1FT1A

Crystal structure of protein farnesyltransferase at 2.25 angstroms resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FARNESYLTRANSFERASE
publication title Crystal structure of protein farnesyltransferase at 2.25 angstrom resolution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1997-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ft1A00
1N95A 1N9AA 3E30A 3Q7AA 1D8EA 1TN6A 1LTXA 1JCSA 4GTMA 1TNZA 4EHMA 1TNOA 1JCQA 2ZIRA 4GTTA 1NI1A 3HXBA 1FT2A 1QBQA 1MZCA 3KSLA 3PZ4A 4GTVA 1DCEA 1SA5A 1KZPA 1TNYA 3HXEA 1NL4A 3E34A 1S64A 2F0YA 2H6GA 3KSQA 1O1SA 1X81A 3E33A 3DSVA 1O1RA 3DSUA 4GTPA 2H6HA 1D8DA 1N4SA 3Q7FA 3E32A 3Q75A 2IEJA 4GTSA 1JCRA 4LNGA 3SFYA 1FT1A 3EUVA 4LNBA 3Q73A 4L9PA 1LD8A 1N4PA 3C72A 4MBGA 4GTQA 3DSSA 3DSWA 1KZOA 3SFXA 3DSTA 3DRAA 3PZ1A 3PZ3A 4GTOA 2ZISA 3Q79A 3HXDA 1SA4A 3HXFA 4YDOA 3EU5A 4YDEA 3DSXA 1N4RA 2H6FA 1TNBA 3PZ2A 3DPYA 3E37A 1TNUA 3HXCA 1S63A 2H6IA 3Q78A 1O1TA 1FPPA 1TN7A 2R2LA 4GTRA 1TN8A 1O5MA 1LD7A 1N4QA 2BEDA 1N94A
chains in the Genus database with same CATH superfamily
3HDXA 5CECB 3Q7AA 1GW6A 2ZXWE 2JABA 2ZGGA 4XE0A 4HRNA 3MKQA 3IHVA 3ZPJA 3IEGA 3PDNA 4KBQA 1N11A 1JCQA 3TWTA 3UT7A 4U8YD 5M72A 2YHCA 4J8DA 2J4DA 4JXTA 4XI0A 4OYSA 2C0LA 3MKRA 3MJWA 3D9MA 3QWWA 3L22A 1E8WA 4G8LA 3UINC 1TEZA 2H6HA 3E4BA 4U0SA 2RKKA 3ZXSA 3R9AB 3JQ1A 3JUIA 2LXMA 3DSTA 4F1SA 1KT1A 2AXVA 2P2CP 3S7BA 2MHKA 1MJ0A 3FTXA 4HOUA 1UJJA 4YDOA 4BT8A 2L6JA 3CVLA 3D9OA 3FY4A 1Z3XA 3MEKA 3AG4E 5JJ7A 2VGEA 4ANVA 1BPOA 2FEZA 4DRXE 2XPZA 5AQBA 1O5MA 4U0ZA 3AU5A 3ZEFA 4UUCA 2VJ8A 4FP7A 4AP2A 3L6AA 4P29A 2RD0A 4LEUA 4A3VA 1OWOA 4DUIA 5FTPA 2KZTB 1OY3D 2DBAA 5EYLA 3PE3A 4GTTA 1NI1A 4UWGA 3S7DA 1NZNA 1DCQA 2A5EA 3PZ4A 4AY6A 2OVBA 1SA5A 1YYHA 4HLLA 4L23A 4G23A 3FTSA 3BG0B 3ASOE 5KJKA 4J8YA 3DXKG 3KD7A 2XCCA 4FULA 2Y4TA 5G04C 2ZU6B 5ENOD 3LVQE 1JCRA 4EPZA 3SF4A 2CFZA 2JLBA 4I6GA 3PEUB 2J8SD 3Q73A 1MQSA 5G05C 4K0RA 3FFLA 3UQ3A 3C72A 5E76A 4I1OB 4HS2A 2XS1A 4WNDA 3V2OA 3CSFA 3TWVA 2H6FA 2DYRE 1TNBA 3UIPC 3TXMA 3UKRG 4DX7D 4GMJA 1TNUA 2EQXA 3GZ1A 5ENQD 3ABKE 3OXLA 3FTVA 5ITZF 2PM6A 1HU3A 3EHMA 5AAOA 1B89A 3QOUA 4QFVA 5EIBE 1TN6A 3MYVA 1RZ4A 4OVVA 5KWDA 3HVEA 1MHQA 3X2QE 1D9SA 4O1PA 3UM1A 4U07A 1TNOA 4RLYA 5ENNA 2C0MA 3V31A 4U7EB 1WY6A 3CVXA 5EN5D 1ZBPA 2PQRA 2V4HC 1LF8A 3PREA 3QKYA 2IFUA 4DI4A 2AJAA 1VDYA 3APCA 2ETCA 4O60A 5G2NA 3FUDA 4I9EA 4GPKA 5D0QD 2HE0A 2IEJA 3RSEG 3B95A 4F6RD 2P9NG 4LNGA 3UIOC 3JXIA 1Q2ZA 1AWCB 2LSVA 3FU3A 4JVSA 1MYOA 2CHXA 4JA7A 1N4PA 1K1BA 4JB8P 4L2LA 1OWMA 3DBSA 3EU9A 5HI7A 2KBXA 4FU3A 1YCSB 3L54A 3U64A 3FUNA 3DSXA 2IO3C 3HVEB 3DPYA 1X5BA 3LY8A 3FUHA 5KJLA 2RG8A 3TL5A 4FC8A 4HNAD 4YDWA 5KJNA 2VGYA 4JEHA 3CEQA 2WPVA 3IHYA 5ANRA 3CKCA 3TAXA 1SVXA 2VGXA 4PH4B 1DVPA 1TNZA 3CHQA 4EHMA 5AARA 4FHKA 1P5QA 2WXLA 5KBAA 1Z5SC 4TV3A 4HOSA 2ZIRA 1MZCA 3I3NA 5FQ8A 2M63A 5B3SE 3UM0A 2ETBA 4LCTA 2XCBA 3J5PA 3R7QA 4XEIG 2XZTG 4A1SA 3SO8A 3UM3A 2F37A 3UMVA 4GCOA 3Q75A 5LX8A 2P9LG 4MLPA 4WWNA 2R03A 1Z3YA 3ML8A 2NSZA 4KXKB 3URZA 2LNIA 2WXGA 2GW1A 3FH8A 3GZ2A 3ZHEA 4GPMA 3SY2A 2J49A 1TJCA 2XGSA 4DLQA 4B0ZA 4WWOA 3EIJA 3SFZA 3AS5A 1H2UA 4ACKA 4FA6A 5HRYA 2IY0C 1BI7B 2WMOA 1IQUA 5AJLA 3UTMA 3ZYLA 4XKCA 3W9FA 2NYJA 1E7VA 4UWKA 2WXJA 3PEVB 4ME2A 3MGBA 4LNUD 3AS8A 2A5UA 3ZVVA 2I1KA 1E96B 4I43A 3NOCD 4NIKA 2OOEA 4LUNU 4XIFA 4Z68A 3N71A 3ZHEB 3IV0A 2IQCA 3E34A 2MRIA 1EPUA 4TXQA 2WMNA 2RFAA 4EBAG 3OTNA 1W3BA 2L0TB 3B7RL 3QWPA 4AVXA 3I4GA 4MRUA 3LS8A 4HB5A 4ANUA 3S7FA 4A55A 4I1MA 5G04J 3PUKA 4CGVA 3B7BA 3FWVA 2XGMA 2RFMA 4DX6D 5G05J 2LO6A 3ONLA 3UM2A 2LUHA 3ASFA 5HQ8A 3DWLG 3KEAA 4BERA 2OCCE 4KVMA 2ZGDA 3FEXA 1BI8B 4FJZA 4AEZC 4DJAA 2V5FA 5AN8A 2WM9A 1MX6A 1HH8A 1TYQG 2P9SG 2WXMA 4N39A 2EILE 4PS8A 1N52A 1LTXA 3JQ0A 1MX4A 2HYZA 2VSOE 3VLEA 3Q9UC 1EYHA 3CHSA 3CVQA 3W9GA 3G2WA 3QJZA 3HRAA 4GA2A 1H2VC 5G55A 4GTVA 1IYGA 4CT4A 1IKND 4JPSA 3HXEA 4HFGA 1U3DA 2ETAA 1H6KA 1HG5A 4JHJA 5HKPA 3U4TA 4WNGA 1N4SA 2LSUA 3E32A 1UW4B 4FLBA 3L9TA 4CYMD 2KCVA 3Q5MA 3T5VA 5EDSA 3LDZA 4GU5A 3SFXA 1FCHA 3NOGD 5CCMA 4RVBA 2VSYA 3T8MA 3PNTB 3FEYA 3PZ1A 3CIAA 4Q96A 4TUMA 3HXDA 3P2BA 4GAAA 5AIJA 4XZ4A 1UOHA 2PM7A 3PZ2A 3FUIA 3L82A 2CG3A 4JW1A 1OCRE 3FUFA 2IJGX 3RAUA 3HXCA 1S63A 1UG3A 2H6IA 4HLEA 4U63A 2R5SA 1QNFA 1OWNA 4IN3B 3KS2A 3NQPA 1LD7A 4KT6B 3APDA 2Y3AA 1N95A 2MOWA 3IXEA 3MKQB 5JMND 3SZ7A 5FIOA 3SGHA 4GTMA 4GCNA 2EINE 4UWHA 2XGOA 3ML9A 3U66A 4YVQC 5D0OD 4YVOA 4EBAA 3PE4A 4C48B 4GMLA 2IOSA 5DIZA 3FDHA 4N3BA 3BQOA 2F0YA 4AV7A 1X81A 3B13A 4BFRA 4K03A 3SFYA 1FT1A 3CVVA 5LCWC 4ILGA 4MBGA 2V5QC 3DSSA 3ISMC 4GZDA 4YDYA 2IOLA 2WXIA 2KM4A 4N5QA 3CHMA 4NURA 3D3MA 2OVFA 2AWIA 3MV3B 3TGOA 1WM5A 4M7CA 4B94A 4K5CA 4JZYA 5CCLA 4C0MA 3E37A 4J6IA 2WQ7A 3APFA 3UT4A 3UT8A 4J8SA 1ELKA 2DZNA 3RK6A 3ENEA 5D66A 4GA1A 4B8CB 4GZ6A 3BG1B 1U2VG 2IO2C 5AJDA 4U8VD 3PUJA 4UWLA 3UX4A 4I6JA 2WQHA 3S2AA 2V4LA 3C3QA 5C2YA 2OV8A 2X6HA 3FTWA 2GRQB 3V30A 4BWRA 1XGWA 3UUXA 4J7WA 4F53A 2FO1E 3TWWA 2BUGA 3ZYMA 1ZU2A 3LJNA 4N3CA 3QDNA 5FQ7A 3LPZA 4JA9A 3Q47B 3BUAA 4DLOA 3UKUG 4MS6A 1OUVA 3SBTB 4L9PA 4BTBA 4U04A 1HO8A 4DX5D 5T4YA 3TWSA 5BNWA 2P9KG 2YINA 2YQ8A 3C3RA 3CQGB 4ILHB 1ELRA 3PZ3A 1JPLA 2X38A 3D9KA 3Q79A 5JJTA 3QARA 5EILA 4YDEA 4AOFA 3AAAC 1V55E 1V54E 3TXNA 2V0PA 2WXQA 4K5BA 2UWJG 1ZB1A 1E8YA 3UXGA 1FPPA 3ULQA 3LKUA 4GMRA 2VQ2A 3SNXA 3CKBA 1TN8A 4GTRA 1N0RA 2BEDA 3QK0A 3ZIMA 1N9AA 1NA0A 1JWFA 3RO2A 3CVNA 5ANLA 4HXIA 3AG1E 2WVIA 2BF0X 5LOZA 1E8ZA 4U95D 3ABLE 2DVWA 2R05A 5ENPD 3PS6A 3G2SA 5BXOA 5T8IA 4F7AA 4N2QA 4RG6A 2KCKA 2CG2A 3LY7A 4G8KA 4YNDA 1HE8A 3DSUA 4KYOB 4AM9A 4HVBA 3VLDA 4EZLA 5E75A 2P9IG 2X3MA 3AG2E 2FULA 4M3OA 4GTQA 4OAVB 1IQRA 3EHQA 5A23A 5ENSD 4UQXA 4FHJA 4V3IA 2I9CA 2ZISA 4ACLA 4WNEA 2F8XK 4DX2A 2UY1A 2MYOA 3SBSA 4L2YA 3VTXA 5EIDA 4H7YA 4D10C 3TG4A 5JJ6A 2QZAA 4OVUA 2DCPA 3Q78A 1S0PA 1YMPA 2QYJA 2A4ZA 3MX3A 1TJFA 3PNLB 5ENTD 4GYWA 2PQNA 5AQ9A 2VGXB 4J0UA 3G2VA 2X6IA 3MA5A 3ASGA 3CK9A 1JWGA 4H7XA 2VTBA 3ZW3A 3ULEG 3CLJA 2X6FA 3F6QA 4O6FA 1NP7A 2X6KA 3D9LA 2H6GA 5EX0A 3CV0A 2ILRA 3E33A 4DK5A 1O1RA 3AG3E 4LG6A 3TJPA 2EIME 3Q7FA 4BT9A 2OEWA 4UQYA 1E8XA 1WAO1 2XS8A 4N5CA 3LEWA 4C0EA 1HS6A 2WXHA 5FZSA 3JCKC 2WXRA 3D9IA 3HIZA 3FUMA 3FU6A 3C3OA 3NB2A 4BEPA 3HHMA 3HYMB 2EIJE 4WNFA 3LY9A 1INZA 1PAQA 1WDYA 4TXPA 4CDNA 3GYZA 3RRNB 4GTOA 4APOA 2KC7A 2AXUA 4F1PA 5LCWJ 3LCAA 3OXGA 5JHAA 2XEHA 4KVOA 3RJVA 4EECA 4JD2G 5HS0A 3AJIA 4ZFHA 2XEVA 3RIBA 4TRQA 1O1TA 4CT0A 1SZ9A 1L5JA 3MZLB 3SHFA 2VSNA 2QY7A 5EX3A 2WXNA 5CERB 4B8AA 4TUUA 5FJYA 2R17C 5KCMA 1D8EA 4UQZA 3JXJA 4I2ZA 3T9KA 1KT0A 1Z6TA 4OAUC 1DNPA 4HI9A 3ASNE 3TWQA 3DEOA 5AQ7A 3CGHA 4JL0A 4KMOA 3NAWA 4BSXA 4URKA 1SW6A 5FQ6A 4G1TA 4HRLA 5KNGA 1NL4A 2OEVA 4UI9K 1H0AA 4HOQA 5AYWD 1RW2A 4RG9A 3KSQA 1BLXB 5KJMA 4DI3A 3K9IA 2Y0BG 3DSVA 4GTPA 3L08A 2V8SE 3FU0A 2CHZA 1OCZE 4MKTA 2C2LA 4XKBA 4PUCA 3ZGQA 1SQMA 4BY6A 3CVUA 1NA3A 2GRNB 4LSZE 3SI5A 3RU0A 3Q4AB 4AXHA 5KNHD 3DXMG 5B1BE 2WXOA 3EIQC 3HXFA 2PZIA 3EU5A 4I2WA 4JHKA 5FINA 4EZKA 3IBEA 1Y6IA 4F3VA 4L7TA 3UI2A 1QQEA 4UI9C 2WXFA 1TN7A 2R2LA 1YA0A 1HF8A 1QZ2A 4ILIA 4RQIA 3RO3A 3QC1A 4RSYA 5LP0A 1H6OA 5DBKA 3IKOB 4U8HA 4C9BB 4U0UA 3ZKJA 4FADA 2Y4UA 1QYMA 4IRUA 2AW6A 4ANWA 3ONKA 5FZRA 3R7RA 2KZTA 4EZJA 3WXXA 5D2MC 2GGFA 3KAEA 4HQDA 4KZ0A 3ULYA 1DC2A 3FH5A 1K3ZD 2XHEA 2WXKA 5J08A 4GB9A 4JEUA 2WXPA 3ZNGA 2KCLA 4G25A 1IHBA 5EYPF 4CDMA 4ATGA 3G2TA 4BTAA 4A3TA 5CBNA 4U96D 3RRMB 2X6JA 3EHNA 3ASHA 1KZOA 2QYUA 3DRAA 2I1JA 2FBNA 1K8KG 5EKQD 4GZCA 4TXRA 4G24A 5JHBA 4BESA 4E85A 3ZN3A 4ANXA 3PZDA 4IULA 4B89A 3FTZA 2XZDG 4G2VA 5BPPA 4E6HA 5ARGA 3Q15A 3JYSA 3QB2A 1OT8A 2BKKB 4CRWA 3L16A 3B7UX 3U3WA 3E30A 2XQ0A 2IU1A 4WUYA 1UJKA 3FUJA 1H6PA 3TG5A 3FHEA 3SQVA 2HM8A 3S7JA 1QBQA 5AQAA 1H19A 4JHRA 4GZ3A 2LAHA 3UPVA 1EDUA 2J9QA 3OXFA 4AY5A 1BU9A 2QFCA 3CQCB 2GROB 2I6HA 1D8DA 3FTUA 4LERA 3CHOA 3Q49B 1HZ4A 3V2XA 3V79K 2WQ6A 2Y1LE 4CDRA 1A5EA 1Y8MA 3EJNA 4GZ5A 2XPYA 3ZXPA 3ZU7B 3CVYA 3CVWA 1OWPA 1OXJA 3FH7A 3FUEA 3J5QB 3NZSA 5BW8C 5A7DB 5BV1A 1N4RA 1E90A 2E2EA 4Q94A 1MX2A 2LAIA 1IXVA 3CHRA 3G2UA 1NFIE 3LYAA 2GRPB 5T3RA 2B6CA 2R59A 4ATZD 5CEDB 1KPSB 2NC9A 2J4BA 5CEAA 2P9PG 3ASDA 1N4QA 2XRYA 4GA0A 3MV2B 4XI9A 2ONDA 2QC9A 4UWFA 3EDTB 2GRRB 3O4ZA 4A63B 4FJYA 3RRUA 2HR2A 5J90A 4BSZB 3EHRA 5CBOA 3MCXA 3AS4A 5BXUA 1XNFA 1SZAA 5ARFA 2VYIA 3L13A 2DZOA 2GRMA 2L6BA 4AJWA 2Y69E 2DYSE 3FU5A 2Q7FA 5FT9A 3TWRA 4PS7A 3BU8A 4K5AB 2FO7A 2VSXE 5A6CA 4HI8A 3D9HA 4I9CA 3FUKA 3C5RA 1O1SA 2CHWA 2PNNA 3B7SA 3JUEA 4W9RA 4BX9A 3GZSA 1U3CA 3EUVA 1E7UA 3CK8A 3WG7E 3NF1A 2LXLA 5CRUA 2AVPA 2GRLA 3CVPA 3D9PA 1SA4A 3RKVA 2FI7A 3OAWA 3U9WA 5LFAA 3NZUA 2JEKA 1N0QA 5CMWA 3QAQA 3ZFWA 3I5PA 4EQFA 4N2SA 3L17A 2R02A 3ZYQA 3FULA 3T8KA 1G3NB 2I2OA 2KATA 1KLXA 2P9UG 5FWQA 1ELWA 4HORA 5C1DA 2F8YA 4UI9J 3ZYKA 1FVFA 1AP7A 4HRMB 3CR3A 1S70B 3QNKA 4WAFA 5CRVA 4CZ2D 3KSLA 1DCEA 3ESLA 1KZPA 2BKGA 1A17A 4X8QA 1OCOE 1TNYA 3LVRE 1JUQA 1EF1C 4J8FA 4R7LA 3DPDA 4NACA 3D9JA 4GTSA 3ZRHA 3VLFA 4ABNA 3PVLA 4I1AA 1LD8A 4A1GA 5FZQA 4CEMA 2XEEA 4WWPA 3C98A 3DEPA 3PH0C 4O1OA 2E0IA 1IHGA 1WG0A 2UY1B 1FVHA 5H7PA 2IONA 1OWLA 3FTYA 3Q9NC 3GW4A 4BX8A 1N54A 3D9NA 2FF4A 3P1UA 3PRZA 1UN9A 4IYPA 4LRZA 4AIFA 3TWXA 2J07A 5FQ4A 1HG2A 1PC2A 3ESKA 3TWUA 5B1AE 2P58C 2DWZA 3ZUVB 4FLHA 3LXUX 1N94A 4CGWA 3LJ3A 1H2TC 4Y6WA 1PY1A 2J08A 3B7TA 4JC8A 1JCSA 5BT1A 4ZHBA 2VTBB 2YNQA 2DIWA 3HXBA 1FT2A 2AXZA 3BEEA 1BD8A 3SD5A 5BV0A 5CHEE 3VTYA 3AU4A 1TR4A 1S64A 5AENA 3CSTA 2EIKE 4DPRA 3HG0D 4PDXA 2J09A 3ABME 1HXIA 3T5XA 2CFUA 3KEZA 5IY5E 4L1BA 4Q69A 3O48A 4LNBA 4B93B 3CK7A 3I4RB 3QWVA 5CMYA 3FP3A 2B0OE 4Y6CA 4G11A 3DSWA 3CHPA 5ENRD 4G26A 2L0IA 4GYYA 4HBDA 1OCCE 2XRZA 4APFA 4I17A 2KXPC 5JA4D 4N3AA 2BTDA 4J8EA 3R9MA 2XPIA 4NQ0A 2WB2A 1UN8A 2PL2A 2NXPA 2YHEA 2XENA 4I6EA 1HX8A 5BUZA 4HOTA 3NBNB 4XX5A 4CCAA 2HO1A 4QQIA 2IF4A 4KZCA 4PS3A 4DX1A 4NRHB 4BETA 4GYOA 1HFAA 2L9BA 1K1AA
chains in the Genus database with same CATH topology
1N95A 1N9AA 3E30A 3Q7AA 1D8EA 1TN6A 1LTXA 1JCSA 4GTMA 1TNZA 4EHMA 1TNOA 1JCQA 2ZIRA 4GTTA 1NI1A 3HXBA 1FT2A 1QBQA 1MZCA 3KSLA 3PZ4A 4GTVA 1DCEA 1SA5A 1KZPA 1TNYA 3HXEA 1NL4A 3E34A 1S64A 2F0YA 2H6GA 3KSQA 1O1SA 1X81A 3E33A 3DSVA 1O1RA 3DSUA 4GTPA 2H6HA 1D8DA 1N4SA 3Q7FA 3E32A 3Q75A 2IEJA 4GTSA 1JCRA 4LNGA 3SFYA 1FT1A 3EUVA 4LNBA 3Q73A 4L9PA 1LD8A 1N4PA 3C72A 4MBGA 4GTQA 3DSSA 3DSWA 1KZOA 3SFXA 3DSTA 3DRAA 3PZ1A 3PZ3A 4GTOA 2ZISA 3Q79A 3HXDA 1SA4A 3HXFA 4YDOA 3EU5A 4YDEA 3DSXA 1N4RA 2H6FA 1TNBA 3PZ2A 3DPYA 3E37A 1TNUA 3HXCA 1S63A 2H6IA 3Q78A 1O1TA 1FPPA 1TN7A 2R2LA 4GTRA 1TN8A 1O5MA 1LD7A 1N4QA 2BEDA 1N94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N95 A;  1N9A A;  3E30 A;  3Q7A A;  1D8E A;  1TN6 A;  1LTX A;  1JCS A;  4GTM A;  1TNZ A;  4EHM A;  1TNO A;  1JCQ A;  2ZIR A;  4GTT A;  1NI1 A;  3HXB A;  1FT2 A;  1QBQ A;  1MZC A;  3KSL A;  3PZ4 A;  4GTV A;  1DCE A;  1SA5 A;  1KZP A;  1TNY A;  3HXE A;  1NL4 A;  3E34 A;  1S64 A;  2F0Y A;  2H6G A;  3KSQ A;  1O1S A;  1X81 A;  3E33 A;  3DSV A;  1O1R A;  3DSU A;  4GTP A;  2H6H A;  1D8D A;  1N4S A;  3Q7F A;  3E32 A;  3Q75 A;  2IEJ A;  4GTS A;  1JCR A;  4LNG A;  3SFY A;  1FT1 A;  3EUV A;  4LNB A;  3Q73 A;  4L9P A;  1LD8 A;  1N4P A;  3C72 A;  4MBG A;  4GTQ A;  3DSS A;  3DSW A;  1KZO A;  3SFX A;  3DST A;  3DRA A;  3PZ1 A;  3PZ3 A;  4GTO A;  2ZIS A;  3Q79 A;  3HXD A;  1SA4 A;  3HXF A;  4YDO A;  3EU5 A;  4YDE A;  3DSX A;  1N4R A;  2H6F A;  1TNB A;  3PZ2 A;  3DPY A;  3E37 A;  1TNU A;  3HXC A;  1S63 A;  2H6I A;  3Q78 A;  1O1T A;  1FPP A;  1TN7 A;  2R2L A;  4GTR A;  1TN8 A;  1O5M A;  1LD7 A;  1N4Q A;  2BED A;  1N94 A; 
#chains in the Genus database with same CATH topology
 3HDX A;  5CEC B;  3Q7A A;  1GW6 A;  2ZXW E;  2JAB A;  2ZGG A;  4XE0 A;  4HRN A;  3MKQ A;  3IHV A;  3ZPJ A;  3IEG A;  3PDN A;  4KBQ A;  1N11 A;  1JCQ A;  3TWT A;  3UT7 A;  4U8Y D;  5M72 A;  2YHC A;  4J8D A;  2J4D A;  4JXT A;  4XI0 A;  4OYS A;  2C0L A;  3MKR A;  3MJW A;  3D9M A;  3QWW A;  3L22 A;  1E8W A;  4G8L A;  3UIN C;  1TEZ A;  2H6H A;  3E4B A;  4U0S A;  2RKK A;  3ZXS A;  3R9A B;  3JQ1 A;  3JUI A;  2LXM A;  3DST A;  4F1S A;  1KT1 A;  2AXV A;  2P2C P;  3S7B A;  2MHK A;  1MJ0 A;  3FTX A;  4HOU A;  1UJJ A;  4YDO A;  4BT8 A;  2L6J A;  3CVL A;  3D9O A;  3FY4 A;  1Z3X A;  3MEK A;  3AG4 E;  5JJ7 A;  2VGE A;  4ANV A;  1BPO A;  2FEZ A;  4DRX E;  2XPZ A;  5AQB A;  1O5M A;  4U0Z A;  3AU5 A;  3ZEF A;  4UUC A;  2VJ8 A;  4FP7 A;  4AP2 A;  3L6A A;  4P29 A;  2RD0 A;  4LEU A;  4A3V A;  1OWO A;  4DUI A;  5FTP A;  2KZT B;  1OY3 D;  2DBA A;  5EYL A;  3PE3 A;  4GTT A;  1NI1 A;  4UWG A;  3S7D A;  1NZN A;  1DCQ A;  2A5E A;  3PZ4 A;  4AY6 A;  2OVB A;  1SA5 A;  1YYH A;  4HLL A;  4L23 A;  4G23 A;  3FTS A;  3BG0 B;  3ASO E;  5KJK A;  4J8Y A;  3DXK G;  3KD7 A;  2XCC A;  4FUL A;  2Y4T A;  5G04 C;  2ZU6 B;  5ENO D;  3LVQ E;  1JCR A;  4EPZ A;  3SF4 A;  2CFZ A;  2JLB A;  4I6G A;  3PEU B;  2J8S D;  3Q73 A;  1MQS A;  5G05 C;  4K0R A;  3FFL A;  3UQ3 A;  3C72 A;  5E76 A;  4I1O B;  4HS2 A;  2XS1 A;  4WND A;  3V2O A;  3CSF A;  3TWV A;  2H6F A;  2DYR E;  1TNB A;  3UIP C;  3TXM A;  3UKR G;  4DX7 D;  4GMJ A;  1TNU A;  2EQX A;  3GZ1 A;  5ENQ D;  3ABK E;  3OXL A;  3FTV A;  5ITZ F;  2PM6 A;  1HU3 A;  3EHM A;  5AAO A;  1B89 A;  3QOU A;  4QFV A;  5EIB E;  1TN6 A;  3MYV A;  1RZ4 A;  4OVV A;  5KWD A;  3HVE A;  1MHQ A;  3X2Q E;  1D9S A;  4O1P A;  3UM1 A;  4U07 A;  1TNO A;  4RLY A;  5ENN A;  2C0M A;  3V31 A;  4U7E B;  1WY6 A;  3CVX A;  5EN5 D;  1ZBP A;  2PQR A;  2V4H C;  1LF8 A;  3PRE A;  3QKY A;  2IFU A;  4DI4 A;  2AJA A;  1VDY A;  3APC A;  2ETC A;  4O60 A;  5G2N A;  3FUD A;  4I9E A;  4GPK A;  5D0Q D;  2HE0 A;  2IEJ A;  3RSE G;  3B95 A;  4F6R D;  2P9N G;  4LNG A;  3UIO C;  3JXI A;  1Q2Z A;  1AWC B;  2LSV A;  3FU3 A;  4JVS A;  1MYO A;  2CHX A;  4JA7 A;  1N4P A;  1K1B A;  4JB8 P;  4L2L A;  1OWM A;  3DBS A;  3EU9 A;  5HI7 A;  2KBX A;  4FU3 A;  1YCS B;  3L54 A;  3U64 A;  3FUN A;  3DSX A;  2IO3 C;  3HVE B;  3DPY A;  1X5B A;  3LY8 A;  3FUH A;  5KJL A;  2RG8 A;  3TL5 A;  4FC8 A;  4HNA D;  4YDW A;  5KJN A;  2VGY A;  4JEH A;  3CEQ A;  2WPV A;  3IHY A;  5ANR A;  3CKC A;  3TAX A;  1SVX A;  2VGX A;  4PH4 B;  1DVP A;  1TNZ A;  3CHQ A;  4EHM A;  5AAR A;  4FHK A;  1P5Q A;  2WXL A;  5KBA A;  1Z5S C;  4TV3 A;  4HOS A;  2ZIR A;  1MZC A;  3I3N A;  5FQ8 A;  2M63 A;  5B3S E;  3UM0 A;  2ETB A;  4LCT A;  2XCB A;  3J5P A;  3R7Q A;  4XEI G;  2XZT G;  4A1S A;  3SO8 A;  3UM3 A;  2F37 A;  3UMV A;  4GCO A;  3Q75 A;  5LX8 A;  2P9L G;  4MLP A;  4WWN A;  2R03 A;  1Z3Y A;  3ML8 A;  2NSZ A;  4KXK B;  3URZ A;  2LNI A;  2WXG A;  2GW1 A;  3FH8 A;  3GZ2 A;  3ZHE A;  4GPM A;  3SY2 A;  2J49 A;  1TJC A;  2XGS A;  4DLQ A;  4B0Z A;  4WWO A;  3EIJ A;  3SFZ A;  3AS5 A;  1H2U A;  4ACK A;  4FA6 A;  5HRY A;  2IY0 C;  1BI7 B;  2WMO A;  1IQU A;  5AJL A;  3UTM A;  3ZYL A;  4XKC A;  3W9F A;  2NYJ A;  1E7V A;  4UWK A;  2WXJ A;  3PEV B;  4ME2 A;  3MGB A;  4LNU D;  3AS8 A;  2A5U A;  3ZVV A;  2I1K A;  1E96 B;  4I43 A;  3NOC D;  4NIK A;  2OOE A;  4LUN U;  4XIF A;  4Z68 A;  3N71 A;  3ZHE B;  3IV0 A;  2IQC A;  3E34 A;  2MRI A;  1EPU A;  4TXQ A;  2WMN A;  2RFA A;  4EBA G;  3OTN A;  1W3B A;  2L0T B;  3B7R L;  3QWP A;  4AVX A;  3I4G A;  4MRU A;  3LS8 A;  4HB5 A;  4ANU A;  3S7F A;  4A55 A;  4I1M A;  5G04 J;  3PUK A;  4CGV A;  3B7B A;  3FWV A;  2XGM A;  2RFM A;  4DX6 D;  5G05 J;  2LO6 A;  3ONL A;  3UM2 A;  2LUH A;  3ASF A;  5HQ8 A;  3DWL G;  3KEA A;  4BER A;  2OCC E;  4KVM A;  2ZGD A;  3FEX A;  1BI8 B;  4FJZ A;  4AEZ C;  4DJA A;  2V5F A;  5AN8 A;  2WM9 A;  1MX6 A;  1HH8 A;  1TYQ G;  2P9S G;  2WXM A;  4N39 A;  2EIL E;  4PS8 A;  1N52 A;  1LTX A;  3JQ0 A;  1MX4 A;  2HYZ A;  2VSO E;  3VLE A;  3Q9U C;  1EYH A;  3CHS A;  3CVQ A;  3W9G A;  3G2W A;  3QJZ A;  3HRA A;  4GA2 A;  1H2V C;  5G55 A;  4GTV A;  1IYG A;  4CT4 A;  1IKN D;  4JPS A;  3HXE A;  4HFG A;  1U3D A;  2ETA A;  1H6K A;  1HG5 A;  4JHJ A;  5HKP A;  3U4T A;  4WNG A;  1N4S A;  2LSU A;  3E32 A;  1UW4 B;  4FLB A;  3L9T A;  4CYM D;  2KCV A;  3Q5M A;  3T5V A;  5EDS A;  3LDZ A;  4GU5 A;  3SFX A;  1FCH A;  3NOG D;  5CCM A;  4RVB A;  2VSY A;  3T8M A;  3PNT B;  3FEY A;  3PZ1 A;  3CIA A;  4Q96 A;  4TUM A;  3HXD A;  3P2B A;  4GAA A;  5AIJ A;  4XZ4 A;  1UOH A;  2PM7 A;  3PZ2 A;  3FUI A;  3L82 A;  2CG3 A;  4JW1 A;  1OCR E;  3FUF A;  2IJG X;  3RAU A;  3HXC A;  1S63 A;  1UG3 A;  2H6I A;  4HLE A;  4U63 A;  2R5S A;  1QNF A;  1OWN A;  4IN3 B;  3KS2 A;  3NQP A;  1LD7 A;  4KT6 B;  3APD A;  2Y3A A;  1N95 A;  2MOW A;  3IXE A;  3MKQ B;  5JMN D;  3SZ7 A;  5FIO A;  3SGH A;  4GTM A;  4GCN A;  2EIN E;  4UWH A;  2XGO A;  3ML9 A;  3U66 A;  4YVQ C;  5D0O D;  4YVO A;  4EBA A;  3PE4 A;  4C48 B;  4GML A;  2IOS A;  5DIZ A;  3FDH A;  4N3B A;  3BQO A;  2F0Y A;  4AV7 A;  1X81 A;  3B13 A;  4BFR A;  4K03 A;  3SFY A;  1FT1 A;  3CVV A;  5LCW C;  4ILG A;  4MBG A;  2V5Q C;  3DSS A;  3ISM C;  4GZD A;  4YDY A;  2IOL A;  2WXI A;  2KM4 A;  4N5Q A;  3CHM A;  4NUR A;  3D3M A;  2OVF A;  2AWI A;  3MV3 B;  3TGO A;  1WM5 A;  4M7C A;  4B94 A;  4K5C A;  4JZY A;  5CCL A;  4C0M A;  3E37 A;  4J6I A;  2WQ7 A;  3APF A;  3UT4 A;  3UT8 A;  4J8S A;  1ELK A;  2DZN A;  3RK6 A;  3ENE A;  5D66 A;  4GA1 A;  4B8C B;  4GZ6 A;  3BG1 B;  1U2V G;  2IO2 C;  5AJD A;  4U8V D;  3PUJ A;  4UWL A;  3UX4 A;  4I6J A;  2WQH A;  3S2A A;  2V4L A;  3C3Q A;  5C2Y A;  2OV8 A;  2X6H A;  3FTW A;  2GRQ B;  3V30 A;  4BWR A;  1XGW A;  3UUX A;  4J7W A;  4F53 A;  2FO1 E;  3TWW A;  2BUG A;  3ZYM A;  1ZU2 A;  3LJN A;  4N3C A;  3QDN A;  5FQ7 A;  3LPZ A;  4JA9 A;  3Q47 B;  3BUA A;  4DLO A;  3UKU G;  4MS6 A;  1OUV A;  3SBT B;  4L9P A;  4BTB A;  4U04 A;  1HO8 A;  4DX5 D;  5T4Y A;  3TWS A;  5BNW A;  2P9K G;  2YIN A;  2YQ8 A;  3C3R A;  3CQG B;  4ILH B;  1ELR A;  3PZ3 A;  1JPL A;  2X38 A;  3D9K A;  3Q79 A;  5JJT A;  3QAR A;  5EIL A;  4YDE A;  4AOF A;  3AAA C;  1V55 E;  1V54 E;  3TXN A;  2V0P A;  2WXQ A;  4K5B A;  2UWJ G;  1ZB1 A;  1E8Y A;  3UXG A;  1FPP A;  3ULQ A;  3LKU A;  4GMR A;  2VQ2 A;  3SNX A;  3CKB A;  1TN8 A;  4GTR A;  1N0R A;  2BED A;  3QK0 A;  3ZIM A;  1N9A A;  1NA0 A;  1JWF A;  3RO2 A;  3CVN A;  5ANL A;  4HXI A;  3AG1 E;  2WVI A;  2BF0 X;  5LOZ A;  1E8Z A;  4U95 D;  3ABL E;  2DVW A;  2R05 A;  5ENP D;  3PS6 A;  3G2S A;  5BXO A;  5T8I A;  4F7A A;  4N2Q A;  4RG6 A;  2KCK A;  2CG2 A;  3LY7 A;  4G8K A;  4YND A;  1HE8 A;  3DSU A;  4KYO B;  4AM9 A;  4HVB A;  3VLD A;  4EZL A;  5E75 A;  2P9I G;  2X3M A;  3AG2 E;  2FUL A;  4M3O A;  4GTQ A;  4OAV B;  1IQR A;  3EHQ A;  5A23 A;  5ENS D;  4UQX A;  4FHJ A;  4V3I A;  2I9C A;  2ZIS A;  4ACL A;  4WNE A;  2F8X K;  4DX2 A;  2UY1 A;  2MYO A;  3SBS A;  4L2Y A;  3VTX A;  5EID A;  4H7Y A;  4D10 C;  3TG4 A;  5JJ6 A;  2QZA A;  4OVU A;  2DCP A;  3Q78 A;  1S0P A;  1YMP A;  2QYJ A;  2A4Z A;  3MX3 A;  1TJF A;  3PNL B;  5ENT D;  4GYW A;  2PQN A;  5AQ9 A;  2VGX B;  4J0U A;  3G2V A;  2X6I A;  3MA5 A;  3ASG A;  3CK9 A;  1JWG A;  4H7X A;  2VTB A;  3ZW3 A;  3ULE G;  3CLJ A;  2X6F A;  3F6Q A;  4O6F A;  1NP7 A;  2X6K A;  3D9L A;  2H6G A;  5EX0 A;  3CV0 A;  2ILR A;  3E33 A;  4DK5 A;  1O1R A;  3AG3 E;  4LG6 A;  3TJP A;  2EIM E;  3Q7F A;  4BT9 A;  2OEW A;  4UQY A;  1E8X A;  1WAO 1;  2XS8 A;  4N5C A;  3LEW A;  4C0E A;  1HS6 A;  2WXH A;  5FZS A;  3JCK C;  2WXR A;  3D9I A;  3HIZ A;  3FUM A;  3FU6 A;  3C3O A;  3NB2 A;  4BEP A;  3HHM A;  3HYM B;  2EIJ E;  4WNF A;  3LY9 A;  1INZ A;  1PAQ A;  1WDY A;  4TXP A;  4CDN A;  3GYZ A;  3RRN B;  4GTO A;  4APO A;  2KC7 A;  2AXU A;  4F1P A;  5LCW J;  3LCA A;  3OXG A;  5JHA A;  2XEH A;  4KVO A;  3RJV A;  4EEC A;  4JD2 G;  5HS0 A;  3AJI A;  4ZFH A;  2XEV A;  3RIB A;  4TRQ A;  1O1T A;  4CT0 A;  1SZ9 A;  1L5J A;  3MZL B;  3SHF A;  2VSN A;  2QY7 A;  5EX3 A;  2WXN A;  5CER B;  4B8A A;  4TUU A;  5FJY A;  2R17 C;  5KCM A;  1D8E A;  4UQZ A;  3JXJ A;  4I2Z A;  3T9K A;  1KT0 A;  1Z6T A;  4OAU C;  1DNP A;  4HI9 A;  3ASN E;  3TWQ A;  3DEO A;  5AQ7 A;  3CGH A;  4JL0 A;  4KMO A;  3NAW A;  4BSX A;  4URK A;  1SW6 A;  5FQ6 A;  4G1T A;  4HRL A;  5KNG A;  1NL4 A;  2OEV A;  4UI9 K;  1H0A A;  4HOQ A;  5AYW D;  1RW2 A;  4RG9 A;  3KSQ A;  1BLX B;  5KJM A;  4DI3 A;  3K9I A;  2Y0B G;  3DSV A;  4GTP A;  3L08 A;  2V8S E;  3FU0 A;  2CHZ A;  1OCZ E;  4MKT A;  2C2L A;  4XKB A;  4PUC A;  3ZGQ A;  1SQM A;  4BY6 A;  3CVU A;  1NA3 A;  2GRN B;  4LSZ E;  3SI5 A;  3RU0 A;  3Q4A B;  4AXH A;  5KNH D;  3DXM G;  5B1B E;  2WXO A;  3EIQ C;  3HXF A;  2PZI A;  3EU5 A;  4I2W A;  4JHK A;  5FIN A;  4EZK A;  3IBE A;  1Y6I A;  4F3V A;  4L7T A;  3UI2 A;  1QQE A;  4UI9 C;  2WXF A;  1TN7 A;  2R2L A;  1YA0 A;  1HF8 A;  1QZ2 A;  4ILI A;  4RQI A;  3RO3 A;  3QC1 A;  4RSY A;  5LP0 A;  1H6O A;  5DBK A;  3IKO B;  4U8H A;  4C9B B;  4U0U A;  3ZKJ A;  4FAD A;  2Y4U A;  1QYM A;  4IRU A;  2AW6 A;  4ANW A;  3ONK A;  5FZR A;  3R7R A;  2KZT A;  4EZJ A;  3WXX A;  5D2M C;  2GGF A;  3KAE A;  4HQD A;  4KZ0 A;  3ULY A;  1DC2 A;  3FH5 A;  1K3Z D;  2XHE A;  2WXK A;  5J08 A;  4GB9 A;  4JEU A;  2WXP A;  3ZNG A;  2KCL A;  4G25 A;  1IHB A;  5EYP F;  4CDM A;  4ATG A;  3G2T A;  4BTA A;  4A3T A;  5CBN A;  4U96 D;  3RRM B;  2X6J A;  3EHN A;  3ASH A;  1KZO A;  2QYU A;  3DRA A;  2I1J A;  2FBN A;  1K8K G;  5EKQ D;  4GZC A;  4TXR A;  4G24 A;  5JHB A;  4BES A;  4E85 A;  3ZN3 A;  4ANX A;  3PZD A;  4IUL A;  4B89 A;  3FTZ A;  2XZD G;  4G2V A;  5BPP A;  4E6H A;  5ARG A;  3Q15 A;  3JYS A;  3QB2 A;  1OT8 A;  2BKK B;  4CRW A;  3L16 A;  3B7U X;  3U3W A;  3E30 A;  2XQ0 A;  2IU1 A;  4WUY A;  1UJK A;  3FUJ A;  1H6P A;  3TG5 A;  3FHE A;  3SQV A;  2HM8 A;  3S7J A;  1QBQ A;  5AQA A;  1H19 A;  4JHR A;  4GZ3 A;  2LAH A;  3UPV A;  1EDU A;  2J9Q A;  3OXF A;  4AY5 A;  1BU9 A;  2QFC A;  3CQC B;  2GRO B;  2I6H A;  1D8D A;  3FTU A;  4LER A;  3CHO A;  3Q49 B;  1HZ4 A;  3V2X A;  3V79 K;  2WQ6 A;  2Y1L E;  4CDR A;  1A5E A;  1Y8M A;  3EJN A;  4GZ5 A;  2XPY A;  3ZXP A;  3ZU7 B;  3CVY A;  3CVW A;  1OWP A;  1OXJ A;  3FH7 A;  3FUE A;  3J5Q B;  3NZS A;  5BW8 C;  5A7D B;  5BV1 A;  1N4R A;  1E90 A;  2E2E A;  4Q94 A;  1MX2 A;  2LAI A;  1IXV A;  3CHR A;  3G2U A;  1NFI E;  3LYA A;  2GRP B;  5T3R A;  2B6C A;  2R59 A;  4ATZ D;  5CED B;  1KPS B;  2NC9 A;  2J4B A;  5CEA A;  2P9P G;  3ASD A;  1N4Q A;  2XRY A;  4GA0 A;  3MV2 B;  4XI9 A;  2OND A;  2QC9 A;  4UWF A;  3EDT B;  2GRR B;  3O4Z A;  4A63 B;  4FJY A;  3RRU A;  2HR2 A;  5J90 A;  4BSZ B;  3EHR A;  5CBO A;  3MCX A;  3AS4 A;  5BXU A;  1XNF A;  1SZA A;  5ARF A;  2VYI A;  3L13 A;  2DZO A;  2GRM A;  2L6B A;  4AJW A;  2Y69 E;  2DYS E;  3FU5 A;  2Q7F A;  5FT9 A;  3TWR A;  4PS7 A;  3BU8 A;  4K5A B;  2FO7 A;  2VSX E;  5A6C A;  4HI8 A;  3D9H A;  4I9C A;  3FUK A;  3C5R A;  1O1S A;  2CHW A;  2PNN A;  3B7S A;  3JUE A;  4W9R A;  4BX9 A;  3GZS A;  1U3C A;  3EUV A;  1E7U A;  3CK8 A;  3WG7 E;  3NF1 A;  2LXL A;  5CRU A;  2AVP A;  2GRL A;  3CVP A;  3D9P A;  1SA4 A;  3RKV A;  2FI7 A;  3OAW A;  3U9W A;  5LFA A;  3NZU A;  2JEK A;  1N0Q A;  5CMW A;  3QAQ A;  3ZFW A;  3I5P A;  4EQF A;  4N2S A;  3L17 A;  2R02 A;  3ZYQ A;  3FUL A;  3T8K A;  1G3N B;  2I2O A;  2KAT A;  1KLX A;  2P9U G;  5FWQ A;  1ELW A;  4HOR A;  5C1D A;  2F8Y A;  4UI9 J;  3ZYK A;  1FVF A;  1AP7 A;  4HRM B;  3CR3 A;  1S70 B;  3QNK A;  4WAF A;  5CRV A;  4CZ2 D;  3KSL A;  1DCE A;  3ESL A;  1KZP A;  2BKG A;  1A17 A;  4X8Q A;  1OCO E;  1TNY A;  3LVR E;  1JUQ A;  1EF1 C;  4J8F A;  4R7L A;  3DPD A;  4NAC A;  3D9J A;  4GTS A;  3ZRH A;  3VLF A;  4ABN A;  3PVL A;  4I1A A;  1LD8 A;  4A1G A;  5FZQ A;  4CEM A;  2XEE A;  4WWP A;  3C98 A;  3DEP A;  3PH0 C;  4O1O A;  2E0I A;  1IHG A;  1WG0 A;  2UY1 B;  1FVH A;  5H7P A;  2ION A;  1OWL A;  3FTY A;  3Q9N C;  3GW4 A;  4BX8 A;  1N54 A;  3D9N A;  2FF4 A;  3P1U A;  3PRZ A;  1UN9 A;  4IYP A;  4LRZ A;  4AIF A;  3TWX A;  2J07 A;  5FQ4 A;  1HG2 A;  1PC2 A;  3ESK A;  3TWU A;  5B1A E;  2P58 C;  2DWZ A;  3ZUV B;  4FLH A;  3LXU X;  1N94 A;  4CGW A;  3LJ3 A;  1H2T C;  4Y6W A;  1PY1 A;  2J08 A;  3B7T A;  4JC8 A;  1JCS A;  5BT1 A;  4ZHB A;  2VTB B;  2YNQ A;  2DIW A;  3HXB A;  1FT2 A;  2AXZ A;  3BEE A;  1BD8 A;  3SD5 A;  5BV0 A;  5CHE E;  3VTY A;  3AU4 A;  1TR4 A;  1S64 A;  5AEN A;  3CST A;  2EIK E;  4DPR A;  3HG0 D;  4PDX A;  2J09 A;  3ABM E;  1HXI A;  3T5X A;  2CFU A;  3KEZ A;  5IY5 E;  4L1B A;  4Q69 A;  3O48 A;  4LNB A;  4B93 B;  3CK7 A;  3I4R B;  3QWV A;  5CMY A;  3FP3 A;  2B0O E;  4Y6C A;  4G11 A;  3DSW A;  3CHP A;  5ENR D;  4G26 A;  2L0I A;  4GYY A;  4HBD A;  1OCC E;  2XRZ A;  4APF A;  4I17 A;  2KXP C;  5JA4 D;  4N3A A;  2BTD A;  4J8E A;  3R9M A;  2XPI A;  4NQ0 A;  2WB2 A;  1UN8 A;  2PL2 A;  2NXP A;  2YHE A;  2XEN A;  4I6E A;  1HX8 A;  5BUZ A;  4HOT A;  3NBN B;  4XX5 A;  4CCA A;  2HO1 A;  4QQI A;  2IF4 A;  4KZC A;  4PS3 A;  4DX1 A;  4NRH B;  4BET A;  4GYO A;  1HFA A;  2L9B A;  1K1A A; 
#chains in the Genus database with same CATH homology
 1N95 A;  1N9A A;  3E30 A;  3Q7A A;  1D8E A;  1TN6 A;  1LTX A;  1JCS A;  4GTM A;  1TNZ A;  4EHM A;  1TNO A;  1JCQ A;  2ZIR A;  4GTT A;  1NI1 A;  3HXB A;  1FT2 A;  1QBQ A;  1MZC A;  3KSL A;  3PZ4 A;  4GTV A;  1DCE A;  1SA5 A;  1KZP A;  1TNY A;  3HXE A;  1NL4 A;  3E34 A;  1S64 A;  2F0Y A;  2H6G A;  3KSQ A;  1O1S A;  1X81 A;  3E33 A;  3DSV A;  1O1R A;  3DSU A;  4GTP A;  2H6H A;  1D8D A;  1N4S A;  3Q7F A;  3E32 A;  3Q75 A;  2IEJ A;  4GTS A;  1JCR A;  4LNG A;  3SFY A;  1FT1 A;  3EUV A;  4LNB A;  3Q73 A;  4L9P A;  1LD8 A;  1N4P A;  3C72 A;  4MBG A;  4GTQ A;  3DSS A;  3DSW A;  1KZO A;  3SFX A;  3DST A;  3DRA A;  3PZ1 A;  3PZ3 A;  4GTO A;  2ZIS A;  3Q79 A;  3HXD A;  1SA4 A;  3HXF A;  4YDO A;  3EU5 A;  4YDE A;  3DSX A;  1N4R A;  2H6F A;  1TNB A;  3PZ2 A;  3DPY A;  3E37 A;  1TNU A;  3HXC A;  1S63 A;  2H6I A;  3Q78 A;  1O1T A;  1FPP A;  1TN7 A;  2R2L A;  4GTR A;  1TN8 A;  1O5M A;  1LD7 A;  1N4Q A;  2BED A;  1N94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...