3Q75A

Cryptococcus neoformans protein farnesyltransferase in complex with fpt-ii and tkcvvm peptide
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
330
structure length
315
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSDLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
total genus 128
structure length 315
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q75A00
4GTRA 2IEJA 3DRAA 1TN8A 3E33A 1TNBA 1S63A 2R2LA 3Q7AA 3DSWA 3Q79A 3E32A 1N4SA 4GTVA 1S64A 4GTTA 3HXEA 3DSUA 4LNBA 1FT2A 1N4RA 1TNZA 4YDEA 3HXBA 1O1TA 1MZCA 1O1RA 3HXDA 1TN6A 1DCEA 1X81A 3DSSA 4GTSA 4GTPA 1JCQA 3HXFA 3HXCA 4YDOA 1NL4A 3DPYA 4GTMA 4EHMA 1LD7A 2H6FA 1KZOA 1LD8A 3PZ2A 3SFYA 1N4QA 3PZ4A 1D8EA 1NI1A 2H6IA 1SA5A 1QBQA 1O1SA 3KSLA 1JCSA 3KSQA 1JCRA 1N95A 1FT1A 1SA4A 4GTOA 1TNYA 3SFXA 4GTQA 4LNGA 4MBGA 2BEDA 3Q73A 1KZPA 3PZ1A 3PZ3A 3EUVA 3Q78A 3E34A 1TNUA 1TNOA 3Q75A 3C72A 2ZIRA 3Q7FA 2H6GA 1N4PA 1N94A 2ZISA 1D8DA 3DSVA 1FPPA 1N9AA 3E30A 3DSXA 1LTXA 4L9PA 2H6HA 3EU5A 2F0YA 1TN7A 3DSTA 3E37A 1O5MA
chains in the Genus database with same CATH superfamily
1IYGA 3CVVA 3KS2A 2ETBA 4EQFA 4KT6B 3V30A 5ANRA 4HS2A 2R2LA 3DSWA 4WNGA 3FTWA 2XEHA 4LNBA 1AWCB 5J08A 3SFZA 4A1SA 3LJNA 4NRHB 1UN9A 3IV0A 2C0LA 2RFMA 5CERB 3TL5A 4APFA 3FEYA 2YQ8A 4J8DA 1BLXB 4KXKB 4HORA 4JPSA 4F6RD 4F3VA 2GRRB 2GW1A 2I2OA 1IHBA 5FQ8A 3ZYKA 2ZGGA 3QNKA 4A3VA 2XPZA 4A1GA 4WAFA 4JW1A 5KWDA 4DI4A 1KZPA 4TXRA 5ENRD 3ML9A 3RJVA 4JD2G 1OWLA 3Q75A 4AY5A 3MX3A 5ENNA 4EZKA 2UWJG 3ASHA 4KMOA 3EU5A 2QZAA 3C3OA 3FWVA 3CR3A 3D9KA 2IO2C 2KCVA 4NIKA 4M7CA 5EN5D 2YHCA 2R59A 3O48A 2WXGA 4J0UA 1SQMA 5ENSD 3DRAA 3JCKC 4LUNU 3IHVA 4XKCA 2DBAA 4TXQA 3E32A 4BETA 3AJIA 1FT2A 2X6HA 1ZU2A 4N3AA 4EPZA 3GW4A 3B7TA 2OEWA 3ZEFA 2IQCA 3CHRA 5KJNA 3FUEA 3FH8A 1BI8B 3TXMA 4FULA 2AXVA 2I1KA 5HS0A 2WXPA 5KBAA 3PZDA 3ULEG 1SVXA 3AAAC 2QY7A 4LG6A 4U07A 4TUUA 2Y4UA 4RSYA 3O4ZA 3B7RL 2CHZA 5A7DB 4YDWA 4I6GA 1OWMA 3P2BA 3MA5A 2EIKE 3SNXA 4PDXA 2F8XK 2DYRE 1NA0A 4DLOA 3D9OA 4PS8A 4XE0A 3VLDA 4I43A 4I1OB 3CKCA 3JYSA 2GRQB 3R7RA 3TWVA 1QZ2A 3MV2B 3L54A 1QQEA 2GRNB 4HQDA 2AJAA 3EHQA 4ZFHA 4U0ZA 3E33A 2X6FA 3FTSA 4V3IA 3C3QA 3AG4E 3UTMA 2P9IG 4N2SA 3ONLA 1OUVA 4FC8A 1H0AA 2ILRA 2P9SG 3ZRHA 1EYHA 3AU5A 4A3TA 1L5JA 3SZ7A 2WQ7A 2WXQA 1WM5A 3G2UA 3B13A 3C5RA 3ONKA 2LXLA 5ENPD 5EIDA 2HE0A 2PZIA 3DPYA 2DYSE 3MKRA 3S2AA 3U64A 3SFYA 1MJ0A 3BEEA 4KZ0A 3UKUG 3JXJA 2A4ZA 1HU3A 4UI9C 3HIZA 3ESLA 1YA0A 5D66A 3Q4AB 5FQ7A 1W3BA 4GTQA 2DIWA 1TR4A 4MBGA 2BEDA 4KBQA 2BKKB 2LXMA 3CIAA 2KBXA 2X6KA 4Q94A 4L2LA 3CVWA 4XEIG 3TGOA 3D9NA 3SGHA 4N3CA 3DXKG 1LTXA 2CG3A 3TG5A 4FADA 5EILA 3ZW3A 3WXXA 3DSTA 1H2VC 3BQOA 2V0PA 2IF4A 4L7TA 4I1AA 2CFUA 2EIJE 5C1DA 2IY0C 4MS6A 4CRWA 4U8HA 1MQSA 4DX7D 3PE3A 1TNBA 4ANXA 5G55A 1S64A 3T9KA 2WXHA 4CDMA 3G2WA 3QK0A 1N52A 5G04C 3ASGA 4GZ6A 1S0PA 4N2QA 3I5PA 1SW6A 5H7PA 1OWOA 3CVNA 2XCBA 3IBEA 3PZ4A 1FVFA 4NQ0A 4L23A 2LAHA 4UWHA 4WWPA 2B0OE 3CVYA 3DEOA 4Y6CA 2WM9A 4MLPA 2LSUA 1JCRA 1N95A 1N0QA 5FZQA 4HOUA 4GTOA 4I1MA 4ANWA 3D3MA 1MX2A 2J07A 4FLHA 3ZN3A 3AG1E 3CV0A 3UT7A 4KVOA 3U3WA 2XENA 1H6PA 2XS8A 2VGXA 4LEUA 4FHKA 4ILIA 1H2UA 2CG2A 3SD5A 4XI0A 3E37A 3SHFA 1NA3A 1O5MA 3L6AA 2XHEA 3MEKA 4MRUA 3URZA 2R02A 3QAQA 3JUEA 5CHEE 5ANLA 4UWLA 3P1UA 3V2XA 3MKQB 1S63A 3Q79A 5E76A 2M63A 2PM6A 1N4RA 2KC7A 4I2ZA 5FJYA 3EHMA 3CK9A 4W9RA 3JQ1A 3L16A 3TJPA 2PQNA 3HXFA 3D9HA 4GTMA 4E6HA 4EBAG 3PNLB 2H6FA 3UM3A 2XGMA 4I9CA 4CCAA 2XPIA 5CRUA 4FJZA 4GCOA 2XEVA 5JHBA 3UI2A 3ASNE 2BF0X 4J8YA 4YVQC 3B7SA 4C0MA 2FBNA 2HO1A 3ABME 4HRNA 1BD8A 3KD7A 4CT4A 1NFIE 4JXTA 3PREA 3HRAA 1TNOA 1MX4A 4WNFA 3TWUA 2ZU6B 2DCPA 3S7DA 1D8DA 4WNDA 2P9PG 3MCXA 4X8QA 3ZU7B 4BSZB 3OXFA 3AU4A 3JUIA 4LERA 5G05J 3LPZA 4N5QA 4L9PA 4U8YD 5JHAA 1FVHA 3DWLG 1YCSB 3GZSA 1MYOA 3R9MA 2XZTG 3UM2A 5CRVA 4GZDA 2LO6A 4DK5A 2WMNA 1EDUA 2X6IA 4HVBA 3PEVB 2V5QC 2MHKA 3HYMB 5LCWC 4AVXA 4XKBA 3SBTB 2XCCA 3FUKA 4PH4B 4ATGA 4JHJA 5FIOA 2WXIA 4D10C 3L82A 1UN8A 4UWGA 3ESKA 3GZ2A 4BSXA 5BT1A 2YINA 3V2OA 1D8EA 4K0RA 2CHWA 4F1SA 2P9NG 3CGHA 4PS7A 1O1SA 3C3RA 3LVRE 2L6JA 3UPVA 2VYIA 2WXFA 1TNYA 2UY1A 3NOCD 3R9AB 3Q73A 3W9GA 4OVVA 1HF8A 3CEQA 5D0QD 1TYQG 1DCQA 3FH5A 3CHSA 4GYWA 1HX8A 4GPMA 4DLQA 3AS8A 3C72A 2WXJA 1UJJA 4IRUA 5B1BE 3UIPC 4B8AA 4FA6A 1N9AA 5BV1A 4DUIA 4JA9A 4I2WA 4YDYA 5AJLA 4GB9A 5ENTD 2RG8A 3NB2A 1MHQA 4ATZD 4GA2A 1X5BA 3ZYLA 4WNEA 5KNHD 1E8YA 3ZHEB 4BTBA 4XZ4A 3NBNB 4AEZC 5FZRA 3CHOA 3ML8A 4TRQA 2FULA 4TV3A 4U7EB 4QFVA 1TN6A 1ZBPA 4U96D 4JZYA 3V79K 5FQ4A 4BTAA 4G2VA 2HYZA 3ZYMA 3J5QB 5AQ7A 4ILGA 2PNNA 2VTBA 4RG6A 4YDOA 1NL4A 4OAUC 4RVBA 2ZXWE 4R7LA 4CDNA 4K5BA 3FTZA 3RIBA 4B0ZA 1KT1A 4LNGA 2FI7A 2CFZA 2WMOA 3U66A 3D9MA 3CVQA 3MJWA 4BERA 3FTYA 1TNUA 3FDHA 4DI3A 1K1BA 3D9LA 3GZ1A 1TEZA 2H6GA 2YNQA 2V8SE 3DSVA 1IHGA 5AQAA 3DSXA 1E8ZA 1VDYA 4U0UA 1WAO1 5B3SE 2J08A 4WWOA 4U8VD 1K8KG 3LYAA 2Q7FA 4EZJA 3BU8A 3ULQA 2WXRA 4BT8A 1BPOA 2MYOA 1S70B 4J8EA 3IEGA 1K3ZD 2Y1LE 4GYYA 4JHRA 3AG3E 2XRYA 3AG2E 5BXOA 2XZDG 1TNZA 4YDEA 1O1TA 4AJWA 3RK6A 1HXIA 4URKA 4G24A 3KEZA 4GTSA 1KT0A 2QYUA 2VGEA 1N0RA 4ZHBA 4EHMA 3LVQE 3TWXA 3G2VA 3HVEA 5ENQD 2LSVA 2P9KG 3UT8A 4ACLA 2J8SD 3PDNA 3FH7A 3DBSA 2YHEA 1HE8A 1YMPA 4FP7A 2P58C 3JXIA 3ZNGA 2L9BA 3NOGD 1WG0A 3SO8A 4FU3A 3PZ1A 5T8IA 3E34A 3QKYA 1U3DA 1OY3D 4BT9A 2J4DA 4HBDA 4O1PA 2Y0BG 5AJDA 3G2SA 1OT8A 3Q47B 3CLJA 3UKRG 4GA1A 3FP3A 2JEKA 5JJTA 2ETAA 5ITZF 3VTXA 5J90A 1QNFA 2J9QA 3CHQA 2NYJA 3S7JA 4HRMB 4WWNA 1V55E 3PS6A 4U95D 4ABNA 4CGVA 2KCKA 1ELKA 5FQ6A 3HXEA 1XGWA 2OVFA 4UWKA 2VSYA 1H19A 3FU3A 2FO1E 2WVIA 5G04J 3TWWA 1EPUA 4BFRA 2FO7A 3LY9A 4WUYA 2DWZA 4DX6D 3ASOE 4JA7A 1JCQA 3APDA 3UX4A 5BXUA 2WXLA 2AWIA 2V5FA 1HZ4A 3SY2A 3HDXA 2XRZA 5JA4D 1PY1A 3FUIA 5AAOA 3APCA 2FEZA 2AXUA 4HLLA 1SA4A 3FEXA 1SZ9A 5AQBA 1V54E 3SFXA 3L22A 2DVWA 4EECA 3DXMG 4CEMA 2NC9A 2XPYA 5FT9A 5KCMA 3QWVA 4DRXE 5AN8A 1JUQA 4HB5A 3UT4A 4J8SA 3QARA 4J6IA 5CBOA 4DX1A 5KNGA 1YYHA 2XS1A 1NP7A 4RG9A 4GCNA 1Y6IA 3OXGA 1ZB1A 3LDZA 3N71A 5JJ6A 4N5CA 2I1JA 2V4HC 3SF4A 2L0IA 3FUNA 4CDRA 5FTPA 2IEJA 3MV3B 4F53A 1MX6A 2IJGX 2GROB 4AP2A 1Z3YA 3UQ3A 4GTTA 3FU5A 5LP0A 4I6JA 5FINA 3U4TA 3PH0C 2E2EA 3DEPA 2X38A 5IY5E 1DCEA 2VGYA 2I9CA 3DSSA 3L9TA 4BX9A 3EHRA 2OVBA 2XGOA 3WG7E 5DBKA 1WDYA 4A63B 4LRZA 3U9WA 3VLFA 1LD7A 1LF8A 4G8LA 4K5AB 1KZOA 3PZ2A 1N4QA 2WXMA 3S7FA 2H6IA 4LSZE 2KZTA 5EX0A 3LY7A 4YNDA 3FU6A 3FHEA 4CGWA 2GRPB 3FUFA 3NZSA 4GU5A 2A5EA 1HFAA 4JEHA 3ABKE 5LFAA 3F6QA 4C0EA 1Z5SC 4L1BA 3T8KA 2AVPA 2E0IA 1E8XA 3L08A 1A17A 3E30A 4GMRA 4XIFA 2QC9A 2HR2A 5EYPF 5ARGA 2X3MA 2F0YA 4JC8A 2KCLA 5FWQA 3FUMA 1PC2A 5EYLA 5BUZA 3AS4A 4QQIA 3LEWA 3QJZA 1IXVA 4KVMA 3ABLE 1N54A 3T5XA 3RRNB 3FTUA 3ASDA 1IQRA 3HG0D 1N4SA 4GTVA 3CQGB 3PE4A 4GMJA 3ENEA 3HXDA 5CEDB 2R05A 2L0TB 1E96B 5HKPA 2UY1B 3FU0A 3ZUVB 2Y4TA 3PVLA 2JABA 4IYPA 4HFGA 1BI7B 2LAIA 5CMWA 3EIJA 4FJYA 4AOFA 4KZCA 4LCTA 2QYJA 1OWPA 1K1AA 2R17C 4TXPA 4UQZA 1SA5A 3NAWA 3KSQA 2P9LG 4JL0A 4HXIA 5G05C 5LX8A 4EBAA 2XQ0A 4I9EA 1GW6A 3NF1A 2B6CA 3Q78A 3ZIMA 3RRUA 3EJNA 1D9SA 4ANVA 4H7YA 4UQXA 3MGBA 4U63A 3LCAA 3X2QE 2ZIRA 2WPVA 2XGSA 3GYZA 3G2TA 2J09A 3FFLA 3IHYA 4B93B 3DPDA 4AY6A 3MZLB 1TN7A 3TAXA 4LNUD 4BY6A 3D9JA 3PUJA 4APOA 2JLBA 1G3NB 5G2NA 5BNWA 2NXPA 2RD0A 2VQ2A 3QB2A 4OYSA 4AIFA 4BWRA 1TN8A 4DX5D 2NSZA 5KJKA 3CSFA 3NZUA 2VTBB 5DIZA 3S7BA 5E75A 4CT0A 2L6BA 4UI9K 1DVPA 5B1AE 5D0OD 3C98A 2XEEA 2WB2A 1OCOE 4JVSA 3D9IA 3RU0A 4GTPA 5CCMA 2OEVA 3FTVA 4N39A 2VSNA 1BU9A 1U3CA 1PAQA 2IOLA 1UG3A 5KJMA 2WQHA 4C9BB 3FUJA 3L13A 2KATA 2F8YA 3EU9A 4U0SA 3Q15A 3OTNA 3E4BA 4TUMA 3ZPJA 1A5EA 1KLXA 2MOWA 4GZ5A 1HG2A 4HOSA 2VSXE 3TXNA 2OV8A 4GYOA 3V31A 3OAWA 4I6EA 1UW4B 2A5UA 3CVXA 4O6FA 2I6HA 1OCCE 2CHXA 2IU1A 1HO8A 4G25A 4K5CA 1N4PA 5KJLA 2EQXA 4HI8A 5ARFA 2EINE 2EILE 4DX2A 4YVOA 1RW2A 2H6HA 2VJ8A 4GMLA 3SQVA 2LNIA 4G26A 2OOEA 2C2LA 3BG1B 5AIJA 1RZ4A 1IKND 2WQ6A 3ZHEA 5EKQD 4I17A 4HNAD 3Q7AA 4JHKA 2IFUA 1Z3XA 1E7VA 5EIBE 3CKBA 4HRLA 5CECB 3DSUA 3HVEB 2DZOA 3UMVA 4JEUA 2RKKA 3ZYQA 3FUHA 3TG4A 1O1RA 3PRZA 5LOZA 1HS6A 1H2TC 2WXOA 2AW6A 4B8CB 2EIME 4Y6WA 3HXCA 4O1OA 2MRIA 3IXEA 2IONA 3ASFA 1E8WA 3UUXA 5CCLA 2BUGA 5HQ8A 1HH8A 1INZA 3W9FA 3QWWA 1JCSA 4C48B 2LUHA 4AV7A 4B89A 4KYOB 2J49A 3PUKA 4AM9A 2VSOE 4IN3B 5T3RA 3CVLA 3EUVA 2ONDA 1HG5A 2FF4A 1IQUA 3MYVA 2PQRA 3UIOC 3B7UX 3QDNA 3CQCB 4UI9J 1N94A 3ZGQA 4CZ2D 3BUAA 4H7XA 2WXNA 4UWFA 3LS8A 3LY8A 3UM1A 2DZNA 3QWPA 4M3OA 4P29A 3QC1A 4GTRA 3ZFWA 4PUCA 3CHPA 3NQPA 3T8MA 3CSTA 4J8FA 5T4YA 1FCHA 5BV0A 3LKUA 3VLEA 1OXJA 3CHMA 4J7WA 3RO2A 3HXBA 4MKTA 4Z68A 3RKVA 2GRMA 4A55A 1XNFA 3D9PA 4G11A 3RO3A 1DNPA 4Q96A 3TWRA 3QOUA 3PNTB 2RFAA 1NZNA 4DJAA 3CK7A 2F37A 5AARA 2P2CP 1P5QA 4DPRA 2R5SA 1QBQA 4F7AA 4F1PA 3I4GA 3RRMB 4JB8P 3ZXPA 3ULYA 4AXHA 3UINC 4B94A 3CK8A 5CBNA 1QYMA 2BTDA 4XX5A 4NACA 3Q5MA 2KXPC 1Z6TA 1FPPA 3EDTB 2VGXB 3B95A 3T5VA 3L17A 1DC2A 3FUDA 3ISMC 3FY4A 4G1TA 1TJCA 4GZ3A 5FZSA 1Q2ZA 5A23A 3B7BA 3K9IA 2IO3C 2OCCE 3RAUA 5AENA 4OVUA 3CVPA 3J5PA 3TWQA 1OCZE 4ACKA 5JMND 5EX3A 2BKGA 4G23A 2HM8A 4EZLA 3I4RB 1B89A 1MZCA 2KZTB 1ELRA 1H6OA 3CVUA 3Q9NC 1X81A 4PS3A 5HI7A 5HRYA 2IOSA 3APFA 3SBSA 1ELWA 1LD8A 4GZCA 5AYWD 3R7QA 3IKOB 1NI1A 2J4BA 2ZGDA 2R03A 4G8KA 2X6JA 2GRLA 2KM4A 4RLYA 1EF1C 3Q9UC 4ANUA 3PZ3A 5M72A 5A6CA 3SI5A 3UM0A 3KAEA 4NURA 3Q7FA 3LJ3A 4XI9A 3EIQC 3BG0B 1N11A 2GGFA 1OCRE 4ILHB 3ZXSA 1AP7A 4CYMD 4FHJA 4GAAA 5JJ7A 5AQ9A 4L2YA 3ZKJA 4RQIA 3Q49B 3JQ0A 1UJKA 1OWNA 1KPSB 1E90A 1SZAA 3OXLA 3LXUX 4HOQA 1WY6A 4O60A 5D2MC 5BW8C 1JWGA 4HI9A 5CMYA 5C2YA 3ZVVA 2QFCA 5EDSA 2Y3AA 2Y69E 2PM7A 4HLEA 3MKQA 3HHMA 3AS5A 1JPLA 4HOTA 5LCWJ 4U04A 1Y8MA 2V4LA 1H6KA 4IULA 1JWFA 4ME2A 4N3BA 3RSEG 3UXGA 3I3NA 3KSLA 2C0MA 1FT1A 2ETCA 3TWSA 4BEPA 2PL2A 3FTXA 3TWTA 2P9UG 3FULA 4GPKA 4BESA 5BPPA 3EHNA 3VTYA 4K03A 4OAVB 3KEAA 1E7UA 2WXKA 4UQYA 2ZISA 4FLBA 5ENOD 4Q69A 4UUCA 3PEUB 1UOHA 4GA0A 2AXZA 5CEAA 1TJFA 1U2VG 4BX8A 4E85A
chains in the Genus database with same CATH topology
4GTRA 2IEJA 3DRAA 1TN8A 3E33A 1TNBA 1S63A 2R2LA 3Q7AA 3DSWA 3Q79A 3E32A 1N4SA 4GTVA 1S64A 4GTTA 3HXEA 3DSUA 4LNBA 1FT2A 1N4RA 1TNZA 4YDEA 3HXBA 1O1TA 1MZCA 1O1RA 3HXDA 1TN6A 1DCEA 1X81A 3DSSA 4GTSA 4GTPA 1JCQA 3HXFA 3HXCA 4YDOA 1NL4A 3DPYA 4GTMA 4EHMA 1LD7A 2H6FA 1KZOA 1LD8A 3PZ2A 3SFYA 1N4QA 3PZ4A 1D8EA 1NI1A 2H6IA 1SA5A 1QBQA 1O1SA 3KSLA 1JCSA 3KSQA 1JCRA 1N95A 1FT1A 1SA4A 4GTOA 1TNYA 3SFXA 4GTQA 4LNGA 4MBGA 2BEDA 3Q73A 1KZPA 3PZ1A 3PZ3A 3EUVA 3Q78A 3E34A 1TNUA 1TNOA 3Q75A 3C72A 2ZIRA 3Q7FA 2H6GA 1N4PA 1N94A 2ZISA 1D8DA 3DSVA 1FPPA 1N9AA 3E30A 3DSXA 1LTXA 4L9PA 2H6HA 3EU5A 2F0YA 1TN7A 3DSTA 3E37A 1O5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTR A;  2IEJ A;  3DRA A;  1TN8 A;  3E33 A;  1TNB A;  1S63 A;  2R2L A;  3Q7A A;  3DSW A;  3Q79 A;  3E32 A;  1N4S A;  4GTV A;  1S64 A;  4GTT A;  3HXE A;  3DSU A;  4LNB A;  1FT2 A;  1N4R A;  1TNZ A;  4YDE A;  3HXB A;  1O1T A;  1MZC A;  1O1R A;  3HXD A;  1TN6 A;  1DCE A;  1X81 A;  3DSS A;  4GTS A;  4GTP A;  1JCQ A;  3HXF A;  3HXC A;  4YDO A;  1NL4 A;  3DPY A;  4GTM A;  4EHM A;  1LD7 A;  2H6F A;  1KZO A;  1LD8 A;  3PZ2 A;  3SFY A;  1N4Q A;  3PZ4 A;  1D8E A;  1NI1 A;  2H6I A;  1SA5 A;  1QBQ A;  1O1S A;  3KSL A;  1JCS A;  3KSQ A;  1JCR A;  1N95 A;  1FT1 A;  1SA4 A;  4GTO A;  1TNY A;  3SFX A;  4GTQ A;  4LNG A;  4MBG A;  2BED A;  3Q73 A;  1KZP A;  3PZ1 A;  3PZ3 A;  3EUV A;  3Q78 A;  3E34 A;  1TNU A;  1TNO A;  3Q75 A;  3C72 A;  2ZIR A;  3Q7F A;  2H6G A;  1N4P A;  1N94 A;  2ZIS A;  1D8D A;  3DSV A;  1FPP A;  1N9A A;  3E30 A;  3DSX A;  1LTX A;  4L9P A;  2H6H A;  3EU5 A;  2F0Y A;  1TN7 A;  3DST A;  3E37 A;  1O5M A; 
#chains in the Genus database with same CATH topology
 1IYG A;  3CVV A;  3KS2 A;  2ETB A;  4EQF A;  4KT6 B;  3V30 A;  5ANR A;  4HS2 A;  2R2L A;  3DSW A;  4WNG A;  3FTW A;  2XEH A;  4LNB A;  1AWC B;  5J08 A;  3SFZ A;  4A1S A;  3LJN A;  4NRH B;  1UN9 A;  3IV0 A;  2C0L A;  2RFM A;  5CER B;  3TL5 A;  4APF A;  3FEY A;  2YQ8 A;  4J8D A;  1BLX B;  4KXK B;  4HOR A;  4JPS A;  4F6R D;  4F3V A;  2GRR B;  2GW1 A;  2I2O A;  1IHB A;  5FQ8 A;  3ZYK A;  2ZGG A;  3QNK A;  4A3V A;  2XPZ A;  4A1G A;  4WAF A;  4JW1 A;  5KWD A;  4DI4 A;  1KZP A;  4TXR A;  5ENR D;  3ML9 A;  3RJV A;  4JD2 G;  1OWL A;  3Q75 A;  4AY5 A;  3MX3 A;  5ENN A;  4EZK A;  2UWJ G;  3ASH A;  4KMO A;  3EU5 A;  2QZA A;  3C3O A;  3FWV A;  3CR3 A;  3D9K A;  2IO2 C;  2KCV A;  4NIK A;  4M7C A;  5EN5 D;  2YHC A;  2R59 A;  3O48 A;  2WXG A;  4J0U A;  1SQM A;  5ENS D;  3DRA A;  3JCK C;  4LUN U;  3IHV A;  4XKC A;  2DBA A;  4TXQ A;  3E32 A;  4BET A;  3AJI A;  1FT2 A;  2X6H A;  1ZU2 A;  4N3A A;  4EPZ A;  3GW4 A;  3B7T A;  2OEW A;  3ZEF A;  2IQC A;  3CHR A;  5KJN A;  3FUE A;  3FH8 A;  1BI8 B;  3TXM A;  4FUL A;  2AXV A;  2I1K A;  5HS0 A;  2WXP A;  5KBA A;  3PZD A;  3ULE G;  1SVX A;  3AAA C;  2QY7 A;  4LG6 A;  4U07 A;  4TUU A;  2Y4U A;  4RSY A;  3O4Z A;  3B7R L;  2CHZ A;  5A7D B;  4YDW A;  4I6G A;  1OWM A;  3P2B A;  3MA5 A;  2EIK E;  3SNX A;  4PDX A;  2F8X K;  2DYR E;  1NA0 A;  4DLO A;  3D9O A;  4PS8 A;  4XE0 A;  3VLD A;  4I43 A;  4I1O B;  3CKC A;  3JYS A;  2GRQ B;  3R7R A;  3TWV A;  1QZ2 A;  3MV2 B;  3L54 A;  1QQE A;  2GRN B;  4HQD A;  2AJA A;  3EHQ A;  4ZFH A;  4U0Z A;  3E33 A;  2X6F A;  3FTS A;  4V3I A;  3C3Q A;  3AG4 E;  3UTM A;  2P9I G;  4N2S A;  3ONL A;  1OUV A;  4FC8 A;  1H0A A;  2ILR A;  2P9S G;  3ZRH A;  1EYH A;  3AU5 A;  4A3T A;  1L5J A;  3SZ7 A;  2WQ7 A;  2WXQ A;  1WM5 A;  3G2U A;  3B13 A;  3C5R A;  3ONK A;  2LXL A;  5ENP D;  5EID A;  2HE0 A;  2PZI A;  3DPY A;  2DYS E;  3MKR A;  3S2A A;  3U64 A;  3SFY A;  1MJ0 A;  3BEE A;  4KZ0 A;  3UKU G;  3JXJ A;  2A4Z A;  1HU3 A;  4UI9 C;  3HIZ A;  3ESL A;  1YA0 A;  5D66 A;  3Q4A B;  5FQ7 A;  1W3B A;  4GTQ A;  2DIW A;  1TR4 A;  4MBG A;  2BED A;  4KBQ A;  2BKK B;  2LXM A;  3CIA A;  2KBX A;  2X6K A;  4Q94 A;  4L2L A;  3CVW A;  4XEI G;  3TGO A;  3D9N A;  3SGH A;  4N3C A;  3DXK G;  1LTX A;  2CG3 A;  3TG5 A;  4FAD A;  5EIL A;  3ZW3 A;  3WXX A;  3DST A;  1H2V C;  3BQO A;  2V0P A;  2IF4 A;  4L7T A;  4I1A A;  2CFU A;  2EIJ E;  5C1D A;  2IY0 C;  4MS6 A;  4CRW A;  4U8H A;  1MQS A;  4DX7 D;  3PE3 A;  1TNB A;  4ANX A;  5G55 A;  1S64 A;  3T9K A;  2WXH A;  4CDM A;  3G2W A;  3QK0 A;  1N52 A;  5G04 C;  3ASG A;  4GZ6 A;  1S0P A;  4N2Q A;  3I5P A;  1SW6 A;  5H7P A;  1OWO A;  3CVN A;  2XCB A;  3IBE A;  3PZ4 A;  1FVF A;  4NQ0 A;  4L23 A;  2LAH A;  4UWH A;  4WWP A;  2B0O E;  3CVY A;  3DEO A;  4Y6C A;  2WM9 A;  4MLP A;  2LSU A;  1JCR A;  1N95 A;  1N0Q A;  5FZQ A;  4HOU A;  4GTO A;  4I1M A;  4ANW A;  3D3M A;  1MX2 A;  2J07 A;  4FLH A;  3ZN3 A;  3AG1 E;  3CV0 A;  3UT7 A;  4KVO A;  3U3W A;  2XEN A;  1H6P A;  2XS8 A;  2VGX A;  4LEU A;  4FHK A;  4ILI A;  1H2U A;  2CG2 A;  3SD5 A;  4XI0 A;  3E37 A;  3SHF A;  1NA3 A;  1O5M A;  3L6A A;  2XHE A;  3MEK A;  4MRU A;  3URZ A;  2R02 A;  3QAQ A;  3JUE A;  5CHE E;  5ANL A;  4UWL A;  3P1U A;  3V2X A;  3MKQ B;  1S63 A;  3Q79 A;  5E76 A;  2M63 A;  2PM6 A;  1N4R A;  2KC7 A;  4I2Z A;  5FJY A;  3EHM A;  3CK9 A;  4W9R A;  3JQ1 A;  3L16 A;  3TJP A;  2PQN A;  3HXF A;  3D9H A;  4GTM A;  4E6H A;  4EBA G;  3PNL B;  2H6F A;  3UM3 A;  2XGM A;  4I9C A;  4CCA A;  2XPI A;  5CRU A;  4FJZ A;  4GCO A;  2XEV A;  5JHB A;  3UI2 A;  3ASN E;  2BF0 X;  4J8Y A;  4YVQ C;  3B7S A;  4C0M A;  2FBN A;  2HO1 A;  3ABM E;  4HRN A;  1BD8 A;  3KD7 A;  4CT4 A;  1NFI E;  4JXT A;  3PRE A;  3HRA A;  1TNO A;  1MX4 A;  4WNF A;  3TWU A;  2ZU6 B;  2DCP A;  3S7D A;  1D8D A;  4WND A;  2P9P G;  3MCX A;  4X8Q A;  3ZU7 B;  4BSZ B;  3OXF A;  3AU4 A;  3JUI A;  4LER A;  5G05 J;  3LPZ A;  4N5Q A;  4L9P A;  4U8Y D;  5JHA A;  1FVH A;  3DWL G;  1YCS B;  3GZS A;  1MYO A;  3R9M A;  2XZT G;  3UM2 A;  5CRV A;  4GZD A;  2LO6 A;  4DK5 A;  2WMN A;  1EDU A;  2X6I A;  4HVB A;  3PEV B;  2V5Q C;  2MHK A;  3HYM B;  5LCW C;  4AVX A;  4XKB A;  3SBT B;  2XCC A;  3FUK A;  4PH4 B;  4ATG A;  4JHJ A;  5FIO A;  2WXI A;  4D10 C;  3L82 A;  1UN8 A;  4UWG A;  3ESK A;  3GZ2 A;  4BSX A;  5BT1 A;  2YIN A;  3V2O A;  1D8E A;  4K0R A;  2CHW A;  4F1S A;  2P9N G;  3CGH A;  4PS7 A;  1O1S A;  3C3R A;  3LVR E;  2L6J A;  3UPV A;  2VYI A;  2WXF A;  1TNY A;  2UY1 A;  3NOC D;  3R9A B;  3Q73 A;  3W9G A;  4OVV A;  1HF8 A;  3CEQ A;  5D0Q D;  1TYQ G;  1DCQ A;  3FH5 A;  3CHS A;  4GYW A;  1HX8 A;  4GPM A;  4DLQ A;  3AS8 A;  3C72 A;  2WXJ A;  1UJJ A;  4IRU A;  5B1B E;  3UIP C;  4B8A A;  4FA6 A;  1N9A A;  5BV1 A;  4DUI A;  4JA9 A;  4I2W A;  4YDY A;  5AJL A;  4GB9 A;  5ENT D;  2RG8 A;  3NB2 A;  1MHQ A;  4ATZ D;  4GA2 A;  1X5B A;  3ZYL A;  4WNE A;  5KNH D;  1E8Y A;  3ZHE B;  4BTB A;  4XZ4 A;  3NBN B;  4AEZ C;  5FZR A;  3CHO A;  3ML8 A;  4TRQ A;  2FUL A;  4TV3 A;  4U7E B;  4QFV A;  1TN6 A;  1ZBP A;  4U96 D;  4JZY A;  3V79 K;  5FQ4 A;  4BTA A;  4G2V A;  2HYZ A;  3ZYM A;  3J5Q B;  5AQ7 A;  4ILG A;  2PNN A;  2VTB A;  4RG6 A;  4YDO A;  1NL4 A;  4OAU C;  4RVB A;  2ZXW E;  4R7L A;  4CDN A;  4K5B A;  3FTZ A;  3RIB A;  4B0Z A;  1KT1 A;  4LNG A;  2FI7 A;  2CFZ A;  2WMO A;  3U66 A;  3D9M A;  3CVQ A;  3MJW A;  4BER A;  3FTY A;  1TNU A;  3FDH A;  4DI3 A;  1K1B A;  3D9L A;  3GZ1 A;  1TEZ A;  2H6G A;  2YNQ A;  2V8S E;  3DSV A;  1IHG A;  5AQA A;  3DSX A;  1E8Z A;  1VDY A;  4U0U A;  1WAO 1;  5B3S E;  2J08 A;  4WWO A;  4U8V D;  1K8K G;  3LYA A;  2Q7F A;  4EZJ A;  3BU8 A;  3ULQ A;  2WXR A;  4BT8 A;  1BPO A;  2MYO A;  1S70 B;  4J8E A;  3IEG A;  1K3Z D;  2Y1L E;  4GYY A;  4JHR A;  3AG3 E;  2XRY A;  3AG2 E;  5BXO A;  2XZD G;  1TNZ A;  4YDE A;  1O1T A;  4AJW A;  3RK6 A;  1HXI A;  4URK A;  4G24 A;  3KEZ A;  4GTS A;  1KT0 A;  2QYU A;  2VGE A;  1N0R A;  4ZHB A;  4EHM A;  3LVQ E;  3TWX A;  3G2V A;  3HVE A;  5ENQ D;  2LSV A;  2P9K G;  3UT8 A;  4ACL A;  2J8S D;  3PDN A;  3FH7 A;  3DBS A;  2YHE A;  1HE8 A;  1YMP A;  4FP7 A;  2P58 C;  3JXI A;  3ZNG A;  2L9B A;  3NOG D;  1WG0 A;  3SO8 A;  4FU3 A;  3PZ1 A;  5T8I A;  3E34 A;  3QKY A;  1U3D A;  1OY3 D;  4BT9 A;  2J4D A;  4HBD A;  4O1P A;  2Y0B G;  5AJD A;  3G2S A;  1OT8 A;  3Q47 B;  3CLJ A;  3UKR G;  4GA1 A;  3FP3 A;  2JEK A;  5JJT A;  2ETA A;  5ITZ F;  3VTX A;  5J90 A;  1QNF A;  2J9Q A;  3CHQ A;  2NYJ A;  3S7J A;  4HRM B;  4WWN A;  1V55 E;  3PS6 A;  4U95 D;  4ABN A;  4CGV A;  2KCK A;  1ELK A;  5FQ6 A;  3HXE A;  1XGW A;  2OVF A;  4UWK A;  2VSY A;  1H19 A;  3FU3 A;  2FO1 E;  2WVI A;  5G04 J;  3TWW A;  1EPU A;  4BFR A;  2FO7 A;  3LY9 A;  4WUY A;  2DWZ A;  4DX6 D;  3ASO E;  4JA7 A;  1JCQ A;  3APD A;  3UX4 A;  5BXU A;  2WXL A;  2AWI A;  2V5F A;  1HZ4 A;  3SY2 A;  3HDX A;  2XRZ A;  5JA4 D;  1PY1 A;  3FUI A;  5AAO A;  3APC A;  2FEZ A;  2AXU A;  4HLL A;  1SA4 A;  3FEX A;  1SZ9 A;  5AQB A;  1V54 E;  3SFX A;  3L22 A;  2DVW A;  4EEC A;  3DXM G;  4CEM A;  2NC9 A;  2XPY A;  5FT9 A;  5KCM A;  3QWV A;  4DRX E;  5AN8 A;  1JUQ A;  4HB5 A;  3UT4 A;  4J8S A;  3QAR A;  4J6I A;  5CBO A;  4DX1 A;  5KNG A;  1YYH A;  2XS1 A;  1NP7 A;  4RG9 A;  4GCN A;  1Y6I A;  3OXG A;  1ZB1 A;  3LDZ A;  3N71 A;  5JJ6 A;  4N5C A;  2I1J A;  2V4H C;  3SF4 A;  2L0I A;  3FUN A;  4CDR A;  5FTP A;  2IEJ A;  3MV3 B;  4F53 A;  1MX6 A;  2IJG X;  2GRO B;  4AP2 A;  1Z3Y A;  3UQ3 A;  4GTT A;  3FU5 A;  5LP0 A;  4I6J A;  5FIN A;  3U4T A;  3PH0 C;  2E2E A;  3DEP A;  2X38 A;  5IY5 E;  1DCE A;  2VGY A;  2I9C A;  3DSS A;  3L9T A;  4BX9 A;  3EHR A;  2OVB A;  2XGO A;  3WG7 E;  5DBK A;  1WDY A;  4A63 B;  4LRZ A;  3U9W A;  3VLF A;  1LD7 A;  1LF8 A;  4G8L A;  4K5A B;  1KZO A;  3PZ2 A;  1N4Q A;  2WXM A;  3S7F A;  2H6I A;  4LSZ E;  2KZT A;  5EX0 A;  3LY7 A;  4YND A;  3FU6 A;  3FHE A;  4CGW A;  2GRP B;  3FUF A;  3NZS A;  4GU5 A;  2A5E A;  1HFA A;  4JEH A;  3ABK E;  5LFA A;  3F6Q A;  4C0E A;  1Z5S C;  4L1B A;  3T8K A;  2AVP A;  2E0I A;  1E8X A;  3L08 A;  1A17 A;  3E30 A;  4GMR A;  4XIF A;  2QC9 A;  2HR2 A;  5EYP F;  5ARG A;  2X3M A;  2F0Y A;  4JC8 A;  2KCL A;  5FWQ A;  3FUM A;  1PC2 A;  5EYL A;  5BUZ A;  3AS4 A;  4QQI A;  3LEW A;  3QJZ A;  1IXV A;  4KVM A;  3ABL E;  1N54 A;  3T5X A;  3RRN B;  3FTU A;  3ASD A;  1IQR A;  3HG0 D;  1N4S A;  4GTV A;  3CQG B;  3PE4 A;  4GMJ A;  3ENE A;  3HXD A;  5CED B;  2R05 A;  2L0T B;  1E96 B;  5HKP A;  2UY1 B;  3FU0 A;  3ZUV B;  2Y4T A;  3PVL A;  2JAB A;  4IYP A;  4HFG A;  1BI7 B;  2LAI A;  5CMW A;  3EIJ A;  4FJY A;  4AOF A;  4KZC A;  4LCT A;  2QYJ A;  1OWP A;  1K1A A;  2R17 C;  4TXP A;  4UQZ A;  1SA5 A;  3NAW A;  3KSQ A;  2P9L G;  4JL0 A;  4HXI A;  5G05 C;  5LX8 A;  4EBA A;  2XQ0 A;  4I9E A;  1GW6 A;  3NF1 A;  2B6C A;  3Q78 A;  3ZIM A;  3RRU A;  3EJN A;  1D9S A;  4ANV A;  4H7Y A;  4UQX A;  3MGB A;  4U63 A;  3LCA A;  3X2Q E;  2ZIR A;  2WPV A;  2XGS A;  3GYZ A;  3G2T A;  2J09 A;  3FFL A;  3IHY A;  4B93 B;  3DPD A;  4AY6 A;  3MZL B;  1TN7 A;  3TAX A;  4LNU D;  4BY6 A;  3D9J A;  3PUJ A;  4APO A;  2JLB A;  1G3N B;  5G2N A;  5BNW A;  2NXP A;  2RD0 A;  2VQ2 A;  3QB2 A;  4OYS A;  4AIF A;  4BWR A;  1TN8 A;  4DX5 D;  2NSZ A;  5KJK A;  3CSF A;  3NZU A;  2VTB B;  5DIZ A;  3S7B A;  5E75 A;  4CT0 A;  2L6B A;  4UI9 K;  1DVP A;  5B1A E;  5D0O D;  3C98 A;  2XEE A;  2WB2 A;  1OCO E;  4JVS A;  3D9I A;  3RU0 A;  4GTP A;  5CCM A;  2OEV A;  3FTV A;  4N39 A;  2VSN A;  1BU9 A;  1U3C A;  1PAQ A;  2IOL A;  1UG3 A;  5KJM A;  2WQH A;  4C9B B;  3FUJ A;  3L13 A;  2KAT A;  2F8Y A;  3EU9 A;  4U0S A;  3Q15 A;  3OTN A;  3E4B A;  4TUM A;  3ZPJ A;  1A5E A;  1KLX A;  2MOW A;  4GZ5 A;  1HG2 A;  4HOS A;  2VSX E;  3TXN A;  2OV8 A;  4GYO A;  3V31 A;  3OAW A;  4I6E A;  1UW4 B;  2A5U A;  3CVX A;  4O6F A;  2I6H A;  1OCC E;  2CHX A;  2IU1 A;  1HO8 A;  4G25 A;  4K5C A;  1N4P A;  5KJL A;  2EQX A;  4HI8 A;  5ARF A;  2EIN E;  2EIL E;  4DX2 A;  4YVO A;  1RW2 A;  2H6H A;  2VJ8 A;  4GML A;  3SQV A;  2LNI A;  4G26 A;  2OOE A;  2C2L A;  3BG1 B;  5AIJ A;  1RZ4 A;  1IKN D;  2WQ6 A;  3ZHE A;  5EKQ D;  4I17 A;  4HNA D;  3Q7A A;  4JHK A;  2IFU A;  1Z3X A;  1E7V A;  5EIB E;  3CKB A;  4HRL A;  5CEC B;  3DSU A;  3HVE B;  2DZO A;  3UMV A;  4JEU A;  2RKK A;  3ZYQ A;  3FUH A;  3TG4 A;  1O1R A;  3PRZ A;  5LOZ A;  1HS6 A;  1H2T C;  2WXO A;  2AW6 A;  4B8C B;  2EIM E;  4Y6W A;  3HXC A;  4O1O A;  2MRI A;  3IXE A;  2ION A;  3ASF A;  1E8W A;  3UUX A;  5CCL A;  2BUG A;  5HQ8 A;  1HH8 A;  1INZ A;  3W9F A;  3QWW A;  1JCS A;  4C48 B;  2LUH A;  4AV7 A;  4B89 A;  4KYO B;  2J49 A;  3PUK A;  4AM9 A;  2VSO E;  4IN3 B;  5T3R A;  3CVL A;  3EUV A;  2OND A;  1HG5 A;  2FF4 A;  1IQU A;  3MYV A;  2PQR A;  3UIO C;  3B7U X;  3QDN A;  3CQC B;  4UI9 J;  1N94 A;  3ZGQ A;  4CZ2 D;  3BUA A;  4H7X A;  2WXN A;  4UWF A;  3LS8 A;  3LY8 A;  3UM1 A;  2DZN A;  3QWP A;  4M3O A;  4P29 A;  3QC1 A;  4GTR A;  3ZFW A;  4PUC A;  3CHP A;  3NQP A;  3T8M A;  3CST A;  4J8F A;  5T4Y A;  1FCH A;  5BV0 A;  3LKU A;  3VLE A;  1OXJ A;  3CHM A;  4J7W A;  3RO2 A;  3HXB A;  4MKT A;  4Z68 A;  3RKV A;  2GRM A;  4A55 A;  1XNF A;  3D9P A;  4G11 A;  3RO3 A;  1DNP A;  4Q96 A;  3TWR A;  3QOU A;  3PNT B;  2RFA A;  1NZN A;  4DJA A;  3CK7 A;  2F37 A;  5AAR A;  2P2C P;  1P5Q A;  4DPR A;  2R5S A;  1QBQ A;  4F7A A;  4F1P A;  3I4G A;  3RRM B;  4JB8 P;  3ZXP A;  3ULY A;  4AXH A;  3UIN C;  4B94 A;  3CK8 A;  5CBN A;  1QYM A;  2BTD A;  4XX5 A;  4NAC A;  3Q5M A;  2KXP C;  1Z6T A;  1FPP A;  3EDT B;  2VGX B;  3B95 A;  3T5V A;  3L17 A;  1DC2 A;  3FUD A;  3ISM C;  3FY4 A;  4G1T A;  1TJC A;  4GZ3 A;  5FZS A;  1Q2Z A;  5A23 A;  3B7B A;  3K9I A;  2IO3 C;  2OCC E;  3RAU A;  5AEN A;  4OVU A;  3CVP A;  3J5P A;  3TWQ A;  1OCZ E;  4ACK A;  5JMN D;  5EX3 A;  2BKG A;  4G23 A;  2HM8 A;  4EZL A;  3I4R B;  1B89 A;  1MZC A;  2KZT B;  1ELR A;  1H6O A;  3CVU A;  3Q9N C;  1X81 A;  4PS3 A;  5HI7 A;  5HRY A;  2IOS A;  3APF A;  3SBS A;  1ELW A;  1LD8 A;  4GZC A;  5AYW D;  3R7Q A;  3IKO B;  1NI1 A;  2J4B A;  2ZGD A;  2R03 A;  4G8K A;  2X6J A;  2GRL A;  2KM4 A;  4RLY A;  1EF1 C;  3Q9U C;  4ANU A;  3PZ3 A;  5M72 A;  5A6C A;  3SI5 A;  3UM0 A;  3KAE A;  4NUR A;  3Q7F A;  3LJ3 A;  4XI9 A;  3EIQ C;  3BG0 B;  1N11 A;  2GGF A;  1OCR E;  4ILH B;  3ZXS A;  1AP7 A;  4CYM D;  4FHJ A;  4GAA A;  5JJ7 A;  5AQ9 A;  4L2Y A;  3ZKJ A;  4RQI A;  3Q49 B;  3JQ0 A;  1UJK A;  1OWN A;  1KPS B;  1E90 A;  1SZA A;  3OXL A;  3LXU X;  4HOQ A;  1WY6 A;  4O60 A;  5D2M C;  5BW8 C;  1JWG A;  4HI9 A;  5CMY A;  5C2Y A;  3ZVV A;  2QFC A;  5EDS A;  2Y3A A;  2Y69 E;  2PM7 A;  4HLE A;  3MKQ A;  3HHM A;  3AS5 A;  1JPL A;  4HOT A;  5LCW J;  4U04 A;  1Y8M A;  2V4L A;  1H6K A;  4IUL A;  1JWF A;  4ME2 A;  4N3B A;  3RSE G;  3UXG A;  3I3N A;  3KSL A;  2C0M A;  1FT1 A;  2ETC A;  3TWS A;  4BEP A;  2PL2 A;  3FTX A;  3TWT A;  2P9U G;  3FUL A;  4GPK A;  4BES A;  5BPP A;  3EHN A;  3VTY A;  4K03 A;  4OAV B;  3KEA A;  1E7U A;  2WXK A;  4UQY A;  2ZIS A;  4FLB A;  5ENO D;  4Q69 A;  4UUC A;  3PEU B;  1UOH A;  4GA0 A;  2AXZ A;  5CEA A;  1TJF A;  1U2V G;  4BX8 A;  4E85 A; 
#chains in the Genus database with same CATH homology
 4GTR A;  2IEJ A;  3DRA A;  1TN8 A;  3E33 A;  1TNB A;  1S63 A;  2R2L A;  3Q7A A;  3DSW A;  3Q79 A;  3E32 A;  1N4S A;  4GTV A;  1S64 A;  4GTT A;  3HXE A;  3DSU A;  4LNB A;  1FT2 A;  1N4R A;  1TNZ A;  4YDE A;  3HXB A;  1O1T A;  1MZC A;  1O1R A;  3HXD A;  1TN6 A;  1DCE A;  1X81 A;  3DSS A;  4GTS A;  4GTP A;  1JCQ A;  3HXF A;  3HXC A;  4YDO A;  1NL4 A;  3DPY A;  4GTM A;  4EHM A;  1LD7 A;  2H6F A;  1KZO A;  1LD8 A;  3PZ2 A;  3SFY A;  1N4Q A;  3PZ4 A;  1D8E A;  1NI1 A;  2H6I A;  1SA5 A;  1QBQ A;  1O1S A;  3KSL A;  1JCS A;  3KSQ A;  1JCR A;  1N95 A;  1FT1 A;  1SA4 A;  4GTO A;  1TNY A;  3SFX A;  4GTQ A;  4LNG A;  4MBG A;  2BED A;  3Q73 A;  1KZP A;  3PZ1 A;  3PZ3 A;  3EUV A;  3Q78 A;  3E34 A;  1TNU A;  1TNO A;  3Q75 A;  3C72 A;  2ZIR A;  3Q7F A;  2H6G A;  1N4P A;  1N94 A;  2ZIS A;  1D8D A;  3DSV A;  1FPP A;  1N9A A;  3E30 A;  3DSX A;  1LTX A;  4L9P A;  2H6H A;  3EU5 A;  2F0Y A;  1TN7 A;  3DST A;  3E37 A;  1O5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...