3F6QA

Crystal structure of integrin-linked kinase ankyrin repeat domain in complex with pinch1 lim1 domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
DDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/signaling protein
molecule keywords Integrin-linked protein kinase
publication title The structural basis of integrin-linked kinase-PINCH interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 169
sequence length 169
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3f6qA00
3JXJA 3NOGD 1YCSB 1NFIE 5CERB 3LJNA 5AARA 4CZ2D 5KBAA 2DVWA 3Q9UC 3TWVA 3JXIA 1UOHA 3TWWA 4RLYA 2B0OE 1YYHA 4DX5D 1MX2A 2QYJA 5CBOA 4O60A 4A63B 5CBNA 5EILA 4HQDA 2AJAA 2DZNA 3V79K 5JA4D 1G3NB 1MX4A 2RFAA 4OAVB 2VGEA 4G8LA 2F8YA 4U95D 4GPMA 1TR4A 2Y1LE 5D66A 4BERA 5CEAA 4HB5A 5ENTD 2L6BA 3F6QA 4HRMB 5AQBA 3J5PA 1BD8A 4JB8P 3EHQA 3ZNGA 3KEAA 3TWQA 5HS0A 5CECB 5ENSD 4HI9A 3IXEA 4OAUC 5KWDA 3HG0D 5HRYA 3V2XA 1WDYA 4CYMD 4DX7D 1BLXB 1IXVA 3JUEA 4HRLA 4BEPA 4K5BA 3D9HA 4G8KA 2MYOA 2V5QC 1AWCB 2XENA 2HE0A 2V4HC 3TWSA 2NYJA 5EIDA 4YDYA 3TWUA 3T8KA 5BXOA 1A5EA 4K5AB 2DWZA 1N0RA 1OY3D 2XEEA 2XEHA 3DEPA 4QFVA 5AN8A 3AAAC 2F8XK 1K3ZD 4Z68A 4O1OA 4DX2A 3SO8A 4U96D 3V31A 1SW6A 4HNAD 4HBDA 1OT8A 3B95A 4ZHBA 4HLLA 3HRAA 1AP7A 2J8SD 3J5QB 3T9KA 4DUIA 4TUMA 2Y0BG 1SVXA 2P2CP 3EU9A 3UI2A 3TWXA 2KXPC 2ZGDA 2ETAA 4LSZE 2XZDG 5ENOD 3NBNB 4GMRA 3V2OA 1BI7B 2KBXA 5FINA 5EN5D 5AQ9A 2BKGA 1BU9A 4ATZD 3DEOA 2BKKB 4HI8A 2RFMA 4BETA 3UXGA 1K1BA 2F37A 5ENPD 3W9FA 3EHRA 3ZKJA 4QQIA 4UUCA 5ENQD 3AJIA 3TWRA 1MYOA 4BSZB 4DRXE 4DX6D 4F6RD 2PNNA 5FIOA 3V30A 4O1PA 5EYLA 4J8YA 4LG6A 2FO1E 4J7WA 5CEDB 5AAOA 5ITZF 1S70B 4F1PA 2ETCA 4NIKA 5AQ7A 3TWTA 4B93B 4N5QA 5AQAA 2A5EA 4DX1A 1MJ0A 4C48B 1N0QA 4LNUD 1YMPA 5KNGA 1WG0A 4YDWA 3W9GA 2ZGGA 1DC2A 5ENRD 4U8YD 4BESA 2XZTG 1MX6A 4U8VD 5KNHD 5EYPF 1D9SA 1N11A 3ZU7B 1DCQA 3NOCD 4HRNA 1BI8B 2QC9A 1K1AA 5EIBE 5HKPA 1IHBA 2JABA 3UTMA 5BXUA 3Q9NC 1IKND 4K5CA 3ZUVB 5JMND 3B7BA 3C5RA 2DZOA 2ETBA 4ZFHA 1QYMA
chains in the Genus database with same CATH superfamily
2H6IA 3ONLA 3HYMB 4KT6B 3E37A 4XX5A 4HVBA 2ZU6B 3FH8A 4HOQA 3E33A 3IHYA 4EZJA 4BX9A 2XPYA 5FZQA 4ACLA 3RIBA 3FU5A 3X2QE 2VSXE 3BEEA 3MYVA 4PS3A 4MS6A 3RSEG 3ABLE 3NAWA 3ULYA 3O4ZA 5BXOA 3SNXA 4WAFA 3CHMA 3DEPA 3LS8A 1WAO1 4J8FA 1U3CA 4G1TA 5CMWA 5LOZA 3T9KA 4U0ZA 1BPOA 3CVYA 3PEVB 4J6IA 2J9QA 3W9FA 2LAIA 2LAHA 3FTYA 4BX8A 3V30A 1NA0A 2EILE 5EYLA 2DYRE 3CR3A 4UI9J 3L22A 1H2TC 2A5EA 3UUXA 5ANRA 5IY5E 4BY6A 4WNDA 2VSYA 3S2AA 2OVFA 1FT2A 3FUMA 3D9MA 3FH7A 1Y8MA 2UY1B 3BU8A 1IHBA 1N95A 4EHMA 2X6KA 1JCQA 4TRQA 2VSNA 2CHZA 2P9SG 4JHRA 4URKA 3EDTB 2VGYA 1TJCA 3QWVA 3R7QA 2Y69E 3RRUA 4F3VA 4YDOA 2DYSE 2L6BA 3L16A 1TYQG 3U9WA 4AXHA 5A6CA 3L08A 1BLXB 1AWCB 3VLDA 4IULA 3TWUA 4F53A 4U8HA 5AENA 4XI9A 1Z5SC 5JHAA 1SW6A 4CT4A 3HDXA 5AJDA 4I9CA 3ZFWA 1HS6A 3KEZA 5D0OD 2X38A 4U63A 5HI7A 5B3SE 3PZ1A 3MGBA 3D9OA 1IYGA 4GYOA 2XGOA 2VGXB 1MYOA 1DCEA 2PNNA 1NP7A 1QQEA 2CG2A 4LERA 3BUAA 4H7XA 3DXKG 5T8IA 4B93B 3CHSA 3E30A 5AQAA 2PQRA 5FQ8A 3FUIA 4GB9A 5KNGA 3MKQA 1KZPA 2CFUA 4J8EA 4DLQA 3PRZA 5LP0A 1VDYA 3UKRG 4ANWA 4OVUA 4GTPA 3L17A 4N39A 2HM8A 2ETBA 1Z6TA 5BUZA 3ZPJA 2WXLA 1TNZA 4O60A 1E90A 3I3NA 4KVMA 2WVIA 1OWPA 3UKUG 2PL2A 5CRUA 4JA9A 4JVSA 3HVEA 3LVRE 4IRUA 3TWQA 5KJLA 3CSFA 1Y6IA 4BSXA 2HE0A 3CQCB 4XIFA 1UN8A 4ANVA 4HXIA 1OY3D 1IQRA 3HXCA 1NZNA 1JPLA 4EZKA 3ASOE 3V31A 2DBAA 1OT8A 4I17A 4HLLA 2XS8A 4JEHA 4XEIG 4CDNA 3LDZA 3LY9A 3MV2B 2WXOA 4GA2A 3TWXA 3ZYMA 1BI7B 2P9IG 5EN5D 1BU9A 4YVQC 2AXZA 2LUHA 4L1BA 5ENPD 3ZKJA 3RK6A 2OV8A 4CDRA 4I43A 2VTBB 1UJJA 4AY5A 5FIOA 4F1PA 3DSXA 3TWTA 3AU5A 4W9RA 4K0RA 3FTUA 4FLHA 3CLJA 2IONA 3CVPA 4GAAA 4JL0A 1LF8A 1OWNA 1SA5A 5CMYA 1Q2ZA 3FUDA 1OCZE 5G05C 2KZTA 4GZ5A 5KBAA 3C72A 1QZ2A 4XKCA 1HXIA 2RFAA 2KCVA 3PVLA 4FA6A 3ONKA 2ZISA 2LNIA 4AV7A 3IBEA 3EIJA 3J5PA 2CHWA 4I6JA 3ZYQA 4OAUC 3TAXA 3HG0D 5HRYA 4I6EA 4ANUA 4C0MA 3U3WA 1SZ9A 2HO1A 3HIZA 3ASGA 4I1AA 1JCRA 3AS8A 4CCAA 4O1OA 2IJGX 1HG2A 4U96D 3ZYLA 3MV3B 2XRYA 1JWGA 5DIZA 2AWIA 3K9IA 2QZAA 1HE8A 2RFMA 3CKCA 4NQ0A 1K1BA 3LCAA 3SHFA 3EHRA 4JPSA 3PDNA 1INZA 1LD7A 4O1PA 4ME2A 3KSLA 4PS8A 4PDXA 4BFRA 4HOSA 2P9UG 4KYOB 2WPVA 3TL5A 3MKQB 5G04J 3U64A 4WWOA 1ZBPA 4C9BB 4FHKA 3UTMA 5BXUA 3AS5A 3C5RA 3R9MA 3NOGD 5FT9A 1S64A 5CERB 4KMOA 1MHQA 2WXNA 3HXEA 3PZ2A 3Q75A 2AJAA 4TUUA 2UY1A 1H6PA 3Q78A 2KM4A 4I1OB 4HB5A 1U2VG 3UM0A 4FLBA 3Q4AB 3WG7E 4J0UA 2OEVA 4I2WA 3CVXA 5E75A 4OVVA 3VTXA 1N0RA 2GW1A 3MKRA 5AN8A 4G24A 2FF4A 2OOEA 3B7UX 3C3QA 2CHXA 2M63A 3CV0A 3FHEA 3L9TA 4GA1A 4Y6CA 4B8CB 2GRMA 2KXPC 4PS7A 2J4DA 5FINA 3ISMC 3DEOA 2F37A 4B8AA 2IF4A 5AYWD 1P5QA 3SFXA 3BG0B 3D9LA 1IQUA 1WY6A 1OWOA 4UWGA 3ZW3A 3UM1A 3CHQA 1JWFA 4B0ZA 3C98A 3SGHA 2BUGA 4O6FA 1N11A 5ANLA 3CVUA 1BI8B 3P2BA 5EIBE 2WXJA 4HLEA 3SI5A 3N71A 3G2UA 1B89A 3QJZA 3SFYA 2IQCA 3SQVA 5G05J 3D9KA 1PAQA 3ULQA 4A63B 4GTSA 2GGFA 1HZ4A 4MLPA 2MOWA 3V79K 1G3NB 2B6CA 1TNYA 2PM7A 1RZ4A 5D66A 1HH8A 4NRHB 2J07A 3F6QA 3KEAA 3UPVA 1HF8A 2EIKE 2JLBA 3QNKA 4HRLA 4N2SA 3OTNA 5JHBA 4E85A 2WXGA 3Q49B 4Q94A 5CHEE 4R7LA 2XEEA 3CHOA 4JA7A 4WNFA 5A23A 2YHCA 3G2VA 2J8SD 4GTQA 3CGHA 2Y0BG 3UI2A 5T3RA 3ZXPA 3UT7A 3QOUA 2BKGA 1RW2A 4XKBA 4AIFA 2XPIA 4QQIA 4M3OA 5FZRA 3ZXSA 2H6FA 1TN6A 4TV3A 3Q79A 3UT8A 4HOTA 4LG6A 3GW4A 2X6JA 4KZCA 4Q69A 3MEKA 3CVLA 3ASHA 3E34A 4J8DA 1JCSA 1YMPA 4JHKA 3KS2A 4LEUA 4BESA 1N4SA 5H7PA 3ASDA 1D9SA 4CGVA 4G25A 2NXPA 3DPDA 2FI7A 3PUKA 2VTBA 2HYZA 4K5CA 3OXFA 3EHMA 2L0IA 3APFA 1NFIE 1KZOA 5G2NA 2A5UA 4UQYA 1PC2A 4GTVA 1MX2A 2QYJA 2WB2A 4L7TA 2C0LA 1WM5A 2MHKA 1HU3A 2J09A 4MKTA 5DBKA 4DLOA 5KWDA 1WDYA 5EX3A 4DX7D 2IO2C 4EZLA 3JCKC 3RU0A 1OCRE 4FADA 1A5EA 1E8ZA 4Z68A 1KT0A 4N3CA 3HRAA 3FH5A 2WXMA 2V5FA 5C2YA 4FJZA 4DI3A 3NBNB 3E4BA 3CK9A 4U04A 3L82A 4C0EA 3T5VA 1EDUA 3D9PA 3UIPC 3DWLG 3C3RA 5D2MC 3D3MA 4JEUA 3QC1A 1OCCE 4ILGA 4GYWA 4N5QA 1H6OA 1D8EA 1N0QA 4PUCA 3Q15A 2ZGGA 4N2QA 4YNDA 3LYAA 3AG4E 3L6AA 4UWKA 2QC9A 4AY6A 1K8KG 3QK0A 3FWVA 3Q9NC 4U07A 4BT8A 3FU6A 1QNFA 3FTSA 3QDNA 5J90A 1N54A 3JXJA 3NQPA 2OEWA 2WQ7A 4UWLA 5FTPA 3TWWA 4RLYA 4GZCA 3JUIA 4A3TA 3APCA 3FTVA 1FPPA 3TXNA 4XZ4A 5LX8A 2Y1LE 4IN3B 3RO2A 3ZNGA 2PQNA 4FU3A 4G2VA 3CVWA 4GTTA 4BEPA 2PZIA 4DI4A 3FEYA 2V5QC 2NYJA 2L6JA 3CVNA 3APDA 1K3ZD 5C1DA 1OWLA 3TG4A 4HBDA 3CVVA 1HO8A 4B89A 3UQ3A 4DUIA 2VJ8A 2IOLA 2I1JA 1SVXA 2P2CP 4JW1A 4WNEA 5CRVA 4CGWA 2CG3A 4GMRA 5BPPA 5AQ9A 4ATZD 5BT1A 3HXDA 3TWRA 3B7SA 2IY0C 2IU1A 5AAOA 2AVPA 5CCMA 4P29A 5AQ7A 4WWPA 4G23A 4AP2A 2Y4UA 3RKVA 3ZU7B 1K1AA 3PE3A 3OXGA 4X8QA 3UIOC 3ZUVB 3ENEA 4ATGA 5JMND 3B7BA 3LJNA 2H6GA 3IEGA 2DVWA 2LXLA 3IHVA 5CCLA 2EQXA 5CBNA 3NZSA 2V4LA 4RVBA 3ZIMA 4AVXA 2GRLA 3PEUB 5EKQD 1OWMA 5KJNA 2RKKA 1DNPA 3FY4A 2CFZA 1ELRA 2P9KG 1E7UA 3UM2A 1ELKA 3UINC 4CYMD 2V8SE 1IXVA 4G8KA 1EF1C 2XENA 4HFGA 3CIAA 4JD2G 4K5AB 2ONDA 4RG9A 3ML9A 3SO8A 3KSQA 4GCOA 2IEJA 3FUEA 4GZ6A 4KXKB 1O1TA 4FULA 5BV1A 5LCWC 2Y3AA 2F0YA 1SQMA 3DSTA 4UQXA 4EBAG 4GU5A 4U0UA 3AJIA 4F6RD 2RG8A 2IOSA 2WXHA 5HQ8A 3AG1E 2X6FA 3LPZA 4B94A 4N5CA 4GCNA 4U8YD 3RJVA 5KNHD 3NOCD 4I2ZA 2WXKA 3Q7FA 3AS4A 2DIWA 5EX0A 3EHNA 4U7EB 2RD0A 2DZOA 2WXRA 3PNLB 4CZ2D 1O5MA 4Q96A 5E76A 3Q9UC 3R9AB 1JUQA 5BNWA 1E8WA 2R03A 3RRMB 2XGSA 4A1GA 4RG6A 4GPMA 5CEAA 4U0SA 2MRIA 5ENSD 3KAEA 4M7CA 5T4YA 3SF4A 3OAWA 2KCKA 3KD7A 2E2EA 2FBNA 2R5SA 4QFVA 3ZEFA 2Q7FA 2F8XK 3UX4A 3O48A 4HNAD 4XI0A 4DPRA 1AP7A 3ZVVA 4N3BA 2WXIA 3EJNA 1N4RA 4HI8A 3NB2A 3UXGA 3FULA 3HHMA 3Q7AA 4GTMA 4XE0A 4FJYA 3MA5A 5CEDB 3D9IA 2J08A 4NIKA 4D10C 3FUFA 4C48B 3ESLA 1UG3A 2ZXWE 4LCTA 3BQOA 1X81A 2QYUA 2JABA 1O1SA 4L23A 2WMNA 4ZFHA 2NSZA 4EQFA 2GRNB 3I4RB 2WMOA 1NA3A 2X3MA 4GMLA 2LXMA 3DSSA 2E0IA 3T8MA 1KT1A 3DSUA 4GZDA 4I9EA 2ZIRA 2XHEA 4HRMB 2A4ZA 5FQ6A 4HI9A 4F1SA 5LFAA 4GMJA 3V2XA 3ASFA 3JUEA 4FHJA 3P1UA 3B7TA 3AAAC 4DX2A 2V0PA 3R7RA 2XS1A 4MBGA 4AEZC 4G26A 4OYSA 4I1MA 2R59A 3LJ3A 3LVQE 3QAQA 3TJPA 3EU9A 3HXFA 3DXMG 5B1AE 5LCWJ 2LSUA 3PUJA 5KJMA 1SA4A 4I6GA 1PY1A 4J8YA 3DRAA 1HFAA 5BV0A 1FVHA 1N52A 3SZ7A 1DC2A 1MX6A 1IHGA 1XNFA 4L2YA 2EIJE 5HKPA 3MJWA 5AIJA 3AG2E 2AXVA 1QBQA 3BG1B 2QFCA 4E6HA 1TNOA 2GROB 4JC8A 1YYHA 3B13A 3SFZA 3VLFA 5EILA 4BWRA 4DJAA 2DZNA 2C0MA 3HXBA 4OAVB 4GZ3A 4EPZA 4G8LA 2F8YA 3L13A 4ACKA 2R2LA 1GW6A 1D8DA 1EYHA 3CK8A 4UI9K 5CECB 4JB8P 1FVFA 5A7DB 4TXQA 5FQ4A 1V54E 2V4HC 3TWSA 3MCXA 2FULA 3G2WA 3I4GA 4NACA 4JHJA 4FP7A 3S7BA 3D9JA 3ML8A 2R17C 3EU5A 4ZHBA 1H0AA 4L9PA 2FO7A 1H2VC 4G11A 4TUMA 3SY2A 4LSZE 3RO3A 3Q47B 2JEKA 4HS2A 4DX6D 3QWPA 3CK7A 5ITZF 4AJWA 3NF1A 1TJFA 2XEVA 1TEZA 1MJ0A 3GZ2A 3QWWA 2XZTG 2WXFA 5EYPF 3UM3A 1E8YA 3QKYA 2P9LG 5M72A 4A3VA 3CHPA 1H19A 1EPUA 2BTDA 3U4TA 1MQSA 4ANXA 3JYSA 5AARA 1UJKA 3ZN3A 4WUYA 1YA0A 2GRPB 1L5JA 1N9AA 4BT9A 4U95D 4LUNU 3FFLA 4BERA 4GTRA 5G55A 1TN8A 1E7VA 1ELWA 2WQ6A 1BD8A 4ILHB 5JJTA 2I2OA 2WQHA 3FTZA 1S0PA 4K5BA 2EINE 2MYOA 1HX8A 3CEQA 3JQ1A 4YDYA 3T8KA 2DWZA 3TGOA 5ARFA 5AJLA 3ZRHA 3FU3A 3DSVA 3CQGB 1DVPA 3S7DA 4MRUA 3B95A 3CSTA 3FU0A 5D0QD 2OCCE 2VQ2A 3J5QB 5G04C 3UT4A 2NC9A 2XZDG 2L9BA 1UN9A 3ABME 5J08A 5FZSA 4GYYA 4RQIA 2KATA 4DRXE 3IV0A 2YINA 3LXUX 2C2LA 1SZAA 1S70B 4AM9A 2XQ0A 5KCMA 4DX1A 3PZ4A 4YDWA 3U66A 2X6IA 3D9NA 4AOFA 4KVOA 3G2SA 2VSOE 4ABNA 4H7YA 3ABKE 1XGWA 1N94A 2B0OE 4DX5D 2GRQB 2BF0X 5JA4D 3JQ0A 4TXRA 3EIQC 3SD5A 4NURA 4YVOA 2R02A 2I9CA 4K03A 5ENTD 5AQBA 1A17A 5FQ7A 5FWQA 3QB2A 4L2LA 3ESKA 3D9HA 3DSWA 3GYZA 2ILRA 4RSYA 1TNUA 2AXUA 2XCBA 2P58C 3T5XA 1OXJA 4WNGA 4WWNA 1N4QA 3SBSA 3FTXA 4GA0A 4YDEA 2Y4TA 3FTWA 2X6HA 3LY8A 1H2UA 2KBXA 2AW6A 4CEMA 2R05A 4JZYA 3FP3A 3PS6A 2IFUA 2PM6A 2J49A 3PH0C 3LY7A 3ZHEA 2KCLA 2I1KA 3PE4A 4LNGA 5BW8C 4Y6WA 2WXPA 1KPSB 4LNUD 2XPZA 4CDMA 2FEZA 5KJKA 4GTOA 5ENRD 5JJ6A 1ZU2A 3Q73A 4A1SA 4U8VD 2LO6A 3PZDA 4BTAA 3FEXA 2YHEA 3ULEG 3CHRA 3OXLA 5ENNA 1LTXA 1E8XA 3C3OA 4F7AA 2WM9A 3TWVA 4FC8A 2GRRB 4HQDA 3UMVA 4UQZA 3GZ1A 3TXMA 3VTYA 4DK5A 2VGEA 2L0TB 3MZLB 3ZGQA 3S7JA 1TN7A 3MX3A 4PH4B 3IXEA 1H6KA 2P9PG 3FUNA 1FCHA 3PREA 2XEHA 2IO3C 1E96B 2DCPA 1LD8A 4JXTA 4CT0A 4EBAA 3G2TA 1HG5A 1KLXA 4IYPA 5JJ7A 2ZGDA 5ENOD 3QARA 3RAUA 1S63A 1V55E 3WXXA 4LRZA 4HORA 4UI9C 2QY7A 4UUCA 2YQ8A 4V3IA 1UW4B 4J7WA 4A55A 2I6HA 2XCCA 2XGMA 5EDSA 3B7RL 1DCQA 1MZCA 1Z3XA 3DPYA 5B1BE 3NZUA 1O1RA 2OVBA 2UWJG 2HR2A 5EIDA 3VLEA 1YCSB 3HVEB 3JXIA 3ZYKA 1UOHA 5CBOA 3AU4A 3IKOB 3EUVA 3LKUA 3Q5MA 2P9NG 1X5BA 3FUJA 1MX4A 3FUHA 4BTBA 2YNQA 4TXPA 2J4BA 1TR4A 4J8SA 3L54A 4APOA 2LSVA 1NI1A 3EHQA 5HS0A 4CRWA 1OUVA 4KZ0A 4LNBA 2EIME 5ARGA 3PZ3A 1TNBA 3S7FA 4UWHA 3I5PA 2H6HA 4ILIA 3PNTB 4HOUA 2WXQA 3RRNB 3LEWA 2BEDA 1W3BA 3ASNE 2ETAA 1OCOE 3V2OA 1N4PA 2BKKB 4BETA 1ZB1A 2VGXA 5ENQD 4BSZB 2XRZA 4APFA 1FT1A 5FJYA 1U3DA 2FO1E 3ZHEB 2ETCA 1NL4A 2KZTB 3E32A 4UWFA 3AG3E 1Z3YA 3SBTB 1WG0A 3W9GA 3FDHA 4N3AA 3TG5A 3DBSA 4HRNA 4KBQA 3CKBA 2VYIA 4EECA 3GZSA 3URZA 4GPKA 1IKND 3FUKA 3CVQA 2KC7A 1QYMA
chains in the Genus database with same CATH topology
3JXJA 3NOGD 1YCSB 1NFIE 5CERB 3LJNA 5AARA 4CZ2D 5KBAA 2DVWA 3Q9UC 3TWVA 3JXIA 1UOHA 3TWWA 4RLYA 2B0OE 1YYHA 4DX5D 1MX2A 2QYJA 5CBOA 4O60A 4A63B 5CBNA 5EILA 4HQDA 2AJAA 2DZNA 3V79K 5JA4D 1G3NB 1MX4A 2RFAA 4OAVB 2VGEA 4G8LA 2F8YA 4U95D 4GPMA 1TR4A 2Y1LE 5D66A 4BERA 5CEAA 4HB5A 5ENTD 2L6BA 3F6QA 4HRMB 5AQBA 3J5PA 1BD8A 4JB8P 3EHQA 3ZNGA 3KEAA 3TWQA 5HS0A 5CECB 5ENSD 4HI9A 3IXEA 4OAUC 5KWDA 3HG0D 5HRYA 3V2XA 1WDYA 4CYMD 4DX7D 1BLXB 1IXVA 3JUEA 4HRLA 4BEPA 4K5BA 3D9HA 4G8KA 2MYOA 2V5QC 1AWCB 2XENA 2HE0A 2V4HC 3TWSA 2NYJA 5EIDA 4YDYA 3TWUA 3T8KA 5BXOA 1A5EA 4K5AB 2DWZA 1N0RA 1OY3D 2XEEA 2XEHA 3DEPA 4QFVA 5AN8A 3AAAC 2F8XK 1K3ZD 4Z68A 4O1OA 4DX2A 3SO8A 4U96D 3V31A 1SW6A 4HNAD 4HBDA 1OT8A 3B95A 4ZHBA 4HLLA 3HRAA 1AP7A 2J8SD 3J5QB 3T9KA 4DUIA 4TUMA 2Y0BG 1SVXA 2P2CP 3EU9A 3UI2A 3TWXA 2KXPC 2ZGDA 2ETAA 4LSZE 2XZDG 5ENOD 3NBNB 4GMRA 3V2OA 1BI7B 2KBXA 5FINA 5EN5D 5AQ9A 2BKGA 1BU9A 4ATZD 3DEOA 2BKKB 4HI8A 2RFMA 4BETA 3UXGA 1K1BA 2F37A 5ENPD 3W9FA 3EHRA 3ZKJA 4QQIA 4UUCA 5ENQD 3AJIA 3TWRA 1MYOA 4BSZB 4DRXE 4DX6D 4F6RD 2PNNA 5FIOA 3V30A 4O1PA 5EYLA 4J8YA 4LG6A 2FO1E 4J7WA 5CEDB 5AAOA 5ITZF 1S70B 4F1PA 2ETCA 4NIKA 5AQ7A 3TWTA 4B93B 4N5QA 5AQAA 2A5EA 4DX1A 1MJ0A 4C48B 1N0QA 4LNUD 1YMPA 5KNGA 1WG0A 4YDWA 3W9GA 2ZGGA 1DC2A 5ENRD 4U8YD 4BESA 2XZTG 1MX6A 4U8VD 5KNHD 5EYPF 1D9SA 1N11A 3ZU7B 1DCQA 3NOCD 4HRNA 1BI8B 2QC9A 1K1AA 5EIBE 5HKPA 1IHBA 2JABA 3UTMA 5BXUA 3Q9NC 1IKND 4K5CA 3ZUVB 5JMND 3B7BA 3C5RA 2DZOA 2ETBA 4ZFHA 1QYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXJ A;  3NOG D;  1YCS B;  1NFI E;  5CER B;  3LJN A;  5AAR A;  4CZ2 D;  5KBA A;  2DVW A;  3Q9U C;  3TWV A;  3JXI A;  1UOH A;  3TWW A;  4RLY A;  2B0O E;  1YYH A;  4DX5 D;  1MX2 A;  2QYJ A;  5CBO A;  4O60 A;  4A63 B;  5CBN A;  5EIL A;  4HQD A;  2AJA A;  2DZN A;  3V79 K;  5JA4 D;  1G3N B;  1MX4 A;  2RFA A;  4OAV B;  2VGE A;  4G8L A;  2F8Y A;  4U95 D;  4GPM A;  1TR4 A;  2Y1L E;  5D66 A;  4BER A;  5CEA A;  4HB5 A;  5ENT D;  2L6B A;  3F6Q A;  4HRM B;  5AQB A;  3J5P A;  1BD8 A;  4JB8 P;  3EHQ A;  3ZNG A;  3KEA A;  3TWQ A;  5HS0 A;  5CEC B;  5ENS D;  4HI9 A;  3IXE A;  4OAU C;  5KWD A;  3HG0 D;  5HRY A;  3V2X A;  1WDY A;  4CYM D;  4DX7 D;  1BLX B;  1IXV A;  3JUE A;  4HRL A;  4BEP A;  4K5B A;  3D9H A;  4G8K A;  2MYO A;  2V5Q C;  1AWC B;  2XEN A;  2HE0 A;  2V4H C;  3TWS A;  2NYJ A;  5EID A;  4YDY A;  3TWU A;  3T8K A;  5BXO A;  1A5E A;  4K5A B;  2DWZ A;  1N0R A;  1OY3 D;  2XEE A;  2XEH A;  3DEP A;  4QFV A;  5AN8 A;  3AAA C;  2F8X K;  1K3Z D;  4Z68 A;  4O1O A;  4DX2 A;  3SO8 A;  4U96 D;  3V31 A;  1SW6 A;  4HNA D;  4HBD A;  1OT8 A;  3B95 A;  4ZHB A;  4HLL A;  3HRA A;  1AP7 A;  2J8S D;  3J5Q B;  3T9K A;  4DUI A;  4TUM A;  2Y0B G;  1SVX A;  2P2C P;  3EU9 A;  3UI2 A;  3TWX A;  2KXP C;  2ZGD A;  2ETA A;  4LSZ E;  2XZD G;  5ENO D;  3NBN B;  4GMR A;  3V2O A;  1BI7 B;  2KBX A;  5FIN A;  5EN5 D;  5AQ9 A;  2BKG A;  1BU9 A;  4ATZ D;  3DEO A;  2BKK B;  4HI8 A;  2RFM A;  4BET A;  3UXG A;  1K1B A;  2F37 A;  5ENP D;  3W9F A;  3EHR A;  3ZKJ A;  4QQI A;  4UUC A;  5ENQ D;  3AJI A;  3TWR A;  1MYO A;  4BSZ B;  4DRX E;  4DX6 D;  4F6R D;  2PNN A;  5FIO A;  3V30 A;  4O1P A;  5EYL A;  4J8Y A;  4LG6 A;  2FO1 E;  4J7W A;  5CED B;  5AAO A;  5ITZ F;  1S70 B;  4F1P A;  2ETC A;  4NIK A;  5AQ7 A;  3TWT A;  4B93 B;  4N5Q A;  5AQA A;  2A5E A;  4DX1 A;  1MJ0 A;  4C48 B;  1N0Q A;  4LNU D;  1YMP A;  5KNG A;  1WG0 A;  4YDW A;  3W9G A;  2ZGG A;  1DC2 A;  5ENR D;  4U8Y D;  4BES A;  2XZT G;  1MX6 A;  4U8V D;  5KNH D;  5EYP F;  1D9S A;  1N11 A;  3ZU7 B;  1DCQ A;  3NOC D;  4HRN A;  1BI8 B;  2QC9 A;  1K1A A;  5EIB E;  5HKP A;  1IHB A;  2JAB A;  3UTM A;  5BXU A;  3Q9N C;  1IKN D;  4K5C A;  3ZUV B;  5JMN D;  3B7B A;  3C5R A;  2DZO A;  2ETB A;  4ZFH A;  1QYM A; 
#chains in the Genus database with same CATH topology
 2H6I A;  3ONL A;  3HYM B;  4KT6 B;  3E37 A;  4XX5 A;  4HVB A;  2ZU6 B;  3FH8 A;  4HOQ A;  3E33 A;  3IHY A;  4EZJ A;  4BX9 A;  2XPY A;  5FZQ A;  4ACL A;  3RIB A;  3FU5 A;  3X2Q E;  2VSX E;  3BEE A;  3MYV A;  4PS3 A;  4MS6 A;  3RSE G;  3ABL E;  3NAW A;  3ULY A;  3O4Z A;  5BXO A;  3SNX A;  4WAF A;  3CHM A;  3DEP A;  3LS8 A;  1WAO 1;  4J8F A;  1U3C A;  4G1T A;  5CMW A;  5LOZ A;  3T9K A;  4U0Z A;  1BPO A;  3CVY A;  3PEV B;  4J6I A;  2J9Q A;  3W9F A;  2LAI A;  2LAH A;  3FTY A;  4BX8 A;  3V30 A;  1NA0 A;  2EIL E;  5EYL A;  2DYR E;  3CR3 A;  4UI9 J;  3L22 A;  1H2T C;  2A5E A;  3UUX A;  5ANR A;  5IY5 E;  4BY6 A;  4WND A;  2VSY A;  3S2A A;  2OVF A;  1FT2 A;  3FUM A;  3D9M A;  3FH7 A;  1Y8M A;  2UY1 B;  3BU8 A;  1IHB A;  1N95 A;  4EHM A;  2X6K A;  1JCQ A;  4TRQ A;  2VSN A;  2CHZ A;  2P9S G;  4JHR A;  4URK A;  3EDT B;  2VGY A;  1TJC A;  3QWV A;  3R7Q A;  2Y69 E;  3RRU A;  4F3V A;  4YDO A;  2DYS E;  2L6B A;  3L16 A;  1TYQ G;  3U9W A;  4AXH A;  5A6C A;  3L08 A;  1BLX B;  1AWC B;  3VLD A;  4IUL A;  3TWU A;  4F53 A;  4U8H A;  5AEN A;  4XI9 A;  1Z5S C;  5JHA A;  1SW6 A;  4CT4 A;  3HDX A;  5AJD A;  4I9C A;  3ZFW A;  1HS6 A;  3KEZ A;  5D0O D;  2X38 A;  4U63 A;  5HI7 A;  5B3S E;  3PZ1 A;  3MGB A;  3D9O A;  1IYG A;  4GYO A;  2XGO A;  2VGX B;  1MYO A;  1DCE A;  2PNN A;  1NP7 A;  1QQE A;  2CG2 A;  4LER A;  3BUA A;  4H7X A;  3DXK G;  5T8I A;  4B93 B;  3CHS A;  3E30 A;  5AQA A;  2PQR A;  5FQ8 A;  3FUI A;  4GB9 A;  5KNG A;  3MKQ A;  1KZP A;  2CFU A;  4J8E A;  4DLQ A;  3PRZ A;  5LP0 A;  1VDY A;  3UKR G;  4ANW A;  4OVU A;  4GTP A;  3L17 A;  4N39 A;  2HM8 A;  2ETB A;  1Z6T A;  5BUZ A;  3ZPJ A;  2WXL A;  1TNZ A;  4O60 A;  1E90 A;  3I3N A;  4KVM A;  2WVI A;  1OWP A;  3UKU G;  2PL2 A;  5CRU A;  4JA9 A;  4JVS A;  3HVE A;  3LVR E;  4IRU A;  3TWQ A;  5KJL A;  3CSF A;  1Y6I A;  4BSX A;  2HE0 A;  3CQC B;  4XIF A;  1UN8 A;  4ANV A;  4HXI A;  1OY3 D;  1IQR A;  3HXC A;  1NZN A;  1JPL A;  4EZK A;  3ASO E;  3V31 A;  2DBA A;  1OT8 A;  4I17 A;  4HLL A;  2XS8 A;  4JEH A;  4XEI G;  4CDN A;  3LDZ A;  3LY9 A;  3MV2 B;  2WXO A;  4GA2 A;  3TWX A;  3ZYM A;  1BI7 B;  2P9I G;  5EN5 D;  1BU9 A;  4YVQ C;  2AXZ A;  2LUH A;  4L1B A;  5ENP D;  3ZKJ A;  3RK6 A;  2OV8 A;  4CDR A;  4I43 A;  2VTB B;  1UJJ A;  4AY5 A;  5FIO A;  4F1P A;  3DSX A;  3TWT A;  3AU5 A;  4W9R A;  4K0R A;  3FTU A;  4FLH A;  3CLJ A;  2ION A;  3CVP A;  4GAA A;  4JL0 A;  1LF8 A;  1OWN A;  1SA5 A;  5CMY A;  1Q2Z A;  3FUD A;  1OCZ E;  5G05 C;  2KZT A;  4GZ5 A;  5KBA A;  3C72 A;  1QZ2 A;  4XKC A;  1HXI A;  2RFA A;  2KCV A;  3PVL A;  4FA6 A;  3ONK A;  2ZIS A;  2LNI A;  4AV7 A;  3IBE A;  3EIJ A;  3J5P A;  2CHW A;  4I6J A;  3ZYQ A;  4OAU C;  3TAX A;  3HG0 D;  5HRY A;  4I6E A;  4ANU A;  4C0M A;  3U3W A;  1SZ9 A;  2HO1 A;  3HIZ A;  3ASG A;  4I1A A;  1JCR A;  3AS8 A;  4CCA A;  4O1O A;  2IJG X;  1HG2 A;  4U96 D;  3ZYL A;  3MV3 B;  2XRY A;  1JWG A;  5DIZ A;  2AWI A;  3K9I A;  2QZA A;  1HE8 A;  2RFM A;  3CKC A;  4NQ0 A;  1K1B A;  3LCA A;  3SHF A;  3EHR A;  4JPS A;  3PDN A;  1INZ A;  1LD7 A;  4O1P A;  4ME2 A;  3KSL A;  4PS8 A;  4PDX A;  4BFR A;  4HOS A;  2P9U G;  4KYO B;  2WPV A;  3TL5 A;  3MKQ B;  5G04 J;  3U64 A;  4WWO A;  1ZBP A;  4C9B B;  4FHK A;  3UTM A;  5BXU A;  3AS5 A;  3C5R A;  3R9M A;  3NOG D;  5FT9 A;  1S64 A;  5CER B;  4KMO A;  1MHQ A;  2WXN A;  3HXE A;  3PZ2 A;  3Q75 A;  2AJA A;  4TUU A;  2UY1 A;  1H6P A;  3Q78 A;  2KM4 A;  4I1O B;  4HB5 A;  1U2V G;  3UM0 A;  4FLB A;  3Q4A B;  3WG7 E;  4J0U A;  2OEV A;  4I2W A;  3CVX A;  5E75 A;  4OVV A;  3VTX A;  1N0R A;  2GW1 A;  3MKR A;  5AN8 A;  4G24 A;  2FF4 A;  2OOE A;  3B7U X;  3C3Q A;  2CHX A;  2M63 A;  3CV0 A;  3FHE A;  3L9T A;  4GA1 A;  4Y6C A;  4B8C B;  2GRM A;  2KXP C;  4PS7 A;  2J4D A;  5FIN A;  3ISM C;  3DEO A;  2F37 A;  4B8A A;  2IF4 A;  5AYW D;  1P5Q A;  3SFX A;  3BG0 B;  3D9L A;  1IQU A;  1WY6 A;  1OWO A;  4UWG A;  3ZW3 A;  3UM1 A;  3CHQ A;  1JWF A;  4B0Z A;  3C98 A;  3SGH A;  2BUG A;  4O6F A;  1N11 A;  5ANL A;  3CVU A;  1BI8 B;  3P2B A;  5EIB E;  2WXJ A;  4HLE A;  3SI5 A;  3N71 A;  3G2U A;  1B89 A;  3QJZ A;  3SFY A;  2IQC A;  3SQV A;  5G05 J;  3D9K A;  1PAQ A;  3ULQ A;  4A63 B;  4GTS A;  2GGF A;  1HZ4 A;  4MLP A;  2MOW A;  3V79 K;  1G3N B;  2B6C A;  1TNY A;  2PM7 A;  1RZ4 A;  5D66 A;  1HH8 A;  4NRH B;  2J07 A;  3F6Q A;  3KEA A;  3UPV A;  1HF8 A;  2EIK E;  2JLB A;  3QNK A;  4HRL A;  4N2S A;  3OTN A;  5JHB A;  4E85 A;  2WXG A;  3Q49 B;  4Q94 A;  5CHE E;  4R7L A;  2XEE A;  3CHO A;  4JA7 A;  4WNF A;  5A23 A;  2YHC A;  3G2V A;  2J8S D;  4GTQ A;  3CGH A;  2Y0B G;  3UI2 A;  5T3R A;  3ZXP A;  3UT7 A;  3QOU A;  2BKG A;  1RW2 A;  4XKB A;  4AIF A;  2XPI A;  4QQI A;  4M3O A;  5FZR A;  3ZXS A;  2H6F A;  1TN6 A;  4TV3 A;  3Q79 A;  3UT8 A;  4HOT A;  4LG6 A;  3GW4 A;  2X6J A;  4KZC A;  4Q69 A;  3MEK A;  3CVL A;  3ASH A;  3E34 A;  4J8D A;  1JCS A;  1YMP A;  4JHK A;  3KS2 A;  4LEU A;  4BES A;  1N4S A;  5H7P A;  3ASD A;  1D9S A;  4CGV A;  4G25 A;  2NXP A;  3DPD A;  2FI7 A;  3PUK A;  2VTB A;  2HYZ A;  4K5C A;  3OXF A;  3EHM A;  2L0I A;  3APF A;  1NFI E;  1KZO A;  5G2N A;  2A5U A;  4UQY A;  1PC2 A;  4GTV A;  1MX2 A;  2QYJ A;  2WB2 A;  4L7T A;  2C0L A;  1WM5 A;  2MHK A;  1HU3 A;  2J09 A;  4MKT A;  5DBK A;  4DLO A;  5KWD A;  1WDY A;  5EX3 A;  4DX7 D;  2IO2 C;  4EZL A;  3JCK C;  3RU0 A;  1OCR E;  4FAD A;  1A5E A;  1E8Z A;  4Z68 A;  1KT0 A;  4N3C A;  3HRA A;  3FH5 A;  2WXM A;  2V5F A;  5C2Y A;  4FJZ A;  4DI3 A;  3NBN B;  3E4B A;  3CK9 A;  4U04 A;  3L82 A;  4C0E A;  3T5V A;  1EDU A;  3D9P A;  3UIP C;  3DWL G;  3C3R A;  5D2M C;  3D3M A;  4JEU A;  3QC1 A;  1OCC E;  4ILG A;  4GYW A;  4N5Q A;  1H6O A;  1D8E A;  1N0Q A;  4PUC A;  3Q15 A;  2ZGG A;  4N2Q A;  4YND A;  3LYA A;  3AG4 E;  3L6A A;  4UWK A;  2QC9 A;  4AY6 A;  1K8K G;  3QK0 A;  3FWV A;  3Q9N C;  4U07 A;  4BT8 A;  3FU6 A;  1QNF A;  3FTS A;  3QDN A;  5J90 A;  1N54 A;  3JXJ A;  3NQP A;  2OEW A;  2WQ7 A;  4UWL A;  5FTP A;  3TWW A;  4RLY A;  4GZC A;  3JUI A;  4A3T A;  3APC A;  3FTV A;  1FPP A;  3TXN A;  4XZ4 A;  5LX8 A;  2Y1L E;  4IN3 B;  3RO2 A;  3ZNG A;  2PQN A;  4FU3 A;  4G2V A;  3CVW A;  4GTT A;  4BEP A;  2PZI A;  4DI4 A;  3FEY A;  2V5Q C;  2NYJ A;  2L6J A;  3CVN A;  3APD A;  1K3Z D;  5C1D A;  1OWL A;  3TG4 A;  4HBD A;  3CVV A;  1HO8 A;  4B89 A;  3UQ3 A;  4DUI A;  2VJ8 A;  2IOL A;  2I1J A;  1SVX A;  2P2C P;  4JW1 A;  4WNE A;  5CRV A;  4CGW A;  2CG3 A;  4GMR A;  5BPP A;  5AQ9 A;  4ATZ D;  5BT1 A;  3HXD A;  3TWR A;  3B7S A;  2IY0 C;  2IU1 A;  5AAO A;  2AVP A;  5CCM A;  4P29 A;  5AQ7 A;  4WWP A;  4G23 A;  4AP2 A;  2Y4U A;  3RKV A;  3ZU7 B;  1K1A A;  3PE3 A;  3OXG A;  4X8Q A;  3UIO C;  3ZUV B;  3ENE A;  4ATG A;  5JMN D;  3B7B A;  3LJN A;  2H6G A;  3IEG A;  2DVW A;  2LXL A;  3IHV A;  5CCL A;  2EQX A;  5CBN A;  3NZS A;  2V4L A;  4RVB A;  3ZIM A;  4AVX A;  2GRL A;  3PEU B;  5EKQ D;  1OWM A;  5KJN A;  2RKK A;  1DNP A;  3FY4 A;  2CFZ A;  1ELR A;  2P9K G;  1E7U A;  3UM2 A;  1ELK A;  3UIN C;  4CYM D;  2V8S E;  1IXV A;  4G8K A;  1EF1 C;  2XEN A;  4HFG A;  3CIA A;  4JD2 G;  4K5A B;  2OND A;  4RG9 A;  3ML9 A;  3SO8 A;  3KSQ A;  4GCO A;  2IEJ A;  3FUE A;  4GZ6 A;  4KXK B;  1O1T A;  4FUL A;  5BV1 A;  5LCW C;  2Y3A A;  2F0Y A;  1SQM A;  3DST A;  4UQX A;  4EBA G;  4GU5 A;  4U0U A;  3AJI A;  4F6R D;  2RG8 A;  2IOS A;  2WXH A;  5HQ8 A;  3AG1 E;  2X6F A;  3LPZ A;  4B94 A;  4N5C A;  4GCN A;  4U8Y D;  3RJV A;  5KNH D;  3NOC D;  4I2Z A;  2WXK A;  3Q7F A;  3AS4 A;  2DIW A;  5EX0 A;  3EHN A;  4U7E B;  2RD0 A;  2DZO A;  2WXR A;  3PNL B;  4CZ2 D;  1O5M A;  4Q96 A;  5E76 A;  3Q9U C;  3R9A B;  1JUQ A;  5BNW A;  1E8W A;  2R03 A;  3RRM B;  2XGS A;  4A1G A;  4RG6 A;  4GPM A;  5CEA A;  4U0S A;  2MRI A;  5ENS D;  3KAE A;  4M7C A;  5T4Y A;  3SF4 A;  3OAW A;  2KCK A;  3KD7 A;  2E2E A;  2FBN A;  2R5S A;  4QFV A;  3ZEF A;  2Q7F A;  2F8X K;  3UX4 A;  3O48 A;  4HNA D;  4XI0 A;  4DPR A;  1AP7 A;  3ZVV A;  4N3B A;  2WXI A;  3EJN A;  1N4R A;  4HI8 A;  3NB2 A;  3UXG A;  3FUL A;  3HHM A;  3Q7A A;  4GTM A;  4XE0 A;  4FJY A;  3MA5 A;  5CED B;  3D9I A;  2J08 A;  4NIK A;  4D10 C;  3FUF A;  4C48 B;  3ESL A;  1UG3 A;  2ZXW E;  4LCT A;  3BQO A;  1X81 A;  2QYU A;  2JAB A;  1O1S A;  4L23 A;  2WMN A;  4ZFH A;  2NSZ A;  4EQF A;  2GRN B;  3I4R B;  2WMO A;  1NA3 A;  2X3M A;  4GML A;  2LXM A;  3DSS A;  2E0I A;  3T8M A;  1KT1 A;  3DSU A;  4GZD A;  4I9E A;  2ZIR A;  2XHE A;  4HRM B;  2A4Z A;  5FQ6 A;  4HI9 A;  4F1S A;  5LFA A;  4GMJ A;  3V2X A;  3ASF A;  3JUE A;  4FHJ A;  3P1U A;  3B7T A;  3AAA C;  4DX2 A;  2V0P A;  3R7R A;  2XS1 A;  4MBG A;  4AEZ C;  4G26 A;  4OYS A;  4I1M A;  2R59 A;  3LJ3 A;  3LVQ E;  3QAQ A;  3TJP A;  3EU9 A;  3HXF A;  3DXM G;  5B1A E;  5LCW J;  2LSU A;  3PUJ A;  5KJM A;  1SA4 A;  4I6G A;  1PY1 A;  4J8Y A;  3DRA A;  1HFA A;  5BV0 A;  1FVH A;  1N52 A;  3SZ7 A;  1DC2 A;  1MX6 A;  1IHG A;  1XNF A;  4L2Y A;  2EIJ E;  5HKP A;  3MJW A;  5AIJ A;  3AG2 E;  2AXV A;  1QBQ A;  3BG1 B;  2QFC A;  4E6H A;  1TNO A;  2GRO B;  4JC8 A;  1YYH A;  3B13 A;  3SFZ A;  3VLF A;  5EIL A;  4BWR A;  4DJA A;  2DZN A;  2C0M A;  3HXB A;  4OAV B;  4GZ3 A;  4EPZ A;  4G8L A;  2F8Y A;  3L13 A;  4ACK A;  2R2L A;  1GW6 A;  1D8D A;  1EYH A;  3CK8 A;  4UI9 K;  5CEC B;  4JB8 P;  1FVF A;  5A7D B;  4TXQ A;  5FQ4 A;  1V54 E;  2V4H C;  3TWS A;  3MCX A;  2FUL A;  3G2W A;  3I4G A;  4NAC A;  4JHJ A;  4FP7 A;  3S7B A;  3D9J A;  3ML8 A;  2R17 C;  3EU5 A;  4ZHB A;  1H0A A;  4L9P A;  2FO7 A;  1H2V C;  4G11 A;  4TUM A;  3SY2 A;  4LSZ E;  3RO3 A;  3Q47 B;  2JEK A;  4HS2 A;  4DX6 D;  3QWP A;  3CK7 A;  5ITZ F;  4AJW A;  3NF1 A;  1TJF A;  2XEV A;  1TEZ A;  1MJ0 A;  3GZ2 A;  3QWW A;  2XZT G;  2WXF A;  5EYP F;  3UM3 A;  1E8Y A;  3QKY A;  2P9L G;  5M72 A;  4A3V A;  3CHP A;  1H19 A;  1EPU A;  2BTD A;  3U4T A;  1MQS A;  4ANX A;  3JYS A;  5AAR A;  1UJK A;  3ZN3 A;  4WUY A;  1YA0 A;  2GRP B;  1L5J A;  1N9A A;  4BT9 A;  4U95 D;  4LUN U;  3FFL A;  4BER A;  4GTR A;  5G55 A;  1TN8 A;  1E7V A;  1ELW A;  2WQ6 A;  1BD8 A;  4ILH B;  5JJT A;  2I2O A;  2WQH A;  3FTZ A;  1S0P A;  4K5B A;  2EIN E;  2MYO A;  1HX8 A;  3CEQ A;  3JQ1 A;  4YDY A;  3T8K A;  2DWZ A;  3TGO A;  5ARF A;  5AJL A;  3ZRH A;  3FU3 A;  3DSV A;  3CQG B;  1DVP A;  3S7D A;  4MRU A;  3B95 A;  3CST A;  3FU0 A;  5D0Q D;  2OCC E;  2VQ2 A;  3J5Q B;  5G04 C;  3UT4 A;  2NC9 A;  2XZD G;  2L9B A;  1UN9 A;  3ABM E;  5J08 A;  5FZS A;  4GYY A;  4RQI A;  2KAT A;  4DRX E;  3IV0 A;  2YIN A;  3LXU X;  2C2L A;  1SZA A;  1S70 B;  4AM9 A;  2XQ0 A;  5KCM A;  4DX1 A;  3PZ4 A;  4YDW A;  3U66 A;  2X6I A;  3D9N A;  4AOF A;  4KVO A;  3G2S A;  2VSO E;  4ABN A;  4H7Y A;  3ABK E;  1XGW A;  1N94 A;  2B0O E;  4DX5 D;  2GRQ B;  2BF0 X;  5JA4 D;  3JQ0 A;  4TXR A;  3EIQ C;  3SD5 A;  4NUR A;  4YVO A;  2R02 A;  2I9C A;  4K03 A;  5ENT D;  5AQB A;  1A17 A;  5FQ7 A;  5FWQ A;  3QB2 A;  4L2L A;  3ESK A;  3D9H A;  3DSW A;  3GYZ A;  2ILR A;  4RSY A;  1TNU A;  2AXU A;  2XCB A;  2P58 C;  3T5X A;  1OXJ A;  4WNG A;  4WWN A;  1N4Q A;  3SBS A;  3FTX A;  4GA0 A;  4YDE A;  2Y4T A;  3FTW A;  2X6H A;  3LY8 A;  1H2U A;  2KBX A;  2AW6 A;  4CEM A;  2R05 A;  4JZY A;  3FP3 A;  3PS6 A;  2IFU A;  2PM6 A;  2J49 A;  3PH0 C;  3LY7 A;  3ZHE A;  2KCL A;  2I1K A;  3PE4 A;  4LNG A;  5BW8 C;  4Y6W A;  2WXP A;  1KPS B;  4LNU D;  2XPZ A;  4CDM A;  2FEZ A;  5KJK A;  4GTO A;  5ENR D;  5JJ6 A;  1ZU2 A;  3Q73 A;  4A1S A;  4U8V D;  2LO6 A;  3PZD A;  4BTA A;  3FEX A;  2YHE A;  3ULE G;  3CHR A;  3OXL A;  5ENN A;  1LTX A;  1E8X A;  3C3O A;  4F7A A;  2WM9 A;  3TWV A;  4FC8 A;  2GRR B;  4HQD A;  3UMV A;  4UQZ A;  3GZ1 A;  3TXM A;  3VTY A;  4DK5 A;  2VGE A;  2L0T B;  3MZL B;  3ZGQ A;  3S7J A;  1TN7 A;  3MX3 A;  4PH4 B;  3IXE A;  1H6K A;  2P9P G;  3FUN A;  1FCH A;  3PRE A;  2XEH A;  2IO3 C;  1E96 B;  2DCP A;  1LD8 A;  4JXT A;  4CT0 A;  4EBA A;  3G2T A;  1HG5 A;  1KLX A;  4IYP A;  5JJ7 A;  2ZGD A;  5ENO D;  3QAR A;  3RAU A;  1S63 A;  1V55 E;  3WXX A;  4LRZ A;  4HOR A;  4UI9 C;  2QY7 A;  4UUC A;  2YQ8 A;  4V3I A;  1UW4 B;  4J7W A;  4A55 A;  2I6H A;  2XCC A;  2XGM A;  5EDS A;  3B7R L;  1DCQ A;  1MZC A;  1Z3X A;  3DPY A;  5B1B E;  3NZU A;  1O1R A;  2OVB A;  2UWJ G;  2HR2 A;  5EID A;  3VLE A;  1YCS B;  3HVE B;  3JXI A;  3ZYK A;  1UOH A;  5CBO A;  3AU4 A;  3IKO B;  3EUV A;  3LKU A;  3Q5M A;  2P9N G;  1X5B A;  3FUJ A;  1MX4 A;  3FUH A;  4BTB A;  2YNQ A;  4TXP A;  2J4B A;  1TR4 A;  4J8S A;  3L54 A;  4APO A;  2LSV A;  1NI1 A;  3EHQ A;  5HS0 A;  4CRW A;  1OUV A;  4KZ0 A;  4LNB A;  2EIM E;  5ARG A;  3PZ3 A;  1TNB A;  3S7F A;  4UWH A;  3I5P A;  2H6H A;  4ILI A;  3PNT B;  4HOU A;  2WXQ A;  3RRN B;  3LEW A;  2BED A;  1W3B A;  3ASN E;  2ETA A;  1OCO E;  3V2O A;  1N4P A;  2BKK B;  4BET A;  1ZB1 A;  2VGX A;  5ENQ D;  4BSZ B;  2XRZ A;  4APF A;  1FT1 A;  5FJY A;  1U3D A;  2FO1 E;  3ZHE B;  2ETC A;  1NL4 A;  2KZT B;  3E32 A;  4UWF A;  3AG3 E;  1Z3Y A;  3SBT B;  1WG0 A;  3W9G A;  3FDH A;  4N3A A;  3TG5 A;  3DBS A;  4HRN A;  4KBQ A;  3CKB A;  2VYI A;  4EEC A;  3GZS A;  3URZ A;  4GPK A;  1IKN D;  3FUK A;  3CVQ A;  2KC7 A;  1QYM A; 
#chains in the Genus database with same CATH homology
 3JXJ A;  3NOG D;  1YCS B;  1NFI E;  5CER B;  3LJN A;  5AAR A;  4CZ2 D;  5KBA A;  2DVW A;  3Q9U C;  3TWV A;  3JXI A;  1UOH A;  3TWW A;  4RLY A;  2B0O E;  1YYH A;  4DX5 D;  1MX2 A;  2QYJ A;  5CBO A;  4O60 A;  4A63 B;  5CBN A;  5EIL A;  4HQD A;  2AJA A;  2DZN A;  3V79 K;  5JA4 D;  1G3N B;  1MX4 A;  2RFA A;  4OAV B;  2VGE A;  4G8L A;  2F8Y A;  4U95 D;  4GPM A;  1TR4 A;  2Y1L E;  5D66 A;  4BER A;  5CEA A;  4HB5 A;  5ENT D;  2L6B A;  3F6Q A;  4HRM B;  5AQB A;  3J5P A;  1BD8 A;  4JB8 P;  3EHQ A;  3ZNG A;  3KEA A;  3TWQ A;  5HS0 A;  5CEC B;  5ENS D;  4HI9 A;  3IXE A;  4OAU C;  5KWD A;  3HG0 D;  5HRY A;  3V2X A;  1WDY A;  4CYM D;  4DX7 D;  1BLX B;  1IXV A;  3JUE A;  4HRL A;  4BEP A;  4K5B A;  3D9H A;  4G8K A;  2MYO A;  2V5Q C;  1AWC B;  2XEN A;  2HE0 A;  2V4H C;  3TWS A;  2NYJ A;  5EID A;  4YDY A;  3TWU A;  3T8K A;  5BXO A;  1A5E A;  4K5A B;  2DWZ A;  1N0R A;  1OY3 D;  2XEE A;  2XEH A;  3DEP A;  4QFV A;  5AN8 A;  3AAA C;  2F8X K;  1K3Z D;  4Z68 A;  4O1O A;  4DX2 A;  3SO8 A;  4U96 D;  3V31 A;  1SW6 A;  4HNA D;  4HBD A;  1OT8 A;  3B95 A;  4ZHB A;  4HLL A;  3HRA A;  1AP7 A;  2J8S D;  3J5Q B;  3T9K A;  4DUI A;  4TUM A;  2Y0B G;  1SVX A;  2P2C P;  3EU9 A;  3UI2 A;  3TWX A;  2KXP C;  2ZGD A;  2ETA A;  4LSZ E;  2XZD G;  5ENO D;  3NBN B;  4GMR A;  3V2O A;  1BI7 B;  2KBX A;  5FIN A;  5EN5 D;  5AQ9 A;  2BKG A;  1BU9 A;  4ATZ D;  3DEO A;  2BKK B;  4HI8 A;  2RFM A;  4BET A;  3UXG A;  1K1B A;  2F37 A;  5ENP D;  3W9F A;  3EHR A;  3ZKJ A;  4QQI A;  4UUC A;  5ENQ D;  3AJI A;  3TWR A;  1MYO A;  4BSZ B;  4DRX E;  4DX6 D;  4F6R D;  2PNN A;  5FIO A;  3V30 A;  4O1P A;  5EYL A;  4J8Y A;  4LG6 A;  2FO1 E;  4J7W A;  5CED B;  5AAO A;  5ITZ F;  1S70 B;  4F1P A;  2ETC A;  4NIK A;  5AQ7 A;  3TWT A;  4B93 B;  4N5Q A;  5AQA A;  2A5E A;  4DX1 A;  1MJ0 A;  4C48 B;  1N0Q A;  4LNU D;  1YMP A;  5KNG A;  1WG0 A;  4YDW A;  3W9G A;  2ZGG A;  1DC2 A;  5ENR D;  4U8Y D;  4BES A;  2XZT G;  1MX6 A;  4U8V D;  5KNH D;  5EYP F;  1D9S A;  1N11 A;  3ZU7 B;  1DCQ A;  3NOC D;  4HRN A;  1BI8 B;  2QC9 A;  1K1A A;  5EIB E;  5HKP A;  1IHB A;  2JAB A;  3UTM A;  5BXU A;  3Q9N C;  1IKN D;  4K5C A;  3ZUV B;  5JMN D;  3B7B A;  3C5R A;  2DZO A;  2ETB A;  4ZFH A;  1QYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...