1FT1A

Crystal structure of protein farnesyltransferase at 2.25 angstroms resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein farnesyltransferase at 2.25 angstrom resolution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords PROTEIN FARNESYLTRANSFERASE
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1997-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ft1A00
2R2LA 3PZ3A 3DSVA 3DSSA 1S64A 1D8EA 3PZ2A 4GTPA 3HXEA 3Q75A 1TNYA 1KZOA 1O1RA 2H6IA 1DCEA 1SA5A 1D8DA 2H6HA 1TN6A 1LTXA 3SFYA 1JCQA 1N4RA 2IEJA 2F0YA 1X81A 4LNBA 1LD8A 3DSUA 1TNOA 1N95A 1FPPA 1N4PA 3HXDA 3KSQA 1JCRA 4YDOA 1LD7A 3PZ4A 3E30A 2H6GA 3E32A 1TN8A 4L9PA 3Q7FA 1O5MA 3DPYA 1NI1A 1FT2A 1FT1A 1TN7A 1JCSA 3DSWA 3PZ1A 3Q73A 3EU5A 4MBGA 1MZCA 1TNUA 4GTOA 1TNZA 4LNGA 3SFXA 3Q79A 2H6FA 1N4QA 2ZIRA 1N94A 3E33A 4GTSA 1QBQA 3E34A 3HXCA 4EHMA 1TNBA 1S63A 2BEDA 3DSXA 3HXBA 3C72A 1O1TA 1N9AA 4GTTA 3Q7AA 4GTVA 1KZPA 3EUVA 1N4SA 3DSTA 3KSLA 2ZISA 1SA4A 3E37A 1O1SA 4GTRA 4GTQA 4YDEA 1NL4A 4GTMA 3DRAA 3HXFA 3Q78A
chains in the Genus database with same CATH superfamily
3LCAA 5AIJA 4KVMA 4G1TA 2WVIA 2ZU6B 4ANUA 1S64A 4HB5A 2VGXB 4EBAG 2OVFA 3PZ2A 5BPPA 4GZCA 4LERA 4RSYA 2FULA 3CVLA 2H6IA 1HG2A 4CDMA 3OTNA 2HR2A 3HVEB 4A1SA 2DBAA 4FULA 4J8DA 5JJTA 3NAWA 3KS2A 2C0LA 3JCKC 4Y6CA 3MKRA 3Q47B 4BFRA 2H6GA 4GZDA 5KNHD 2WXNA 2XGSA 2WXIA 2KCLA 1E8XA 4UI9C 1MZCA 4TUMA 1FCHA 1N52A 4ILGA 3Q79A 2IO3C 2H6FA 3D3MA 2ZIRA 2PQRA 1SQMA 1OCZE 2UY1B 3HXCA 4OVVA 1SZ9A 3HVEA 3ULQA 4DX1A 4URKA 3LJ3A 4NRHB 1UOHA 4JZYA 2QYJA 4L2YA 2DZOA 2CG2A 4RLYA 2NXPA 1H0AA 2BKKB 3KSLA 4WAFA 3DBSA 4LNUD 2DIWA 4WNGA 5A7DB 1UG3A 3HXFA 3CVWA 2R02A 3IKOB 4UUCA 1JWFA 3NOGD 4UWHA 4GAAA 1H2UA 3HXEA 2EILE 3UX4A 1KZOA 3NB2A 2P9LG 2A5UA 1W3BA 4I2WA 1D8DA 3PE4A 3ASDA 3C3OA 2F0YA 1G3NB 4LCTA 5M72A 1INZA 2Y4UA 2XGMA 3CVYA 1RZ4A 5LFAA 1E7UA 5EIDA 1TN8A 5HQ8A 3PRZA 5FINA 3PZ1A 4PS7A 3T8KA 3FULA 3ZW3A 2WXOA 3JUIA 4XKCA 2DWZA 2MHKA 5FZRA 2R5SA 1UJJA 3JYSA 2ETBA 3AG3E 4XI0A 4N5QA 4DJAA 2PM6A 5FQ7A 1DVPA 4F1PA 4J0UA 2WXFA 4AXHA 4G8LA 3J5PA 1MQSA 4GTRA 4FC8A 2WB2A 1AP7A 3TWXA 4KZCA 2IQCA 4BWRA 2WXLA 3BQOA 2IJGX 2VSOE 3I5PA 3Q9UC 2C2LA 3EU9A 4UWLA 3AU4A 3PNLB 3BG1B 2LSUA 3AS8A 2XEVA 4YDYA 1E90A 2FO7A 4B93B 3NF1A 1OCRE 2NYJA 4R7LA 3KAEA 5D0OD 3ZGQA 1OCCE 1H6KA 3KEAA 4LUNU 4UI9J 4HRMB 2OEVA 3UM1A 3R7QA 2LNIA 4HXIA 4BSZB 2WXPA 4CT0A 2GRPB 3S2AA 3QARA 3JXIA 3FUNA 1NI1A 4U04A 3CQCB 2IF4A 3L9TA 4LRZA 5B1BE 3URZA 3ESKA 4WUYA 1HFAA 3SNXA 3FTWA 2P9IG 4RG9A 5CRVA 3HXBA 3AG1E 1TEZA 1RW2A 3Q7AA 2Q7FA 1TYQG 1OWNA 5FJYA 4V3IA 3Q4AB 3FUHA 4GZ5A 3BU8A 4BESA 5JHAA 5CBOA 2Y69E 3ZHEB 3C5RA 5CRUA 5FQ8A 2V5QC 4W9RA 3Q78A 2R2LA 3QOUA 2WMNA 3MEKA 4WNEA 3C3RA 5CCMA 2DYSE 3LYAA 2V4LA 2P2CP 3IV0A 4BY6A 2B0OE 2UWJG 3FWVA 3U4TA 2XRYA 4GMJA 2X6IA 4G11A 4RVBA 1DCEA 5E76A 4B8AA 2L0TB 2MYOA 3UINC 3CKCA 1X81A 4GCNA 5ENTD 2KCVA 5EX3A 3EHNA 3FTUA 3L16A 3OAWA 5FTPA 1K3ZD 1P5QA 4E6HA 3FTYA 3PUKA 2I9CA 4B89A 3VLDA 1HS6A 5J90A 5AN8A 2AXZA 2NC9A 4MBGA 2ETAA 1HX8A 3BEEA 4TXQA 5KJLA 3ASNE 4H7YA 2UY1A 4DLOA 3SGHA 5T4YA 2YQ8A 4ABNA 1HG5A 3RKVA 2X6FA 2JABA 2X6KA 3DSXA 3S7FA 2P9PG 4GTTA 3TL5A 3APDA 4G24A 4GTVA 4TRQA 4JA7A 4KXKB 3UKUG 5FIOA 4BERA 4FHKA 5AARA 3LDZA 4OVUA 2GRRB 4HOSA 2WXRA 4CEMA 4FHJA 1X5BA 2P9UG 5BNWA 3U9WA 4JXTA 5KJKA 3ZXPA 3CHRA 2CHWA 3VTXA 3SFZA 5G05C 2VSYA 2YINA 2IFUA 3UMVA 2GROB 3WXXA 2IY0C 4MS6A 2VGYA 4HI8A 2Y4TA 2WPVA 2WXHA 1HF8A 3G2WA 1IXVA 4PDXA 3KSQA 3QB2A 4UQZA 3FUMA 3PZ4A 2QFCA 4A1GA 4FJZA 1BPOA 2KATA 3CVVA 3MV3B 1Q2ZA 4TV3A 2L6BA 5JHBA 1OWPA 1ELRA 4FADA 4IULA 1TNUA 4ANXA 1TNZA 4U0ZA 3UIPC 2V5FA 3D9IA 4RG6A 3MKQA 4U8VD 2KXPC 5BW8C 2ZGDA 4JHRA 3ZKJA 3R9AB 3RK6A 5EDSA 5AENA 1N4SA 4EZLA 3EIJA 2BKGA 5JJ7A 2PZIA 3VLEA 1MX2A 2ZISA 4GTQA 2R59A 4YDEA 4U96D 3GZSA 2XS1A 2AVPA 3VLFA 1NA3A 4I1MA 2E2EA 3T5VA 5C2YA 3D9JA 3APCA 2PQNA 4DPRA 4HLEA 3W9FA 4KBQA 2GRNB 2I6HA 1PC2A 1E7VA 4PUCA 2LSVA 2PL2A 3PH0C 2WMOA 2RFMA 3DEPA 3ZN3A 1XGWA 5KCMA 3G2TA 3RO2A 3B7SA 3CVXA 1TN6A 1UW4B 1N4RA 5FQ6A 1L5JA 5AJDA 4PS8A 3HXDA 4YVQC 3V2OA 2RFAA 5EYPF 2R17C 3ULYA 4C9BB 1E8WA 1XNFA 4JD2G 2WM9A 4IYPA 3UT8A 4WWOA 1JCSA 3SBTB 1MX4A 2YHCA 3L08A 2CHXA 4BEPA 4U07A 2DVWA 2MOWA 2NSZA 4A63B 2VQ2A 3CSFA 3QWPA 1N94A 3SY2A 3RU0A 4EZKA 4GYOA 4HOQA 5FZQA 3F6QA 2WQ7A 3CVNA 3DXKG 3J5QB 5BXOA 1B89A 4FA6A 4XI9A 4A3VA 3CHQA 4APOA 3UPVA 3DEOA 4U0SA 2E0IA 1DNPA 4U63A 4YNDA 5KBAA 4D10C 4GTPA 3HHMA 3U3WA 1PAQA 3UTMA 4BSXA 4GB9A 3FEYA 3V30A 3Q9NC 1NA0A 2WXKA 4LG6A 3LEWA 3SI5A 1HZ4A 4DUIA 1EYHA 4XX5A 5JJ6A 4EZJA 3MZLB 1Z3YA 1UJKA 3GYZA 1N4PA 3HG0D 3BUAA 3CVPA 2XCBA 2FF4A 5FT9A 2P9NG 4QQIA 1BU9A 1TN7A 4O6FA 2LXMA 3FUJA 4JC8A 4AJWA 5JMND 3SZ7A 3EIQC 4GU5A 3FHEA 4J7WA 4FLHA 3V31A 5T3RA 4CGVA 3AS5A 4EPZA 4CGWA 3ABLE 2GW1A 1QBQA 5LCWC 4C0MA 3CHOA 4GCOA 4I17A 2B6CA 4I2ZA 3CHSA 3TWTA 3EUVA 4JEHA 2GGFA 3FU0A 3RIBA 1WM5A 3VTYA 1UN9A 5J08A 2J4BA 1H6PA 4DX5D 4CT4A 4N39A 3DRAA 3B95A 3ZUVB 3JQ1A 1MHQA 4A55A 2FBNA 2OCCE 3PZ3A 4BTBA 1YCSB 5LP0A 3FU5A 2Y3AA 3IEGA 4C0EA 4ZFHA 2HM8A 3Q75A 2F37A 3CHPA 2XQ0A 3ENEA 5G04C 4HNAD 2QY7A 4HS2A 4N5CA 1SA5A 2ETCA 2LXLA 4OAUC 1OWOA 5CCLA 3ZRHA 3TWWA 1BI7B 1OUVA 2IOSA 4N3CA 1UN8A 5AYWD 2LUHA 2IEJA 4K03A 2J07A 2HO1A 2MRIA 4DI3A 3QWWA 3ML8A 3ZVVA 2AJAA 4JHJA 4C48B 4L7TA 1U3CA 1O5MA 4G26A 3B7TA 3O4ZA 3L13A 3ZYKA 1ELKA 4N3AA 2R05A 5IY5E 1GW6A 4NACA 4ATZD 4YDWA 5KJMA 3UM0A 4GZ3A 1IHGA 3S7JA 2CG3A 3L6AA 4N2QA 5EYLA 4K5BA 2I1KA 4GA1A 2BEDA 1BD8A 3KEZA 3I3NA 3SO8A 2BTDA 3CGHA 4DLQA 5AQ9A 5ITZF 2CFZA 3WG7E 3G2SA 3ZU7B 5KJNA 2R03A 5LOZA 1WAO1 4AY5A 4FJYA 5CMWA 3V79K 3DSVA 2V4HC 3FTXA 3CSTA 3ULEG 2RG8A 3BG0B 4WNDA 1WY6A 4TXRA 1TNYA 5EX0A 3C98A 3FY4A 4HOTA 2V8SE 4JA9A 2H6HA 5HRYA 3SHFA 4U7EB 3SFYA 1JCQA 2DZNA 5ANRA 3UI2A 1EF1C 3X2QE 1LD8A 4XEIG 1N95A 4F6RD 4GYWA 1HH8A 4JVSA 4O1PA 3Q7FA 3ABME 4AY6A 4HOUA 4Y6WA 4ACLA 4OYSA 2VGEA 2WXMA 3EHQA 3ZYMA 4JEUA 2KBXA 4CRWA 3AAAC 5D0QD 3QDNA 3RJVA 5B1AE 4MKTA 4EHMA 4I9EA 2J08A 3TJPA 1V55E 4GA0A 3TXMA 4EQFA 4Q69A 1KZPA 3NOCD 4L1BA 3L17A 1KLXA 1NL4A 5CMYA 3ASHA 5AQAA 4JHKA 2LAHA 5ENRD 3MX3A 2GRLA 3MYVA 4PS3A 3FH8A 4ME2A 1MJ0A 1Y6IA 2A5EA 1QQEA 1OY3D 1BLXB 1S0PA 4K5CA 3L54A 3NQPA 3CR3A 3RRMB 1OCOE 2AXVA 3PEVB 4X8QA 3RO3A 4CZ2D 3TG4A 3UIOC 2HYZA 4U0UA 2DCPA 1H19A 3LJNA 2BUGA 1JCRA 4YDOA 3MV2B 2KZTB 4YVOA 3SD5A 1OWLA 5ANLA 3LS8A 3AU5A 1EDUA 2GRMA 1A5EA 3JQ0A 3UT7A 3FH7A 1FT2A 2XHEA 2I1JA 4HRLA 4J8EA 2Y0BG 3ASFA 1KT1A 3TWRA 4GTOA 4APFA 2J4DA 2WXQA 4TUUA 3SQVA 1IYGA 4UQYA 3RSEG 3PUJA 1Z5SC 2KC7A 4FP7A 5CBNA 3LY7A 4CYMD 2DYRE 3MCXA 3CK9A 1S63A 4IN3B 4MLPA 4B0ZA 4NURA 4ZHBA 1O1TA 4MRUA 4HRNA 4HQDA 2QZAA 4EECA 4Q94A 5ENQD 4AIFA 2BF0X 3S7BA 3MKQB 3QAQA 4F1SA 3ISMC 2L9BA 3UM3A 3QKYA 3OXLA 1IQRA 2P9KG 1HO8A 1IHBA 3PREA 1E8ZA 4KYOB 1NP7A 3TG5A 4HVBA 4N3BA 1H2TC 4TXPA 2JEKA 4B94A 3D9MA 3HRAA 3GZ1A 3OXFA 3Q15A 1IQUA 2XCCA 3D9OA 2VJ8A 1YA0A 4JPSA 3AG4E 4BT8A 1LTXA 2RD0A 3E4BA 3U66A 4LNBA 4FLBA 1FPPA 1NZNA 2CFUA 3SF4A 1LD7A 1H2VC 5EILA 1HE8A 3E32A 2P9SG 1JPLA 2XPYA 2KM4A 3ABKE 4NQ0A 2EIJE 2P58C 1Z3XA 2WXJA 5G05J 3MGBA 1N54A 4I6GA 4BX8A 2X3MA 2IONA 4K5AB 1MYOA 5ARGA 3AS4A 3ZIMA 3UUXA 3D9KA 3V2XA 2WXGA 4AV7A 1MX6A 4XIFA 4A3TA 1YMPA 3S7DA 2Y1LE 2KZTA 1WDYA 3LY8A 3CHMA 3UKRG 4JB8P 4JL0A 4PH4B 1OT8A 4B8CB 4GTMA 3ESLA 1U3DA 1YYHA 5KNGA 1N0QA 2OVBA 1QNFA 1S70B 3PS6A 3EHRA 3AJIA 1O1RA 4GPKA 4KMOA 1BI8B 4GPMA 3ASGA 3OXGA 2WQHA 3MJWA 5BV0A 3IXEA 3GW4A 4UI9K 3GZ2A 4G8KA 1K1AA 3EJNA 5D2MC 2VYIA 1LF8A 3QJZA 2XEEA 3IHYA 5EKQD 2RKKA 3NBNB 3FUFA 3FDHA 3FP3A 3LXUX 5ENSD 4LSZE 1NFIE 4HORA 2X38A 1E8YA 3CKBA 2AXUA 3FEXA 5FZSA 3ZXSA 3KD7A 3T9KA 3D9PA 5BXUA 5B3SE 3LPZA 5AQBA 1N4QA 3E34A 4WWNA 3PZDA 2XGOA 3PE3A 4HFGA 2F8YA 4HBDA 3P2BA 1ELWA 5D66A 3B13A 1KPSB 3UM2A 3DSTA 2VTBB 3D9NA 3E37A 4N2SA 3CV0A 4P29A 4G2VA 4U95D 2EINE 3B7RL 4BT9A 4BTAA 3LVQE 4I6EA 3ML9A 4ILHB 3CIAA 1HXIA 2YNQA 1VDYA 3K9IA 5BT1A 3G2VA 3TWSA 1HU3A 2KCKA 3EHMA 4RQIA 2FI7A 3QWVA 3FU3A 4Q96A 3APFA 1JUQA 5DBKA 1EPUA 3FUIA 3B7UX 2OEWA 2J9QA 2IOLA 4AEZC 5E75A 1K8KG 3ASOE 3ONLA 2A4ZA 4DI4A 3DPYA 3IBEA 2XPZA 3Q73A 3EU5A 4J8YA 1TJCA 3IHVA 3QNKA 3CEQA 3DPDA 4F53A 3DWLG 4DRXE 3TGOA 2F8XK 1QYMA 4GMRA 3CK8A 5HS0A 2AWIA 1Y8MA 4EBAA 3C72A 4WNFA 3TAXA 4CCAA 2EIKE 3T8MA 1H6OA 4I1AA 1O1SA 2XS8A 4J8FA 3D9HA 3NZUA 4O60A 2L0IA 2ONDA 3DSSA 1DCQA 5CECB 3PEUB 1D8EA 5KWDA 5G2NA 1ZBPA 2JLBA 3Q5MA 2XRZA 1SVXA 3FUEA 3QC1A 3P1UA 4DX7D 2QC9A 3TWQA 5FWQA 3CQGB 4O1OA 4DX2A 4G25A 3TWUA 4GMLA 2XEHA 2J09A 2V0PA 3PDNA 4I1OB 1AWCB 2ZGGA 3DXMG 4L9PA 3FTSA 3R9MA 1IKND 3UXGA 3TXNA 3LY9A 4XE0A 3FTVA 3G2UA 1FVHA 3Q49B 4QFVA 4GYYA 4U8HA 1K1BA 3E33A 1N11A 4GTSA 3TWVA 3ZYLA 3RRUA 1OWMA 4KT6B 4LEUA 4IRUA 3ZNGA 1JWGA 2QYUA 5ENOD 5A6CA 1N9AA 2LO6A 3N71A 1ZU2A 1OXJA 2PNNA 4UWGA 2WQ6A 2FO1E 2CHZA 3AG2E 3O48A 4L23A 5LX8A 5H7PA 5CEAA 3JXJA 1A17A 4U8YD 3L22A 2GRQB 3W9GA 1U2VG 5ARFA 2L6JA 2LAIA 5EIBE 4JW1A 4GZ6A 2X6HA 3FUKA 5AJLA 4XKBA 5JA4D 3QK0A 3ZHEA 3MA5A 4HI9A 5LCWJ 3I4RB 4AP2A 4F7AA 4I43A 3ZFWA 4GA2A 4Z68A 5A23A 3LVRE 4G23A 4NIKA 3SBSA 4M3OA 3DSUA 1ZB1A 2XENA 2AW6A 4ACKA 2OOEA 3FU6A 1DC2A 4WWPA 2HE0A 2VGXA 2VSXE 3C3QA 4KZ0A 3PNTB 4CDRA 4ANWA 3DSWA 3RAUA 5C1DA 3B7BA 3CK7A 5CERB 5DIZA 4LNGA 5AQ7A 1TJFA 2XZDG 4L2LA 1SZAA 3LKUA 1SW6A 2OV8A 3UT4A 1TNBA 2ZXWE 2EQXA 5AAOA 3FTZA 3U64A 4UWKA 4BX9A 2FEZA 4XZ4A 4DK5A 2VTBA 3CVQA 2X6JA 4BETA 2C0MA 2J8SD 3CVUA 3T5XA 3ZYQA 4HLLA 4FU3A 3HYMB 4E85A 3PVLA 2I2OA 2J49A 4AM9A 4ILIA 3HDXA 4J8SA 5G55A 1N0RA 3FFLA 3FUDA 2VSNA 4UWFA 5CHEE 4H7XA 3ONKA 4CDNA 1WG0A 3CLJA 2XPIA 1TR4A 1QZ2A 4KVOA 4AVXA 5T8IA 4ATGA 5ENPD 1TNOA 5G04J 4I6JA 2XZTG 2YHEA 3E30A 4J6IA 2M63A 5HKPA 5FQ4A 3EDTB 1PY1A 4ANVA 1FT1A 1KT0A 5BUZA 3RRNB 3HIZA 4UQXA 3UQ3A 4DX6D 1E96B 4I9CA 4F3VA 3FH5A 3SFXA 5EN5D 3ZEFA 1V54E 1Z6TA 2ILRA 5HI7A 1D9SA 3JUEA 2IU1A 1FVFA 5ENNA 3L82A 2PM7A 3ZPJA 3D9LA 3R7RA 1SA4A 3I4GA 2IO2C 4K0RA 4AOFA 5BV1A 2EIME 4M7CA 3NZSA 4OAVB 5CEDB
chains in the Genus database with same CATH topology
2R2LA 3PZ3A 3DSVA 3DSSA 1S64A 1D8EA 3PZ2A 4GTPA 3HXEA 3Q75A 1TNYA 1KZOA 1O1RA 2H6IA 1DCEA 1SA5A 1D8DA 2H6HA 1TN6A 1LTXA 3SFYA 1JCQA 1N4RA 2IEJA 2F0YA 1X81A 4LNBA 1LD8A 3DSUA 1TNOA 1N95A 1FPPA 1N4PA 3HXDA 3KSQA 1JCRA 4YDOA 1LD7A 3PZ4A 3E30A 2H6GA 3E32A 1TN8A 4L9PA 3Q7FA 1O5MA 3DPYA 1NI1A 1FT2A 1FT1A 1TN7A 1JCSA 3DSWA 3PZ1A 3Q73A 3EU5A 4MBGA 1MZCA 1TNUA 4GTOA 1TNZA 4LNGA 3SFXA 3Q79A 2H6FA 1N4QA 2ZIRA 1N94A 3E33A 4GTSA 1QBQA 3E34A 3HXCA 4EHMA 1TNBA 1S63A 2BEDA 3DSXA 3HXBA 3C72A 1O1TA 1N9AA 4GTTA 3Q7AA 4GTVA 1KZPA 3EUVA 1N4SA 3DSTA 3KSLA 2ZISA 1SA4A 3E37A 1O1SA 4GTRA 4GTQA 4YDEA 1NL4A 4GTMA 3DRAA 3HXFA 3Q78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2L A;  3PZ3 A;  3DSV A;  3DSS A;  1S64 A;  1D8E A;  3PZ2 A;  4GTP A;  3HXE A;  3Q75 A;  1TNY A;  1KZO A;  1O1R A;  2H6I A;  1DCE A;  1SA5 A;  1D8D A;  2H6H A;  1TN6 A;  1LTX A;  3SFY A;  1JCQ A;  1N4R A;  2IEJ A;  2F0Y A;  1X81 A;  4LNB A;  1LD8 A;  3DSU A;  1TNO A;  1N95 A;  1FPP A;  1N4P A;  3HXD A;  3KSQ A;  1JCR A;  4YDO A;  1LD7 A;  3PZ4 A;  3E30 A;  2H6G A;  3E32 A;  1TN8 A;  4L9P A;  3Q7F A;  1O5M A;  3DPY A;  1NI1 A;  1FT2 A;  1FT1 A;  1TN7 A;  1JCS A;  3DSW A;  3PZ1 A;  3Q73 A;  3EU5 A;  4MBG A;  1MZC A;  1TNU A;  4GTO A;  1TNZ A;  4LNG A;  3SFX A;  3Q79 A;  2H6F A;  1N4Q A;  2ZIR A;  1N94 A;  3E33 A;  4GTS A;  1QBQ A;  3E34 A;  3HXC A;  4EHM A;  1TNB A;  1S63 A;  2BED A;  3DSX A;  3HXB A;  3C72 A;  1O1T A;  1N9A A;  4GTT A;  3Q7A A;  4GTV A;  1KZP A;  3EUV A;  1N4S A;  3DST A;  3KSL A;  2ZIS A;  1SA4 A;  3E37 A;  1O1S A;  4GTR A;  4GTQ A;  4YDE A;  1NL4 A;  4GTM A;  3DRA A;  3HXF A;  3Q78 A; 
#chains in the Genus database with same CATH topology
 3LCA A;  5AIJ A;  4KVM A;  4G1T A;  2WVI A;  2ZU6 B;  4ANU A;  1S64 A;  4HB5 A;  2VGX B;  4EBA G;  2OVF A;  3PZ2 A;  5BPP A;  4GZC A;  4LER A;  4RSY A;  2FUL A;  3CVL A;  2H6I A;  1HG2 A;  4CDM A;  3OTN A;  2HR2 A;  3HVE B;  4A1S A;  2DBA A;  4FUL A;  4J8D A;  5JJT A;  3NAW A;  3KS2 A;  2C0L A;  3JCK C;  4Y6C A;  3MKR A;  3Q47 B;  4BFR A;  2H6G A;  4GZD A;  5KNH D;  2WXN A;  2XGS A;  2WXI A;  2KCL A;  1E8X A;  4UI9 C;  1MZC A;  4TUM A;  1FCH A;  1N52 A;  4ILG A;  3Q79 A;  2IO3 C;  2H6F A;  3D3M A;  2ZIR A;  2PQR A;  1SQM A;  1OCZ E;  2UY1 B;  3HXC A;  4OVV A;  1SZ9 A;  3HVE A;  3ULQ A;  4DX1 A;  4URK A;  3LJ3 A;  4NRH B;  1UOH A;  4JZY A;  2QYJ A;  4L2Y A;  2DZO A;  2CG2 A;  4RLY A;  2NXP A;  1H0A A;  2BKK B;  3KSL A;  4WAF A;  3DBS A;  4LNU D;  2DIW A;  4WNG A;  5A7D B;  1UG3 A;  3HXF A;  3CVW A;  2R02 A;  3IKO B;  4UUC A;  1JWF A;  3NOG D;  4UWH A;  4GAA A;  1H2U A;  3HXE A;  2EIL E;  3UX4 A;  1KZO A;  3NB2 A;  2P9L G;  2A5U A;  1W3B A;  4I2W A;  1D8D A;  3PE4 A;  3ASD A;  3C3O A;  2F0Y A;  1G3N B;  4LCT A;  5M72 A;  1INZ A;  2Y4U A;  2XGM A;  3CVY A;  1RZ4 A;  5LFA A;  1E7U A;  5EID A;  1TN8 A;  5HQ8 A;  3PRZ A;  5FIN A;  3PZ1 A;  4PS7 A;  3T8K A;  3FUL A;  3ZW3 A;  2WXO A;  3JUI A;  4XKC A;  2DWZ A;  2MHK A;  5FZR A;  2R5S A;  1UJJ A;  3JYS A;  2ETB A;  3AG3 E;  4XI0 A;  4N5Q A;  4DJA A;  2PM6 A;  5FQ7 A;  1DVP A;  4F1P A;  4J0U A;  2WXF A;  4AXH A;  4G8L A;  3J5P A;  1MQS A;  4GTR A;  4FC8 A;  2WB2 A;  1AP7 A;  3TWX A;  4KZC A;  2IQC A;  4BWR A;  2WXL A;  3BQO A;  2IJG X;  2VSO E;  3I5P A;  3Q9U C;  2C2L A;  3EU9 A;  4UWL A;  3AU4 A;  3PNL B;  3BG1 B;  2LSU A;  3AS8 A;  2XEV A;  4YDY A;  1E90 A;  2FO7 A;  4B93 B;  3NF1 A;  1OCR E;  2NYJ A;  4R7L A;  3KAE A;  5D0O D;  3ZGQ A;  1OCC E;  1H6K A;  3KEA A;  4LUN U;  4UI9 J;  4HRM B;  2OEV A;  3UM1 A;  3R7Q A;  2LNI A;  4HXI A;  4BSZ B;  2WXP A;  4CT0 A;  2GRP B;  3S2A A;  3QAR A;  3JXI A;  3FUN A;  1NI1 A;  4U04 A;  3CQC B;  2IF4 A;  3L9T A;  4LRZ A;  5B1B E;  3URZ A;  3ESK A;  4WUY A;  1HFA A;  3SNX A;  3FTW A;  2P9I G;  4RG9 A;  5CRV A;  3HXB A;  3AG1 E;  1TEZ A;  1RW2 A;  3Q7A A;  2Q7F A;  1TYQ G;  1OWN A;  5FJY A;  4V3I A;  3Q4A B;  3FUH A;  4GZ5 A;  3BU8 A;  4BES A;  5JHA A;  5CBO A;  2Y69 E;  3ZHE B;  3C5R A;  5CRU A;  5FQ8 A;  2V5Q C;  4W9R A;  3Q78 A;  2R2L A;  3QOU A;  2WMN A;  3MEK A;  4WNE A;  3C3R A;  5CCM A;  2DYS E;  3LYA A;  2V4L A;  2P2C P;  3IV0 A;  4BY6 A;  2B0O E;  2UWJ G;  3FWV A;  3U4T A;  2XRY A;  4GMJ A;  2X6I A;  4G11 A;  4RVB A;  1DCE A;  5E76 A;  4B8A A;  2L0T B;  2MYO A;  3UIN C;  3CKC A;  1X81 A;  4GCN A;  5ENT D;  2KCV A;  5EX3 A;  3EHN A;  3FTU A;  3L16 A;  3OAW A;  5FTP A;  1K3Z D;  1P5Q A;  4E6H A;  3FTY A;  3PUK A;  2I9C A;  4B89 A;  3VLD A;  1HS6 A;  5J90 A;  5AN8 A;  2AXZ A;  2NC9 A;  4MBG A;  2ETA A;  1HX8 A;  3BEE A;  4TXQ A;  5KJL A;  3ASN E;  4H7Y A;  2UY1 A;  4DLO A;  3SGH A;  5T4Y A;  2YQ8 A;  4ABN A;  1HG5 A;  3RKV A;  2X6F A;  2JAB A;  2X6K A;  3DSX A;  3S7F A;  2P9P G;  4GTT A;  3TL5 A;  3APD A;  4G24 A;  4GTV A;  4TRQ A;  4JA7 A;  4KXK B;  3UKU G;  5FIO A;  4BER A;  4FHK A;  5AAR A;  3LDZ A;  4OVU A;  2GRR B;  4HOS A;  2WXR A;  4CEM A;  4FHJ A;  1X5B A;  2P9U G;  5BNW A;  3U9W A;  4JXT A;  5KJK A;  3ZXP A;  3CHR A;  2CHW A;  3VTX A;  3SFZ A;  5G05 C;  2VSY A;  2YIN A;  2IFU A;  3UMV A;  2GRO B;  3WXX A;  2IY0 C;  4MS6 A;  2VGY A;  4HI8 A;  2Y4T A;  2WPV A;  2WXH A;  1HF8 A;  3G2W A;  1IXV A;  4PDX A;  3KSQ A;  3QB2 A;  4UQZ A;  3FUM A;  3PZ4 A;  2QFC A;  4A1G A;  4FJZ A;  1BPO A;  2KAT A;  3CVV A;  3MV3 B;  1Q2Z A;  4TV3 A;  2L6B A;  5JHB A;  1OWP A;  1ELR A;  4FAD A;  4IUL A;  1TNU A;  4ANX A;  1TNZ A;  4U0Z A;  3UIP C;  2V5F A;  3D9I A;  4RG6 A;  3MKQ A;  4U8V D;  2KXP C;  5BW8 C;  2ZGD A;  4JHR A;  3ZKJ A;  3R9A B;  3RK6 A;  5EDS A;  5AEN A;  1N4S A;  4EZL A;  3EIJ A;  2BKG A;  5JJ7 A;  2PZI A;  3VLE A;  1MX2 A;  2ZIS A;  4GTQ A;  2R59 A;  4YDE A;  4U96 D;  3GZS A;  2XS1 A;  2AVP A;  3VLF A;  1NA3 A;  4I1M A;  2E2E A;  3T5V A;  5C2Y A;  3D9J A;  3APC A;  2PQN A;  4DPR A;  4HLE A;  3W9F A;  4KBQ A;  2GRN B;  2I6H A;  1PC2 A;  1E7V A;  4PUC A;  2LSV A;  2PL2 A;  3PH0 C;  2WMO A;  2RFM A;  3DEP A;  3ZN3 A;  1XGW A;  5KCM A;  3G2T A;  3RO2 A;  3B7S A;  3CVX A;  1TN6 A;  1UW4 B;  1N4R A;  5FQ6 A;  1L5J A;  5AJD A;  4PS8 A;  3HXD A;  4YVQ C;  3V2O A;  2RFA A;  5EYP F;  2R17 C;  3ULY A;  4C9B B;  1E8W A;  1XNF A;  4JD2 G;  2WM9 A;  4IYP A;  3UT8 A;  4WWO A;  1JCS A;  3SBT B;  1MX4 A;  2YHC A;  3L08 A;  2CHX A;  4BEP A;  4U07 A;  2DVW A;  2MOW A;  2NSZ A;  4A63 B;  2VQ2 A;  3CSF A;  3QWP A;  1N94 A;  3SY2 A;  3RU0 A;  4EZK A;  4GYO A;  4HOQ A;  5FZQ A;  3F6Q A;  2WQ7 A;  3CVN A;  3DXK G;  3J5Q B;  5BXO A;  1B89 A;  4FA6 A;  4XI9 A;  4A3V A;  3CHQ A;  4APO A;  3UPV A;  3DEO A;  4U0S A;  2E0I A;  1DNP A;  4U63 A;  4YND A;  5KBA A;  4D10 C;  4GTP A;  3HHM A;  3U3W A;  1PAQ A;  3UTM A;  4BSX A;  4GB9 A;  3FEY A;  3V30 A;  3Q9N C;  1NA0 A;  2WXK A;  4LG6 A;  3LEW A;  3SI5 A;  1HZ4 A;  4DUI A;  1EYH A;  4XX5 A;  5JJ6 A;  4EZJ A;  3MZL B;  1Z3Y A;  1UJK A;  3GYZ A;  1N4P A;  3HG0 D;  3BUA A;  3CVP A;  2XCB A;  2FF4 A;  5FT9 A;  2P9N G;  4QQI A;  1BU9 A;  1TN7 A;  4O6F A;  2LXM A;  3FUJ A;  4JC8 A;  4AJW A;  5JMN D;  3SZ7 A;  3EIQ C;  4GU5 A;  3FHE A;  4J7W A;  4FLH A;  3V31 A;  5T3R A;  4CGV A;  3AS5 A;  4EPZ A;  4CGW A;  3ABL E;  2GW1 A;  1QBQ A;  5LCW C;  4C0M A;  3CHO A;  4GCO A;  4I17 A;  2B6C A;  4I2Z A;  3CHS A;  3TWT A;  3EUV A;  4JEH A;  2GGF A;  3FU0 A;  3RIB A;  1WM5 A;  3VTY A;  1UN9 A;  5J08 A;  2J4B A;  1H6P A;  4DX5 D;  4CT4 A;  4N39 A;  3DRA A;  3B95 A;  3ZUV B;  3JQ1 A;  1MHQ A;  4A55 A;  2FBN A;  2OCC E;  3PZ3 A;  4BTB A;  1YCS B;  5LP0 A;  3FU5 A;  2Y3A A;  3IEG A;  4C0E A;  4ZFH A;  2HM8 A;  3Q75 A;  2F37 A;  3CHP A;  2XQ0 A;  3ENE A;  5G04 C;  4HNA D;  2QY7 A;  4HS2 A;  4N5C A;  1SA5 A;  2ETC A;  2LXL A;  4OAU C;  1OWO A;  5CCL A;  3ZRH A;  3TWW A;  1BI7 B;  1OUV A;  2IOS A;  4N3C A;  1UN8 A;  5AYW D;  2LUH A;  2IEJ A;  4K03 A;  2J07 A;  2HO1 A;  2MRI A;  4DI3 A;  3QWW A;  3ML8 A;  3ZVV A;  2AJA A;  4JHJ A;  4C48 B;  4L7T A;  1U3C A;  1O5M A;  4G26 A;  3B7T A;  3O4Z A;  3L13 A;  3ZYK A;  1ELK A;  4N3A A;  2R05 A;  5IY5 E;  1GW6 A;  4NAC A;  4ATZ D;  4YDW A;  5KJM A;  3UM0 A;  4GZ3 A;  1IHG A;  3S7J A;  2CG3 A;  3L6A A;  4N2Q A;  5EYL A;  4K5B A;  2I1K A;  4GA1 A;  2BED A;  1BD8 A;  3KEZ A;  3I3N A;  3SO8 A;  2BTD A;  3CGH A;  4DLQ A;  5AQ9 A;  5ITZ F;  2CFZ A;  3WG7 E;  3G2S A;  3ZU7 B;  5KJN A;  2R03 A;  5LOZ A;  1WAO 1;  4AY5 A;  4FJY A;  5CMW A;  3V79 K;  3DSV A;  2V4H C;  3FTX A;  3CST A;  3ULE G;  2RG8 A;  3BG0 B;  4WND A;  1WY6 A;  4TXR A;  1TNY A;  5EX0 A;  3C98 A;  3FY4 A;  4HOT A;  2V8S E;  4JA9 A;  2H6H A;  5HRY A;  3SHF A;  4U7E B;  3SFY A;  1JCQ A;  2DZN A;  5ANR A;  3UI2 A;  1EF1 C;  3X2Q E;  1LD8 A;  4XEI G;  1N95 A;  4F6R D;  4GYW A;  1HH8 A;  4JVS A;  4O1P A;  3Q7F A;  3ABM E;  4AY6 A;  4HOU A;  4Y6W A;  4ACL A;  4OYS A;  2VGE A;  2WXM A;  3EHQ A;  3ZYM A;  4JEU A;  2KBX A;  4CRW A;  3AAA C;  5D0Q D;  3QDN A;  3RJV A;  5B1A E;  4MKT A;  4EHM A;  4I9E A;  2J08 A;  3TJP A;  1V55 E;  4GA0 A;  3TXM A;  4EQF A;  4Q69 A;  1KZP A;  3NOC D;  4L1B A;  3L17 A;  1KLX A;  1NL4 A;  5CMY A;  3ASH A;  5AQA A;  4JHK A;  2LAH A;  5ENR D;  3MX3 A;  2GRL A;  3MYV A;  4PS3 A;  3FH8 A;  4ME2 A;  1MJ0 A;  1Y6I A;  2A5E A;  1QQE A;  1OY3 D;  1BLX B;  1S0P A;  4K5C A;  3L54 A;  3NQP A;  3CR3 A;  3RRM B;  1OCO E;  2AXV A;  3PEV B;  4X8Q A;  3RO3 A;  4CZ2 D;  3TG4 A;  3UIO C;  2HYZ A;  4U0U A;  2DCP A;  1H19 A;  3LJN A;  2BUG A;  1JCR A;  4YDO A;  3MV2 B;  2KZT B;  4YVO A;  3SD5 A;  1OWL A;  5ANL A;  3LS8 A;  3AU5 A;  1EDU A;  2GRM A;  1A5E A;  3JQ0 A;  3UT7 A;  3FH7 A;  1FT2 A;  2XHE A;  2I1J A;  4HRL A;  4J8E A;  2Y0B G;  3ASF A;  1KT1 A;  3TWR A;  4GTO A;  4APF A;  2J4D A;  2WXQ A;  4TUU A;  3SQV A;  1IYG A;  4UQY A;  3RSE G;  3PUJ A;  1Z5S C;  2KC7 A;  4FP7 A;  5CBN A;  3LY7 A;  4CYM D;  2DYR E;  3MCX A;  3CK9 A;  1S63 A;  4IN3 B;  4MLP A;  4B0Z A;  4NUR A;  4ZHB A;  1O1T A;  4MRU A;  4HRN A;  4HQD A;  2QZA A;  4EEC A;  4Q94 A;  5ENQ D;  4AIF A;  2BF0 X;  3S7B A;  3MKQ B;  3QAQ A;  4F1S A;  3ISM C;  2L9B A;  3UM3 A;  3QKY A;  3OXL A;  1IQR A;  2P9K G;  1HO8 A;  1IHB A;  3PRE A;  1E8Z A;  4KYO B;  1NP7 A;  3TG5 A;  4HVB A;  4N3B A;  1H2T C;  4TXP A;  2JEK A;  4B94 A;  3D9M A;  3HRA A;  3GZ1 A;  3OXF A;  3Q15 A;  1IQU A;  2XCC A;  3D9O A;  2VJ8 A;  1YA0 A;  4JPS A;  3AG4 E;  4BT8 A;  1LTX A;  2RD0 A;  3E4B A;  3U66 A;  4LNB A;  4FLB A;  1FPP A;  1NZN A;  2CFU A;  3SF4 A;  1LD7 A;  1H2V C;  5EIL A;  1HE8 A;  3E32 A;  2P9S G;  1JPL A;  2XPY A;  2KM4 A;  3ABK E;  4NQ0 A;  2EIJ E;  2P58 C;  1Z3X A;  2WXJ A;  5G05 J;  3MGB A;  1N54 A;  4I6G A;  4BX8 A;  2X3M A;  2ION A;  4K5A B;  1MYO A;  5ARG A;  3AS4 A;  3ZIM A;  3UUX A;  3D9K A;  3V2X A;  2WXG A;  4AV7 A;  1MX6 A;  4XIF A;  4A3T A;  1YMP A;  3S7D A;  2Y1L E;  2KZT A;  1WDY A;  3LY8 A;  3CHM A;  3UKR G;  4JB8 P;  4JL0 A;  4PH4 B;  1OT8 A;  4B8C B;  4GTM A;  3ESL A;  1U3D A;  1YYH A;  5KNG A;  1N0Q A;  2OVB A;  1QNF A;  1S70 B;  3PS6 A;  3EHR A;  3AJI A;  1O1R A;  4GPK A;  4KMO A;  1BI8 B;  4GPM A;  3ASG A;  3OXG A;  2WQH A;  3MJW A;  5BV0 A;  3IXE A;  3GW4 A;  4UI9 K;  3GZ2 A;  4G8K A;  1K1A A;  3EJN A;  5D2M C;  2VYI A;  1LF8 A;  3QJZ A;  2XEE A;  3IHY A;  5EKQ D;  2RKK A;  3NBN B;  3FUF A;  3FDH A;  3FP3 A;  3LXU X;  5ENS D;  4LSZ E;  1NFI E;  4HOR A;  2X38 A;  1E8Y A;  3CKB A;  2AXU A;  3FEX A;  5FZS A;  3ZXS A;  3KD7 A;  3T9K A;  3D9P A;  5BXU A;  5B3S E;  3LPZ A;  5AQB A;  1N4Q A;  3E34 A;  4WWN A;  3PZD A;  2XGO A;  3PE3 A;  4HFG A;  2F8Y A;  4HBD A;  3P2B A;  1ELW A;  5D66 A;  3B13 A;  1KPS B;  3UM2 A;  3DST A;  2VTB B;  3D9N A;  3E37 A;  4N2S A;  3CV0 A;  4P29 A;  4G2V A;  4U95 D;  2EIN E;  3B7R L;  4BT9 A;  4BTA A;  3LVQ E;  4I6E A;  3ML9 A;  4ILH B;  3CIA A;  1HXI A;  2YNQ A;  1VDY A;  3K9I A;  5BT1 A;  3G2V A;  3TWS A;  1HU3 A;  2KCK A;  3EHM A;  4RQI A;  2FI7 A;  3QWV A;  3FU3 A;  4Q96 A;  3APF A;  1JUQ A;  5DBK A;  1EPU A;  3FUI A;  3B7U X;  2OEW A;  2J9Q A;  2IOL A;  4AEZ C;  5E75 A;  1K8K G;  3ASO E;  3ONL A;  2A4Z A;  4DI4 A;  3DPY A;  3IBE A;  2XPZ A;  3Q73 A;  3EU5 A;  4J8Y A;  1TJC A;  3IHV A;  3QNK A;  3CEQ A;  3DPD A;  4F53 A;  3DWL G;  4DRX E;  3TGO A;  2F8X K;  1QYM A;  4GMR A;  3CK8 A;  5HS0 A;  2AWI A;  1Y8M A;  4EBA A;  3C72 A;  4WNF A;  3TAX A;  4CCA A;  2EIK E;  3T8M A;  1H6O A;  4I1A A;  1O1S A;  2XS8 A;  4J8F A;  3D9H A;  3NZU A;  4O60 A;  2L0I A;  2OND A;  3DSS A;  1DCQ A;  5CEC B;  3PEU B;  1D8E A;  5KWD A;  5G2N A;  1ZBP A;  2JLB A;  3Q5M A;  2XRZ A;  1SVX A;  3FUE A;  3QC1 A;  3P1U A;  4DX7 D;  2QC9 A;  3TWQ A;  5FWQ A;  3CQG B;  4O1O A;  4DX2 A;  4G25 A;  3TWU A;  4GML A;  2XEH A;  2J09 A;  2V0P A;  3PDN A;  4I1O B;  1AWC B;  2ZGG A;  3DXM G;  4L9P A;  3FTS A;  3R9M A;  1IKN D;  3UXG A;  3TXN A;  3LY9 A;  4XE0 A;  3FTV A;  3G2U A;  1FVH A;  3Q49 B;  4QFV A;  4GYY A;  4U8H A;  1K1B A;  3E33 A;  1N11 A;  4GTS A;  3TWV A;  3ZYL A;  3RRU A;  1OWM A;  4KT6 B;  4LEU A;  4IRU A;  3ZNG A;  1JWG A;  2QYU A;  5ENO D;  5A6C A;  1N9A A;  2LO6 A;  3N71 A;  1ZU2 A;  1OXJ A;  2PNN A;  4UWG A;  2WQ6 A;  2FO1 E;  2CHZ A;  3AG2 E;  3O48 A;  4L23 A;  5LX8 A;  5H7P A;  5CEA A;  3JXJ A;  1A17 A;  4U8Y D;  3L22 A;  2GRQ B;  3W9G A;  1U2V G;  5ARF A;  2L6J A;  2LAI A;  5EIB E;  4JW1 A;  4GZ6 A;  2X6H A;  3FUK A;  5AJL A;  4XKB A;  5JA4 D;  3QK0 A;  3ZHE A;  3MA5 A;  4HI9 A;  5LCW J;  3I4R B;  4AP2 A;  4F7A A;  4I43 A;  3ZFW A;  4GA2 A;  4Z68 A;  5A23 A;  3LVR E;  4G23 A;  4NIK A;  3SBS A;  4M3O A;  3DSU A;  1ZB1 A;  2XEN A;  2AW6 A;  4ACK A;  2OOE A;  3FU6 A;  1DC2 A;  4WWP A;  2HE0 A;  2VGX A;  2VSX E;  3C3Q A;  4KZ0 A;  3PNT B;  4CDR A;  4ANW A;  3DSW A;  3RAU A;  5C1D A;  3B7B A;  3CK7 A;  5CER B;  5DIZ A;  4LNG A;  5AQ7 A;  1TJF A;  2XZD G;  4L2L A;  1SZA A;  3LKU A;  1SW6 A;  2OV8 A;  3UT4 A;  1TNB A;  2ZXW E;  2EQX A;  5AAO A;  3FTZ A;  3U64 A;  4UWK A;  4BX9 A;  2FEZ A;  4XZ4 A;  4DK5 A;  2VTB A;  3CVQ A;  2X6J A;  4BET A;  2C0M A;  2J8S D;  3CVU A;  3T5X A;  3ZYQ A;  4HLL A;  4FU3 A;  3HYM B;  4E85 A;  3PVL A;  2I2O A;  2J49 A;  4AM9 A;  4ILI A;  3HDX A;  4J8S A;  5G55 A;  1N0R A;  3FFL A;  3FUD A;  2VSN A;  4UWF A;  5CHE E;  4H7X A;  3ONK A;  4CDN A;  1WG0 A;  3CLJ A;  2XPI A;  1TR4 A;  1QZ2 A;  4KVO A;  4AVX A;  5T8I A;  4ATG A;  5ENP D;  1TNO A;  5G04 J;  4I6J A;  2XZT G;  2YHE A;  3E30 A;  4J6I A;  2M63 A;  5HKP A;  5FQ4 A;  3EDT B;  1PY1 A;  4ANV A;  1FT1 A;  1KT0 A;  5BUZ A;  3RRN B;  3HIZ A;  4UQX A;  3UQ3 A;  4DX6 D;  1E96 B;  4I9C A;  4F3V A;  3FH5 A;  3SFX A;  5EN5 D;  3ZEF A;  1V54 E;  1Z6T A;  2ILR A;  5HI7 A;  1D9S A;  3JUE A;  2IU1 A;  1FVF A;  5ENN A;  3L82 A;  2PM7 A;  3ZPJ A;  3D9L A;  3R7R A;  1SA4 A;  3I4G A;  2IO2 C;  4K0R A;  4AOF A;  5BV1 A;  2EIM E;  4M7C A;  3NZS A;  4OAV B;  5CED B; 
#chains in the Genus database with same CATH homology
 2R2L A;  3PZ3 A;  3DSV A;  3DSS A;  1S64 A;  1D8E A;  3PZ2 A;  4GTP A;  3HXE A;  3Q75 A;  1TNY A;  1KZO A;  1O1R A;  2H6I A;  1DCE A;  1SA5 A;  1D8D A;  2H6H A;  1TN6 A;  1LTX A;  3SFY A;  1JCQ A;  1N4R A;  2IEJ A;  2F0Y A;  1X81 A;  4LNB A;  1LD8 A;  3DSU A;  1TNO A;  1N95 A;  1FPP A;  1N4P A;  3HXD A;  3KSQ A;  1JCR A;  4YDO A;  1LD7 A;  3PZ4 A;  3E30 A;  2H6G A;  3E32 A;  1TN8 A;  4L9P A;  3Q7F A;  1O5M A;  3DPY A;  1NI1 A;  1FT2 A;  1FT1 A;  1TN7 A;  1JCS A;  3DSW A;  3PZ1 A;  3Q73 A;  3EU5 A;  4MBG A;  1MZC A;  1TNU A;  4GTO A;  1TNZ A;  4LNG A;  3SFX A;  3Q79 A;  2H6F A;  1N4Q A;  2ZIR A;  1N94 A;  3E33 A;  4GTS A;  1QBQ A;  3E34 A;  3HXC A;  4EHM A;  1TNB A;  1S63 A;  2BED A;  3DSX A;  3HXB A;  3C72 A;  1O1T A;  1N9A A;  4GTT A;  3Q7A A;  4GTV A;  1KZP A;  3EUV A;  1N4S A;  3DST A;  3KSL A;  2ZIS A;  1SA4 A;  3E37 A;  1O1S A;  4GTR A;  4GTQ A;  4YDE A;  1NL4 A;  4GTM A;  3DRA A;  3HXF A;  3Q78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...