1SVXA

Crystal structure of a designed selected ankyrin repeat protein in complex with the maltose binding protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
SDLGRKLLEAARAGQDDEVRILMANGADVNAADNTGTTPLHLAAYSGHLEIVEVLLKHGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein/sugar binding protein
molecule keywords Ankyrin Repeat Protein off7
publication title High-affinity binders selected from designed ankyrin repeat protein libraries
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2004-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1svxA00
5CEDB 2DZOA 3V31A 3DEPA 3B95A 5ENPD 4GPMA 3TWQA 3NBNB 2F8YA 2QC9A 3B7BA 3KEAA 4G8KA 2A5EA 3F6QA 5ITZF 3W9FA 2HE0A 2JABA 2VGEA 5FINA 1BLXB 4DX2A 4ZHBA 2BKGA 3EU9A 4RLYA 5AARA 4DX6D 4HI8A 3HG0D 3V2XA 5FIOA 3J5QB 1WDYA 5CECB 5ENSD 3EHRA 2B0OE 1MJ0A 4BETA 3JXJA 5EYLA 1WG0A 4O1OA 1A5EA 4HQDA 3LJNA 2DVWA 5JMND 5D66A 2DWZA 4HRMB 3ZU7B 5HKPA 4B93B 4HRNA 1BI8B 3UXGA 4BSZB 4J8YA 5AQAA 4TUMA 4JB8P 1YMPA 1MX4A 2AJAA 2KBXA 4HNAD 4BESA 1IHBA 2Y1LE 4QQIA 5KNGA 4YDYA 4HRLA 2KXPC 5KNHD 4LNUD 3TWRA 4NIKA 4N5QA 4J7WA 1YCSB 4DRXE 2ZGGA 3TWTA 4HBDA 2NYJA 4O60A 2XEHA 4F6RD 1DC2A 3D9HA 5AQ9A 2ZGDA 4CYMD 5EIDA 1OT8A 5KBAA 1BD8A 1N11A 1OY3D 3AAAC 3SO8A 1BI7B 5AQBA 4C48B 4U96D 4K5CA 5EIBE 4ATZD 5BXOA 1MX2A 3UTMA 3JXIA 3TWVA 3NOGD 3HRAA 1SVXA 4HLLA 4CZ2D 3C5RA 3T8KA 2XZDG 4BEPA 5ENTD 3IXEA 1G3NB 1IKND 5EN5D 5HS0A 2ETBA 5AQ7A 1N0QA 4Z68A 1K3ZD 4ZFHA 1N0RA 5JA4D 5HRYA 2DZNA 4GMRA 2ETAA 4QFVA 4U8YD 5BXUA 1K1AA 1QYMA 4O1PA 4K5BA 4LSZE 1TR4A 2F37A 1DCQA 2V5QC 5EILA 3ZUVB 5AAOA 5ENOD 3TWXA 1NFIE 3Q9UC 2Y0BG 1UOHA 1SW6A 2PNNA 3W9GA 4DX1A 5ENRD 3TWUA 5ENQD 4A63B 1AP7A 1K1BA 3V30A 1IXVA 4OAVB 3T9KA 1S70B 2XENA 3ZNGA 3EHQA 3Q9NC 2RFAA 3TWWA 4DX5D 5CEAA 1MX6A 5CERB 2J8SD 5CBNA 3V2OA 3J5PA 1D9SA 2QYJA 2ETCA 1YYHA 2RFMA 3JUEA 3NOCD 4HI9A 2V4HC 3UI2A 4F1PA 1AWCB 4U8VD 1MYOA 2XEEA 4BERA 5EYPF 2L6BA 4G8LA 4YDWA 3DEOA 3V79K 4DX7D 2MYOA 3AJIA 3TWSA 4DUIA 5KWDA 2FO1E 2XZTG 5AN8A 3ZKJA 5CBOA 2P2CP 4K5AB 4U95D 4HB5A 4UUCA 2F8XK 4OAUC 4LG6A 2BKKB 1BU9A
chains in the Genus database with same CATH superfamily
1HE8A 2EIME 4XEIG 3E4BA 3FUJA 5FTPA 4L9PA 4WNGA 2LXLA 3SQVA 4U04A 1WDYA 1E8ZA 3AG4E 4RVBA 4BETA 4ANWA 5JMND 3ZRHA 4ANXA 4EZKA 4UQYA 2WXGA 5E76A 2P58C 3DXMG 2AJAA 4CT0A 4V3IA 3C3OA 4GU5A 3PEVB 2KZTB 1FPPA 3ZFWA 2JEKA 4A3TA 4F6RD 1E7VA 4CYMD 5KBAA 1N11A 5FT9A 1BI7B 4LCTA 4WNEA 3CK8A 3CR3A 4K5CA 4YNDA 1TNUA 4LUNU 1SZ9A 1ZU2A 2XZDG 5BT1A 4ATGA 4ME2A 4L1BA 4TXRA 2J9QA 2EIKE 4GYYA 4U0ZA 2QZAA 1EPUA 3PZ2A 2PNNA 3CHRA 5ENQD 3OXFA 2BEDA 4GZDA 4GTOA 3CKBA 3V2OA 3TAXA 3RO3A 3JUEA 4GZCA 5ARGA 4UWFA 1MYOA 3OXGA 4JEHA 2P2CP 3GZ1A 4FA6A 4L2YA 4OAUC 4I6JA 3FEXA 3R7QA 2BF0X 3BEEA 5FINA 4RLYA 3UT7A 2F0YA 4N3AA 2YQ8A 3FUNA 3MKQA 2CFUA 4N5CA 4BT8A 2NXPA 3DSTA 4I6EA 2H6FA 5G04C 4JVSA 1IYGA 3FUKA 2A5UA 3CVXA 3PNLB 4JA7A 3ZPJA 2FULA 2X6FA 4Q94A 3UQ3A 4I1OB 5EX3A 5EIDA 2OVFA 2OOEA 3KEZA 3SO8A 2DYRE 5KJMA 2J09A 5AQBA 5AENA 2GRPB 2L0TB 4GTRA 1SVXA 3ZYKA 2RG8A 5ENNA 4B89A 1N9AA 3T8MA 1OCZE 4HS2A 2Y0BG 5IY5E 4B8AA 4KVMA 3EIJA 4I1MA 3Q15A 3ZYLA 2H6HA 3EHQA 3PE3A 4DX5D 3O48A 4AJWA 5A23A 2KCKA 5CBNA 4LNBA 4G1TA 4UI9C 3U9WA 4FHKA 3PH0C 1UJJA 2VTBB 3V79K 2MYOA 2LO6A 3AJIA 1Z3YA 4K5AB 4HB5A 4F3VA 1HXIA 1BU9A 4BY6A 4N3BA 3B95A 5LX8A 2YINA 2JABA 3VLFA 2XGOA 3C98A 1VDYA 1OWNA 2J49A 4WWOA 4U7EB 2CG2A 4HRMB 3ZU7B 3DRAA 2ONDA 2VYIA 4HLEA 5KNGA 3QWWA 3UIOC 2R05A 1O1TA 3D9KA 3FY4A 4JC8A 3RRUA 1U3DA 4HXIA 4GMJA 4I9CA 3UM2A 2I2OA 1H6OA 5BV0A 4GMLA 3CVYA 4RG9A 1UW4B 4UQZA 3FTXA 3LDZA 5BXUA 1K1AA 2EIJE 4ANUA 1L5JA 3UM3A 2OCCE 2HR2A 4RG6A 5CCMA 1GW6A 3TWWA 3T5VA 3APDA 4J8EA 4KT6B 2ETCA 2RFMA 3SFXA 2XS1A 3ZVVA 2J4BA 5FQ7A 3HXEA 3AG2E 3UX4A 1FT2A 2C0MA 1NA0A 3PVLA 2YNQA 3HHMA 3EIQC 4F1SA 3RU0A 2BKKB 1KPSB 3SZ7A 4DX2A 4APOA 4AIFA 3D9PA 2B0OE 2WXHA 1MJ0A 1MQSA 1Y8MA 3MKQB 3JUIA 4CT4A 5EYLA 1H2TC 1Z5SC 1KZOA 4KMOA 5B3SE 4U8HA 4N39A 4NURA 5A6CA 2YHEA 2KC7A 4GTTA 3FH5A 1MX4A 3QARA 1N95A 3QC1A 3HXCA 5B1AE 3Q7FA 4DI4A 1Z3XA 4GTQA 3D9HA 5FZQA 3ASDA 4MKTA 2PL2A 1HG5A 1DNPA 3IV0A 3L16A 5KJLA 4U07A 2GW1A 2DCPA 3SY2A 4C9BB 5HS0A 2KZTA 3FH8A 3SFYA 3TXMA 3C3RA 4TUUA 2A4ZA 3MA5A 1DCQA 1H19A 1JCQA 5ENOD 3Q9UC 1QBQA 4EBAG 1DCEA 3V30A 2WB2A 2M63A 3T9KA 4MBGA 3Q9NC 3UKUG 4E85A 1MX6A 1MHQA 3CGHA 2P9SG 2IJGX 3L9TA 3FUEA 1HX8A 4B94A 3UI2A 3G2WA 1NZNA 3L13A 1YA0A 5EYPF 3IBEA 4EQFA 3ML9A 5FQ6A 2IOSA 4HVBA 4HOTA 3SHFA 3AS8A 4GPMA 5T4YA 3HG0D 1HG2A 4EBAA 1OCRE 3R7RA 5BUZA 4O1OA 5ARFA 4P29A 3P2BA 5JJ7A 2OEVA 4TXQA 4ACLA 4BSZB 4HNAD 1P5QA 2AWIA 3AS5A 5CCLA 2IY0C 2XRYA 1OT8A 1PY1A 2UWJG 3ONLA 1MX2A 3NOGD 3B13A 3ZXPA 3MKRA 2FEZA 3OXLA 4K03A 3AG1E 3CVVA 2C2LA 2DIWA 1OWPA 2V5QC 3ZUVB 3SF4A 2EQXA 3K9IA 3PRZA 2XENA 3CVNA 4BT9A 2WQHA 2J8SD 5JHBA 2R17C 1AWCB 3D9NA 1OUVA 2IO3C 4TV3A 1OWOA 3S7DA 3ABME 3D9MA 4N2QA 1NL4A 2CG3A 3ZEFA 3V31A 4GPKA 3NBNB 3CEQA 4PH4B 1H2UA 4J8SA 5FQ4A 4ZHBA 4AXHA 3FWVA 1IQUA 1N4PA 3DSUA 2AXUA 1Q2ZA 3CLJA 3HXBA 4W9RA 1E8YA 1A5EA 4AV7A 3LYAA 3TJPA 3VLEA 3LVRE 4UWGA 4EECA 3ULEG 2DWZA 1TN8A 5AQAA 3FH7A 1QZ2A 2ILRA 4YDYA 4AY5A 3CHPA 2MRIA 1JCSA 4KXKB 3NF1A 3DSXA 3QAQA 3CSFA 3QJZA 2CHZA 1TEZA 3AAAC 1DVPA 3ZW3A 2KATA 3AU5A 4I9EA 5D2MC 4BTAA 2QFCA 4XE0A 2FO7A 3Q78A 4MRUA 3ZHEA 4NRHB 1UN8A 4QFVA 4O1PA 4K5BA 4LSZE 2LAIA 2R2LA 3RRMB 3LS8A 4BTBA 1UOHA 1H6KA 1FVFA 5HI7A 1ZB1A 4D10C 2GGFA 4FJYA 4YDOA 5FZRA 4LRZA 3CQGB 3JCKC 3SI5A 3U3WA 4AVXA 1S0PA 3UM1A 3E33A 3UKRG 2VGYA 2XGMA 3CQCB 3ENEA 2F8YA 3B7BA 2A5EA 4YVQC 4GAAA 2VGEA 4J8FA 4MS6A 3D3MA 3V2XA 1JCRA 1HS6A 4Y6CA 3FTSA 5FJYA 3MV2B 1A17A 5D66A 2I1KA 1SQMA 3KSLA 4EZLA 3NAWA 1TNZA 3MZLB 4TUMA 3CHMA 3LY8A 4KBQA 3EDTB 2WXRA 4Q69A 3MJWA 5CMYA 2ZGGA 3FHEA 2GROB 4G26A 3CV0A 3FULA 3B7UX 2L9BA 4U0SA 4I1AA 3TL5A 3AG3E 2L0IA 2Y69E 3ASFA 2WXKA 4JHKA 3E37A 5DBKA 2IQCA 3MCXA 1WM5A 2X38A 2DZNA 4JHJA 4YDEA 4WWPA 5LFAA 4AP2A 4BX8A 1TN6A 3CSTA 4JW1A 3L6AA 2X3MA 4DLQA 3O4ZA 5CHEE 5CRUA 3S7FA 1N4QA 4JXTA 4TRQA 2VSOE 3ULYA 4G8LA 3PREA 3CHSA 3SFZA 4GCOA 4NACA 1S63A 3T5XA 5E75A 4RSYA 4C0MA 1OCOE 2J08A 3FU0A 3D9IA 3W9FA 3EU9A 2AW6A 2J07A 2V8SE 5FIOA 5ENSD 3FU5A 4HOSA 4B8CB 1NA3A 4GA2A 4CDNA 3CK9A 4FU3A 4H7YA 2KXPC 4N5QA 5BW8C 3FTWA 2R59A 2AVPA 2P9KG 1DC2A 1BD8A 4U96D 4ATZD 3BQOA 4HORA 4HLLA 3ASNE 4BEPA 3IXEA 4N2SA 3MV3B 3GW4A 2H6GA 4EPZA 2BUGA 3ZHEB 5FWQA 4G2VA 4BFRA 4O6FA 3NQPA 3UINC 5HQ8A 3VTYA 2RD0A 3ZN3A 4M7CA 2RFAA 3E30A 3PZ1A 3NOCD 4GA1A 4HI9A 4J0UA 1K8KG 3FTZA 4L7TA 5ANLA 1INZA 1B89A 4YDWA 5B1BE 2CHWA 3ZKJA 2NC9A 4U63A 4UUCA 3N71A 5M72A 3SD5A 5ENPD 5J08A 1IHGA 1TYQG 4OVVA 4GA0A 3UPVA 1QQEA 3LEWA 4NQ0A 3QOUA 4WNDA 4UI9K 2XPYA 3EHRA 2WXJA 4N3CA 2AXVA 3KS2A 3FDHA 4I17A 2V4LA 1BPOA 4I2ZA 1E8XA 4J8YA 4JB8P 1YMPA 4M3OA 2XQ0A 4NIKA 4OVUA 5EX0A 3B7RL 3RIBA 4DRXE 1N4RA 5BNWA 2XEHA 2WXMA 4A3VA 4EZJA 4KYOB 2IEJA 1QNFA 5LOZA 1OY3D 1HH8A 5BXOA 3UTMA 5FZSA 3R9AB 4FADA 3C5RA 4GTSA 1IKND 2XCCA 2WXPA 5EN5D 1HF8A 4MLPA 2IF4A 2NSZA 4XI9A 1TN7A 4U8YD 2ETAA 4JZYA 1N54A 4CGVA 3RSEG 2R02A 5AAOA 4A63B 2GRLA 1IXVA 4DI3A 3AS4A 3SGHA 5CERB 4FLHA 1V54E 3GZSA 4WUYA 2LSVA 1SZAA 3HVEB 2XEEA 4I43A 4C0EA 3EJNA 3FEYA 2FO1E 4FLBA 3IEGA 5JJ6A 5H7PA 1X5BA 4FHJA 2XS8A 3IHYA 2FI7A 4DLOA 1BLXB 2BKGA 4G11A 5JHAA 3J5QB 5CECB 2UY1B 1JPLA 1TNOA 1RW2A 4ILHB 3CHQA 2KCVA 4H7XA 3G2VA 3QNKA 2H6IA 3URZA 3CKCA 3QDNA 5HKPA 4HRNA 2FBNA 4BESA 4QQIA 2X6IA 3MGBA 5KNHD 4IRUA 5A7DB 3FUHA 2CFZA 3TG4A 2KCLA 1ELWA 4GZ3A 4FC8A 4AEZC 2ZGDA 2Y3AA 3CK7A 3U64A 4C48B 5D0OD 4BWRA 4B0ZA 1O1SA 4CZ2D 2Y4UA 1OXJA 4HOUA 3SBTB 1N0QA 1XGWA 4XZ4A 1N0RA 4G23A 3UMVA 5JA4D 1UN9A 3D9JA 3LY9A 4EHMA 3KSQA 1SA4A 1SW6A 3EUVA 1N52A 3MEKA 5J90A 1AP7A 1TJFA 1V55E 4WWNA 1O1RA 2GRMA 3FFLA 1D9SA 2WQ7A 3ASOE 2V4HC 2X6HA 4GYOA 3D9LA 4ANVA 2E2EA 3DEOA 3E34A 2GRNB 2AXZA 4U95D 5T8IA 4OAVB 4LG6A 2WPVA 3QK0A 3F6QA 2BTDA 5AARA 3ESKA 1XNFA 3DXKG 2R03A 4KZ0A 5G05J 4ILIA 2YHCA 2MHKA 3S7BA 2Y1LE 1ZBPA 3L17A 3TWRA 4LNUD 3ZYMA 3CVWA 3QB2A 4J7WA 1N94A 3X2QE 3Q5MA 3RK6A 3UUXA 1LF8A 4J8DA 3LXUX 3CHOA 3ULQA 1WAO1 2ZXWE 2ZU6B 3S7JA 1G3NB 4PS3A 2CHXA 5BPPA 4G25A 1FT1A 4CRWA 4PUCA 4GMRA 1PC2A 2E0IA 2WM9A 5EILA 3TWXA 4GZ6A 3ZNGA 3ONKA 2V5FA 2PZIA 5EDSA 2KM4A 3C72A 4I2WA 3EHNA 2FF4A 3BG1B 1KLXA 3S2AA 2F8XK 2DZOA 2R5SA 1D8DA 3FU3A 5JJTA 3L22A 3ESLA 4A1SA 4HI8A 1EF1C 3DPYA 3Q7AA 4XKCA 2VQ2A 3I4RB 1LD7A 4HQDA 2DVWA 1FVHA 3GZ2A 1UG3A 1RZ4A 5CMWA 2EINE 5G2NA 3I4GA 1LTXA 1OWLA 4HBDA 4KVOA 4JHRA 1D8EA 3FU6A 3Q47B 3JQ0A 3LY7A 1KZPA 2WQ6A 2XEVA 3U4TA 1TJCA 3JXIA 4CGWA 3HRAA 2XPZA 3CIAA 2J4DA 4E6HA 2I6HA 1K3ZD 4ZFHA 3PS6A 2VJ8A 3FP3A 1IQRA 4LEUA 5HRYA 4GYWA 1TR4A 2F37A 3ZGQA 3NZUA 3CVLA 2X6KA 3E32A 3I5PA 3VTXA 1K1BA 4GZ5A 1Y6IA 1S70B 4LNGA 3FUDA 3DPDA 2EILE 4I6GA 2QYJA 3QWPA 2IONA 1EDUA 4U8VD 3JQ1A 4BERA 5ANRA 1FCHA 2XGSA 1H2VC 3TWSA 2HM8A 2LSUA 2I1JA 1X81A 4G24A 4CDMA 3APCA 1ELKA 2XRZA 5LP0A 1KT0A 3KEAA 2Q7FA 5ITZF 2WMNA 1E7UA 2WXFA 2X6JA 4DX6D 2VGXA 3HVEA 2RKKA 3LJ3A 1HZ4A 1N4SA 4YVOA 2XHEA 1O5MA 1MZCA 2LAHA 2HYZA 1ELRA 3PZDA 2WXQA 1JWGA 3UXGA 4DJAA 2DBAA 4HRLA 1NI1A 5D0QD 3FTVA 3FTYA 3G2TA 3ASHA 2UY1A 3SNXA 5KCMA 4U0UA 3DSWA 5AQ9A 1U3CA 3UT8A 4OYSA 4XKBA 5EIBE 2OVBA 3ZXSA 5ENTD 1HFAA 3LPZA 5G04J 3U66A 4UWKA 3I3NA 1QYMA 3FUIA 3WG7E 2P9UG 3GYZA 3PEUB 3TWUA 4HFGA 4A1GA 1E90A 5CEAA 2HO1A 4ABNA 4PS8A 1YYHA 4LERA 3FUFA 4CDRA 3IHVA 4AM9A 3HXDA 2XPIA 5FQ8A 4J6IA 2MOWA 3NZSA 3APFA 4XIFA 5KWDA 3DSVA 3G2SA 5AN8A 3L54A 3JYSA 2IO2C 3PUKA 3IKOB 5AJDA 1HO8A 4DPRA 2QC9A 2LUHA 4GB9A 2Y4TA 2OV8A 4L23A 3CVUA 3WXXA 4GTMA 1WG0A 3LJNA 1TNYA 4UI9J 3KD7A 4F53A 2PM7A 1JWFA 2I9CA 1IHBA 3HDXA 4ACKA 1KT1A 3ZIMA 3TWTA 4UWHA 3Q4AB 3Q73A 4UQXA 3Q75A 1PAQA 2WXIA 2XCBA 2V0PA 3L08A 5T3RA 4JD2G 5LCWC 4JEUA 3ABKE 2LXMA 4L2LA 5G55A 2WXNA 3B7SA 4JL0A 1E96B 1NFIE 4FULA 3W9GA 4DX1A 5ENRD 1SA5A 1JUQA 3RKVA 2IFUA 3EHMA 3BUAA 4A55A 2QY7A 4WNFA 4AY6A 2WVIA 4R7LA 3DBSA 4GCNA 4DUIA 1WY6A 5BV1A 3EU5A 3BU8A 2L6BA 2PM6A 2C0LA 3TWQA 3D9OA 2WXLA 1H6PA 2HE0A 2IU1A 3DSSA 4IN3B 4X8QA 1HU3A 2VGXB 3HIZA 3PNTB 3CVPA 3RRNB 3UT4A 5LCWJ 1UJKA 3G2UA 4IYPA 5C1DA 4B93B 1TNBA 1BI8B 1LD8A 4FP7A 2ZISA 2KBXA 4GTVA 5AIJA 3OAWA 2OEWA 2P9IG 3AU4A 4IULA 4UWLA 4HOQA 3PUJA 1S64A 3ZYQA 2VSXE 2B6CA 3VLDA 3TWVA 3DWLG 3LKUA 4DK5A 4APFA 3L82A 3FTUA 3Q49B 5AQ7A 4F7AA 4AOFA 4PS7A 1OWMA 1U2VG 4GTPA 3FUMA 3TG5A 2PQRA 4KZCA 3MYVA 4CEMA 4WAFA 3BG0B 2WMOA 3J5PA 2ZIRA 5KJKA 4CCAA 2QYUA 1Z6TA 4F1PA 5G05C 5AJLA 3QKYA 4DX7D 3P1UA 2XZTG 5C2YA 5CBOA 4BX9A 5CEDB 3DEPA 4ILGA 2L6JA 3CVQA 4G8KA 4JPSA 2VSNA 2PQNA 3UIPC 3TGOA 2WXOA 4XI0A 4XX5A 2P9NG 3JXJA 3C3QA 3ASGA 3HXFA 4K0RA 3TXNA 3KAEA 3ISMC 4BSXA 3SBSA 3RO2A 3R9MA 4RQIA 1NP7A 4Q96A 3LVQE 1H0AA 5KJNA 2IOLA 1YCSB 3RJVA 1E8WA 4TXPA 2NYJA 4O60A 3PE4A 3NB2A 5EKQD 3UM0A 4Y6WA 3OTNA 3RAUA 3MX3A 5DIZA 4FJZA 4JA9A 1OCCE 3T8KA 2ETBA 4Z68A 2GRQB 2GRRB 2P9LG 3HYMB 4PDXA 3ABLE 3Q79A 5CRVA 2P9PG 2LNIA 5AYWD 3QWVA 2VSYA 2JLBA 3ML8A 1W3BA 4URKA 1EYHA 3LCAA 2VTBA 2DYSE 3PZ4A 3B7TA 3PZ3A 3PDNA
chains in the Genus database with same CATH topology
5CEDB 2DZOA 3V31A 3DEPA 3B95A 5ENPD 4GPMA 3TWQA 3NBNB 2F8YA 2QC9A 3B7BA 3KEAA 4G8KA 2A5EA 3F6QA 5ITZF 3W9FA 2HE0A 2JABA 2VGEA 5FINA 1BLXB 4DX2A 4ZHBA 2BKGA 3EU9A 4RLYA 5AARA 4DX6D 4HI8A 3HG0D 3V2XA 5FIOA 3J5QB 1WDYA 5CECB 5ENSD 3EHRA 2B0OE 1MJ0A 4BETA 3JXJA 5EYLA 1WG0A 4O1OA 1A5EA 4HQDA 3LJNA 2DVWA 5JMND 5D66A 2DWZA 4HRMB 3ZU7B 5HKPA 4B93B 4HRNA 1BI8B 3UXGA 4BSZB 4J8YA 5AQAA 4TUMA 4JB8P 1YMPA 1MX4A 2AJAA 2KBXA 4HNAD 4BESA 1IHBA 2Y1LE 4QQIA 5KNGA 4YDYA 4HRLA 2KXPC 5KNHD 4LNUD 3TWRA 4NIKA 4N5QA 4J7WA 1YCSB 4DRXE 2ZGGA 3TWTA 4HBDA 2NYJA 4O60A 2XEHA 4F6RD 1DC2A 3D9HA 5AQ9A 2ZGDA 4CYMD 5EIDA 1OT8A 5KBAA 1BD8A 1N11A 1OY3D 3AAAC 3SO8A 1BI7B 5AQBA 4C48B 4U96D 4K5CA 5EIBE 4ATZD 5BXOA 1MX2A 3UTMA 3JXIA 3TWVA 3NOGD 3HRAA 1SVXA 4HLLA 4CZ2D 3C5RA 3T8KA 2XZDG 4BEPA 5ENTD 3IXEA 1G3NB 1IKND 5EN5D 5HS0A 2ETBA 5AQ7A 1N0QA 4Z68A 1K3ZD 4ZFHA 1N0RA 5JA4D 5HRYA 2DZNA 4GMRA 2ETAA 4QFVA 4U8YD 5BXUA 1K1AA 1QYMA 4O1PA 4K5BA 4LSZE 1TR4A 2F37A 1DCQA 2V5QC 5EILA 3ZUVB 5AAOA 5ENOD 3TWXA 1NFIE 3Q9UC 2Y0BG 1UOHA 1SW6A 2PNNA 3W9GA 4DX1A 5ENRD 3TWUA 5ENQD 4A63B 1AP7A 1K1BA 3V30A 1IXVA 4OAVB 3T9KA 1S70B 2XENA 3ZNGA 3EHQA 3Q9NC 2RFAA 3TWWA 4DX5D 5CEAA 1MX6A 5CERB 2J8SD 5CBNA 3V2OA 3J5PA 1D9SA 2QYJA 2ETCA 1YYHA 2RFMA 3JUEA 3NOCD 4HI9A 2V4HC 3UI2A 4F1PA 1AWCB 4U8VD 1MYOA 2XEEA 4BERA 5EYPF 2L6BA 4G8LA 4YDWA 3DEOA 3V79K 4DX7D 2MYOA 3AJIA 3TWSA 4DUIA 5KWDA 2FO1E 2XZTG 5AN8A 3ZKJA 5CBOA 2P2CP 4K5AB 4U95D 4HB5A 4UUCA 2F8XK 4OAUC 4LG6A 2BKKB 1BU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CED B;  2DZO A;  3V31 A;  3DEP A;  3B95 A;  5ENP D;  4GPM A;  3TWQ A;  3NBN B;  2F8Y A;  2QC9 A;  3B7B A;  3KEA A;  4G8K A;  2A5E A;  3F6Q A;  5ITZ F;  3W9F A;  2HE0 A;  2JAB A;  2VGE A;  5FIN A;  1BLX B;  4DX2 A;  4ZHB A;  2BKG A;  3EU9 A;  4RLY A;  5AAR A;  4DX6 D;  4HI8 A;  3HG0 D;  3V2X A;  5FIO A;  3J5Q B;  1WDY A;  5CEC B;  5ENS D;  3EHR A;  2B0O E;  1MJ0 A;  4BET A;  3JXJ A;  5EYL A;  1WG0 A;  4O1O A;  1A5E A;  4HQD A;  3LJN A;  2DVW A;  5JMN D;  5D66 A;  2DWZ A;  4HRM B;  3ZU7 B;  5HKP A;  4B93 B;  4HRN A;  1BI8 B;  3UXG A;  4BSZ B;  4J8Y A;  5AQA A;  4TUM A;  4JB8 P;  1YMP A;  1MX4 A;  2AJA A;  2KBX A;  4HNA D;  4BES A;  1IHB A;  2Y1L E;  4QQI A;  5KNG A;  4YDY A;  4HRL A;  2KXP C;  5KNH D;  4LNU D;  3TWR A;  4NIK A;  4N5Q A;  4J7W A;  1YCS B;  4DRX E;  2ZGG A;  3TWT A;  4HBD A;  2NYJ A;  4O60 A;  2XEH A;  4F6R D;  1DC2 A;  3D9H A;  5AQ9 A;  2ZGD A;  4CYM D;  5EID A;  1OT8 A;  5KBA A;  1BD8 A;  1N11 A;  1OY3 D;  3AAA C;  3SO8 A;  1BI7 B;  5AQB A;  4C48 B;  4U96 D;  4K5C A;  5EIB E;  4ATZ D;  5BXO A;  1MX2 A;  3UTM A;  3JXI A;  3TWV A;  3NOG D;  3HRA A;  1SVX A;  4HLL A;  4CZ2 D;  3C5R A;  3T8K A;  2XZD G;  4BEP A;  5ENT D;  3IXE A;  1G3N B;  1IKN D;  5EN5 D;  5HS0 A;  2ETB A;  5AQ7 A;  1N0Q A;  4Z68 A;  1K3Z D;  4ZFH A;  1N0R A;  5JA4 D;  5HRY A;  2DZN A;  4GMR A;  2ETA A;  4QFV A;  4U8Y D;  5BXU A;  1K1A A;  1QYM A;  4O1P A;  4K5B A;  4LSZ E;  1TR4 A;  2F37 A;  1DCQ A;  2V5Q C;  5EIL A;  3ZUV B;  5AAO A;  5ENO D;  3TWX A;  1NFI E;  3Q9U C;  2Y0B G;  1UOH A;  1SW6 A;  2PNN A;  3W9G A;  4DX1 A;  5ENR D;  3TWU A;  5ENQ D;  4A63 B;  1AP7 A;  1K1B A;  3V30 A;  1IXV A;  4OAV B;  3T9K A;  1S70 B;  2XEN A;  3ZNG A;  3EHQ A;  3Q9N C;  2RFA A;  3TWW A;  4DX5 D;  5CEA A;  1MX6 A;  5CER B;  2J8S D;  5CBN A;  3V2O A;  3J5P A;  1D9S A;  2QYJ A;  2ETC A;  1YYH A;  2RFM A;  3JUE A;  3NOC D;  4HI9 A;  2V4H C;  3UI2 A;  4F1P A;  1AWC B;  4U8V D;  1MYO A;  2XEE A;  4BER A;  5EYP F;  2L6B A;  4G8L A;  4YDW A;  3DEO A;  3V79 K;  4DX7 D;  2MYO A;  3AJI A;  3TWS A;  4DUI A;  5KWD A;  2FO1 E;  2XZT G;  5AN8 A;  3ZKJ A;  5CBO A;  2P2C P;  4K5A B;  4U95 D;  4HB5 A;  4UUC A;  2F8X K;  4OAU C;  4LG6 A;  2BKK B;  1BU9 A; 
#chains in the Genus database with same CATH topology
 1HE8 A;  2EIM E;  4XEI G;  3E4B A;  3FUJ A;  5FTP A;  4L9P A;  4WNG A;  2LXL A;  3SQV A;  4U04 A;  1WDY A;  1E8Z A;  3AG4 E;  4RVB A;  4BET A;  4ANW A;  5JMN D;  3ZRH A;  4ANX A;  4EZK A;  4UQY A;  2WXG A;  5E76 A;  2P58 C;  3DXM G;  2AJA A;  4CT0 A;  4V3I A;  3C3O A;  4GU5 A;  3PEV B;  2KZT B;  1FPP A;  3ZFW A;  2JEK A;  4A3T A;  4F6R D;  1E7V A;  4CYM D;  5KBA A;  1N11 A;  5FT9 A;  1BI7 B;  4LCT A;  4WNE A;  3CK8 A;  3CR3 A;  4K5C A;  4YND A;  1TNU A;  4LUN U;  1SZ9 A;  1ZU2 A;  2XZD G;  5BT1 A;  4ATG A;  4ME2 A;  4L1B A;  4TXR A;  2J9Q A;  2EIK E;  4GYY A;  4U0Z A;  2QZA A;  1EPU A;  3PZ2 A;  2PNN A;  3CHR A;  5ENQ D;  3OXF A;  2BED A;  4GZD A;  4GTO A;  3CKB A;  3V2O A;  3TAX A;  3RO3 A;  3JUE A;  4GZC A;  5ARG A;  4UWF A;  1MYO A;  3OXG A;  4JEH A;  2P2C P;  3GZ1 A;  4FA6 A;  4L2Y A;  4OAU C;  4I6J A;  3FEX A;  3R7Q A;  2BF0 X;  3BEE A;  5FIN A;  4RLY A;  3UT7 A;  2F0Y A;  4N3A A;  2YQ8 A;  3FUN A;  3MKQ A;  2CFU A;  4N5C A;  4BT8 A;  2NXP A;  3DST A;  4I6E A;  2H6F A;  5G04 C;  4JVS A;  1IYG A;  3FUK A;  2A5U A;  3CVX A;  3PNL B;  4JA7 A;  3ZPJ A;  2FUL A;  2X6F A;  4Q94 A;  3UQ3 A;  4I1O B;  5EX3 A;  5EID A;  2OVF A;  2OOE A;  3KEZ A;  3SO8 A;  2DYR E;  5KJM A;  2J09 A;  5AQB A;  5AEN A;  2GRP B;  2L0T B;  4GTR A;  1SVX A;  3ZYK A;  2RG8 A;  5ENN A;  4B89 A;  1N9A A;  3T8M A;  1OCZ E;  4HS2 A;  2Y0B G;  5IY5 E;  4B8A A;  4KVM A;  3EIJ A;  4I1M A;  3Q15 A;  3ZYL A;  2H6H A;  3EHQ A;  3PE3 A;  4DX5 D;  3O48 A;  4AJW A;  5A23 A;  2KCK A;  5CBN A;  4LNB A;  4G1T A;  4UI9 C;  3U9W A;  4FHK A;  3PH0 C;  1UJJ A;  2VTB B;  3V79 K;  2MYO A;  2LO6 A;  3AJI A;  1Z3Y A;  4K5A B;  4HB5 A;  4F3V A;  1HXI A;  1BU9 A;  4BY6 A;  4N3B A;  3B95 A;  5LX8 A;  2YIN A;  2JAB A;  3VLF A;  2XGO A;  3C98 A;  1VDY A;  1OWN A;  2J49 A;  4WWO A;  4U7E B;  2CG2 A;  4HRM B;  3ZU7 B;  3DRA A;  2OND A;  2VYI A;  4HLE A;  5KNG A;  3QWW A;  3UIO C;  2R05 A;  1O1T A;  3D9K A;  3FY4 A;  4JC8 A;  3RRU A;  1U3D A;  4HXI A;  4GMJ A;  4I9C A;  3UM2 A;  2I2O A;  1H6O A;  5BV0 A;  4GML A;  3CVY A;  4RG9 A;  1UW4 B;  4UQZ A;  3FTX A;  3LDZ A;  5BXU A;  1K1A A;  2EIJ E;  4ANU A;  1L5J A;  3UM3 A;  2OCC E;  2HR2 A;  4RG6 A;  5CCM A;  1GW6 A;  3TWW A;  3T5V A;  3APD A;  4J8E A;  4KT6 B;  2ETC A;  2RFM A;  3SFX A;  2XS1 A;  3ZVV A;  2J4B A;  5FQ7 A;  3HXE A;  3AG2 E;  3UX4 A;  1FT2 A;  2C0M A;  1NA0 A;  3PVL A;  2YNQ A;  3HHM A;  3EIQ C;  4F1S A;  3RU0 A;  2BKK B;  1KPS B;  3SZ7 A;  4DX2 A;  4APO A;  4AIF A;  3D9P A;  2B0O E;  2WXH A;  1MJ0 A;  1MQS A;  1Y8M A;  3MKQ B;  3JUI A;  4CT4 A;  5EYL A;  1H2T C;  1Z5S C;  1KZO A;  4KMO A;  5B3S E;  4U8H A;  4N39 A;  4NUR A;  5A6C A;  2YHE A;  2KC7 A;  4GTT A;  3FH5 A;  1MX4 A;  3QAR A;  1N95 A;  3QC1 A;  3HXC A;  5B1A E;  3Q7F A;  4DI4 A;  1Z3X A;  4GTQ A;  3D9H A;  5FZQ A;  3ASD A;  4MKT A;  2PL2 A;  1HG5 A;  1DNP A;  3IV0 A;  3L16 A;  5KJL A;  4U07 A;  2GW1 A;  2DCP A;  3SY2 A;  4C9B B;  5HS0 A;  2KZT A;  3FH8 A;  3SFY A;  3TXM A;  3C3R A;  4TUU A;  2A4Z A;  3MA5 A;  1DCQ A;  1H19 A;  1JCQ A;  5ENO D;  3Q9U C;  1QBQ A;  4EBA G;  1DCE A;  3V30 A;  2WB2 A;  2M63 A;  3T9K A;  4MBG A;  3Q9N C;  3UKU G;  4E85 A;  1MX6 A;  1MHQ A;  3CGH A;  2P9S G;  2IJG X;  3L9T A;  3FUE A;  1HX8 A;  4B94 A;  3UI2 A;  3G2W A;  1NZN A;  3L13 A;  1YA0 A;  5EYP F;  3IBE A;  4EQF A;  3ML9 A;  5FQ6 A;  2IOS A;  4HVB A;  4HOT A;  3SHF A;  3AS8 A;  4GPM A;  5T4Y A;  3HG0 D;  1HG2 A;  4EBA A;  1OCR E;  3R7R A;  5BUZ A;  4O1O A;  5ARF A;  4P29 A;  3P2B A;  5JJ7 A;  2OEV A;  4TXQ A;  4ACL A;  4BSZ B;  4HNA D;  1P5Q A;  2AWI A;  3AS5 A;  5CCL A;  2IY0 C;  2XRY A;  1OT8 A;  1PY1 A;  2UWJ G;  3ONL A;  1MX2 A;  3NOG D;  3B13 A;  3ZXP A;  3MKR A;  2FEZ A;  3OXL A;  4K03 A;  3AG1 E;  3CVV A;  2C2L A;  2DIW A;  1OWP A;  2V5Q C;  3ZUV B;  3SF4 A;  2EQX A;  3K9I A;  3PRZ A;  2XEN A;  3CVN A;  4BT9 A;  2WQH A;  2J8S D;  5JHB A;  2R17 C;  1AWC B;  3D9N A;  1OUV A;  2IO3 C;  4TV3 A;  1OWO A;  3S7D A;  3ABM E;  3D9M A;  4N2Q A;  1NL4 A;  2CG3 A;  3ZEF A;  3V31 A;  4GPK A;  3NBN B;  3CEQ A;  4PH4 B;  1H2U A;  4J8S A;  5FQ4 A;  4ZHB A;  4AXH A;  3FWV A;  1IQU A;  1N4P A;  3DSU A;  2AXU A;  1Q2Z A;  3CLJ A;  3HXB A;  4W9R A;  1E8Y A;  1A5E A;  4AV7 A;  3LYA A;  3TJP A;  3VLE A;  3LVR E;  4UWG A;  4EEC A;  3ULE G;  2DWZ A;  1TN8 A;  5AQA A;  3FH7 A;  1QZ2 A;  2ILR A;  4YDY A;  4AY5 A;  3CHP A;  2MRI A;  1JCS A;  4KXK B;  3NF1 A;  3DSX A;  3QAQ A;  3CSF A;  3QJZ A;  2CHZ A;  1TEZ A;  3AAA C;  1DVP A;  3ZW3 A;  2KAT A;  3AU5 A;  4I9E A;  5D2M C;  4BTA A;  2QFC A;  4XE0 A;  2FO7 A;  3Q78 A;  4MRU A;  3ZHE A;  4NRH B;  1UN8 A;  4QFV A;  4O1P A;  4K5B A;  4LSZ E;  2LAI A;  2R2L A;  3RRM B;  3LS8 A;  4BTB A;  1UOH A;  1H6K A;  1FVF A;  5HI7 A;  1ZB1 A;  4D10 C;  2GGF A;  4FJY A;  4YDO A;  5FZR A;  4LRZ A;  3CQG B;  3JCK C;  3SI5 A;  3U3W A;  4AVX A;  1S0P A;  3UM1 A;  3E33 A;  3UKR G;  2VGY A;  2XGM A;  3CQC B;  3ENE A;  2F8Y A;  3B7B A;  2A5E A;  4YVQ C;  4GAA A;  2VGE A;  4J8F A;  4MS6 A;  3D3M A;  3V2X A;  1JCR A;  1HS6 A;  4Y6C A;  3FTS A;  5FJY A;  3MV2 B;  1A17 A;  5D66 A;  2I1K A;  1SQM A;  3KSL A;  4EZL A;  3NAW A;  1TNZ A;  3MZL B;  4TUM A;  3CHM A;  3LY8 A;  4KBQ A;  3EDT B;  2WXR A;  4Q69 A;  3MJW A;  5CMY A;  2ZGG A;  3FHE A;  2GRO B;  4G26 A;  3CV0 A;  3FUL A;  3B7U X;  2L9B A;  4U0S A;  4I1A A;  3TL5 A;  3AG3 E;  2L0I A;  2Y69 E;  3ASF A;  2WXK A;  4JHK A;  3E37 A;  5DBK A;  2IQC A;  3MCX A;  1WM5 A;  2X38 A;  2DZN A;  4JHJ A;  4YDE A;  4WWP A;  5LFA A;  4AP2 A;  4BX8 A;  1TN6 A;  3CST A;  4JW1 A;  3L6A A;  2X3M A;  4DLQ A;  3O4Z A;  5CHE E;  5CRU A;  3S7F A;  1N4Q A;  4JXT A;  4TRQ A;  2VSO E;  3ULY A;  4G8L A;  3PRE A;  3CHS A;  3SFZ A;  4GCO A;  4NAC A;  1S63 A;  3T5X A;  5E75 A;  4RSY A;  4C0M A;  1OCO E;  2J08 A;  3FU0 A;  3D9I A;  3W9F A;  3EU9 A;  2AW6 A;  2J07 A;  2V8S E;  5FIO A;  5ENS D;  3FU5 A;  4HOS A;  4B8C B;  1NA3 A;  4GA2 A;  4CDN A;  3CK9 A;  4FU3 A;  4H7Y A;  2KXP C;  4N5Q A;  5BW8 C;  3FTW A;  2R59 A;  2AVP A;  2P9K G;  1DC2 A;  1BD8 A;  4U96 D;  4ATZ D;  3BQO A;  4HOR A;  4HLL A;  3ASN E;  4BEP A;  3IXE A;  4N2S A;  3MV3 B;  3GW4 A;  2H6G A;  4EPZ A;  2BUG A;  3ZHE B;  5FWQ A;  4G2V A;  4BFR A;  4O6F A;  3NQP A;  3UIN C;  5HQ8 A;  3VTY A;  2RD0 A;  3ZN3 A;  4M7C A;  2RFA A;  3E30 A;  3PZ1 A;  3NOC D;  4GA1 A;  4HI9 A;  4J0U A;  1K8K G;  3FTZ A;  4L7T A;  5ANL A;  1INZ A;  1B89 A;  4YDW A;  5B1B E;  2CHW A;  3ZKJ A;  2NC9 A;  4U63 A;  4UUC A;  3N71 A;  5M72 A;  3SD5 A;  5ENP D;  5J08 A;  1IHG A;  1TYQ G;  4OVV A;  4GA0 A;  3UPV A;  1QQE A;  3LEW A;  4NQ0 A;  3QOU A;  4WND A;  4UI9 K;  2XPY A;  3EHR A;  2WXJ A;  4N3C A;  2AXV A;  3KS2 A;  3FDH A;  4I17 A;  2V4L A;  1BPO A;  4I2Z A;  1E8X A;  4J8Y A;  4JB8 P;  1YMP A;  4M3O A;  2XQ0 A;  4NIK A;  4OVU A;  5EX0 A;  3B7R L;  3RIB A;  4DRX E;  1N4R A;  5BNW A;  2XEH A;  2WXM A;  4A3V A;  4EZJ A;  4KYO B;  2IEJ A;  1QNF A;  5LOZ A;  1OY3 D;  1HH8 A;  5BXO A;  3UTM A;  5FZS A;  3R9A B;  4FAD A;  3C5R A;  4GTS A;  1IKN D;  2XCC A;  2WXP A;  5EN5 D;  1HF8 A;  4MLP A;  2IF4 A;  2NSZ A;  4XI9 A;  1TN7 A;  4U8Y D;  2ETA A;  4JZY A;  1N54 A;  4CGV A;  3RSE G;  2R02 A;  5AAO A;  4A63 B;  2GRL A;  1IXV A;  4DI3 A;  3AS4 A;  3SGH A;  5CER B;  4FLH A;  1V54 E;  3GZS A;  4WUY A;  2LSV A;  1SZA A;  3HVE B;  2XEE A;  4I43 A;  4C0E A;  3EJN A;  3FEY A;  2FO1 E;  4FLB A;  3IEG A;  5JJ6 A;  5H7P A;  1X5B A;  4FHJ A;  2XS8 A;  3IHY A;  2FI7 A;  4DLO A;  1BLX B;  2BKG A;  4G11 A;  5JHA A;  3J5Q B;  5CEC B;  2UY1 B;  1JPL A;  1TNO A;  1RW2 A;  4ILH B;  3CHQ A;  2KCV A;  4H7X A;  3G2V A;  3QNK A;  2H6I A;  3URZ A;  3CKC A;  3QDN A;  5HKP A;  4HRN A;  2FBN A;  4BES A;  4QQI A;  2X6I A;  3MGB A;  5KNH D;  4IRU A;  5A7D B;  3FUH A;  2CFZ A;  3TG4 A;  2KCL A;  1ELW A;  4GZ3 A;  4FC8 A;  4AEZ C;  2ZGD A;  2Y3A A;  3CK7 A;  3U64 A;  4C48 B;  5D0O D;  4BWR A;  4B0Z A;  1O1S A;  4CZ2 D;  2Y4U A;  1OXJ A;  4HOU A;  3SBT B;  1N0Q A;  1XGW A;  4XZ4 A;  1N0R A;  4G23 A;  3UMV A;  5JA4 D;  1UN9 A;  3D9J A;  3LY9 A;  4EHM A;  3KSQ A;  1SA4 A;  1SW6 A;  3EUV A;  1N52 A;  3MEK A;  5J90 A;  1AP7 A;  1TJF A;  1V55 E;  4WWN A;  1O1R A;  2GRM A;  3FFL A;  1D9S A;  2WQ7 A;  3ASO E;  2V4H C;  2X6H A;  4GYO A;  3D9L A;  4ANV A;  2E2E A;  3DEO A;  3E34 A;  2GRN B;  2AXZ A;  4U95 D;  5T8I A;  4OAV B;  4LG6 A;  2WPV A;  3QK0 A;  3F6Q A;  2BTD A;  5AAR A;  3ESK A;  1XNF A;  3DXK G;  2R03 A;  4KZ0 A;  5G05 J;  4ILI A;  2YHC A;  2MHK A;  3S7B A;  2Y1L E;  1ZBP A;  3L17 A;  3TWR A;  4LNU D;  3ZYM A;  3CVW A;  3QB2 A;  4J7W A;  1N94 A;  3X2Q E;  3Q5M A;  3RK6 A;  3UUX A;  1LF8 A;  4J8D A;  3LXU X;  3CHO A;  3ULQ A;  1WAO 1;  2ZXW E;  2ZU6 B;  3S7J A;  1G3N B;  4PS3 A;  2CHX A;  5BPP A;  4G25 A;  1FT1 A;  4CRW A;  4PUC A;  4GMR A;  1PC2 A;  2E0I A;  2WM9 A;  5EIL A;  3TWX A;  4GZ6 A;  3ZNG A;  3ONK A;  2V5F A;  2PZI A;  5EDS A;  2KM4 A;  3C72 A;  4I2W A;  3EHN A;  2FF4 A;  3BG1 B;  1KLX A;  3S2A A;  2F8X K;  2DZO A;  2R5S A;  1D8D A;  3FU3 A;  5JJT A;  3L22 A;  3ESL A;  4A1S A;  4HI8 A;  1EF1 C;  3DPY A;  3Q7A A;  4XKC A;  2VQ2 A;  3I4R B;  1LD7 A;  4HQD A;  2DVW A;  1FVH A;  3GZ2 A;  1UG3 A;  1RZ4 A;  5CMW A;  2EIN E;  5G2N A;  3I4G A;  1LTX A;  1OWL A;  4HBD A;  4KVO A;  4JHR A;  1D8E A;  3FU6 A;  3Q47 B;  3JQ0 A;  3LY7 A;  1KZP A;  2WQ6 A;  2XEV A;  3U4T A;  1TJC A;  3JXI A;  4CGW A;  3HRA A;  2XPZ A;  3CIA A;  2J4D A;  4E6H A;  2I6H A;  1K3Z D;  4ZFH A;  3PS6 A;  2VJ8 A;  3FP3 A;  1IQR A;  4LEU A;  5HRY A;  4GYW A;  1TR4 A;  2F37 A;  3ZGQ A;  3NZU A;  3CVL A;  2X6K A;  3E32 A;  3I5P A;  3VTX A;  1K1B A;  4GZ5 A;  1Y6I A;  1S70 B;  4LNG A;  3FUD A;  3DPD A;  2EIL E;  4I6G A;  2QYJ A;  3QWP A;  2ION A;  1EDU A;  4U8V D;  3JQ1 A;  4BER A;  5ANR A;  1FCH A;  2XGS A;  1H2V C;  3TWS A;  2HM8 A;  2LSU A;  2I1J A;  1X81 A;  4G24 A;  4CDM A;  3APC A;  1ELK A;  2XRZ A;  5LP0 A;  1KT0 A;  3KEA A;  2Q7F A;  5ITZ F;  2WMN A;  1E7U A;  2WXF A;  2X6J A;  4DX6 D;  2VGX A;  3HVE A;  2RKK A;  3LJ3 A;  1HZ4 A;  1N4S A;  4YVO A;  2XHE A;  1O5M A;  1MZC A;  2LAH A;  2HYZ A;  1ELR A;  3PZD A;  2WXQ A;  1JWG A;  3UXG A;  4DJA A;  2DBA A;  4HRL A;  1NI1 A;  5D0Q D;  3FTV A;  3FTY A;  3G2T A;  3ASH A;  2UY1 A;  3SNX A;  5KCM A;  4U0U A;  3DSW A;  5AQ9 A;  1U3C A;  3UT8 A;  4OYS A;  4XKB A;  5EIB E;  2OVB A;  3ZXS A;  5ENT D;  1HFA A;  3LPZ A;  5G04 J;  3U66 A;  4UWK A;  3I3N A;  1QYM A;  3FUI A;  3WG7 E;  2P9U G;  3GYZ A;  3PEU B;  3TWU A;  4HFG A;  4A1G A;  1E90 A;  5CEA A;  2HO1 A;  4ABN A;  4PS8 A;  1YYH A;  4LER A;  3FUF A;  4CDR A;  3IHV A;  4AM9 A;  3HXD A;  2XPI A;  5FQ8 A;  4J6I A;  2MOW A;  3NZS A;  3APF A;  4XIF A;  5KWD A;  3DSV A;  3G2S A;  5AN8 A;  3L54 A;  3JYS A;  2IO2 C;  3PUK A;  3IKO B;  5AJD A;  1HO8 A;  4DPR A;  2QC9 A;  2LUH A;  4GB9 A;  2Y4T A;  2OV8 A;  4L23 A;  3CVU A;  3WXX A;  4GTM A;  1WG0 A;  3LJN A;  1TNY A;  4UI9 J;  3KD7 A;  4F53 A;  2PM7 A;  1JWF A;  2I9C A;  1IHB A;  3HDX A;  4ACK A;  1KT1 A;  3ZIM A;  3TWT A;  4UWH A;  3Q4A B;  3Q73 A;  4UQX A;  3Q75 A;  1PAQ A;  2WXI A;  2XCB A;  2V0P A;  3L08 A;  5T3R A;  4JD2 G;  5LCW C;  4JEU A;  3ABK E;  2LXM A;  4L2L A;  5G55 A;  2WXN A;  3B7S A;  4JL0 A;  1E96 B;  1NFI E;  4FUL A;  3W9G A;  4DX1 A;  5ENR D;  1SA5 A;  1JUQ A;  3RKV A;  2IFU A;  3EHM A;  3BUA A;  4A55 A;  2QY7 A;  4WNF A;  4AY6 A;  2WVI A;  4R7L A;  3DBS A;  4GCN A;  4DUI A;  1WY6 A;  5BV1 A;  3EU5 A;  3BU8 A;  2L6B A;  2PM6 A;  2C0L A;  3TWQ A;  3D9O A;  2WXL A;  1H6P A;  2HE0 A;  2IU1 A;  3DSS A;  4IN3 B;  4X8Q A;  1HU3 A;  2VGX B;  3HIZ A;  3PNT B;  3CVP A;  3RRN B;  3UT4 A;  5LCW J;  1UJK A;  3G2U A;  4IYP A;  5C1D A;  4B93 B;  1TNB A;  1BI8 B;  1LD8 A;  4FP7 A;  2ZIS A;  2KBX A;  4GTV A;  5AIJ A;  3OAW A;  2OEW A;  2P9I G;  3AU4 A;  4IUL A;  4UWL A;  4HOQ A;  3PUJ A;  1S64 A;  3ZYQ A;  2VSX E;  2B6C A;  3VLD A;  3TWV A;  3DWL G;  3LKU A;  4DK5 A;  4APF A;  3L82 A;  3FTU A;  3Q49 B;  5AQ7 A;  4F7A A;  4AOF A;  4PS7 A;  1OWM A;  1U2V G;  4GTP A;  3FUM A;  3TG5 A;  2PQR A;  4KZC A;  3MYV A;  4CEM A;  4WAF A;  3BG0 B;  2WMO A;  3J5P A;  2ZIR A;  5KJK A;  4CCA A;  2QYU A;  1Z6T A;  4F1P A;  5G05 C;  5AJL A;  3QKY A;  4DX7 D;  3P1U A;  2XZT G;  5C2Y A;  5CBO A;  4BX9 A;  5CED B;  3DEP A;  4ILG A;  2L6J A;  3CVQ A;  4G8K A;  4JPS A;  2VSN A;  2PQN A;  3UIP C;  3TGO A;  2WXO A;  4XI0 A;  4XX5 A;  2P9N G;  3JXJ A;  3C3Q A;  3ASG A;  3HXF A;  4K0R A;  3TXN A;  3KAE A;  3ISM C;  4BSX A;  3SBS A;  3RO2 A;  3R9M A;  4RQI A;  1NP7 A;  4Q96 A;  3LVQ E;  1H0A A;  5KJN A;  2IOL A;  1YCS B;  3RJV A;  1E8W A;  4TXP A;  2NYJ A;  4O60 A;  3PE4 A;  3NB2 A;  5EKQ D;  3UM0 A;  4Y6W A;  3OTN A;  3RAU A;  3MX3 A;  5DIZ A;  4FJZ A;  4JA9 A;  1OCC E;  3T8K A;  2ETB A;  4Z68 A;  2GRQ B;  2GRR B;  2P9L G;  3HYM B;  4PDX A;  3ABL E;  3Q79 A;  5CRV A;  2P9P G;  2LNI A;  5AYW D;  3QWV A;  2VSY A;  2JLB A;  3ML8 A;  1W3B A;  4URK A;  1EYH A;  3LCA A;  2VTB A;  2DYS E;  3PZ4 A;  3B7T A;  3PZ3 A;  3PDN A; 
#chains in the Genus database with same CATH homology
 5CED B;  2DZO A;  3V31 A;  3DEP A;  3B95 A;  5ENP D;  4GPM A;  3TWQ A;  3NBN B;  2F8Y A;  2QC9 A;  3B7B A;  3KEA A;  4G8K A;  2A5E A;  3F6Q A;  5ITZ F;  3W9F A;  2HE0 A;  2JAB A;  2VGE A;  5FIN A;  1BLX B;  4DX2 A;  4ZHB A;  2BKG A;  3EU9 A;  4RLY A;  5AAR A;  4DX6 D;  4HI8 A;  3HG0 D;  3V2X A;  5FIO A;  3J5Q B;  1WDY A;  5CEC B;  5ENS D;  3EHR A;  2B0O E;  1MJ0 A;  4BET A;  3JXJ A;  5EYL A;  1WG0 A;  4O1O A;  1A5E A;  4HQD A;  3LJN A;  2DVW A;  5JMN D;  5D66 A;  2DWZ A;  4HRM B;  3ZU7 B;  5HKP A;  4B93 B;  4HRN A;  1BI8 B;  3UXG A;  4BSZ B;  4J8Y A;  5AQA A;  4TUM A;  4JB8 P;  1YMP A;  1MX4 A;  2AJA A;  2KBX A;  4HNA D;  4BES A;  1IHB A;  2Y1L E;  4QQI A;  5KNG A;  4YDY A;  4HRL A;  2KXP C;  5KNH D;  4LNU D;  3TWR A;  4NIK A;  4N5Q A;  4J7W A;  1YCS B;  4DRX E;  2ZGG A;  3TWT A;  4HBD A;  2NYJ A;  4O60 A;  2XEH A;  4F6R D;  1DC2 A;  3D9H A;  5AQ9 A;  2ZGD A;  4CYM D;  5EID A;  1OT8 A;  5KBA A;  1BD8 A;  1N11 A;  1OY3 D;  3AAA C;  3SO8 A;  1BI7 B;  5AQB A;  4C48 B;  4U96 D;  4K5C A;  5EIB E;  4ATZ D;  5BXO A;  1MX2 A;  3UTM A;  3JXI A;  3TWV A;  3NOG D;  3HRA A;  1SVX A;  4HLL A;  4CZ2 D;  3C5R A;  3T8K A;  2XZD G;  4BEP A;  5ENT D;  3IXE A;  1G3N B;  1IKN D;  5EN5 D;  5HS0 A;  2ETB A;  5AQ7 A;  1N0Q A;  4Z68 A;  1K3Z D;  4ZFH A;  1N0R A;  5JA4 D;  5HRY A;  2DZN A;  4GMR A;  2ETA A;  4QFV A;  4U8Y D;  5BXU A;  1K1A A;  1QYM A;  4O1P A;  4K5B A;  4LSZ E;  1TR4 A;  2F37 A;  1DCQ A;  2V5Q C;  5EIL A;  3ZUV B;  5AAO A;  5ENO D;  3TWX A;  1NFI E;  3Q9U C;  2Y0B G;  1UOH A;  1SW6 A;  2PNN A;  3W9G A;  4DX1 A;  5ENR D;  3TWU A;  5ENQ D;  4A63 B;  1AP7 A;  1K1B A;  3V30 A;  1IXV A;  4OAV B;  3T9K A;  1S70 B;  2XEN A;  3ZNG A;  3EHQ A;  3Q9N C;  2RFA A;  3TWW A;  4DX5 D;  5CEA A;  1MX6 A;  5CER B;  2J8S D;  5CBN A;  3V2O A;  3J5P A;  1D9S A;  2QYJ A;  2ETC A;  1YYH A;  2RFM A;  3JUE A;  3NOC D;  4HI9 A;  2V4H C;  3UI2 A;  4F1P A;  1AWC B;  4U8V D;  1MYO A;  2XEE A;  4BER A;  5EYP F;  2L6B A;  4G8L A;  4YDW A;  3DEO A;  3V79 K;  4DX7 D;  2MYO A;  3AJI A;  3TWS A;  4DUI A;  5KWD A;  2FO1 E;  2XZT G;  5AN8 A;  3ZKJ A;  5CBO A;  2P2C P;  4K5A B;  4U95 D;  4HB5 A;  4UUC A;  2F8X K;  4OAU C;  4LG6 A;  2BKK B;  1BU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...