3F6QA

Crystal structure of integrin-linked kinase ankyrin repeat domain in complex with pinch1 lim1 domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
DDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of integrin-linked kinase-PINCH interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
molecule keywords Integrin-linked protein kinase
total genus 57
structure length 169
sequence length 169
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3f6qA00
3DEPA 1YMPA 5JMND 4F1PA 2XEEA 4NIKA 4K5AB 3TWTA 2MYOA 1OY3D 1MX4A 1D9SA 2V5QC 4BERA 3TWVA 2DZOA 2BKGA 2RFMA 3J5QB 5AN8A 4ZFHA 4RLYA 1MX2A 1AWCB 3TWQA 1BI8B 4DX5D 4F6RD 5FINA 2FO1E 4UUCA 4J8YA 2XEHA 4K5CA 4Z68A 2F37A 1DC2A 3JXJA 3HRAA 2QYJA 3V31A 2NYJA 3T9KA 4OAVB 3ZU7B 5KBAA 1G3NB 3B95A 5JA4D 1MYOA 4A63B 4DX1A 2XENA 4DUIA 1WDYA 2JABA 2ZGGA 3LJNA 2KBXA 1A5EA 2DWZA 4BETA 1MJ0A 5BXUA 3W9FA 1K1BA 1WG0A 3IXEA 3V79K 1BD8A 3TWRA 1DCQA 4CYMD 2DZNA 3T8KA 4CZ2D 5BXOA 2V4HC 2BKKB 4BSZB 5CBOA 2AJAA 5EYPF 4OAUC 3C5RA 4GMRA 3KEAA 4U96D 1BU9A 4U8VD 2XZDG 4U8YD 5ENSD 2QC9A 3Q9NC 2KXPC 3Q9UC 5CEDB 3NOCD 5HKPA 2ETBA 4QQIA 5EILA 4DRXE 4LSZE 4G8KA 3DEOA 4J7WA 1IHBA 2Y1LE 3ZUVB 4BESA 1UOHA 3EHRA 2ETCA 3B7BA 4HRMB 1S70B 3UI2A 5AAOA 4G8LA 4GPMA 3J5PA 1QYMA 3V30A 4ZHBA 3ZKJA 5FIOA 4QFVA 1K3ZD 4ATZD 4HB5A 5KNGA 2J8SD 5ITZF 3TWWA 5AQBA 3D9HA 4O1PA 5KNHD 3UTMA 1BI7B 3TWSA 2DVWA 3JXIA 5CEAA 1MX6A 5AQ7A 2P2CP 4HRNA 3TWXA 3V2XA 3F6QA 4B93B 4O60A 5HS0A 1IKND 3NOGD 4C48B 2ZGDA 2Y0BG 3JUEA 4HLLA 5CERB 1SVXA 1YCSB 2F8YA 2L6BA 3EHQA 5KWDA 3NBNB 4O1OA 5EYLA 1OT8A 5HRYA 5AARA 5CECB 5EIBE 1YYHA 5EN5D 4LNUD 4YDWA 5ENQD 1BLXB 4HNAD 3W9GA 5ENPD 1AP7A 4YDYA 4JB8P 3AAAC 2XZTG 1N11A 5ENTD 2HE0A 4HQDA 2RFAA 4HI8A 2A5EA 4U95D 3TWUA 4DX6D 2VGEA 1K1AA 1SW6A 5D66A 2ETAA 4LG6A 5CBNA 3EU9A 4TUMA 2PNNA 4K5BA 4HRLA 1NFIE 3AJIA 5ENRD 3HG0D 3V2OA 3UXGA 4DX2A 4HBDA 3SO8A 5AQAA 4HI9A 5ENOD 1IXVA 5AQ9A 4BEPA 1TR4A 4N5QA 3ZNGA 4DX7D 1N0QA 2B0OE 1N0RA 2F8XK 5EIDA
chains in the Genus database with same CATH superfamily
1TN8A 2J9QA 3Q15A 3SFYA 2RFMA 4DX5D 2IFUA 4I6GA 3FP3A 2VYIA 4A3VA 3L08A 4G1TA 3E37A 3B7SA 2C0MA 4JC8A 1O1SA 1UN8A 2PQNA 4JVSA 3BG1B 3AG1E 2QC9A 2ETBA 1IHBA 1KT1A 4B8CB 3EHRA 4ILIA 4HRMB 1H2TC 2NC9A 2NSZA 2R17C 1L5JA 5JHBA 2OCCE 4U07A 3D9KA 3LKUA 3LVQE 4U7EB 3ISMC 2GRRB 4L7TA 3TG5A 4CDMA 2QYUA 3Q79A 4I9CA 3ZRHA 3GZ2A 1U2VG 4PS7A 4L2YA 3TGOA 4I2WA 2GW1A 2PQRA 4HOQA 3DSSA 5D66A 2XCCA 5ENRD 5G04J 3KSQA 4BSXA 4N2SA 2F8XK 4I1OB 4NIKA 4K5AB 3FUFA 4TXRA 3TWTA 1OY3D 5KJLA 3DWLG 4EBAG 4LRZA 5FINA 3ABME 3V31A 3RIBA 2AXZA 2DYRE 3ZPJA 2J09A 3HHMA 3ASHA 4F1SA 3PDNA 4FHKA 3MJWA 3DSUA 3LY8A 2BKKB 4BSZB 3LDZA 4CRWA 1ELKA 4ATGA 5JJ7A 5LCWC 3K9IA 3ZHEB 1N4RA 4FU3A 4XKBA 4TXQA 1S70B 4I6EA 4LCTA 4FLHA 1Z6TA 3UKRG 2H6FA 2CHZA 3BEEA 5KJNA 3CK9A 4U8HA 4GZDA 5AJDA 2L0IA 1JUQA 4HXIA 3P1UA 2P2CP 4GAAA 3FUJA 3TG4A 4XI0A 4C48B 3OXLA 5ANRA 2RD0A 5KWDA 1E8YA 3QKYA 4NACA 1V54E 3FY4A 3TJPA 4JW1A 4HQDA 2RFAA 3FTVA 2IY0C 4LG6A 1E96B 2OEWA 3DPYA 2NXPA 3ZGQA 3FFLA 1NL4A 1IXVA 2DCPA 1X81A 4HOTA 1OWOA 3LEWA 4GTSA 4TXPA 2J4DA 3R9AB 4Q69A 2J49A 3GYZA 4C0EA 3TWQA 4L1BA 4LNBA 1JPLA 2XS8A 4K5CA 5BT1A 2FULA 3CVYA 5JA4D 3TXNA 2AW6A 2E0IA 1EDUA 2IF4A 1OWLA 4HFGA 3LS8A 3ONKA 3LJ3A 4I43A 3LCAA 3NQPA 3JQ0A 4WWNA 3ESKA 2WXKA 3FTYA 2HYZA 2KZTB 4XZ4A 2KM4A 4LSZE 1YA0A 2WXPA 2VGXB 4ME2A 4UWLA 3FU5A 4GYYA 2ILRA 4WNGA 4UWFA 4GCOA 1UN9A 4G11A 3C3RA 3PZ1A 3GZ1A 3ZHEA 4O1PA 4UI9K 3CK8A 5IY5E 1LD7A 1N54A 2C2LA 4FJYA 4H7XA 4AXHA 1JWFA 4B93B 4E6HA 1E90A 4LUNU 3D9NA 4OYSA 4AOFA 3U64A 3ASDA 2P9IG 4HNAD 4YDOA 3RJVA 5HI7A 1N4PA 3ZXSA 2WQ7A 4HOSA 4GZ6A 1HZ4A 2ETAA 3PE3A 5FTPA 3FEYA 1O1RA 4HRLA 3G2TA 2IEJA 4DX2A 1ZB1A 3MV3B 4HBDA 1GW6A 3KS2A 5AQ9A 2E2EA 4WNFA 3ZKJA 2MYOA 3EUVA 4FULA 1MZCA 4ZFHA 1AWCB 3CIAA 2LNIA 4MKTA 1N95A 1TNOA 4AP2A 5BUZA 4A63B 1WDYA 2AVPA 4AJWA 3CR3A 4HORA 3Q78A 5H7PA 3SY2A 1XGWA 3C5RA 1U3DA 3C72A 3ASNE 3FH5A 1HU3A 3OAWA 2V5FA 3FTXA 4GMJA 5ENNA 2LAHA 3HXEA 3ULYA 2WMNA 2XGOA 4ANUA 3FU3A 5AAOA 4GPMA 3PUJA 1QYMA 2XQ0A 4KBQA 3HXFA 3JQ1A 4GCNA 1SA5A 3FEXA 5FQ8A 5ITZF 3ZYLA 3UTMA 5EDSA 3JXIA 5CEAA 4RG6A 1SZ9A 3AS5A 3UKUG 4UQZA 1Y6IA 2Y4TA 5AJLA 1UJKA 3L17A 3IHYA 3MGBA 3NB2A 2PZIA 4DX6D 4WAFA 5CBNA 1HFAA 3FTWA 1HX8A 3EU5A 5BV1A 3DEPA 4JD2G 1OWPA 3MZLB 3BQOA 4BX8A 1SZAA 4JXTA 1DC2A 4F53A 2R05A 3AU4A 4MS6A 3DSXA 4IULA 4XKCA 1N4QA 3CSFA 4CCAA 3VTYA 4AV7A 5LFAA 1S63A 3S7FA 3AG3E 1D8DA 2VTBB 2EQXA 4XEIG 3S7BA 3MV2B 4KVOA 4YNDA 4BWRA 4HVBA 2DYSE 4M7CA 3SBTB 3E34A 3QARA 2L6JA 2F0YA 4DRXE 2OVBA 1LF8A 3C3OA 3QDNA 3CVWA 2KCVA 4QFVA 2GGFA 1K3ZD 4ATZD 2QFCA 1SQMA 3L22A 2LO6A 2OOEA 5CERB 4O1OA 3LY7A 5AARA 4A1SA 1BLXB 2WXMA 3QWPA 1AP7A 3ULEG 4X8QA 4FLBA 3ULQA 2PNNA 3NAWA 3ZXPA 5G05J 3SO8A 2R03A 4HI9A 4A3TA 3SFZA 5KJMA 1TR4A 4DX7D 4MBGA 4WNEA 4JA9A 4RG9A 2I6HA 1DNPA 1D9SA 4BERA 3L54A 3DSWA 5C2YA 2EIME 2R02A 3ENEA 2YQ8A 4RLYA 4BT9A 1TJFA 2DIWA 4G2VA 4UUCA 4UWKA 3R9MA 2MOWA 2NYJA 4FADA 3CSTA 3GZSA 3O4ZA 3AG4E 4GPKA 4C9BB 2WXJA 3E30A 2OVFA 3V79K 1DCQA 4GTPA 3PUKA 5G04C 3OXFA 1SA4A 4JZYA 5FZSA 2BF0X 4UI9C 2XZDG 2X6JA 2CFUA 3D9MA 3VLEA 5ARGA 4J7WA 2Y1LE 3FUIA 4UI9J 5FJYA 3HIZA 4NQ0A 2PM6A 3J5PA 4IRUA 4FHJA 3U4TA 4DI4A 4PS8A 3TWSA 3ZIMA 3CVUA 2X6IA 2CG2A 3CKBA 3KSLA 3UM2A 4N2QA 3CQCB 4BTBA 2IQCA 2UY1A 1FVFA 2KCLA 3D9PA 4AM9A 4B0ZA 4EBAA 1N9AA 5G05C 2XCBA 4N5QA 1NA3A 2HM8A 1N0RA 3U9WA 1TN6A 5A7DB 1FT1A 1FPPA 2DZOA 4GZ5A 2RKKA 2XGMA 2VSNA 3RKVA 2WXNA 3CVXA 3HVEA 4OAVB 5CRVA 3HYMB 5D0QD 4U04A 4UWHA 3MKQA 1A5EA 2XEVA 4GYWA 4FP7A 3W9FA 4JHJA 2DZNA 3FTUA 2HR2A 4OAUC 2WVIA 2X6KA 1IHGA 3UM3A 3SD5A 1IYGA 3NOCD 5EILA 2CG3A 2GRMA 3EDTB 4RVBA 4NRHB 5G55A 3FTZA 4XX5A 3DSVA 3Q7AA 2VSOE 1KT0A 4J0UA 3V30A 1EPUA 3L82A 3PZDA 3CHRA 1OWMA 4J6IA 1K8KG 3R7RA 4AVXA 3FUKA 5JHAA 4LERA 1FVHA 5CMYA 5BV0A 4CGWA 2J4BA 1IKND 2WXQA 2R59A 3SZ7A 2L6BA 3ZW3A 1INZA 1OT8A 2BUGA 1E8WA 4F3VA 2HE0A 4GTTA 1SW6A 5ARFA 4K5BA 1TN7A 5AQAA 1PAQA 2UY1B 3VLFA 2MHKA 5ENOD 2Y4UA 1HE8A 3ASGA 3SHFA 1YMPA 4MLPA 2YHEA 3CVNA 3J5QB 1ZU2A 4U0UA 1MX2A 4GU5A 3RK6A 3RAUA 4G25A 4YVQC 3B95A 1PC2A 2P9PG 2XENA 4JEUA 5BXUA 1H2UA 3CV0A 5T8IA 3D9IA 4GA0A 4UWGA 3T8KA 1Z5SC 3UPVA 4GZCA 3QWVA 4PH4B 4GTQA 3RO3A 5CEDB 3AS4A 4QQIA 2H6IA 4U0SA 3U3WA 2WXGA 4I17A 4APFA 2I9CA 1FT2A 3B7RL 3JYSA 2LSVA 1B89A 4U0ZA 3CVPA 3FTSA 4Q94A 4I2ZA 5KNHD 5FZRA 3SQVA 5AQ7A 4APOA 3F6QA 4O60A 2YNQA 3PH0C 3OTNA 4M3OA 2X38A 1N94A 1JCQA 2L0TB 4AEZC 2LUHA 1ELRA 1A17A 2L9BA 1P5QA 1FCHA 3FUNA 4IN3B 2I2OA 4TUMA 3PNTB 3HG0D 2V8SE 4LNGA 1BPOA 4B89A 4D10C 2KC7A 2B0OE 3NZUA 4AY6A 3CVVA 4OVUA 1UJJA 4KVMA 5AN8A 3UIOC 1BI8B 4J8YA 5HQ8A 4Z68A 2F37A 1UW4B 2WXIA 3D9OA 1G3NB 2V0PA 2LXMA 2DWZA 5T3RA 5CMWA 1K1BA 3PREA 2WXHA 3IXEA 1BD8A 4CYMD 4PS3A 5CCMA 3MYVA 4HS2A 1NP7A 4O6FA 4GMRA 3KEAA 1LD8A 3WG7E 3MCXA 2EIJE 4I6JA 5M72A 5E75A 3B7BA 2VTBA 1H19A 3ZYMA 2WXFA 2IO3C 3N71A 4HB5A 3UUXA 1IQRA 1ZBPA 2FEZA 5DBKA 1BI7B 4AIFA 4EHMA 2KCKA 2WXRA 4EZLA 3ZEFA 4FC8A 5HS0A 3C98A 1LTXA 4HLLA 3RO2A 3NBNB 4GZ3A 3B7TA 5B1AE 5EYLA 5HRYA 3PEUB 5EN5D 2CHWA 3PZ2A 4LNUD 3T8MA 4B8AA 2P58C 5ENPD 3FU6A 5ENTD 2A5EA 3ZYQA 4U95D 2VGEA 2FBNA 5BPPA 3VTXA 4B94A 5D2MC 3D9LA 3TAXA 3GW4A 4L23A 2UWJG 3BU8A 1N0QA 3UM1A 5JMND 4G23A 2XEEA 4DPRA 3UT8A 1U3CA 2V5QC 4PDXA 5B1BE 2FO1E 2XEHA 5LOZA 2GRPB 5BNWA 2P9UG 3UX4A 2X6HA 3U66A 2ZXWE 3RRUA 4EZJA 1Q2ZA 4CT4A 2WXLA 2V4HC 3UINC 4CDRA 5CCLA 4N3AA 4XE0A 1NA0A 4K03A 3KD7A 3CHSA 4A55A 1TNUA 5LCWJ 3B7UX 2A5UA 1Z3XA 2ETCA 3ABLE 1OWNA 1HO8A 4G8LA 2R2LA 3QJZA 4YVOA 2P9KG 2J8SD 4F7AA 2RG8A 2JEKA 3UM0A 5G2NA 1H6PA 2QZAA 1MX6A 2Y3AA 4U63A 3BUAA 2KATA 2ZGDA 1PY1A 3I4GA 2BTDA 1DCEA 3Q5MA 1V55E 4JA7A 3CGHA 3CHPA 2HO1A 2P9NG 4JB8P 2IOLA 1N11A 3ML8A 3QB2A 2CFZA 4HI8A 1VDYA 3SBSA 3FH7A 3FWVA 1WM5A 5LX8A 4ILGA 4DJAA 1HG2A 1W3BA 3B13A 3TWVA 4JPSA 4RSYA 1S64A 4F6RD 3T5XA 4WWPA 3JXJA 4IYPA 2GROB 3PS6A 1N4SA 1MYOA 3NZSA 2LSUA 2AWIA 2EIKE 4KXKB 1WG0A 3IBEA 4EECA 3QOUA 3ML9A 3DXKG 5EKQD 3TXMA 1E7UA 4FJZA 3G2SA 3DXMG 3Q9UC 3WXXA 3QWWA 5HKPA 2EINE 4L2LA 3FUEA 3ZUVB 3P2BA 1WAO1 3CLJA 4BT8A 4Y6CA 4CT0A 5CHEE 4XIFA 2WQHA 2DVWA 3CVLA 3FU0A 3Q73A 3TWXA 4TUUA 3CHQA 2XRZA 3NOGD 4G26A 1OCOE 3Q7FA 5EIBE 3HXCA 4JHRA 4LEUA 3I5PA 3LXUX 4YDYA 4OVVA 3G2WA 2KZTA 3EHNA 1NZNA 1K1AA 3FUHA 4GTVA 1H6OA 2YHCA 3KAEA 5A23A 4ANXA 3S7DA 4KZCA 4N39A 2GRNB 3DBSA 4JL0A 4WNDA 3ZNGA 3IV0A 4ANWA 4UQYA 2Q7FA 4EPZA 4P29A 3QAQA 4TRQA 3MKRA 3UIPC 2WB2A 3AG2E 3ZVVA 3RRMB 3EIJA 3MKQB 5FWQA 3DSTA 2ZGGA 2KBXA 3APFA 2B6CA 1S0PA 2XHEA 5KCMA 3UMVA 2AJAA 4I9EA 2J07A 2WQ6A 3EIQC 4U8VD 2XGSA 3ZYKA 1OCRE 3HDXA 2VSYA 4A1GA 4J8EA 4MRUA 3DEOA 1WY6A 1O5MA 2WMOA 3JUIA 3C3QA 3CHMA 4I1AA 4URKA 3D9HA 2Y69E 4E85A 3FULA 4FA6A 3UQ3A 4C0MA 3PE4A 2WM9A 1SVXA 3ABKE 3CK7A 3PZ4A 5CECB 3PZ3A 1Z3YA 4ACLA 3LVRE 1TEZA 1NI1A 1JCSA 1TNZA 2QY7A 5T4YA 3ZN3A 3PVLA 5JJ6A 2I1JA 3PEVB 3EU9A 2XPZA 1NFIE 3UXGA 1QNFA 2H6HA 2X6FA 3T5VA 1D8EA 4ACKA 2FI7A 4DI3A 4KZ0A 4F1PA 3QK0A 1MX4A 2BKGA 1QQEA 2J08A 2XPIA 3ASOE 4JHKA 3UT4A 2XS1A 4GTRA 3RSEG 2JABA 3LJNA 3D9JA 1HXIA 1HF8A 3LY9A 3RU0A 3IKOB 3FH8A 1OXJA 5CBOA 5EYPF 4KMOA 4U96D 1BU9A 3QNKA 3PRZA 4ABNA 4Q96A 3LYAA 4J8SA 2I1KA 3SFXA 3BG0B 2OV8A 4GA2A 4GB9A 1H6KA 1KZPA 4ILHB 2CHXA 1JWGA 5AQBA 4R7LA 2GRLA 5FQ7A 1XNFA 3FDHA 3V2XA 1E8XA 3JUEA 5A6CA 3S7JA 3E33A 2EILE 1YYHA 5BW8C 3S2AA 4KT6B 1X5BA 1TNYA 2XZTG 3FUMA 3Q75A 2BEDA 4J8FA 4RQIA 1MHQA 1TJCA 4W9RA 2ZU6B 4AY5A 4BEPA 5D0OD 4HOUA 1E7VA 5KJKA 2DBAA 4N3CA 5FT9A 2PL2A 3DRAA 4KYOB 1ELWA 5C1DA 2P9SG 3AS8A 2QYJA 3APCA 3RRNB 4WWOA 2MRIA 4EZKA 1N52A 3IEGA 2FF4A 5KBAA 4EQFA 4J8DA 2V4LA 2IO2C 4DUIA 5JJTA 3EHMA 2ZISA 5J08A 4CZ2D 5BXOA 1EF1C 4XI9A 5B3SE 4Y6WA 1OCCE 3E4BA 5ANLA 5AYWD 4BFRA 4U8YD 3CQGB 3SGHA 2KXPC 4YDEA 3QC1A 4N3BA 3HXBA 2H6GA 2VSXE 4CDNA 4ZHBA 1RZ4A 1Y8MA 3L13A 3ESLA 2XPYA 4I1MA 2Y0BG 2F8YA 1YCSB 3I3NA 1OUVA 5J90A 3SF4A 2WPVA 3D3MA 3KEZA 3W9GA 4TV3A 2VJ8A 4CGVA 3TWUA 3PNLB 1DVPA 2PM7A 4G24A 1KZOA 2IU1A 3MEKA 3V2OA 1HS6A 4DK5A 3OXGA 5FQ4A 4BY6A 4UQXA 2AXUA 3E32A 2ZIRA 1O1TA 4V3IA 1TYQG 2LAIA 2VGYA 3ZU7B 4WUYA 3CHOA 4DLQA 1MJ0A 3CKCA 3SI5A 3Q49B 2GRQB 3NF1A 1HG5A 1OCZE 1HH8A 1RW2A 3L9TA 3MX3A 5ENSD 1MQSA 1QBQA 3Q9NC 3DPDA 5LP0A 3ASFA 1E8ZA 1TNBA 3UI2A 1KPSB 2IJGX 2A4ZA 3FHEA 5FIOA 5DIZA 5KNGA 2AXVA 3TWWA 2VQ2A 4HRNA 1QZ2A 1H0AA 3L16A 5FZQA 5AENA 3EHQA 4DLOA 4YDWA 2JLBA 3FUDA 3LPZA 3I4RB 3Q47B 3O48A 2VGXA 3TL5A 3Q4AB 2M63A 1H2VC 1KLXA 3AU5A 5EIDA 3IHVA 1UG3A 4CEMA 4NURA 5E76A 2X3MA 2FO7A 4JEHA 3HRAA 4K0RA 3T9KA 2C0LA 1IQUA 4DX1A 3VLDA 4BETA 3CVQA 2YINA 4HLEA 4PUCA 2XRYA 3TWRA 3G2VA 4GTMA 4GTOA 3JCKC 3MA5A 5FQ6A 4G8KA 4BX9A 4BESA 3ZFWA 1UOHA 5CRUA 2LXLA 4GYOA 1JCRA 3HXDA 2R5SA 1EYHA 3R7QA 3APDA 2IONA 3X2QE 5EX0A 3SNXA 3L6AA 2ONDA 2IOSA 3ONLA 5ENQD 4H7YA 3AAAC 2WXOA 5EX3A 3HVEB 3UT7A 3G2UA 4N5CA 4GA1A 3CEQA 5AIJA 3AJIA 2P9LG 3URZA 4ANVA 2OEVA 4L9PA 4GMLA 4BTAA 3EJNA
chains in the Genus database with same CATH topology
3DEPA 1YMPA 5JMND 4F1PA 2XEEA 4NIKA 4K5AB 3TWTA 2MYOA 1OY3D 1MX4A 1D9SA 2V5QC 4BERA 3TWVA 2DZOA 2BKGA 2RFMA 3J5QB 5AN8A 4ZFHA 4RLYA 1MX2A 1AWCB 3TWQA 1BI8B 4DX5D 4F6RD 5FINA 2FO1E 4UUCA 4J8YA 2XEHA 4K5CA 4Z68A 2F37A 1DC2A 3JXJA 3HRAA 2QYJA 3V31A 2NYJA 3T9KA 4OAVB 3ZU7B 5KBAA 1G3NB 3B95A 5JA4D 1MYOA 4A63B 4DX1A 2XENA 4DUIA 1WDYA 2JABA 2ZGGA 3LJNA 2KBXA 1A5EA 2DWZA 4BETA 1MJ0A 5BXUA 3W9FA 1K1BA 1WG0A 3IXEA 3V79K 1BD8A 3TWRA 1DCQA 4CYMD 2DZNA 3T8KA 4CZ2D 5BXOA 2V4HC 2BKKB 4BSZB 5CBOA 2AJAA 5EYPF 4OAUC 3C5RA 4GMRA 3KEAA 4U96D 1BU9A 4U8VD 2XZDG 4U8YD 5ENSD 2QC9A 3Q9NC 2KXPC 3Q9UC 5CEDB 3NOCD 5HKPA 2ETBA 4QQIA 5EILA 4DRXE 4LSZE 4G8KA 3DEOA 4J7WA 1IHBA 2Y1LE 3ZUVB 4BESA 1UOHA 3EHRA 2ETCA 3B7BA 4HRMB 1S70B 3UI2A 5AAOA 4G8LA 4GPMA 3J5PA 1QYMA 3V30A 4ZHBA 3ZKJA 5FIOA 4QFVA 1K3ZD 4ATZD 4HB5A 5KNGA 2J8SD 5ITZF 3TWWA 5AQBA 3D9HA 4O1PA 5KNHD 3UTMA 1BI7B 3TWSA 2DVWA 3JXIA 5CEAA 1MX6A 5AQ7A 2P2CP 4HRNA 3TWXA 3V2XA 3F6QA 4B93B 4O60A 5HS0A 1IKND 3NOGD 4C48B 2ZGDA 2Y0BG 3JUEA 4HLLA 5CERB 1SVXA 1YCSB 2F8YA 2L6BA 3EHQA 5KWDA 3NBNB 4O1OA 5EYLA 1OT8A 5HRYA 5AARA 5CECB 5EIBE 1YYHA 5EN5D 4LNUD 4YDWA 5ENQD 1BLXB 4HNAD 3W9GA 5ENPD 1AP7A 4YDYA 4JB8P 3AAAC 2XZTG 1N11A 5ENTD 2HE0A 4HQDA 2RFAA 4HI8A 2A5EA 4U95D 3TWUA 4DX6D 2VGEA 1K1AA 1SW6A 5D66A 2ETAA 4LG6A 5CBNA 3EU9A 4TUMA 2PNNA 4K5BA 4HRLA 1NFIE 3AJIA 5ENRD 3HG0D 3V2OA 3UXGA 4DX2A 4HBDA 3SO8A 5AQAA 4HI9A 5ENOD 1IXVA 5AQ9A 4BEPA 1TR4A 4N5QA 3ZNGA 4DX7D 1N0QA 2B0OE 1N0RA 2F8XK 5EIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEP A;  1YMP A;  5JMN D;  4F1P A;  2XEE A;  4NIK A;  4K5A B;  3TWT A;  2MYO A;  1OY3 D;  1MX4 A;  1D9S A;  2V5Q C;  4BER A;  3TWV A;  2DZO A;  2BKG A;  2RFM A;  3J5Q B;  5AN8 A;  4ZFH A;  4RLY A;  1MX2 A;  1AWC B;  3TWQ A;  1BI8 B;  4DX5 D;  4F6R D;  5FIN A;  2FO1 E;  4UUC A;  4J8Y A;  2XEH A;  4K5C A;  4Z68 A;  2F37 A;  1DC2 A;  3JXJ A;  3HRA A;  2QYJ A;  3V31 A;  2NYJ A;  3T9K A;  4OAV B;  3ZU7 B;  5KBA A;  1G3N B;  3B95 A;  5JA4 D;  1MYO A;  4A63 B;  4DX1 A;  2XEN A;  4DUI A;  1WDY A;  2JAB A;  2ZGG A;  3LJN A;  2KBX A;  1A5E A;  2DWZ A;  4BET A;  1MJ0 A;  5BXU A;  3W9F A;  1K1B A;  1WG0 A;  3IXE A;  3V79 K;  1BD8 A;  3TWR A;  1DCQ A;  4CYM D;  2DZN A;  3T8K A;  4CZ2 D;  5BXO A;  2V4H C;  2BKK B;  4BSZ B;  5CBO A;  2AJA A;  5EYP F;  4OAU C;  3C5R A;  4GMR A;  3KEA A;  4U96 D;  1BU9 A;  4U8V D;  2XZD G;  4U8Y D;  5ENS D;  2QC9 A;  3Q9N C;  2KXP C;  3Q9U C;  5CED B;  3NOC D;  5HKP A;  2ETB A;  4QQI A;  5EIL A;  4DRX E;  4LSZ E;  4G8K A;  3DEO A;  4J7W A;  1IHB A;  2Y1L E;  3ZUV B;  4BES A;  1UOH A;  3EHR A;  2ETC A;  3B7B A;  4HRM B;  1S70 B;  3UI2 A;  5AAO A;  4G8L A;  4GPM A;  3J5P A;  1QYM A;  3V30 A;  4ZHB A;  3ZKJ A;  5FIO A;  4QFV A;  1K3Z D;  4ATZ D;  4HB5 A;  5KNG A;  2J8S D;  5ITZ F;  3TWW A;  5AQB A;  3D9H A;  4O1P A;  5KNH D;  3UTM A;  1BI7 B;  3TWS A;  2DVW A;  3JXI A;  5CEA A;  1MX6 A;  5AQ7 A;  2P2C P;  4HRN A;  3TWX A;  3V2X A;  3F6Q A;  4B93 B;  4O60 A;  5HS0 A;  1IKN D;  3NOG D;  4C48 B;  2ZGD A;  2Y0B G;  3JUE A;  4HLL A;  5CER B;  1SVX A;  1YCS B;  2F8Y A;  2L6B A;  3EHQ A;  5KWD A;  3NBN B;  4O1O A;  5EYL A;  1OT8 A;  5HRY A;  5AAR A;  5CEC B;  5EIB E;  1YYH A;  5EN5 D;  4LNU D;  4YDW A;  5ENQ D;  1BLX B;  4HNA D;  3W9G A;  5ENP D;  1AP7 A;  4YDY A;  4JB8 P;  3AAA C;  2XZT G;  1N11 A;  5ENT D;  2HE0 A;  4HQD A;  2RFA A;  4HI8 A;  2A5E A;  4U95 D;  3TWU A;  4DX6 D;  2VGE A;  1K1A A;  1SW6 A;  5D66 A;  2ETA A;  4LG6 A;  5CBN A;  3EU9 A;  4TUM A;  2PNN A;  4K5B A;  4HRL A;  1NFI E;  3AJI A;  5ENR D;  3HG0 D;  3V2O A;  3UXG A;  4DX2 A;  4HBD A;  3SO8 A;  5AQA A;  4HI9 A;  5ENO D;  1IXV A;  5AQ9 A;  4BEP A;  1TR4 A;  4N5Q A;  3ZNG A;  4DX7 D;  1N0Q A;  2B0O E;  1N0R A;  2F8X K;  5EID A; 
#chains in the Genus database with same CATH topology
 1TN8 A;  2J9Q A;  3Q15 A;  3SFY A;  2RFM A;  4DX5 D;  2IFU A;  4I6G A;  3FP3 A;  2VYI A;  4A3V A;  3L08 A;  4G1T A;  3E37 A;  3B7S A;  2C0M A;  4JC8 A;  1O1S A;  1UN8 A;  2PQN A;  4JVS A;  3BG1 B;  3AG1 E;  2QC9 A;  2ETB A;  1IHB A;  1KT1 A;  4B8C B;  3EHR A;  4ILI A;  4HRM B;  1H2T C;  2NC9 A;  2NSZ A;  2R17 C;  1L5J A;  5JHB A;  2OCC E;  4U07 A;  3D9K A;  3LKU A;  3LVQ E;  4U7E B;  3ISM C;  2GRR B;  4L7T A;  3TG5 A;  4CDM A;  2QYU A;  3Q79 A;  4I9C A;  3ZRH A;  3GZ2 A;  1U2V G;  4PS7 A;  4L2Y A;  3TGO A;  4I2W A;  2GW1 A;  2PQR A;  4HOQ A;  3DSS A;  5D66 A;  2XCC A;  5ENR D;  5G04 J;  3KSQ A;  4BSX A;  4N2S A;  2F8X K;  4I1O B;  4NIK A;  4K5A B;  3FUF A;  4TXR A;  3TWT A;  1OY3 D;  5KJL A;  3DWL G;  4EBA G;  4LRZ A;  5FIN A;  3ABM E;  3V31 A;  3RIB A;  2AXZ A;  2DYR E;  3ZPJ A;  2J09 A;  3HHM A;  3ASH A;  4F1S A;  3PDN A;  4FHK A;  3MJW A;  3DSU A;  3LY8 A;  2BKK B;  4BSZ B;  3LDZ A;  4CRW A;  1ELK A;  4ATG A;  5JJ7 A;  5LCW C;  3K9I A;  3ZHE B;  1N4R A;  4FU3 A;  4XKB A;  4TXQ A;  1S70 B;  4I6E A;  4LCT A;  4FLH A;  1Z6T A;  3UKR G;  2H6F A;  2CHZ A;  3BEE A;  5KJN A;  3CK9 A;  4U8H A;  4GZD A;  5AJD A;  2L0I A;  1JUQ A;  4HXI A;  3P1U A;  2P2C P;  4GAA A;  3FUJ A;  3TG4 A;  4XI0 A;  4C48 B;  3OXL A;  5ANR A;  2RD0 A;  5KWD A;  1E8Y A;  3QKY A;  4NAC A;  1V54 E;  3FY4 A;  3TJP A;  4JW1 A;  4HQD A;  2RFA A;  3FTV A;  2IY0 C;  4LG6 A;  1E96 B;  2OEW A;  3DPY A;  2NXP A;  3ZGQ A;  3FFL A;  1NL4 A;  1IXV A;  2DCP A;  1X81 A;  4HOT A;  1OWO A;  3LEW A;  4GTS A;  4TXP A;  2J4D A;  3R9A B;  4Q69 A;  2J49 A;  3GYZ A;  4C0E A;  3TWQ A;  4L1B A;  4LNB A;  1JPL A;  2XS8 A;  4K5C A;  5BT1 A;  2FUL A;  3CVY A;  5JA4 D;  3TXN A;  2AW6 A;  2E0I A;  1EDU A;  2IF4 A;  1OWL A;  4HFG A;  3LS8 A;  3ONK A;  3LJ3 A;  4I43 A;  3LCA A;  3NQP A;  3JQ0 A;  4WWN A;  3ESK A;  2WXK A;  3FTY A;  2HYZ A;  2KZT B;  4XZ4 A;  2KM4 A;  4LSZ E;  1YA0 A;  2WXP A;  2VGX B;  4ME2 A;  4UWL A;  3FU5 A;  4GYY A;  2ILR A;  4WNG A;  4UWF A;  4GCO A;  1UN9 A;  4G11 A;  3C3R A;  3PZ1 A;  3GZ1 A;  3ZHE A;  4O1P A;  4UI9 K;  3CK8 A;  5IY5 E;  1LD7 A;  1N54 A;  2C2L A;  4FJY A;  4H7X A;  4AXH A;  1JWF A;  4B93 B;  4E6H A;  1E90 A;  4LUN U;  3D9N A;  4OYS A;  4AOF A;  3U64 A;  3ASD A;  2P9I G;  4HNA D;  4YDO A;  3RJV A;  5HI7 A;  1N4P A;  3ZXS A;  2WQ7 A;  4HOS A;  4GZ6 A;  1HZ4 A;  2ETA A;  3PE3 A;  5FTP A;  3FEY A;  1O1R A;  4HRL A;  3G2T A;  2IEJ A;  4DX2 A;  1ZB1 A;  3MV3 B;  4HBD A;  1GW6 A;  3KS2 A;  5AQ9 A;  2E2E A;  4WNF A;  3ZKJ A;  2MYO A;  3EUV A;  4FUL A;  1MZC A;  4ZFH A;  1AWC B;  3CIA A;  2LNI A;  4MKT A;  1N95 A;  1TNO A;  4AP2 A;  5BUZ A;  4A63 B;  1WDY A;  2AVP A;  4AJW A;  3CR3 A;  4HOR A;  3Q78 A;  5H7P A;  3SY2 A;  1XGW A;  3C5R A;  1U3D A;  3C72 A;  3ASN E;  3FH5 A;  1HU3 A;  3OAW A;  2V5F A;  3FTX A;  4GMJ A;  5ENN A;  2LAH A;  3HXE A;  3ULY A;  2WMN A;  2XGO A;  4ANU A;  3FU3 A;  5AAO A;  4GPM A;  3PUJ A;  1QYM A;  2XQ0 A;  4KBQ A;  3HXF A;  3JQ1 A;  4GCN A;  1SA5 A;  3FEX A;  5FQ8 A;  5ITZ F;  3ZYL A;  3UTM A;  5EDS A;  3JXI A;  5CEA A;  4RG6 A;  1SZ9 A;  3AS5 A;  3UKU G;  4UQZ A;  1Y6I A;  2Y4T A;  5AJL A;  1UJK A;  3L17 A;  3IHY A;  3MGB A;  3NB2 A;  2PZI A;  4DX6 D;  4WAF A;  5CBN A;  1HFA A;  3FTW A;  1HX8 A;  3EU5 A;  5BV1 A;  3DEP A;  4JD2 G;  1OWP A;  3MZL B;  3BQO A;  4BX8 A;  1SZA A;  4JXT A;  1DC2 A;  4F53 A;  2R05 A;  3AU4 A;  4MS6 A;  3DSX A;  4IUL A;  4XKC A;  1N4Q A;  3CSF A;  4CCA A;  3VTY A;  4AV7 A;  5LFA A;  1S63 A;  3S7F A;  3AG3 E;  1D8D A;  2VTB B;  2EQX A;  4XEI G;  3S7B A;  3MV2 B;  4KVO A;  4YND A;  4BWR A;  4HVB A;  2DYS E;  4M7C A;  3SBT B;  3E34 A;  3QAR A;  2L6J A;  2F0Y A;  4DRX E;  2OVB A;  1LF8 A;  3C3O A;  3QDN A;  3CVW A;  2KCV A;  4QFV A;  2GGF A;  1K3Z D;  4ATZ D;  2QFC A;  1SQM A;  3L22 A;  2LO6 A;  2OOE A;  5CER B;  4O1O A;  3LY7 A;  5AAR A;  4A1S A;  1BLX B;  2WXM A;  3QWP A;  1AP7 A;  3ULE G;  4X8Q A;  4FLB A;  3ULQ A;  2PNN A;  3NAW A;  3ZXP A;  5G05 J;  3SO8 A;  2R03 A;  4HI9 A;  4A3T A;  3SFZ A;  5KJM A;  1TR4 A;  4DX7 D;  4MBG A;  4WNE A;  4JA9 A;  4RG9 A;  2I6H A;  1DNP A;  1D9S A;  4BER A;  3L54 A;  3DSW A;  5C2Y A;  2EIM E;  2R02 A;  3ENE A;  2YQ8 A;  4RLY A;  4BT9 A;  1TJF A;  2DIW A;  4G2V A;  4UUC A;  4UWK A;  3R9M A;  2MOW A;  2NYJ A;  4FAD A;  3CST A;  3GZS A;  3O4Z A;  3AG4 E;  4GPK A;  4C9B B;  2WXJ A;  3E30 A;  2OVF A;  3V79 K;  1DCQ A;  4GTP A;  3PUK A;  5G04 C;  3OXF A;  1SA4 A;  4JZY A;  5FZS A;  2BF0 X;  4UI9 C;  2XZD G;  2X6J A;  2CFU A;  3D9M A;  3VLE A;  5ARG A;  4J7W A;  2Y1L E;  3FUI A;  4UI9 J;  5FJY A;  3HIZ A;  4NQ0 A;  2PM6 A;  3J5P A;  4IRU A;  4FHJ A;  3U4T A;  4DI4 A;  4PS8 A;  3TWS A;  3ZIM A;  3CVU A;  2X6I A;  2CG2 A;  3CKB A;  3KSL A;  3UM2 A;  4N2Q A;  3CQC B;  4BTB A;  2IQC A;  2UY1 A;  1FVF A;  2KCL A;  3D9P A;  4AM9 A;  4B0Z A;  4EBA A;  1N9A A;  5G05 C;  2XCB A;  4N5Q A;  1NA3 A;  2HM8 A;  1N0R A;  3U9W A;  1TN6 A;  5A7D B;  1FT1 A;  1FPP A;  2DZO A;  4GZ5 A;  2RKK A;  2XGM A;  2VSN A;  3RKV A;  2WXN A;  3CVX A;  3HVE A;  4OAV B;  5CRV A;  3HYM B;  5D0Q D;  4U04 A;  4UWH A;  3MKQ A;  1A5E A;  2XEV A;  4GYW A;  4FP7 A;  3W9F A;  4JHJ A;  2DZN A;  3FTU A;  2HR2 A;  4OAU C;  2WVI A;  2X6K A;  1IHG A;  3UM3 A;  3SD5 A;  1IYG A;  3NOC D;  5EIL A;  2CG3 A;  2GRM A;  3EDT B;  4RVB A;  4NRH B;  5G55 A;  3FTZ A;  4XX5 A;  3DSV A;  3Q7A A;  2VSO E;  1KT0 A;  4J0U A;  3V30 A;  1EPU A;  3L82 A;  3PZD A;  3CHR A;  1OWM A;  4J6I A;  1K8K G;  3R7R A;  4AVX A;  3FUK A;  5JHA A;  4LER A;  1FVH A;  5CMY A;  5BV0 A;  4CGW A;  2J4B A;  1IKN D;  2WXQ A;  2R59 A;  3SZ7 A;  2L6B A;  3ZW3 A;  1INZ A;  1OT8 A;  2BUG A;  1E8W A;  4F3V A;  2HE0 A;  4GTT A;  1SW6 A;  5ARF A;  4K5B A;  1TN7 A;  5AQA A;  1PAQ A;  2UY1 B;  3VLF A;  2MHK A;  5ENO D;  2Y4U A;  1HE8 A;  3ASG A;  3SHF A;  1YMP A;  4MLP A;  2YHE A;  3CVN A;  3J5Q B;  1ZU2 A;  4U0U A;  1MX2 A;  4GU5 A;  3RK6 A;  3RAU A;  4G25 A;  4YVQ C;  3B95 A;  1PC2 A;  2P9P G;  2XEN A;  4JEU A;  5BXU A;  1H2U A;  3CV0 A;  5T8I A;  3D9I A;  4GA0 A;  4UWG A;  3T8K A;  1Z5S C;  3UPV A;  4GZC A;  3QWV A;  4PH4 B;  4GTQ A;  3RO3 A;  5CED B;  3AS4 A;  4QQI A;  2H6I A;  4U0S A;  3U3W A;  2WXG A;  4I17 A;  4APF A;  2I9C A;  1FT2 A;  3B7R L;  3JYS A;  2LSV A;  1B89 A;  4U0Z A;  3CVP A;  3FTS A;  4Q94 A;  4I2Z A;  5KNH D;  5FZR A;  3SQV A;  5AQ7 A;  4APO A;  3F6Q A;  4O60 A;  2YNQ A;  3PH0 C;  3OTN A;  4M3O A;  2X38 A;  1N94 A;  1JCQ A;  2L0T B;  4AEZ C;  2LUH A;  1ELR A;  1A17 A;  2L9B A;  1P5Q A;  1FCH A;  3FUN A;  4IN3 B;  2I2O A;  4TUM A;  3PNT B;  3HG0 D;  2V8S E;  4LNG A;  1BPO A;  4B89 A;  4D10 C;  2KC7 A;  2B0O E;  3NZU A;  4AY6 A;  3CVV A;  4OVU A;  1UJJ A;  4KVM A;  5AN8 A;  3UIO C;  1BI8 B;  4J8Y A;  5HQ8 A;  4Z68 A;  2F37 A;  1UW4 B;  2WXI A;  3D9O A;  1G3N B;  2V0P A;  2LXM A;  2DWZ A;  5T3R A;  5CMW A;  1K1B A;  3PRE A;  2WXH A;  3IXE A;  1BD8 A;  4CYM D;  4PS3 A;  5CCM A;  3MYV A;  4HS2 A;  1NP7 A;  4O6F A;  4GMR A;  3KEA A;  1LD8 A;  3WG7 E;  3MCX A;  2EIJ E;  4I6J A;  5M72 A;  5E75 A;  3B7B A;  2VTB A;  1H19 A;  3ZYM A;  2WXF A;  2IO3 C;  3N71 A;  4HB5 A;  3UUX A;  1IQR A;  1ZBP A;  2FEZ A;  5DBK A;  1BI7 B;  4AIF A;  4EHM A;  2KCK A;  2WXR A;  4EZL A;  3ZEF A;  4FC8 A;  5HS0 A;  3C98 A;  1LTX A;  4HLL A;  3RO2 A;  3NBN B;  4GZ3 A;  3B7T A;  5B1A E;  5EYL A;  5HRY A;  3PEU B;  5EN5 D;  2CHW A;  3PZ2 A;  4LNU D;  3T8M A;  4B8A A;  2P58 C;  5ENP D;  3FU6 A;  5ENT D;  2A5E A;  3ZYQ A;  4U95 D;  2VGE A;  2FBN A;  5BPP A;  3VTX A;  4B94 A;  5D2M C;  3D9L A;  3TAX A;  3GW4 A;  4L23 A;  2UWJ G;  3BU8 A;  1N0Q A;  3UM1 A;  5JMN D;  4G23 A;  2XEE A;  4DPR A;  3UT8 A;  1U3C A;  2V5Q C;  4PDX A;  5B1B E;  2FO1 E;  2XEH A;  5LOZ A;  2GRP B;  5BNW A;  2P9U G;  3UX4 A;  2X6H A;  3U66 A;  2ZXW E;  3RRU A;  4EZJ A;  1Q2Z A;  4CT4 A;  2WXL A;  2V4H C;  3UIN C;  4CDR A;  5CCL A;  4N3A A;  4XE0 A;  1NA0 A;  4K03 A;  3KD7 A;  3CHS A;  4A55 A;  1TNU A;  5LCW J;  3B7U X;  2A5U A;  1Z3X A;  2ETC A;  3ABL E;  1OWN A;  1HO8 A;  4G8L A;  2R2L A;  3QJZ A;  4YVO A;  2P9K G;  2J8S D;  4F7A A;  2RG8 A;  2JEK A;  3UM0 A;  5G2N A;  1H6P A;  2QZA A;  1MX6 A;  2Y3A A;  4U63 A;  3BUA A;  2KAT A;  2ZGD A;  1PY1 A;  3I4G A;  2BTD A;  1DCE A;  3Q5M A;  1V55 E;  4JA7 A;  3CGH A;  3CHP A;  2HO1 A;  2P9N G;  4JB8 P;  2IOL A;  1N11 A;  3ML8 A;  3QB2 A;  2CFZ A;  4HI8 A;  1VDY A;  3SBS A;  3FH7 A;  3FWV A;  1WM5 A;  5LX8 A;  4ILG A;  4DJA A;  1HG2 A;  1W3B A;  3B13 A;  3TWV A;  4JPS A;  4RSY A;  1S64 A;  4F6R D;  3T5X A;  4WWP A;  3JXJ A;  4IYP A;  2GRO B;  3PS6 A;  1N4S A;  1MYO A;  3NZS A;  2LSU A;  2AWI A;  2EIK E;  4KXK B;  1WG0 A;  3IBE A;  4EEC A;  3QOU A;  3ML9 A;  3DXK G;  5EKQ D;  3TXM A;  1E7U A;  4FJZ A;  3G2S A;  3DXM G;  3Q9U C;  3WXX A;  3QWW A;  5HKP A;  2EIN E;  4L2L A;  3FUE A;  3ZUV B;  3P2B A;  1WAO 1;  3CLJ A;  4BT8 A;  4Y6C A;  4CT0 A;  5CHE E;  4XIF A;  2WQH A;  2DVW A;  3CVL A;  3FU0 A;  3Q73 A;  3TWX A;  4TUU A;  3CHQ A;  2XRZ A;  3NOG D;  4G26 A;  1OCO E;  3Q7F A;  5EIB E;  3HXC A;  4JHR A;  4LEU A;  3I5P A;  3LXU X;  4YDY A;  4OVV A;  3G2W A;  2KZT A;  3EHN A;  1NZN A;  1K1A A;  3FUH A;  4GTV A;  1H6O A;  2YHC A;  3KAE A;  5A23 A;  4ANX A;  3S7D A;  4KZC A;  4N39 A;  2GRN B;  3DBS A;  4JL0 A;  4WND A;  3ZNG A;  3IV0 A;  4ANW A;  4UQY A;  2Q7F A;  4EPZ A;  4P29 A;  3QAQ A;  4TRQ A;  3MKR A;  3UIP C;  2WB2 A;  3AG2 E;  3ZVV A;  3RRM B;  3EIJ A;  3MKQ B;  5FWQ A;  3DST A;  2ZGG A;  2KBX A;  3APF A;  2B6C A;  1S0P A;  2XHE A;  5KCM A;  3UMV A;  2AJA A;  4I9E A;  2J07 A;  2WQ6 A;  3EIQ C;  4U8V D;  2XGS A;  3ZYK A;  1OCR E;  3HDX A;  2VSY A;  4A1G A;  4J8E A;  4MRU A;  3DEO A;  1WY6 A;  1O5M A;  2WMO A;  3JUI A;  3C3Q A;  3CHM A;  4I1A A;  4URK A;  3D9H A;  2Y69 E;  4E85 A;  3FUL A;  4FA6 A;  3UQ3 A;  4C0M A;  3PE4 A;  2WM9 A;  1SVX A;  3ABK E;  3CK7 A;  3PZ4 A;  5CEC B;  3PZ3 A;  1Z3Y A;  4ACL A;  3LVR E;  1TEZ A;  1NI1 A;  1JCS A;  1TNZ A;  2QY7 A;  5T4Y A;  3ZN3 A;  3PVL A;  5JJ6 A;  2I1J A;  3PEV B;  3EU9 A;  2XPZ A;  1NFI E;  3UXG A;  1QNF A;  2H6H A;  2X6F A;  3T5V A;  1D8E A;  4ACK A;  2FI7 A;  4DI3 A;  4KZ0 A;  4F1P A;  3QK0 A;  1MX4 A;  2BKG A;  1QQE A;  2J08 A;  2XPI A;  3ASO E;  4JHK A;  3UT4 A;  2XS1 A;  4GTR A;  3RSE G;  2JAB A;  3LJN A;  3D9J A;  1HXI A;  1HF8 A;  3LY9 A;  3RU0 A;  3IKO B;  3FH8 A;  1OXJ A;  5CBO A;  5EYP F;  4KMO A;  4U96 D;  1BU9 A;  3QNK A;  3PRZ A;  4ABN A;  4Q96 A;  3LYA A;  4J8S A;  2I1K A;  3SFX A;  3BG0 B;  2OV8 A;  4GA2 A;  4GB9 A;  1H6K A;  1KZP A;  4ILH B;  2CHX A;  1JWG A;  5AQB A;  4R7L A;  2GRL A;  5FQ7 A;  1XNF A;  3FDH A;  3V2X A;  1E8X A;  3JUE A;  5A6C A;  3S7J A;  3E33 A;  2EIL E;  1YYH A;  5BW8 C;  3S2A A;  4KT6 B;  1X5B A;  1TNY A;  2XZT G;  3FUM A;  3Q75 A;  2BED A;  4J8F A;  4RQI A;  1MHQ A;  1TJC A;  4W9R A;  2ZU6 B;  4AY5 A;  4BEP A;  5D0O D;  4HOU A;  1E7V A;  5KJK A;  2DBA A;  4N3C A;  5FT9 A;  2PL2 A;  3DRA A;  4KYO B;  1ELW A;  5C1D A;  2P9S G;  3AS8 A;  2QYJ A;  3APC A;  3RRN B;  4WWO A;  2MRI A;  4EZK A;  1N52 A;  3IEG A;  2FF4 A;  5KBA A;  4EQF A;  4J8D A;  2V4L A;  2IO2 C;  4DUI A;  5JJT A;  3EHM A;  2ZIS A;  5J08 A;  4CZ2 D;  5BXO A;  1EF1 C;  4XI9 A;  5B3S E;  4Y6W A;  1OCC E;  3E4B A;  5ANL A;  5AYW D;  4BFR A;  4U8Y D;  3CQG B;  3SGH A;  2KXP C;  4YDE A;  3QC1 A;  4N3B A;  3HXB A;  2H6G A;  2VSX E;  4CDN A;  4ZHB A;  1RZ4 A;  1Y8M A;  3L13 A;  3ESL A;  2XPY A;  4I1M A;  2Y0B G;  2F8Y A;  1YCS B;  3I3N A;  1OUV A;  5J90 A;  3SF4 A;  2WPV A;  3D3M A;  3KEZ A;  3W9G A;  4TV3 A;  2VJ8 A;  4CGV A;  3TWU A;  3PNL B;  1DVP A;  2PM7 A;  4G24 A;  1KZO A;  2IU1 A;  3MEK A;  3V2O A;  1HS6 A;  4DK5 A;  3OXG A;  5FQ4 A;  4BY6 A;  4UQX A;  2AXU A;  3E32 A;  2ZIR A;  1O1T A;  4V3I A;  1TYQ G;  2LAI A;  2VGY A;  3ZU7 B;  4WUY A;  3CHO A;  4DLQ A;  1MJ0 A;  3CKC A;  3SI5 A;  3Q49 B;  2GRQ B;  3NF1 A;  1HG5 A;  1OCZ E;  1HH8 A;  1RW2 A;  3L9T A;  3MX3 A;  5ENS D;  1MQS A;  1QBQ A;  3Q9N C;  3DPD A;  5LP0 A;  3ASF A;  1E8Z A;  1TNB A;  3UI2 A;  1KPS B;  2IJG X;  2A4Z A;  3FHE A;  5FIO A;  5DIZ A;  5KNG A;  2AXV A;  3TWW A;  2VQ2 A;  4HRN A;  1QZ2 A;  1H0A A;  3L16 A;  5FZQ A;  5AEN A;  3EHQ A;  4DLO A;  4YDW A;  2JLB A;  3FUD A;  3LPZ A;  3I4R B;  3Q47 B;  3O48 A;  2VGX A;  3TL5 A;  3Q4A B;  2M63 A;  1H2V C;  1KLX A;  3AU5 A;  5EID A;  3IHV A;  1UG3 A;  4CEM A;  4NUR A;  5E76 A;  2X3M A;  2FO7 A;  4JEH A;  3HRA A;  4K0R A;  3T9K A;  2C0L A;  1IQU A;  4DX1 A;  3VLD A;  4BET A;  3CVQ A;  2YIN A;  4HLE A;  4PUC A;  2XRY A;  3TWR A;  3G2V A;  4GTM A;  4GTO A;  3JCK C;  3MA5 A;  5FQ6 A;  4G8K A;  4BX9 A;  4BES A;  3ZFW A;  1UOH A;  5CRU A;  2LXL A;  4GYO A;  1JCR A;  3HXD A;  2R5S A;  1EYH A;  3R7Q A;  3APD A;  2ION A;  3X2Q E;  5EX0 A;  3SNX A;  3L6A A;  2OND A;  2IOS A;  3ONL A;  5ENQ D;  4H7Y A;  3AAA C;  2WXO A;  5EX3 A;  3HVE B;  3UT7 A;  3G2U A;  4N5C A;  4GA1 A;  3CEQ A;  5AIJ A;  3AJI A;  2P9L G;  3URZ A;  4ANV A;  2OEV A;  4L9P A;  4GML A;  4BTA A;  3EJN A; 
#chains in the Genus database with same CATH homology
 3DEP A;  1YMP A;  5JMN D;  4F1P A;  2XEE A;  4NIK A;  4K5A B;  3TWT A;  2MYO A;  1OY3 D;  1MX4 A;  1D9S A;  2V5Q C;  4BER A;  3TWV A;  2DZO A;  2BKG A;  2RFM A;  3J5Q B;  5AN8 A;  4ZFH A;  4RLY A;  1MX2 A;  1AWC B;  3TWQ A;  1BI8 B;  4DX5 D;  4F6R D;  5FIN A;  2FO1 E;  4UUC A;  4J8Y A;  2XEH A;  4K5C A;  4Z68 A;  2F37 A;  1DC2 A;  3JXJ A;  3HRA A;  2QYJ A;  3V31 A;  2NYJ A;  3T9K A;  4OAV B;  3ZU7 B;  5KBA A;  1G3N B;  3B95 A;  5JA4 D;  1MYO A;  4A63 B;  4DX1 A;  2XEN A;  4DUI A;  1WDY A;  2JAB A;  2ZGG A;  3LJN A;  2KBX A;  1A5E A;  2DWZ A;  4BET A;  1MJ0 A;  5BXU A;  3W9F A;  1K1B A;  1WG0 A;  3IXE A;  3V79 K;  1BD8 A;  3TWR A;  1DCQ A;  4CYM D;  2DZN A;  3T8K A;  4CZ2 D;  5BXO A;  2V4H C;  2BKK B;  4BSZ B;  5CBO A;  2AJA A;  5EYP F;  4OAU C;  3C5R A;  4GMR A;  3KEA A;  4U96 D;  1BU9 A;  4U8V D;  2XZD G;  4U8Y D;  5ENS D;  2QC9 A;  3Q9N C;  2KXP C;  3Q9U C;  5CED B;  3NOC D;  5HKP A;  2ETB A;  4QQI A;  5EIL A;  4DRX E;  4LSZ E;  4G8K A;  3DEO A;  4J7W A;  1IHB A;  2Y1L E;  3ZUV B;  4BES A;  1UOH A;  3EHR A;  2ETC A;  3B7B A;  4HRM B;  1S70 B;  3UI2 A;  5AAO A;  4G8L A;  4GPM A;  3J5P A;  1QYM A;  3V30 A;  4ZHB A;  3ZKJ A;  5FIO A;  4QFV A;  1K3Z D;  4ATZ D;  4HB5 A;  5KNG A;  2J8S D;  5ITZ F;  3TWW A;  5AQB A;  3D9H A;  4O1P A;  5KNH D;  3UTM A;  1BI7 B;  3TWS A;  2DVW A;  3JXI A;  5CEA A;  1MX6 A;  5AQ7 A;  2P2C P;  4HRN A;  3TWX A;  3V2X A;  3F6Q A;  4B93 B;  4O60 A;  5HS0 A;  1IKN D;  3NOG D;  4C48 B;  2ZGD A;  2Y0B G;  3JUE A;  4HLL A;  5CER B;  1SVX A;  1YCS B;  2F8Y A;  2L6B A;  3EHQ A;  5KWD A;  3NBN B;  4O1O A;  5EYL A;  1OT8 A;  5HRY A;  5AAR A;  5CEC B;  5EIB E;  1YYH A;  5EN5 D;  4LNU D;  4YDW A;  5ENQ D;  1BLX B;  4HNA D;  3W9G A;  5ENP D;  1AP7 A;  4YDY A;  4JB8 P;  3AAA C;  2XZT G;  1N11 A;  5ENT D;  2HE0 A;  4HQD A;  2RFA A;  4HI8 A;  2A5E A;  4U95 D;  3TWU A;  4DX6 D;  2VGE A;  1K1A A;  1SW6 A;  5D66 A;  2ETA A;  4LG6 A;  5CBN A;  3EU9 A;  4TUM A;  2PNN A;  4K5B A;  4HRL A;  1NFI E;  3AJI A;  5ENR D;  3HG0 D;  3V2O A;  3UXG A;  4DX2 A;  4HBD A;  3SO8 A;  5AQA A;  4HI9 A;  5ENO D;  1IXV A;  5AQ9 A;  4BEP A;  1TR4 A;  4N5Q A;  3ZNG A;  4DX7 D;  1N0Q A;  2B0O E;  1N0R A;  2F8X K;  5EID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...