3Q75A

Cryptococcus neoformans protein farnesyltransferase in complex with fpt-ii and tkcvvm peptide
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
330
structure length
315
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSDLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
molecule keywords Farnesyltransferase alpha subunit
total genus 128
structure length 315
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q75A00
3PZ4A 1O5MA 2ZISA 3HXBA 2H6GA 3HXDA 3DSWA 3PZ1A 2ZIRA 4YDEA 1TNBA 4L9PA 1N4SA 2H6IA 3DPYA 1TN7A 1N9AA 1TNZA 3DSUA 3DSTA 1D8DA 3Q73A 1N4QA 1O1TA 1NL4A 3Q75A 4GTRA 3E34A 1S63A 3E32A 1FT1A 1D8EA 3EU5A 2BEDA 1TNYA 2F0YA 3E33A 3PZ3A 3Q79A 4GTVA 1FPPA 4GTSA 4GTMA 3PZ2A 3HXEA 1N4RA 1O1SA 3DSVA 3DRAA 4YDOA 4GTPA 3DSXA 3HXCA 1DCEA 3E30A 2IEJA 2H6FA 1LTXA 1SA5A 3Q7FA 3E37A 1FT2A 1O1RA 1SA4A 1S64A 4GTTA 4LNGA 3KSQA 1JCQA 3C72A 3HXFA 4LNBA 3Q7AA 1KZPA 1NI1A 1X81A 3SFYA 2H6HA 1LD8A 1QBQA 3KSLA 3EUVA 3DSSA 3SFXA 1TNUA 4GTQA 2R2LA 1JCSA 1KZOA 1TNOA 4EHMA 1JCRA 3Q78A 4MBGA 1N4PA 1MZCA 1LD7A 1N95A 1TN6A 1N94A 1TN8A 4GTOA
chains in the Genus database with same CATH superfamily
5LFAA 3RO2A 3PZ4A 1BI8B 2KBXA 3V79K 3ZXSA 2VTBB 3JQ1A 5CEDB 3LS8A 5BXOA 3HDXA 3HVEB 3EDTB 3DSUA 2VSXE 4GA1A 3ZIMA 2IOSA 3T8MA 3PDNA 4GMJA 4J7WA 4KBQA 2PNNA 3RJVA 1OUVA 4G26A 2UWJG 2WXRA 4UWHA 1HE8A 2XGOA 4GTVA 5AJDA 4NQ0A 1HXIA 3B7TA 3I5PA 3GZSA 4J6IA 5G05J 1Y6IA 3GYZA 2L6JA 2DYSE 1MX4A 4WNEA 1QQEA 4BT9A 2VGYA 4HBDA 3J5PA 4HRLA 1FT2A 4XKCA 3TWXA 2X3MA 3Q7AA 5EYPF 1NI1A 1X81A 3LY8A 4JA7A 5E75A 3FUJA 2Y69E 3CVNA 3L08A 2KXPC 4OYSA 5JMND 5AIJA 3KSLA 3SFXA 2FBNA 4AM9A 1S0PA 4J8FA 2X6JA 2XGMA 2GROB 5FZSA 1KZOA 1JCRA 3FTXA 2KCLA 3C5RA 3S7DA 4ILGA 3V30A 3UMVA 1HZ4A 4AXHA 4LSZE 4FLHA 2P9KG 3C3QA 1X5BA 1H2UA 1WM5A 3U64A 2H6IA 1A17A 1NP7A 3UIPC 2BKKB 4FA6A 1D8DA 2X6HA 3GW4A 5C1DA 3ZHEA 2IONA 3FU3A 3BU8A 2WVIA 3CHPA 4WWOA 5HI7A 3L17A 2XCCA 3PNTB 1MJ0A 4A3TA 4DPRA 3PZ3A 2Y4UA 4JVSA 3VTYA 4YDYA 4E6HA 4CT0A 5H7PA 3PH0C 4GB9A 3LJNA 3EJNA 2VJ8A 3ZHEB 3MYVA 2X38A 4CDMA 3IEGA 5FJYA 5ENTD 4E85A 1ELRA 3HXFA 3ASGA 4LCTA 3Q5MA 1WY6A 5ENQD 4XEIG 1QBQA 2V4LA 1OXJA 2HM8A 4JEUA 3MKQB 3ZNGA 2I9CA 4B94A 3F6QA 1TN6A 1N95A 2J8SD 1PY1A 2LXLA 2NC9A 3LXUX 1N0RA 1XGWA 2DCPA 1B89A 3FY4A 1ELKA 2WXJA 1OCZE 3MCXA 4A3VA 3TXMA 4GYWA 3HHMA 3CHMA 5FQ4A 4GA0A 3Q47B 1OY3D 3VTXA 4GYOA 3AS4A 4Q94A 3TWQA 2ONDA 1UW4B 5KNGA 4ATZD 3UKRG 3CHSA 2FF4A 2XQ0A 4I1OB 2YINA 3SFZA 2YHCA 3APDA 2WXNA 3QK0A 2QY7A 3PZ2A 2CG2A 4I6EA 3DSVA 4XIFA 2GRMA 3FUIA 1QNFA 5BXUA 4JZYA 5FINA 4H7YA 3CKBA 2ETBA 2EILE 3V2XA 2QZAA 3FU0A 2DBAA 3LJ3A 4LNBA 4Y6CA 3DPDA 3FUKA 3D9KA 4NRHB 3UPVA 3LVQE 2OVBA 3MX3A 5CCLA 2UY1A 3HIZA 3L22A 4JA9A 3K9IA 3D9HA 3HVEA 3MGBA 1MX6A 3TWRA 1TN8A 3AJIA 3RSEG 2YHEA 1AP7A 1ZB1A 3T5XA 4U8YD 3TWUA 4B93B 3FULA 1TJCA 4W9RA 2HYZA 3MV2B 3PZ1A 4L9PA 3U3WA 5ARFA 4K5CA 3U9WA 2OVFA 2LUHA 4IRUA 5G05C 5BV1A 3CVPA 1O1TA 4I9EA 2XZTG 3EHNA 4F1SA 3CEQA 2P2CP 4BETA 3NQPA 3E34A 3UUXA 3S7JA 2R5SA 3Q9NC 4XX5A 4I2WA 3QARA 4BTBA 3ZEFA 5E76A 4HI8A 2AXZA 1JWFA 3ZFWA 4EZLA 4DI3A 5CEAA 5D2MC 2XZDG 2WXQA 3CVLA 3CVUA 3FP3A 4EBAG 4GTTA 4DUIA 3N71A 4DX1A 4KT6B 2KCKA 3RRMB 1KLXA 5AYWD 4PS8A 4FP7A 3SBTB 3JCKC 4MS6A 3CHOA 4N5CA 3CVQA 1TNOA 3OXFA 2IY0C 3CHQA 1LD7A 5FQ8A 4GZ5A 5AQ7A 1L5JA 3ONKA 3UT4A 4U96D 3PS6A 3SF4A 3IKOB 4ANVA 1DCQA 4HXIA 4RLYA 2ZXWE 5BNWA 4TV3A 2QC9A 3R9MA 4TXPA 1N9AA 3C3OA 5JJ6A 2B6CA 1NL4A 2P9LG 3FTSA 4DJAA 2WMNA 3OXLA 4GCNA 2KCVA 3RAUA 2MRIA 1Z6TA 1D8EA 3QDNA 5BPPA 3EU5A 3D9NA 5CECB 3CIAA 3BUAA 2AJAA 2VSYA 1N11A 3UQ3A 1PAQA 3LEWA 4GMLA 1O1SA 2KM4A 3DSXA 4XZ4A 4O6FA 2ILRA 3FEYA 4KXKB 4OAVB 5KJNA 3CLJA 4DLOA 3PRZA 3FFLA 1PC2A 5HKPA 1OWPA 3O48A 3L6AA 3DSSA 1SW6A 4K5AB 1UG3A 4ME2A 2MHKA 3D9PA 3U4TA 3G2SA 4HRNA 4GZCA 4PUCA 3QWVA 2CFUA 2KC7A 1MQSA 3ZN3A 4ATGA 5FIOA 4AV7A 3MKQA 4PH4B 4B8AA 4KMOA 5A6CA 3HXDA 2J49A 3PUJA 1AWCB 4KYOB 4A55A 4A63B 5CMYA 5KWDA 4I43A 2UY1B 3AS8A 3MKRA 4EZKA 4GTRA 4MRUA 1TEZA 1OCRE 2DZNA 5AQBA 2Y4TA 3Q49B 3T5VA 2FI7A 2OEVA 2J09A 3UT8A 2AXUA 1H2TC 4B0ZA 3APCA 2EIME 1Z3XA 3JQ0A 4U8VD 4BFRA 4K5BA 2L9BA 3R7RA 1H6OA 2FEZA 3R9AB 5FZRA 4ABNA 4ANWA 4DX2A 4OVUA 4JHRA 3DEPA 1WDYA 3ASNE 3G2VA 1EF1C 3OTNA 3CVXA 4TUUA 3B13A 3QB2A 1E7VA 3ASFA 3TL5A 2J4DA 3SNXA 4ACKA 1SQMA 5ITZF 3L16A 4LERA 4EHMA 1E7UA 3JXJA 4N3CA 3TWWA 3ZGQA 5JHAA 4F7AA 1TR4A 3FHEA 4NIKA 3RKVA 3JUIA 1HO8A 2WXIA 3MV3B 3SI5A 3S7FA 3PE3A 2ETAA 4U8HA 4FC8A 3DSWA 3IBEA 4DX6D 1HS6A 3UX4A 3NZUA 5KJKA 1U3DA 2P9UG 1DVPA 3UM1A 4NACA 5G2NA 4HI9A 1TN7A 2GRLA 1QYMA 3OAWA 3DSTA 4ILIA 1IXVA 2CHZA 3ABLE 4AP2A 5EDSA 2ETCA 2GRQB 2WQ7A 4YNDA 2BEDA 4CDNA 3FUFA 3ZYMA 3RIBA 5EX3A 1IHBA 3JYSA 3FTUA 4GMRA 4GTPA 2WB2A 1RW2A 4EPZA 3CHRA 5T4YA 2H6FA 2QYJA 4Q69A 1HX8A 2WPVA 4G2VA 4MLPA 4B8CB 3LYAA 4Q96A 3L54A 4UQXA 1NZNA 4B89A 4BT8A 3CSTA 2XRZA 4I6GA 4DRXE 4JD2G 2KZTB 2XHEA 2I1KA 5AQAA 4O1PA 4JL0A 3Q78A 4WNFA 4I1MA 3VLDA 1OCOE 3KD7A 2LNIA 1MX2A 2R03A 3B7UX 2RKKA 3SBSA 3JXIA 4JB8P 4GYYA 2XS8A 4TRQA 3PZDA 4IULA 1TNBA 2RFMA 5A7DB 1E96B 1HU3A 5FWQA 1BI7B 4AEZC 2E0IA 3QNKA 5JA4D 2V4HC 2OV8A 3AU5A 4D10C 3SD5A 5FQ7A 1G3NB 1ELWA 3FDHA 2F0YA 4GZDA 4ANXA 1N52A 5CCMA 4G25A 2F8XK 2F37A 2F8YA 4AY6A 3QWPA 4CDRA 4BY6A 1H6KA 5IY5E 4HLEA 3QOUA 4JHJA 2CHWA 1WAO1 3EHMA 4AIFA 1OCCE 4LG6A 5CRVA 4WNGA 2VSOE 3BEEA 2X6FA 1JCQA 2QFCA 4UI9C 4V3IA 2BKGA 2PZIA 1FVHA 3FEXA 4GCOA 3RRNB 2XEHA 3EUVA 4DI4A 4J8EA 4M7CA 3FUHA 3PNLB 2FO7A 2P9SG 4AJWA 5ENPD 2Q7FA 1YCSB 3NBNB 1YYHA 5T3RA 2RD0A 1OWMA 4GZ3A 2B0OE 3NAWA 3OXGA 5LCWC 3CVYA 4KVOA 3DXMG 5AENA 2R05A 2DYRE 3NOCD 2AW6A 3WG7E 3AU4A 3EU9A 4F53A 2I1JA 3PEVB 4UI9J 1BLXB 3RK6A 3SGHA 1EDUA 3CK7A 2X6KA 5CERB 1Z5SC 1E8ZA 2WXPA 4MKTA 4UUCA 2XPYA 3Q4AB 4BX8A 5ENSD 4UWFA 2P9IG 1N54A 3FU6A 3V2OA 1OWOA 4TXQA 5LCWJ 4N5QA 4APFA 5ANLA 3LDZA 3APFA 4N39A 4GU5A 1D9SA 3FH7A 3TWSA 4UI9K 3FH5A 3RO3A 2EQXA 1H2VC 2P9NG 4WUYA 4N2SA 1IQRA 3TJPA 4O1OA 1FVFA 3GZ2A 1N0QA 4GZ6A 2GRRB 2WQ6A 1IYGA 1SZ9A 3CKCA 4HOQA 2ZGGA 2DZOA 1S70B 4MBGA 4I9CA 3UM2A 4G8KA 3ONLA 3J5QB 4A1SA 5AARA 4FU3A 4U07A 3TXNA 4X8QA 3KAEA 3FUEA 2EIKE 5FZQA 1N4SA 4EECA 3S7BA 1ZU2A 3CQGB 3DBSA 4UQYA 3FUDA 3KEAA 1Z3YA 2V8SE 3ZW3A 4C9BB 2X6IA 3E32A 3ZYQA 4BWRA 3AAAC 2I6HA 3V31A 3EHRA 4HORA 5A23A 4I2ZA 1JWGA 4I6JA 2WM9A 4F3VA 3HXCA 1E8YA 3NF1A 3TWTA 5JHBA 5EIDA 2A5UA 1SA5A 4EBAA 3ENEA 4FLBA 3MZLB 1IQUA 3PE4A 1HG5A 3JUEA 4HOSA 4JC8A 2CHXA 3SFYA 3ZUVB 4LEUA 1LD8A 3MA5A 4BERA 3ULYA 4L23A 3DEOA 3AG3E 5ENNA 4APOA 5B3SE 4IYPA 3U66A 3HG0D 3BQOA 2P58C 4JHKA 3QKYA 3D9LA 4L7TA 4ZHBA 5EN5D 2AVPA 4FHJA 4FADA 3CQCB 2IFUA 4URKA 4UQZA 4RQIA 1K1BA 1E8WA 1JUQA 2LO6A 3D9IA 4J8DA 3ZYLA 4HB5A 2VTBA 4M3OA 3X2QE 3RU0A 1H19A 4A1GA 3O4ZA 1U2VG 3LVRE 3AG1E 4WWPA 5EYLA 2ZGDA 2XPZA 1BU9A 3FTWA 3ABKE 3UM3A 3D9OA 2HE0A 1FPPA 1E90A 2VQ2A 3S2AA 1GW6A 2C0LA 4DK5A 2GRNB 1BD8A 4O60A 3TGOA 3B7SA 2J08A 5B1BE 2LAHA 4UWKA 5KCMA 3ZU7B 4N2QA 2A5EA 4J8YA 1P5QA 3GZ1A 2BTDA 4CRWA 4QQIA 3AS5A 3E4BA 2WXFA 2FULA 4U0SA 5KJMA 4XKBA 2XS1A 2P9PG 4OVVA 4GTQA 4CEMA 2KATA 5LP0A 4XI9A 4AY5A 1QZ2A 4BESA 5KNHD 2L6BA 4U04A 2WXHA 4GTOA 4CGVA 3UTMA 2C0MA 2NXPA 5FT9A 3IHYA 2IJGX 1K1AA 4RG9A 3D9JA 3PUKA 2C2LA 4AVXA 4YDEA 4I17A 4K0RA 1UJKA 4G24A 3EIQC 1OWNA 4HRMB 1IHGA 2LSUA 1INZA 4RVBA 3Q73A 4K03A 2WXLA 2CFZA 2XEVA 2WXMA 4JW1A 3T8KA 4PS7A 2GRPB 3L9TA 3E33A 3G2UA 4KZCA 3FUMA 3ZXPA 2JEKA 4HLLA 4WWNA 4EQFA 1WG0A 5M72A 2M63A 1ZBPA 2XPIA 3FTZA 1Q2ZA 4EZJA 4H7XA 2IEJA 1H6PA 3MJWA 5EILA 2MOWA 2KZTA 5LX8A 2EIJE 5BT1A 3UIOC 1KPSB 5FQ6A 3CV0A 1NA3A 3FUNA 4L1BA 4HOTA 3BG0B 4DX5D 3EHQA 1TJFA 4N3BA 5B1AE 2VGXA 4LRZA 3HYMB 3AG2E 3ZKJA 5ENOD 1N4PA 2PM7A 2Y1LE 5CRUA 2IOLA 4YVQC 5ANRA 1RZ4A 2IO3C 1TYQG 1OWLA 4G8LA 2XRYA 5JJTA 5BW8C 1HF8A 3TAXA 2JLBA 2VGXB 1TNZA 4KZ0A 5AJLA 1N4QA 2R59A 3RRUA 1HG2A 4Y6WA 1A5EA 5ENRD 5G04C 5CBNA 1TNYA 3G2WA 2RFAA 2VSNA 1U3CA 4IN3B 4BEPA 5J08A 3Q79A 4DLQA 3UXGA 4ACLA 1UOHA 5CHEE 3C3RA 1N4RA 2LXMA 4YDOA 5AQ9A 2PQRA 1Y8MA 5AN8A 1DCEA 4AOFA 1O1RA 2R02A 3W9GA 5CMWA 1NFIE 3B95A 3C72A 4KVMA 1VDYA 3KS2A 3FTVA 1UN8A 5C2YA 3PVLA 4U0UA 3UI2A 2IO2C 3NB2A 4JXTA 2LAIA 3ZVVA 3L82A 5DBKA 3AG4E 3LKUA 1N94A 5D0QD 4BSXA 1MHQA 4ANUA 3CR3A 4HNAD 3L13A 3TG5A 4UWGA 4HFGA 2WQHA 3ESLA 5J90A 2AWIA 2WXGA 5KBAA 1KT0A 3I3NA 2E2EA 5BUZA 3C98A 4F1PA 3UT7A 4NURA 1MYOA 1SZAA 3P1UA 2PM6A 1FCHA 2J4BA 4GPMA 4U7EB 3QAQA 1S63A 3TG4A 1FT1A 2GGFA 2IU1A 3SHFA 2AXVA 2OCCE 4DX7D 1DNPA 3HRAA 3Q9UC 3QC1A 2L0IA 4N3AA 4WAFA 1H0AA 1IKND 3T9KA 2YQ8A 4GTSA 4GTMA 4YVOA 3DWLG 3DRAA 1YMPA 5HS0A 2QYUA 3EIJA 2VGEA 4CZ2D 3E37A 4U0ZA 3FTYA 4LNGA 3KSQA 5DIZA 1E8XA 4XI0A 2XCBA 3ASHA 3FH8A 3SQVA 5ARGA 4C0MA 3ESKA 3KEZA 1UJJA 1UN9A 3ZPJA 2LSVA 3WXXA 3ASOE 3CSFA 5FTPA 5LOZA 4U63A 1MZCA 2IQCA 4UWLA 5AAOA 3PEUB 3DXKG 3SZ7A 4FJZA 4HQDA 3UKUG 2MYOA 2DVWA 3CVWA 4R7LA 2BUGA 3D9MA 3I4RB 1XNFA 4RG6A 3ISMC 1OT8A 2ZIRA 2OOEA 2Y3AA 2ZU6B 1K8KG 4ILHB 2HO1A 2PL2A 3W9FA 2DIWA 4GAAA 4TUMA 5D0OD 4HOUA 2I2OA 2R17C 3MEKA 5EIBE 4FULA 3B7RL 5G04J 3Q75A 4PS3A 4OAUC 4Z68A 3CVVA 3LY9A 3VLFA 3R7QA 5BV0A 2NYJA 3IV0A 2IF4A 4GPKA 3ZRHA 2JABA 4TXRA 3FU5A 1DC2A 5KJLA 2HR2A 4I1AA 2J9QA 1LTXA 2XEEA 1SA4A 2V5FA 3PREA 3UINC 4C0EA 5HRYA 4BX9A 3ML9A 1EPUA 1NA0A 2H6HA 3IXEA 4J0UA 5HQ8A 5CBOA 3VLEA 4HS2A 1SVXA 2R2LA 3TWVA 1EYHA 2WMOA 1V55E 2NSZA 3ZYKA 1YA0A 3CGHA 3NOGD 5EKQD 2WXOA 4G23A 1O5MA 2ZISA 3HXBA 2V0PA 2H6GA 4QFVA 3G2TA 3UM0A 3IHVA 3LY7A 5T8IA 3D3MA 3CK9A 3QJZA 3SY2A 3URZA 3DPYA 3FWVA 1K3ZD 3ABME 1KT1A 4XE0A 3ML8A 3BG1B 2XGSA 4LNUD 2EINE 2RG8A 4FHKA 3B7BA 1HFAA 2J07A 4WNDA 2DWZA 2A4ZA 2GW1A 2CG3A 3ASDA 3LPZA 5JJ7A 3QWWA 4HVBA 4JPSA 4G1TA 4F6RD 2Y0BG 3HXEA 3ULQA 3NZSA 4FJYA 4PDXA 1BPOA 1V54E 1W3BA 5D66A 3E30A 5G55A 4CT4A 2V5QC 3Q7FA 4L2YA 2PQNA 4ZFHA 2FO1E 1JPLA 1S64A 4P29A 2YNQA 4YDWA 1KZPA 4LUNU 3Q15A 1HH8A 2OEWA 4RSYA 3LCAA 3ULEG 4U95D 5EX0A 4JEHA 2XENA 2VYIA 3I4GA 1TNUA 2L0TB 1LF8A 4CGWA 4BTAA 4L2LA 1JCSA 4GA2A 4CCAA 4C48B 4BSZB 3SO8A 4CYMD 3CK8A 2BF0X 2WXKA 3P2BA 4J8SA 4G11A
chains in the Genus database with same CATH topology
3PZ4A 1O5MA 2ZISA 3HXBA 2H6GA 3HXDA 3DSWA 3PZ1A 2ZIRA 4YDEA 1TNBA 4L9PA 1N4SA 2H6IA 3DPYA 1TN7A 1N9AA 1TNZA 3DSUA 3DSTA 1D8DA 3Q73A 1N4QA 1O1TA 1NL4A 3Q75A 4GTRA 3E34A 1S63A 3E32A 1FT1A 1D8EA 3EU5A 2BEDA 1TNYA 2F0YA 3E33A 3PZ3A 3Q79A 4GTVA 1FPPA 4GTSA 4GTMA 3PZ2A 3HXEA 1N4RA 1O1SA 3DSVA 3DRAA 4YDOA 4GTPA 3DSXA 3HXCA 1DCEA 3E30A 2IEJA 2H6FA 1LTXA 1SA5A 3Q7FA 3E37A 1FT2A 1O1RA 1SA4A 1S64A 4GTTA 4LNGA 3KSQA 1JCQA 3C72A 3HXFA 4LNBA 3Q7AA 1KZPA 1NI1A 1X81A 3SFYA 2H6HA 1LD8A 1QBQA 3KSLA 3EUVA 3DSSA 3SFXA 1TNUA 4GTQA 2R2LA 1JCSA 1KZOA 1TNOA 4EHMA 1JCRA 3Q78A 4MBGA 1N4PA 1MZCA 1LD7A 1N95A 1TN6A 1N94A 1TN8A 4GTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ4 A;  1O5M A;  2ZIS A;  3HXB A;  2H6G A;  3HXD A;  3DSW A;  3PZ1 A;  2ZIR A;  4YDE A;  1TNB A;  4L9P A;  1N4S A;  2H6I A;  3DPY A;  1TN7 A;  1N9A A;  1TNZ A;  3DSU A;  3DST A;  1D8D A;  3Q73 A;  1N4Q A;  1O1T A;  1NL4 A;  3Q75 A;  4GTR A;  3E34 A;  1S63 A;  3E32 A;  1FT1 A;  1D8E A;  3EU5 A;  2BED A;  1TNY A;  2F0Y A;  3E33 A;  3PZ3 A;  3Q79 A;  4GTV A;  1FPP A;  4GTS A;  4GTM A;  3PZ2 A;  3HXE A;  1N4R A;  1O1S A;  3DSV A;  3DRA A;  4YDO A;  4GTP A;  3DSX A;  3HXC A;  1DCE A;  3E30 A;  2IEJ A;  2H6F A;  1LTX A;  1SA5 A;  3Q7F A;  3E37 A;  1FT2 A;  1O1R A;  1SA4 A;  1S64 A;  4GTT A;  4LNG A;  3KSQ A;  1JCQ A;  3C72 A;  3HXF A;  4LNB A;  3Q7A A;  1KZP A;  1NI1 A;  1X81 A;  3SFY A;  2H6H A;  1LD8 A;  1QBQ A;  3KSL A;  3EUV A;  3DSS A;  3SFX A;  1TNU A;  4GTQ A;  2R2L A;  1JCS A;  1KZO A;  1TNO A;  4EHM A;  1JCR A;  3Q78 A;  4MBG A;  1N4P A;  1MZC A;  1LD7 A;  1N95 A;  1TN6 A;  1N94 A;  1TN8 A;  4GTO A; 
#chains in the Genus database with same CATH topology
 5LFA A;  3RO2 A;  3PZ4 A;  1BI8 B;  2KBX A;  3V79 K;  3ZXS A;  2VTB B;  3JQ1 A;  5CED B;  3LS8 A;  5BXO A;  3HDX A;  3HVE B;  3EDT B;  3DSU A;  2VSX E;  4GA1 A;  3ZIM A;  2IOS A;  3T8M A;  3PDN A;  4GMJ A;  4J7W A;  4KBQ A;  2PNN A;  3RJV A;  1OUV A;  4G26 A;  2UWJ G;  2WXR A;  4UWH A;  1HE8 A;  2XGO A;  4GTV A;  5AJD A;  4NQ0 A;  1HXI A;  3B7T A;  3I5P A;  3GZS A;  4J6I A;  5G05 J;  1Y6I A;  3GYZ A;  2L6J A;  2DYS E;  1MX4 A;  4WNE A;  1QQE A;  4BT9 A;  2VGY A;  4HBD A;  3J5P A;  4HRL A;  1FT2 A;  4XKC A;  3TWX A;  2X3M A;  3Q7A A;  5EYP F;  1NI1 A;  1X81 A;  3LY8 A;  4JA7 A;  5E75 A;  3FUJ A;  2Y69 E;  3CVN A;  3L08 A;  2KXP C;  4OYS A;  5JMN D;  5AIJ A;  3KSL A;  3SFX A;  2FBN A;  4AM9 A;  1S0P A;  4J8F A;  2X6J A;  2XGM A;  2GRO B;  5FZS A;  1KZO A;  1JCR A;  3FTX A;  2KCL A;  3C5R A;  3S7D A;  4ILG A;  3V30 A;  3UMV A;  1HZ4 A;  4AXH A;  4LSZ E;  4FLH A;  2P9K G;  3C3Q A;  1X5B A;  1H2U A;  1WM5 A;  3U64 A;  2H6I A;  1A17 A;  1NP7 A;  3UIP C;  2BKK B;  4FA6 A;  1D8D A;  2X6H A;  3GW4 A;  5C1D A;  3ZHE A;  2ION A;  3FU3 A;  3BU8 A;  2WVI A;  3CHP A;  4WWO A;  5HI7 A;  3L17 A;  2XCC A;  3PNT B;  1MJ0 A;  4A3T A;  4DPR A;  3PZ3 A;  2Y4U A;  4JVS A;  3VTY A;  4YDY A;  4E6H A;  4CT0 A;  5H7P A;  3PH0 C;  4GB9 A;  3LJN A;  3EJN A;  2VJ8 A;  3ZHE B;  3MYV A;  2X38 A;  4CDM A;  3IEG A;  5FJY A;  5ENT D;  4E85 A;  1ELR A;  3HXF A;  3ASG A;  4LCT A;  3Q5M A;  1WY6 A;  5ENQ D;  4XEI G;  1QBQ A;  2V4L A;  1OXJ A;  2HM8 A;  4JEU A;  3MKQ B;  3ZNG A;  2I9C A;  4B94 A;  3F6Q A;  1TN6 A;  1N95 A;  2J8S D;  1PY1 A;  2LXL A;  2NC9 A;  3LXU X;  1N0R A;  1XGW A;  2DCP A;  1B89 A;  3FY4 A;  1ELK A;  2WXJ A;  1OCZ E;  3MCX A;  4A3V A;  3TXM A;  4GYW A;  3HHM A;  3CHM A;  5FQ4 A;  4GA0 A;  3Q47 B;  1OY3 D;  3VTX A;  4GYO A;  3AS4 A;  4Q94 A;  3TWQ A;  2OND A;  1UW4 B;  5KNG A;  4ATZ D;  3UKR G;  3CHS A;  2FF4 A;  2XQ0 A;  4I1O B;  2YIN A;  3SFZ A;  2YHC A;  3APD A;  2WXN A;  3QK0 A;  2QY7 A;  3PZ2 A;  2CG2 A;  4I6E A;  3DSV A;  4XIF A;  2GRM A;  3FUI A;  1QNF A;  5BXU A;  4JZY A;  5FIN A;  4H7Y A;  3CKB A;  2ETB A;  2EIL E;  3V2X A;  2QZA A;  3FU0 A;  2DBA A;  3LJ3 A;  4LNB A;  4Y6C A;  3DPD A;  3FUK A;  3D9K A;  4NRH B;  3UPV A;  3LVQ E;  2OVB A;  3MX3 A;  5CCL A;  2UY1 A;  3HIZ A;  3L22 A;  4JA9 A;  3K9I A;  3D9H A;  3HVE A;  3MGB A;  1MX6 A;  3TWR A;  1TN8 A;  3AJI A;  3RSE G;  2YHE A;  1AP7 A;  1ZB1 A;  3T5X A;  4U8Y D;  3TWU A;  4B93 B;  3FUL A;  1TJC A;  4W9R A;  2HYZ A;  3MV2 B;  3PZ1 A;  4L9P A;  3U3W A;  5ARF A;  4K5C A;  3U9W A;  2OVF A;  2LUH A;  4IRU A;  5G05 C;  5BV1 A;  3CVP A;  1O1T A;  4I9E A;  2XZT G;  3EHN A;  4F1S A;  3CEQ A;  2P2C P;  4BET A;  3NQP A;  3E34 A;  3UUX A;  3S7J A;  2R5S A;  3Q9N C;  4XX5 A;  4I2W A;  3QAR A;  4BTB A;  3ZEF A;  5E76 A;  4HI8 A;  2AXZ A;  1JWF A;  3ZFW A;  4EZL A;  4DI3 A;  5CEA A;  5D2M C;  2XZD G;  2WXQ A;  3CVL A;  3CVU A;  3FP3 A;  4EBA G;  4GTT A;  4DUI A;  3N71 A;  4DX1 A;  4KT6 B;  2KCK A;  3RRM B;  1KLX A;  5AYW D;  4PS8 A;  4FP7 A;  3SBT B;  3JCK C;  4MS6 A;  3CHO A;  4N5C A;  3CVQ A;  1TNO A;  3OXF A;  2IY0 C;  3CHQ A;  1LD7 A;  5FQ8 A;  4GZ5 A;  5AQ7 A;  1L5J A;  3ONK A;  3UT4 A;  4U96 D;  3PS6 A;  3SF4 A;  3IKO B;  4ANV A;  1DCQ A;  4HXI A;  4RLY A;  2ZXW E;  5BNW A;  4TV3 A;  2QC9 A;  3R9M A;  4TXP A;  1N9A A;  3C3O A;  5JJ6 A;  2B6C A;  1NL4 A;  2P9L G;  3FTS A;  4DJA A;  2WMN A;  3OXL A;  4GCN A;  2KCV A;  3RAU A;  2MRI A;  1Z6T A;  1D8E A;  3QDN A;  5BPP A;  3EU5 A;  3D9N A;  5CEC B;  3CIA A;  3BUA A;  2AJA A;  2VSY A;  1N11 A;  3UQ3 A;  1PAQ A;  3LEW A;  4GML A;  1O1S A;  2KM4 A;  3DSX A;  4XZ4 A;  4O6F A;  2ILR A;  3FEY A;  4KXK B;  4OAV B;  5KJN A;  3CLJ A;  4DLO A;  3PRZ A;  3FFL A;  1PC2 A;  5HKP A;  1OWP A;  3O48 A;  3L6A A;  3DSS A;  1SW6 A;  4K5A B;  1UG3 A;  4ME2 A;  2MHK A;  3D9P A;  3U4T A;  3G2S A;  4HRN A;  4GZC A;  4PUC A;  3QWV A;  2CFU A;  2KC7 A;  1MQS A;  3ZN3 A;  4ATG A;  5FIO A;  4AV7 A;  3MKQ A;  4PH4 B;  4B8A A;  4KMO A;  5A6C A;  3HXD A;  2J49 A;  3PUJ A;  1AWC B;  4KYO B;  4A55 A;  4A63 B;  5CMY A;  5KWD A;  4I43 A;  2UY1 B;  3AS8 A;  3MKR A;  4EZK A;  4GTR A;  4MRU A;  1TEZ A;  1OCR E;  2DZN A;  5AQB A;  2Y4T A;  3Q49 B;  3T5V A;  2FI7 A;  2OEV A;  2J09 A;  3UT8 A;  2AXU A;  1H2T C;  4B0Z A;  3APC A;  2EIM E;  1Z3X A;  3JQ0 A;  4U8V D;  4BFR A;  4K5B A;  2L9B A;  3R7R A;  1H6O A;  2FEZ A;  3R9A B;  5FZR A;  4ABN A;  4ANW A;  4DX2 A;  4OVU A;  4JHR A;  3DEP A;  1WDY A;  3ASN E;  3G2V A;  1EF1 C;  3OTN A;  3CVX A;  4TUU A;  3B13 A;  3QB2 A;  1E7V A;  3ASF A;  3TL5 A;  2J4D A;  3SNX A;  4ACK A;  1SQM A;  5ITZ F;  3L16 A;  4LER A;  4EHM A;  1E7U A;  3JXJ A;  4N3C A;  3TWW A;  3ZGQ A;  5JHA A;  4F7A A;  1TR4 A;  3FHE A;  4NIK A;  3RKV A;  3JUI A;  1HO8 A;  2WXI A;  3MV3 B;  3SI5 A;  3S7F A;  3PE3 A;  2ETA A;  4U8H A;  4FC8 A;  3DSW A;  3IBE A;  4DX6 D;  1HS6 A;  3UX4 A;  3NZU A;  5KJK A;  1U3D A;  2P9U G;  1DVP A;  3UM1 A;  4NAC A;  5G2N A;  4HI9 A;  1TN7 A;  2GRL A;  1QYM A;  3OAW A;  3DST A;  4ILI A;  1IXV A;  2CHZ A;  3ABL E;  4AP2 A;  5EDS A;  2ETC A;  2GRQ B;  2WQ7 A;  4YND A;  2BED A;  4CDN A;  3FUF A;  3ZYM A;  3RIB A;  5EX3 A;  1IHB A;  3JYS A;  3FTU A;  4GMR A;  4GTP A;  2WB2 A;  1RW2 A;  4EPZ A;  3CHR A;  5T4Y A;  2H6F A;  2QYJ A;  4Q69 A;  1HX8 A;  2WPV A;  4G2V A;  4MLP A;  4B8C B;  3LYA A;  4Q96 A;  3L54 A;  4UQX A;  1NZN A;  4B89 A;  4BT8 A;  3CST A;  2XRZ A;  4I6G A;  4DRX E;  4JD2 G;  2KZT B;  2XHE A;  2I1K A;  5AQA A;  4O1P A;  4JL0 A;  3Q78 A;  4WNF A;  4I1M A;  3VLD A;  1OCO E;  3KD7 A;  2LNI A;  1MX2 A;  2R03 A;  3B7U X;  2RKK A;  3SBS A;  3JXI A;  4JB8 P;  4GYY A;  2XS8 A;  4TRQ A;  3PZD A;  4IUL A;  1TNB A;  2RFM A;  5A7D B;  1E96 B;  1HU3 A;  5FWQ A;  1BI7 B;  4AEZ C;  2E0I A;  3QNK A;  5JA4 D;  2V4H C;  2OV8 A;  3AU5 A;  4D10 C;  3SD5 A;  5FQ7 A;  1G3N B;  1ELW A;  3FDH A;  2F0Y A;  4GZD A;  4ANX A;  1N52 A;  5CCM A;  4G25 A;  2F8X K;  2F37 A;  2F8Y A;  4AY6 A;  3QWP A;  4CDR A;  4BY6 A;  1H6K A;  5IY5 E;  4HLE A;  3QOU A;  4JHJ A;  2CHW A;  1WAO 1;  3EHM A;  4AIF A;  1OCC E;  4LG6 A;  5CRV A;  4WNG A;  2VSO E;  3BEE A;  2X6F A;  1JCQ A;  2QFC A;  4UI9 C;  4V3I A;  2BKG A;  2PZI A;  1FVH A;  3FEX A;  4GCO A;  3RRN B;  2XEH A;  3EUV A;  4DI4 A;  4J8E A;  4M7C A;  3FUH A;  3PNL B;  2FO7 A;  2P9S G;  4AJW A;  5ENP D;  2Q7F A;  1YCS B;  3NBN B;  1YYH A;  5T3R A;  2RD0 A;  1OWM A;  4GZ3 A;  2B0O E;  3NAW A;  3OXG A;  5LCW C;  3CVY A;  4KVO A;  3DXM G;  5AEN A;  2R05 A;  2DYR E;  3NOC D;  2AW6 A;  3WG7 E;  3AU4 A;  3EU9 A;  4F53 A;  2I1J A;  3PEV B;  4UI9 J;  1BLX B;  3RK6 A;  3SGH A;  1EDU A;  3CK7 A;  2X6K A;  5CER B;  1Z5S C;  1E8Z A;  2WXP A;  4MKT A;  4UUC A;  2XPY A;  3Q4A B;  4BX8 A;  5ENS D;  4UWF A;  2P9I G;  1N54 A;  3FU6 A;  3V2O A;  1OWO A;  4TXQ A;  5LCW J;  4N5Q A;  4APF A;  5ANL A;  3LDZ A;  3APF A;  4N39 A;  4GU5 A;  1D9S A;  3FH7 A;  3TWS A;  4UI9 K;  3FH5 A;  3RO3 A;  2EQX A;  1H2V C;  2P9N G;  4WUY A;  4N2S A;  1IQR A;  3TJP A;  4O1O A;  1FVF A;  3GZ2 A;  1N0Q A;  4GZ6 A;  2GRR B;  2WQ6 A;  1IYG A;  1SZ9 A;  3CKC A;  4HOQ A;  2ZGG A;  2DZO A;  1S70 B;  4MBG A;  4I9C A;  3UM2 A;  4G8K A;  3ONL A;  3J5Q B;  4A1S A;  5AAR A;  4FU3 A;  4U07 A;  3TXN A;  4X8Q A;  3KAE A;  3FUE A;  2EIK E;  5FZQ A;  1N4S A;  4EEC A;  3S7B A;  1ZU2 A;  3CQG B;  3DBS A;  4UQY A;  3FUD A;  3KEA A;  1Z3Y A;  2V8S E;  3ZW3 A;  4C9B B;  2X6I A;  3E32 A;  3ZYQ A;  4BWR A;  3AAA C;  2I6H A;  3V31 A;  3EHR A;  4HOR A;  5A23 A;  4I2Z A;  1JWG A;  4I6J A;  2WM9 A;  4F3V A;  3HXC A;  1E8Y A;  3NF1 A;  3TWT A;  5JHB A;  5EID A;  2A5U A;  1SA5 A;  4EBA A;  3ENE A;  4FLB A;  3MZL B;  1IQU A;  3PE4 A;  1HG5 A;  3JUE A;  4HOS A;  4JC8 A;  2CHX A;  3SFY A;  3ZUV B;  4LEU A;  1LD8 A;  3MA5 A;  4BER A;  3ULY A;  4L23 A;  3DEO A;  3AG3 E;  5ENN A;  4APO A;  5B3S E;  4IYP A;  3U66 A;  3HG0 D;  3BQO A;  2P58 C;  4JHK A;  3QKY A;  3D9L A;  4L7T A;  4ZHB A;  5EN5 D;  2AVP A;  4FHJ A;  4FAD A;  3CQC B;  2IFU A;  4URK A;  4UQZ A;  4RQI A;  1K1B A;  1E8W A;  1JUQ A;  2LO6 A;  3D9I A;  4J8D A;  3ZYL A;  4HB5 A;  2VTB A;  4M3O A;  3X2Q E;  3RU0 A;  1H19 A;  4A1G A;  3O4Z A;  1U2V G;  3LVR E;  3AG1 E;  4WWP A;  5EYL A;  2ZGD A;  2XPZ A;  1BU9 A;  3FTW A;  3ABK E;  3UM3 A;  3D9O A;  2HE0 A;  1FPP A;  1E90 A;  2VQ2 A;  3S2A A;  1GW6 A;  2C0L A;  4DK5 A;  2GRN B;  1BD8 A;  4O60 A;  3TGO A;  3B7S A;  2J08 A;  5B1B E;  2LAH A;  4UWK A;  5KCM A;  3ZU7 B;  4N2Q A;  2A5E A;  4J8Y A;  1P5Q A;  3GZ1 A;  2BTD A;  4CRW A;  4QQI A;  3AS5 A;  3E4B A;  2WXF A;  2FUL A;  4U0S A;  5KJM A;  4XKB A;  2XS1 A;  2P9P G;  4OVV A;  4GTQ A;  4CEM A;  2KAT A;  5LP0 A;  4XI9 A;  4AY5 A;  1QZ2 A;  4BES A;  5KNH D;  2L6B A;  4U04 A;  2WXH A;  4GTO A;  4CGV A;  3UTM A;  2C0M A;  2NXP A;  5FT9 A;  3IHY A;  2IJG X;  1K1A A;  4RG9 A;  3D9J A;  3PUK A;  2C2L A;  4AVX A;  4YDE A;  4I17 A;  4K0R A;  1UJK A;  4G24 A;  3EIQ C;  1OWN A;  4HRM B;  1IHG A;  2LSU A;  1INZ A;  4RVB A;  3Q73 A;  4K03 A;  2WXL A;  2CFZ A;  2XEV A;  2WXM A;  4JW1 A;  3T8K A;  4PS7 A;  2GRP B;  3L9T A;  3E33 A;  3G2U A;  4KZC A;  3FUM A;  3ZXP A;  2JEK A;  4HLL A;  4WWN A;  4EQF A;  1WG0 A;  5M72 A;  2M63 A;  1ZBP A;  2XPI A;  3FTZ A;  1Q2Z A;  4EZJ A;  4H7X A;  2IEJ A;  1H6P A;  3MJW A;  5EIL A;  2MOW A;  2KZT A;  5LX8 A;  2EIJ E;  5BT1 A;  3UIO C;  1KPS B;  5FQ6 A;  3CV0 A;  1NA3 A;  3FUN A;  4L1B A;  4HOT A;  3BG0 B;  4DX5 D;  3EHQ A;  1TJF A;  4N3B A;  5B1A E;  2VGX A;  4LRZ A;  3HYM B;  3AG2 E;  3ZKJ A;  5ENO D;  1N4P A;  2PM7 A;  2Y1L E;  5CRU A;  2IOL A;  4YVQ C;  5ANR A;  1RZ4 A;  2IO3 C;  1TYQ G;  1OWL A;  4G8L A;  2XRY A;  5JJT A;  5BW8 C;  1HF8 A;  3TAX A;  2JLB A;  2VGX B;  1TNZ A;  4KZ0 A;  5AJL A;  1N4Q A;  2R59 A;  3RRU A;  1HG2 A;  4Y6W A;  1A5E A;  5ENR D;  5G04 C;  5CBN A;  1TNY A;  3G2W A;  2RFA A;  2VSN A;  1U3C A;  4IN3 B;  4BEP A;  5J08 A;  3Q79 A;  4DLQ A;  3UXG A;  4ACL A;  1UOH A;  5CHE E;  3C3R A;  1N4R A;  2LXM A;  4YDO A;  5AQ9 A;  2PQR A;  1Y8M A;  5AN8 A;  1DCE A;  4AOF A;  1O1R A;  2R02 A;  3W9G A;  5CMW A;  1NFI E;  3B95 A;  3C72 A;  4KVM A;  1VDY A;  3KS2 A;  3FTV A;  1UN8 A;  5C2Y A;  3PVL A;  4U0U A;  3UI2 A;  2IO2 C;  3NB2 A;  4JXT A;  2LAI A;  3ZVV A;  3L82 A;  5DBK A;  3AG4 E;  3LKU A;  1N94 A;  5D0Q D;  4BSX A;  1MHQ A;  4ANU A;  3CR3 A;  4HNA D;  3L13 A;  3TG5 A;  4UWG A;  4HFG A;  2WQH A;  3ESL A;  5J90 A;  2AWI A;  2WXG A;  5KBA A;  1KT0 A;  3I3N A;  2E2E A;  5BUZ A;  3C98 A;  4F1P A;  3UT7 A;  4NUR A;  1MYO A;  1SZA A;  3P1U A;  2PM6 A;  1FCH A;  2J4B A;  4GPM A;  4U7E B;  3QAQ A;  1S63 A;  3TG4 A;  1FT1 A;  2GGF A;  2IU1 A;  3SHF A;  2AXV A;  2OCC E;  4DX7 D;  1DNP A;  3HRA A;  3Q9U C;  3QC1 A;  2L0I A;  4N3A A;  4WAF A;  1H0A A;  1IKN D;  3T9K A;  2YQ8 A;  4GTS A;  4GTM A;  4YVO A;  3DWL G;  3DRA A;  1YMP A;  5HS0 A;  2QYU A;  3EIJ A;  2VGE A;  4CZ2 D;  3E37 A;  4U0Z A;  3FTY A;  4LNG A;  3KSQ A;  5DIZ A;  1E8X A;  4XI0 A;  2XCB A;  3ASH A;  3FH8 A;  3SQV A;  5ARG A;  4C0M A;  3ESK A;  3KEZ A;  1UJJ A;  1UN9 A;  3ZPJ A;  2LSV A;  3WXX A;  3ASO E;  3CSF A;  5FTP A;  5LOZ A;  4U63 A;  1MZC A;  2IQC A;  4UWL A;  5AAO A;  3PEU B;  3DXK G;  3SZ7 A;  4FJZ A;  4HQD A;  3UKU G;  2MYO A;  2DVW A;  3CVW A;  4R7L A;  2BUG A;  3D9M A;  3I4R B;  1XNF A;  4RG6 A;  3ISM C;  1OT8 A;  2ZIR A;  2OOE A;  2Y3A A;  2ZU6 B;  1K8K G;  4ILH B;  2HO1 A;  2PL2 A;  3W9F A;  2DIW A;  4GAA A;  4TUM A;  5D0O D;  4HOU A;  2I2O A;  2R17 C;  3MEK A;  5EIB E;  4FUL A;  3B7R L;  5G04 J;  3Q75 A;  4PS3 A;  4OAU C;  4Z68 A;  3CVV A;  3LY9 A;  3VLF A;  3R7Q A;  5BV0 A;  2NYJ A;  3IV0 A;  2IF4 A;  4GPK A;  3ZRH A;  2JAB A;  4TXR A;  3FU5 A;  1DC2 A;  5KJL A;  2HR2 A;  4I1A A;  2J9Q A;  1LTX A;  2XEE A;  1SA4 A;  2V5F A;  3PRE A;  3UIN C;  4C0E A;  5HRY A;  4BX9 A;  3ML9 A;  1EPU A;  1NA0 A;  2H6H A;  3IXE A;  4J0U A;  5HQ8 A;  5CBO A;  3VLE A;  4HS2 A;  1SVX A;  2R2L A;  3TWV A;  1EYH A;  2WMO A;  1V55 E;  2NSZ A;  3ZYK A;  1YA0 A;  3CGH A;  3NOG D;  5EKQ D;  2WXO A;  4G23 A;  1O5M A;  2ZIS A;  3HXB A;  2V0P A;  2H6G A;  4QFV A;  3G2T A;  3UM0 A;  3IHV A;  3LY7 A;  5T8I A;  3D3M A;  3CK9 A;  3QJZ A;  3SY2 A;  3URZ A;  3DPY A;  3FWV A;  1K3Z D;  3ABM E;  1KT1 A;  4XE0 A;  3ML8 A;  3BG1 B;  2XGS A;  4LNU D;  2EIN E;  2RG8 A;  4FHK A;  3B7B A;  1HFA A;  2J07 A;  4WND A;  2DWZ A;  2A4Z A;  2GW1 A;  2CG3 A;  3ASD A;  3LPZ A;  5JJ7 A;  3QWW A;  4HVB A;  4JPS A;  4G1T A;  4F6R D;  2Y0B G;  3HXE A;  3ULQ A;  3NZS A;  4FJY A;  4PDX A;  1BPO A;  1V54 E;  1W3B A;  5D66 A;  3E30 A;  5G55 A;  4CT4 A;  2V5Q C;  3Q7F A;  4L2Y A;  2PQN A;  4ZFH A;  2FO1 E;  1JPL A;  1S64 A;  4P29 A;  2YNQ A;  4YDW A;  1KZP A;  4LUN U;  3Q15 A;  1HH8 A;  2OEW A;  4RSY A;  3LCA A;  3ULE G;  4U95 D;  5EX0 A;  4JEH A;  2XEN A;  2VYI A;  3I4G A;  1TNU A;  2L0T B;  1LF8 A;  4CGW A;  4BTA A;  4L2L A;  1JCS A;  4GA2 A;  4CCA A;  4C48 B;  4BSZ B;  3SO8 A;  4CYM D;  3CK8 A;  2BF0 X;  2WXK A;  3P2B A;  4J8S A;  4G11 A; 
#chains in the Genus database with same CATH homology
 3PZ4 A;  1O5M A;  2ZIS A;  3HXB A;  2H6G A;  3HXD A;  3DSW A;  3PZ1 A;  2ZIR A;  4YDE A;  1TNB A;  4L9P A;  1N4S A;  2H6I A;  3DPY A;  1TN7 A;  1N9A A;  1TNZ A;  3DSU A;  3DST A;  1D8D A;  3Q73 A;  1N4Q A;  1O1T A;  1NL4 A;  3Q75 A;  4GTR A;  3E34 A;  1S63 A;  3E32 A;  1FT1 A;  1D8E A;  3EU5 A;  2BED A;  1TNY A;  2F0Y A;  3E33 A;  3PZ3 A;  3Q79 A;  4GTV A;  1FPP A;  4GTS A;  4GTM A;  3PZ2 A;  3HXE A;  1N4R A;  1O1S A;  3DSV A;  3DRA A;  4YDO A;  4GTP A;  3DSX A;  3HXC A;  1DCE A;  3E30 A;  2IEJ A;  2H6F A;  1LTX A;  1SA5 A;  3Q7F A;  3E37 A;  1FT2 A;  1O1R A;  1SA4 A;  1S64 A;  4GTT A;  4LNG A;  3KSQ A;  1JCQ A;  3C72 A;  3HXF A;  4LNB A;  3Q7A A;  1KZP A;  1NI1 A;  1X81 A;  3SFY A;  2H6H A;  1LD8 A;  1QBQ A;  3KSL A;  3EUV A;  3DSS A;  3SFX A;  1TNU A;  4GTQ A;  2R2L A;  1JCS A;  1KZO A;  1TNO A;  4EHM A;  1JCR A;  3Q78 A;  4MBG A;  1N4P A;  1MZC A;  1LD7 A;  1N95 A;  1TN6 A;  1N94 A;  1TN8 A;  4GTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...