1FT1A

Crystal structure of protein farnesyltransferase at 2.25 angstroms resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FARNESYLTRANSFERASE
publication title Crystal structure of protein farnesyltransferase at 2.25 angstrom resolution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1997-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ft1A00
1QBQA 1TNUA 3Q78A 4YDEA 3DSTA 2BEDA 3PZ2A 3HXCA 3DRAA 1JCRA 1MZCA 3Q7AA 1D8EA 1D8DA 4GTOA 1TNBA 4GTVA 4MBGA 2H6HA 3Q75A 3HXFA 2F0YA 1JCQA 1N9AA 1N4RA 1TNOA 1FT2A 1TN8A 3E33A 3E30A 4LNGA 1O1SA 3KSLA 1NI1A 1TNZA 3DSUA 3SFXA 3C72A 1O1TA 2ZISA 4GTMA 1N4PA 3Q79A 4GTTA 3Q73A 3EUVA 3PZ1A 1SA5A 3PZ3A 3HXDA 3HXBA 1TNYA 4YDOA 1TN6A 1FPPA 1N94A 1LTXA 3PZ4A 4L9PA 1O5MA 4GTSA 3DSXA 4LNBA 3HXEA 1LD8A 1X81A 2H6FA 3E37A 3DPYA 1DCEA 4GTQA 2H6IA 3SFYA 1FT1A 3E32A 1S64A 4EHMA 3DSWA 3DSSA 3Q7FA 1N4QA 4GTPA 1SA4A 3EU5A 1O1RA 2H6GA 3E34A 1KZOA 1N4SA 1NL4A 1JCSA 2ZIRA 3KSQA 2IEJA 1TN7A 2R2LA 1KZPA 1LD7A 4GTRA 1N95A 1S63A 3DSVA
chains in the Genus database with same CATH superfamily
4MRUA 3UTMA 4G8LA 2P9UG 1HU3A 3LVRE 3TG5A 4KMOA 2XEEA 3CIAA 2ETAA 2BEDA 3DEOA 1OWOA 1JCRA 4CCAA 3OXFA 3QC1A 4AIFA 4GAAA 4HQDA 3IV0A 4TUMA 4CT4A 2P58C 2P9IG 2H6HA 3MGBA 2XPZA 2EQXA 4APFA 5ENRD 1JPLA 4KVMA 4JEUA 4AJWA 4ILHB 3AJIA 5DIZA 2X3MA 1H19A 3CQCB 1EDUA 2HM8A 3S7FA 4U04A 3SFXA 4Q69A 2YHEA 5ENPD 3T8MA 5EIBE 2WMNA 2C2LA 4ME2A 4U07A 3JXJA 3FU6A 4U0ZA 3U64A 2M63A 4JZYA 4I6GA 3ZPJA 2J9QA 4URKA 3ZN3A 2P9KG 2XHEA 4OAVB 4DJAA 5KJMA 3I5PA 5J90A 2NXPA 1HF8A 1QZ2A 5EYPF 1OT8A 4LRZA 2Y4UA 4LSZE 2VSXE 5D2MC 3R7RA 2A5UA 5KWDA 1S64A 1SQMA 1BI7B 5AQ7A 3FH7A 4XX5A 1W3BA 2L0TB 3FUKA 2CG2A 2VSNA 3KSQA 3L9TA 2IEJA 1MYOA 4WWNA 2ETCA 3AU5A 4N5QA 2WXPA 4EPZA 2WQ7A 1TYQG 1EPUA 2NC9A 5JMND 3J5PA 1ELWA 3OAWA 4GA1A 1OWNA 3AG2E 4GA2A 2V8SE 4B8CB 2AJAA 3SFZA 1HXIA 4BTBA 3ENEA 4J0UA 2EIJE 4DPRA 1MJ0A 4N5CA 3ASHA 4FP7A 2B6CA 3HDXA 3LS8A 4KXKB 3Q15A 1DCQA 4RSYA 4UWFA 3HHMA 4DX6D 1BD8A 3MCXA 4JB8P 2GW1A 2GGFA 3ASNE 1QNFA 2X6KA 3CKBA 3CHRA 4ILGA 3RRNB 1SZAA 3IKOB 5CEAA 5A23A 3PNTB 4NQ0A 3LYAA 2FO1E 5FT9A 2R59A 4FHKA 1HE8A 2WXQA 5ITZF 3BUAA 1FT1A 5CBNA 4KT6B 4ACLA 3FTXA 4Z68A 2H6GA 3L22A 2I1JA 2IO2C 1NL4A 5BUZA 5M72A 1OCCE 3GZSA 5AQ9A 3T5XA 4HVBA 2BKGA 1KT0A 2WXGA 3PEVB 3LPZA 2F0YA 3HRAA 5JA4D 4JHJA 2ILRA 3BG1B 2OEWA 2AXUA 1JWFA 1ZU2A 4FJYA 3SI5A 3PE3A 1IXVA 2WXRA 4GMRA 5AQAA 1EF1C 3PUKA 2IF4A 3Q73A 3ESKA 5ENNA 4RG9A 2LXLA 4GB9A 3VLDA 3FDHA 3I4GA 1XGWA 3CVUA 4GTSA 3F6QA 2GRMA 3SHFA 3CVXA 2KCKA 3LVQE 4LNBA 4JW1A 4YDYA 3CGHA 3EDTB 3TWRA 3RO2A 3L08A 3QK0A 3UM2A 4XI9A 4U8VD 4XEIG 4KVOA 3AAAC 3CHMA 4AP2A 4EHMA 1OWLA 3JQ0A 2Y69E 4N39A 4XI0A 2GRQB 4RLYA 5B1AE 4I6JA 4GTRA 3FTWA 3C3OA 3FFLA 1EYHA 1K1AA 3CK7A 5E75A 3ZXSA 2WVIA 5ENOD 5BV1A 4PS7A 4ATGA 4EQFA 2WXLA 2ZGDA 5KBAA 3QB2A 3MA5A 3AG4E 4U7EB 2ETBA 1K1BA 4I1OB 1N9AA 2UY1A 5LOZA 2AWIA 3TG4A 4I2ZA 4IN3B 3FUFA 5EKQD 1E96B 3KS2A 2OVFA 3MKQB 4AEZC 1NP7A 5AIJA 3ULQA 4BTAA 2I6HA 4OYSA 2IOSA 5T8IA 4LERA 1HG5A 2XS1A 3G2WA 2OVBA 3T5VA 3NQPA 4J8YA 1N94A 3LXUX 3NAWA 3UIOC 2V5QC 4GMJA 5AJLA 3ZHEA 1AP7A 3SZ7A 5BW8C 3UQ3A 3ZIMA 3IHYA 4KZ0A 2WXOA 3S7JA 5ENSD 1H2VC 4DUIA 2QYUA 1G3NB 4LNUD 4PH4B 4XKBA 1HH8A 2GRLA 5ANLA 2UY1B 4NURA 1SA4A 2RD0A 4JA7A 4KYOB 3CVVA 5ENTD 1HG2A 2CHZA 4A3VA 4O60A 3CVYA 3RRMB 2J8SD 2A5EA 3D9JA 1WAO1 3ZYLA 2ZU6B 3AG1E 2BF0X 2XENA 1N52A 3L82A 1MZCA 1A17A 3TWUA 3TXNA 3BG0B 1N0QA 1YYHA 2VGEA 3B7UX 3KEAA 4F1SA 4H7YA 4CZ2D 3CVPA 4GCOA 3HYMB 2I2OA 2Q7FA 1E90A 4FHJA 4UQZA 3V31A 2WM9A 2XPIA 2AVPA 1RW2A 2BUGA 1HZ4A 3AG3E 3WG7E 5CERB 4LG6A 3KSLA 1NI1A 4PS8A 1U2VG 2X6IA 4MS6A 1N4PA 4GTTA 2P9PG 2KBXA 2VGXA 3EUVA 4GPMA 2XCBA 4KZCA 5EX3A 2IU1A 5HI7A 1H2TC 3ZYMA 3PZ4A 3U3WA 1JUQA 1E8WA 4I2WA 5DBKA 3TWTA 4EECA 4HB5A 1BPOA 1X81A 5D66A 3CR3A 1HS6A 4U0UA 3UM3A 5E76A 3APCA 1UW4B 4FLHA 4F7AA 4LCTA 1E8XA 4IYPA 1PC2A 4YNDA 3UKRG 1O1RA 3B13A 3CVWA 2Y4TA 4HXIA 3TXMA 5AENA 3HG0D 4UI9K 2JEKA 2YINA 4I43A 3NF1A 1YMPA 2KC7A 5LX8A 4PS3A 1IHBA 3ULYA 4UWKA 2P9LG 3HVEB 3UT7A 2VTBB 1E8YA 3NB2A 1JCQA 3C5RA 2CHXA 3CKCA 3PDNA 3GW4A 2R02A 3O4ZA 4HNAD 4A1GA 4HS2A 3FY4A 4ABNA 4B89A 3TL5A 4YVOA 2FBNA 3Q79A 3PZ1A 1SA5A 3B95A 4G24A 4XZ4A 3QAQA 3O48A 4HOSA 3EHNA 4CT0A 3VTYA 4AY6A 3DSXA 5EILA 4LEUA 4Y6WA 4B8AA 1H6KA 3FEXA 5T3RA 4BX8A 2MYOA 1Z3XA 3UX4A 4DLQA 3TWXA 3KAEA 3ULEG 4C9BB 3TWQA 3L16A 3SFYA 4F53A 2FEZA 4QFVA 4Q94A 3ZW3A 3Q7FA 1N4QA 1OY3D 4K03A 3CSFA 3R7QA 2V4LA 4CRWA 2XGOA 4G11A 5KNHD 1OWPA 4CGWA 2VSYA 1LD7A 3MJWA 4EZLA 3C3QA 3ZYQA 1H0AA 4ZFHA 5FIOA 5BV0A 2LSVA 3EHQA 4HRMB 2EINE 2J4BA 3L54A 3RJVA 3RO3A 3D3MA 4HOQA 2HO1A 4GYOA 3U4TA 3RK6A 4JHRA 5FQ8A 4F6RD 1TN8A 2L6BA 1MQSA 4TUUA 3FUEA 4FADA 4FA6A 3PNLB 3ASOE 5D0OD 2KZTB 3SD5A 1BI8B 4HLEA 4ANUA 5FQ4A 3PZ3A 3UINC 3RSEG 3FUMA 1FPPA 1Y6IA 3PS6A 2X6JA 3WXXA 4GZ5A 3EJNA 4A55A 5A6CA 3ASFA 1O5MA 1IKND 5ARGA 3I3NA 2VQ2A 3FH5A 4EBAA 3LY8A 4BSXA 1K3ZD 2OOEA 2IONA 4GYWA 3E32A 2HYZA 4UWGA 3TJPA 3EU5A 4G1TA 1KZOA 4BX9A 2EIME 2LAIA 2FI7A 2ONDA 3Q78A 3NZSA 1FVFA 1PAQA 3FH8A 4AM9A 3ZRHA 2KM4A 2PM7A 1H6OA 5EDSA 1IYGA 3SQVA 3JCKC 4GYYA 1KLXA 3CK9A 2AXVA 3T8KA 3D9PA 1MX4A 5EYLA 3GYZA 1O1SA 3BU8A 1TNZA 3LEWA 3FTYA 5JJTA 3TWVA 1UJJA 4JEHA 2WXNA 3HXBA 2WXJA 4YDOA 3QKYA 3FULA 1NA0A 4ZHBA 5AN8A 2P9SG 4N3BA 5FZRA 3B7TA 4WNDA 2DZOA 4J8FA 2DZNA 3TAXA 3UUXA 2J4DA 5BNWA 4L7TA 4UWLA 4BT9A 5AAOA 1DCEA 2IOLA 2DVWA 3C3RA 5C1DA 1L5JA 2EIKE 4F3VA 4HBDA 2HR2A 2LSUA 4JL0A 3NOGD 3CHPA 4JVSA 1Z6TA 3FHEA 5FQ6A 2VJ8A 1OCZE 2R05A 4H7XA 2GRNB 2IY0C 2DBAA 3MKQA 4BERA 2XRYA 4AXHA 5KJLA 3IEGA 4MBGA 3NBNB 1Z5SC 4K5BA 2QFCA 5C2YA 2KCVA 4I1MA 4G8KA 3CSTA 2J49A 1N4RA 3VLEA 3DBSA 2PQNA 1A5EA 4WNEA 3CQGB 4LNGA 4GZDA 3NOCD 2GRRB 4L23A 1O1TA 4GTMA 5ANRA 5CBOA 2LAHA 3TWWA 4ACKA 2WMOA 2F37A 1NFIE 4L1BA 1LTXA 5FINA 2P9NG 2WQHA 4L9PA 2DYSE 5ARFA 2KXPC 3S7BA 4J8SA 2XS8A 2L9BA 2A4ZA 1S0PA 4PDXA 4D10C 1YA0A 3R9AB 3DWLG 5CMYA 4F1PA 3DPYA 4BSZB 1E8ZA 3FUDA 5KCMA 1QYMA 5HRYA 1BLXB 2AXZA 4K0RA 4DX1A 3PREA 4E85A 1XNFA 4NACA 1TR4A 3V2XA 3V79K 3IHVA 2ZGGA 3LY9A 2PM6A 2WXHA 4FJZA 3PZ2A 4DX5D 2GROB 1WDYA 4Q96A 2WQ6A 1D8DA 5LP0A 4GTOA 3ZNGA 3ABME 3QARA 3QWWA 2V5FA 3D9HA 5JHBA 1TJFA 2J08A 2JABA 3X2QE 5CECB 2HE0A 3CVQA 2RFAA 5CEDB 3IXEA 3EHRA 5FJYA 2FULA 1N0RA 3FUJA 3PVLA 5KJNA 4R7LA 1VDYA 4B93B 2PL2A 2OCCE 1V54E 3D9OA 3MV3B 3EIQC 4BETA 1DC2A 2V4HC 3RU0A 4O1PA 1INZA 1ELKA 4HLLA 4ILIA 4AVXA 4HRNA 3RAUA 3V30A 4BFRA 3LKUA 1K8KG 3CVLA 2JLBA 4E6HA 4WNGA 4C48B 1WY6A 3ZXPA 2Y3AA 3HVEA 3APFA 3GZ2A 2VTBA 5AARA 3ZUVB 3QDNA 5BPPA 3QNKA 3D9LA 2XZTG 5G05J 4P29A 4JHKA 1SZ9A 4ATZD 1DVPA 4YVQC 3UXGA 3L6AA 3QWVA 5LCWJ 2X38A 3SGHA 5B3SE 3FUIA 3LJ3A 2R17C 2QY7A 1Y8MA 3W9FA 1FT2A 3E33A 4UI9C 5AYWD 2LUHA 3KD7A 3CHQA 2C0MA 3FP3A 4GCNA 4I17A 3UT4A 4UQYA 2XGMA 4A3TA 3ZFWA 4ANWA 5T4YA 3Q9UC 3L17A 1WG0A 3JUEA 2OV8A 1TNYA 3ONKA 3FUNA 3PEUB 3G2TA 3FTZA 2F8XK 4C0MA 3MZLB 4JPSA 1OWMA 5G05C 5AJDA 2LNIA 3N71A 2WXIA 2I9CA 4FLBA 2NYJA 4OVVA 2V0PA 3FWVA 3G2UA 4HFGA 5LCWC 5KJKA 4HOTA 3B7SA 2H6IA 4LUNU 4W9RA 4RVBA 2X6FA 2RFMA 3L13A 3V2OA 1ZBPA 1S70B 4V3IA 3DSWA 3J5QB 3E34A 1N4SA 3Q49B 1RZ4A 1U3CA 4CGVA 4OAUC 1WM5A 3VLFA 4CYMD 2XEVA 5JJ6A 4BY6A 1TNUA 3CLJA 5FQ7A 3D9NA 4QQIA 4KBQA 1H6PA 3RRUA 3HXCA 3DRAA 1X5BA 3E4BA 3JUIA 2KZTA 2C0LA 4O1OA 4TV3A 1D8EA 1N54A 4NRHB 5FZQA 3EU9A 4UUCA 4EZJA 4G26A 2WB2A 2UWJG 3K9IA 4JA9A 3CHSA 2B0OE 2QC9A 4UQXA 3S2AA 1OCRE 3FTUA 4EZKA 1P5QA 3QJZA 3QWPA 2RG8A 1NA3A 5H7PA 3CHOA 3PZDA 5HS0A 4DI3A 4N2SA 3D9IA 4M7CA 1FVHA 1H2UA 4OVUA 3ZU7B 3AS4A 3LCAA 1Q2ZA 4J8DA 2VYIA 2Y0BG 4L2LA 3CK8A 2QZAA 3UM1A 4N3AA 1E7VA 4ANVA 4CDRA 3HXEA 3NZUA 3SBSA 3MV2B 3UT8A 4N3CA 3CV0A 4DX7D 1TEZA 3SO8A 2J07A 2XCCA 1TJCA 3BQOA 3ZGQA 3LY7A 3G2VA 1MX6A 4G23A 3Q47B 2KATA 4X8QA 4J8EA 3S7DA 1KT1A 5JJ7A 1UOHA 4GTPA 4U95D 2PZIA 3AU4A 3OXLA 4YDWA 2BTDA 1JCSA 3U9WA 3APDA 3ABKE 2NSZA 2DWZA 3FUHA 4NIKA 3SNXA 5CRUA 1E7UA 3C98A 2FF4A 2WXFA 3DPDA 3T9KA 2VGYA 1MHQA 2MHKA 4BT8A 4GTVA 2XPYA 4WUYA 3AS5A 3JXIA 4FC8A 4PUCA 3I4RB 3P1UA 4GPKA 3ISMC 4MLPA 3ZYKA 3MEKA 2Y1LE 3PH0C 5ENQD 3C72A 2ZISA 3R9MA 2P2CP 4U8YD 4J7WA 4CDMA 5CCMA 3PUJA 1HX8A 3PE4A 3UKUG 4DK5A 4HI9A 4AV7A 3B7BA 4RG6A 5G2NA 2L0IA 2IQCA 3GZ1A 5AQBA 3EHMA 4HRLA 4HORA 1HFAA 3RIBA 3UMVA 1MX2A 4U0SA 1HO8A 1Z3YA 2YHCA 4GZ6A 5EIDA 4N2QA 3W9GA 2L6JA 1YCSB 4FULA 3ASGA 2IFUA 1UN9A 2GRPB 3LDZA 5G55A 1QBQA 4I1AA 3DSTA 3CEQA 4XIFA 2E0IA 3JQ1A 3ESLA 1D9SA 3ZVVA 2PQRA 5LFAA 1OUVA 3URZA 3FTVA 3HXFA 4GU5A 2RKKA 3E30A 3BEEA 3ML8A 1JWGA 4GZ3A 5CMWA 1IHGA 3B7RL 4CDNA 1ELRA 4XE0A 3HXDA 4B0ZA 3TGOA 1N11A 5EN5D 3KEZA 3ASDA 3IBEA 1B89A 1QQEA 3ABLE 3FU0A 4WNFA 2XRZA 4DI4A 2QYJA 4I9CA 1V55E 1ZB1A 3PRZA 4BESA 3G2SA 5IY5E 4HOUA 2CG3A 1LF8A 4MKTA 4GTQA 2XZDG 1AWCB 3FU3A 3SF4A 4U96D 2ZIRA 3FU5A 1TN7A 2R2LA 1UG3A 1KZPA 4U8HA 1N95A 4BEPA 4DRXE 2LO6A 1UJKA 1GW6A 2YNQA 2DCPA 3ML9A 3ONLA 3P2BA 3Q4AB 4APOA 4IRUA 1DNPA 4JXTA 1IQUA 4TRQA 1BU9A 2KCLA 4FU3A 1TNBA 3MKRA 3Q5MA 5FZSA 2WXMA 4K5AB 5JHAA 1U3DA 4JC8A 2IJGX 2OEVA 2F8YA 5HKPA 3CVNA 2WPVA 2VSOE 3QOUA 2AW6A 3FTSA 3MYVA 3DXMG 2X6HA 2CFZA 4A1SA 3OTNA 3UM0A 3D9MA 5BXUA 4A63B 4AY5A 4WWOA 3Q9NC 4K5CA 4Y6CA 4TXQA 1LD8A 5J08A 3AS8A 4UWHA 5D0QD 2MOWA 1OXJA 2XQ0A 3TWSA 5BT1A 3E37A 1SVXA 4M3OA 2CHWA 5HQ8A 5CHEE 4XKCA 3ZHEB 2WXKA 2YQ8A 4IULA 4WAFA 1UN8A 3VTXA 4G25A 5A7DB 4CEMA 4AOFA 3OXGA 2LXMA 2EILE 1S63A 4UI9J 4WWPA 3LJNA 2E2EA 4YDEA 5B1BE 3UIPC 5G04J 2CFUA 3UI2A 2FO7A 3Q7AA 2BKKB 1SW6A 3JYSA 4TXPA 3ZEFA 4BWRA 4DX2A 4J6IA 3Q75A 3DEPA 3D9KA 1TNOA 3DXKG 2DIWA 1KPSB 5FWQA 3UPVA 4L2YA 3DSUA 4RQIA 4JD2G 2ZXWE 4O6FA 4G2VA 5BXOA 4GMLA 2I1KA 3EIJA 3FEYA 3SY2A 5KNGA 4TXRA 1OCOE 1TN6A 4C0EA 4U63A 4I9EA 1FCHA 4GA0A 4HI8A 3HIZA 3ZKJA 5G04C 4DLOA 2XEHA 5CRVA 1NZNA 4ANXA 2R03A 2DYRE 2PNNA 2VGXB 2H6FA 5CCLA 2J09A 5EX0A 5FTPA 2R5SA 2XGSA 4EBAG 4GZCA 3MX3A 2MRIA 3DSSA 3SBTB 3RKVA 3U66A 1IQRA 4I6EA 4B94A 2IO3C 1PY1A 3DSVA
chains in the Genus database with same CATH topology
1QBQA 1TNUA 3Q78A 4YDEA 3DSTA 2BEDA 3PZ2A 3HXCA 3DRAA 1JCRA 1MZCA 3Q7AA 1D8EA 1D8DA 4GTOA 1TNBA 4GTVA 4MBGA 2H6HA 3Q75A 3HXFA 2F0YA 1JCQA 1N9AA 1N4RA 1TNOA 1FT2A 1TN8A 3E33A 3E30A 4LNGA 1O1SA 3KSLA 1NI1A 1TNZA 3DSUA 3SFXA 3C72A 1O1TA 2ZISA 4GTMA 1N4PA 3Q79A 4GTTA 3Q73A 3EUVA 3PZ1A 1SA5A 3PZ3A 3HXDA 3HXBA 1TNYA 4YDOA 1TN6A 1FPPA 1N94A 1LTXA 3PZ4A 4L9PA 1O5MA 4GTSA 3DSXA 4LNBA 3HXEA 1LD8A 1X81A 2H6FA 3E37A 3DPYA 1DCEA 4GTQA 2H6IA 3SFYA 1FT1A 3E32A 1S64A 4EHMA 3DSWA 3DSSA 3Q7FA 1N4QA 4GTPA 1SA4A 3EU5A 1O1RA 2H6GA 3E34A 1KZOA 1N4SA 1NL4A 1JCSA 2ZIRA 3KSQA 2IEJA 1TN7A 2R2LA 1KZPA 1LD7A 4GTRA 1N95A 1S63A 3DSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QBQ A;  1TNU A;  3Q78 A;  4YDE A;  3DST A;  2BED A;  3PZ2 A;  3HXC A;  3DRA A;  1JCR A;  1MZC A;  3Q7A A;  1D8E A;  1D8D A;  4GTO A;  1TNB A;  4GTV A;  4MBG A;  2H6H A;  3Q75 A;  3HXF A;  2F0Y A;  1JCQ A;  1N9A A;  1N4R A;  1TNO A;  1FT2 A;  1TN8 A;  3E33 A;  3E30 A;  4LNG A;  1O1S A;  3KSL A;  1NI1 A;  1TNZ A;  3DSU A;  3SFX A;  3C72 A;  1O1T A;  2ZIS A;  4GTM A;  1N4P A;  3Q79 A;  4GTT A;  3Q73 A;  3EUV A;  3PZ1 A;  1SA5 A;  3PZ3 A;  3HXD A;  3HXB A;  1TNY A;  4YDO A;  1TN6 A;  1FPP A;  1N94 A;  1LTX A;  3PZ4 A;  4L9P A;  1O5M A;  4GTS A;  3DSX A;  4LNB A;  3HXE A;  1LD8 A;  1X81 A;  2H6F A;  3E37 A;  3DPY A;  1DCE A;  4GTQ A;  2H6I A;  3SFY A;  1FT1 A;  3E32 A;  1S64 A;  4EHM A;  3DSW A;  3DSS A;  3Q7F A;  1N4Q A;  4GTP A;  1SA4 A;  3EU5 A;  1O1R A;  2H6G A;  3E34 A;  1KZO A;  1N4S A;  1NL4 A;  1JCS A;  2ZIR A;  3KSQ A;  2IEJ A;  1TN7 A;  2R2L A;  1KZP A;  1LD7 A;  4GTR A;  1N95 A;  1S63 A;  3DSV A; 
#chains in the Genus database with same CATH topology
 4MRU A;  3UTM A;  4G8L A;  2P9U G;  1HU3 A;  3LVR E;  3TG5 A;  4KMO A;  2XEE A;  3CIA A;  2ETA A;  2BED A;  3DEO A;  1OWO A;  1JCR A;  4CCA A;  3OXF A;  3QC1 A;  4AIF A;  4GAA A;  4HQD A;  3IV0 A;  4TUM A;  4CT4 A;  2P58 C;  2P9I G;  2H6H A;  3MGB A;  2XPZ A;  2EQX A;  4APF A;  5ENR D;  1JPL A;  4KVM A;  4JEU A;  4AJW A;  4ILH B;  3AJI A;  5DIZ A;  2X3M A;  1H19 A;  3CQC B;  1EDU A;  2HM8 A;  3S7F A;  4U04 A;  3SFX A;  4Q69 A;  2YHE A;  5ENP D;  3T8M A;  5EIB E;  2WMN A;  2C2L A;  4ME2 A;  4U07 A;  3JXJ A;  3FU6 A;  4U0Z A;  3U64 A;  2M63 A;  4JZY A;  4I6G A;  3ZPJ A;  2J9Q A;  4URK A;  3ZN3 A;  2P9K G;  2XHE A;  4OAV B;  4DJA A;  5KJM A;  3I5P A;  5J90 A;  2NXP A;  1HF8 A;  1QZ2 A;  5EYP F;  1OT8 A;  4LRZ A;  2Y4U A;  4LSZ E;  2VSX E;  5D2M C;  3R7R A;  2A5U A;  5KWD A;  1S64 A;  1SQM A;  1BI7 B;  5AQ7 A;  3FH7 A;  4XX5 A;  1W3B A;  2L0T B;  3FUK A;  2CG2 A;  2VSN A;  3KSQ A;  3L9T A;  2IEJ A;  1MYO A;  4WWN A;  2ETC A;  3AU5 A;  4N5Q A;  2WXP A;  4EPZ A;  2WQ7 A;  1TYQ G;  1EPU A;  2NC9 A;  5JMN D;  3J5P A;  1ELW A;  3OAW A;  4GA1 A;  1OWN A;  3AG2 E;  4GA2 A;  2V8S E;  4B8C B;  2AJA A;  3SFZ A;  1HXI A;  4BTB A;  3ENE A;  4J0U A;  2EIJ E;  4DPR A;  1MJ0 A;  4N5C A;  3ASH A;  4FP7 A;  2B6C A;  3HDX A;  3LS8 A;  4KXK B;  3Q15 A;  1DCQ A;  4RSY A;  4UWF A;  3HHM A;  4DX6 D;  1BD8 A;  3MCX A;  4JB8 P;  2GW1 A;  2GGF A;  3ASN E;  1QNF A;  2X6K A;  3CKB A;  3CHR A;  4ILG A;  3RRN B;  1SZA A;  3IKO B;  5CEA A;  5A23 A;  3PNT B;  4NQ0 A;  3LYA A;  2FO1 E;  5FT9 A;  2R59 A;  4FHK A;  1HE8 A;  2WXQ A;  5ITZ F;  3BUA A;  1FT1 A;  5CBN A;  4KT6 B;  4ACL A;  3FTX A;  4Z68 A;  2H6G A;  3L22 A;  2I1J A;  2IO2 C;  1NL4 A;  5BUZ A;  5M72 A;  1OCC E;  3GZS A;  5AQ9 A;  3T5X A;  4HVB A;  2BKG A;  1KT0 A;  2WXG A;  3PEV B;  3LPZ A;  2F0Y A;  3HRA A;  5JA4 D;  4JHJ A;  2ILR A;  3BG1 B;  2OEW A;  2AXU A;  1JWF A;  1ZU2 A;  4FJY A;  3SI5 A;  3PE3 A;  1IXV A;  2WXR A;  4GMR A;  5AQA A;  1EF1 C;  3PUK A;  2IF4 A;  3Q73 A;  3ESK A;  5ENN A;  4RG9 A;  2LXL A;  4GB9 A;  3VLD A;  3FDH A;  3I4G A;  1XGW A;  3CVU A;  4GTS A;  3F6Q A;  2GRM A;  3SHF A;  3CVX A;  2KCK A;  3LVQ E;  4LNB A;  4JW1 A;  4YDY A;  3CGH A;  3EDT B;  3TWR A;  3RO2 A;  3L08 A;  3QK0 A;  3UM2 A;  4XI9 A;  4U8V D;  4XEI G;  4KVO A;  3AAA C;  3CHM A;  4AP2 A;  4EHM A;  1OWL A;  3JQ0 A;  2Y69 E;  4N39 A;  4XI0 A;  2GRQ B;  4RLY A;  5B1A E;  4I6J A;  4GTR A;  3FTW A;  3C3O A;  3FFL A;  1EYH A;  1K1A A;  3CK7 A;  5E75 A;  3ZXS A;  2WVI A;  5ENO D;  5BV1 A;  4PS7 A;  4ATG A;  4EQF A;  2WXL A;  2ZGD A;  5KBA A;  3QB2 A;  3MA5 A;  3AG4 E;  4U7E B;  2ETB A;  1K1B A;  4I1O B;  1N9A A;  2UY1 A;  5LOZ A;  2AWI A;  3TG4 A;  4I2Z A;  4IN3 B;  3FUF A;  5EKQ D;  1E96 B;  3KS2 A;  2OVF A;  3MKQ B;  4AEZ C;  1NP7 A;  5AIJ A;  3ULQ A;  4BTA A;  2I6H A;  4OYS A;  2IOS A;  5T8I A;  4LER A;  1HG5 A;  2XS1 A;  3G2W A;  2OVB A;  3T5V A;  3NQP A;  4J8Y A;  1N94 A;  3LXU X;  3NAW A;  3UIO C;  2V5Q C;  4GMJ A;  5AJL A;  3ZHE A;  1AP7 A;  3SZ7 A;  5BW8 C;  3UQ3 A;  3ZIM A;  3IHY A;  4KZ0 A;  2WXO A;  3S7J A;  5ENS D;  1H2V C;  4DUI A;  2QYU A;  1G3N B;  4LNU D;  4PH4 B;  4XKB A;  1HH8 A;  2GRL A;  5ANL A;  2UY1 B;  4NUR A;  1SA4 A;  2RD0 A;  4JA7 A;  4KYO B;  3CVV A;  5ENT D;  1HG2 A;  2CHZ A;  4A3V A;  4O60 A;  3CVY A;  3RRM B;  2J8S D;  2A5E A;  3D9J A;  1WAO 1;  3ZYL A;  2ZU6 B;  3AG1 E;  2BF0 X;  2XEN A;  1N52 A;  3L82 A;  1MZC A;  1A17 A;  3TWU A;  3TXN A;  3BG0 B;  1N0Q A;  1YYH A;  2VGE A;  3B7U X;  3KEA A;  4F1S A;  4H7Y A;  4CZ2 D;  3CVP A;  4GCO A;  3HYM B;  2I2O A;  2Q7F A;  1E90 A;  4FHJ A;  4UQZ A;  3V31 A;  2WM9 A;  2XPI A;  2AVP A;  1RW2 A;  2BUG A;  1HZ4 A;  3AG3 E;  3WG7 E;  5CER B;  4LG6 A;  3KSL A;  1NI1 A;  4PS8 A;  1U2V G;  2X6I A;  4MS6 A;  1N4P A;  4GTT A;  2P9P G;  2KBX A;  2VGX A;  3EUV A;  4GPM A;  2XCB A;  4KZC A;  5EX3 A;  2IU1 A;  5HI7 A;  1H2T C;  3ZYM A;  3PZ4 A;  3U3W A;  1JUQ A;  1E8W A;  4I2W A;  5DBK A;  3TWT A;  4EEC A;  4HB5 A;  1BPO A;  1X81 A;  5D66 A;  3CR3 A;  1HS6 A;  4U0U A;  3UM3 A;  5E76 A;  3APC A;  1UW4 B;  4FLH A;  4F7A A;  4LCT A;  1E8X A;  4IYP A;  1PC2 A;  4YND A;  3UKR G;  1O1R A;  3B13 A;  3CVW A;  2Y4T A;  4HXI A;  3TXM A;  5AEN A;  3HG0 D;  4UI9 K;  2JEK A;  2YIN A;  4I43 A;  3NF1 A;  1YMP A;  2KC7 A;  5LX8 A;  4PS3 A;  1IHB A;  3ULY A;  4UWK A;  2P9L G;  3HVE B;  3UT7 A;  2VTB B;  1E8Y A;  3NB2 A;  1JCQ A;  3C5R A;  2CHX A;  3CKC A;  3PDN A;  3GW4 A;  2R02 A;  3O4Z A;  4HNA D;  4A1G A;  4HS2 A;  3FY4 A;  4ABN A;  4B89 A;  3TL5 A;  4YVO A;  2FBN A;  3Q79 A;  3PZ1 A;  1SA5 A;  3B95 A;  4G24 A;  4XZ4 A;  3QAQ A;  3O48 A;  4HOS A;  3EHN A;  4CT0 A;  3VTY A;  4AY6 A;  3DSX A;  5EIL A;  4LEU A;  4Y6W A;  4B8A A;  1H6K A;  3FEX A;  5T3R A;  4BX8 A;  2MYO A;  1Z3X A;  3UX4 A;  4DLQ A;  3TWX A;  3KAE A;  3ULE G;  4C9B B;  3TWQ A;  3L16 A;  3SFY A;  4F53 A;  2FEZ A;  4QFV A;  4Q94 A;  3ZW3 A;  3Q7F A;  1N4Q A;  1OY3 D;  4K03 A;  3CSF A;  3R7Q A;  2V4L A;  4CRW A;  2XGO A;  4G11 A;  5KNH D;  1OWP A;  4CGW A;  2VSY A;  1LD7 A;  3MJW A;  4EZL A;  3C3Q A;  3ZYQ A;  1H0A A;  4ZFH A;  5FIO A;  5BV0 A;  2LSV A;  3EHQ A;  4HRM B;  2EIN E;  2J4B A;  3L54 A;  3RJV A;  3RO3 A;  3D3M A;  4HOQ A;  2HO1 A;  4GYO A;  3U4T A;  3RK6 A;  4JHR A;  5FQ8 A;  4F6R D;  1TN8 A;  2L6B A;  1MQS A;  4TUU A;  3FUE A;  4FAD A;  4FA6 A;  3PNL B;  3ASO E;  5D0O D;  2KZT B;  3SD5 A;  1BI8 B;  4HLE A;  4ANU A;  5FQ4 A;  3PZ3 A;  3UIN C;  3RSE G;  3FUM A;  1FPP A;  1Y6I A;  3PS6 A;  2X6J A;  3WXX A;  4GZ5 A;  3EJN A;  4A55 A;  5A6C A;  3ASF A;  1O5M A;  1IKN D;  5ARG A;  3I3N A;  2VQ2 A;  3FH5 A;  4EBA A;  3LY8 A;  4BSX A;  1K3Z D;  2OOE A;  2ION A;  4GYW A;  3E32 A;  2HYZ A;  4UWG A;  3TJP A;  3EU5 A;  4G1T A;  1KZO A;  4BX9 A;  2EIM E;  2LAI A;  2FI7 A;  2OND A;  3Q78 A;  3NZS A;  1FVF A;  1PAQ A;  3FH8 A;  4AM9 A;  3ZRH A;  2KM4 A;  2PM7 A;  1H6O A;  5EDS A;  1IYG A;  3SQV A;  3JCK C;  4GYY A;  1KLX A;  3CK9 A;  2AXV A;  3T8K A;  3D9P A;  1MX4 A;  5EYL A;  3GYZ A;  1O1S A;  3BU8 A;  1TNZ A;  3LEW A;  3FTY A;  5JJT A;  3TWV A;  1UJJ A;  4JEH A;  2WXN A;  3HXB A;  2WXJ A;  4YDO A;  3QKY A;  3FUL A;  1NA0 A;  4ZHB A;  5AN8 A;  2P9S G;  4N3B A;  5FZR A;  3B7T A;  4WND A;  2DZO A;  4J8F A;  2DZN A;  3TAX A;  3UUX A;  2J4D A;  5BNW A;  4L7T A;  4UWL A;  4BT9 A;  5AAO A;  1DCE A;  2IOL A;  2DVW A;  3C3R A;  5C1D A;  1L5J A;  2EIK E;  4F3V A;  4HBD A;  2HR2 A;  2LSU A;  4JL0 A;  3NOG D;  3CHP A;  4JVS A;  1Z6T A;  3FHE A;  5FQ6 A;  2VJ8 A;  1OCZ E;  2R05 A;  4H7X A;  2GRN B;  2IY0 C;  2DBA A;  3MKQ A;  4BER A;  2XRY A;  4AXH A;  5KJL A;  3IEG A;  4MBG A;  3NBN B;  1Z5S C;  4K5B A;  2QFC A;  5C2Y A;  2KCV A;  4I1M A;  4G8K A;  3CST A;  2J49 A;  1N4R A;  3VLE A;  3DBS A;  2PQN A;  1A5E A;  4WNE A;  3CQG B;  4LNG A;  4GZD A;  3NOC D;  2GRR B;  4L23 A;  1O1T A;  4GTM A;  5ANR A;  5CBO A;  2LAH A;  3TWW A;  4ACK A;  2WMO A;  2F37 A;  1NFI E;  4L1B A;  1LTX A;  5FIN A;  2P9N G;  2WQH A;  4L9P A;  2DYS E;  5ARF A;  2KXP C;  3S7B A;  4J8S A;  2XS8 A;  2L9B A;  2A4Z A;  1S0P A;  4PDX A;  4D10 C;  1YA0 A;  3R9A B;  3DWL G;  5CMY A;  4F1P A;  3DPY A;  4BSZ B;  1E8Z A;  3FUD A;  5KCM A;  1QYM A;  5HRY A;  1BLX B;  2AXZ A;  4K0R A;  4DX1 A;  3PRE A;  4E85 A;  1XNF A;  4NAC A;  1TR4 A;  3V2X A;  3V79 K;  3IHV A;  2ZGG A;  3LY9 A;  2PM6 A;  2WXH A;  4FJZ A;  3PZ2 A;  4DX5 D;  2GRO B;  1WDY A;  4Q96 A;  2WQ6 A;  1D8D A;  5LP0 A;  4GTO A;  3ZNG A;  3ABM E;  3QAR A;  3QWW A;  2V5F A;  3D9H A;  5JHB A;  1TJF A;  2J08 A;  2JAB A;  3X2Q E;  5CEC B;  2HE0 A;  3CVQ A;  2RFA A;  5CED B;  3IXE A;  3EHR A;  5FJY A;  2FUL A;  1N0R A;  3FUJ A;  3PVL A;  5KJN A;  4R7L A;  1VDY A;  4B93 B;  2PL2 A;  2OCC E;  1V54 E;  3D9O A;  3MV3 B;  3EIQ C;  4BET A;  1DC2 A;  2V4H C;  3RU0 A;  4O1P A;  1INZ A;  1ELK A;  4HLL A;  4ILI A;  4AVX A;  4HRN A;  3RAU A;  3V30 A;  4BFR A;  3LKU A;  1K8K G;  3CVL A;  2JLB A;  4E6H A;  4WNG A;  4C48 B;  1WY6 A;  3ZXP A;  2Y3A A;  3HVE A;  3APF A;  3GZ2 A;  2VTB A;  5AAR A;  3ZUV B;  3QDN A;  5BPP A;  3QNK A;  3D9L A;  2XZT G;  5G05 J;  4P29 A;  4JHK A;  1SZ9 A;  4ATZ D;  1DVP A;  4YVQ C;  3UXG A;  3L6A A;  3QWV A;  5LCW J;  2X38 A;  3SGH A;  5B3S E;  3FUI A;  3LJ3 A;  2R17 C;  2QY7 A;  1Y8M A;  3W9F A;  1FT2 A;  3E33 A;  4UI9 C;  5AYW D;  2LUH A;  3KD7 A;  3CHQ A;  2C0M A;  3FP3 A;  4GCN A;  4I17 A;  3UT4 A;  4UQY A;  2XGM A;  4A3T A;  3ZFW A;  4ANW A;  5T4Y A;  3Q9U C;  3L17 A;  1WG0 A;  3JUE A;  2OV8 A;  1TNY A;  3ONK A;  3FUN A;  3PEU B;  3G2T A;  3FTZ A;  2F8X K;  4C0M A;  3MZL B;  4JPS A;  1OWM A;  5G05 C;  5AJD A;  2LNI A;  3N71 A;  2WXI A;  2I9C A;  4FLB A;  2NYJ A;  4OVV A;  2V0P A;  3FWV A;  3G2U A;  4HFG A;  5LCW C;  5KJK A;  4HOT A;  3B7S A;  2H6I A;  4LUN U;  4W9R A;  4RVB A;  2X6F A;  2RFM A;  3L13 A;  3V2O A;  1ZBP A;  1S70 B;  4V3I A;  3DSW A;  3J5Q B;  3E34 A;  1N4S A;  3Q49 B;  1RZ4 A;  1U3C A;  4CGV A;  4OAU C;  1WM5 A;  3VLF A;  4CYM D;  2XEV A;  5JJ6 A;  4BY6 A;  1TNU A;  3CLJ A;  5FQ7 A;  3D9N A;  4QQI A;  4KBQ A;  1H6P A;  3RRU A;  3HXC A;  3DRA A;  1X5B A;  3E4B A;  3JUI A;  2KZT A;  2C0L A;  4O1O A;  4TV3 A;  1D8E A;  1N54 A;  4NRH B;  5FZQ A;  3EU9 A;  4UUC A;  4EZJ A;  4G26 A;  2WB2 A;  2UWJ G;  3K9I A;  4JA9 A;  3CHS A;  2B0O E;  2QC9 A;  4UQX A;  3S2A A;  1OCR E;  3FTU A;  4EZK A;  1P5Q A;  3QJZ A;  3QWP A;  2RG8 A;  1NA3 A;  5H7P A;  3CHO A;  3PZD A;  5HS0 A;  4DI3 A;  4N2S A;  3D9I A;  4M7C A;  1FVH A;  1H2U A;  4OVU A;  3ZU7 B;  3AS4 A;  3LCA A;  1Q2Z A;  4J8D A;  2VYI A;  2Y0B G;  4L2L A;  3CK8 A;  2QZA A;  3UM1 A;  4N3A A;  1E7V A;  4ANV A;  4CDR A;  3HXE A;  3NZU A;  3SBS A;  3MV2 B;  3UT8 A;  4N3C A;  3CV0 A;  4DX7 D;  1TEZ A;  3SO8 A;  2J07 A;  2XCC A;  1TJC A;  3BQO A;  3ZGQ A;  3LY7 A;  3G2V A;  1MX6 A;  4G23 A;  3Q47 B;  2KAT A;  4X8Q A;  4J8E A;  3S7D A;  1KT1 A;  5JJ7 A;  1UOH A;  4GTP A;  4U95 D;  2PZI A;  3AU4 A;  3OXL A;  4YDW A;  2BTD A;  1JCS A;  3U9W A;  3APD A;  3ABK E;  2NSZ A;  2DWZ A;  3FUH A;  4NIK A;  3SNX A;  5CRU A;  1E7U A;  3C98 A;  2FF4 A;  2WXF A;  3DPD A;  3T9K A;  2VGY A;  1MHQ A;  2MHK A;  4BT8 A;  4GTV A;  2XPY A;  4WUY A;  3AS5 A;  3JXI A;  4FC8 A;  4PUC A;  3I4R B;  3P1U A;  4GPK A;  3ISM C;  4MLP A;  3ZYK A;  3MEK A;  2Y1L E;  3PH0 C;  5ENQ D;  3C72 A;  2ZIS A;  3R9M A;  2P2C P;  4U8Y D;  4J7W A;  4CDM A;  5CCM A;  3PUJ A;  1HX8 A;  3PE4 A;  3UKU G;  4DK5 A;  4HI9 A;  4AV7 A;  3B7B A;  4RG6 A;  5G2N A;  2L0I A;  2IQC A;  3GZ1 A;  5AQB A;  3EHM A;  4HRL A;  4HOR A;  1HFA A;  3RIB A;  3UMV A;  1MX2 A;  4U0S A;  1HO8 A;  1Z3Y A;  2YHC A;  4GZ6 A;  5EID A;  4N2Q A;  3W9G A;  2L6J A;  1YCS B;  4FUL A;  3ASG A;  2IFU A;  1UN9 A;  2GRP B;  3LDZ A;  5G55 A;  1QBQ A;  4I1A A;  3DST A;  3CEQ A;  4XIF A;  2E0I A;  3JQ1 A;  3ESL A;  1D9S A;  3ZVV A;  2PQR A;  5LFA A;  1OUV A;  3URZ A;  3FTV A;  3HXF A;  4GU5 A;  2RKK A;  3E30 A;  3BEE A;  3ML8 A;  1JWG A;  4GZ3 A;  5CMW A;  1IHG A;  3B7R L;  4CDN A;  1ELR A;  4XE0 A;  3HXD A;  4B0Z A;  3TGO A;  1N11 A;  5EN5 D;  3KEZ A;  3ASD A;  3IBE A;  1B89 A;  1QQE A;  3ABL E;  3FU0 A;  4WNF A;  2XRZ A;  4DI4 A;  2QYJ A;  4I9C A;  1V55 E;  1ZB1 A;  3PRZ A;  4BES A;  3G2S A;  5IY5 E;  4HOU A;  2CG3 A;  1LF8 A;  4MKT A;  4GTQ A;  2XZD G;  1AWC B;  3FU3 A;  3SF4 A;  4U96 D;  2ZIR A;  3FU5 A;  1TN7 A;  2R2L A;  1UG3 A;  1KZP A;  4U8H A;  1N95 A;  4BEP A;  4DRX E;  2LO6 A;  1UJK A;  1GW6 A;  2YNQ A;  2DCP A;  3ML9 A;  3ONL A;  3P2B A;  3Q4A B;  4APO A;  4IRU A;  1DNP A;  4JXT A;  1IQU A;  4TRQ A;  1BU9 A;  2KCL A;  4FU3 A;  1TNB A;  3MKR A;  3Q5M A;  5FZS A;  2WXM A;  4K5A B;  5JHA A;  1U3D A;  4JC8 A;  2IJG X;  2OEV A;  2F8Y A;  5HKP A;  3CVN A;  2WPV A;  2VSO E;  3QOU A;  2AW6 A;  3FTS A;  3MYV A;  3DXM G;  2X6H A;  2CFZ A;  4A1S A;  3OTN A;  3UM0 A;  3D9M A;  5BXU A;  4A63 B;  4AY5 A;  4WWO A;  3Q9N C;  4K5C A;  4Y6C A;  4TXQ A;  1LD8 A;  5J08 A;  3AS8 A;  4UWH A;  5D0Q D;  2MOW A;  1OXJ A;  2XQ0 A;  3TWS A;  5BT1 A;  3E37 A;  1SVX A;  4M3O A;  2CHW A;  5HQ8 A;  5CHE E;  4XKC A;  3ZHE B;  2WXK A;  2YQ8 A;  4IUL A;  4WAF A;  1UN8 A;  3VTX A;  4G25 A;  5A7D B;  4CEM A;  4AOF A;  3OXG A;  2LXM A;  2EIL E;  1S63 A;  4UI9 J;  4WWP A;  3LJN A;  2E2E A;  4YDE A;  5B1B E;  3UIP C;  5G04 J;  2CFU A;  3UI2 A;  2FO7 A;  3Q7A A;  2BKK B;  1SW6 A;  3JYS A;  4TXP A;  3ZEF A;  4BWR A;  4DX2 A;  4J6I A;  3Q75 A;  3DEP A;  3D9K A;  1TNO A;  3DXK G;  2DIW A;  1KPS B;  5FWQ A;  3UPV A;  4L2Y A;  3DSU A;  4RQI A;  4JD2 G;  2ZXW E;  4O6F A;  4G2V A;  5BXO A;  4GML A;  2I1K A;  3EIJ A;  3FEY A;  3SY2 A;  5KNG A;  4TXR A;  1OCO E;  1TN6 A;  4C0E A;  4U63 A;  4I9E A;  1FCH A;  4GA0 A;  4HI8 A;  3HIZ A;  3ZKJ A;  5G04 C;  4DLO A;  2XEH A;  5CRV A;  1NZN A;  4ANX A;  2R03 A;  2DYR E;  2PNN A;  2VGX B;  2H6F A;  5CCL A;  2J09 A;  5EX0 A;  5FTP A;  2R5S A;  2XGS A;  4EBA G;  4GZC A;  3MX3 A;  2MRI A;  3DSS A;  3SBT B;  3RKV A;  3U66 A;  1IQR A;  4I6E A;  4B94 A;  2IO3 C;  1PY1 A;  3DSV A; 
#chains in the Genus database with same CATH homology
 1QBQ A;  1TNU A;  3Q78 A;  4YDE A;  3DST A;  2BED A;  3PZ2 A;  3HXC A;  3DRA A;  1JCR A;  1MZC A;  3Q7A A;  1D8E A;  1D8D A;  4GTO A;  1TNB A;  4GTV A;  4MBG A;  2H6H A;  3Q75 A;  3HXF A;  2F0Y A;  1JCQ A;  1N9A A;  1N4R A;  1TNO A;  1FT2 A;  1TN8 A;  3E33 A;  3E30 A;  4LNG A;  1O1S A;  3KSL A;  1NI1 A;  1TNZ A;  3DSU A;  3SFX A;  3C72 A;  1O1T A;  2ZIS A;  4GTM A;  1N4P A;  3Q79 A;  4GTT A;  3Q73 A;  3EUV A;  3PZ1 A;  1SA5 A;  3PZ3 A;  3HXD A;  3HXB A;  1TNY A;  4YDO A;  1TN6 A;  1FPP A;  1N94 A;  1LTX A;  3PZ4 A;  4L9P A;  1O5M A;  4GTS A;  3DSX A;  4LNB A;  3HXE A;  1LD8 A;  1X81 A;  2H6F A;  3E37 A;  3DPY A;  1DCE A;  4GTQ A;  2H6I A;  3SFY A;  1FT1 A;  3E32 A;  1S64 A;  4EHM A;  3DSW A;  3DSS A;  3Q7F A;  1N4Q A;  4GTP A;  1SA4 A;  3EU5 A;  1O1R A;  2H6G A;  3E34 A;  1KZO A;  1N4S A;  1NL4 A;  1JCS A;  2ZIR A;  3KSQ A;  2IEJ A;  1TN7 A;  2R2L A;  1KZP A;  1LD7 A;  4GTR A;  1N95 A;  1S63 A;  3DSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...