1SVXA

Crystal structure of a designed selected ankyrin repeat protein in complex with the maltose binding protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
b'SDLGRKLLEAARAGQDDEVRILMANGADVNAADNTGTTPLHLAAYSGHLEIVEVLLKHGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin Repeat Protein off7
publication title High-affinity binders selected from designed ankyrin repeat protein libraries
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein/sugar binding protein
total genus 53
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2004-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1svxA00
3ZUVB 3DEPA 2MYOA 4DX5D 5CBOA 1N0QA 4K5BA 5ITZF 4OAVB 4C48B 1YYHA 2XENA 3HG0D 4BERA 5EIDA 4N5QA 3UTMA 4HQDA 1G3NB 3EHRA 5EN5D 3IXEA 1BI8B 4ZHBA 4HI9A 3NBNB 5CEAA 1OY3D 2V4HC 3ZU7B 4DX1A 3TWQA 3ZKJA 2ETBA 2RFAA 3W9GA 4A63B 1K1BA 3D9HA 4OAUC 1BI7B 4HNAD 3SO8A 3T8KA 3J5QB 4Z68A 1MX2A 3AJIA 2ZGDA 1TR4A 2BKKB 4YDWA 4UUCA 3TWVA 1BD8A 5D66A 3T9KA 4DUIA 2B0OE 4HRMB 4J7WA 5AAOA 5AQAA 5AQBA 3W9FA 2HE0A 3J5PA 2Y0BG 3JXJA 4YDYA 2FO1E 2BKGA 3DEOA 2L6BA 5ENTD 5CBNA 2F37A 4K5CA 5AN8A 1A5EA 4QQIA 4JB8P 3NOCD 4U8VD 2QYJA 5EILA 4U95D 5FINA 4BETA 2F8XK 5ENPD 3TWUA 1BLXB 1IHBA 5HRYA 4DX7D 1DCQA 4RLYA 5FIOA 3JXIA 5EIBE 3V2OA 1IKND 2P2CP 5KNGA 3TWSA 3EU9A 5JMND 4BEPA 2XEEA 4K5AB 4O60A 5ENQD 4QFVA 2J8SD 3LJNA 4GPMA 2Y1LE 1MYOA 1SVXA 2ETAA 2V5QC 4J8YA 4NIKA 3TWRA 1K3ZD 2XZDG 4HB5A 4HRNA 4F6RD 3V30A 3F6QA 3JUEA 4ATZD 1UOHA 5BXUA 2F8YA 3Q9UC 4HRLA 4F1PA 2DZOA 5AARA 4LG6A 5AQ7A 2NYJA 4HLLA 4G8KA 4CYMD 4O1OA 1S70B 4G8LA 4LSZE 2PNNA 5BXOA 2AJAA 5KBAA 5CEDB 2VGEA 1D9SA 4TUMA 4B93B 1WDYA 3V2XA 1AP7A 4BSZB 2DWZA 5KNHD 4DX6D 5HKPA 5KWDA 1N0RA 1WG0A 2DZNA 2ZGGA 2XEHA 3ZNGA 1MX6A 2A5EA 3UI2A 1SW6A 1YMPA 3TWTA 5ENSD 2QC9A 4O1PA 4U96D 3B7BA 4DX2A 3Q9NC 5EYPF 3C5RA 1DC2A 1IXVA 3AAAC 4GMRA 4BESA 4ZFHA 5JA4D 5EYLA 5HS0A 1MX4A 1BU9A 1K1AA 5ENRD 3TWWA 5CECB 3B95A 2KBXA 3NOGD 2KXPC 5ENOD 2RFMA 4HI8A 2ETCA 1QYMA 1YCSB 2XZTG 3V31A 5AQ9A 4DRXE 4HBDA 1AWCB 3V79K 4LNUD 1N11A 1MJ0A 3KEAA 4U8YD 4CZ2D 3TWXA 3EHQA 2JABA 1OT8A 2DVWA 1NFIE 3UXGA 5CERB 3HRAA
chains in the Genus database with same CATH superfamily
4TXPA 5FQ8A 2MYOA 4FJYA 3O48A 5ARGA 2LAIA 4N5QA 4FA6A 4AV7A 3ZVVA 3FULA 4XI0A 1OY3D 2JEKA 5G04C 3ZHEB 3J5QB 5JJ6A 5EX3A 1SA5A 4L2YA 2P9PG 5AAOA 1B89A 4WNEA 3DEOA 5FWQA 5ENTD 3NOCD 2BEDA 5FINA 3SFXA 2WM9A 3PH0C 3IKOB 1KZPA 3VLFA 3DRAA 2NC9A 4Q94A 3AS5A 2C0MA 3CK8A 5JMND 4GYYA 4GZ6A 4UWKA 5ANRA 4DLQA 3KD7A 1N4SA 2NYJA 2EQXA 4DX6D 3UPVA 2HYZA 1V55E 2ONDA 3CHOA 2DZNA 4FHKA 3ZYQA 4N2SA 4FULA 2Q7FA 1EPUA 3C5RA 3AAAC 4Q96A 2BF0X 5HS0A 1O1SA 3DBSA 3NOGD 3D9JA 3ZEFA 3ONLA 3TWXA 2IFUA 2P58C 1PAQA 3FUNA 3AU4A 4JW1A 3CSFA 5CMYA 3RJVA 4UQXA 2FO7A 3NAWA 3QDNA 3EJNA 4GTOA 3CVPA 5BV0A 3W9GA 4L1BA 2VJ8A 2XHEA 2EINE 3L54A 3PZ1A 4HFGA 3ULEG 2QYUA 2LAHA 2BKKB 3FEYA 4J0UA 3UQ3A 3SQVA 2NXPA 4K5CA 4JB8P 1V54E 1RW2A 4JZYA 2XGSA 3QWPA 4LNGA 3FTWA 4ANUA 4LERA 4ACLA 3V2OA 3TWSA 1QZ2A 5ANLA 3FTUA 4KXKB 2J4BA 3FU3A 3TWRA 4F6RD 3ML8A 4A3VA 3KS2A 3HXEA 5A7DB 1TNYA 5BXOA 3CK7A 4U04A 1H2UA 4N3AA 1TYQG 4N3BA 4GYWA 2UY1A 2ZXWE 5ENSD 3AG3E 3CVVA 2DCPA 3U3WA 2OEWA 3D9MA 3D9NA 2XCBA 5EYLA 5CECB 1HO8A 3FUIA 2AVPA 4YVQC 5AQ9A 3V79K 3IBEA 5BPPA 2HM8A 4XKBA 4AIFA 2ZISA 1OT8A 4KZCA 1N4QA 1HZ4A 1YA0A 4RG9A 5ITZF 1TNOA 2YHCA 5BUZA 2XENA 1OWPA 2OCCE 4HI9A 5KJMA 2LXMA 1U3DA 4A63B 4OAUC 3ML9A 3QKYA 4U8HA 5ARFA 4DUIA 1IYGA 2EIME 3C72A 2EIJE 5D0QD 3QARA 2V8SE 4GA0A 4CDMA 4U8VD 4NRHB 2E2EA 3IEGA 2UY1B 4BETA 3TWUA 3RU0A 4CRWA 3KSLA 3HXFA 4AJWA 3Q78A 5FQ7A 1Z6TA 1RZ4A 3LY8A 2XZDG 3V30A 3UT4A 3VLDA 3DXKG 1S70B 3FFLA 4LSZE 3RRMB 3MYVA 3LXUX 5KNHD 1ELWA 2IY0C 4GA1A 1D8DA 3ZYLA 1HS6A 4DX2A 2A5UA 4G11A 3TJPA 5JJTA 3B7RL 2X3MA 2X6KA 2ETCA 4A55A 4XKCA 2XZTG 1N4PA 4DRXE 4N5CA 5CRUA 4GU5A 2P9UG 4OVVA 3UXGA 2XRZA 4WWOA 3JQ1A 3I4RB 3QWWA 1XNFA 4LNBA 5EN5D 4U0SA 4U63A 2V4HC 3TWQA 4JXTA 1TNZA 3DWLG 1Y6IA 1BI7B 1WAO1 3SO8A 2GRNB 1L5JA 4GA2A 4I1OB 1NP7A 3JQ0A 3N71A 3ISMC 5EKQD 1JWGA 4O6FA 3APDA 3L17A 4ILHB 4Y6WA 5FIOA 4DPRA 4EHMA 1ZB1A 3CVWA 4LUNU 4BEPA 1KPSB 1N94A 5BV1A 5FT9A 4K5AB 2XRYA 5ENQD 4QFVA 4GTVA 1SVXA 1OCRE 3HDXA 3ESLA 4OVUA 2I6HA 3Q9UC 4I6EA 4G8LA 3MZLB 4X8QA 3BQOA 4KMOA 2WXLA 3FTXA 4RG6A 2VSNA 2I1KA 3PS6A 2QC9A 5LP0A 4B0ZA 1SA4A 2X6FA 3PEUB 2R05A 4GMRA 2AWIA 4BESA 3RAUA 2VTBA 2FI7A 5HQ8A 2GRQB 3QWVA 1YCSB 3ASDA 1HFAA 3FUFA 4UQYA 3ASGA 5CERB 3HRAA 1WM5A 4C48B 4ANXA 2GGFA 4JC8A 1JUQA 3IXEA 3L13A 3L9TA 3E32A 3FUDA 4UWHA 5FZRA 1Z3XA 4XE0A 3LVRE 3RRNB 1E7VA 2J08A 2LSVA 1MX2A 1MZCA 3T9KA 4J7WA 3L6AA 3CVNA 3MX3A 4B8AA 4XZ4A 3OXLA 1E90A 2WXKA 3CHMA 3I4GA 5AN8A 4CGVA 1DCEA 4K0RA 5EILA 4U95D 3HHMA 4XEIG 4HLEA 1IQRA 2P9LG 3Q4AB 1HG5A 2ZIRA 3ZXPA 5ENNA 3U66A 4KT6B 4NIKA 1S63A 4IRUA 4KVOA 4I9EA 2V4LA 2QFCA 5KBAA 1D9SA 3V2XA 4XX5A 1NA3A 2AW6A 3G2WA 4GTQA 3OAWA 1MX6A 1VDYA 3TG5A 2WQ6A 4U96D 3G2VA 1IXVA 3L22A 4F1SA 3FWVA 4ZFHA 1Z3YA 4JEUA 2J07A 3FU0A 1TJFA 2WMOA 4BSXA 2WXGA 4PS3A 5C2YA 3ZW3A 4N2QA 4LNUD 4MRUA 4UWLA 2DVWA 1DNPA 2YNQA 1MQSA 4AVXA 2OV8A 3MV3B 1JCQA 1OCZE 2MOWA 2FBNA 4ZHBA 4J8DA 3C98A 1ELRA 1INZA 3UT7A 5EDSA 2RFAA 2X38A 1N52A 1TEZA 3LY7A 1TR4A 3NZSA 3TXNA 1BD8A 3VTYA 3SHFA 1PY1A 2B6CA 3E34A 3SFZA 2FF4A 3CVXA 3FH8A 2LO6A 1H6KA 3PE4A 1OCCE 2YINA 4EBAA 3ASOE 2X6IA 4L23A 3ENEA 5HRYA 2CG2A 4U7EB 4F53A 4FP7A 4IYPA 3CGHA 3B7UX 2ZU6B 4GPMA 4YDOA 2VGYA 4OYSA 4U07A 5BT1A 1EDUA 3KEZA 5EX0A 4RQIA 3X2QE 1NI1A 4B93B 2BUGA 2CHZA 3HXDA 4MKTA 1SW6A 4E85A 2WB2A 4EZJA 2XCCA 2CFZA 5KCMA 2A4ZA 2GW1A 3APFA 3JYSA 3UKRG 1QQEA 3IHVA 3PDNA 2F0YA 2IONA 4C0EA 4I2ZA 3UM3A 5LCWJ 4I9CA 1FT1A 3QK0A 1QNFA 2IO2C 4HQDA 2CHWA 4ILIA 3DSXA 1E8ZA 3ZFWA 4BTBA 5KJNA 3UIPC 3TWVA 2R17C 4YDWA 4GZCA 3G2UA 4CDRA 3APCA 3QB2A 4JVSA 3E4BA 3PREA 3HIZA 4J8EA 2KCVA 4KZ0A 4QQIA 3RO3A 3FUKA 4AOFA 4G25A 5CMWA 1IHBA 4RLYA 3JXIA 3S7FA 4LEUA 3EU9A 4GAAA 4AXHA 2IU1A 2R02A 3PNLB 5BXUA 4HRLA 1N95A 2M63A 4APFA 3LCAA 5AIJA 2H6IA 5CHEE 4CDNA 1HX8A 5HI7A 2A5EA 3UI2A 4H7XA 4L9PA 3TG4A 4HOQA 3PNTB 2VSXE 5CRVA 2WQ7A 5M72A 5G05J 1NA0A 4C9BB 2IF4A 3C3QA 3FEXA 3Q75A 4Y6CA 1BU9A 1JPLA 3B95A 2MHKA 5FQ4A 4GZ3A 3V31A 5LX8A 1HE8A 1MJ0A 2WXJA 5D2MC 5CEDB 3FTVA 4PUCA 4J8FA 3FP3A 5A23A 3CQCB 4GB9A 1KT0A 3G2SA 3P2BA 3ZKJA 4HVBA 1K1BA 2P9KG 1QBQA 3CVYA 2GRMA 4GCOA 4A1SA 3FUMA 4UI9K 2HE0A 3RRUA 4NURA 5B1BE 3D9KA 1A5EA 1E8XA 3UM1A 3UX4A 4KYOB 2Y4UA 4V3IA 2XGMA 4F7AA 1BLXB 4N3CA 5AYWD 2LXLA 3ZRHA 4G24A 5KNGA 5G04J 5JJ7A 2Y1LE 2V5QC 3GZSA 3ULYA 3B7SA 3JUEA 1D8EA 3ZXSA 1UJJA 4AM9A 3L08A 1WDYA 4BSZB 1X5BA 1O1TA 5A6CA 5KWDA 2ZGGA 2X6JA 3Q49B 3ZPJA 1UG3A 3SFYA 1WY6A 1OCOE 4MS6A 4YVOA 1FT2A 3RO2A 1OWMA 1H0AA 3PZ3A 1E7UA 3FHEA 3FU6A 2P9IG 3CQGB 3IHYA 3QAQA 4HORA 4A3TA 3D9IA 1TN8A 1IHGA 2E0IA 3FY4A 4ABNA 1N0QA 2RKKA 1YYHA 4JHJA 1H6OA 2DIWA 1BI8B 1SZAA 4JA7A 5BW8C 3IV0A 4URKA 3BG0B 3AJIA 3TGOA 3ZIMA 4N39A 1S0PA 5AQAA 2R59A 2XPZA 3BEEA 3Q7AA 4WNDA 1LTXA 3URZA 2WVIA 5AENA 4L2LA 3ULQA 3ABKE 3PUKA 1UJKA 4Q69A 2DYSE 3G2TA 4E6HA 4B8CB 4FLHA 1UOHA 1H6PA 2F8YA 2DZOA 4ILGA 4ATGA 4CYMD 1UN9A 3AG2E 1KT1A 2PNNA 1ZU2A 3HXBA 4I1MA 1O5MA 4AEZC 4GTRA 2FULA 2C2LA 3AU5A 4TXQA 3MKQB 3OXGA 3SI5A 4UI9C 1N11A 4BTAA 4U8YD 3ZN3A 4PDXA 1PC2A 3D9PA 3QJZA 5J08A 2H6HA 4NQ0A 3HG0D 2WXPA 1P5QA 5EIDA 5DBKA 3CEQA 2PQRA 2L9BA 3CKCA 4CGWA 1O1RA 2LNIA 1FPPA 2R5SA 3Q7FA 3UUXA 3B13A 1HH8A 4G23A 3J5PA 4P29A 3PE3A 3BG1B 3MGBA 2YQ8A 2QZAA 4JA9A 4EBAG 4O60A 3AS8A 1W3BA 3F6QA 3CHRA 1NZNA 4O1OA 5FZQA 5E75A 2WPVA 3GZ2A 2FEZA 3JUIA 3NB2A 2WXOA 3PRZA 3GZ1A 2YHEA 4PS8A 3C3RA 4M3OA 4EPZA 3RKVA 1HXIA 2V0PA 3SGHA 3CHPA 5KJKA 3R9MA 1KZOA 3HVEB 3SBTB 5ENRD 2OVFA 4ANVA 3BUAA 5AJDA 4F3VA 2P9SG 1A17A 3UM2A 3E33A 3UKUG 4APOA 3EIJA 4GTMA 4TRQA 1N9AA 2AXZA 1Z5SC 3CK9A 2JLBA 2ILRA 2EILE 1U3CA 1G3NB 4FU3A 3CSTA 2X6HA 1LD7A 2PQNA 3DSTA 3ZU7B 3MKRA 3D9HA 4EZLA 2V5FA 2CFUA 1FCHA 3UIOC 3DSSA 4GPKA 3PEVB 1E8WA 2Y3AA 4YNDA 4R7LA 3SF4A 2AXVA 3LVQE 3JCKC 3S7BA 3L16A 2OOEA 1KLXA 4HRNA 4HB5A 4DK5A 1JCRA 3LYAA 4ATZD 3LY9A 3SNXA 2LSUA 5AQ7A 4TUUA 4TV3A 4AP2A 4GMLA 4TUMA 1AP7A 4GZDA 5HKPA 1E8YA 2J4DA 1Y8MA 1TNBA 4L7TA 4JHRA 3DPYA 3FUJA 4FHJA 1TN6A 3MV2B 3CLJA 3ESKA 4YDEA 3CR3A 2R03A 3AG1E 4HI8A 1AWCB 4JL0A 2I9CA 3EHQA 4FADA 4UI9J 3QC1A 3PUJA 4WWPA 2KCLA 3UMVA 2VSOE 2IO3C 4EECA 2LUHA 3HYMB 3FTYA 3JXJA 1SZ9A 2BKGA 4TXRA 5T3RA 1N54A 4PS7A 1H19A 5DIZA 2PZIA 4WUYA 3VLEA 1EF1C 5T8IA 3DSWA 4CT0A 3ZYKA 1IQUA 1NL4A 3WG7E 3NQPA 4FLBA 2XQ0A 3Q73A 4BX9A 4WWNA 3CHQA 3I5PA 1U2VG 3SY2A 4LRZA 1FVFA 3MJWA 3R7RA 3EHNA 1WG0A 2XEHA 1LD8A 3MEKA 4GZ5A 2PL2A 3EHMA 3D9LA 1DC2A 4JEHA 2IJGX 2J09A 3ASHA 2CHXA 5JA4D 1MX4A 2I1JA 3TWWA 3O4ZA 3RIBA 3EDTB 2RFMA 4WAFA 4CZ2D 1NFIE 4I6JA 3Q5MA 1UN8A 3DEPA 1S64A 4G2VA 1GW6A 3DSVA 3SBSA 2VYIA 5CEAA 4U0ZA 1TJCA 3P1UA 2L0IA 3LPZA 4AY5A 5G55A 1E96B 2H6GA 4DI3A 2Y0BG 2RG8A 4LCTA 2L6BA 5CBNA 5LOZA 4JPSA 3R7QA 2AXUA 2HR2A 4BT9A 4BFRA 1DVPA 4DX7D 2HO1A 3EU5A 5CCMA 4I17A 5FTPA 3LJNA 4I6GA 1H2VC 3B7TA 2NSZA 3CV0A 3PZ2A 3QOUA 3LJ3A 3SZ7A 4BX8A 4G8KA 4J6IA 4RSYA 5J90A 2VGEA 3NF1A 1X81A 4BY6A 4GCNA 1XGWA 4MLPA 1YMPA 5JHAA 3DSUA 3CKBA 5EYPF 4MBGA 4XI9A 4HS2A 3RK6A 3ASNE 5LFAA 5FZSA 2KBXA 3CHSA 2KXPC 5ENOD 1MHQA 1UW4B 3AS4A 2WXQA 4ACKA 5CBOA 5B3SE 3CVQA 2IQCA 3EHRA 2KM4A 2Y4TA 4KVMA 4PH4B 4DX1A 3U9WA 2L0TB 3OXFA 4Z68A 5CCLA 2ZGDA 2XPIA 4UUCA 3TAXA 4CCAA 1ELKA 4UWFA 4G26A 4BT8A 4JHKA 2J9QA 2WXNA 4IN3B 3CIAA 3UINC 5C1DA 3LS8A 3T5XA 2P2CP 1FVHA 2PM6A 3MKQA 4GTSA 3ZGQA 4I1AA 5H7PA 4CEMA 2WXRA 4UWGA 5AARA 4DI4A 4HLLA 3FDHA 2XEVA 2R2LA 3WXXA 2DWZA 4GMJA 2XGOA 3D3MA 2VGXA 2EIKE 4GYOA 3FUHA 4C0MA 3B7BA 3FU5A 2RD0A 1JWFA 4BWRA 4WNGA 3FTSA 3GYZA 2WXFA 3MA5A 3KSQA 3KAEA 1QYMA 4HBDA 4D10C 2JABA 2GROB 3ONKA 3ZUVB 4DX5D 4OAVB 2XS8A 3FH5A 3ABLE 2BTDA 5BNWA 1OUVA 3NBNB 1OWLA 2ETBA 4DJAA 3U4TA 1ZBPA 2IOSA 4HNAD 3T8KA 3MCXA 2WXMA 5G2NA 3R9AB 3S7DA 1EYHA 4DLOA 2GRPB 3L82A 2QY7A 4U0UA 3W9FA 2FO1E 2KC7A 4YDYA 4NACA 2XPYA 1OWOA 4B94A 3FTZA 3TXMA 2QYJA 3EIQC 5D0OD 2VGXB 4HOSA 2F8XK 3T5VA 5ENPD 4WNFA 2GRLA 1N4RA 4B89A 2GRRB 1SQMA 3HVEA 3PVLA 2VSYA 4HXIA 2DYRE 1K3ZD 3AG4E 4FC8A 1LF8A 3OTNA 5T4YA 4H7YA 4G1TA 4LG6A 2P9NG 2H6FA 4HOTA 2AJAA 3D9OA 4FJZA 4AY6A 1N0RA 1JCSA 4EQFA 2WQHA 3T8MA 5LCWC 4KBQA 3TWTA 4O1PA 3LDZA 2IEJA 3HXCA 2L6JA 3CVUA 3FUEA 1OWNA 3E30A 4J8SA 3LKUA 4XIFA 3C3OA 3KEAA 2OVBA 3ZYMA 4M7CA 1H2TC 5JHBA 4K5BA 2KATA 4I43A 2KCKA 3Q79A 4BERA 2PM7A 3UTMA 1TN7A 3K9IA 3PZDA 5IY5E 1K8KG 3FH7A 3DXMG 4GTTA 3RSEG 2I2OA 1HG2A 1Q2ZA 5D66A 4A1GA 2B0OE 4HRMB 2VTBB 2KZTA 5AQBA 3DPDA 3S2AA 3SD5A 2F37A 2Y69E 5FJYA 3UM0A 1TNUA 1DCQA 2UWJG 3BU8A 3VTXA 2VQ2A 5AJLA 5EIBE 1IKND 5B1AE 4ANWA 2XEEA 1HF8A 3CVLA 2C0LA 4RVBA 3ABME 5G05C 2J8SD 5FQ6A 4CT4A 4EZKA 2OEVA 1MYOA 4IULA 4UQZA 1HU3A 2ETAA 4J8YA 2MRIA 4GTPA 3ZHEA 5KJLA 4F1PA 3Q15A 3EUVA 2CG3A 3ASFA 1OXJA 1BPOA 4W9RA 2DBAA 4ME2A 3QNKA 3PZ4A 3ZNGA 3LEWA 4K03A 3UT8A 3TL5A 3I3NA 2WMNA 3Q9NC 3E37A 4JD2G 2WXHA 4HOUA 1K1AA 5E76A 4I2WA 3NZUA 2KZTB 3GW4A 2XS1A 3S7JA 2J49A 2WXIA 3U64A 3Q47B 2IOLA
chains in the Genus database with same CATH topology
3ZUVB 3DEPA 2MYOA 4DX5D 5CBOA 1N0QA 4K5BA 5ITZF 4OAVB 4C48B 1YYHA 2XENA 3HG0D 4BERA 5EIDA 4N5QA 3UTMA 4HQDA 1G3NB 3EHRA 5EN5D 3IXEA 1BI8B 4ZHBA 4HI9A 3NBNB 5CEAA 1OY3D 2V4HC 3ZU7B 4DX1A 3TWQA 3ZKJA 2ETBA 2RFAA 3W9GA 4A63B 1K1BA 3D9HA 4OAUC 1BI7B 4HNAD 3SO8A 3T8KA 3J5QB 4Z68A 1MX2A 3AJIA 2ZGDA 1TR4A 2BKKB 4YDWA 4UUCA 3TWVA 1BD8A 5D66A 3T9KA 4DUIA 2B0OE 4HRMB 4J7WA 5AAOA 5AQAA 5AQBA 3W9FA 2HE0A 3J5PA 2Y0BG 3JXJA 4YDYA 2FO1E 2BKGA 3DEOA 2L6BA 5ENTD 5CBNA 2F37A 4K5CA 5AN8A 1A5EA 4QQIA 4JB8P 3NOCD 4U8VD 2QYJA 5EILA 4U95D 5FINA 4BETA 2F8XK 5ENPD 3TWUA 1BLXB 1IHBA 5HRYA 4DX7D 1DCQA 4RLYA 5FIOA 3JXIA 5EIBE 3V2OA 1IKND 2P2CP 5KNGA 3TWSA 3EU9A 5JMND 4BEPA 2XEEA 4K5AB 4O60A 5ENQD 4QFVA 2J8SD 3LJNA 4GPMA 2Y1LE 1MYOA 1SVXA 2ETAA 2V5QC 4J8YA 4NIKA 3TWRA 1K3ZD 2XZDG 4HB5A 4HRNA 4F6RD 3V30A 3F6QA 3JUEA 4ATZD 1UOHA 5BXUA 2F8YA 3Q9UC 4HRLA 4F1PA 2DZOA 5AARA 4LG6A 5AQ7A 2NYJA 4HLLA 4G8KA 4CYMD 4O1OA 1S70B 4G8LA 4LSZE 2PNNA 5BXOA 2AJAA 5KBAA 5CEDB 2VGEA 1D9SA 4TUMA 4B93B 1WDYA 3V2XA 1AP7A 4BSZB 2DWZA 5KNHD 4DX6D 5HKPA 5KWDA 1N0RA 1WG0A 2DZNA 2ZGGA 2XEHA 3ZNGA 1MX6A 2A5EA 3UI2A 1SW6A 1YMPA 3TWTA 5ENSD 2QC9A 4O1PA 4U96D 3B7BA 4DX2A 3Q9NC 5EYPF 3C5RA 1DC2A 1IXVA 3AAAC 4GMRA 4BESA 4ZFHA 5JA4D 5EYLA 5HS0A 1MX4A 1BU9A 1K1AA 5ENRD 3TWWA 5CECB 3B95A 2KBXA 3NOGD 2KXPC 5ENOD 2RFMA 4HI8A 2ETCA 1QYMA 1YCSB 2XZTG 3V31A 5AQ9A 4DRXE 4HBDA 1AWCB 3V79K 4LNUD 1N11A 1MJ0A 3KEAA 4U8YD 4CZ2D 3TWXA 3EHQA 2JABA 1OT8A 2DVWA 1NFIE 3UXGA 5CERB 3HRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZUV B;  3DEP A;  2MYO A;  4DX5 D;  5CBO A;  1N0Q A;  4K5B A;  5ITZ F;  4OAV B;  4C48 B;  1YYH A;  2XEN A;  3HG0 D;  4BER A;  5EID A;  4N5Q A;  3UTM A;  4HQD A;  1G3N B;  3EHR A;  5EN5 D;  3IXE A;  1BI8 B;  4ZHB A;  4HI9 A;  3NBN B;  5CEA A;  1OY3 D;  2V4H C;  3ZU7 B;  4DX1 A;  3TWQ A;  3ZKJ A;  2ETB A;  2RFA A;  3W9G A;  4A63 B;  1K1B A;  3D9H A;  4OAU C;  1BI7 B;  4HNA D;  3SO8 A;  3T8K A;  3J5Q B;  4Z68 A;  1MX2 A;  3AJI A;  2ZGD A;  1TR4 A;  2BKK B;  4YDW A;  4UUC A;  3TWV A;  1BD8 A;  5D66 A;  3T9K A;  4DUI A;  2B0O E;  4HRM B;  4J7W A;  5AAO A;  5AQA A;  5AQB A;  3W9F A;  2HE0 A;  3J5P A;  2Y0B G;  3JXJ A;  4YDY A;  2FO1 E;  2BKG A;  3DEO A;  2L6B A;  5ENT D;  5CBN A;  2F37 A;  4K5C A;  5AN8 A;  1A5E A;  4QQI A;  4JB8 P;  3NOC D;  4U8V D;  2QYJ A;  5EIL A;  4U95 D;  5FIN A;  4BET A;  2F8X K;  5ENP D;  3TWU A;  1BLX B;  1IHB A;  5HRY A;  4DX7 D;  1DCQ A;  4RLY A;  5FIO A;  3JXI A;  5EIB E;  3V2O A;  1IKN D;  2P2C P;  5KNG A;  3TWS A;  3EU9 A;  5JMN D;  4BEP A;  2XEE A;  4K5A B;  4O60 A;  5ENQ D;  4QFV A;  2J8S D;  3LJN A;  4GPM A;  2Y1L E;  1MYO A;  1SVX A;  2ETA A;  2V5Q C;  4J8Y A;  4NIK A;  3TWR A;  1K3Z D;  2XZD G;  4HB5 A;  4HRN A;  4F6R D;  3V30 A;  3F6Q A;  3JUE A;  4ATZ D;  1UOH A;  5BXU A;  2F8Y A;  3Q9U C;  4HRL A;  4F1P A;  2DZO A;  5AAR A;  4LG6 A;  5AQ7 A;  2NYJ A;  4HLL A;  4G8K A;  4CYM D;  4O1O A;  1S70 B;  4G8L A;  4LSZ E;  2PNN A;  5BXO A;  2AJA A;  5KBA A;  5CED B;  2VGE A;  1D9S A;  4TUM A;  4B93 B;  1WDY A;  3V2X A;  1AP7 A;  4BSZ B;  2DWZ A;  5KNH D;  4DX6 D;  5HKP A;  5KWD A;  1N0R A;  1WG0 A;  2DZN A;  2ZGG A;  2XEH A;  3ZNG A;  1MX6 A;  2A5E A;  3UI2 A;  1SW6 A;  1YMP A;  3TWT A;  5ENS D;  2QC9 A;  4O1P A;  4U96 D;  3B7B A;  4DX2 A;  3Q9N C;  5EYP F;  3C5R A;  1DC2 A;  1IXV A;  3AAA C;  4GMR A;  4BES A;  4ZFH A;  5JA4 D;  5EYL A;  5HS0 A;  1MX4 A;  1BU9 A;  1K1A A;  5ENR D;  3TWW A;  5CEC B;  3B95 A;  2KBX A;  3NOG D;  2KXP C;  5ENO D;  2RFM A;  4HI8 A;  2ETC A;  1QYM A;  1YCS B;  2XZT G;  3V31 A;  5AQ9 A;  4DRX E;  4HBD A;  1AWC B;  3V79 K;  4LNU D;  1N11 A;  1MJ0 A;  3KEA A;  4U8Y D;  4CZ2 D;  3TWX A;  3EHQ A;  2JAB A;  1OT8 A;  2DVW A;  1NFI E;  3UXG A;  5CER B;  3HRA A; 
#chains in the Genus database with same CATH topology
 4TXP A;  5FQ8 A;  2MYO A;  4FJY A;  3O48 A;  5ARG A;  2LAI A;  4N5Q A;  4FA6 A;  4AV7 A;  3ZVV A;  3FUL A;  4XI0 A;  1OY3 D;  2JEK A;  5G04 C;  3ZHE B;  3J5Q B;  5JJ6 A;  5EX3 A;  1SA5 A;  4L2Y A;  2P9P G;  5AAO A;  1B89 A;  4WNE A;  3DEO A;  5FWQ A;  5ENT D;  3NOC D;  2BED A;  5FIN A;  3SFX A;  2WM9 A;  3PH0 C;  3IKO B;  1KZP A;  3VLF A;  3DRA A;  2NC9 A;  4Q94 A;  3AS5 A;  2C0M A;  3CK8 A;  5JMN D;  4GYY A;  4GZ6 A;  4UWK A;  5ANR A;  4DLQ A;  3KD7 A;  1N4S A;  2NYJ A;  2EQX A;  4DX6 D;  3UPV A;  2HYZ A;  1V55 E;  2OND A;  3CHO A;  2DZN A;  4FHK A;  3ZYQ A;  4N2S A;  4FUL A;  2Q7F A;  1EPU A;  3C5R A;  3AAA C;  4Q96 A;  2BF0 X;  5HS0 A;  1O1S A;  3DBS A;  3NOG D;  3D9J A;  3ZEF A;  3ONL A;  3TWX A;  2IFU A;  2P58 C;  1PAQ A;  3FUN A;  3AU4 A;  4JW1 A;  3CSF A;  5CMY A;  3RJV A;  4UQX A;  2FO7 A;  3NAW A;  3QDN A;  3EJN A;  4GTO A;  3CVP A;  5BV0 A;  3W9G A;  4L1B A;  2VJ8 A;  2XHE A;  2EIN E;  3L54 A;  3PZ1 A;  4HFG A;  3ULE G;  2QYU A;  2LAH A;  2BKK B;  3FEY A;  4J0U A;  3UQ3 A;  3SQV A;  2NXP A;  4K5C A;  4JB8 P;  1V54 E;  1RW2 A;  4JZY A;  2XGS A;  3QWP A;  4LNG A;  3FTW A;  4ANU A;  4LER A;  4ACL A;  3V2O A;  3TWS A;  1QZ2 A;  5ANL A;  3FTU A;  4KXK B;  2J4B A;  3FU3 A;  3TWR A;  4F6R D;  3ML8 A;  4A3V A;  3KS2 A;  3HXE A;  5A7D B;  1TNY A;  5BXO A;  3CK7 A;  4U04 A;  1H2U A;  4N3A A;  1TYQ G;  4N3B A;  4GYW A;  2UY1 A;  2ZXW E;  5ENS D;  3AG3 E;  3CVV A;  2DCP A;  3U3W A;  2OEW A;  3D9M A;  3D9N A;  2XCB A;  5EYL A;  5CEC B;  1HO8 A;  3FUI A;  2AVP A;  4YVQ C;  5AQ9 A;  3V79 K;  3IBE A;  5BPP A;  2HM8 A;  4XKB A;  4AIF A;  2ZIS A;  1OT8 A;  4KZC A;  1N4Q A;  1HZ4 A;  1YA0 A;  4RG9 A;  5ITZ F;  1TNO A;  2YHC A;  5BUZ A;  2XEN A;  1OWP A;  2OCC E;  4HI9 A;  5KJM A;  2LXM A;  1U3D A;  4A63 B;  4OAU C;  3ML9 A;  3QKY A;  4U8H A;  5ARF A;  4DUI A;  1IYG A;  2EIM E;  3C72 A;  2EIJ E;  5D0Q D;  3QAR A;  2V8S E;  4GA0 A;  4CDM A;  4U8V D;  4NRH B;  2E2E A;  3IEG A;  2UY1 B;  4BET A;  3TWU A;  3RU0 A;  4CRW A;  3KSL A;  3HXF A;  4AJW A;  3Q78 A;  5FQ7 A;  1Z6T A;  1RZ4 A;  3LY8 A;  2XZD G;  3V30 A;  3UT4 A;  3VLD A;  3DXK G;  1S70 B;  3FFL A;  4LSZ E;  3RRM B;  3MYV A;  3LXU X;  5KNH D;  1ELW A;  2IY0 C;  4GA1 A;  1D8D A;  3ZYL A;  1HS6 A;  4DX2 A;  2A5U A;  4G11 A;  3TJP A;  5JJT A;  3B7R L;  2X3M A;  2X6K A;  2ETC A;  4A55 A;  4XKC A;  2XZT G;  1N4P A;  4DRX E;  4N5C A;  5CRU A;  4GU5 A;  2P9U G;  4OVV A;  3UXG A;  2XRZ A;  4WWO A;  3JQ1 A;  3I4R B;  3QWW A;  1XNF A;  4LNB A;  5EN5 D;  4U0S A;  4U63 A;  2V4H C;  3TWQ A;  4JXT A;  1TNZ A;  3DWL G;  1Y6I A;  1BI7 B;  1WAO 1;  3SO8 A;  2GRN B;  1L5J A;  4GA2 A;  4I1O B;  1NP7 A;  3JQ0 A;  3N71 A;  3ISM C;  5EKQ D;  1JWG A;  4O6F A;  3APD A;  3L17 A;  4ILH B;  4Y6W A;  5FIO A;  4DPR A;  4EHM A;  1ZB1 A;  3CVW A;  4LUN U;  4BEP A;  1KPS B;  1N94 A;  5BV1 A;  5FT9 A;  4K5A B;  2XRY A;  5ENQ D;  4QFV A;  4GTV A;  1SVX A;  1OCR E;  3HDX A;  3ESL A;  4OVU A;  2I6H A;  3Q9U C;  4I6E A;  4G8L A;  3MZL B;  4X8Q A;  3BQO A;  4KMO A;  2WXL A;  3FTX A;  4RG6 A;  2VSN A;  2I1K A;  3PS6 A;  2QC9 A;  5LP0 A;  4B0Z A;  1SA4 A;  2X6F A;  3PEU B;  2R05 A;  4GMR A;  2AWI A;  4BES A;  3RAU A;  2VTB A;  2FI7 A;  5HQ8 A;  2GRQ B;  3QWV A;  1YCS B;  3ASD A;  1HFA A;  3FUF A;  4UQY A;  3ASG A;  5CER B;  3HRA A;  1WM5 A;  4C48 B;  4ANX A;  2GGF A;  4JC8 A;  1JUQ A;  3IXE A;  3L13 A;  3L9T A;  3E32 A;  3FUD A;  4UWH A;  5FZR A;  1Z3X A;  4XE0 A;  3LVR E;  3RRN B;  1E7V A;  2J08 A;  2LSV A;  1MX2 A;  1MZC A;  3T9K A;  4J7W A;  3L6A A;  3CVN A;  3MX3 A;  4B8A A;  4XZ4 A;  3OXL A;  1E90 A;  2WXK A;  3CHM A;  3I4G A;  5AN8 A;  4CGV A;  1DCE A;  4K0R A;  5EIL A;  4U95 D;  3HHM A;  4XEI G;  4HLE A;  1IQR A;  2P9L G;  3Q4A B;  1HG5 A;  2ZIR A;  3ZXP A;  5ENN A;  3U66 A;  4KT6 B;  4NIK A;  1S63 A;  4IRU A;  4KVO A;  4I9E A;  2V4L A;  2QFC A;  5KBA A;  1D9S A;  3V2X A;  4XX5 A;  1NA3 A;  2AW6 A;  3G2W A;  4GTQ A;  3OAW A;  1MX6 A;  1VDY A;  3TG5 A;  2WQ6 A;  4U96 D;  3G2V A;  1IXV A;  3L22 A;  4F1S A;  3FWV A;  4ZFH A;  1Z3Y A;  4JEU A;  2J07 A;  3FU0 A;  1TJF A;  2WMO A;  4BSX A;  2WXG A;  4PS3 A;  5C2Y A;  3ZW3 A;  4N2Q A;  4LNU D;  4MRU A;  4UWL A;  2DVW A;  1DNP A;  2YNQ A;  1MQS A;  4AVX A;  2OV8 A;  3MV3 B;  1JCQ A;  1OCZ E;  2MOW A;  2FBN A;  4ZHB A;  4J8D A;  3C98 A;  1ELR A;  1INZ A;  3UT7 A;  5EDS A;  2RFA A;  2X38 A;  1N52 A;  1TEZ A;  3LY7 A;  1TR4 A;  3NZS A;  3TXN A;  1BD8 A;  3VTY A;  3SHF A;  1PY1 A;  2B6C A;  3E34 A;  3SFZ A;  2FF4 A;  3CVX A;  3FH8 A;  2LO6 A;  1H6K A;  3PE4 A;  1OCC E;  2YIN A;  4EBA A;  3ASO E;  2X6I A;  4L23 A;  3ENE A;  5HRY A;  2CG2 A;  4U7E B;  4F53 A;  4FP7 A;  4IYP A;  3CGH A;  3B7U X;  2ZU6 B;  4GPM A;  4YDO A;  2VGY A;  4OYS A;  4U07 A;  5BT1 A;  1EDU A;  3KEZ A;  5EX0 A;  4RQI A;  3X2Q E;  1NI1 A;  4B93 B;  2BUG A;  2CHZ A;  3HXD A;  4MKT A;  1SW6 A;  4E85 A;  2WB2 A;  4EZJ A;  2XCC A;  2CFZ A;  5KCM A;  2A4Z A;  2GW1 A;  3APF A;  3JYS A;  3UKR G;  1QQE A;  3IHV A;  3PDN A;  2F0Y A;  2ION A;  4C0E A;  4I2Z A;  3UM3 A;  5LCW J;  4I9C A;  1FT1 A;  3QK0 A;  1QNF A;  2IO2 C;  4HQD A;  2CHW A;  4ILI A;  3DSX A;  1E8Z A;  3ZFW A;  4BTB A;  5KJN A;  3UIP C;  3TWV A;  2R17 C;  4YDW A;  4GZC A;  3G2U A;  4CDR A;  3APC A;  3QB2 A;  4JVS A;  3E4B A;  3PRE A;  3HIZ A;  4J8E A;  2KCV A;  4KZ0 A;  4QQI A;  3RO3 A;  3FUK A;  4AOF A;  4G25 A;  5CMW A;  1IHB A;  4RLY A;  3JXI A;  3S7F A;  4LEU A;  3EU9 A;  4GAA A;  4AXH A;  2IU1 A;  2R02 A;  3PNL B;  5BXU A;  4HRL A;  1N95 A;  2M63 A;  4APF A;  3LCA A;  5AIJ A;  2H6I A;  5CHE E;  4CDN A;  1HX8 A;  5HI7 A;  2A5E A;  3UI2 A;  4H7X A;  4L9P A;  3TG4 A;  4HOQ A;  3PNT B;  2VSX E;  5CRV A;  2WQ7 A;  5M72 A;  5G05 J;  1NA0 A;  4C9B B;  2IF4 A;  3C3Q A;  3FEX A;  3Q75 A;  4Y6C A;  1BU9 A;  1JPL A;  3B95 A;  2MHK A;  5FQ4 A;  4GZ3 A;  3V31 A;  5LX8 A;  1HE8 A;  1MJ0 A;  2WXJ A;  5D2M C;  5CED B;  3FTV A;  4PUC A;  4J8F A;  3FP3 A;  5A23 A;  3CQC B;  4GB9 A;  1KT0 A;  3G2S A;  3P2B A;  3ZKJ A;  4HVB A;  1K1B A;  2P9K G;  1QBQ A;  3CVY A;  2GRM A;  4GCO A;  4A1S A;  3FUM A;  4UI9 K;  2HE0 A;  3RRU A;  4NUR A;  5B1B E;  3D9K A;  1A5E A;  1E8X A;  3UM1 A;  3UX4 A;  4KYO B;  2Y4U A;  4V3I A;  2XGM A;  4F7A A;  1BLX B;  4N3C A;  5AYW D;  2LXL A;  3ZRH A;  4G24 A;  5KNG A;  5G04 J;  5JJ7 A;  2Y1L E;  2V5Q C;  3GZS A;  3ULY A;  3B7S A;  3JUE A;  1D8E A;  3ZXS A;  1UJJ A;  4AM9 A;  3L08 A;  1WDY A;  4BSZ B;  1X5B A;  1O1T A;  5A6C A;  5KWD A;  2ZGG A;  2X6J A;  3Q49 B;  3ZPJ A;  1UG3 A;  3SFY A;  1WY6 A;  1OCO E;  4MS6 A;  4YVO A;  1FT2 A;  3RO2 A;  1OWM A;  1H0A A;  3PZ3 A;  1E7U A;  3FHE A;  3FU6 A;  2P9I G;  3CQG B;  3IHY A;  3QAQ A;  4HOR A;  4A3T A;  3D9I A;  1TN8 A;  1IHG A;  2E0I A;  3FY4 A;  4ABN A;  1N0Q A;  2RKK A;  1YYH A;  4JHJ A;  1H6O A;  2DIW A;  1BI8 B;  1SZA A;  4JA7 A;  5BW8 C;  3IV0 A;  4URK A;  3BG0 B;  3AJI A;  3TGO A;  3ZIM A;  4N39 A;  1S0P A;  5AQA A;  2R59 A;  2XPZ A;  3BEE A;  3Q7A A;  4WND A;  1LTX A;  3URZ A;  2WVI A;  5AEN A;  4L2L A;  3ULQ A;  3ABK E;  3PUK A;  1UJK A;  4Q69 A;  2DYS E;  3G2T A;  4E6H A;  4B8C B;  4FLH A;  1UOH A;  1H6P A;  2F8Y A;  2DZO A;  4ILG A;  4ATG A;  4CYM D;  1UN9 A;  3AG2 E;  1KT1 A;  2PNN A;  1ZU2 A;  3HXB A;  4I1M A;  1O5M A;  4AEZ C;  4GTR A;  2FUL A;  2C2L A;  3AU5 A;  4TXQ A;  3MKQ B;  3OXG A;  3SI5 A;  4UI9 C;  1N11 A;  4BTA A;  4U8Y D;  3ZN3 A;  4PDX A;  1PC2 A;  3D9P A;  3QJZ A;  5J08 A;  2H6H A;  4NQ0 A;  3HG0 D;  2WXP A;  1P5Q A;  5EID A;  5DBK A;  3CEQ A;  2PQR A;  2L9B A;  3CKC A;  4CGW A;  1O1R A;  2LNI A;  1FPP A;  2R5S A;  3Q7F A;  3UUX A;  3B13 A;  1HH8 A;  4G23 A;  3J5P A;  4P29 A;  3PE3 A;  3BG1 B;  3MGB A;  2YQ8 A;  2QZA A;  4JA9 A;  4EBA G;  4O60 A;  3AS8 A;  1W3B A;  3F6Q A;  3CHR A;  1NZN A;  4O1O A;  5FZQ A;  5E75 A;  2WPV A;  3GZ2 A;  2FEZ A;  3JUI A;  3NB2 A;  2WXO A;  3PRZ A;  3GZ1 A;  2YHE A;  4PS8 A;  3C3R A;  4M3O A;  4EPZ A;  3RKV A;  1HXI A;  2V0P A;  3SGH A;  3CHP A;  5KJK A;  3R9M A;  1KZO A;  3HVE B;  3SBT B;  5ENR D;  2OVF A;  4ANV A;  3BUA A;  5AJD A;  4F3V A;  2P9S G;  1A17 A;  3UM2 A;  3E33 A;  3UKU G;  4APO A;  3EIJ A;  4GTM A;  4TRQ A;  1N9A A;  2AXZ A;  1Z5S C;  3CK9 A;  2JLB A;  2ILR A;  2EIL E;  1U3C A;  1G3N B;  4FU3 A;  3CST A;  2X6H A;  1LD7 A;  2PQN A;  3DST A;  3ZU7 B;  3MKR A;  3D9H A;  4EZL A;  2V5F A;  2CFU A;  1FCH A;  3UIO C;  3DSS A;  4GPK A;  3PEV B;  1E8W A;  2Y3A A;  4YND A;  4R7L A;  3SF4 A;  2AXV A;  3LVQ E;  3JCK C;  3S7B A;  3L16 A;  2OOE A;  1KLX A;  4HRN A;  4HB5 A;  4DK5 A;  1JCR A;  3LYA A;  4ATZ D;  3LY9 A;  3SNX A;  2LSU A;  5AQ7 A;  4TUU A;  4TV3 A;  4AP2 A;  4GML A;  4TUM A;  1AP7 A;  4GZD A;  5HKP A;  1E8Y A;  2J4D A;  1Y8M A;  1TNB A;  4L7T A;  4JHR A;  3DPY A;  3FUJ A;  4FHJ A;  1TN6 A;  3MV2 B;  3CLJ A;  3ESK A;  4YDE A;  3CR3 A;  2R03 A;  3AG1 E;  4HI8 A;  1AWC B;  4JL0 A;  2I9C A;  3EHQ A;  4FAD A;  4UI9 J;  3QC1 A;  3PUJ A;  4WWP A;  2KCL A;  3UMV A;  2VSO E;  2IO3 C;  4EEC A;  2LUH A;  3HYM B;  3FTY A;  3JXJ A;  1SZ9 A;  2BKG A;  4TXR A;  5T3R A;  1N54 A;  4PS7 A;  1H19 A;  5DIZ A;  2PZI A;  4WUY A;  3VLE A;  1EF1 C;  5T8I A;  3DSW A;  4CT0 A;  3ZYK A;  1IQU A;  1NL4 A;  3WG7 E;  3NQP A;  4FLB A;  2XQ0 A;  3Q73 A;  4BX9 A;  4WWN A;  3CHQ A;  3I5P A;  1U2V G;  3SY2 A;  4LRZ A;  1FVF A;  3MJW A;  3R7R A;  3EHN A;  1WG0 A;  2XEH A;  1LD8 A;  3MEK A;  4GZ5 A;  2PL2 A;  3EHM A;  3D9L A;  1DC2 A;  4JEH A;  2IJG X;  2J09 A;  3ASH A;  2CHX A;  5JA4 D;  1MX4 A;  2I1J A;  3TWW A;  3O4Z A;  3RIB A;  3EDT B;  2RFM A;  4WAF A;  4CZ2 D;  1NFI E;  4I6J A;  3Q5M A;  1UN8 A;  3DEP A;  1S64 A;  4G2V A;  1GW6 A;  3DSV A;  3SBS A;  2VYI A;  5CEA A;  4U0Z A;  1TJC A;  3P1U A;  2L0I A;  3LPZ A;  4AY5 A;  5G55 A;  1E96 B;  2H6G A;  4DI3 A;  2Y0B G;  2RG8 A;  4LCT A;  2L6B A;  5CBN A;  5LOZ A;  4JPS A;  3R7Q A;  2AXU A;  2HR2 A;  4BT9 A;  4BFR A;  1DVP A;  4DX7 D;  2HO1 A;  3EU5 A;  5CCM A;  4I17 A;  5FTP A;  3LJN A;  4I6G A;  1H2V C;  3B7T A;  2NSZ A;  3CV0 A;  3PZ2 A;  3QOU A;  3LJ3 A;  3SZ7 A;  4BX8 A;  4G8K A;  4J6I A;  4RSY A;  5J90 A;  2VGE A;  3NF1 A;  1X81 A;  4BY6 A;  4GCN A;  1XGW A;  4MLP A;  1YMP A;  5JHA A;  3DSU A;  3CKB A;  5EYP F;  4MBG A;  4XI9 A;  4HS2 A;  3RK6 A;  3ASN E;  5LFA A;  5FZS A;  2KBX A;  3CHS A;  2KXP C;  5ENO D;  1MHQ A;  1UW4 B;  3AS4 A;  2WXQ A;  4ACK A;  5CBO A;  5B3S E;  3CVQ A;  2IQC A;  3EHR A;  2KM4 A;  2Y4T A;  4KVM A;  4PH4 B;  4DX1 A;  3U9W A;  2L0T B;  3OXF A;  4Z68 A;  5CCL A;  2ZGD A;  2XPI A;  4UUC A;  3TAX A;  4CCA A;  1ELK A;  4UWF A;  4G26 A;  4BT8 A;  4JHK A;  2J9Q A;  2WXN A;  4IN3 B;  3CIA A;  3UIN C;  5C1D A;  3LS8 A;  3T5X A;  2P2C P;  1FVH A;  2PM6 A;  3MKQ A;  4GTS A;  3ZGQ A;  4I1A A;  5H7P A;  4CEM A;  2WXR A;  4UWG A;  5AAR A;  4DI4 A;  4HLL A;  3FDH A;  2XEV A;  2R2L A;  3WXX A;  2DWZ A;  4GMJ A;  2XGO A;  3D3M A;  2VGX A;  2EIK E;  4GYO A;  3FUH A;  4C0M A;  3B7B A;  3FU5 A;  2RD0 A;  1JWF A;  4BWR A;  4WNG A;  3FTS A;  3GYZ A;  2WXF A;  3MA5 A;  3KSQ A;  3KAE A;  1QYM A;  4HBD A;  4D10 C;  2JAB A;  2GRO B;  3ONK A;  3ZUV B;  4DX5 D;  4OAV B;  2XS8 A;  3FH5 A;  3ABL E;  2BTD A;  5BNW A;  1OUV A;  3NBN B;  1OWL A;  2ETB A;  4DJA A;  3U4T A;  1ZBP A;  2IOS A;  4HNA D;  3T8K A;  3MCX A;  2WXM A;  5G2N A;  3R9A B;  3S7D A;  1EYH A;  4DLO A;  2GRP B;  3L82 A;  2QY7 A;  4U0U A;  3W9F A;  2FO1 E;  2KC7 A;  4YDY A;  4NAC A;  2XPY A;  1OWO A;  4B94 A;  3FTZ A;  3TXM A;  2QYJ A;  3EIQ C;  5D0O D;  2VGX B;  4HOS A;  2F8X K;  3T5V A;  5ENP D;  4WNF A;  2GRL A;  1N4R A;  4B89 A;  2GRR B;  1SQM A;  3HVE A;  3PVL A;  2VSY A;  4HXI A;  2DYR E;  1K3Z D;  3AG4 E;  4FC8 A;  1LF8 A;  3OTN A;  5T4Y A;  4H7Y A;  4G1T A;  4LG6 A;  2P9N G;  2H6F A;  4HOT A;  2AJA A;  3D9O A;  4FJZ A;  4AY6 A;  1N0R A;  1JCS A;  4EQF A;  2WQH A;  3T8M A;  5LCW C;  4KBQ A;  3TWT A;  4O1P A;  3LDZ A;  2IEJ A;  3HXC A;  2L6J A;  3CVU A;  3FUE A;  1OWN A;  3E30 A;  4J8S A;  3LKU A;  4XIF A;  3C3O A;  3KEA A;  2OVB A;  3ZYM A;  4M7C A;  1H2T C;  5JHB A;  4K5B A;  2KAT A;  4I43 A;  2KCK A;  3Q79 A;  4BER A;  2PM7 A;  3UTM A;  1TN7 A;  3K9I A;  3PZD A;  5IY5 E;  1K8K G;  3FH7 A;  3DXM G;  4GTT A;  3RSE G;  2I2O A;  1HG2 A;  1Q2Z A;  5D66 A;  4A1G A;  2B0O E;  4HRM B;  2VTB B;  2KZT A;  5AQB A;  3DPD A;  3S2A A;  3SD5 A;  2F37 A;  2Y69 E;  5FJY A;  3UM0 A;  1TNU A;  1DCQ A;  2UWJ G;  3BU8 A;  3VTX A;  2VQ2 A;  5AJL A;  5EIB E;  1IKN D;  5B1A E;  4ANW A;  2XEE A;  1HF8 A;  3CVL A;  2C0L A;  4RVB A;  3ABM E;  5G05 C;  2J8S D;  5FQ6 A;  4CT4 A;  4EZK A;  2OEV A;  1MYO A;  4IUL A;  4UQZ A;  1HU3 A;  2ETA A;  4J8Y A;  2MRI A;  4GTP A;  3ZHE A;  5KJL A;  4F1P A;  3Q15 A;  3EUV A;  2CG3 A;  3ASF A;  1OXJ A;  1BPO A;  4W9R A;  2DBA A;  4ME2 A;  3QNK A;  3PZ4 A;  3ZNG A;  3LEW A;  4K03 A;  3UT8 A;  3TL5 A;  3I3N A;  2WMN A;  3Q9N C;  3E37 A;  4JD2 G;  2WXH A;  4HOU A;  1K1A A;  5E76 A;  4I2W A;  3NZU A;  2KZT B;  3GW4 A;  2XS1 A;  3S7J A;  2J49 A;  2WXI A;  3U64 A;  3Q47 B;  2IOL A; 
#chains in the Genus database with same CATH homology
 3ZUV B;  3DEP A;  2MYO A;  4DX5 D;  5CBO A;  1N0Q A;  4K5B A;  5ITZ F;  4OAV B;  4C48 B;  1YYH A;  2XEN A;  3HG0 D;  4BER A;  5EID A;  4N5Q A;  3UTM A;  4HQD A;  1G3N B;  3EHR A;  5EN5 D;  3IXE A;  1BI8 B;  4ZHB A;  4HI9 A;  3NBN B;  5CEA A;  1OY3 D;  2V4H C;  3ZU7 B;  4DX1 A;  3TWQ A;  3ZKJ A;  2ETB A;  2RFA A;  3W9G A;  4A63 B;  1K1B A;  3D9H A;  4OAU C;  1BI7 B;  4HNA D;  3SO8 A;  3T8K A;  3J5Q B;  4Z68 A;  1MX2 A;  3AJI A;  2ZGD A;  1TR4 A;  2BKK B;  4YDW A;  4UUC A;  3TWV A;  1BD8 A;  5D66 A;  3T9K A;  4DUI A;  2B0O E;  4HRM B;  4J7W A;  5AAO A;  5AQA A;  5AQB A;  3W9F A;  2HE0 A;  3J5P A;  2Y0B G;  3JXJ A;  4YDY A;  2FO1 E;  2BKG A;  3DEO A;  2L6B A;  5ENT D;  5CBN A;  2F37 A;  4K5C A;  5AN8 A;  1A5E A;  4QQI A;  4JB8 P;  3NOC D;  4U8V D;  2QYJ A;  5EIL A;  4U95 D;  5FIN A;  4BET A;  2F8X K;  5ENP D;  3TWU A;  1BLX B;  1IHB A;  5HRY A;  4DX7 D;  1DCQ A;  4RLY A;  5FIO A;  3JXI A;  5EIB E;  3V2O A;  1IKN D;  2P2C P;  5KNG A;  3TWS A;  3EU9 A;  5JMN D;  4BEP A;  2XEE A;  4K5A B;  4O60 A;  5ENQ D;  4QFV A;  2J8S D;  3LJN A;  4GPM A;  2Y1L E;  1MYO A;  1SVX A;  2ETA A;  2V5Q C;  4J8Y A;  4NIK A;  3TWR A;  1K3Z D;  2XZD G;  4HB5 A;  4HRN A;  4F6R D;  3V30 A;  3F6Q A;  3JUE A;  4ATZ D;  1UOH A;  5BXU A;  2F8Y A;  3Q9U C;  4HRL A;  4F1P A;  2DZO A;  5AAR A;  4LG6 A;  5AQ7 A;  2NYJ A;  4HLL A;  4G8K A;  4CYM D;  4O1O A;  1S70 B;  4G8L A;  4LSZ E;  2PNN A;  5BXO A;  2AJA A;  5KBA A;  5CED B;  2VGE A;  1D9S A;  4TUM A;  4B93 B;  1WDY A;  3V2X A;  1AP7 A;  4BSZ B;  2DWZ A;  5KNH D;  4DX6 D;  5HKP A;  5KWD A;  1N0R A;  1WG0 A;  2DZN A;  2ZGG A;  2XEH A;  3ZNG A;  1MX6 A;  2A5E A;  3UI2 A;  1SW6 A;  1YMP A;  3TWT A;  5ENS D;  2QC9 A;  4O1P A;  4U96 D;  3B7B A;  4DX2 A;  3Q9N C;  5EYP F;  3C5R A;  1DC2 A;  1IXV A;  3AAA C;  4GMR A;  4BES A;  4ZFH A;  5JA4 D;  5EYL A;  5HS0 A;  1MX4 A;  1BU9 A;  1K1A A;  5ENR D;  3TWW A;  5CEC B;  3B95 A;  2KBX A;  3NOG D;  2KXP C;  5ENO D;  2RFM A;  4HI8 A;  2ETC A;  1QYM A;  1YCS B;  2XZT G;  3V31 A;  5AQ9 A;  4DRX E;  4HBD A;  1AWC B;  3V79 K;  4LNU D;  1N11 A;  1MJ0 A;  3KEA A;  4U8Y D;  4CZ2 D;  3TWX A;  3EHQ A;  2JAB A;  1OT8 A;  2DVW A;  1NFI E;  3UXG A;  5CER B;  3HRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...