 A;  4UUC A;  4PDX A;  2X6K A;  3ML8 A;  3Q78 A;  3FUI A;  5D0Q D;  3QAQ A;  4KZC A;  4GCO A;  5B1B E;  1S70 B;  3U3W A;  2XGS A;  2EIK E;  3CVQ A;  2WXG A;  4BX8 A;  2LAI A;  3TXN A;  3UI2 A;  3GYZ A;  2WXQ A;  3HHM A;  2JLB A;  3ULQ A;  1TN8 A;  2NSZ A;  5KNH D;  4TRQ A;  5ANR A;  1HFA A;  4CGV A;  1V54 E;  3Q5M A;  4GZ3 A;  2WPV A;  4Q94 A;  4GMR A;  2Y4U A;  2IOS A;  4JPS A;  3B7S A;  5LCW J;  3LY9 A;  4JZY A;  1D8E A;  1SVX A;  2RKK A;  2DVW A;  3EHN A;  5DBK A;  4FJZ A;  2J07 A;  2RG8 A;  4FJY A;  3AS4 A;  3SHF A;  1O1T A;  3BUA A;  4ANU A;  4AXH A;  1U3C A;  3MCX A;  3QJZ A;  3OXG A;  4B8C B;  1GW6 A;  1W3B A;  2B6C A;  3D9J A;  1QYM A;  1MQS A;  1KT0 A;  3SBS A;  1O1R A;  4F1S A;  5AQB A;  3V2O A;  2PQR A;  4G24 A;  4U04 A;  2FUL A;  1TR4 A;  3Q9U C;  4B93 B;  1E96 B;  1K1B A;  5D66 A;  3SBT B;  4PUC A;  3GZS A;  4BFR A;  3FTU A;  1L5J A;  4UWF A;  3UM1 A;  4PS3 A;  2EIJ E;  5T4Y A;  2LNI A;  2QC9 A;  1MX6 A;  4KVM A;  3I5P A;  4FP7 A;  1OCZ E;  4XI0 A;  4J8S A;  4GMJ A;  2JAB A;  3BQO A;  4BTB A;  3DRA A;  3CHR A;  3LY7 A;  2FO1 E;  2MHK A;  3LYA A;  3D9K A;  4CYM D;  4ANX A;  2FF4 A;  2IU1 A;  3L08 A;  2WQ6 A;  3HXF A;  4HXI A;  4RG9 A;  2XHE A;  1TN7 A;  3DPY A;  1N4S A;  2LO6 A;  4O6F A;  1H6P A;  3KEZ A;  2XCB A;  2JEK A;  4GZ5 A;  4TV3 A;  1FCH A;  2LUH A;  2P2C P;  1N0R A;  4NIK A;  3LVQ E;  2X6F A;  4HOT A;  4XIF A;  2RD0 A;  3V2X A;  3HDX A;  2ZXW E;  3L54 A;  3UTM A;  3L17 A;  1D8D A;  3UT8 A;  3ESL A;  4I9E A;  3TG5 A;  4GTM A;  2PL2 A;  3LJ3 A;  2M63 A;  2KZT B;  4DLQ A;  5AQ7 A;  1K3Z D;  2L9B A;  5AYW D;  4ILG A;  3FTZ A;  5ANL A;  5CEC B;  2YIN A;  4G2V A;  2ZGD A;  3CST A;  3SFX A;  3D9L A;  4FUL A;  4JHK A;  1Z3Y A;  4JEU A;  3O4Z A;  3PRZ A;  3QWP A;  4JD2 G;  4FLB A;  2OV8 A;  3QB2 A;  1QQE A;  1UN9 A;  3DWL G;  2AXV A;  2DIW A;  4O1P A;  3Q15 A;  1FVF A;  2WXN A;  3AG1 E;  1NA0 A;  3C3O A;  4U0U A;  2Y69 E;  1PAQ A;  4ZFH A;  3ZEF A;  3HG0 D;  4G8L A;  5CBO A;  4ILI A;  3ZVV A;  3FUF A;  2ZIR A;  5E76 A;  1K8K G;  5IY5 E;  3CHM A;  1ZB1 A;  5BUZ A;  2J09 A;  2X6J A;  3NBN B;  1E7U A;  4K03 A;  3MJW A;  4F7A A;  2VGY A;  2LAH A;  3NF1 A;  3G2U A;  5ARF A;  4FLH A;  5HS0 A;  4DI3 A;  1LD7 A;  3U66 A;  3U64 A;  3UM2 A;  3ULE G;  4TUM A;  2KBX A;  3CKB A;  4J7W A;  1HZ4 A;  1E8Y A;  2WXJ A;  3DXM G;  2HE0 A;  4V3I A;  2GRM A;  1AWC B;  5FQ4 A;  1X5B A;  3L6A A;  5AIJ A;  2WXP A;  4BER A;  2P9P G;  2IO3 C;  5FWQ A;  4M7C A;  2KC7 A;  3R7Q A;  3T9K A;  4GAA A;  3UX4 A;  2L6J A;  2ZIS A;  3HIZ A;  2I1J A;  4XI9 A;  4J8Y A;  3OXF A;  1OCC E;  1N54 A;  1XNF A;  3ZFW A;  3AAA C;  3FTY A;  3JQ0 A;  2IQC A;  2CFU A;  3J5Q B;  4MS6 A;  4O60 A;  2PZI A;  3DBS A;  4I17 A;  4CDR A;  4UI9 K;  3CVP A;  4NAC A;  4ACL A;  1N4P A;  3QDN A;  3ULY A;  5CEA A;  2PM7 A;  3LKU A;  2XQ0 A;  2XGO A;  2EQX A;  3Q7F A;  4BY6 A;  5AQA A;  3TWT A;  1NI1 A;  2BF0 X;  1E8Z A;  2ION A;  3X2Q E;  3FY4 A;  4U95 D;  3MX3 A;  3L13 A;  3S2A A;  3ASH A;  1NL4 A;  4QQI A;  2VTB A;  5T8I A;  3B7B A;  3FTW A;  4A3T A;  3FHE A;  3PRE A;  4AY6 A;  5AEN A;  3LPZ A;  3QAR A;  4IN3 B;  4HRL A;  2CFZ A;  3FWV A;  5CCM A;  4GYW A;  1MHQ A;  2XS1 A;  5FIO A;  3IEG A;  5LFA A;  3D9H A;  4OAU C;  1IQR A;  4FA6 A;  4CT4 A;  5EID A;  3B7T A;  2XRY A;  5FJY A;  4N2Q A;  2YQ8 A;  1Y8M A;  3PZ4 A;  2OEW A;  2VTB B;  1OWN A;  3D9M A;  1Z5S C;  1BLX B;  3I3N A;  1IKN D;  3FUE A;  3EUV A;  4I6G A;  2PNN A;  3ZRH A;  2ETA A;  5AN8 A;  4XKC A;  2EIN E;  3ASO E;  4ATG A;  4K5B A;  3EIJ A;  3ISM C;  2P58 C;  4HS2 A;  3ZHE A;  4GZD A;  4U96 D;  2NC9 A;  3CK7 A;  1HU3 A;  1TNB A;  3ZW3 A;  1K1A A;  2V5Q C;  4OYS A;  4LNB A;  3URZ A;  1HE8 A;  3CK9 A;  1BU9 A;  5FT9 A;  4G26 A;  3D9P A;  4F3V A;  2P9N G;  4EZL A;  4XZ4 A;  4EBA A;  2J4B A;  2WMN A;  4PH4 B;  3SQV A;  3NZS A;  2F37 A;  2XCC A;  1A17 A;  4DX7 D;  3G2T A;  5HI7 A;  4EBA G;  4G8K A;  3D9O A;  4ILH B;  4N39 A;  4DI4 A;  1HO8 A;  1H2U A;  5EKQ D;  4WWO A;  3ZHE B;  3E30 A;  5ENS D;  4JXT A;  1NZN A;  4J0U A;  3OXL A;  5JJ6 A;  4EHM A;  1DC2 A;  4P29 A;  3K9I A;  3ENE A;  3MGB A;  4LRZ A;  1JCR A;  3VTY A;  2YHC A;  2GRR B;  3FTV A;  3FH5 A;  4RVB A;  3V31 A;  4GZC A; 
#chains in the Genus database with same CATH homology
 2I6H A;  3S7J A;  4BT9 A;  3TL5 A;  4GU5 A;  4DK5 A;  2I2O A;  3FTX A;  1H2V C;  1TEZ A;  2NXP A;  3QNK A;  1UG3 A;  4KVM A;  3Q47 B;  3GZ1 A;  3CLJ A;  3I5P A;  3D9N A;  3IHV A;  4FP7 A;  4ACK A;  4CDN A;  5A23 A;  1ELW A;  5LOZ A;  4XI0 A;  4J8S A;  4UQX A;  4GMJ A;  3QKY A;  5BNW A;  4JA9 A;  2X38 A;  4L2Y A;  4AVX A;  4BTB A;  1E90 A;  2IF4 A;  3CHR A;  3LY7 A;  4DLO A;  5G04 C;  4GB9 A;  2MOW A;  5JHB A;  5JJ7 A;  3MKQ A;  2MHK A;  4EPZ A;  4GA1 A;  4A1S A;  1SQM A;  1JWF A;  5LCW C;  3AU4 A;  3LYA A;  4JVS A;  3LS8 A;  3FUK A;  4UI9 J;  3D9K A;  4APF A;  3LXU X;  3RRU A;  3D3M A;  4ANX A;  1YA0 A;  2FF4 A;  3IKO B;  2IU1 A;  3L08 A;  3UQ3 A;  2WXH A;  5LX8 A;  2WQ6 A;  4HOS A;  3RIB A;  3UT7 A;  2QFC A;  4BT8 A;  3KS2 A;  1DVP A;  4JL0 A;  3PNL B;  3APD A;  4G25 A;  4N5C A;  3RJV A;  4KBQ A;  4JW1 A;  3VLE A;  4JC8 A;  3ASF A;  3ASD A;  4HXI A;  2X3M A;  4RG9 A;  3T5X A;  4NRH B;  4A3V A;  1P5Q A;  1ELK A;  4TUU A;  5FQ6 A;  1EDU A;  2AXU A;  3CEQ A;  3JCK C;  3RU0 A;  4E6H A;  2XHE A;  3NZU A;  3CVU A;  4GPK A;  4UWG A;  3LY8 A;  3MKR A;  1PY1 A;  1S0P A;  5BPP A;  2LO6 A;  4O6F A;  4U0S A;  2WMO A;  2XCB A;  3KEZ A;  1U3D A;  4Y6C A;  3ZXS A;  4E85 A;  1JWG A;  4LUN U;  2JEK A;  1IQU A;  3UMV A;  4MLP A;  4UQY A;  4GZ5 A;  5A7D B;  4U8H A;  3BG0 B;  3CHP A;  1FCH A;  3FFL A;  4TV3 A;  4K0R A;  1NA3 A;  4I1M A;  4BSX A;  3MKQ B;  3E4B A;  2WQH A;  2QY7 A;  3FU5 A;  3LVQ E;  2MRI A;  2CG3 A;  2WVI A;  4EZK A;  3ZYK A;  2X6F A;  3PVL A;  3RRN B;  4L2L A;  4I6J A;  3OTN A;  3CVX A;  4HOT A;  2R17 C;  4XIF A;  3ZN3 A;  2RD0 A;  2XPI A;  4I1A A;  5KCM A;  3MYV A;  3HDX A;  1E7V A;  3CHS A;  3JQ1 A;  5EDS A;  1B89 A;  5J90 A;  5JJT A;  2KM4 A;  4I1O B;  4BTA A;  4CEM A;  3SI5 A;  3ZYL A;  5M72 A;  3L54 A;  1H0A A;  2CHZ A;  1ELR A;  3Q4A B;  4HFG A;  2V4L A;  4KT6 B;  3L17 A;  4I9C A;  3CKC A;  5BT1 A;  3UT8 A;  3ESL A;  4I9E A;  4G23 A;  4XE0 A;  3TG5 A;  1SZ9 A;  2J08 A;  2PL2 A;  4WNE A;  3LJ3 A;  2M63 A;  3FUJ A;  3B13 A;  3FUM A;  2KZT B;  4DLQ A;  2OND A;  1JPL A;  3L16 A;  4HLE A;  2L9B A;  5AYW D;  1H19 A;  5EX3 A;  3FTS A;  4JHR A;  4ILG A;  2FEZ A;  2KCK A;  3FTZ A;  2WXO A;  5ANL A;  2C0L A;  2LSV A;  2WXR A;  2YIN A;  3MZL B;  1OWP A;  4FC8 A;  3CST A;  4G2V A;  3RKV A;  3CV0 A;  1E8W A;  2WXK A;  3BG1 B;  3ZPJ A;  3D9L A;  3G2S A;  3B7R L;  4U0Z A;  5BW8 C;  4FUL A;  3VLF A;  4JHK A;  4H7X A;  4KMO A;  5AJD A;  1Z3Y A;  2HM8 A;  2ILR A;  1JUQ A;  4IYP A;  2A4Z A;  3FP3 A;  3CVV A;  3C98 A;  1HH8 A;  1UN8 A;  4BWR A;  3OAW A;  2ZU6 B;  4JEU A;  3O4Z A;  3PRZ A;  3QWP A;  4KVO A;  3TG4 A;  3FDH A;  3PZD A;  5G05 J;  1TJF A;  4FLB A;  2OV8 A;  3PEV B;  3QB2 A;  4U63 A;  4AM9 A;  5HQ8 A;  4AIF A;  3FUH A;  4B89 A;  4Q69 A;  1QQE A;  3B7U X;  3EIQ C;  1UN9 A;  1Y6I A;  2AXV A;  2C2L A;  2WXI A;  2AWI A;  3IHY A;  4YVO A;  2DIW A;  5FTP A;  4C0M A;  2VJ8 A;  4KXK B;  4UI9 C;  3AS5 A;  3Q15 A;  5FZS A;  4WND A;  1FVF A;  4JHJ A;  4M3O A;  2WXN A;  4G11 A;  3TAX A;  3CVL A;  1NA0 A;  1EPU A;  2WM9 A;  4I2W A;  4U0U A;  4BX9 A;  1PAQ A;  3SFZ A;  4R7L A;  4I43 A;  3FH7 A;  3ONK A;  1FVH A;  3Q49 B;  3ZEF A;  4EZJ A;  3ESK A;  4URK A;  3UPV A;  4ILI A;  2V0P A;  4C9B B;  3ZVV A;  1PC2 A;  3FUF A;  4GZ6 A;  5CCL A;  3FUD A;  5LP0 A;  1HF8 A;  5FQ7 A;  4YVQ C;  5KJL A;  5T3R A;  5E76 A;  4NUR A;  3CHM A;  3GW4 A;  3ASG A;  5E75 A;  3UUX A;  5CMW A;  4UQZ A;  5BUZ A;  2J09 A;  2X6J A;  3FEY A;  1E7U A;  3CIA A;  3IV0 A;  3PNT B;  5CHE E;  4F53 A;  4K03 A;  3MJW A;  2GGF A;  4F7A A;  2GW1 A;  5D0O D;  2VGY A;  2LAH A;  4GYO A;  3NF1 A;  5JHA A;  2UY1 A;  3PS6 A;  3MEK A;  1QZ2 A;  5C1D A;  4L1B A;  4D10 C;  4CGW A;  2AVP A;  1HG2 A;  3CVY A;  3HVE A;  1KT1 A;  3G2U A;  5ARF A;  4WNG A;  4WUY A;  1E8X A;  4FLH A;  4DI3 A;  2KAT A;  5FQ8 A;  3U66 A;  3R9A B;  1UJK A;  2VGX A;  2OOE A;  3G2W A;  3U64 A;  3MV3 B;  3ZYM A;  4NQ0 A;  3BEE A;  2E2E A;  5C2Y A;  2VYI A;  3S7B A;  3CKB A;  3TJP A;  3SZ7 A;  4XX5 A;  1HZ4 A;  1E8Y A;  3S7D A;  3PUK A;  4AP2 A;  2WXJ A;  4RG6 A;  3PE4 A;  3DPD A;  1IYG A;  3FEX A;  3CHQ A;  2HO1 A;  2DCP A;  3CQG B;  3L22 A;  1NP7 A;  2WB2 A;  4GML A;  3APC A;  3SGH A;  4V3I A;  2GRM A;  3CSF A;  2AXZ A;  5DIZ A;  5FQ4 A;  1X5B A;  3L6A A;  5AIJ A;  3KAE A;  2WXP A;  1WY6 A;  4UWH A;  3T5V A;  2CHX A;  4JEH A;  4A1G A;  2UY1 B;  2IFU A;  4MRU A;  3FU6 A;  4YND A;  4RSY A;  2L0T B;  3EHM A;  1OWL A;  5A6C A;  4HOR A;  2VQ2 A;  4ANV A;  3HVE B;  4N2S A;  5FWQ A;  2KC7 A;  4AY5 A;  3R7Q A;  4GAA A;  4N3B A;  2XEV A;  4FAD A;  3UX4 A;  2VGX B;  5G05 C;  3VLD A;  4Q96 A;  1H2T C;  3CK8 A;  3JYS A;  4XKB A;  4DJA A;  2VSN A;  1OWM A;  1UJJ A;  2BUG A;  2L6J A;  3MV2 B;  3QC1 A;  3HIZ A;  2LSU A;  5KJM A;  1HG5 A;  2FBN A;  2I1J A;  2L0I A;  2HR2 A;  4ANW A;  4XI9 A;  2J49 A;  3OXF A;  4KZ0 A;  2CG2 A;  2KCL A;  1N54 A;  1XNF A;  2WXM A;  2FO7 A;  2I1K A;  2Y4T A;  4GA0 A;  3WXX A;  3ZFW A;  3ZYQ A;  3PUJ A;  3FTY A;  4DPR A;  3FUN A;  3ML9 A;  3ONL A;  3RK6 A;  4L7T A;  3ZGQ A;  3JQ0 A;  2IQC A;  4AV7 A;  2CFU A;  1IHG A;  4MS6 A;  3SNX A;  4U07 A;  4JA7 A;  4I6E A;  4N3A A;  3LDZ A;  3P2B A;  2VSX E;  4W9R A;  2PZI A;  3DBS A;  4I17 A;  4CDR A;  2C0M A;  4OVV A;  4UI9 K;  2XGM A;  3CVP A;  1WAO 1;  1ZBP A;  3O48 A;  4L23 A;  4NAC A;  4OVU A;  4UWL A;  3RO3 A;  3QDN A;  4ACL A;  4A55 A;  4J8E A;  2PM7 A;  3LKU A;  2IJG X;  2XQ0 A;  1XGW A;  5FZR A;  3AS8 A;  3SF4 A;  2VSY A;  2XGO A;  2EQX A;  3FUL A;  3FH8 A;  4BY6 A;  4MKT A;  3CVN A;  1HXI A;  3I4G A;  4H7Y A;  2BF0 X;  5ARG A;  4HOU A;  2WQ7 A;  1E8Z A;  4I2Z A;  2ION A;  3FY4 A;  5BV1 A;  2X6H A;  3GZ2 A;  4J8D A;  3MX3 A;  3L13 A;  3S2A A;  2PM6 A;  3U4T A;  5G55 A;  3ASH A;  5KJN A;  1KLX A;  3VTX A;  5G2N A;  1SZA A;  2VTB A;  3QOU A;  4C0E A;  2PQN A;  2OVF A;  4HVB A;  3TGO A;  2J4D A;  2E0I A;  2CHW A;  2WXF A;  5T8I A;  3FTW A;  4A3T A;  3FHE A;  3FU0 A;  3PRE A;  3T8M A;  3PEU B;  3N71 A;  4AY6 A;  4IUL A;  4ME2 A;  5ENN A;  4PDX A;  2X6K A;  3G2V A;  3ML8 A;  3NQP A;  4EQF A;  3FUI A;  5AEN A;  5D0Q D;  2VSO E;  3CR3 A;  3LPZ A;  3QAQ A;  4KZC A;  3QAR A;  4IN3 B;  4GCO A;  2CFZ A;  3FWV A;  4J8F A;  5CCM A;  3U3W A;  4GYW A;  4N3C A;  3EDT B;  2XGS A;  3CVQ A;  1Z3X A;  2WXG A;  1MHQ A;  4BX8 A;  1DNP A;  2LAI A;  2HYZ A;  3IEG A;  5LFA A;  3TXN A;  5CMY A;  1IQR A;  4J6I A;  5EX0 A;  3GYZ A;  2WXQ A;  3CQC B;  3HHM A;  4FA6 A;  2XRZ A;  2JLB A;  3ULQ A;  5FZQ A;  4CT4 A;  3B7T A;  2XRY A;  3FU3 A;  2J9Q A;  3CHO A;  4WAF A;  5FJY A;  3JUI A;  2YQ8 A;  4HOQ A;  4PS7 A;  3TXM A;  1Y8M A;  4N2Q A;  2VTB B;  4KYO B;  2AW6 A;  3CVW A;  1OWN A;  3D9M A;  1BPO A;  3I3N A;  4B0Z A;  2NSZ A;  4AOF A;  3FUE A;  2R5S A;  4I6G A;  2V5F A;  2FI7 A;  3ZRH A;  1ZU2 A;  4TRQ A;  2IOL A;  3LEW A;  5ANR A;  4CCA A;  3HYM B;  1HFA A;  4CGV A;  4XKC A;  3CGH A;  1OUV A;  3Q5M A;  4GZ3 A;  4ATG A;  5G04 J;  4WWN A;  2WPV A;  3EIJ A;  4Q94 A;  2Y4U A;  2P58 C;  2DBA A;  2IOS A;  4HS2 A;  4JPS A;  3ZHE A;  2KZT A;  3B7S A;  4GZD A;  5LCW J;  2NC9 A;  1TJC A;  1INZ A;  3LY9 A;  1H6K A;  2WXL A;  3CK7 A;  4JZY A;  3RRM B;  2UWJ G;  1EF1 C;  4GYY A;  2V8S E;  3IBE A;  4CRW A;  1HU3 A;  2Q7F A;  2XPY A;  3ZW3 A;  4CDM A;  4OYS A;  4AJW A;  2R59 A;  3EHN A;  3SD5 A;  2OVB A;  3URZ A;  5BV0 A;  5KJK A;  1HE8 A;  3CK9 A;  5DBK A;  4FJZ A;  2XPZ A;  2J07 A;  2RG8 A;  4WNF A;  4WWP A;  4FJY A;  5FT9 A;  4EEC A;  2GRL A;  3MA5 A;  3P1U A;  3AS4 A;  4G26 A;  3SHF A;  3D9P A;  3EJN A;  4F3V A;  1LF8 A;  1UW4 B;  4EZL A;  4XZ4 A;  4ANU A;  3PH0 C;  4EBA A;  2J4B A;  2WMN A;  4PH4 B;  4AXH A;  1U3C A;  2Y3A A;  3MCX A;  3I4R B;  3NZS A;  3QJZ A;  3OXG A;  2XCC A;  4LEU A;  1Z6T A;  4APO A;  1A17 A;  4AEZ C;  4B8C B;  3G2T A;  4PS8 A;  1GW6 A;  5AJL A;  3R7R A;  1QNF A;  5HI7 A;  1W3B A;  3AU5 A;  4FU3 A;  4EBA G;  3U9W A;  3D9O A;  3D9J A;  4Y6W A;  4ILH B;  4N39 A;  4GCN A;  2BTD A;  4DI4 A;  2YHE A;  4ABN A;  1HO8 A;  4LER A;  4UWK A;  1H2U A;  2YNQ A;  5EKQ D;  1MQS A;  4WWO A;  1HX8 A;  3PE3 A;  3RO2 A;  1N52 A;  3ZHE B;  1KT0 A;  2I9C A;  4LCT A;  3SBS A;  4F1S A;  4JXT A;  1NZN A;  4J0U A;  2A5U A;  3D9I A;  2PQR A;  3OXL A;  3LVR E;  3PDN A;  3QWV A;  1EYH A;  5JJ6 A;  4G24 A;  2KCV A;  4IRU A;  2FUL A;  4P29 A;  4U04 A;  3K9I A;  1E96 B;  4B94 A;  3ENE A;  1WM5 A;  3MGB A;  4FHK A;  4B8A A;  3S7F A;  2X6I A;  3SBT B;  4LRZ A;  3VTY A;  2YHC A;  5J08 A;  4PUC A;  3GZS A;  3QK0 A;  3ZIM A;  4BFR A;  4CT0 A;  3FTU A;  3LCA A;  3UT4 A;  4GA2 A;  1L5J A;  3FTV A;  4UWF A;  4G1T A;  4QFV A;  1HS6 A;  4PS3 A;  3FH5 A;  3KD7 A;  3APF A;  4RVB A;  1OWO A;  3QWW A;  5T4Y A;  4GZC A;  1VDY A;  4FHJ A;  2LNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...