1FT1A

Crystal structure of protein farnesyltransferase at 2.25 angstroms resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FARNESYLTRANSFERASE
publication title Crystal structure of protein farnesyltransferase at 2.25 angstrom resolution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1997-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ft1A00
1N9AA 4LNBA 3DSXA 3E32A 1JCQA 1TNZA 3Q79A 1N4PA 1O1SA 3PZ1A 1SA5A 3PZ2A 3C72A 1LD8A 1D8EA 4GTOA 1JCSA 2BEDA 3E37A 3HXCA 1TN7A 3Q75A 3PZ4A 3E33A 1N4SA 4YDOA 3DRAA 2H6IA 1N4RA 3DSVA 3HXEA 3Q7FA 1N95A 2H6HA 2H6FA 3KSLA 1O1TA 1MZCA 2R2LA 3Q7AA 4L9PA 3DSWA 3E30A 4GTPA 3SFYA 1O1RA 1N94A 4EHMA 1LD7A 1X81A 1TNYA 2ZIRA 2H6GA 1FT1A 3EUVA 1NI1A 3DPYA 4LNGA 3E34A 3DSUA 4GTTA 2ZISA 4GTQA 1SA4A 3HXBA 4YDEA 1QBQA 1O5MA 1S64A 1FPPA 3HXFA 4GTRA 1D8DA 1N4QA 2F0YA 1TNBA 3DSSA 1TNUA 1TNOA 1FT2A 3KSQA 1LTXA 1KZOA 3HXDA 2IEJA 1KZPA 1S63A 3PZ3A 4GTVA 3Q78A 1TN6A 3DSTA 1DCEA 4GTMA 3Q73A 1NL4A 1TN8A 1JCRA 3EU5A 3SFXA 4GTSA 4MBGA
chains in the Genus database with same CATH superfamily
2C2LA 4G11A 2VGXA 4LG6A 3TL5A 5FQ7A 2V8SE 1JCQA 3L9TA 4MLPA 3CVYA 4U0ZA 4I1AA 5IY5E 4KMOA 4HOQA 4APFA 1HF8A 4JEHA 3ZYMA 5CEAA 3TWVA 4UQXA 5A6CA 3FU5A 2VGYA 2PZIA 4JC8A 3AJIA 3DSVA 4BFRA 5D0QD 2AXUA 1O1TA 1RZ4A 3O4ZA 5CERB 2IQCA 4HQDA 1XGWA 2UWJG 1OWLA 3LPZA 3RRNB 1QZ2A 2AJAA 4B0ZA 5E76A 5T4YA 3J5PA 2QYUA 3ULEG 3ZFWA 3B95A 1QNFA 3QKYA 4DPRA 4GTQA 4DUIA 2F8YA 3PVLA 3QOUA 4RSYA 2I6HA 1S64A 3FDHA 4BSZB 2WXLA 3PE4A 5AENA 1IYGA 3CKCA 1N0RA 4JVSA 3FUJA 2VYIA 3J5QB 3FTSA 4A63B 3UQ3A 4GTMA 1NL4A 4LERA 5B1AE 3PNTB 1N9AA 4TXPA 2NYJA 3EHNA 3HRAA 3SD5A 2VQ2A 4GZDA 2WXNA 5BXOA 1A17A 4G8KA 1TYQG 4KVOA 1H2UA 3RJVA 3ASNE 3L08A 4CDMA 2XCCA 4KVMA 4TXRA 3ABKE 3UXGA 2H6IA 4XKCA 1Z3YA 3NQPA 2IJGX 1OCCE 2V4LA 3ASOE 3VLEA 4C9BB 1E7UA 3LS8A 2JLBA 4WNEA 1QQEA 4K5BA 4L9PA 2LUHA 4BTAA 3MYVA 4YVOA 2PNNA 4IYPA 4U63A 3JYSA 5ENTD 4CDRA 3UT4A 2P9UG 1GW6A 4ACLA 1NFIE 3FHEA 2AXZA 3RAUA 4HRNA 4FJZA 1N54A 3FFLA 5KJMA 2XGSA 4YDEA 2WMOA 4HI9A 2C0MA 4GZ5A 2ONDA 2R17C 4C48B 3HVEA 3DXMG 5LP0A 2LSVA 4HOUA 2NSZA 1IQRA 2CFUA 3I4RB 3CKBA 3QB2A 2F8XK 3AS5A 1OCZE 1K1AA 2XHEA 1SQMA 2GRQB 2IO3C 1K8KG 2X6FA 2ZU6B 5CRUA 1IHBA 4GPKA 3AG4E 1HO8A 2LNIA 3OTNA 3JCKC 3G2VA 1YA0A 3PUJA 4I6JA 4O6FA 3FH7A 5DIZA 1WM5A 3FEXA 2RKKA 3UINC 3EIJA 3E37A 3HXCA 1H2VC 4A3VA 5LFAA 3E33A 4HOTA 4J8DA 1MYOA 2ETAA 4MS6A 1K3ZD 3Q7FA 5FQ4A 5CECB 4AEZC 3TJPA 3CSTA 3EJNA 1JUQA 1O1RA 4TUUA 1V54E 2E0IA 3T8MA 2ZIRA 4BY6A 4CDNA 4HBDA 5HI7A 1G3NB 4AP2A 4A1GA 2FF4A 3VLDA 3WXXA 1FPPA 2LXLA 4CEMA 2NC9A 2UY1B 3FUMA 2ZXWE 4XI9A 1AWCB 5KJKA 3TWRA 2C0LA 4L1BA 2I2OA 2X6KA 2Y69E 2XRZA 3PRZA 2KZTA 5A23A 4P29A 2I1KA 2R5SA 4WWNA 3VTXA 5ENRD 5KBAA 4D10C 3D9IA 3ISMC 2DYSE 3EIQC 3CHPA 3UT8A 1OWNA 4LNBA 2DWZA 2OOEA 4X8QA 2VSOE 1N4PA 4F6RD 5ARFA 5ANLA 4AXHA 2A4ZA 3Q49B 5LCWC 1D8EA 2BEDA 4HS2A 4DX6D 3LKUA 4XKBA 3L6AA 4UWHA 3CVWA 3V31A 2MRIA 1L5JA 3S7DA 4DK5A 3DSWA 5AQ7A 4K0RA 5ARGA 2P9PG 4G23A 3CVNA 3QDNA 2AWIA 2J49A 4G26A 2MOWA 5G55A 3C3OA 4BX8A 3R7RA 3HDXA 3L82A 1H19A 2XEEA 3ZYLA 4XE0A 1Q2ZA 2YNQA 3CVLA 2V4HC 1OY3D 3RU0A 4PH4B 5HS0A 2GROB 4PUCA 4EZJA 2X38A 2WXMA 3SY2A 2XZDG 4PS7A 3Q78A 1DCEA 5JHBA 1NA0A 4U7EB 3CEQA 1OUVA 1MJ0A 4I6GA 4M3OA 3LVQE 4C0MA 4AIFA 4L2LA 3CQGB 4RQIA 4F53A 2M63A 3CVPA 3BUAA 4WWOA 5KJLA 3N71A 4ANWA 4J8EA 3AG1E 3QARA 1JWGA 2J07A 1LD8A 5CBOA 4QFVA 3Q75A 3APDA 4G8LA 2VJ8A 4LCTA 3JQ1A 4U8HA 4UUCA 1MZCA 1N11A 4RG6A 3NB2A 4BERA 1H6KA 2GRMA 3MKQB 5C1DA 1H6PA 2AXVA 3C3QA 3ML8A 2VTBA 3SF4A 2Y0BG 5DBKA 4FADA 3APFA 3DBSA 3ABLE 4DLOA 1H6OA 4K5CA 2J09A 2WMNA 2KBXA 2HE0A 4NQ0A 1UN9A 3TXMA 4U0SA 4GMLA 3ULQA 3HG0D 2Y4UA 3HXDA 2HM8A 4JHJA 4CGWA 3Q4AB 1TN8A 1IQUA 1IXVA 2YINA 3T8KA 3PDNA 5FIOA 1HH8A 3MZLB 3D9HA 5FZRA 2J4DA 2XPZA 4URKA 4I9CA 3E32A 3CK7A 3E4BA 4Q96A 2WXKA 1UN8A 3Q79A 4FHJA 3UKUG 4CT0A 3TG5A 3MA5A 5KWDA 3B13A 3FTUA 1HS6A 3TWTA 4O1PA 3FH8A 3RKVA 4GCOA 3UM2A 1N95A 4ANUA 3Q7AA 3E30A 4I2WA 4EBAA 2PQNA 2I9CA 3CHQA 5G04C 2QC9A 3FULA 1YYHA 1MX2A 3DEOA 4WUYA 5CCMA 1NI1A 1E90A 5A7DB 4HFGA 3DSUA 4GTTA 4ILGA 3QWWA 1UG3A 4G1TA 3HXBA 1MQSA 4DX7D 2OVFA 5KNGA 3HXFA 4GTRA 3FUNA 3FU0A 3LJNA 3HHMA 3LDZA 2EIME 5BT1A 4WWPA 2GRNB 2FBNA 2R02A 5FZSA 4E6HA 2J08A 3DSTA 2LXMA 4TUMA 4KYOB 1HZ4A 5EX0A 2J4BA 2P58C 2IOLA 3FU3A 3QAQA 2LSUA 3FTZA 3GZ1A 2IFUA 2A5EA 2PQRA 1WDYA 5AJLA 1S0PA 3EHQA 3V79K 3BQOA 5ENQD 2DYRE 4JHRA 3RIBA 1SVXA 1W3BA 3PREA 5EYPF 3RO3A 5FQ6A 3HXEA 1Y6IA 2VSXE 2NXPA 4U0UA 3LYAA 3Q5MA 3EDTB 2LO6A 3L22A 2DIWA 4J8FA 2WB2A 3G2TA 3D9LA 4N2QA 2R59A 4EHMA 2JABA 4FULA 1OT8A 4NIKA 1FT1A 5M72A 3QC1A 3Q9UC 4Z68A 3CHMA 3T5XA 5B3SE 1SA4A 3D9OA 3HIZA 4U07A 4U95D 3OXFA 1ZB1A 1D8DA 4ANXA 2AVPA 2HO1A 1Z3XA 1E96B 3IBEA 3L54A 2GRLA 1P5QA 2YQ8A 2WPVA 4A55A 1Y8MA 2XPIA 4FLHA 1E8WA 3FUIA 2VGXB 2WM9A 1ELWA 3LY7A 4GTVA 2QZAA 4G25A 3Q73A 2V0PA 2MHKA 1FVFA 4JA7A 3RO2A 2BKGA 3ZNGA 2GRRB 1A5EA 4I6EA 4I1MA 1ZU2A 2XRYA 2XGMA 4B8CB 1SA5A 3MKRA 4DRXE 4L2YA 3ASGA 3OXLA 4BT9A 3G2SA 3LY8A 3DRAA 5AQ9A 2RFAA 5FZQA 4EBAG 1E7VA 4RLYA 5BV1A 3ZN3A 1DNPA 5HKPA 4JXTA 4BEPA 4CZ2D 2DZOA 2EILE 2DVWA 2WXHA 1X81A 5D66A 4LRZA 4BETA 2KCLA 5FT9A 3ZHEA 1E8XA 3PE3A 2HYZA 3PEUB 2BF0X 4G24A 2RG8A 1TR4A 3SQVA 3TWSA 3URZA 4GMRA 3FH5A 4FLBA 3TAXA 4I43A 3OAWA 1D9SA 4JW1A 1BD8A 4O1OA 1ELKA 1TNOA 1HFAA 1BU9A 1LTXA 2I1JA 2VSYA 3U66A 1HXIA 4WNFA 1MX6A 3R7QA 5LCWJ 3UM3A 3PH0C 3U3WA 1FCHA 5ANRA 4JB8P 2XS8A 1PAQA 3FEYA 4GTSA 5FINA 2IOSA 5EDSA 2CHZA 5JMND 4YVQC 2XEHA 1KT0A 2DCPA 4CCAA 4H7XA 2EQXA 3CGHA 4XIFA 4WAFA 2IU1A 1TN7A 3MCXA 4YDOA 1EDUA 4PS3A 4HVBA 2EIKE 2XENA 3PNLB 4APOA 4B8AA 2H6HA 1WY6A 5BPPA 4GYYA 3JUIA 4KT6B 5JHAA 3SFYA 3QWPA 4FHKA 2OCCE 3TWWA 4GA0A 3RRMB 3G2WA 1DCQA 4UI9K 5EKQD 5B1BE 2ETCA 3KEZA 2GRPB 3UT7A 1NA3A 4CRWA 2L6BA 3CVXA 5AQAA 2R03A 3EU9A 4H7YA 4XZ4A 2KATA 1EF1C 3TWUA 4KZCA 2VGEA 3LXUX 5FWQA 4HI8A 4J8YA 5EILA 3CVQA 4EPZA 4DLQA 2DZNA 2F37A 3QNKA 4AV7A 2L9BA 4N3AA 5JJTA 2IY0C 5AYWD 1BI7B 3VLFA 2P9SG 1TN6A 2P9NG 4M7CA 4HRLA 2PL2A 4A3TA 2FULA 3EU5A 2CG3A 3PS6A 3U9WA 4FC8A 4MBGA 2PM6A 2QY7A 3SBTB 3DSXA 4WNDA 4GYWA 3CQCB 5J08A 3AU5A 2V5QC 3C3RA 4B94A 5AARA 5AAOA 3ZIMA 1VDYA 3KS2A 1IHGA 4HLEA 3MV2B 1IKND 4O60A 2WXRA 3ZU7B 2R2LA 3D9NA 1H2TC 4HB5A 1OWOA 3SFZA 5JJ7A 3SHFA 3FU6A 2OEVA 2WXQA 3LY9A 3VTYA 4GA2A 3RRUA 2H6GA 3DXKG 3P1UA 4J0UA 3E34A 4NRHB 4Q69A 3P2BA 3ZKJA 5KCMA 4IN3B 3G2UA 1V55E 4Y6WA 4EZLA 4Q94A 4U8YD 3S7JA 1B89A 4GZCA 2XPYA 1FT2A 3TXNA 3MGBA 4FP7A 4KZ0A 2J9QA 1KLXA 3CLJA 3ZPJA 3ONKA 1TJCA 4W9RA 2Y1LE 3NZSA 3UI2A 1NP7A 3ABME 2DBAA 3C98A 1K1BA 1PC2A 3ASHA 3APCA 3AG3E 3CHSA 4GMJA 3CHRA 4Y6CA 1U3DA 3IHVA 1WG0A 3RK6A 4L7TA 5FQ8A 5CEDB 3GYZA 4CYMD 3R9MA 2XEVA 4HNAD 1BI8B 4BTBA 3CK9A 3NZUA 4DJAA 3C72A 5G04J 2XS1A 2FI7A 5KNHD 4A1SA 3MX3A 4V3IA 1JWFA 3MEKA 4GZ6A 4J7WA 4K03A 5EIBE 3ZYQA 2KCVA 1DC2A 5G2NA 2WXFA 4UQZA 2WXJA 3D9JA 1LD7A 4I9EA 3CVUA 1X5BA 3V2OA 5E75A 4BWRA 3UUXA 4LEUA 2ZISA 4F1SA 2WVIA 4OVVA 5FJYA 3AS4A 3QWVA 1UOHA 1JPLA 3V2XA 2P9KG 4GU5A 1E8YA 4GPMA 1TNBA 4CT4A 5BV0A 3OXGA 1TNUA 4ILHB 1H0AA 3KSQA 2WXOA 3CV0A 2KC7A 3ZVVA 4TV3A 4I1OB 3SGHA 4UI9C 5JA4D 3TWXA 4AJWA 3ULYA 5ENSD 1HU3A 1OWMA 4AY6A 4YNDA 1OWPA 2L0IA 2LAIA 1U3CA 3UIPC 2FO1E 3ZGQA 3ASDA 5CRVA 3Q47B 3NAWA 3UX4A 4TRQA 5HRYA 3TGOA 4B93B 1KT1A 2P2CP 4GTOA 1JCSA 4FJYA 4GZ3A 3IEGA 3ZXSA 2VTBB 3KAEA 1N4RA 1PY1A 4GB9A 5T3RA 1YMPA 3D9PA 2YHCA 5ENOD 4AVXA 1N94A 2EIJE 5EYLA 4HOSA 4HXIA 3GZ2A 2WXIA 4QQIA 4BSXA 1LF8A 2OEWA 5LX8A 2LAHA 4UWKA 2XGOA 2XQ0A 3NOGD 3D9KA 1BPOA 3B7SA 1ELRA 5G05J 1UJKA 1OXJA 3DWLG 4LSZE 3CIAA 1Z6TA 3F6QA 3DPDA 2WXPA 1KZPA 3PZ3A 4G2VA 3BG0B 4KBQA 2UY1A 4JZYA 1SZ9A 2IONA 4YDYA 5D0OD 5EN5D 4F1PA 4ANVA 2WQ6A 1XNFA 1UJJA 3L17A 2ILRA 5C2YA 2BUGA 3NBNB 1WAO1 4DI4A 2BKKB 3AG2E 4F7AA 4IRUA 3S7BA 2MYOA 4GCNA 3I3NA 3QJZA 2OV8A 5CBNA 3B7TA 2GW1A 4XI0A 5G05C 4BESA 2XCBA 3JXJA 5T8IA 4EECA 3KEAA 2X3MA 3LVRE 4GAAA 1TJFA 1RW2A 2L0TB 4LUNU 5ENPD 1N0QA 2Y3AA 1FVHA 2J8SD 3L16A 4ACKA 2WQHA 3DEPA 1HX8A 2FO7A 3FUHA 1SZAA 4ILIA 3ML9A 5JJ6A 4I2ZA 4KXKB 3LJ3A 4HRMB 1OCOE 3IXEA 5AN8A 1S70B 4ABNA 1KZOA 2HR2A 1YCSB 4OAVB 3FUDA 1AP7A 3T9KA 3S7FA 4JA9A 2EINE 4EQFA 2RFMA 3SFXA 4N3BA 4N39A 3SO8A 2YHEA 3UIOC 5ENNA 4ATZD 4YDWA 1OCRE 4U04A 2V5FA 3NOCD 4N5QA 3CVVA 5ITZF 2KM4A 1N52A 2QFCA 5J90A 3PZDA 5BNWA 4PS8A 3TG4A 3UM0A 2L6JA 3U4TA 2KCKA 4BT8A 2R05A 3ZUVB 2CHWA 2H6FA 3KSLA 3NF1A 3WG7E 3ZYKA 4L23A 3W9FA 4DX5D 4GTPA 4E85A 3BU8A 2QYJA 4U8VD 4B89A 5BUZA 5D2MC 4AOFA 3LEWA 5KJNA 4N3CA 4MRUA 2ZGDA 3BEEA 3MKQA 4J8SA 1O5MA 2PM7A 4GA1A 5LOZA 4MKTA 3HVEB 1MHQA 2F0YA 3JXIA 3AU4A 3DSSA 2OVBA 3O48A 3JUEA 3UPVA 3FUFA 3C5RA 4UWFA 3UKRG 2IEJA 3S2AA 4UWLA 3R9AB 2IF4A 3EHRA 1TEZA 4NURA 4K5AB 3GZSA 2X6IA 2B0OE 2A5UA 2P9IG 1EYHA 4N2SA 3KD7A 3PZ1A 1INZA 2KXPC 3FP3A 5FTPA 5BXUA 2CG2A 3PZ4A 1N4SA 4ATGA 2FEZA 3ZHEB 4GYOA 4TXQA 3X2QE 3FTWA 5BW8C 4DX1A 3UTMA 5HQ8A 3ENEA 4PDXA 4U96D 2X6HA 4J6IA 3T5VA 5AQBA 4RVBA 1NZNA 3FTXA 3RSEG 3CR3A 2E2EA 3IKOB 1HG5A 1ZBPA 4UWGA 4LNGA 3CSFA 1DVPA 5AIJA 5CMWA 5AJDA 3QK0A 4JEUA 3UMVA 3CHOA 2XZTG 4JPSA 2RD0A 4OVUA 1QBQA 4LNUD 3GW4A 1E8ZA 3ZRHA 5EX3A 2WXGA 3FTYA 4JD2G 3B7UX 2WQ7A 1KPSB 4N5CA 4NACA 4DI3A 3TWQA 1SW6A 3IV0A 3ZXPA 2ZGGA 3SI5A 3EHMA 2AW6A 3ZEFA 4WNGA 5CMYA 4DX2A 2KZTB 2JEKA 3L13A 4AY5A 3UM1A 3FUKA 1HE8A 4R7LA 4FA6A 4JL0A 3I4GA 3AS8A 2GGFA 1TNZA 4EZKA 3FTVA 2ETBA 4HORA 1O1SA 3PZ2A 1BLXB 3Q9NC 3CK8A 4F3VA 4CGVA 3V30A 4XEIG 3SNXA 5CCLA 1U2VG 3U64A 2VSNA 3MV3B 5H7PA 3ZW3A 4I17A 4OYSA 3SBSA 3ONLA 1QYMA 3ESLA 3I5PA 3Q15A 4BX9A 3ESKA 4FU3A 2Q7FA 4RG9A 1TNYA 4JHKA 2B6CA 1EPUA 3EUVA 3DPYA 5CHEE 4C0EA 3PUKA 3HYMB 3B7RL 4OAUC 4UI9J 4AM9A 3LCAA 4UQYA 4ME2A 3K9IA 3W9GA 2X6JA 4ZFHA 2P9LG 1N4QA 2CHXA 3D9MA 2IO2C 1MX4A 5EIDA 1HG2A 3BG1B 3B7BA 3FWVA 3SZ7A 2BTDA 4IULA 4ZHBA 1S63A 3FY4A 2CFZA 1Z5SC 3PEVB 3MJWA 3D3MA 1JCRA 3AAAC 4HLLA 1UW4B 3ASFA 4XX5A 3FUEA 3IHYA 2Y4TA 3JQ0A
chains in the Genus database with same CATH topology
1N9AA 4LNBA 3DSXA 3E32A 1JCQA 1TNZA 3Q79A 1N4PA 1O1SA 3PZ1A 1SA5A 3PZ2A 3C72A 1LD8A 1D8EA 4GTOA 1JCSA 2BEDA 3E37A 3HXCA 1TN7A 3Q75A 3PZ4A 3E33A 1N4SA 4YDOA 3DRAA 2H6IA 1N4RA 3DSVA 3HXEA 3Q7FA 1N95A 2H6HA 2H6FA 3KSLA 1O1TA 1MZCA 2R2LA 3Q7AA 4L9PA 3DSWA 3E30A 4GTPA 3SFYA 1O1RA 1N94A 4EHMA 1LD7A 1X81A 1TNYA 2ZIRA 2H6GA 1FT1A 3EUVA 1NI1A 3DPYA 4LNGA 3E34A 3DSUA 4GTTA 2ZISA 4GTQA 1SA4A 3HXBA 4YDEA 1QBQA 1O5MA 1S64A 1FPPA 3HXFA 4GTRA 1D8DA 1N4QA 2F0YA 1TNBA 3DSSA 1TNUA 1TNOA 1FT2A 3KSQA 1LTXA 1KZOA 3HXDA 2IEJA 1KZPA 1S63A 3PZ3A 4GTVA 3Q78A 1TN6A 3DSTA 1DCEA 4GTMA 3Q73A 1NL4A 1TN8A 1JCRA 3EU5A 3SFXA 4GTSA 4MBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9A A;  4LNB A;  3DSX A;  3E32 A;  1JCQ A;  1TNZ A;  3Q79 A;  1N4P A;  1O1S A;  3PZ1 A;  1SA5 A;  3PZ2 A;  3C72 A;  1LD8 A;  1D8E A;  4GTO A;  1JCS A;  2BED A;  3E37 A;  3HXC A;  1TN7 A;  3Q75 A;  3PZ4 A;  3E33 A;  1N4S A;  4YDO A;  3DRA A;  2H6I A;  1N4R A;  3DSV A;  3HXE A;  3Q7F A;  1N95 A;  2H6H A;  2H6F A;  3KSL A;  1O1T A;  1MZC A;  2R2L A;  3Q7A A;  4L9P A;  3DSW A;  3E30 A;  4GTP A;  3SFY A;  1O1R A;  1N94 A;  4EHM A;  1LD7 A;  1X81 A;  1TNY A;  2ZIR A;  2H6G A;  1FT1 A;  3EUV A;  1NI1 A;  3DPY A;  4LNG A;  3E34 A;  3DSU A;  4GTT A;  2ZIS A;  4GTQ A;  1SA4 A;  3HXB A;  4YDE A;  1QBQ A;  1O5M A;  1S64 A;  1FPP A;  3HXF A;  4GTR A;  1D8D A;  1N4Q A;  2F0Y A;  1TNB A;  3DSS A;  1TNU A;  1TNO A;  1FT2 A;  3KSQ A;  1LTX A;  1KZO A;  3HXD A;  2IEJ A;  1KZP A;  1S63 A;  3PZ3 A;  4GTV A;  3Q78 A;  1TN6 A;  3DST A;  1DCE A;  4GTM A;  3Q73 A;  1NL4 A;  1TN8 A;  1JCR A;  3EU5 A;  3SFX A;  4GTS A;  4MBG A; 
#chains in the Genus database with same CATH topology
 2C2L A;  4G11 A;  2VGX A;  4LG6 A;  3TL5 A;  5FQ7 A;  2V8S E;  1JCQ A;  3L9T A;  4MLP A;  3CVY A;  4U0Z A;  4I1A A;  5IY5 E;  4KMO A;  4HOQ A;  4APF A;  1HF8 A;  4JEH A;  3ZYM A;  5CEA A;  3TWV A;  4UQX A;  5A6C A;  3FU5 A;  2VGY A;  2PZI A;  4JC8 A;  3AJI A;  3DSV A;  4BFR A;  5D0Q D;  2AXU A;  1O1T A;  1RZ4 A;  3O4Z A;  5CER B;  2IQC A;  4HQD A;  1XGW A;  2UWJ G;  1OWL A;  3LPZ A;  3RRN B;  1QZ2 A;  2AJA A;  4B0Z A;  5E76 A;  5T4Y A;  3J5P A;  2QYU A;  3ULE G;  3ZFW A;  3B95 A;  1QNF A;  3QKY A;  4DPR A;  4GTQ A;  4DUI A;  2F8Y A;  3PVL A;  3QOU A;  4RSY A;  2I6H A;  1S64 A;  3FDH A;  4BSZ B;  2WXL A;  3PE4 A;  5AEN A;  1IYG A;  3CKC A;  1N0R A;  4JVS A;  3FUJ A;  2VYI A;  3J5Q B;  3FTS A;  4A63 B;  3UQ3 A;  4GTM A;  1NL4 A;  4LER A;  5B1A E;  3PNT B;  1N9A A;  4TXP A;  2NYJ A;  3EHN A;  3HRA A;  3SD5 A;  2VQ2 A;  4GZD A;  2WXN A;  5BXO A;  1A17 A;  4G8K A;  1TYQ G;  4KVO A;  1H2U A;  3RJV A;  3ASN E;  3L08 A;  4CDM A;  2XCC A;  4KVM A;  4TXR A;  3ABK E;  3UXG A;  2H6I A;  4XKC A;  1Z3Y A;  3NQP A;  2IJG X;  1OCC E;  2V4L A;  3ASO E;  3VLE A;  4C9B B;  1E7U A;  3LS8 A;  2JLB A;  4WNE A;  1QQE A;  4K5B A;  4L9P A;  2LUH A;  4BTA A;  3MYV A;  4YVO A;  2PNN A;  4IYP A;  4U63 A;  3JYS A;  5ENT D;  4CDR A;  3UT4 A;  2P9U G;  1GW6 A;  4ACL A;  1NFI E;  3FHE A;  2AXZ A;  3RAU A;  4HRN A;  4FJZ A;  1N54 A;  3FFL A;  5KJM A;  2XGS A;  4YDE A;  2WMO A;  4HI9 A;  2C0M A;  4GZ5 A;  2OND A;  2R17 C;  4C48 B;  3HVE A;  3DXM G;  5LP0 A;  2LSV A;  4HOU A;  2NSZ A;  1IQR A;  2CFU A;  3I4R B;  3CKB A;  3QB2 A;  2F8X K;  3AS5 A;  1OCZ E;  1K1A A;  2XHE A;  1SQM A;  2GRQ B;  2IO3 C;  1K8K G;  2X6F A;  2ZU6 B;  5CRU A;  1IHB A;  4GPK A;  3AG4 E;  1HO8 A;  2LNI A;  3OTN A;  3JCK C;  3G2V A;  1YA0 A;  3PUJ A;  4I6J A;  4O6F A;  3FH7 A;  5DIZ A;  1WM5 A;  3FEX A;  2RKK A;  3UIN C;  3EIJ A;  3E37 A;  3HXC A;  1H2V C;  4A3V A;  5LFA A;  3E33 A;  4HOT A;  4J8D A;  1MYO A;  2ETA A;  4MS6 A;  1K3Z D;  3Q7F A;  5FQ4 A;  5CEC B;  4AEZ C;  3TJP A;  3CST A;  3EJN A;  1JUQ A;  1O1R A;  4TUU A;  1V54 E;  2E0I A;  3T8M A;  2ZIR A;  4BY6 A;  4CDN A;  4HBD A;  5HI7 A;  1G3N B;  4AP2 A;  4A1G A;  2FF4 A;  3VLD A;  3WXX A;  1FPP A;  2LXL A;  4CEM A;  2NC9 A;  2UY1 B;  3FUM A;  2ZXW E;  4XI9 A;  1AWC B;  5KJK A;  3TWR A;  2C0L A;  4L1B A;  2I2O A;  2X6K A;  2Y69 E;  2XRZ A;  3PRZ A;  2KZT A;  5A23 A;  4P29 A;  2I1K A;  2R5S A;  4WWN A;  3VTX A;  5ENR D;  5KBA A;  4D10 C;  3D9I A;  3ISM C;  2DYS E;  3EIQ C;  3CHP A;  3UT8 A;  1OWN A;  4LNB A;  2DWZ A;  2OOE A;  4X8Q A;  2VSO E;  1N4P A;  4F6R D;  5ARF A;  5ANL A;  4AXH A;  2A4Z A;  3Q49 B;  5LCW C;  1D8E A;  2BED A;  4HS2 A;  4DX6 D;  3LKU A;  4XKB A;  3L6A A;  4UWH A;  3CVW A;  3V31 A;  2MRI A;  1L5J A;  3S7D A;  4DK5 A;  3DSW A;  5AQ7 A;  4K0R A;  5ARG A;  2P9P G;  4G23 A;  3CVN A;  3QDN A;  2AWI A;  2J49 A;  4G26 A;  2MOW A;  5G55 A;  3C3O A;  4BX8 A;  3R7R A;  3HDX A;  3L82 A;  1H19 A;  2XEE A;  3ZYL A;  4XE0 A;  1Q2Z A;  2YNQ A;  3CVL A;  2V4H C;  1OY3 D;  3RU0 A;  4PH4 B;  5HS0 A;  2GRO B;  4PUC A;  4EZJ A;  2X38 A;  2WXM A;  3SY2 A;  2XZD G;  4PS7 A;  3Q78 A;  1DCE A;  5JHB A;  1NA0 A;  4U7E B;  3CEQ A;  1OUV A;  1MJ0 A;  4I6G A;  4M3O A;  3LVQ E;  4C0M A;  4AIF A;  4L2L A;  3CQG B;  4RQI A;  4F53 A;  2M63 A;  3CVP A;  3BUA A;  4WWO A;  5KJL A;  3N71 A;  4ANW A;  4J8E A;  3AG1 E;  3QAR A;  1JWG A;  2J07 A;  1LD8 A;  5CBO A;  4QFV A;  3Q75 A;  3APD A;  4G8L A;  2VJ8 A;  4LCT A;  3JQ1 A;  4U8H A;  4UUC A;  1MZC A;  1N11 A;  4RG6 A;  3NB2 A;  4BER A;  1H6K A;  2GRM A;  3MKQ B;  5C1D A;  1H6P A;  2AXV A;  3C3Q A;  3ML8 A;  2VTB A;  3SF4 A;  2Y0B G;  5DBK A;  4FAD A;  3APF A;  3DBS A;  3ABL E;  4DLO A;  1H6O A;  4K5C A;  2J09 A;  2WMN A;  2KBX A;  2HE0 A;  4NQ0 A;  1UN9 A;  3TXM A;  4U0S A;  4GML A;  3ULQ A;  3HG0 D;  2Y4U A;  3HXD A;  2HM8 A;  4JHJ A;  4CGW A;  3Q4A B;  1TN8 A;  1IQU A;  1IXV A;  2YIN A;  3T8K A;  3PDN A;  5FIO A;  1HH8 A;  3MZL B;  3D9H A;  5FZR A;  2J4D A;  2XPZ A;  4URK A;  4I9C A;  3E32 A;  3CK7 A;  3E4B A;  4Q96 A;  2WXK A;  1UN8 A;  3Q79 A;  4FHJ A;  3UKU G;  4CT0 A;  3TG5 A;  3MA5 A;  5KWD A;  3B13 A;  3FTU A;  1HS6 A;  3TWT A;  4O1P A;  3FH8 A;  3RKV A;  4GCO A;  3UM2 A;  1N95 A;  4ANU A;  3Q7A A;  3E30 A;  4I2W A;  4EBA A;  2PQN A;  2I9C A;  3CHQ A;  5G04 C;  2QC9 A;  3FUL A;  1YYH A;  1MX2 A;  3DEO A;  4WUY A;  5CCM A;  1NI1 A;  1E90 A;  5A7D B;  4HFG A;  3DSU A;  4GTT A;  4ILG A;  3QWW A;  1UG3 A;  4G1T A;  3HXB A;  1MQS A;  4DX7 D;  2OVF A;  5KNG A;  3HXF A;  4GTR A;  3FUN A;  3FU0 A;  3LJN A;  3HHM A;  3LDZ A;  2EIM E;  5BT1 A;  4WWP A;  2GRN B;  2FBN A;  2R02 A;  5FZS A;  4E6H A;  2J08 A;  3DST A;  2LXM A;  4TUM A;  4KYO B;  1HZ4 A;  5EX0 A;  2J4B A;  2P58 C;  2IOL A;  3FU3 A;  3QAQ A;  2LSU A;  3FTZ A;  3GZ1 A;  2IFU A;  2A5E A;  2PQR A;  1WDY A;  5AJL A;  1S0P A;  3EHQ A;  3V79 K;  3BQO A;  5ENQ D;  2DYR E;  4JHR A;  3RIB A;  1SVX A;  1W3B A;  3PRE A;  5EYP F;  3RO3 A;  5FQ6 A;  3HXE A;  1Y6I A;  2VSX E;  2NXP A;  4U0U A;  3LYA A;  3Q5M A;  3EDT B;  2LO6 A;  3L22 A;  2DIW A;  4J8F A;  2WB2 A;  3G2T A;  3D9L A;  4N2Q A;  2R59 A;  4EHM A;  2JAB A;  4FUL A;  1OT8 A;  4NIK A;  1FT1 A;  5M72 A;  3QC1 A;  3Q9U C;  4Z68 A;  3CHM A;  3T5X A;  5B3S E;  1SA4 A;  3D9O A;  3HIZ A;  4U07 A;  4U95 D;  3OXF A;  1ZB1 A;  1D8D A;  4ANX A;  2AVP A;  2HO1 A;  1Z3X A;  1E96 B;  3IBE A;  3L54 A;  2GRL A;  1P5Q A;  2YQ8 A;  2WPV A;  4A55 A;  1Y8M A;  2XPI A;  4FLH A;  1E8W A;  3FUI A;  2VGX B;  2WM9 A;  1ELW A;  3LY7 A;  4GTV A;  2QZA A;  4G25 A;  3Q73 A;  2V0P A;  2MHK A;  1FVF A;  4JA7 A;  3RO2 A;  2BKG A;  3ZNG A;  2GRR B;  1A5E A;  4I6E A;  4I1M A;  1ZU2 A;  2XRY A;  2XGM A;  4B8C B;  1SA5 A;  3MKR A;  4DRX E;  4L2Y A;  3ASG A;  3OXL A;  4BT9 A;  3G2S A;  3LY8 A;  3DRA A;  5AQ9 A;  2RFA A;  5FZQ A;  4EBA G;  1E7V A;  4RLY A;  5BV1 A;  3ZN3 A;  1DNP A;  5HKP A;  4JXT A;  4BEP A;  4CZ2 D;  2DZO A;  2EIL E;  2DVW A;  2WXH A;  1X81 A;  5D66 A;  4LRZ A;  4BET A;  2KCL A;  5FT9 A;  3ZHE A;  1E8X A;  3PE3 A;  2HYZ A;  3PEU B;  2BF0 X;  4G24 A;  2RG8 A;  1TR4 A;  3SQV A;  3TWS A;  3URZ A;  4GMR A;  3FH5 A;  4FLB A;  3TAX A;  4I43 A;  3OAW A;  1D9S A;  4JW1 A;  1BD8 A;  4O1O A;  1ELK A;  1TNO A;  1HFA A;  1BU9 A;  1LTX A;  2I1J A;  2VSY A;  3U66 A;  1HXI A;  4WNF A;  1MX6 A;  3R7Q A;  5LCW J;  3UM3 A;  3PH0 C;  3U3W A;  1FCH A;  5ANR A;  4JB8 P;  2XS8 A;  1PAQ A;  3FEY A;  4GTS A;  5FIN A;  2IOS A;  5EDS A;  2CHZ A;  5JMN D;  4YVQ C;  2XEH A;  1KT0 A;  2DCP A;  4CCA A;  4H7X A;  2EQX A;  3CGH A;  4XIF A;  4WAF A;  2IU1 A;  1TN7 A;  3MCX A;  4YDO A;  1EDU A;  4PS3 A;  4HVB A;  2EIK E;  2XEN A;  3PNL B;  4APO A;  4B8A A;  2H6H A;  1WY6 A;  5BPP A;  4GYY A;  3JUI A;  4KT6 B;  5JHA A;  3SFY A;  3QWP A;  4FHK A;  2OCC E;  3TWW A;  4GA0 A;  3RRM B;  3G2W A;  1DCQ A;  4UI9 K;  5EKQ D;  5B1B E;  2ETC A;  3KEZ A;  2GRP B;  3UT7 A;  1NA3 A;  4CRW A;  2L6B A;  3CVX A;  5AQA A;  2R03 A;  3EU9 A;  4H7Y A;  4XZ4 A;  2KAT A;  1EF1 C;  3TWU A;  4KZC A;  2VGE A;  3LXU X;  5FWQ A;  4HI8 A;  4J8Y A;  5EIL A;  3CVQ A;  4EPZ A;  4DLQ A;  2DZN A;  2F37 A;  3QNK A;  4AV7 A;  2L9B A;  4N3A A;  5JJT A;  2IY0 C;  5AYW D;  1BI7 B;  3VLF A;  2P9S G;  1TN6 A;  2P9N G;  4M7C A;  4HRL A;  2PL2 A;  4A3T A;  2FUL A;  3EU5 A;  2CG3 A;  3PS6 A;  3U9W A;  4FC8 A;  4MBG A;  2PM6 A;  2QY7 A;  3SBT B;  3DSX A;  4WND A;  4GYW A;  3CQC B;  5J08 A;  3AU5 A;  2V5Q C;  3C3R A;  4B94 A;  5AAR A;  5AAO A;  3ZIM A;  1VDY A;  3KS2 A;  1IHG A;  4HLE A;  3MV2 B;  1IKN D;  4O60 A;  2WXR A;  3ZU7 B;  2R2L A;  3D9N A;  1H2T C;  4HB5 A;  1OWO A;  3SFZ A;  5JJ7 A;  3SHF A;  3FU6 A;  2OEV A;  2WXQ A;  3LY9 A;  3VTY A;  4GA2 A;  3RRU A;  2H6G A;  3DXK G;  3P1U A;  4J0U A;  3E34 A;  4NRH B;  4Q69 A;  3P2B A;  3ZKJ A;  5KCM A;  4IN3 B;  3G2U A;  1V55 E;  4Y6W A;  4EZL A;  4Q94 A;  4U8Y D;  3S7J A;  1B89 A;  4GZC A;  2XPY A;  1FT2 A;  3TXN A;  3MGB A;  4FP7 A;  4KZ0 A;  2J9Q A;  1KLX A;  3CLJ A;  3ZPJ A;  3ONK A;  1TJC A;  4W9R A;  2Y1L E;  3NZS A;  3UI2 A;  1NP7 A;  3ABM E;  2DBA A;  3C98 A;  1K1B A;  1PC2 A;  3ASH A;  3APC A;  3AG3 E;  3CHS A;  4GMJ A;  3CHR A;  4Y6C A;  1U3D A;  3IHV A;  1WG0 A;  3RK6 A;  4L7T A;  5FQ8 A;  5CED B;  3GYZ A;  4CYM D;  3R9M A;  2XEV A;  4HNA D;  1BI8 B;  4BTB A;  3CK9 A;  3NZU A;  4DJA A;  3C72 A;  5G04 J;  2XS1 A;  2FI7 A;  5KNH D;  4A1S A;  3MX3 A;  4V3I A;  1JWF A;  3MEK A;  4GZ6 A;  4J7W A;  4K03 A;  5EIB E;  3ZYQ A;  2KCV A;  1DC2 A;  5G2N A;  2WXF A;  4UQZ A;  2WXJ A;  3D9J A;  1LD7 A;  4I9E A;  3CVU A;  1X5B A;  3V2O A;  5E75 A;  4BWR A;  3UUX A;  4LEU A;  2ZIS A;  4F1S A;  2WVI A;  4OVV A;  5FJY A;  3AS4 A;  3QWV A;  1UOH A;  1JPL A;  3V2X A;  2P9K G;  4GU5 A;  1E8Y A;  4GPM A;  1TNB A;  4CT4 A;  5BV0 A;  3OXG A;  1TNU A;  4ILH B;  1H0A A;  3KSQ A;  2WXO A;  3CV0 A;  2KC7 A;  3ZVV A;  4TV3 A;  4I1O B;  3SGH A;  4UI9 C;  5JA4 D;  3TWX A;  4AJW A;  3ULY A;  5ENS D;  1HU3 A;  1OWM A;  4AY6 A;  4YND A;  1OWP A;  2L0I A;  2LAI A;  1U3C A;  3UIP C;  2FO1 E;  3ZGQ A;  3ASD A;  5CRV A;  3Q47 B;  3NAW A;  3UX4 A;  4TRQ A;  5HRY A;  3TGO A;  4B93 B;  1KT1 A;  2P2C P;  4GTO A;  1JCS A;  4FJY A;  4GZ3 A;  3IEG A;  3ZXS A;  2VTB B;  3KAE A;  1N4R A;  1PY1 A;  4GB9 A;  5T3R A;  1YMP A;  3D9P A;  2YHC A;  5ENO D;  4AVX A;  1N94 A;  2EIJ E;  5EYL A;  4HOS A;  4HXI A;  3GZ2 A;  2WXI A;  4QQI A;  4BSX A;  1LF8 A;  2OEW A;  5LX8 A;  2LAH A;  4UWK A;  2XGO A;  2XQ0 A;  3NOG D;  3D9K A;  1BPO A;  3B7S A;  1ELR A;  5G05 J;  1UJK A;  1OXJ A;  3DWL G;  4LSZ E;  3CIA A;  1Z6T A;  3F6Q A;  3DPD A;  2WXP A;  1KZP A;  3PZ3 A;  4G2V A;  3BG0 B;  4KBQ A;  2UY1 A;  4JZY A;  1SZ9 A;  2ION A;  4YDY A;  5D0O D;  5EN5 D;  4F1P A;  4ANV A;  2WQ6 A;  1XNF A;  1UJJ A;  3L17 A;  2ILR A;  5C2Y A;  2BUG A;  3NBN B;  1WAO 1;  4DI4 A;  2BKK B;  3AG2 E;  4F7A A;  4IRU A;  3S7B A;  2MYO A;  4GCN A;  3I3N A;  3QJZ A;  2OV8 A;  5CBN A;  3B7T A;  2GW1 A;  4XI0 A;  5G05 C;  4BES A;  2XCB A;  3JXJ A;  5T8I A;  4EEC A;  3KEA A;  2X3M A;  3LVR E;  4GAA A;  1TJF A;  1RW2 A;  2L0T B;  4LUN U;  5ENP D;  1N0Q A;  2Y3A A;  1FVH A;  2J8S D;  3L16 A;  4ACK A;  2WQH A;  3DEP A;  1HX8 A;  2FO7 A;  3FUH A;  1SZA A;  4ILI A;  3ML9 A;  5JJ6 A;  4I2Z A;  4KXK B;  3LJ3 A;  4HRM B;  1OCO E;  3IXE A;  5AN8 A;  1S70 B;  4ABN A;  1KZO A;  2HR2 A;  1YCS B;  4OAV B;  3FUD A;  1AP7 A;  3T9K A;  3S7F A;  4JA9 A;  2EIN E;  4EQF A;  2RFM A;  3SFX A;  4N3B A;  4N39 A;  3SO8 A;  2YHE A;  3UIO C;  5ENN A;  4ATZ D;  4YDW A;  1OCR E;  4U04 A;  2V5F A;  3NOC D;  4N5Q A;  3CVV A;  5ITZ F;  2KM4 A;  1N52 A;  2QFC A;  5J90 A;  3PZD A;  5BNW A;  4PS8 A;  3TG4 A;  3UM0 A;  2L6J A;  3U4T A;  2KCK A;  4BT8 A;  2R05 A;  3ZUV B;  2CHW A;  2H6F A;  3KSL A;  3NF1 A;  3WG7 E;  3ZYK A;  4L23 A;  3W9F A;  4DX5 D;  4GTP A;  4E85 A;  3BU8 A;  2QYJ A;  4U8V D;  4B89 A;  5BUZ A;  5D2M C;  4AOF A;  3LEW A;  5KJN A;  4N3C A;  4MRU A;  2ZGD A;  3BEE A;  3MKQ A;  4J8S A;  1O5M A;  2PM7 A;  4GA1 A;  5LOZ A;  4MKT A;  3HVE B;  1MHQ A;  2F0Y A;  3JXI A;  3AU4 A;  3DSS A;  2OVB A;  3O48 A;  3JUE A;  3UPV A;  3FUF A;  3C5R A;  4UWF A;  3UKR G;  2IEJ A;  3S2A A;  4UWL A;  3R9A B;  2IF4 A;  3EHR A;  1TEZ A;  4NUR A;  4K5A B;  3GZS A;  2X6I A;  2B0O E;  2A5U A;  2P9I G;  1EYH A;  4N2S A;  3KD7 A;  3PZ1 A;  1INZ A;  2KXP C;  3FP3 A;  5FTP A;  5BXU A;  2CG2 A;  3PZ4 A;  1N4S A;  4ATG A;  2FEZ A;  3ZHE B;  4GYO A;  4TXQ A;  3X2Q E;  3FTW A;  5BW8 C;  4DX1 A;  3UTM A;  5HQ8 A;  3ENE A;  4PDX A;  4U96 D;  2X6H A;  4J6I A;  3T5V A;  5AQB A;  4RVB A;  1NZN A;  3FTX A;  3RSE G;  3CR3 A;  2E2E A;  3IKO B;  1HG5 A;  1ZBP A;  4UWG A;  4LNG A;  3CSF A;  1DVP A;  5AIJ A;  5CMW A;  5AJD A;  3QK0 A;  4JEU A;  3UMV A;  3CHO A;  2XZT G;  4JPS A;  2RD0 A;  4OVU A;  1QBQ A;  4LNU D;  3GW4 A;  1E8Z A;  3ZRH A;  5EX3 A;  2WXG A;  3FTY A;  4JD2 G;  3B7U X;  2WQ7 A;  1KPS B;  4N5C A;  4NAC A;  4DI3 A;  3TWQ A;  1SW6 A;  3IV0 A;  3ZXP A;  2ZGG A;  3SI5 A;  3EHM A;  2AW6 A;  3ZEF A;  4WNG A;  5CMY A;  4DX2 A;  2KZT B;  2JEK A;  3L13 A;  4AY5 A;  3UM1 A;  3FUK A;  1HE8 A;  4R7L A;  4FA6 A;  4JL0 A;  3I4G A;  3AS8 A;  2GGF A;  1TNZ A;  4EZK A;  3FTV A;  2ETB A;  4HOR A;  1O1S A;  3PZ2 A;  1BLX B;  3Q9N C;  3CK8 A;  4F3V A;  4CGV A;  3V30 A;  4XEI G;  3SNX A;  5CCL A;  1U2V G;  3U64 A;  2VSN A;  3MV3 B;  5H7P A;  3ZW3 A;  4I17 A;  4OYS A;  3SBS A;  3ONL A;  1QYM A;  3ESL A;  3I5P A;  3Q15 A;  4BX9 A;  3ESK A;  4FU3 A;  2Q7F A;  4RG9 A;  1TNY A;  4JHK A;  2B6C A;  1EPU A;  3EUV A;  3DPY A;  5CHE E;  4C0E A;  3PUK A;  3HYM B;  3B7R L;  4OAU C;  4UI9 J;  4AM9 A;  3LCA A;  4UQY A;  4ME2 A;  3K9I A;  3W9G A;  2X6J A;  4ZFH A;  2P9L G;  1N4Q A;  2CHX A;  3D9M A;  2IO2 C;  1MX4 A;  5EID A;  1HG2 A;  3BG1 B;  3B7B A;  3FWV A;  3SZ7 A;  2BTD A;  4IUL A;  4ZHB A;  1S63 A;  3FY4 A;  2CFZ A;  1Z5S C;  3PEV B;  3MJW A;  3D3M A;  1JCR A;  3AAA C;  4HLL A;  1UW4 B;  3ASF A;  4XX5 A;  3FUE A;  3IHY A;  2Y4T A;  3JQ0 A; 
#chains in the Genus database with same CATH homology
 1N9A A;  4LNB A;  3DSX A;  3E32 A;  1JCQ A;  1TNZ A;  3Q79 A;  1N4P A;  1O1S A;  3PZ1 A;  1SA5 A;  3PZ2 A;  3C72 A;  1LD8 A;  1D8E A;  4GTO A;  1JCS A;  2BED A;  3E37 A;  3HXC A;  1TN7 A;  3Q75 A;  3PZ4 A;  3E33 A;  1N4S A;  4YDO A;  3DRA A;  2H6I A;  1N4R A;  3DSV A;  3HXE A;  3Q7F A;  1N95 A;  2H6H A;  2H6F A;  3KSL A;  1O1T A;  1MZC A;  2R2L A;  3Q7A A;  4L9P A;  3DSW A;  3E30 A;  4GTP A;  3SFY A;  1O1R A;  1N94 A;  4EHM A;  1LD7 A;  1X81 A;  1TNY A;  2ZIR A;  2H6G A;  1FT1 A;  3EUV A;  1NI1 A;  3DPY A;  4LNG A;  3E34 A;  3DSU A;  4GTT A;  2ZIS A;  4GTQ A;  1SA4 A;  3HXB A;  4YDE A;  1QBQ A;  1O5M A;  1S64 A;  1FPP A;  3HXF A;  4GTR A;  1D8D A;  1N4Q A;  2F0Y A;  1TNB A;  3DSS A;  1TNU A;  1TNO A;  1FT2 A;  3KSQ A;  1LTX A;  1KZO A;  3HXD A;  2IEJ A;  1KZP A;  1S63 A;  3PZ3 A;  4GTV A;  3Q78 A;  1TN6 A;  3DST A;  1DCE A;  4GTM A;  3Q73 A;  1NL4 A;  1TN8 A;  1JCR A;  3EU5 A;  3SFX A;  4GTS A;  4MBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...