1FT1A

Crystal structure of protein farnesyltransferase at 2.25 angstroms resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN FARNESYLTRANSFERASE
publication title Crystal structure of protein farnesyltransferase at 2.25 angstrom resolution.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1997-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ft1A00
4EHMA 3DSWA 1LD7A 3Q7AA 1NI1A 1N95A 1SA5A 1DCEA 4GTPA 1JCSA 1N4PA 3HXBA 4LNBA 3DRAA 3EUVA 1TNBA 1N4RA 1X81A 1NL4A 2IEJA 3Q73A 4GTMA 1TNZA 3PZ3A 3DPYA 2R2LA 1TN6A 4GTTA 1N9AA 4L9PA 1TN7A 2H6GA 3DSTA 1QBQA 1O5MA 1S64A 3E37A 1FT1A 3Q75A 3E30A 3KSQA 3PZ1A 1O1SA 1KZPA 1S63A 1TNUA 2H6HA 2ZISA 3E33A 4YDOA 1LTXA 2F0YA 1N94A 3HXFA 4YDEA 1TNOA 3C72A 3DSVA 1O1TA 1SA4A 1D8DA 4GTVA 3SFXA 2ZIRA 3DSUA 1TNYA 4LNGA 3HXEA 2BEDA 3PZ4A 3Q78A 4MBGA 1KZOA 3E32A 1LD8A 1FT2A 3EU5A 3PZ2A 1N4QA 4GTOA 1MZCA 1N4SA 3HXCA 3DSXA 3SFYA 1JCQA 1TN8A 1FPPA 3E34A 3HXDA 3KSLA 1JCRA 2H6FA 1D8EA 3Q7FA 2H6IA 1O1RA 3Q79A 4GTQA 4GTSA 4GTRA 3DSSA
chains in the Genus database with same CATH superfamily
4JA7A 4O6FA 3TGOA 5FJYA 4XX5A 3LDZA 2WXIA 4DLOA 1TR4A 3UQ3A 4GZCA 2DBAA 4UWLA 4G8KA 4DX7D 5ITZF 1JCSA 3HXBA 3ZVVA 3I3NA 3V2OA 1N4RA 1X81A 3ZEFA 1U3CA 2P9UG 2I6HA 2EIKE 5KWDA 2Q7FA 3ZXSA 4AV7A 2H6GA 2L9BA 3Q4AB 2KATA 3LY9A 1YA0A 3Q75A 3E30A 2E2EA 3V30A 4DX6D 4B0ZA 4RQIA 3MZLB 4IN3B 4I2WA 3NOGD 3UIPC 2YNQA 3RK6A 4JD2G 3UIOC 3ASGA 3ZKJA 2R17C 3JXJA 4TUUA 4RG6A 3TWWA 2NSZA 1N54A 1W3BA 3ASOE 1Q2ZA 1Z3XA 4GCOA 4WAFA 4WWPA 2XPZA 4HVBA 2LAIA 3O48A 4DI4A 1HH8A 4ATGA 3FUDA 2DIWA 3QNKA 3BU8A 2PZIA 1PC2A 4TXPA 1H6KA 2HR2A 3UMVA 1N52A 5C2YA 1UW4B 3FUIA 1OWMA 4X8QA 3TXMA 3L9TA 3L13A 1PY1A 1VDYA 2XENA 4J7WA 2KZTB 3ESLA 4FJYA 2VTBA 1ZU2A 3MV3B 2NC9A 4FU3A 5EKQD 3FTZA 2XQ0A 2NXPA 3DRAA 4Y6CA 5G05C 3JUEA 4BY6A 3EHNA 3PZ3A 1EDUA 4LRZA 1TN7A 4CDNA 2JABA 1QBQA 4FJZA 5KJLA 1SZAA 3PUKA 1OWPA 2GRLA 3BG1B 2PL2A 3MCXA 4WWOA 3QWWA 4G24A 2JLBA 1WAO1 5LP0A 3OXFA 3S7DA 4HQDA 3HHMA 4GU5A 2LSUA 4GYOA 3QARA 4YDWA 1ZBPA 4HB5A 3CQCB 3FUFA 5EX3A 2P9SG 2ZIRA 3APCA 3HXEA 2HYZA 4UWGA 5FTPA 3FEYA 3ZW3A 4ANWA 4DUIA 3UX4A 3LVQE 5ENNA 4PS3A 4GCNA 5LX8A 2GROB 5BXOA 3SI5A 1JCQA 3ONKA 2V5QC 4KXKB 3I5PA 3QC1A 3E34A 3ZYLA 3HXDA 3ZHEB 3MYVA 5E75A 2H6FA 4C9BB 2YINA 4TRQA 4HRNA 2WMOA 3D9OA 1PAQA 1FVHA 1B89A 5AENA 1SA5A 2X6KA 1KT0A 3IHYA 1MX6A 4A1SA 2XCBA 5CMWA 1H6OA 3TWTA 4KYOB 5CERB 3UINC 4HI8A 2V0PA 4JEUA 1H6PA 5ARGA 4ACLA 4U95D 3DSTA 3LYAA 2C2LA 4G25A 4GMRA 4I6JA 4XKCA 3ZYMA 3CHSA 3CK8A 4B93B 1V54E 4B89A 1HF8A 1UN8A 4OAVB 1ELKA 3C72A 4Z68A 4NIKA 4UUCA 4BEPA 3RU0A 4K5CA 4MS6A 2WXPA 2GRQB 2PQRA 4XIFA 3D9LA 5G04J 4YVOA 3CVPA 2AJAA 2XCCA 3ZXPA 3BEEA 4LG6A 1N4QA 2RFMA 5ENOD 3C3QA 3R9AB 3FUNA 4AJWA 4N3AA 3B13A 3KD7A 4CDRA 5KJNA 1OCZE 2VYIA 3VLFA 2X6FA 2OOEA 4CEMA 3D9NA 3V79K 1K1BA 1IYGA 4H7YA 3CK7A 3MX3A 5AN8A 1Z3YA 3QWVA 2FF4A 2HM8A 3AU4A 2WXMA 4AY6A 4G11A 4GTPA 4UI9J 3CV0A 1EPUA 3PDNA 2XZDG 3PE3A 4CGWA 4HLEA 1N0RA 3UM3A 4N2SA 4FHJA 1OWNA 3DBSA 2KCLA 4BT8A 4K0RA 5FZRA 1EF1C 1U3DA 5BV1A 3MKRA 3GYZA 3JUIA 3B7SA 4I1MA 3CK9A 3DEOA 2J49A 3AG1E 3C3RA 3HRAA 2ZISA 1N11A 2V5FA 5H7PA 4A1GA 1MJ0A 2WXKA 3FTWA 2VTBB 2DVWA 2YQ8A 3FHEA 3SNXA 4ANUA 3CVLA 4JW1A 3L17A 4O60A 4KVMA 3ULEG 2CHZA 2L6BA 1JUQA 2VSOE 3IXEA 4L1BA 2LSVA 3V2XA 3G2TA 4CGVA 4JEHA 2F8XK 4J6IA 2GGFA 1O1RA 5JJTA 4J0UA 4R7LA 4IULA 4B94A 5C1DA 2XGOA 3MEKA 3SBTB 2AXZA 3FULA 4DLQA 4EBAA 2OCCE 3EHMA 5A7DB 4AY5A 2P2CP 3S2AA 2KM4A 4RSYA 2PM6A 4URKA 3NOCD 1Z6TA 3DPYA 1TN6A 4GTTA 3B7UX 1HXIA 4TXQA 4PDXA 4U07A 1DNPA 4PS8A 2P9LG 5T4YA 4CYMD 1BU9A 1KZPA 4JVSA 5BPPA 3UT4A 5IY5E 2R59A 1MX4A 1E90A 4BTBA 3ZUVB 3JCKC 5BXUA 2VQ2A 4UQYA 2Y0BG 2AVPA 2Y4UA 3ZYKA 4ANVA 3CSTA 4DJAA 3IEGA 4DX2A 3FTXA 3OTNA 3V31A 4I43A 1OY3D 3QOUA 4KZCA 3EU5A 3UKRG 1BI7B 4J8YA 3VTXA 5FZQA 3TWRA 3HIZA 5AARA 3LVRE 4HNAD 1XNFA 3Q9NC 4A63B 1EYHA 5CRVA 3FU6A 4K03A 1XGWA 3D9MA 4JHJA 4O1OA 3MV2B 2CG2A 3L16A 3PUJA 1JPLA 2X38A 3SO8A 3ABME 3RKVA 3FEXA 1RW2A 4J8EA 4PUCA 3D9HA 1NL4A 3TWVA 4BETA 1K8KG 1QZ2A 2IO3C 1H2TC 2RD0A 4LSZE 5B3SE 4U0UA 1OXJA 2FI7A 2ETBA 3Q15A 2X3MA 5FINA 3TAXA 1P5QA 3R9MA 5EILA 1BI8B 2WXFA 5AQ7A 1ELWA 3CVVA 3BQOA 3W9FA 4M7CA 1INZA 1OWLA 1TNUA 2P9NG 3C3OA 5D2MC 3G2WA 3NZUA 3CSFA 4C48B 2E0IA 3DEPA 4Q94A 4B8AA 3ULYA 3FUHA 5BV0A 4YDEA 3Q5MA 3MKQA 2BF0X 3FTUA 3U9WA 3PEVB 2AXVA 2BKGA 1DC2A 5FIOA 3HYMB 2QC9A 5KCMA 4ABNA 5AIJA 2V4HC 4CCAA 4E85A 4I1OB 4BESA 1BPOA 3OXGA 2WXJA 5ENQD 1RZ4A 4F3VA 1H0AA 3KEAA 4E6HA 3Q7FA 3BUAA 3DPDA 5A23A 4OYSA 3DSUA 4U8HA 3S7FA 3GZ2A 3GZSA 3D9PA 1K1AA 1N95A 4ILGA 3VLEA 4BSXA 3PE4A 4MRUA 4I2ZA 4JL0A 4HRLA 1N4PA 5HS0A 4D10C 4K5BA 2C0LA 3CVQA 3NBNB 1HG5A 3CVXA 4P29A 3PRZA 5CBNA 5KBAA 5JA4D 3SBSA 3D9IA 5FT9A 3E37A 2AXUA 4GYWA 2PNNA 5BUZA 2EQXA 4JB8P 3FU5A 2XHEA 3WXXA 4JPSA 2XEEA 4LUNU 3LJ3A 1JWFA 3JQ1A 2LNIA 2GRNB 3LEWA 4G8LA 1D9SA 4JA9A 2F0YA 1YYHA 2WM9A 2WXNA 2ZGDA 4TV3A 4OVUA 1IHBA 2ZU6B 3TXNA 2Y4TA 3ZN3A 2VGYA 3NAWA 3AAAC 4DRXE 2ONDA 1MQSA 1H2VC 2IJGX 2OEVA 4U0ZA 3GW4A 4GMLA 3NQPA 2FBNA 3DXKG 3DSXA 3SFYA 2QZAA 3CHRA 4GZ3A 5AYWD 4CRWA 3OAWA 1WG0A 4GTQA 3ZPJA 2BTDA 3RAUA 2XPIA 1E7VA 3VLDA 3U66A 1WM5A 3T5XA 5EIDA 3U64A 2B6CA 4L7TA 4U04A 4EBAG 1GW6A 5G04C 1OCRE 3SQVA 4NQ0A 4F6RD 2XGMA 1MYOA 3Q49B 4UWFA 5JHBA 3CEQA 3L54A 4EZLA 4GYYA 4V3IA 5FWQA 2CHWA 4N3BA 2IF4A 3CQGB 4GAAA 3UT8A 3J5QB 4W9RA 4TUMA 2GRMA 1Z5SC 5JJ6A 1L5JA 3NB2A 2X6HA 3PVLA 5LOZA 4UI9C 2A5EA 3FY4A 2VGXA 5ENPD 4ACKA 2J4BA 4J8FA 4ATZD 2GRPB 3G2SA 3QK0A 4MLPA 2QYUA 3E32A 1LD8A 1FT2A 1DVPA 5CECB 1N0QA 4I6GA 3SY2A 2MRIA 4IYPA 2P9PG 4G2VA 2QYJA 2ETAA 3RIBA 1D8EA 2H6IA 3UM1A 5DBKA 4GTRA 5ANRA 2R5SA 4UQXA 4N39A 5AQ9A 3DSWA 1LD7A 1QYMA 5ARFA 1KT1A 2J9QA 2OV8A 4YVQC 3MKQB 1AP7A 5DIZA 3ASFA 1H19A 2IQCA 2IFUA 2XRYA 3EHRA 4DI3A 4WWNA 2YHEA 4C0EA 2DZOA 3B7BA 3PH0C 3APFA 2J4DA 3SGHA 1O5MA 4EECA 4OVVA 2DCPA 2DZNA 3RRUA 4PH4B 4FLBA 2IY0C 1E8ZA 2VSXE 4J8DA 3IKOB 2J09A 2P9KG 4AM9A 3E33A 1LTXA 3FU3A 4XI0A 3E4BA 3UM0A 2VJ8A 3LJNA 1SW6A 1HU3A 1TNOA 5HI7A 3QDNA 5B1AE 2C0MA 3FWVA 3MGBA 4ME2A 3FTVA 3EIQC 3KAEA 1TEZA 1IXVA 1HO8A 3FU0A 1G3NB 3CIAA 5T8IA 4GTOA 2LUHA 4I1AA 2CFZA 2MHKA 2OVBA 4NRHB 4KZ0A 2X6JA 5AJLA 1IHGA 3QB2A 4I6EA 1HFAA 5ENSD 3JYSA 2OEWA 4WNEA 3FUKA 5EX0A 1DCEA 5KJMA 4G1TA 2XS1A 1NA3A 4GTMA 2DWZA 1YCSB 4KBQA 3ZRHA 3B95A 1N9AA 2DYRE 3PNTB 5BNWA 5BT1A 5EDSA 4A3VA 3G2UA 1O1SA 3T9KA 3D3MA 2Y69E 3FDHA 1NP7A 2VGEA 1NFIE 4RLYA 1N94A 3ZFWA 3TG5A 3ENEA 4BWRA 2M63A 5FQ6A 4XI9A 4AEZC 1AWCB 3UKUG 4HORA 3CGHA 3UXGA 5E76A 1TNYA 4CT4A 2Y3AA 4L2LA 4EZJA 3DXMG 3TWUA 2FO7A 1MZCA 4G26A 3PS6A 4YDYA 4GPKA 2RFAA 4HOSA 4BERA 4N5CA 4NURA 3CVNA 2I2OA 2XGSA 3ML8A 3SZ7A 2XEVA 2VGXB 5KNGA 2YHCA 3EUVA 4GMJA 1TNBA 2IO2C 4JZYA 3KEZA 3RSEG 2Y1LE 2V4LA 2QFCA 4BTAA 4QQIA 1JWGA 4CDMA 3UUXA 3LXUX 4L9PA 4U0SA 4HOTA 4CT0A 3RRMB 4GB9A 1S0PA 1FT1A 5FQ8A 3PZ1A 2EIJE 4HOUA 3AS4A 3U4TA 2V8SE 4UWHA 3B7TA 1A17A 4BFRA 3L08A 3TL5A 1X5BA 5EIBE 5AAOA 4YDOA 1HS6A 2MOWA 4BT9A 1KPSB 4AP2A 3HG0D 3AS8A 5CBOA 4GA1A 3CLJA 3OXLA 1O1TA 5D0OD 4GTVA 2IOSA 3LCAA 4QFVA 4DX5D 3PZ4A 4HRMB 3I4GA 3C5RA 5CHEE 3FUEA 5KJKA 1A5EA 3J5PA 3FUMA 4WNFA 2R03A 4WUYA 4DPRA 1HZ4A 3FTYA 2WQ6A 4XKBA 4F7AA 1UJKA 4B8CB 4HXIA 4LERA 2PQNA 3NF1A 3DSSA 3R7QA 3P1UA 4EHMA 4I17A 1IKND 4ILHB 3Q7AA 4TXRA 3RRNB 3HVEA 3VTYA 2KXPC 2CHXA 3CR3A 4PS7A 2LXMA 2ZGGA 3SHFA 3IV0A 3AJIA 5CCLA 2X6IA 4XZ4A 5ANLA 4F53A 3LY7A 4BSZB 1TYQG 4XE0A 3TWQA 2I9CA 1S63A 4ZHBA 4J8SA 3UTMA 5HKPA 4KMOA 4FHKA 5CMYA 2AWIA 3HDXA 1UOHA 4EPZA 3K9IA 2KC7A 2XS8A 3S7JA 2A5UA 5AQAA 2L0IA 3PNLB 3CVUA 1OCOE 1SA4A 2DYSE 5AQBA 2P58C 3R7RA 3SFXA 4FULA 2QY7A 2BEDA 1BLXB 3CKBA 3MJWA 2LO6A 2XEHA 3PZ2A 3S7BA 1HX8A 3JQ0A 2KCVA 1SQMA 3CKCA 3JXIA 2HE0A 4DK5A 3URZA 3RJVA 3QJZA 2WXHA 1OUVA 4GPMA 4MKTA 2GRRB 4FADA 2FO1E 3TWSA 3MA5A 2WQ7A 3FH5A 2FEZA 4KVOA 1TNZA 3FP3A 2EILE 3QKYA 5CRUA 3ZU7B 5FQ7A 1Y6IA 2R2LA 3FTSA 3ZIMA 2WMNA 1QNFA 4HOQA 2BKKB 3CHPA 2J07A 2UY1B 3L82A 1HE8A 4NACA 5EN5D 4FC8A 3FUJA 1SZ9A 2VSNA 1KLXA 1E8YA 5ENTD 1BD8A 4IRUA 2P9IG 4APOA 2PM7A 4AOFA 3EJNA 4RVBA 3X2QE 3ASDA 3ONLA 2R02A 2ETCA 3EDTB 4GZ5A 3Q9UC 2CFUA 1E8WA 3ESKA 4YNDA 1OWOA 4LNGA 3ABLE 5D0QD 3ABKE 5G05J 5A6CA 3PREA 3SF4A 2KBXA 2LAHA 1N4SA 2XRZA 4APFA 1HG2A 1FPPA 4O1PA 4BX8A 1JCRA 4H7XA 4JC8A 1K3ZD 3Q79A 3FH8A 2J8SD 3ZNGA 5FQ4A 3AG3E 3BG0B 1NI1A 3IBEA 4LEUA 5JMND 3AG4E 2EINE 4F1PA 3EHQA 4UQZA 5KNHD 5JJ7A 4EZKA 4GA0A 4HFGA 3CHQA 3Q73A 4UI9K 2I1KA 4LCTA 3GZ1A 5M72A 2GW1A 5G55A 2R05A 1ELRA 3ASNE 2OVFA 5T3RA 5BW8C 3EIJA 5EYLA 2IONA 3KSQA 5HQ8A 3CVWA 3G2VA 4GZDA 4I9EA 4FA6A 2WVIA 5EYPF 4LNUD 4ANXA 3AS5A 2VSYA 4Q69A 1MHQA 2HO1A 1U2VG 3RO3A 3W9GA 2H6HA 3U3WA 5CEDB 1UJJA 3P2BA 3F6QA 3HVEB 1D8DA 2IOLA 4A3TA 2JEKA 2MYOA 4HI9A 3UI2A 1E96B 1TJFA 2B0OE 4N5QA 4GA2A 4N2QA 3T8KA 4K5AB 4GZ6A 3HXCA 4JXTA 4FP7A 4FLHA 4U63A 4Y6WA 3O4ZA 2L6JA 4GTSA 2KCKA 3UT7A 1QQEA 3CHOA 3RO2A 3KS2A 4WNGA 3SFZA 2WB2A 5ENRD 3L6AA 1MX2A 2L0TB 3ML9A 4RG9A 4U8YD 3B7RL 4LNBA 1WY6A 4M3OA 2IEJA 1ZB1A 1E8XA 2CG3A 3EU9A 4AXHA 3CHMA 3TWXA 4U96D 5LCWC 1SVXA 3AG2E 4HS2A 5HRYA 1DCQA 4A55A 3C98A 1IQRA 5D66A 4C0MA 4EQFA 3ISMC 1UN9A 3WG7E 3I4RB 2XZTG 1LF8A 3QAQA 2KZTA 3D9JA 3HXFA 3SD5A 3N71A 3LKUA 3T8MA 2WQHA 1V55E 2UWJG 4N3CA 4MBGA 3LY8A 2WXRA 1KZOA 3DWLG 3T5VA 1OT8A 3IHVA 4HLLA 3L22A 1TN8A 4L23A 5FZSA 1NZNA 2ZXWE 4JHKA 3ASHA 3KSLA 1IQUA 2ILRA 3FFLA 3QWPA 1FCHA 4G23A 3LPZA 4AIFA 2WXLA 2F8YA 1OCCE 4WNDA 5LCWJ 3UPVA 2WXGA 4DX1A 2IU1A 2UY1A 2XPYA 1Y8MA 5G2NA 4OAUC 5JHAA 4Q96A 3Q47B 4BX9A 1H2UA 2A4ZA 4XEIG 4F1SA 1TJCA 1S70B 3PZDA 4JHRA 2NYJA 1S64A 3ZYQA 2LXLA 4KT6B 4AVXA 1YMPA 3ZHEA 5J90A 5B1BE 5CEAA 5J08A 1WDYA 2I1JA 2F37A 4I9CA 3CVYA 2WXOA 1NA0A 5LFAA 1FVFA 3LS8A 2FULA 1UG3A 2RKKA 3DSVA 3UM2A 3NZSA 4UWKA 2WXQA 3AU5A 4L2YA 3Q78A 4ILIA 3FH7A 4ZFHA 2J08A 4U8VD 3D9KA 2AW6A 3ZGQA 1E7UA 5AJDA 3PEUB 2RG8A 4HBDA 2WPVA 4CZ2D 2BUGA 2EIME 5CCMA 4U7EB 3TG4A 3TJPA 3APDA 3ULQA
chains in the Genus database with same CATH topology
4EHMA 3DSWA 1LD7A 3Q7AA 1NI1A 1N95A 1SA5A 1DCEA 4GTPA 1JCSA 1N4PA 3HXBA 4LNBA 3DRAA 3EUVA 1TNBA 1N4RA 1X81A 1NL4A 2IEJA 3Q73A 4GTMA 1TNZA 3PZ3A 3DPYA 2R2LA 1TN6A 4GTTA 1N9AA 4L9PA 1TN7A 2H6GA 3DSTA 1QBQA 1O5MA 1S64A 3E37A 1FT1A 3Q75A 3E30A 3KSQA 3PZ1A 1O1SA 1KZPA 1S63A 1TNUA 2H6HA 2ZISA 3E33A 4YDOA 1LTXA 2F0YA 1N94A 3HXFA 4YDEA 1TNOA 3C72A 3DSVA 1O1TA 1SA4A 1D8DA 4GTVA 3SFXA 2ZIRA 3DSUA 1TNYA 4LNGA 3HXEA 2BEDA 3PZ4A 3Q78A 4MBGA 1KZOA 3E32A 1LD8A 1FT2A 3EU5A 3PZ2A 1N4QA 4GTOA 1MZCA 1N4SA 3HXCA 3DSXA 3SFYA 1JCQA 1TN8A 1FPPA 3E34A 3HXDA 3KSLA 1JCRA 2H6FA 1D8EA 3Q7FA 2H6IA 1O1RA 3Q79A 4GTQA 4GTSA 4GTRA 3DSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EHM A;  3DSW A;  1LD7 A;  3Q7A A;  1NI1 A;  1N95 A;  1SA5 A;  1DCE A;  4GTP A;  1JCS A;  1N4P A;  3HXB A;  4LNB A;  3DRA A;  3EUV A;  1TNB A;  1N4R A;  1X81 A;  1NL4 A;  2IEJ A;  3Q73 A;  4GTM A;  1TNZ A;  3PZ3 A;  3DPY A;  2R2L A;  1TN6 A;  4GTT A;  1N9A A;  4L9P A;  1TN7 A;  2H6G A;  3DST A;  1QBQ A;  1O5M A;  1S64 A;  3E37 A;  1FT1 A;  3Q75 A;  3E30 A;  3KSQ A;  3PZ1 A;  1O1S A;  1KZP A;  1S63 A;  1TNU A;  2H6H A;  2ZIS A;  3E33 A;  4YDO A;  1LTX A;  2F0Y A;  1N94 A;  3HXF A;  4YDE A;  1TNO A;  3C72 A;  3DSV A;  1O1T A;  1SA4 A;  1D8D A;  4GTV A;  3SFX A;  2ZIR A;  3DSU A;  1TNY A;  4LNG A;  3HXE A;  2BED A;  3PZ4 A;  3Q78 A;  4MBG A;  1KZO A;  3E32 A;  1LD8 A;  1FT2 A;  3EU5 A;  3PZ2 A;  1N4Q A;  4GTO A;  1MZC A;  1N4S A;  3HXC A;  3DSX A;  3SFY A;  1JCQ A;  1TN8 A;  1FPP A;  3E34 A;  3HXD A;  3KSL A;  1JCR A;  2H6F A;  1D8E A;  3Q7F A;  2H6I A;  1O1R A;  3Q79 A;  4GTQ A;  4GTS A;  4GTR A;  3DSS A; 
#chains in the Genus database with same CATH topology
 4JA7 A;  4O6F A;  3TGO A;  5FJY A;  4XX5 A;  3LDZ A;  2WXI A;  4DLO A;  1TR4 A;  3UQ3 A;  4GZC A;  2DBA A;  4UWL A;  4G8K A;  4DX7 D;  5ITZ F;  1JCS A;  3HXB A;  3ZVV A;  3I3N A;  3V2O A;  1N4R A;  1X81 A;  3ZEF A;  1U3C A;  2P9U G;  2I6H A;  2EIK E;  5KWD A;  2Q7F A;  3ZXS A;  4AV7 A;  2H6G A;  2L9B A;  3Q4A B;  2KAT A;  3LY9 A;  1YA0 A;  3Q75 A;  3E30 A;  2E2E A;  3V30 A;  4DX6 D;  4B0Z A;  4RQI A;  3MZL B;  4IN3 B;  4I2W A;  3NOG D;  3UIP C;  2YNQ A;  3RK6 A;  4JD2 G;  3UIO C;  3ASG A;  3ZKJ A;  2R17 C;  3JXJ A;  4TUU A;  4RG6 A;  3TWW A;  2NSZ A;  1N54 A;  1W3B A;  3ASO E;  1Q2Z A;  1Z3X A;  4GCO A;  4WAF A;  4WWP A;  2XPZ A;  4HVB A;  2LAI A;  3O48 A;  4DI4 A;  1HH8 A;  4ATG A;  3FUD A;  2DIW A;  3QNK A;  3BU8 A;  2PZI A;  1PC2 A;  4TXP A;  1H6K A;  2HR2 A;  3UMV A;  1N52 A;  5C2Y A;  1UW4 B;  3FUI A;  1OWM A;  4X8Q A;  3TXM A;  3L9T A;  3L13 A;  1PY1 A;  1VDY A;  2XEN A;  4J7W A;  2KZT B;  3ESL A;  4FJY A;  2VTB A;  1ZU2 A;  3MV3 B;  2NC9 A;  4FU3 A;  5EKQ D;  3FTZ A;  2XQ0 A;  2NXP A;  3DRA A;  4Y6C A;  5G05 C;  3JUE A;  4BY6 A;  3EHN A;  3PZ3 A;  1EDU A;  4LRZ A;  1TN7 A;  4CDN A;  2JAB A;  1QBQ A;  4FJZ A;  5KJL A;  1SZA A;  3PUK A;  1OWP A;  2GRL A;  3BG1 B;  2PL2 A;  3MCX A;  4WWO A;  3QWW A;  4G24 A;  2JLB A;  1WAO 1;  5LP0 A;  3OXF A;  3S7D A;  4HQD A;  3HHM A;  4GU5 A;  2LSU A;  4GYO A;  3QAR A;  4YDW A;  1ZBP A;  4HB5 A;  3CQC B;  3FUF A;  5EX3 A;  2P9S G;  2ZIR A;  3APC A;  3HXE A;  2HYZ A;  4UWG A;  5FTP A;  3FEY A;  3ZW3 A;  4ANW A;  4DUI A;  3UX4 A;  3LVQ E;  5ENN A;  4PS3 A;  4GCN A;  5LX8 A;  2GRO B;  5BXO A;  3SI5 A;  1JCQ A;  3ONK A;  2V5Q C;  4KXK B;  3I5P A;  3QC1 A;  3E34 A;  3ZYL A;  3HXD A;  3ZHE B;  3MYV A;  5E75 A;  2H6F A;  4C9B B;  2YIN A;  4TRQ A;  4HRN A;  2WMO A;  3D9O A;  1PAQ A;  1FVH A;  1B89 A;  5AEN A;  1SA5 A;  2X6K A;  1KT0 A;  3IHY A;  1MX6 A;  4A1S A;  2XCB A;  5CMW A;  1H6O A;  3TWT A;  4KYO B;  5CER B;  3UIN C;  4HI8 A;  2V0P A;  4JEU A;  1H6P A;  5ARG A;  4ACL A;  4U95 D;  3DST A;  3LYA A;  2C2L A;  4G25 A;  4GMR A;  4I6J A;  4XKC A;  3ZYM A;  3CHS A;  3CK8 A;  4B93 B;  1V54 E;  4B89 A;  1HF8 A;  1UN8 A;  4OAV B;  1ELK A;  3C72 A;  4Z68 A;  4NIK A;  4UUC A;  4BEP A;  3RU0 A;  4K5C A;  4MS6 A;  2WXP A;  2GRQ B;  2PQR A;  4XIF A;  3D9L A;  5G04 J;  4YVO A;  3CVP A;  2AJA A;  2XCC A;  3ZXP A;  3BEE A;  4LG6 A;  1N4Q A;  2RFM A;  5ENO D;  3C3Q A;  3R9A B;  3FUN A;  4AJW A;  4N3A A;  3B13 A;  3KD7 A;  4CDR A;  5KJN A;  1OCZ E;  2VYI A;  3VLF A;  2X6F A;  2OOE A;  4CEM A;  3D9N A;  3V79 K;  1K1B A;  1IYG A;  4H7Y A;  3CK7 A;  3MX3 A;  5AN8 A;  1Z3Y A;  3QWV A;  2FF4 A;  2HM8 A;  3AU4 A;  2WXM A;  4AY6 A;  4G11 A;  4GTP A;  4UI9 J;  3CV0 A;  1EPU A;  3PDN A;  2XZD G;  3PE3 A;  4CGW A;  4HLE A;  1N0R A;  3UM3 A;  4N2S A;  4FHJ A;  1OWN A;  3DBS A;  2KCL A;  4BT8 A;  4K0R A;  5FZR A;  1EF1 C;  1U3D A;  5BV1 A;  3MKR A;  3GYZ A;  3JUI A;  3B7S A;  4I1M A;  3CK9 A;  3DEO A;  2J49 A;  3AG1 E;  3C3R A;  3HRA A;  2ZIS A;  1N11 A;  2V5F A;  5H7P A;  4A1G A;  1MJ0 A;  2WXK A;  3FTW A;  2VTB B;  2DVW A;  2YQ8 A;  3FHE A;  3SNX A;  4ANU A;  3CVL A;  4JW1 A;  3L17 A;  4O60 A;  4KVM A;  3ULE G;  2CHZ A;  2L6B A;  1JUQ A;  2VSO E;  3IXE A;  4L1B A;  2LSV A;  3V2X A;  3G2T A;  4CGV A;  4JEH A;  2F8X K;  4J6I A;  2GGF A;  1O1R A;  5JJT A;  4J0U A;  4R7L A;  4IUL A;  4B94 A;  5C1D A;  2XGO A;  3MEK A;  3SBT B;  2AXZ A;  3FUL A;  4DLQ A;  4EBA A;  2OCC E;  3EHM A;  5A7D B;  4AY5 A;  2P2C P;  3S2A A;  2KM4 A;  4RSY A;  2PM6 A;  4URK A;  3NOC D;  1Z6T A;  3DPY A;  1TN6 A;  4GTT A;  3B7U X;  1HXI A;  4TXQ A;  4PDX A;  4U07 A;  1DNP A;  4PS8 A;  2P9L G;  5T4Y A;  4CYM D;  1BU9 A;  1KZP A;  4JVS A;  5BPP A;  3UT4 A;  5IY5 E;  2R59 A;  1MX4 A;  1E90 A;  4BTB A;  3ZUV B;  3JCK C;  5BXU A;  2VQ2 A;  4UQY A;  2Y0B G;  2AVP A;  2Y4U A;  3ZYK A;  4ANV A;  3CST A;  4DJA A;  3IEG A;  4DX2 A;  3FTX A;  3OTN A;  3V31 A;  4I43 A;  1OY3 D;  3QOU A;  4KZC A;  3EU5 A;  3UKR G;  1BI7 B;  4J8Y A;  3VTX A;  5FZQ A;  3TWR A;  3HIZ A;  5AAR A;  3LVR E;  4HNA D;  1XNF A;  3Q9N C;  4A63 B;  1EYH A;  5CRV A;  3FU6 A;  4K03 A;  1XGW A;  3D9M A;  4JHJ A;  4O1O A;  3MV2 B;  2CG2 A;  3L16 A;  3PUJ A;  1JPL A;  2X38 A;  3SO8 A;  3ABM E;  3RKV A;  3FEX A;  1RW2 A;  4J8E A;  4PUC A;  3D9H A;  1NL4 A;  3TWV A;  4BET A;  1K8K G;  1QZ2 A;  2IO3 C;  1H2T C;  2RD0 A;  4LSZ E;  5B3S E;  4U0U A;  1OXJ A;  2FI7 A;  2ETB A;  3Q15 A;  2X3M A;  5FIN A;  3TAX A;  1P5Q A;  3R9M A;  5EIL A;  1BI8 B;  2WXF A;  5AQ7 A;  1ELW A;  3CVV A;  3BQO A;  3W9F A;  4M7C A;  1INZ A;  1OWL A;  1TNU A;  2P9N G;  3C3O A;  5D2M C;  3G2W A;  3NZU A;  3CSF A;  4C48 B;  2E0I A;  3DEP A;  4Q94 A;  4B8A A;  3ULY A;  3FUH A;  5BV0 A;  4YDE A;  3Q5M A;  3MKQ A;  2BF0 X;  3FTU A;  3U9W A;  3PEV B;  2AXV A;  2BKG A;  1DC2 A;  5FIO A;  3HYM B;  2QC9 A;  5KCM A;  4ABN A;  5AIJ A;  2V4H C;  4CCA A;  4E85 A;  4I1O B;  4BES A;  1BPO A;  3OXG A;  2WXJ A;  5ENQ D;  1RZ4 A;  4F3V A;  1H0A A;  3KEA A;  4E6H A;  3Q7F A;  3BUA A;  3DPD A;  5A23 A;  4OYS A;  3DSU A;  4U8H A;  3S7F A;  3GZ2 A;  3GZS A;  3D9P A;  1K1A A;  1N95 A;  4ILG A;  3VLE A;  4BSX A;  3PE4 A;  4MRU A;  4I2Z A;  4JL0 A;  4HRL A;  1N4P A;  5HS0 A;  4D10 C;  4K5B A;  2C0L A;  3CVQ A;  3NBN B;  1HG5 A;  3CVX A;  4P29 A;  3PRZ A;  5CBN A;  5KBA A;  5JA4 D;  3SBS A;  3D9I A;  5FT9 A;  3E37 A;  2AXU A;  4GYW A;  2PNN A;  5BUZ A;  2EQX A;  4JB8 P;  3FU5 A;  2XHE A;  3WXX A;  4JPS A;  2XEE A;  4LUN U;  3LJ3 A;  1JWF A;  3JQ1 A;  2LNI A;  2GRN B;  3LEW A;  4G8L A;  1D9S A;  4JA9 A;  2F0Y A;  1YYH A;  2WM9 A;  2WXN A;  2ZGD A;  4TV3 A;  4OVU A;  1IHB A;  2ZU6 B;  3TXN A;  2Y4T A;  3ZN3 A;  2VGY A;  3NAW A;  3AAA C;  4DRX E;  2OND A;  1MQS A;  1H2V C;  2IJG X;  2OEV A;  4U0Z A;  3GW4 A;  4GML A;  3NQP A;  2FBN A;  3DXK G;  3DSX A;  3SFY A;  2QZA A;  3CHR A;  4GZ3 A;  5AYW D;  4CRW A;  3OAW A;  1WG0 A;  4GTQ A;  3ZPJ A;  2BTD A;  3RAU A;  2XPI A;  1E7V A;  3VLD A;  3U66 A;  1WM5 A;  3T5X A;  5EID A;  3U64 A;  2B6C A;  4L7T A;  4U04 A;  4EBA G;  1GW6 A;  5G04 C;  1OCR E;  3SQV A;  4NQ0 A;  4F6R D;  2XGM A;  1MYO A;  3Q49 B;  4UWF A;  5JHB A;  3CEQ A;  3L54 A;  4EZL A;  4GYY A;  4V3I A;  5FWQ A;  2CHW A;  4N3B A;  2IF4 A;  3CQG B;  4GAA A;  3UT8 A;  3J5Q B;  4W9R A;  4TUM A;  2GRM A;  1Z5S C;  5JJ6 A;  1L5J A;  3NB2 A;  2X6H A;  3PVL A;  5LOZ A;  4UI9 C;  2A5E A;  3FY4 A;  2VGX A;  5ENP D;  4ACK A;  2J4B A;  4J8F A;  4ATZ D;  2GRP B;  3G2S A;  3QK0 A;  4MLP A;  2QYU A;  3E32 A;  1LD8 A;  1FT2 A;  1DVP A;  5CEC B;  1N0Q A;  4I6G A;  3SY2 A;  2MRI A;  4IYP A;  2P9P G;  4G2V A;  2QYJ A;  2ETA A;  3RIB A;  1D8E A;  2H6I A;  3UM1 A;  5DBK A;  4GTR A;  5ANR A;  2R5S A;  4UQX A;  4N39 A;  5AQ9 A;  3DSW A;  1LD7 A;  1QYM A;  5ARF A;  1KT1 A;  2J9Q A;  2OV8 A;  4YVQ C;  3MKQ B;  1AP7 A;  5DIZ A;  3ASF A;  1H19 A;  2IQC A;  2IFU A;  2XRY A;  3EHR A;  4DI3 A;  4WWN A;  2YHE A;  4C0E A;  2DZO A;  3B7B A;  3PH0 C;  3APF A;  2J4D A;  3SGH A;  1O5M A;  4EEC A;  4OVV A;  2DCP A;  2DZN A;  3RRU A;  4PH4 B;  4FLB A;  2IY0 C;  1E8Z A;  2VSX E;  4J8D A;  3IKO B;  2J09 A;  2P9K G;  4AM9 A;  3E33 A;  1LTX A;  3FU3 A;  4XI0 A;  3E4B A;  3UM0 A;  2VJ8 A;  3LJN A;  1SW6 A;  1HU3 A;  1TNO A;  5HI7 A;  3QDN A;  5B1A E;  2C0M A;  3FWV A;  3MGB A;  4ME2 A;  3FTV A;  3EIQ C;  3KAE A;  1TEZ A;  1IXV A;  1HO8 A;  3FU0 A;  1G3N B;  3CIA A;  5T8I A;  4GTO A;  2LUH A;  4I1A A;  2CFZ A;  2MHK A;  2OVB A;  4NRH B;  4KZ0 A;  2X6J A;  5AJL A;  1IHG A;  3QB2 A;  4I6E A;  1HFA A;  5ENS D;  3JYS A;  2OEW A;  4WNE A;  3FUK A;  5EX0 A;  1DCE A;  5KJM A;  4G1T A;  2XS1 A;  1NA3 A;  4GTM A;  2DWZ A;  1YCS B;  4KBQ A;  3ZRH A;  3B95 A;  1N9A A;  2DYR E;  3PNT B;  5BNW A;  5BT1 A;  5EDS A;  4A3V A;  3G2U A;  1O1S A;  3T9K A;  3D3M A;  2Y69 E;  3FDH A;  1NP7 A;  2VGE A;  1NFI E;  4RLY A;  1N94 A;  3ZFW A;  3TG5 A;  3ENE A;  4BWR A;  2M63 A;  5FQ6 A;  4XI9 A;  4AEZ C;  1AWC B;  3UKU G;  4HOR A;  3CGH A;  3UXG A;  5E76 A;  1TNY A;  4CT4 A;  2Y3A A;  4L2L A;  4EZJ A;  3DXM G;  3TWU A;  2FO7 A;  1MZC A;  4G26 A;  3PS6 A;  4YDY A;  4GPK A;  2RFA A;  4HOS A;  4BER A;  4N5C A;  4NUR A;  3CVN A;  2I2O A;  2XGS A;  3ML8 A;  3SZ7 A;  2XEV A;  2VGX B;  5KNG A;  2YHC A;  3EUV A;  4GMJ A;  1TNB A;  2IO2 C;  4JZY A;  3KEZ A;  3RSE G;  2Y1L E;  2V4L A;  2QFC A;  4BTA A;  4QQI A;  1JWG A;  4CDM A;  3UUX A;  3LXU X;  4L9P A;  4U0S A;  4HOT A;  4CT0 A;  3RRM B;  4GB9 A;  1S0P A;  1FT1 A;  5FQ8 A;  3PZ1 A;  2EIJ E;  4HOU A;  3AS4 A;  3U4T A;  2V8S E;  4UWH A;  3B7T A;  1A17 A;  4BFR A;  3L08 A;  3TL5 A;  1X5B A;  5EIB E;  5AAO A;  4YDO A;  1HS6 A;  2MOW A;  4BT9 A;  1KPS B;  4AP2 A;  3HG0 D;  3AS8 A;  5CBO A;  4GA1 A;  3CLJ A;  3OXL A;  1O1T A;  5D0O D;  4GTV A;  2IOS A;  3LCA A;  4QFV A;  4DX5 D;  3PZ4 A;  4HRM B;  3I4G A;  3C5R A;  5CHE E;  3FUE A;  5KJK A;  1A5E A;  3J5P A;  3FUM A;  4WNF A;  2R03 A;  4WUY A;  4DPR A;  1HZ4 A;  3FTY A;  2WQ6 A;  4XKB A;  4F7A A;  1UJK A;  4B8C B;  4HXI A;  4LER A;  2PQN A;  3NF1 A;  3DSS A;  3R7Q A;  3P1U A;  4EHM A;  4I17 A;  1IKN D;  4ILH B;  3Q7A A;  4TXR A;  3RRN B;  3HVE A;  3VTY A;  2KXP C;  2CHX A;  3CR3 A;  4PS7 A;  2LXM A;  2ZGG A;  3SHF A;  3IV0 A;  3AJI A;  5CCL A;  2X6I A;  4XZ4 A;  5ANL A;  4F53 A;  3LY7 A;  4BSZ B;  1TYQ G;  4XE0 A;  3TWQ A;  2I9C A;  1S63 A;  4ZHB A;  4J8S A;  3UTM A;  5HKP A;  4KMO A;  4FHK A;  5CMY A;  2AWI A;  3HDX A;  1UOH A;  4EPZ A;  3K9I A;  2KC7 A;  2XS8 A;  3S7J A;  2A5U A;  5AQA A;  2L0I A;  3PNL B;  3CVU A;  1OCO E;  1SA4 A;  2DYS E;  5AQB A;  2P58 C;  3R7R A;  3SFX A;  4FUL A;  2QY7 A;  2BED A;  1BLX B;  3CKB A;  3MJW A;  2LO6 A;  2XEH A;  3PZ2 A;  3S7B A;  1HX8 A;  3JQ0 A;  2KCV A;  1SQM A;  3CKC A;  3JXI A;  2HE0 A;  4DK5 A;  3URZ A;  3RJV A;  3QJZ A;  2WXH A;  1OUV A;  4GPM A;  4MKT A;  2GRR B;  4FAD A;  2FO1 E;  3TWS A;  3MA5 A;  2WQ7 A;  3FH5 A;  2FEZ A;  4KVO A;  1TNZ A;  3FP3 A;  2EIL E;  3QKY A;  5CRU A;  3ZU7 B;  5FQ7 A;  1Y6I A;  2R2L A;  3FTS A;  3ZIM A;  2WMN A;  1QNF A;  4HOQ A;  2BKK B;  3CHP A;  2J07 A;  2UY1 B;  3L82 A;  1HE8 A;  4NAC A;  5EN5 D;  4FC8 A;  3FUJ A;  1SZ9 A;  2VSN A;  1KLX A;  1E8Y A;  5ENT D;  1BD8 A;  4IRU A;  2P9I G;  4APO A;  2PM7 A;  4AOF A;  3EJN A;  4RVB A;  3X2Q E;  3ASD A;  3ONL A;  2R02 A;  2ETC A;  3EDT B;  4GZ5 A;  3Q9U C;  2CFU A;  1E8W A;  3ESK A;  4YND A;  1OWO A;  4LNG A;  3ABL E;  5D0Q D;  3ABK E;  5G05 J;  5A6C A;  3PRE A;  3SF4 A;  2KBX A;  2LAH A;  1N4S A;  2XRZ A;  4APF A;  1HG2 A;  1FPP A;  4O1P A;  4BX8 A;  1JCR A;  4H7X A;  4JC8 A;  1K3Z D;  3Q79 A;  3FH8 A;  2J8S D;  3ZNG A;  5FQ4 A;  3AG3 E;  3BG0 B;  1NI1 A;  3IBE A;  4LEU A;  5JMN D;  3AG4 E;  2EIN E;  4F1P A;  3EHQ A;  4UQZ A;  5KNH D;  5JJ7 A;  4EZK A;  4GA0 A;  4HFG A;  3CHQ A;  3Q73 A;  4UI9 K;  2I1K A;  4LCT A;  3GZ1 A;  5M72 A;  2GW1 A;  5G55 A;  2R05 A;  1ELR A;  3ASN E;  2OVF A;  5T3R A;  5BW8 C;  3EIJ A;  5EYL A;  2ION A;  3KSQ A;  5HQ8 A;  3CVW A;  3G2V A;  4GZD A;  4I9E A;  4FA6 A;  2WVI A;  5EYP F;  4LNU D;  4ANX A;  3AS5 A;  2VSY A;  4Q69 A;  1MHQ A;  2HO1 A;  1U2V G;  3RO3 A;  3W9G A;  2H6H A;  3U3W A;  5CED B;  1UJJ A;  3P2B A;  3F6Q A;  3HVE B;  1D8D A;  2IOL A;  4A3T A;  2JEK A;  2MYO A;  4HI9 A;  3UI2 A;  1E96 B;  1TJF A;  2B0O E;  4N5Q A;  4GA2 A;  4N2Q A;  3T8K A;  4K5A B;  4GZ6 A;  3HXC A;  4JXT A;  4FP7 A;  4FLH A;  4U63 A;  4Y6W A;  3O4Z A;  2L6J A;  4GTS A;  2KCK A;  3UT7 A;  1QQE A;  3CHO A;  3RO2 A;  3KS2 A;  4WNG A;  3SFZ A;  2WB2 A;  5ENR D;  3L6A A;  1MX2 A;  2L0T B;  3ML9 A;  4RG9 A;  4U8Y D;  3B7R L;  4LNB A;  1WY6 A;  4M3O A;  2IEJ A;  1ZB1 A;  1E8X A;  2CG3 A;  3EU9 A;  4AXH A;  3CHM A;  3TWX A;  4U96 D;  5LCW C;  1SVX A;  3AG2 E;  4HS2 A;  5HRY A;  1DCQ A;  4A55 A;  3C98 A;  1IQR A;  5D66 A;  4C0M A;  4EQF A;  3ISM C;  1UN9 A;  3WG7 E;  3I4R B;  2XZT G;  1LF8 A;  3QAQ A;  2KZT A;  3D9J A;  3HXF A;  3SD5 A;  3N71 A;  3LKU A;  3T8M A;  2WQH A;  1V55 E;  2UWJ G;  4N3C A;  4MBG A;  3LY8 A;  2WXR A;  1KZO A;  3DWL G;  3T5V A;  1OT8 A;  3IHV A;  4HLL A;  3L22 A;  1TN8 A;  4L23 A;  5FZS A;  1NZN A;  2ZXW E;  4JHK A;  3ASH A;  3KSL A;  1IQU A;  2ILR A;  3FFL A;  3QWP A;  1FCH A;  4G23 A;  3LPZ A;  4AIF A;  2WXL A;  2F8Y A;  1OCC E;  4WND A;  5LCW J;  3UPV A;  2WXG A;  4DX1 A;  2IU1 A;  2UY1 A;  2XPY A;  1Y8M A;  5G2N A;  4OAU C;  5JHA A;  4Q96 A;  3Q47 B;  4BX9 A;  1H2U A;  2A4Z A;  4XEI G;  4F1S A;  1TJC A;  1S70 B;  3PZD A;  4JHR A;  2NYJ A;  1S64 A;  3ZYQ A;  2LXL A;  4KT6 B;  4AVX A;  1YMP A;  3ZHE A;  5J90 A;  5B1B E;  5CEA A;  5J08 A;  1WDY A;  2I1J A;  2F37 A;  4I9C A;  3CVY A;  2WXO A;  1NA0 A;  5LFA A;  1FVF A;  3LS8 A;  2FUL A;  1UG3 A;  2RKK A;  3DSV A;  3UM2 A;  3NZS A;  4UWK A;  2WXQ A;  3AU5 A;  4L2Y A;  3Q78 A;  4ILI A;  3FH7 A;  4ZFH A;  2J08 A;  4U8V D;  3D9K A;  2AW6 A;  3ZGQ A;  1E7U A;  5AJD A;  3PEU B;  2RG8 A;  4HBD A;  2WPV A;  4CZ2 D;  2BUG A;  2EIM E;  5CCM A;  4U7E B;  3TG4 A;  3TJP A;  3APD A;  3ULQ A; 
#chains in the Genus database with same CATH homology
 4EHM A;  3DSW A;  1LD7 A;  3Q7A A;  1NI1 A;  1N95 A;  1SA5 A;  1DCE A;  4GTP A;  1JCS A;  1N4P A;  3HXB A;  4LNB A;  3DRA A;  3EUV A;  1TNB A;  1N4R A;  1X81 A;  1NL4 A;  2IEJ A;  3Q73 A;  4GTM A;  1TNZ A;  3PZ3 A;  3DPY A;  2R2L A;  1TN6 A;  4GTT A;  1N9A A;  4L9P A;  1TN7 A;  2H6G A;  3DST A;  1QBQ A;  1O5M A;  1S64 A;  3E37 A;  1FT1 A;  3Q75 A;  3E30 A;  3KSQ A;  3PZ1 A;  1O1S A;  1KZP A;  1S63 A;  1TNU A;  2H6H A;  2ZIS A;  3E33 A;  4YDO A;  1LTX A;  2F0Y A;  1N94 A;  3HXF A;  4YDE A;  1TNO A;  3C72 A;  3DSV A;  1O1T A;  1SA4 A;  1D8D A;  4GTV A;  3SFX A;  2ZIR A;  3DSU A;  1TNY A;  4LNG A;  3HXE A;  2BED A;  3PZ4 A;  3Q78 A;  4MBG A;  1KZO A;  3E32 A;  1LD8 A;  1FT2 A;  3EU5 A;  3PZ2 A;  1N4Q A;  4GTO A;  1MZC A;  1N4S A;  3HXC A;  3DSX A;  3SFY A;  1JCQ A;  1TN8 A;  1FPP A;  3E34 A;  3HXD A;  3KSL A;  1JCR A;  2H6F A;  1D8E A;  3Q7F A;  2H6I A;  1O1R A;  3Q79 A;  4GTQ A;  4GTS A;  4GTR A;  3DSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...