5LCWJ

Cryo-em structure of the anaphase-promoting complex/cyclosome, in complex with the mitotic checkpoint complex (apc/c-mcc) at 4.2 angstrom resolution
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Anaphase-promoting complex subunit 1
publication title Molecular basis of APC/C regulation by the spindle assembly checkpoint.
pubmed doi rcsb
source organism Homo sapiens
total genus 179
structure length 504
sequence length 532
chains with identical sequence K
ec nomenclature
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lcwJ00
3ASHA 3EDTB 5G05C 4YNDA 1HXIA 3AS8A 5FTPA 2XCCA 4CDRA 4HORA 3UQ3A 3UUXA 3VTXA 3FFLA 2L6JA 2C2LA 4I9EA 5BNWA 2Q7FA 3HYMB 2UY1B 4H7YA 5HQ8A 3CK7A 2WQHA 4I17A 4A1SA 3R9AB 2HO1A 3KS2A 4AY6A 4N39A 3S7JA 3URZA 3QDNA 4NRHB 3QWWA 3ASDA 3Q4AB 3ASFA 3CV0A 4YVOA 2IF4A 4RG6A 3SZ7A 3FWVA 4UQZA 3RKVA 3O48A 1ELRA 4U0SA 2KATA 5JJTA 4WNGA 2VQ2A 5CHEE 1HH8A 5KJLA 3GZ2A 1KT0A 5C1DA 2UWJG 5LCWJ 4I2ZA 2FO7A 2E2EA 3LPZA 3S7BA 4J8EA 4IN3B 1W3BA 1KLXA 4HOUA 4J8FA 4U0ZA 3U4TA 3PE4A 5DIZA 3ZFWA 4N3AA 2ONDA 1NZNA 2HR2A 4AM9A 5A6CA 4WNEA 3GYZA 2KC7A 1TJCA 4YVQC 3NF1A 1A17A 4G24A 1WM5A 4Y6WA 3ULQA 3U3WA 5CCLA 2LNIA 4WUYA 2FF4A 2LSUA 5LCWC 4BTAA 4CGVA 4U04A 4N3CA 5D0QD 4XI9A 2PQRA 4N2SA 4BT9A 3QOUA 4BTBA 4N3BA 2LSVA 3LKUA 3CVPA 5G04J 5JJ6A 5BT1A 4EQFA 4J0UA 5D0OD 3QWPA 2XCBA 2FBNA 2HYZA 3PE3A 4H7XA 4JA9A 4JL0A 3RIBA 5KJMA 4GYWA 3LCAA 4U07A 4O6FA 2KCLA 4UQXA 1HZ4A 3ZHEA 5FT9A 4KXKB 3RO2A 3MEKA 4RG9A 2Y4UA 5CCMA 3TAXA 1P5QA 3RO3A 1KT1A 2V5FA 4APOA 4J8DA 1QQEA 3BEEA 3CKCA 4KBQA 1XNFA 2XPIA 5FZRA 4HOTA 2XEVA 3ZPJA 4GYYA 5KJNA 2VGXA 4I1AA 3CVLA 2UY1A 3WXXA 3GW4A 4KYOB 1E96B 1OUVA 3Q5MA 2XGMA 2JLBA 4W9RA 3MA5A 4F3VA 5ARFA 5M72A 2PQNA 5EX0A 3KAEA 4HOQA 2YQ8A 3UPVA 4ABNA 3IEGA 2P58C 4I9CA 4G23A 3TGOA 4GZ6A 1ELWA 3RJVA 4GA2A 3MV2B 4G1TA 5JJ7A 4ME2A 3AS5A 3FP3A 2Y4TA 3N71A 3LY8A 4XIFA 3LY9A 2PL2A 4JA7A 3CK9A 3TG5A 3TG4A 5EKQD 2R5SA 2MHKA 3ZHEB 4LEUA 1IYGA 1WAO1 3RU0A 2C0MA 1FCHA 3CKBA 4AY5A 4GCOA 4WNFA 5KJKA 1ZU2A 2NC9A 3OXGA 4NQ0A 4U0UA 4N2QA 4UI9J 2IFUA 3KD7A 2VGXB 3VTYA 2YHCA 1NA3A 3Q15A 4Y6CA 4UQYA 3MKRA 3JYSA 3OXLA 5AYWD 4HOSA 5FZQA 5G04C 1YA0A 2AVPA 1PC2A 4GCNA 4WNDA 4CGWA 5HI7A 3LY7A 3E4BA 1IHGA 4GZ5A 3Q47B 2J9QA 3QKYA 2KCKA 3SF4A 4AIFA 2I6HA 3ZN3A 4GPKA 4I2WA 3ASGA 4N5CA 2KCVA 4GA1A 2VYIA 3S7DA 4UI9K 3QWVA 1QZ2A 4UI9C 2VGYA 2BUGA 4GYOA 3K9IA 5BW8C 2WPVA 3MV3B 2PZIA 4JHRA 1Y8MA 2QFCA 4BWRA 5FJYA 4G2VA 2VSNA 4XI0A 2OOEA 3CVQA 2XGSA 3S7FA 4G26A 5EX3A 5G05J 4B94A 4G25A 2DBAA 2GW1A 4BT8A 5A7DB 3PDNA 2C0LA 1ZBPA 2FI7A 2VSYA 4GZ3A 3AS4A 3OXFA 3LYAA 1NA0A 2XGOA 2FEZA 3GZ1A 5FZSA 4GA0A 3CK8A 5ARGA 5DBKA 1B89A 3ESKA 3ZGQA 3Q49B 3CEQA 3CVNA
chains in the Genus database with same CATH superfamily
4GMRA 3DSVA 3ZIMA 3APFA 4YNDA 1HXIA 1H0AA 5LP0A 4O1PA 5ENRD 4JZYA 4CDRA 3UQ3A 4JHKA 4GTTA 2GGFA 3DXMG 3FTYA 3SFXA 3DXKG 2WXOA 3UKRG 2ZGDA 2A4ZA 5AJDA 1JCRA 3Q7AA 1S0PA 2P2CP 1U3DA 5AIJA 2IU1A 3KS2A 4CRWA 3FH7A 2BF0X 4GB9A 5CEAA 3UM2A 1HG2A 2IONA 3SHFA 2H6FA 4JEUA 5FQ6A 2GRLA 4R7LA 2VTBB 3UKUG 1O1RA 5FQ7A 1LF8A 1TNZA 4OVVA 3FUJA 5JJTA 2NSZA 2AXUA 3HXDA 5KNGA 2V8SE 4WNGA 4EBAA 5CHEE 3MJWA 5EYLA 4I1MA 1KT0A 3I4RB 2Y69E 5LCWJ 2DZNA 3DSXA 5BPPA 1SZAA 4U0ZA 1E7UA 3JQ1A 3OTNA 2X6FA 3ZYMA 3ZFWA 3JXIA 2ONDA 4LUNU 2H6HA 3UM0A 3IHVA 4JB8P 3FUKA 2VGEA 2BEDA 5FWQA 3GYZA 3FUMA 3PRZA 4GMLA 4Y6WA 3ULQA 3HG0D 2WXFA 2EQXA 1HG5A 5D0QD 4XI9A 4D10C 4AV7A 4FJYA 4BT9A 1DCQA 2CHZA 4G8LA 4NIKA 2LSVA 3CVPA 3ONKA 4HI9A 5D0OD 5JHAA 3QWPA 3U64A 1FVFA 3L54A 2H6IA 4ACKA 4LG6A 1UN8A 3RSEG 4L23A 4A55A 3IBEA 3EJNA 3RO2A 3P2BA 4ILIA 4AXHA 4NURA 1Z5SC 1IXVA 1KT1A 2V5FA 3UXGA 4B93B 3EHMA 1QQEA 3CKCA 3DSSA 5CMYA 4EHMA 4HI8A 4GMJA 1XNFA 4U8VD 2R05A 5FZRA 4CDNA 4HOTA 2P9NG 4UWLA 3ABKE 5KJNA 5FQ4A 3LVQE 3ZXSA 4E85A 1E8XA 3GW4A 4KZCA 1N95A 3FH5A 3EHQA 3TWVA 4CZ2D 3RRNB 2XZTG 5BXUA 1H2TC 3F6QA 5ITZF 5C2YA 3JQ0A 5G55A 4XZ4A 3CGHA 4GTPA 2YQ8A 4FHKA 2V0PA 4EBAG 3SFYA 4OAUC 2J08A 2L9BA 4G23A 1OXJA 4B8CB 3TGOA 1HS6A 4GZ6A 2WXRA 3RJVA 3TWQA 4GA2A 3MV2B 4JEHA 5JJ7A 4C9BB 5ENNA 5EDSA 4EZLA 1PAQA 3VLDA 2ZISA 4MKTA 4LNBA 2LAIA 2R5SA 3D9LA 1MX6A 5KWDA 2MHKA 4I6JA 2DCPA 4CCAA 3AG1E 1E7VA 2DZOA 2LAHA 4PS8A 3B7RL 4HBDA 2R17C 4A63B 4EECA 4O60A 2J4DA 5KBAA 4FJZA 5AQBA 5CERB 4LNUD 4UI9J 3AG2E 3P1UA 2YHCA 3QNKA 3CIAA 5ANRA 3MKRA 3JYSA 3Q7FA 5AYWD 4J6IA 1E8ZA 4L2YA 2EINE 4TUUA 1OWOA 4O1OA 3ZYQA 4ANXA 3I5PA 2XPZA 3T8MA 3FTUA 1S63A 1K3ZD 3ASGA 4BEPA 3Q9NC 1N11A 3MX3A 3CHPA 2VYIA 1BPOA 1N94A 2RD0A 4DLQA 3C72A 5BW8C 2WPVA 3HDXA 4FHJA 2QFCA 3R7QA 4G2VA 2WXPA 5LFAA 3T9KA 1YMPA 2DWZA 1N4PA 4B94A 1O1TA 2BTDA 3E34A 1KZPA 5AN8A 3MYVA 3NZUA 3CVXA 4V3IA 1N0RA 3CHSA 1ZBPA 3FTXA 2WXKA 5LOZA 3OXFA 3LYAA 4Z68A 4DRXE 2RKKA 4ACLA 1SA5A 3ASOE 4BFRA 5DBKA 2GRPB 2L0TB 4J8SA 3IV0A 3FUDA 2PM6A 3ZGQA 4U8HA 3UI2A 3CVNA 3ASHA 1MX4A 3EDTB 4K0RA 3PUJA 1OWLA 2WXGA 3SFZA 1INZA 1Z3YA 1OCZE 4DX7D 3FTSA 3UUXA 3VTXA 1TJFA 2IY0C 3ZU7B 3BG1B 2C2LA 4I9EA 5EILA 1X5BA 3HYMB 2WQ6A 2UY1B 5HQ8A 4CT4A 1EDUA 3DPYA 4KVOA 2WQHA 4I17A 2VSXE 3FH8A 4JHJA 4I6GA 1TN6A 4N39A 2E0IA 4L7TA 3S7JA 3URZA 1HU3A 1H2VC 4NRHB 3Q4AB 2F37A 3CV0A 2XRZA 3ZW3A 4M7CA 1TNBA 2ETCA 3SZ7A 3L17A 3CVVA 3RKVA 5JA4D 4GZCA 2I9CA 2WXMA 3V30A 3PREA 2VQ2A 1HH8A 3V2XA 3CHQA 5C1DA 3AAAC 3TWSA 4LSZE 2FO7A 2OEVA 1N54A 1W3BA 3NZSA 4HVBA 3Q9UC 3E32A 3ZYKA 1UJKA 1NZNA 1AP7A 4AM9A 2XEEA 4Q69A 3HVEA 3TJPA 2CG3A 3LVRE 3AG3E 2KC7A 5T3RA 3IXEA 3APCA 3NF1A 3HXBA 5JMND 2V5QC 5BV0A 5CCLA 4WUYA 2FF4A 2LSUA 4CDMA 4GU5A 3FTVA 3W9GA 3KEAA 4AEZC 2PQRA 4PS7A 1QYMA 5BT1A 2XRYA 3J5PA 4J0UA 3WG7E 3JUIA 4LERA 3RK6A 3ZNGA 1HO8A 3PE3A 4JL0A 5CBNA 3SO8A 1EYHA 1JCSA 5FT9A 4KXKB 4UWHA 3MEKA 1FPPA 4ANWA 2Y4UA 3W9FA 4JVSA 4J8DA 3NB2A 4ANVA 2LXLA 1XGWA 3C98A 2DYRE 3Q75A 3EUVA 3SQVA 5D66A 4JD2G 3CQCB 4Q96A 4HRLA 4DI3A 2VGXA 4I1AA 3U9WA 3CVLA 2KXPC 3EIQC 3WXXA 2J49A 1SQMA 3FY4A 4KYOB 1SW6A 1E96B 1OUVA 3Q5MA 5H7PA 4RLYA 2KBXA 2H6GA 3FUNA 3MA5A 5LX8A 3MKQA 4F3VA 3QC1A 5ARFA 3Q73A 2HM8A 1JWFA 1H6PA 3G2SA 4M3OA 3GZSA 1OCOE 1BLXB 2CHWA 3SBTB 3ZXPA 4ABNA 2QYJA 4IRUA 4BSZB 2P58C 4I9CA 4F53A 4JC8A 3FUIA 4N5QA 2DVWA 1IKND 4C0EA 3UMVA 3ZYLA 5AQ9A 4ME2A 1Z6TA 2Y4TA 3B7TA 4BESA 2AWIA 1MJ0A 4JPSA 3PEUB 3LY9A 3ULEG 4P29A 2IO2C 1K1AA 3TG4A 3NOGD 1S64A 2XPYA 3G2UA 2DIWA 1L5JA 3RU0A 3B95A 3L08A 3CKBA 3ABLE 4DPRA 4GCOA 3PNLB 1OCCE 2P9UG 4UWKA 3UM1A 2AW6A 5CMWA 4NQ0A 2X6IA 3LJNA 3Q78A 2VJ8A 4K5CA 1H6OA 4Q94A 1WY6A 4HLLA 2IFUA 2VGXB 2XS1A 2X38A 4Y6CA 3OXLA 1YA0A 2WXLA 4GCNA 2X3MA 4YDOA 4CGWA 4TRQA 3DEOA 1IHGA 3ONLA 2YNQA 4ANUA 2YINA 3MKQB 2J9QA 2R03A 1HX8A 3UX4A 3NQPA 3QK0A 1ELKA 3T8KA 2WXIA 4PUCA 2MRIA 3HXCA 4XKCA 3EU5A 2B6CA 4AIFA 3ZN3A 4GA1A 3ZEFA 2R2LA 5KCMA 1MYOA 2NYJA 2VGYA 2BUGA 4MBGA 4GYOA 4K5BA 4TXQA 4X8QA 4HRNA 1Y8MA 4BWRA 3Q79A 4F1PA 3PZ4A 3G2VA 1OT8A 5J90A 2OOEA 2ZU6B 1JWGA 1TN8A 5EYPF 4G25A 4ATZD 5B3SE 3UM3A 1YCSB 4J7WA 3D9PA 4U63A 4UWFA 3PDNA 1IHBA 5A23A 3ABME 1IQUA 2FI7A 5AARA 3AS4A 3L22A 3FEYA 4FADA 1UW4B 5FINA 1NA0A 1HF8A 4KMOA 1VDYA 1JPLA 4GA0A 4DJAA 1B89A 1QBQA 4FLHA 2WXHA 3JCKC 5FQ8A 1WDYA 2F8YA 2ILRA 3FUHA 3L9TA 1LD7A 4FULA 5G05C 4PS3A 2ETAA 2ETBA 3KEZA 5AAOA 2XCCA 4GTOA 4HORA 3D9NA 5E76A 3FFLA 1NI1A 2L6JA 3NOCD 2Y3AA 3T5XA 3DSTA 2Q7FA 3PZ1A 3ISMC 1UN9A 4H7YA 2FO1E 3HIZA 4F1SA 3R9AB 1S70B 2HO1A 3PS6A 4AY6A 2XHEA 4MS6A 3FUFA 5AQ7A 3CVWA 2P9KG 1Y6IA 3QDNA 1DVPA 3QWWA 3ASDA 4PDXA 3ASFA 4FU3A 4YVOA 2IF4A 3MZLB 2RG8A 3SY2A 2WB2A 1SA4A 4UQZA 4GTSA 4I43A 4OVUA 4UUCA 2WXNA 3HRAA 2ZIRA 4BY6A 2LO6A 1JCQA 5ENQD 5KJLA 3GZ2A 2J09A 1D8DA 4I2ZA 5BV1A 3S7BA 2VSOE 4J8EA 1TEZA 4WWOA 3TWTA 4HOUA 3U4TA 1H2UA 4TXRA 4A1GA 1FT2A 3E37A 4GTMA 4GTVA 2AXZA 2R59A 3PZDA 2GRQB 1E90A 2X6JA 2GRMA 2A5UA 2HR2A 2WM9A 3D9OA 3DSUA 5A6CA 4J8YA 4WNEA 3MCXA 1UOHA 1TJCA 4YVQC 4G24A 1WM5A 3U3WA 1KZOA 2M63A 3SBSA 4CGVA 4U04A 5AJLA 4L2LA 3C3RA 1BD8A 3DBSA 4N2SA 4RQIA 4BTBA 2QYUA 4N3BA 3LKUA 4F7AA 2DYSE 4EQFA 2AXVA 1N0QA 2XCBA 3SI5A 4L9PA 2XENA 2HYZA 5EIDA 4H7XA 5KJMA 3RIBA 5IY5E 4GYWA 3LCAA 4O6FA 5CECB 4UQXA 3PNTB 4MLPA 5B1AE 3FUEA 3BUAA 1N9AA 1BI7B 1IQRA 3PH0C 2OEWA 3BEEA 2MOWA 1WG0A 2L6BA 4GZDA 3I3NA 2XPIA 3SNXA 3NAWA 4WWPA 3EIJA 3V31A 4ILGA 4DX2A 3LS8A 3G2WA 5G2NA 5FIOA 4U7EB 2X6KA 3UTMA 2GRRB 3T5VA 5ENOD 1K8KG 1TR4A 2JLBA 4W9RA 3L13A 3DEPA 4FC8A 2PQNA 4OAVB 1TN7A 3RAUA 2VTBA 1MZCA 2KM4A 4RVBA 2J4BA 4A3TA 2IEJA 3C3QA 3LXUX 3B7BA 5CRUA 5T4YA 1ELWA 4IYPA 1MHQA 2WMNA 1OWPA 2P9PG 4LCTA 2CHXA 3FHEA 4DLOA 3CHRA 3V79K 3AS5A 3N71A 4XIFA 2PL2A 4JA7A 3TG5A 4E6HA 2EILE 3RRMB 5EKQD 2IOSA 4TXPA 1NP7A 4GAAA 3AJIA 3FU5A 4FLBA 3R9MA 1IYGA 3QAQA 1WAO1 4HFGA 1PY1A 1UG3A 4HXIA 4AY5A 2X6HA 2WXQA 3G2TA 2FULA 5KJKA 2KZTA 2NC9A 3OXGA 5HKPA 1OWMA 3LEWA 3L82A 3FEXA 3KD7A 1HE8A 5HS0A 3VTYA 4LRZA 3Q15A 3X2QE 2QY7A 3CLJA 4HOSA 5FZQA 3IHYA 3D3MA 1PC2A 4WNDA 3S2AA 4A3VA 1X81A 2GRNB 1NL4A 4DX5D 3L16A 1DC2A 3PZ2A 2V4LA 3RRUA 3R7RA 4I2WA 4GPKA 4N5CA 2KCVA 4UI9K 3HHMA 3B7SA 3QWVA 2WMOA 2IQCA 3O4ZA 4EZJA 4AVXA 3K9IA 3MV3B 3DWLG 3HVEB 2PZIA 4JHRA 2VSNA 4XI0A 1KPSB 5ANLA 1A5EA 1BU9A 2XGSA 3QARA 5G05J 2EIME 2P9SG 4LNGA 4KT6B 2EIKE 3CHMA 4U8YD 2LXMA 1FVHA 4CT0A 2JEKA 3TXNA 3VLEA 4C48B 3D9KA 1UJJA 2VSYA 4GZ3A 2J8SD 1Q2ZA 2XGOA 2FEZA 3GZ1A 4QQIA 4HB5A 4TUMA 2OCCE 1E8YA 5FZSA 3CVUA 3D9IA 3APDA 2KZTB 4DK5A 1D8EA 4GPMA 2EIJE 3CEQA 2QZAA 3CR3A 3AS8A 4NACA 5FTPA 3EHNA 4GTQA 4B89A 2Y1LE 1ZB1A 3TXMA 2WQ7A 3B7UX 1G3NB 3E33A 2IJGX 4AP2A 3ULYA 5BNWA 5EN5D 3AG4E 2CFUA 3HXEA 3CK7A 5ENTD 4A1SA 3FU3A 2CG2A 2L0IA 1HFAA 2RFMA 4QFVA 4EPZA 4BERA 2NXPA 3TWUA 1GW6A 2A5EA 3I4GA 3ENEA 2ZXWE 3AU5A 4DI4A 4RG6A 4XX5A 3FWVA 3TL5A 2I1JA 3UT4A 3O48A 1ELRA 4U0SA 4DX6D 2KATA 2IOLA 2BKKB 3BU8A 3KSLA 3TWWA 3LDZA 4ZFHA 3JUEA 4U96D 2UWJG 2E2EA 3LPZA 4IN3B 1KLXA 1OWNA 4J8FA 3PE4A 1H6KA 5DIZA 4N3AA 2XS8A 3FTZA 2JABA 2P9LG 3EU9A 1A17A 2HE0A 4U95D 1DNPA 2LNIA 2ZGGA 4MRUA 4AOFA 5LCWC 4K5AB 4BTAA 4BETA 1RZ4A 4N3CA 3IKOB 5HRYA 5JHBA 2PNNA 2GROB 2BKGA 4I1OB 4YDWA 3EHRA 3QOUA 4FA6A 1D9SA 1RW2A 4DX1A 5G04J 5JJ6A 2QC9A 4DUIA 2IO3C 3UIPC 4I6EA 2OVBA 4F6RD 2F8XK 3SD5A 3OAWA 3UT7A 2FBNA 1TNUA 1TYQG 3C5RA 2Y0BG 4JA9A 3JXJA 1TNOA 3ZUVB 5EIBE 4G11A 4U07A 3PUKA 4IULA 3ZRHA 2KCLA 1HZ4A 4XE0A 3ZHEA 4RG9A 5CCMA 3TAXA 1P5QA 3RO3A 1OY3D 4APOA 3PVLA 3VLFA 3FU0A 4KBQA 5AQAA 4HLEA 4CYMD 5ENSD 4K03A 2XEVA 3ZPJA 3FULA 4GYYA 4TV3A 5T8IA 2UY1A 2I2OA 1K1BA 1SVXA 2RFAA 2XGMA 4HRMB 1V54E 3ZVVA 3BQOA 2YHEA 3FDHA 5ENPD 3ML8A 3ESLA 5M72A 2I1KA 4HS2A 4EZKA 2MYOA 4C0MA 3NBNB 2XZDG 5EX0A 1NFIE 1AWCB 3FU6A 3KAEA 4HOQA 3FTWA 3SGHA 1SZ9A 4PH4B 3CSTA 5CBOA 4ATGA 3UPVA 4OYSA 4WAFA 3TWRA 2OVFA 3IEGA 3L6AA 3D9MA 4KVMA 1FT1A 1OCRE 4XEIG 4XKBA 4G1TA 3DSWA 3D9HA 3FP3A 1EF1C 5CEDB 2AJAA 3LY8A 3J5QB 3CK9A 4JXTA 1MQSA 1V55E 2R02A 5CRVA 3ZHEB 4LEUA 1U2VG 1N4RA 5B1BE 2CFZA 3AU4A 2C0MA 4BX8A 1FCHA 4YDEA 4WNFA 1ZU2A 2XEHA 2P9IG 3UT8A 4BSXA 1O1SA 3LJ3A 4U0UA 3UINC 1TNYA 4ILHB 4N2QA 5BXOA 3DRAA 1LTXA 4B0ZA 1BI8B 1NA3A 1N4SA 3MGBA 4UQYA 4URKA 5E75A 2OV8A 5G04C 1DCEA 1U3CA 2AVPA 3DPDA 5HI7A 3LY7A 3E4BA 4GZ5A 3Q47B 4JW1A 4GTRA 2WVIA 4AJWA 3QKYA 5J08A 2KCKA 5D2MC 1MX2A 3V2OA 3U66A 4YDYA 3ML9A 4CEMA 3SF4A 2I6HA 1JUQA 3C3OA 2F0YA 2J07A 3QB2A 3S7DA 1QNFA 1QZ2A 1N4QA 4HNAD 4UI9C 3BG0B 3ZKJA 3CVYA 3B13A 3CSFA 1Z3XA 4L1BA 5FJYA 4UWGA 2B0OE 2XQ0A 5BUZA 4G8KA 3KSQA 4FP7A 4HQDA 3CVQA 3E30A 3S7FA 4G26A 5EX3A 3PZ3A 1O5MA 2LUHA 5KNHD 3D9JA 2DBAA 1E8WA 2V4HC 4B8AA 2PM7A 4APFA 3CHOA 4BX9A 2GW1A 4BT8A 5A7DB 1EPUA 2C0LA 3CQGB 3UIOC 3QJZA 3TWXA 2WXJA 3HXFA 5AENA 3ASNE 3CK8A 5ARGA 1LD8A 1N52A 4WWNA 3PEVB 3ESKA 1YYHA 4RSYA 4KZ0A 4ZHBA 3Q49B 1H19A
chains in the Genus database with same CATH topology
3ASHA 4FULA 3ZIMA 3APFA 3EDTB 5G05C 4K0RA 4YNDA 3CR3A 4PS3A 1HXIA 3PUJA 3AS8A 1H0AA 3KEZA 1OWLA 2WXGA 3EHNA 4NACA 5FTPA 3SFZA 1Z3YA 4B89A 1INZA 3TXMA 2WQ7A 2XCCA 3FTSA 4JZYA 4CDRA 4HORA 3D9NA 3UQ3A 5E76A 4JHKA 3UUXA 3B7UX 3FFLA 3VTXA 2GGFA 3FTYA 2IJGX 1TJFA 2L6JA 4AP2A 3BG1B 2Y3AA 2C2LA 3T5XA 4I9EA 5BNWA 1X5BA 2Q7FA 2WXOA 2A4ZA 3HYMB 5AJDA 2WQ6A 2UY1B 1UN9A 4H7YA 5HQ8A 1S0PA 2CFUA 4CT4A 1EDUA 3CK7A 4KVOA 2WQHA 4I17A 2VSXE 3FH8A 4A1SA 3FU3A 3HIZA 1U3DA 4F1SA 3R9AB 2CG2A 4JHJA 2L0IA 5AIJA 2HO1A 1HFAA 2IU1A 4I6GA 3KS2A 3PS6A 4AY6A 4N39A 2E0IA 4L7TA 3S7JA 4CRWA 3URZA 1HU3A 2XHEA 4MS6A 3FUFA 3CVWA 3FH7A 4QFVA 4EPZA 2BF0X 4GB9A 1H2VC 1Y6IA 2NXPA 3QDNA 1DVPA 1GW6A 4NRHB 3QWWA 3ASDA 1HG2A 2IONA 3SHFA 3Q4AB 4PDXA 3ASFA 3I4GA 3ENEA 3CV0A 4FU3A 4JEUA 4YVOA 5FQ6A 2GRLA 4R7LA 2IF4A 3AU5A 2XRZA 3ZW3A 4DI4A 4RG6A 4XX5A 2VTBB 3MZLB 3SZ7A 5FQ7A 2RG8A 3FWVA 1LF8A 3L17A 3TL5A 2WB2A 3CVVA 2I1JA 3UT4A 4UQZA 3RKVA 3O48A 1ELRA 4U0SA 2KATA 4I43A 4OVUA 4OVVA 3FUJA 4GZCA 5JJTA 2I9CA 2NSZA 2IOLA 2WXNA 2WXMA 2AXUA 2V8SE 3LDZA 3PREA 4WNGA 4BY6A 4EBAA 2VQ2A 5CHEE 1HH8A 3MJWA 2LO6A 3CHQA 5KJLA 3GZ2A 1KT0A 4I1MA 5C1DA 3I4RB 2UWJG 2J09A 5LCWJ 4I2ZA 2FO7A 2E2EA 5BV1A 3LPZA 3S7BA 2VSOE 4J8EA 4IN3B 1TEZA 1N54A 4WWOA 1W3BA 1KLXA 1OWNA 4HOUA 5BPPA 4J8FA 1SZAA 3NZSA 4U0ZA 3U4TA 1E7UA 1H2UA 4HVBA 3PE4A 1H6KA 3JQ1A 3OTNA 2X6FA 5DIZA 4A1GA 3ZYMA 3ZFWA 4N3AA 2ONDA 2AXZA 2R59A 3PZDA 4LUNU 3IHVA 1E90A 3ZYKA 1UJKA 1NZNA 2X6JA 3FUKA 2GRMA 2A5UA 2HR2A 2WM9A 3D9OA 3FTZA 4AM9A 5A6CA 4Q69A 3HVEA 3TJPA 4WNEA 3MCXA 5FWQA 2CG3A 3GYZA 3FUMA 3LVRE 2KC7A 3PRZA 1TJCA 4YVQC 5T3RA 4GMLA 3APCA 3NF1A 1A17A 4G24A 1WM5A 4Y6WA 3ULQA 3U3WA 5BV0A 2WXFA 1DNPA 2LNIA 5CCLA 4WUYA 2FF4A 2M63A 2LSUA 4CDMA 4MRUA 4AOFA 4GU5A 5LCWC 4BTAA 3SBSA 4CGVA 3FTVA 2EQXA 4U04A 5AJLA 1HG5A 4L2LA 4N3CA 3IKOB 5D0QD 5JHBA 4XI9A 4D10C 4AEZC 4AV7A 2PQRA 3DBSA 4FJYA 4PS7A 4N2SA 4BT9A 2CHZA 4I1OB 4FA6A 3QOUA 4BTBA 4N3BA 2LSVA 3LKUA 3CVPA 5G04J 5JJ6A 2XRYA 4F7AA 5BT1A 3ONKA 4EQFA 4J0UA 4I6EA 3JUIA 2OVBA 5D0OD 2AXVA 5JHAA 3SD5A 3QWPA 4LERA 2XCBA 3SI5A 3OAWA 3U64A 2FBNA 3UT7A 3RK6A 1HO8A 2HYZA 1FVFA 3PE3A 4H7XA 4JA9A 3L54A 4JL0A 3RIBA 5KJMA 4GYWA 3LCAA 4ACKA 4G11A 4U07A 1UN8A 3PUKA 4O6FA 4IULA 4L23A 3ZRHA 2KCLA 1EYHA 3PNTB 1HZ4A 4MLPA 4UQXA 4A55A 4XE0A 3ZHEA 5FT9A 4KXKB 4UWHA 3FUEA 3IBEA 3EJNA 3RO2A 3MEKA 3P2BA 4ILIA 4AXHA 4ANWA 4NURA 4RG9A 2Y4UA 5CCMA 3TAXA 1P5QA 3RO3A 4JVSA 1KT1A 2V5FA 1IQRA 4APOA 3PH0C 4J8DA 3EHMA 1QQEA 3BEEA 3CKCA 2MOWA 3PVLA 5CMYA 3VLFA 4GZDA 3I3NA 4ANVA 4GMJA 3FU0A 4KBQA 1XNFA 2XPIA 4HLEA 1XGWA 3C98A 3SNXA 5FZRA 4CDNA 4K03A 4HOTA 2XEVA 3CQCB 4Q96A 3ZPJA 3FULA 4WWPA 4GYYA 4TV3A 3EIJA 5T8IA 4ILGA 4UWLA 4DI3A 5KJNA 2VGXA 4I1AA 5FQ4A 3LVQE 3U9WA 3CVLA 3ZXSA 2UY1A 4E85A 3EIQC 3LS8A 3G2WA 3WXXA 2I2OA 1E8XA 2J49A 3GW4A 5G2NA 4KZCA 1SQMA 3FY4A 4KYOB 1E96B 1OUVA 3Q5MA 3FH5A 2XGMA 2X6KA 3T5VA 3ZVVA 2JLBA 3RRNB 4W9RA 3L13A 2YHEA 3FUNA 3MA5A 3FDHA 5LX8A 4FC8A 1H2TC 3MKQA 4F3VA 3QC1A 3ML8A 3ESLA 5ARFA 5M72A 2I1KA 2PQNA 2HM8A 4HS2A 4EZKA 1JWFA 4C0MA 5EX0A 3G2SA 3FU6A 5C2YA 3KAEA 4M3OA 3JQ0A 4HOQA 5G55A 4XZ4A 3CGHA 3FTWA 3GZSA 2VTBA 3SGHA 2KM4A 1SZ9A 4PH4B 3CSTA 4RVBA 2YQ8A 4ATGA 2CHWA 2J4BA 3SBTB 4A3TA 4FHKA 3UPVA 4OYSA 2V0PA 4WAFA 4ABNA 4EBAG 2OVFA 3IEGA 4IRUA 2P58C 4I9CA 4F53A 5LP0A 4JC8A 2J08A 2L9BA 3FUIA 3LXUX 4G23A 3L6AA 4B8CB 5T4YA 1HS6A 3TGOA 3D9MA 4GZ6A 1ELWA 4IYPA 1MHQA 2WXRA 4KVMA 3RJVA 2WMNA 4C0EA 1OWPA 4LCTA 2CHXA 3UMVA 3FHEA 4GA2A 3ZYLA 4DLOA 3MV2B 3CHRA 4XKBA 4G1TA 4JEHA 4ME2A 5JJ7A 3AS5A 3FP3A 4C9BB 5ENNA 1Z6TA 5EDSA 2Y4TA 3B7TA 1EF1C 2AWIA 3N71A 4JPSA 4EZLA 3LY8A 3PEUB 4XIFA 3LY9A 2PL2A 4JA7A 3CK9A 1PAQA 3TG5A 3VLDA 4JXTA 1MQSA 4MKTA 4P29A 4E6HA 2LAIA 3RRMB 3TG4A 5EKQD 2IOSA 2R5SA 3D9LA 1NP7A 4GAAA 3FU5A 4FLBA 2MHKA 2XPYA 3G2UA 2DIWA 4I6JA 3ZHEB 4LEUA 2DCPA 1IYGA 4CCAA 3QAQA 1WAO1 1L5JA 3RU0A 2CFZA 3L08A 4HFGA 3AU4A 1PY1A 2C0MA 1E7VA 4BX8A 2LAHA 4PS8A 1UG3A 1FCHA 3CKBA 3B7RL 4HXIA 4AY5A 2X6HA 2WXQA 4DPRA 3G2TA 4GCOA 3PNLB 2FULA 4WNFA 5KJKA 2KZTA 2R17C 1ZU2A 4UWKA 2NC9A 3OXGA 2AW6A 4EECA 5CMWA 4NQ0A 2J4DA 2X6IA 1OWMA 3UT8A 4FJZA 2VJ8A 4BSXA 3LJ3A 3LEWA 4U0UA 4ILHB 4Q94A 4N2QA 4UI9J 1WY6A 3FEXA 4B0ZA 2IFUA 3KD7A 1HE8A 2VGXB 3VTYA 4LRZA 3P1UA 2X38A 2YHCA 1NA3A 3Q15A 3QNKA 3CIAA 4Y6CA 3MGBA 5ANRA 4UQYA 2QY7A 3CLJA 4URKA 3MKRA 3JYSA 3OXLA 5AYWD 4HOSA 5E75A 2OV8A 4J6IA 1E8ZA 5FZQA 5G04C 3IHYA 1U3CA 1YA0A 2AVPA 3D3MA 1PC2A 2WXLA 4GCNA 4WNDA 2X3MA 4CGWA 3S2AA 3DPDA 4L2YA 3LY7A 4TRQA 5HI7A 4A3VA 3E4BA 1IHGA 4GZ5A 3ONLA 3Q47B 2YNQA 4ANUA 4JW1A 2YINA 4TUUA 1OWOA 3MKQB 2J9QA 2WVIA 3QKYA 4AJWA 5J08A 1HX8A 3ZYQA 3UX4A 3NQPA 3QK0A 4ANXA 3I5PA 2KCKA 1ELKA 3U66A 3L16A 2WXIA 2XPZA 4PUCA 3ML9A 2MRIA 3FTUA 3SF4A 3T8MA 4CEMA 4XKCA 2V4LA 4AIFA 2I6HA 3RRUA 3ZN3A 3R7RA 4I2WA 3ASGA 4GPKA 4N5CA 2KCVA 4GA1A 3MX3A 1JUQA 3ZEFA 3CHPA 2J07A 3QB2A 2VYIA 3S7DA 1BPOA 3HHMA 4UI9K 2RD0A 1QNFA 3B7SA 4DLQA 3QWVA 1QZ2A 2IQCA 2WMOA 4UI9C 3O4ZA 5KCMA 4EZJA 2VGYA 4AVXA 2BUGA 4GYOA 3K9IA 5BW8C 2WPVA 3MV3B 3BG0B 3HDXA 3HVEB 2PZIA 4JHRA 1Y8MA 4FHJA 3CVYA 2QFCA 3B13A 3CSFA 3R7QA 1Z3XA 4L1BA 5FJYA 4UWGA 4BWRA 4G2VA 2WXPA 2VSNA 2XQ0A 3G2VA 5LFAA 4XI0A 5BUZA 4FP7A 5ANLA 5J90A 2OOEA 2ZU6B 2XGSA 3CVQA 3QARA 1JWGA 3S7FA 4G26A 5EX3A 5G05J 4B94A 4G25A 3D9JA 2DBAA 4KT6B 1E8WA 3CHMA 4B8AA 2BTDA 2PM7A 4APFA 1FVHA 3CHOA 3D9PA 4BX9A 2GW1A 4U63A 4CT0A 3MYVA 3NZUA 4UWFA 4BT8A 3CVXA 2JEKA 4V3IA 5A7DB 1EPUA 3PDNA 3TXNA 3VLEA 2C0LA 3D9KA 5A23A 3CHSA 1ZBPA 1IQUA 1UJJA 2FI7A 3FTXA 2WXKA 2VSYA 3CQGB 4GZ3A 5LOZA 3AS4A 3L22A 3FEYA 3LYAA 3OXFA 4FADA 3QJZA 1UW4B 1NA0A 1HF8A 2XGOA 2FEZA 3GZ1A 4KMOA 1VDYA 2WXJA 1E8YA 1JPLA 5AENA 5FZSA 4GA0A 3CK8A 4ACLA 3CVUA 3D9IA 5ARGA 5DBKA 4BFRA 1N52A 4DJAA 3APDA 2L0TB 4WWNA 4J8SA 1B89A 4FLHA 2WXHA 3ESKA 2KZTB 3IV0A 3FUDA 3JCKC 3PEVB 5FQ8A 4RSYA 4DK5A 2PM6A 2ILRA 3FUHA 4KZ0A 3ZGQA 3Q49B 3CEQA 4U8HA 1H19A 3CVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASH A;  3EDT B;  5G05 C;  4YND A;  1HXI A;  3AS8 A;  5FTP A;  2XCC A;  4CDR A;  4HOR A;  3UQ3 A;  3UUX A;  3VTX A;  3FFL A;  2L6J A;  2C2L A;  4I9E A;  5BNW A;  2Q7F A;  3HYM B;  2UY1 B;  4H7Y A;  5HQ8 A;  3CK7 A;  2WQH A;  4I17 A;  4A1S A;  3R9A B;  2HO1 A;  3KS2 A;  4AY6 A;  4N39 A;  3S7J A;  3URZ A;  3QDN A;  4NRH B;  3QWW A;  3ASD A;  3Q4A B;  3ASF A;  3CV0 A;  4YVO A;  2IF4 A;  4RG6 A;  3SZ7 A;  3FWV A;  4UQZ A;  3RKV A;  3O48 A;  1ELR A;  4U0S A;  2KAT A;  5JJT A;  4WNG A;  2VQ2 A;  5CHE E;  1HH8 A;  5KJL A;  3GZ2 A;  1KT0 A;  5C1D A;  2UWJ G;  5LCW J;  4I2Z A;  2FO7 A;  2E2E A;  3LPZ A;  3S7B A;  4J8E A;  4IN3 B;  1W3B A;  1KLX A;  4HOU A;  4J8F A;  4U0Z A;  3U4T A;  3PE4 A;  5DIZ A;  3ZFW A;  4N3A A;  2OND A;  1NZN A;  2HR2 A;  4AM9 A;  5A6C A;  4WNE A;  3GYZ A;  2KC7 A;  1TJC A;  4YVQ C;  3NF1 A;  1A17 A;  4G24 A;  1WM5 A;  4Y6W A;  3ULQ A;  3U3W A;  5CCL A;  2LNI A;  4WUY A;  2FF4 A;  2LSU A;  5LCW C;  4BTA A;  4CGV A;  4U04 A;  4N3C A;  5D0Q D;  4XI9 A;  2PQR A;  4N2S A;  4BT9 A;  3QOU A;  4BTB A;  4N3B A;  2LSV A;  3LKU A;  3CVP A;  5G04 J;  5JJ6 A;  5BT1 A;  4EQF A;  4J0U A;  5D0O D;  3QWP A;  2XCB A;  2FBN A;  2HYZ A;  3PE3 A;  4H7X A;  4JA9 A;  4JL0 A;  3RIB A;  5KJM A;  4GYW A;  3LCA A;  4U07 A;  4O6F A;  2KCL A;  4UQX A;  1HZ4 A;  3ZHE A;  5FT9 A;  4KXK B;  3RO2 A;  3MEK A;  4RG9 A;  2Y4U A;  5CCM A;  3TAX A;  1P5Q A;  3RO3 A;  1KT1 A;  2V5F A;  4APO A;  4J8D A;  1QQE A;  3BEE A;  3CKC A;  4KBQ A;  1XNF A;  2XPI A;  5FZR A;  4HOT A;  2XEV A;  3ZPJ A;  4GYY A;  5KJN A;  2VGX A;  4I1A A;  3CVL A;  2UY1 A;  3WXX A;  3GW4 A;  4KYO B;  1E96 B;  1OUV A;  3Q5M A;  2XGM A;  2JLB A;  4W9R A;  3MA5 A;  4F3V A;  5ARF A;  5M72 A;  2PQN A;  5EX0 A;  3KAE A;  4HOQ A;  2YQ8 A;  3UPV A;  4ABN A;  3IEG A;  2P58 C;  4I9C A;  4G23 A;  3TGO A;  4GZ6 A;  1ELW A;  3RJV A;  4GA2 A;  3MV2 B;  4G1T A;  5JJ7 A;  4ME2 A;  3AS5 A;  3FP3 A;  2Y4T A;  3N71 A;  3LY8 A;  4XIF A;  3LY9 A;  2PL2 A;  4JA7 A;  3CK9 A;  3TG5 A;  3TG4 A;  5EKQ D;  2R5S A;  2MHK A;  3ZHE B;  4LEU A;  1IYG A;  1WAO 1;  3RU0 A;  2C0M A;  1FCH A;  3CKB A;  4AY5 A;  4GCO A;  4WNF A;  5KJK A;  1ZU2 A;  2NC9 A;  3OXG A;  4NQ0 A;  4U0U A;  4N2Q A;  4UI9 J;  2IFU A;  3KD7 A;  2VGX B;  3VTY A;  2YHC A;  1NA3 A;  3Q15 A;  4Y6C A;  4UQY A;  3MKR A;  3JYS A;  3OXL A;  5AYW D;  4HOS A;  5FZQ A;  5G04 C;  1YA0 A;  2AVP A;  1PC2 A;  4GCN A;  4WND A;  4CGW A;  5HI7 A;  3LY7 A;  3E4B A;  1IHG A;  4GZ5 A;  3Q47 B;  2J9Q A;  3QKY A;  2KCK A;  3SF4 A;  4AIF A;  2I6H A;  3ZN3 A;  4GPK A;  4I2W A;  3ASG A;  4N5C A;  2KCV A;  4GA1 A;  2VYI A;  3S7D A;  4UI9 K;  3QWV A;  1QZ2 A;  4UI9 C;  2VGY A;  2BUG A;  4GYO A;  3K9I A;  5BW8 C;  2WPV A;  3MV3 B;  2PZI A;  4JHR A;  1Y8M A;  2QFC A;  4BWR A;  5FJY A;  4G2V A;  2VSN A;  4XI0 A;  2OOE A;  3CVQ A;  2XGS A;  3S7F A;  4G26 A;  5EX3 A;  5G05 J;  4B94 A;  4G25 A;  2DBA A;  2GW1 A;  4BT8 A;  5A7D B;  3PDN A;  2C0L A;  1ZBP A;  2FI7 A;  2VSY A;  4GZ3 A;  3AS4 A;  3OXF A;  3LYA A;  1NA0 A;  2XGO A;  2FEZ A;  3GZ1 A;  5FZS A;  4GA0 A;  3CK8 A;  5ARG A;  5DBK A;  1B89 A;  3ESK A;  3ZGQ A;  3Q49 B;  3CEQ A;  3CVN A; 
#chains in the Genus database with same CATH topology
 4GMR A;  3DSV A;  3ZIM A;  3APF A;  4YND A;  1HXI A;  1H0A A;  5LP0 A;  4O1P A;  5ENR D;  4JZY A;  4CDR A;  3UQ3 A;  4JHK A;  4GTT A;  2GGF A;  3DXM G;  3FTY A;  3SFX A;  3DXK G;  2WXO A;  3UKR G;  2ZGD A;  2A4Z A;  5AJD A;  1JCR A;  3Q7A A;  1S0P A;  2P2C P;  1U3D A;  5AIJ A;  2IU1 A;  3KS2 A;  4CRW A;  3FH7 A;  2BF0 X;  4GB9 A;  5CEA A;  3UM2 A;  1HG2 A;  2ION A;  3SHF A;  2H6F A;  4JEU A;  5FQ6 A;  2GRL A;  4R7L A;  2VTB B;  3UKU G;  1O1R A;  5FQ7 A;  1LF8 A;  1TNZ A;  4OVV A;  3FUJ A;  5JJT A;  2NSZ A;  2AXU A;  3HXD A;  5KNG A;  2V8S E;  4WNG A;  4EBA A;  5CHE E;  3MJW A;  5EYL A;  4I1M A;  1KT0 A;  3I4R B;  2Y69 E;  5LCW J;  2DZN A;  3DSX A;  5BPP A;  1SZA A;  4U0Z A;  1E7U A;  3JQ1 A;  3OTN A;  2X6F A;  3ZYM A;  3ZFW A;  3JXI A;  2OND A;  4LUN U;  2H6H A;  3UM0 A;  3IHV A;  4JB8 P;  3FUK A;  2VGE A;  2BED A;  5FWQ A;  3GYZ A;  3FUM A;  3PRZ A;  4GML A;  4Y6W A;  3ULQ A;  3HG0 D;  2WXF A;  2EQX A;  1HG5 A;  5D0Q D;  4XI9 A;  4D10 C;  4AV7 A;  4FJY A;  4BT9 A;  1DCQ A;  2CHZ A;  4G8L A;  4NIK A;  2LSV A;  3CVP A;  3ONK A;  4HI9 A;  5D0O D;  5JHA A;  3QWP A;  3U64 A;  1FVF A;  3L54 A;  2H6I A;  4ACK A;  4LG6 A;  1UN8 A;  3RSE G;  4L23 A;  4A55 A;  3IBE A;  3EJN A;  3RO2 A;  3P2B A;  4ILI A;  4AXH A;  4NUR A;  1Z5S C;  1IXV A;  1KT1 A;  2V5F A;  3UXG A;  4B93 B;  3EHM A;  1QQE A;  3CKC A;  3DSS A;  5CMY A;  4EHM A;  4HI8 A;  4GMJ A;  1XNF A;  4U8V D;  2R05 A;  5FZR A;  4CDN A;  4HOT A;  2P9N G;  4UWL A;  3ABK E;  5KJN A;  5FQ4 A;  3LVQ E;  3ZXS A;  4E85 A;  1E8X A;  3GW4 A;  4KZC A;  1N95 A;  3FH5 A;  3EHQ A;  3TWV A;  4CZ2 D;  3RRN B;  2XZT G;  5BXU A;  1H2T C;  3F6Q A;  5ITZ F;  5C2Y A;  3JQ0 A;  5G55 A;  4XZ4 A;  3CGH A;  4GTP A;  2YQ8 A;  4FHK A;  2V0P A;  4EBA G;  3SFY A;  4OAU C;  2J08 A;  2L9B A;  4G23 A;  1OXJ A;  4B8C B;  3TGO A;  1HS6 A;  4GZ6 A;  2WXR A;  3RJV A;  3TWQ A;  4GA2 A;  3MV2 B;  4JEH A;  5JJ7 A;  4C9B B;  5ENN A;  5EDS A;  4EZL A;  1PAQ A;  3VLD A;  2ZIS A;  4MKT A;  4LNB A;  2LAI A;  2R5S A;  3D9L A;  1MX6 A;  5KWD A;  2MHK A;  4I6J A;  2DCP A;  4CCA A;  3AG1 E;  1E7V A;  2DZO A;  2LAH A;  4PS8 A;  3B7R L;  4HBD A;  2R17 C;  4A63 B;  4EEC A;  4O60 A;  2J4D A;  5KBA A;  4FJZ A;  5AQB A;  5CER B;  4LNU D;  4UI9 J;  3AG2 E;  3P1U A;  2YHC A;  3QNK A;  3CIA A;  5ANR A;  3MKR A;  3JYS A;  3Q7F A;  5AYW D;  4J6I A;  1E8Z A;  4L2Y A;  2EIN E;  4TUU A;  1OWO A;  4O1O A;  3ZYQ A;  4ANX A;  3I5P A;  2XPZ A;  3T8M A;  3FTU A;  1S63 A;  1K3Z D;  3ASG A;  4BEP A;  3Q9N C;  1N11 A;  3MX3 A;  3CHP A;  2VYI A;  1BPO A;  1N94 A;  2RD0 A;  4DLQ A;  3C72 A;  5BW8 C;  2WPV A;  3HDX A;  4FHJ A;  2QFC A;  3R7Q A;  4G2V A;  2WXP A;  5LFA A;  3T9K A;  1YMP A;  2DWZ A;  1N4P A;  4B94 A;  1O1T A;  2BTD A;  3E34 A;  1KZP A;  5AN8 A;  3MYV A;  3NZU A;  3CVX A;  4V3I A;  1N0R A;  3CHS A;  1ZBP A;  3FTX A;  2WXK A;  5LOZ A;  3OXF A;  3LYA A;  4Z68 A;  4DRX E;  2RKK A;  4ACL A;  1SA5 A;  3ASO E;  4BFR A;  5DBK A;  2GRP B;  2L0T B;  4J8S A;  3IV0 A;  3FUD A;  2PM6 A;  3ZGQ A;  4U8H A;  3UI2 A;  3CVN A;  3ASH A;  1MX4 A;  3EDT B;  4K0R A;  3PUJ A;  1OWL A;  2WXG A;  3SFZ A;  1INZ A;  1Z3Y A;  1OCZ E;  4DX7 D;  3FTS A;  3UUX A;  3VTX A;  1TJF A;  2IY0 C;  3ZU7 B;  3BG1 B;  2C2L A;  4I9E A;  5EIL A;  1X5B A;  3HYM B;  2WQ6 A;  2UY1 B;  5HQ8 A;  4CT4 A;  1EDU A;  3DPY A;  4KVO A;  2WQH A;  4I17 A;  2VSX E;  3FH8 A;  4JHJ A;  4I6G A;  1TN6 A;  4N39 A;  2E0I A;  4L7T A;  3S7J A;  3URZ A;  1HU3 A;  1H2V C;  4NRH B;  3Q4A B;  2F37 A;  3CV0 A;  2XRZ A;  3ZW3 A;  4M7C A;  1TNB A;  2ETC A;  3SZ7 A;  3L17 A;  3CVV A;  3RKV A;  5JA4 D;  4GZC A;  2I9C A;  2WXM A;  3V30 A;  3PRE A;  2VQ2 A;  1HH8 A;  3V2X A;  3CHQ A;  5C1D A;  3AAA C;  3TWS A;  4LSZ E;  2FO7 A;  2OEV A;  1N54 A;  1W3B A;  3NZS A;  4HVB A;  3Q9U C;  3E32 A;  3ZYK A;  1UJK A;  1NZN A;  1AP7 A;  4AM9 A;  2XEE A;  4Q69 A;  3HVE A;  3TJP A;  2CG3 A;  3LVR E;  3AG3 E;  2KC7 A;  5T3R A;  3IXE A;  3APC A;  3NF1 A;  3HXB A;  5JMN D;  2V5Q C;  5BV0 A;  5CCL A;  4WUY A;  2FF4 A;  2LSU A;  4CDM A;  4GU5 A;  3FTV A;  3W9G A;  3KEA A;  4AEZ C;  2PQR A;  4PS7 A;  1QYM A;  5BT1 A;  2XRY A;  3J5P A;  4J0U A;  3WG7 E;  3JUI A;  4LER A;  3RK6 A;  3ZNG A;  1HO8 A;  3PE3 A;  4JL0 A;  5CBN A;  3SO8 A;  1EYH A;  1JCS A;  5FT9 A;  4KXK B;  4UWH A;  3MEK A;  1FPP A;  4ANW A;  2Y4U A;  3W9F A;  4JVS A;  4J8D A;  3NB2 A;  4ANV A;  2LXL A;  1XGW A;  3C98 A;  2DYR E;  3Q75 A;  3EUV A;  3SQV A;  5D66 A;  4JD2 G;  3CQC B;  4Q96 A;  4HRL A;  4DI3 A;  2VGX A;  4I1A A;  3U9W A;  3CVL A;  2KXP C;  3EIQ C;  3WXX A;  2J49 A;  1SQM A;  3FY4 A;  4KYO B;  1SW6 A;  1E96 B;  1OUV A;  3Q5M A;  5H7P A;  4RLY A;  2KBX A;  2H6G A;  3FUN A;  3MA5 A;  5LX8 A;  3MKQ A;  4F3V A;  3QC1 A;  5ARF A;  3Q73 A;  2HM8 A;  1JWF A;  1H6P A;  3G2S A;  4M3O A;  3GZS A;  1OCO E;  1BLX B;  2CHW A;  3SBT B;  3ZXP A;  4ABN A;  2QYJ A;  4IRU A;  4BSZ B;  2P58 C;  4I9C A;  4F53 A;  4JC8 A;  3FUI A;  4N5Q A;  2DVW A;  1IKN D;  4C0E A;  3UMV A;  3ZYL A;  5AQ9 A;  4ME2 A;  1Z6T A;  2Y4T A;  3B7T A;  4BES A;  2AWI A;  1MJ0 A;  4JPS A;  3PEU B;  3LY9 A;  3ULE G;  4P29 A;  2IO2 C;  1K1A A;  3TG4 A;  3NOG D;  1S64 A;  2XPY A;  3G2U A;  2DIW A;  1L5J A;  3RU0 A;  3B95 A;  3L08 A;  3CKB A;  3ABL E;  4DPR A;  4GCO A;  3PNL B;  1OCC E;  2P9U G;  4UWK A;  3UM1 A;  2AW6 A;  5CMW A;  4NQ0 A;  2X6I A;  3LJN A;  3Q78 A;  2VJ8 A;  4K5C A;  1H6O A;  4Q94 A;  1WY6 A;  4HLL A;  2IFU A;  2VGX B;  2XS1 A;  2X38 A;  4Y6C A;  3OXL A;  1YA0 A;  2WXL A;  4GCN A;  2X3M A;  4YDO A;  4CGW A;  4TRQ A;  3DEO A;  1IHG A;  3ONL A;  2YNQ A;  4ANU A;  2YIN A;  3MKQ B;  2J9Q A;  2R03 A;  1HX8 A;  3UX4 A;  3NQP A;  3QK0 A;  1ELK A;  3T8K A;  2WXI A;  4PUC A;  2MRI A;  3HXC A;  4XKC A;  3EU5 A;  2B6C A;  4AIF A;  3ZN3 A;  4GA1 A;  3ZEF A;  2R2L A;  5KCM A;  1MYO A;  2NYJ A;  2VGY A;  2BUG A;  4MBG A;  4GYO A;  4K5B A;  4TXQ A;  4X8Q A;  4HRN A;  1Y8M A;  4BWR A;  3Q79 A;  4F1P A;  3PZ4 A;  3G2V A;  1OT8 A;  5J90 A;  2OOE A;  2ZU6 B;  1JWG A;  1TN8 A;  5EYP F;  4G25 A;  4ATZ D;  5B3S E;  3UM3 A;  1YCS B;  4J7W A;  3D9P A;  4U63 A;  4UWF A;  3PDN A;  1IHB A;  5A23 A;  3ABM E;  1IQU A;  2FI7 A;  5AAR A;  3AS4 A;  3L22 A;  3FEY A;  4FAD A;  1UW4 B;  5FIN A;  1NA0 A;  1HF8 A;  4KMO A;  1VDY A;  1JPL A;  4GA0 A;  4DJA A;  1B89 A;  1QBQ A;  4FLH A;  2WXH A;  3JCK C;  5FQ8 A;  1WDY A;  2F8Y A;  2ILR A;  3FUH A;  3L9T A;  1LD7 A;  4FUL A;  5G05 C;  4PS3 A;  2ETA A;  2ETB A;  3KEZ A;  5AAO A;  2XCC A;  4GTO A;  4HOR A;  3D9N A;  5E76 A;  3FFL A;  1NI1 A;  2L6J A;  3NOC D;  2Y3A A;  3T5X A;  3DST A;  2Q7F A;  3PZ1 A;  3ISM C;  1UN9 A;  4H7Y A;  2FO1 E;  3HIZ A;  4F1S A;  3R9A B;  1S70 B;  2HO1 A;  3PS6 A;  4AY6 A;  2XHE A;  4MS6 A;  3FUF A;  5AQ7 A;  3CVW A;  2P9K G;  1Y6I A;  3QDN A;  1DVP A;  3QWW A;  3ASD A;  4PDX A;  3ASF A;  4FU3 A;  4YVO A;  2IF4 A;  3MZL B;  2RG8 A;  3SY2 A;  2WB2 A;  1SA4 A;  4UQZ A;  4GTS A;  4I43 A;  4OVU A;  4UUC A;  2WXN A;  3HRA A;  2ZIR A;  4BY6 A;  2LO6 A;  1JCQ A;  5ENQ D;  5KJL A;  3GZ2 A;  2J09 A;  1D8D A;  4I2Z A;  5BV1 A;  3S7B A;  2VSO E;  4J8E A;  1TEZ A;  4WWO A;  3TWT A;  4HOU A;  3U4T A;  1H2U A;  4TXR A;  4A1G A;  1FT2 A;  3E37 A;  4GTM A;  4GTV A;  2AXZ A;  2R59 A;  3PZD A;  2GRQ B;  1E90 A;  2X6J A;  2GRM A;  2A5U A;  2HR2 A;  2WM9 A;  3D9O A;  3DSU A;  5A6C A;  4J8Y A;  4WNE A;  3MCX A;  1UOH A;  1TJC A;  4YVQ C;  4G24 A;  1WM5 A;  3U3W A;  1KZO A;  2M63 A;  3SBS A;  4CGV A;  4U04 A;  5AJL A;  4L2L A;  3C3R A;  1BD8 A;  3DBS A;  4N2S A;  4RQI A;  4BTB A;  2QYU A;  4N3B A;  3LKU A;  4F7A A;  2DYS E;  4EQF A;  2AXV A;  1N0Q A;  2XCB A;  3SI5 A;  4L9P A;  2XEN A;  2HYZ A;  5EID A;  4H7X A;  5KJM A;  3RIB A;  5IY5 E;  4GYW A;  3LCA A;  4O6F A;  5CEC B;  4UQX A;  3PNT B;  4MLP A;  5B1A E;  3FUE A;  3BUA A;  1N9A A;  1BI7 B;  1IQR A;  3PH0 C;  2OEW A;  3BEE A;  2MOW A;  1WG0 A;  2L6B A;  4GZD A;  3I3N A;  2XPI A;  3SNX A;  3NAW A;  4WWP A;  3EIJ A;  3V31 A;  4ILG A;  4DX2 A;  3LS8 A;  3G2W A;  5G2N A;  5FIO A;  4U7E B;  2X6K A;  3UTM A;  2GRR B;  3T5V A;  5ENO D;  1K8K G;  1TR4 A;  2JLB A;  4W9R A;  3L13 A;  3DEP A;  4FC8 A;  2PQN A;  4OAV B;  1TN7 A;  3RAU A;  2VTB A;  1MZC A;  2KM4 A;  4RVB A;  2J4B A;  4A3T A;  2IEJ A;  3C3Q A;  3LXU X;  3B7B A;  5CRU A;  5T4Y A;  1ELW A;  4IYP A;  1MHQ A;  2WMN A;  1OWP A;  2P9P G;  4LCT A;  2CHX A;  3FHE A;  4DLO A;  3CHR A;  3V79 K;  3AS5 A;  3N71 A;  4XIF A;  2PL2 A;  4JA7 A;  3TG5 A;  4E6H A;  2EIL E;  3RRM B;  5EKQ D;  2IOS A;  4TXP A;  1NP7 A;  4GAA A;  3AJI A;  3FU5 A;  4FLB A;  3R9M A;  1IYG A;  3QAQ A;  1WAO 1;  4HFG A;  1PY1 A;  1UG3 A;  4HXI A;  4AY5 A;  2X6H A;  2WXQ A;  3G2T A;  2FUL A;  5KJK A;  2KZT A;  2NC9 A;  3OXG A;  5HKP A;  1OWM A;  3LEW A;  3L82 A;  3FEX A;  3KD7 A;  1HE8 A;  5HS0 A;  3VTY A;  4LRZ A;  3Q15 A;  3X2Q E;  2QY7 A;  3CLJ A;  4HOS A;  5FZQ A;  3IHY A;  3D3M A;  1PC2 A;  4WND A;  3S2A A;  4A3V A;  1X81 A;  2GRN B;  1NL4 A;  4DX5 D;  3L16 A;  1DC2 A;  3PZ2 A;  2V4L A;  3RRU A;  3R7R A;  4I2W A;  4GPK A;  4N5C A;  2KCV A;  4UI9 K;  3HHM A;  3B7S A;  3QWV A;  2WMO A;  2IQC A;  3O4Z A;  4EZJ A;  4AVX A;  3K9I A;  3MV3 B;  3DWL G;  3HVE B;  2PZI A;  4JHR A;  2VSN A;  4XI0 A;  1KPS B;  5ANL A;  1A5E A;  1BU9 A;  2XGS A;  3QAR A;  5G05 J;  2EIM E;  2P9S G;  4LNG A;  4KT6 B;  2EIK E;  3CHM A;  4U8Y D;  2LXM A;  1FVH A;  4CT0 A;  2JEK A;  3TXN A;  3VLE A;  4C48 B;  3D9K A;  1UJJ A;  2VSY A;  4GZ3 A;  2J8S D;  1Q2Z A;  2XGO A;  2FEZ A;  3GZ1 A;  4QQI A;  4HB5 A;  4TUM A;  2OCC E;  1E8Y A;  5FZS A;  3CVU A;  3D9I A;  3APD A;  2KZT B;  4DK5 A;  1D8E A;  4GPM A;  2EIJ E;  3CEQ A;  2QZA A;  3CR3 A;  3AS8 A;  4NAC A;  5FTP A;  3EHN A;  4GTQ A;  4B89 A;  2Y1L E;  1ZB1 A;  3TXM A;  2WQ7 A;  3B7U X;  1G3N B;  3E33 A;  2IJG X;  4AP2 A;  3ULY A;  5BNW A;  5EN5 D;  3AG4 E;  2CFU A;  3HXE A;  3CK7 A;  5ENT D;  4A1S A;  3FU3 A;  2CG2 A;  2L0I A;  1HFA A;  2RFM A;  4QFV A;  4EPZ A;  4BER A;  2NXP A;  3TWU A;  1GW6 A;  2A5E A;  3I4G A;  3ENE A;  2ZXW E;  3AU5 A;  4DI4 A;  4RG6 A;  4XX5 A;  3FWV A;  3TL5 A;  2I1J A;  3UT4 A;  3O48 A;  1ELR A;  4U0S A;  4DX6 D;  2KAT A;  2IOL A;  2BKK B;  3BU8 A;  3KSL A;  3TWW A;  3LDZ A;  4ZFH A;  3JUE A;  4U96 D;  2UWJ G;  2E2E A;  3LPZ A;  4IN3 B;  1KLX A;  1OWN A;  4J8F A;  3PE4 A;  1H6K A;  5DIZ A;  4N3A A;  2XS8 A;  3FTZ A;  2JAB A;  2P9L G;  3EU9 A;  1A17 A;  2HE0 A;  4U95 D;  1DNP A;  2LNI A;  2ZGG A;  4MRU A;  4AOF A;  5LCW C;  4K5A B;  4BTA A;  4BET A;  1RZ4 A;  4N3C A;  3IKO B;  5HRY A;  5JHB A;  2PNN A;  2GRO B;  2BKG A;  4I1O B;  4YDW A;  3EHR A;  3QOU A;  4FA6 A;  1D9S A;  1RW2 A;  4DX1 A;  5G04 J;  5JJ6 A;  2QC9 A;  4DUI A;  2IO3 C;  3UIP C;  4I6E A;  2OVB A;  4F6R D;  2F8X K;  3SD5 A;  3OAW A;  3UT7 A;  2FBN A;  1TNU A;  1TYQ G;  3C5R A;  2Y0B G;  4JA9 A;  3JXJ A;  1TNO A;  3ZUV B;  5EIB E;  4G11 A;  4U07 A;  3PUK A;  4IUL A;  3ZRH A;  2KCL A;  1HZ4 A;  4XE0 A;  3ZHE A;  4RG9 A;  5CCM A;  3TAX A;  1P5Q A;  3RO3 A;  1OY3 D;  4APO A;  3PVL A;  3VLF A;  3FU0 A;  4KBQ A;  5AQA A;  4HLE A;  4CYM D;  5ENS D;  4K03 A;  2XEV A;  3ZPJ A;  3FUL A;  4GYY A;  4TV3 A;  5T8I A;  2UY1 A;  2I2O A;  1K1B A;  1SVX A;  2RFA A;  2XGM A;  4HRM B;  1V54 E;  3ZVV A;  3BQO A;  2YHE A;  3FDH A;  5ENP D;  3ML8 A;  3ESL A;  5M72 A;  2I1K A;  4HS2 A;  4EZK A;  2MYO A;  4C0M A;  3NBN B;  2XZD G;  5EX0 A;  1NFI E;  1AWC B;  3FU6 A;  3KAE A;  4HOQ A;  3FTW A;  3SGH A;  1SZ9 A;  4PH4 B;  3CST A;  5CBO A;  4ATG A;  3UPV A;  4OYS A;  4WAF A;  3TWR A;  2OVF A;  3IEG A;  3L6A A;  3D9M A;  4KVM A;  1FT1 A;  1OCR E;  4XEI G;  4XKB A;  4G1T A;  3DSW A;  3D9H A;  3FP3 A;  1EF1 C;  5CED B;  2AJA A;  3LY8 A;  3J5Q B;  3CK9 A;  4JXT A;  1MQS A;  1V55 E;  2R02 A;  5CRV A;  3ZHE B;  4LEU A;  1U2V G;  1N4R A;  5B1B E;  2CFZ A;  3AU4 A;  2C0M A;  4BX8 A;  1FCH A;  4YDE A;  4WNF A;  1ZU2 A;  2XEH A;  2P9I G;  3UT8 A;  4BSX A;  1O1S A;  3LJ3 A;  4U0U A;  3UIN C;  1TNY A;  4ILH B;  4N2Q A;  5BXO A;  3DRA A;  1LTX A;  4B0Z A;  1BI8 B;  1NA3 A;  1N4S A;  3MGB A;  4UQY A;  4URK A;  5E75 A;  2OV8 A;  5G04 C;  1DCE A;  1U3C A;  2AVP A;  3DPD A;  5HI7 A;  3LY7 A;  3E4B A;  4GZ5 A;  3Q47 B;  4JW1 A;  4GTR A;  2WVI A;  4AJW A;  3QKY A;  5J08 A;  2KCK A;  5D2M C;  1MX2 A;  3V2O A;  3U66 A;  4YDY A;  3ML9 A;  4CEM A;  3SF4 A;  2I6H A;  1JUQ A;  3C3O A;  2F0Y A;  2J07 A;  3QB2 A;  3S7D A;  1QNF A;  1QZ2 A;  1N4Q A;  4HNA D;  4UI9 C;  3BG0 B;  3ZKJ A;  3CVY A;  3B13 A;  3CSF A;  1Z3X A;  4L1B A;  5FJY A;  4UWG A;  2B0O E;  2XQ0 A;  5BUZ A;  4G8K A;  3KSQ A;  4FP7 A;  4HQD A;  3CVQ A;  3E30 A;  3S7F A;  4G26 A;  5EX3 A;  3PZ3 A;  1O5M A;  2LUH A;  5KNH D;  3D9J A;  2DBA A;  1E8W A;  2V4H C;  4B8A A;  2PM7 A;  4APF A;  3CHO A;  4BX9 A;  2GW1 A;  4BT8 A;  5A7D B;  1EPU A;  2C0L A;  3CQG B;  3UIO C;  3QJZ A;  3TWX A;  2WXJ A;  3HXF A;  5AEN A;  3ASN E;  3CK8 A;  5ARG A;  1LD8 A;  1N52 A;  4WWN A;  3PEV B;  3ESK A;  1YYH A;  4RSY A;  4KZ0 A;  4ZHB A;  3Q49 B;  1H19 A; 
#chains in the Genus database with same CATH homology
 3ASH A;  4FUL A;  3ZIM A;  3APF A;  3EDT B;  5G05 C;  4K0R A;  4YND A;  3CR3 A;  4PS3 A;  1HXI A;  3PUJ A;  3AS8 A;  1H0A A;  3KEZ A;  1OWL A;  2WXG A;  3EHN A;  4NAC A;  5FTP A;  3SFZ A;  1Z3Y A;  4B89 A;  1INZ A;  3TXM A;  2WQ7 A;  2XCC A;  3FTS A;  4JZY A;  4CDR A;  4HOR A;  3D9N A;  3UQ3 A;  5E76 A;  4JHK A;  3UUX A;  3B7U X;  3FFL A;  3VTX A;  2GGF A;  3FTY A;  2IJG X;  1TJF A;  2L6J A;  4AP2 A;  3BG1 B;  2Y3A A;  2C2L A;  3T5X A;  4I9E A;  5BNW A;  1X5B A;  2Q7F A;  2WXO A;  2A4Z A;  3HYM B;  5AJD A;  2WQ6 A;  2UY1 B;  1UN9 A;  4H7Y A;  5HQ8 A;  1S0P A;  2CFU A;  4CT4 A;  1EDU A;  3CK7 A;  4KVO A;  2WQH A;  4I17 A;  2VSX E;  3FH8 A;  4A1S A;  3FU3 A;  3HIZ A;  1U3D A;  4F1S A;  3R9A B;  2CG2 A;  4JHJ A;  2L0I A;  5AIJ A;  2HO1 A;  1HFA A;  2IU1 A;  4I6G A;  3KS2 A;  3PS6 A;  4AY6 A;  4N39 A;  2E0I A;  4L7T A;  3S7J A;  4CRW A;  3URZ A;  1HU3 A;  2XHE A;  4MS6 A;  3FUF A;  3CVW A;  3FH7 A;  4QFV A;  4EPZ A;  2BF0 X;  4GB9 A;  1H2V C;  1Y6I A;  2NXP A;  3QDN A;  1DVP A;  1GW6 A;  4NRH B;  3QWW A;  3ASD A;  1HG2 A;  2ION A;  3SHF A;  3Q4A B;  4PDX A;  3ASF A;  3I4G A;  3ENE A;  3CV0 A;  4FU3 A;  4JEU A;  4YVO A;  5FQ6 A;  2GRL A;  4R7L A;  2IF4 A;  3AU5 A;  2XRZ A;  3ZW3 A;  4DI4 A;  4RG6 A;  4XX5 A;  2VTB B;  3MZL B;  3SZ7 A;  5FQ7 A;  2RG8 A;  3FWV A;  1LF8 A;  3L17 A;  3TL5 A;  2WB2 A;  3CVV A;  2I1J A;  3UT4 A;  4UQZ A;  3RKV A;  3O48 A;  1ELR A;  4U0S A;  2KAT A;  4I43 A;  4OVU A;  4OVV A;  3FUJ A;  4GZC A;  5JJT A;  2I9C A;  2NSZ A;  2IOL A;  2WXN A;  2WXM A;  2AXU A;  2V8S E;  3LDZ A;  3PRE A;  4WNG A;  4BY6 A;  4EBA A;  2VQ2 A;  5CHE E;  1HH8 A;  3MJW A;  2LO6 A;  3CHQ A;  5KJL A;  3GZ2 A;  1KT0 A;  4I1M A;  5C1D A;  3I4R B;  2UWJ G;  2J09 A;  5LCW J;  4I2Z A;  2FO7 A;  2E2E A;  5BV1 A;  3LPZ A;  3S7B A;  2VSO E;  4J8E A;  4IN3 B;  1TEZ A;  1N54 A;  4WWO A;  1W3B A;  1KLX A;  1OWN A;  4HOU A;  5BPP A;  4J8F A;  1SZA A;  3NZS A;  4U0Z A;  3U4T A;  1E7U A;  1H2U A;  4HVB A;  3PE4 A;  1H6K A;  3JQ1 A;  3OTN A;  2X6F A;  5DIZ A;  4A1G A;  3ZYM A;  3ZFW A;  4N3A A;  2OND A;  2AXZ A;  2R59 A;  3PZD A;  4LUN U;  3IHV A;  1E90 A;  3ZYK A;  1UJK A;  1NZN A;  2X6J A;  3FUK A;  2GRM A;  2A5U A;  2HR2 A;  2WM9 A;  3D9O A;  3FTZ A;  4AM9 A;  5A6C A;  4Q69 A;  3HVE A;  3TJP A;  4WNE A;  3MCX A;  5FWQ A;  2CG3 A;  3GYZ A;  3FUM A;  3LVR E;  2KC7 A;  3PRZ A;  1TJC A;  4YVQ C;  5T3R A;  4GML A;  3APC A;  3NF1 A;  1A17 A;  4G24 A;  1WM5 A;  4Y6W A;  3ULQ A;  3U3W A;  5BV0 A;  2WXF A;  1DNP A;  2LNI A;  5CCL A;  4WUY A;  2FF4 A;  2M63 A;  2LSU A;  4CDM A;  4MRU A;  4AOF A;  4GU5 A;  5LCW C;  4BTA A;  3SBS A;  4CGV A;  3FTV A;  2EQX A;  4U04 A;  5AJL A;  1HG5 A;  4L2L A;  4N3C A;  3IKO B;  5D0Q D;  5JHB A;  4XI9 A;  4D10 C;  4AEZ C;  4AV7 A;  2PQR A;  3DBS A;  4FJY A;  4PS7 A;  4N2S A;  4BT9 A;  2CHZ A;  4I1O B;  4FA6 A;  3QOU A;  4BTB A;  4N3B A;  2LSV A;  3LKU A;  3CVP A;  5G04 J;  5JJ6 A;  2XRY A;  4F7A A;  5BT1 A;  3ONK A;  4EQF A;  4J0U A;  4I6E A;  3JUI A;  2OVB A;  5D0O D;  2AXV A;  5JHA A;  3SD5 A;  3QWP A;  4LER A;  2XCB A;  3SI5 A;  3OAW A;  3U64 A;  2FBN A;  3UT7 A;  3RK6 A;  1HO8 A;  2HYZ A;  1FVF A;  3PE3 A;  4H7X A;  4JA9 A;  3L54 A;  4JL0 A;  3RIB A;  5KJM A;  4GYW A;  3LCA A;  4ACK A;  4G11 A;  4U07 A;  1UN8 A;  3PUK A;  4O6F A;  4IUL A;  4L23 A;  3ZRH A;  2KCL A;  1EYH A;  3PNT B;  1HZ4 A;  4MLP A;  4UQX A;  4A55 A;  4XE0 A;  3ZHE A;  5FT9 A;  4KXK B;  4UWH A;  3FUE A;  3IBE A;  3EJN A;  3RO2 A;  3MEK A;  3P2B A;  4ILI A;  4AXH A;  4ANW A;  4NUR A;  4RG9 A;  2Y4U A;  5CCM A;  3TAX A;  1P5Q A;  3RO3 A;  4JVS A;  1KT1 A;  2V5F A;  1IQR A;  4APO A;  3PH0 C;  4J8D A;  3EHM A;  1QQE A;  3BEE A;  3CKC A;  2MOW A;  3PVL A;  5CMY A;  3VLF A;  4GZD A;  3I3N A;  4ANV A;  4GMJ A;  3FU0 A;  4KBQ A;  1XNF A;  2XPI A;  4HLE A;  1XGW A;  3C98 A;  3SNX A;  5FZR A;  4CDN A;  4K03 A;  4HOT A;  2XEV A;  3CQC B;  4Q96 A;  3ZPJ A;  3FUL A;  4WWP A;  4GYY A;  4TV3 A;  3EIJ A;  5T8I A;  4ILG A;  4UWL A;  4DI3 A;  5KJN A;  2VGX A;  4I1A A;  5FQ4 A;  3LVQ E;  3U9W A;  3CVL A;  3ZXS A;  2UY1 A;  4E85 A;  3EIQ C;  3LS8 A;  3G2W A;  3WXX A;  2I2O A;  1E8X A;  2J49 A;  3GW4 A;  5G2N A;  4KZC A;  1SQM A;  3FY4 A;  4KYO B;  1E96 B;  1OUV A;  3Q5M A;  3FH5 A;  2XGM A;  2X6K A;  3T5V A;  3ZVV A;  2JLB A;  3RRN B;  4W9R A;  3L13 A;  2YHE A;  3FUN A;  3MA5 A;  3FDH A;  5LX8 A;  4FC8 A;  1H2T C;  3MKQ A;  4F3V A;  3QC1 A;  3ML8 A;  3ESL A;  5ARF A;  5M72 A;  2I1K A;  2PQN A;  2HM8 A;  4HS2 A;  4EZK A;  1JWF A;  4C0M A;  5EX0 A;  3G2S A;  3FU6 A;  5C2Y A;  3KAE A;  4M3O A;  3JQ0 A;  4HOQ A;  5G55 A;  4XZ4 A;  3CGH A;  3FTW A;  3GZS A;  2VTB A;  3SGH A;  2KM4 A;  1SZ9 A;  4PH4 B;  3CST A;  4RVB A;  2YQ8 A;  4ATG A;  2CHW A;  2J4B A;  3SBT B;  4A3T A;  4FHK A;  3UPV A;  4OYS A;  2V0P A;  4WAF A;  4ABN A;  4EBA G;  2OVF A;  3IEG A;  4IRU A;  2P58 C;  4I9C A;  4F53 A;  5LP0 A;  4JC8 A;  2J08 A;  2L9B A;  3FUI A;  3LXU X;  4G23 A;  3L6A A;  4B8C B;  5T4Y A;  1HS6 A;  3TGO A;  3D9M A;  4GZ6 A;  1ELW A;  4IYP A;  1MHQ A;  2WXR A;  4KVM A;  3RJV A;  2WMN A;  4C0E A;  1OWP A;  4LCT A;  2CHX A;  3UMV A;  3FHE A;  4GA2 A;  3ZYL A;  4DLO A;  3MV2 B;  3CHR A;  4XKB A;  4G1T A;  4JEH A;  4ME2 A;  5JJ7 A;  3AS5 A;  3FP3 A;  4C9B B;  5ENN A;  1Z6T A;  5EDS A;  2Y4T A;  3B7T A;  1EF1 C;  2AWI A;  3N71 A;  4JPS A;  4EZL A;  3LY8 A;  3PEU B;  4XIF A;  3LY9 A;  2PL2 A;  4JA7 A;  3CK9 A;  1PAQ A;  3TG5 A;  3VLD A;  4JXT A;  1MQS A;  4MKT A;  4P29 A;  4E6H A;  2LAI A;  3RRM B;  3TG4 A;  5EKQ D;  2IOS A;  2R5S A;  3D9L A;  1NP7 A;  4GAA A;  3FU5 A;  4FLB A;  2MHK A;  2XPY A;  3G2U A;  2DIW A;  4I6J A;  3ZHE B;  4LEU A;  2DCP A;  1IYG A;  4CCA A;  3QAQ A;  1WAO 1;  1L5J A;  3RU0 A;  2CFZ A;  3L08 A;  4HFG A;  3AU4 A;  1PY1 A;  2C0M A;  1E7V A;  4BX8 A;  2LAH A;  4PS8 A;  1UG3 A;  1FCH A;  3CKB A;  3B7R L;  4HXI A;  4AY5 A;  2X6H A;  2WXQ A;  4DPR A;  3G2T A;  4GCO A;  3PNL B;  2FUL A;  4WNF A;  5KJK A;  2KZT A;  2R17 C;  1ZU2 A;  4UWK A;  2NC9 A;  3OXG A;  2AW6 A;  4EEC A;  5CMW A;  4NQ0 A;  2J4D A;  2X6I A;  1OWM A;  3UT8 A;  4FJZ A;  2VJ8 A;  4BSX A;  3LJ3 A;  3LEW A;  4U0U A;  4ILH B;  4Q94 A;  4N2Q A;  4UI9 J;  1WY6 A;  3FEX A;  4B0Z A;  2IFU A;  3KD7 A;  1HE8 A;  2VGX B;  3VTY A;  4LRZ A;  3P1U A;  2X38 A;  2YHC A;  1NA3 A;  3Q15 A;  3QNK A;  3CIA A;  4Y6C A;  3MGB A;  5ANR A;  4UQY A;  2QY7 A;  3CLJ A;  4URK A;  3MKR A;  3JYS A;  3OXL A;  5AYW D;  4HOS A;  5E75 A;  2OV8 A;  4J6I A;  1E8Z A;  5FZQ A;  5G04 C;  3IHY A;  1U3C A;  1YA0 A;  2AVP A;  3D3M A;  1PC2 A;  2WXL A;  4GCN A;  4WND A;  2X3M A;  4CGW A;  3S2A A;  3DPD A;  4L2Y A;  3LY7 A;  4TRQ A;  5HI7 A;  4A3V A;  3E4B A;  1IHG A;  4GZ5 A;  3ONL A;  3Q47 B;  2YNQ A;  4ANU A;  4JW1 A;  2YIN A;  4TUU A;  1OWO A;  3MKQ B;  2J9Q A;  2WVI A;  3QKY A;  4AJW A;  5J08 A;  1HX8 A;  3ZYQ A;  3UX4 A;  3NQP A;  3QK0 A;  4ANX A;  3I5P A;  2KCK A;  1ELK A;  3U66 A;  3L16 A;  2WXI A;  2XPZ A;  4PUC A;  3ML9 A;  2MRI A;  3FTU A;  3SF4 A;  3T8M A;  4CEM A;  4XKC A;  2V4L A;  4AIF A;  2I6H A;  3RRU A;  3ZN3 A;  3R7R A;  4I2W A;  3ASG A;  4GPK A;  4N5C A;  2KCV A;  4GA1 A;  3MX3 A;  1JUQ A;  3ZEF A;  3CHP A;  2J07 A;  3QB2 A;  2VYI A;  3S7D A;  1BPO A;  3HHM A;  4UI9 K;  2RD0 A;  1QNF A;  3B7S A;  4DLQ A;  3QWV A;  1QZ2 A;  2IQC A;  2WMO A;  4UI9 C;  3O4Z A;  5KCM A;  4EZJ A;  2VGY A;  4AVX A;  2BUG A;  4GYO A;  3K9I A;  5BW8 C;  2WPV A;  3MV3 B;  3BG0 B;  3HDX A;  3HVE B;  2PZI A;  4JHR A;  1Y8M A;  4FHJ A;  3CVY A;  2QFC A;  3B13 A;  3CSF A;  3R7Q A;  1Z3X A;  4L1B A;  5FJY A;  4UWG A;  4BWR A;  4G2V A;  2WXP A;  2VSN A;  2XQ0 A;  3G2V A;  5LFA A;  4XI0 A;  5BUZ A;  4FP7 A;  5ANL A;  5J90 A;  2OOE A;  2ZU6 B;  2XGS A;  3CVQ A;  3QAR A;  1JWG A;  3S7F A;  4G26 A;  5EX3 A;  5G05 J;  4B94 A;  4G25 A;  3D9J A;  2DBA A;  4KT6 B;  1E8W A;  3CHM A;  4B8A A;  2BTD A;  2PM7 A;  4APF A;  1FVH A;  3CHO A;  3D9P A;  4BX9 A;  2GW1 A;  4U63 A;  4CT0 A;  3MYV A;  3NZU A;  4UWF A;  4BT8 A;  3CVX A;  2JEK A;  4V3I A;  5A7D B;  1EPU A;  3PDN A;  3TXN A;  3VLE A;  2C0L A;  3D9K A;  5A23 A;  3CHS A;  1ZBP A;  1IQU A;  1UJJ A;  2FI7 A;  3FTX A;  2WXK A;  2VSY A;  3CQG B;  4GZ3 A;  5LOZ A;  3AS4 A;  3L22 A;  3FEY A;  3LYA A;  3OXF A;  4FAD A;  3QJZ A;  1UW4 B;  1NA0 A;  1HF8 A;  2XGO A;  2FEZ A;  3GZ1 A;  4KMO A;  1VDY A;  2WXJ A;  1E8Y A;  1JPL A;  5AEN A;  5FZS A;  4GA0 A;  3CK8 A;  4ACL A;  3CVU A;  3D9I A;  5ARG A;  5DBK A;  4BFR A;  1N52 A;  4DJA A;  3APD A;  2L0T B;  4WWN A;  4J8S A;  1B89 A;  4FLH A;  2WXH A;  3ESK A;  2KZT B;  3IV0 A;  3FUD A;  3JCK C;  3PEV B;  5FQ8 A;  4RSY A;  4DK5 A;  2PM6 A;  2ILR A;  3FUH A;  4KZ0 A;  3ZGQ A;  3Q49 B;  3CEQ A;  4U8H A;  1H19 A;  3CVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...