5CHEE

Crystal structure of arabidopsis glutamyl-trna reductase in complex with its regulatory proteins
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
119
structure length
119
Chain Sequence
EPKKQELISKLKTGKTFLRNQEPEKAYTEFKIALELAQSLKDPTEEKKAARGLGASLQRQGKYREAIQYHSMVLAISKRESEDSGITEAYGAIADCYTELGDLEKAGKFYDTYIARLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamyl-tRNA reductase 1, chloroplastic
publication title The Arabidopsis glutamyl-tRNA reductase (GluTR) forms a ternary complex with FLU and GluTR-binding protein
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 47
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5cheE00
4N2SA 1W3BA 4GYYA 3PE3A 4KBQA 4F3VA 4J8DA 3AS5A 3LPZA 3CK9A 4BT9A 4WUYA 5KJMA 3RU0A 5EX3A 5A7DB 1WAO1 5G05C 3MA5A 3ESKA 2KC7A 4GZ5A 3RKVA 4J0UA 2MHKA 4BTBA 4I9CA 3LKUA 4B94A 4EQFA 1IHGA 2XCCA 3TGOA 5JJTA 2XGOA 3CK7A 3MV3B 4KYOB 5HI7A 2YQ8A 4I9EA 5C1DA 3Q15A 3QWPA 1HZ4A 4UQXA 2UY1B 4N3CA 5DIZA 3JYSA 2VGXA 2PL2A 4Y6CA 3CEQA 4I1AA 5FTPA 4HOUA 2WQHA 4GZ3A 2XGSA 2DBAA 3AS4A 2HYZA 3BEEA 4JA9A 3ZN3A 2KCLA 5ARGA 4W9RA 3Q5MA 3HYMB 2V5FA 3R9AB 3U4TA 3ZGQA 3OXFA 3MEKA 5FT9A 3SF4A 3E4BA 5ARFA 1ELWA 4U0ZA 3S7JA 2R5SA 5CHEE 3ASFA 4NQ0A 3FFLA 3FWVA 3ZFWA 1P5QA 1Y8MA 2C0MA 5G04C 4GA1A 2PQRA 4GPKA 1NZNA 2IFUA 4UQZA 4AIFA 3LCAA 2I6HA 4I2ZA 4WNGA 5JJ6A 1FCHA 3KAEA 3ZHEB 2L6JA 4N3AA 1HXIA 4CGVA 4AY6A 2YHCA 4ABNA 3KD7A 4Y6WA 3S7FA 4BWRA 3PE4A 1TJCA 4XI9A 2Q7FA 5D0QD 4GZ6A 5CCLA 4H7YA 4G24A 4LEUA 5LCWJ 4G26A 2LNIA 1NA0A 2C0LA 4WNFA 5EKQD 4UI9J 2XEVA 3OXGA 5KJKA 2Y4TA 1ELRA 2VQ2A 4G25A 1HH8A 3CVPA 3UQ3A 4UQYA 3GZ2A 4J8EA 4GYOA 3AS8A 1IYGA 3ASDA 3QWVA 3VTYA 1QZ2A 3U3WA 5G05J 5BW8C 2XGMA 3N71A 3CK8A 2LSVA 3K9IA 3QKYA 1E96B 2VSYA 5KJLA 4CGWA 2VYIA 4XIFA 2VGXB 4JL0A 3FP3A 2GW1A 3GW4A 5BT1A 5FZRA 4WNEA 5KJNA 4U0UA 3LY8A 2WPVA 4N39A 4RG6A 4G23A 3ASHA 4KXKB 3O48A 2J9QA 5JJ7A 4GYWA 5CCMA 4BT8A 3CVLA 3MV2B 2VSNA 4I17A 4G2VA 2FO7A 1B89A 3NF1A 5BNWA 4YNDA 3CVQA 3GYZA 4RG9A 3TAXA 3UPVA 2QFCA 4XI0A 4HOTA 4N2QA 4IN3B 2IF4A 3ULQA 4HOSA 4BTAA 2LSUA 4G1TA 1XNFA 2P58C 5FZQA 2FI7A 4U07A 3CKCA 4YVOA 3Q47B 2XPIA 3CKBA 3RO2A 1ZBPA 3CV0A 1PC2A 3TG4A 2JLBA 2NC9A 1KT0A 3SZ7A 2PQNA 2UY1A 4JHRA 2KCVA 3LY7A 2FF4A 2VGYA 3EDTB 3RIBA 2KCKA 2C2LA 1QQEA 2ONDA 5DBKA 4CDRA 3KS2A 4HORA 3IEGA 1YA0A 5EX0A 3ZPJA 3OXLA 4AM9A 2AVPA 5G04J 4ME2A 2HR2A 4UI9K 3QWWA 3VTXA 3MKRA 1OUVA 3RO3A 4WNDA 2OOEA 4GCNA 1A17A 4U0SA 5M72A 1ZU2A 1WM5A 5D0OD 2FBNA 2PZIA 3GZ1A 5FJYA 4NRHB 3S7BA 3Q49B 3TG5A 3RJVA 4HOQA 4J8FA 2HO1A 4I2WA 2KATA 3UUXA 4N5CA 4GA2A 2BUGA 3Q4AB 4GA0A 2Y4UA 4YVQC 3QOUA 4N3BA 5AYWD 2E2EA 3URZA 4APOA 3WXXA 3LYAA 3CVNA 4JA7A 4H7XA 4GCOA 4U04A 5HQ8A 5LCWC 1KLXA 4O6FA 2XCBA 1NA3A 3PDNA 5FZSA 2FEZA 3ZHEA 2UWJG 4UI9C 3ASGA 4AY5A 3LY9A 3QDNA 4A1SA 1KT1A 3S7DA 5A6CA
chains in the Genus database with same CATH superfamily
4GYYA 2L6BA 3BUAA 2A5UA 3JCKC 3NB2A 4BT9A 2GRMA 5KJMA 3RU0A 4TXQA 3I3NA 3PZ4A 3UX4A 3SI5A 2P9KG 2R2LA 5ENQD 5A7DB 5G05C 3UIPC 2P9LG 2IO2C 1DC2A 3AG4E 3AU5A 2EILE 4I9CA 4LUNU 2QY7A 3Q7FA 3ONKA 2AWIA 1JCRA 1D8EA 3QK0A 4DI3A 3CIAA 5HI7A 4GTMA 4I9EA 3Q15A 1LTXA 2I1JA 1EPUA 2WMOA 4A63B 2BKGA 3DWLG 4N3CA 4DUIA 4K0RA 4UWHA 3LVQE 4KVMA 3I4RB 4JB8P 3RSEG 3CEQA 5C2YA 2YNQA 4OYSA 2IJGX 3DSSA 3D9HA 2DVWA 4NIKA 2X6JA 3VLFA 3E34A 5T8IA 3SBSA 2FULA 1OCOE 4KZ0A 4HXIA 4Q94A 4CRWA 4K03A 4UUCA 4JC8A 4RSYA 2ETCA 2J09A 3FU3A 4AOFA 4J8YA 2QYUA 4DLOA 4AP2A 2V8SE 5T3RA 4BSXA 3CVWA 3S7JA 4EECA 3C3OA 1FT1A 4LRZA 5CHEE 4TUUA 3ASFA 1WY6A 2GRLA 5HKPA 4UWLA 2WQ7A 4U96D 3FTYA 5EDSA 1Y8MA 3T8KA 5G04C 1AWCB 1OY3D 2PQRA 4GPKA 1NZNA 4GTPA 1MYOA 4UQZA 2AXZA 3SGHA 3JQ1A 1H2TC 5AN8A 4GZCA 3ZHEB 4HRNA 4N3AA 5KNHD 3FUEA 3SQVA 1WDYA 4CGVA 3AJIA 4AY6A 2YHCA 4P29A 2J07A 1KZPA 3EIQC 3FTXA 1IKND 1TJCA 2CHZA 2Q7FA 5A23A 2ZISA 4GZ6A 1TNZA 4H7YA 3ZYMA 4BESA 5AJLA 1MJ0A 4ZHBA 5LCWJ 4G26A 3DBSA 2LNIA 2EQXA 3L6AA 2WXQA 3ABLE 2DCPA 3CLJA 3QB2A 4APFA 3CHPA 3MKQA 2PNNA 4G25A 1HH8A 4E85A 1UJKA 2WXLA 5KCMA 1WG0A 2V5QC 1LF8A 4K5BA 4B93B 1E8WA 2LSVA 3B13A 3K9IA 4GZDA 1E96B 3LXUX 2VSYA 4CGWA 3FH7A 5LOZA 2XQ0A 4JL0A 5CECB 4DX6D 3FUKA 3GW4A 5BT1A 4WNEA 4OVVA 5KJNA 3RRMB 3ASHA 5IY5E 3JUEA 4PDXA 4OAUC 3J5QB 2KBXA 4BT8A 2WXRA 1E8YA 2M63A 2VSNA 3D9IA 5LFAA 4G2VA 2CFZA 1B89A 1H2VC 3IKOB 3GYZA 4URKA 4RG9A 3TAXA 3UPVA 2WXNA 4XI0A 4N2QA 3MJWA 3QJZA 2QYJA 4CYMD 3D9LA 2DZNA 2OVBA 2IF4A 3ULQA 3UXGA 2AXVA 4EBAA 4ACLA 1BPOA 1XNFA 4GU5A 2P58C 5BXUA 1L5JA 5BV1A 5EIDA 1N95A 2WXJA 4L2YA 3FUNA 3TG4A 5CMWA 3ESLA 3DRAA 3G2WA 3R9MA 4XKCA 1HG5A 3B7BA 1K1AA 2BKKB 1HU3A 1UG3A 3RIBA 3DSWA 2KCKA 3AG3E 4Q69A 3PREA 1TEZA 1U2VG 2KXPC 5DBKA 3Q79A 3KS2A 2R02A 4HORA 4KZCA 5EYPF 3E30A 2AW6A 3AAAC 4AJWA 3I5PA 2AVPA 2HR2A 3UI2A 2JEKA 2RFAA 3QWWA 1OUVA 3RO3A 3IHYA 4WNDA 3D3MA 4ILHB 3TWRA 4GCNA 1HX8A 1KZOA 5FQ8A 4B8AA 1HF8A 3EIJA 2XRYA 1HS6A 3P1UA 4B0ZA 1WM5A 3DXMG 5D0OD 3QAQA 3TWXA 1UN9A 3UTMA 2HO1A 3E37A 2KATA 2BUGA 3G2VA 5H7PA 1MX4A 3QOUA 3PUKA 2F8YA 2L0IA 3WXXA 3CVNA 2ILRA 1MX6A 4O1OA 2CG2A 2RFMA 5HQ8A 4N5QA 5LCWC 2WQ6A 3PDNA 1FT2A 3ZHEA 3ZVVA 3D9NA 4CT4A 4BY6A 3O4ZA 4AY5A 4ATGA 4A1SA 4K5AB 1SVXA 2VGEA 2QC9A 2VSXE 3PE3A 3CQCB 3P2BA 2DYRE 3CK9A 5T4YA 4DX2A 1SZAA 1OCCE 2LXMA 4YDWA 5ENTD 3JXIA 4MKTA 3ABME 2KC7A 2MRIA 3L16A 3IBEA 2PM6A 4GZ5A 4WWPA 3MX3A 5LX8A 4C0MA 4WWOA 1D9SA 2XCCA 5JJTA 3SHFA 3HXFA 4HRMB 3AU4A 3TXMA 3ISMC 5AJDA 1VDYA 2YQ8A 1IQUA 2I9CA 1HZ4A 2ZU6B 1GW6A 5BPPA 3ZYKA 4UWKA 3JYSA 3ZU7B 2J8SD 4HQDA 3PVLA 3TWQA 3EU9A 4Y6CA 5BV0A 4I1AA 3MCXA 2WXKA 3DXKG 5FTPA 3SFZA 2OVFA 4GTTA 2V4HC 4JEUA 4F53A 3HVEB 2IOLA 2CHWA 3VLEA 2HYZA 4JA9A 3CVVA 2KCLA 2L0TB 4CT0A 5ARGA 3FU0A 4DJAA 4Z68A 4GMJA 4BEPA 3HYMB 2NYJA 2X3MA 3CHMA 1BI8B 5E75A 3U4TA 3ZGQA 2J4BA 2GRNB 4F1SA 5FT9A 3SF4A 1ELWA 2H6GA 3QARA 2X38A 3CVYA 1A5EA 2XZTG 4FJZA 1YCSB 3UM1A 1E8XA 5EYLA 3FFLA 4FJYA 4I1OB 2QZAA 3APCA 3FWVA 1P5QA 3CSFA 2C0MA 3U9WA 4CEMA 4I1MA 4RLYA 1K3ZD 3IXEA 4K5CA 3GZSA 2ZGDA 3ML8A 2XEHA 4I2ZA 3SD5A 5JJ6A 4WWNA 1FCHA 4CDNA 2L6JA 4QFVA 2BEDA 4ABNA 3G2UA 3KD7A 3FTZA 4Q96A 3S7FA 4BWRA 4HI9A 4TUMA 1JUQA 3RRNB 3G2SA 4LEUA 3FULA 2A5EA 2XS1A 3HRAA 3V31A 4WNFA 4UI9J 2OEWA 4JEHA 2NSZA 3B7TA 4GPMA 2WXHA 2XEEA 1UOHA 3UQ3A 4UQYA 4J8EA 3AS8A 3PZDA 3UMVA 3ASDA 1UN8A 2HM8A 3QWVA 3TWWA 3VTYA 1QZ2A 3U3WA 1OWOA 4GTVA 3EHMA 3ZXPA 2XZDG 3R7QA 4ACKA 2LO6A 2R17C 1TJFA 4KVOA 4CDMA 1H19A 4XIFA 1RW2A 3SY2A 3NAWA 2WXIA 4UWFA 4TXRA 1N54A 3FUDA 3LY8A 4RG6A 4G23A 5JJ7A 5CCMA 3FUHA 3LVRE 1JCQA 3SBTB 3UT4A 3W9FA 3MV2B 5AIJA 1H6KA 3FEXA 4KT6B 2FO7A 5JA4D 3NF1A 5CRVA 2AXUA 4FU3A 4O1PA 3CSTA 1DCQA 1SW6A 5AARA 1D8DA 1AP7A 4FP7A 3ML9A 2DZOA 3NQPA 5HRYA 4IN3B 4QQIA 2LSUA 4G1TA 5FZQA 2FI7A 3D9OA 3NZUA 3L17A 3CVUA 3G2TA 4U63A 4YVOA 3Q47B 2NXPA 2VTBB 4PH4B 2VSOE 1OWLA 3NZSA 1PY1A 3TWVA 3HXCA 5BUZA 1ZBPA 3CV0A 3IV0A 4G8KA 2NC9A 1LD7A 2B0OE 1TYQG 3ZYLA 3SZ7A 3FTWA 2X6FA 4JHRA 2KCVA 4L23A 3U64A 1Z5SC 4L2LA 5AQ9A 3RAUA 2EIKE 3UM0A 3R7RA 3V30A 1X5BA 3JUIA 1Z3YA 2WXFA 4HLEA 3PNTB 5EX0A 2P9SG 2ZXWE 3HVEA 2X6HA 4C48B 3PEUB 1N52A 4C9BB 4UI9K 4A3VA 4PS3A 2LXLA 4U7EB 3NOGD 3MKRA 4I6JA 2DIWA 2OOEA 3T5XA 4GTSA 3CR3A 1ZB1A 1FPPA 4GTOA 1ZU2A 2XHEA 4ANVA 4LERA 2FBNA 2PZIA 3Q49B 1N9AA 3UKRG 4U8YD 5FIOA 2X6IA 3Q4AB 4HS2A 2Y4UA 4YVQC 5AYWD 3URZA 1E7VA 3LYAA 4ANUA 3QC1A 4H7XA 1N4RA 4GCOA 4MLPA 4O6FA 1O1RA 4JHJA 4JW1A 2XCBA 1G3NB 2KZTB 5FZSA 2FEZA 4GB9A 3PZ1A 4UI9C 3ASGA 4V3IA 3QDNA 3J5PA 4A1GA 1W3BA 1H0AA 2GRQB 4FHJA 3CGHA 4F3VA 4J8DA 3LPZA 5FQ4A 4WUYA 1JWGA 1N11A 1IQRA 4MRUA 3TL5A 3MA5A 5LP0A 5CMYA 1N4PA 1TN7A 4J0UA 3LKUA 4B94A 4EQFA 1IHGA 3E32A 3FH8A 2PM7A 3CK7A 4ATZD 4KYOB 2KM4A 3PRZA 2MOWA 2IEJA 5C1DA 3QWPA 1BD8A 4UQXA 1X81A 2UY1B 3RK6A 1OCRE 5DIZA 5AENA 3ONLA 2F0YA 3LJNA 2OV8A 2PL2A 1V55E 5ENSD 5EIBE 4LNBA 4GZ3A 3FU6A 3HXEA 2DBAA 4F6RD 2EINE 4YDYA 3AS4A 4TV3A 3JQ0A 3TWUA 3BEEA 3ENEA 3HIZA 4HB5A 3PNLB 1JCSA 4NURA 4W9RA 4JD2G 4IYPA 3Q5MA 3B7SA 4MS6A 2V5FA 3R9AB 1H6PA 3OAWA 2RD0A 4IRUA 3OXFA 2XRZA 3UT7A 3E33A 3T9KA 3Q7AA 4L9PA 5ARFA 3PH0C 3APDA 4G11A 4B8CB 2BTDA 1DVPA 2VTBA 3V79K 3ZFWA 4J8SA 3CQGB 5KNGA 4KMOA 2Y3AA 3C5RA 2IFUA 1K8KG 3C3QA 3L08A 4ZFHA 4EZKA 3MZLB 5FWQA 2I6HA 3PEVB 1EYHA 4ANWA 3D9PA 4BSZB 3FUIA 3X2QE 1TNOA 3BU8A 3B95A 3SFXA 5CEDB 5ENPD 3KAEA 4ILGA 1HXIA 3UT8A 1S63A 1U3DA 5AQ7A 2LAIA 2GROB 3PE4A 2FO1E 1K1BA 4XI9A 4RQIA 1OWPA 4G24A 5ANRA 3DSXA 3HHMA 1NA0A 2C0LA 3ZKJA 5CBOA 3OXGA 4CZ2D 5KJKA 2Y4TA 1ELRA 3ZIMA 2LAHA 4YDEA 2VQ2A 1BU9A 2IO3C 3APFA 5JHAA 3GZ2A 4PS8A 3VLDA 5JHBA 4C0EA 5ANLA 2A4ZA 3ULYA 2XGMA 5AQBA 3QKYA 5KJLA 1MHQA 4BETA 2VYIA 4BX8A 3DEOA 2VGXB 3FP3A 5D66A 2WMNA 2KZTA 4O60A 5FZRA 2CHXA 3FTSA 1E90A 1YMPA 4U0UA 4KXKB 3FHEA 3O48A 2J9QA 3L54A 3TWSA 4GTRA 2BF0X 4XX5A 1ELKA 3CVLA 3EU5A 4I43A 4I17A 1DCEA 2L9BA 5B1BE 3EHQA 5BNWA 3CVQA 1SA4A 4GTQA 2R59A 3T5VA 3DSUA 4FULA 4F1PA 3EHRA 3AG1E 1OWNA 5CRUA 3QNKA 4HOSA 4BTAA 3FEYA 1TN6A 4D10C 2DYSE 5B1AE 2XPIA 3ZYQA 4FC8A 3RO2A 3DSVA 1PC2A 3L13A 2JLBA 1SQMA 3FUJA 1IHBA 1O5MA 3EUVA 4ILIA 2UY1A 1TNBA 2WXOA 5FINA 2FF4A 1PAQA 2WVIA 3EDTB 4RVBA 4A3TA 2CFUA 3ZUVB 1UJJA 1O1TA 3Q9UC 4XZ4A 3NBNB 4GMLA 2IU1A 3IEGA 3L82A 1YA0A 2ETAA 3ULEG 4AM9A 3SO8A 1N4QA 4HRLA 4M3OA 5EN5D 4FA6A 3V2XA 3ASOE 4DPRA 3VTXA 1OCZE 2Y0BG 1LD8A 1IXVA 3W9GA 5KWDA 2IY0C 2P9IG 3ZNGA 4U8VD 1HE8A 4EPZA 4BX9A 5FJYA 3MYVA 5EILA 3T8MA 4U8HA 3RJVA 4HOQA 4J8FA 4I2WA 4EZJA 4N5CA 3OTNA 2ETBA 4L1BA 4DLQA 4GA0A 1FVFA 3C3RA 4TXPA 1MZCA 2XPZA 4N3BA 4JHKA 3WG7E 5KBAA 2E2EA 3PUJA 3TWTA 2IQCA 4JA7A 3Q75A 5ENRD 2J4DA 1HG2A 3I4GA 1NA3A 4DX5D 1TNUA 3Q78A 1TN8A 3NOCD 4FLHA 3LY9A 1DNPA 3S7DA 5A6CA 4N2SA 2JABA 4AXHA 3KSQA 4KBQA 3AS5A 3LS8A 4HLLA 1O1SA 3LDZA 1N0QA 5HS0A 5CBNA 5EX3A 3Q9NC 4JVSA 4NACA 1WAO1 3ESKA 4OVUA 1H6OA 1S70B 3BG0B 3RKVA 1E7UA 2MHKA 4BTBA 3PZ2A 3DSTA 2RG8A 2F8XK 3TXNA 2YINA 2I2OA 2XENA 3TGOA 2XGOA 3MV3B 4LSZE 1OXJA 4LCTA 3F6QA 4PUCA 4HNAD 1MQSA 2X6KA 4AV7A 1Z6TA 2WXMA 3ZEFA 2VGXA 3B7RL 3ZRHA 2H6IA 3S2AA 2GRRB 4G8LA 4BFRA 4HOUA 2WQHA 2XGSA 2XS8A 4EZLA 1Q2ZA 4I6GA 3ZN3A 2P9UG 3UIOC 3FUMA 1HO8A 1S0PA 2OEVA 4I6EA 4DI4A 3IHVA 3MEKA 3FY4A 3E4BA 1NI1A 4U0ZA 2R5SA 2VJ8A 1JWFA 3B7UX 4EBAG 4FLBA 2LUHA 4NQ0A 2WXPA 1EF1C 4BERA 1KPSB 3DPDA 5CERB 4GMRA 4GA1A 3FTUA 4AVXA 4WAFA 3CHQA 2R05A 3SNXA 4A55A 3HDXA 4AIFA 4XE0A 3LCAA 1E8ZA 1NP7A 4EHMA 4WNGA 5J90A 1MX2A 3FUFA 5ITZF 4TRQA 1N0RA 2MYOA 4L7TA 3LJ3A 4JZYA 3KSLA 2GRPB 3KEAA 3SFYA 4DRXE 2P9NG 4Y6WA 4J7WA 1V54E 3PS6A 2J08A 4HBDA 5D0QD 2HE0A 5CCLA 3FDHA 4YDOA 2H6HA 2IONA 3AG2E 4HI8A 3C72A 1N4SA 2Y69E 3CHSA 3CHRA 4LNGA 5EKQD 1JPLA 4E6HA 2XEVA 5ENNA 4B89A 5D2MC 5G55A 3UKUG 2V4LA 3CVPA 1TR4A 3BQOA 3CHOA 4GYOA 1IYGA 1BI7B 1HFAA 2P9PG 4IULA 4R7LA 5G2NA 4F7AA 5G05J 5BW8C 5CEAA 4LNUD 3N71A 2H6FA 3CK8A 3L9TA 1OWMA 3HXBA 1OT8A 1SZ9A 5J08A 2GW1A 4DX1A 2Y1LE 4FHKA 2EIME 2WPVA 4N39A 4ANXA 1Z3XA 3UM2A 4GYWA 2GGFA 2R03A 2ZIRA 4XKBA 4MBGA 4YNDA 2QFCA 5FQ7A 4HOTA 3ASNE 1FVHA 2IOSA 2WM9A 3C98A 4JPSA 2XPYA 1SA5A 1XGWA 3ZXSA 3CVXA 4XEIG 4GAAA 2I1KA 2E0IA 5ENOD 4M7CA 1UW4B 4U07A 3CKCA 2ZGGA 4DX7D 3CKBA 3Q73A 1EDUA 3JXJA 1KT0A 4X8QA 3ABKE 1TNYA 3EJNA 3BG1B 2YHEA 1RZ4A 3DPYA 2PQNA 3LY7A 4PS7A 2VGYA 5E76A 5FQ6A 4U95D 1QBQA 1QNFA 2C2LA 1QQEA 4JXTA 2P2CP 2ONDA 4UWGA 4CDRA 2CG3A 2WB2A 2AJAA 3LEWA 3ZPJA 3KEZA 3ZW3A 3OXLA 5G04J 4CCAA 2F37A 4ME2A 5B3SE 1QYMA 1NFIE 1NL4A 4OAVB 2V0PA 5JMND 1Y6IA 3TJPA 3D9JA 4DK5A 3HXDA 3FTVA 4HFGA 1A17A 3FH5A 4U0SA 5M72A 3U66A 3DEPA 5AQAA 3RRUA 1YYHA 3MGBA 3MKQB 3GZ1A 2DWZA 4NRHB 4FADA 3S7BA 3TG5A 3EHNA 1U3CA 3UUXA 4GA2A 2B6CA 1INZA 1BLXB 1H2UA 3PZ3A 3FU5A 3V2OA 5AAOA 4J6IA 1N94A 1S64A 2EIJE 4APOA 3UINC 4LG6A 3D9MA 2OCCE 3UM3A 4U04A 2WXGA 5BXOA 1KLXA 3D9KA 4AEZC 2J49A 2UWJG 3L22A 4HVBA 3HG0D 1KT1A 2RKKA
chains in the Genus database with same CATH topology
4N2SA 1W3BA 1H0AA 4GYYA 2VSXE 3PE3A 4AXHA 4FHJA 4KBQA 3CQCB 2A5UA 3P2BA 3CGHA 4F3VA 4J8DA 3AS5A 3JCKC 3LPZA 3CK9A 3LS8A 5FQ4A 5T4YA 4WUYA 4BT9A 2GRMA 5KJMA 3RU0A 1JWGA 3I3NA 3LDZA 1SZAA 1IQRA 5EX3A 3UX4A 3SI5A 4MRUA 3TL5A 4JVSA 4NACA 5A7DB 4MKTA 1WAO1 5G05C 3MA5A 3ESKA 5LP0A 4OVUA 2KC7A 2MRIA 5CMYA 3L16A 3IBEA 3AU5A 2PM6A 4GZ5A 3BG0B 3RKVA 4J0UA 1E7UA 2MHKA 4BTBA 4I9CA 4WWPA 2RG8A 3LKUA 4B94A 3MX3A 5LX8A 3TXNA 2YINA 4LUNU 4C0MA 2QY7A 2I2OA 4EQFA 4WWOA 1IHGA 3ONKA 2AWIA 2XCCA 3FH8A 3TGOA 2PM7A 5JJTA 3SHFA 2XGOA 3CK7A 3MV3B 3QK0A 4KYOB 2KM4A 3AU4A 4DI3A 3TXMA 3CIAA 3PRZA 5HI7A 5AJDA 1VDYA 4LCTA 2YQ8A 1IQUA 2MOWA 2I9CA 4I9EA 5C1DA 3Q15A 2I1JA 3QWPA 4PUCA 1EPUA 1MQSA 1HZ4A 2WMOA 2X6KA 2ZU6B 4UQXA 4AV7A 1Z6TA 2UY1B 4N3CA 3RK6A 1GW6A 5DIZA 5BPPA 3ZYKA 4UWKA 4K0RA 4UWHA 3JYSA 2WXMA 3ZEFA 2VGXA 3B7RL 3ZRHA 5AENA 3LVQE 4KVMA 3I4RB 3ONLA 3S2AA 3PVLA 2OV8A 2PL2A 4Y6CA 5BV0A 4BFRA 3CEQA 5C2YA 4I1AA 2YNQA 3MCXA 2WXKA 5FTPA 4HOUA 3SFZA 2WQHA 2OVFA 4GZ3A 3FU6A 4OYSA 2XGSA 2DBAA 4JEUA 3AS4A 4F53A 4EZLA 2IJGX 3HVEB 2IOLA 4TV3A 3JQ0A 2CHWA 4I6GA 3VLEA 2HYZA 3BEEA 4JA9A 3ENEA 3ZN3A 3CVVA 3HIZA 2KCLA 2X6JA 2L0TB 3PNLB 4CT0A 3VLFA 3FUMA 5T8IA 4NURA 3SBSA 5ARGA 2FULA 1HO8A 4KZ0A 4HXIA 1S0PA 3FU0A 4Q94A 4W9RA 4CRWA 4K03A 4IYPA 4JC8A 4DJAA 4GMJA 4I6EA 3Q5MA 3B7SA 4RSYA 3HYMB 4MS6A 4DI4A 2J09A 2V5FA 3R9AB 2X3MA 3CHMA 3FU3A 5E75A 3IHVA 3OAWA 4AOFA 2RD0A 3U4TA 4DLOA 4IRUA 3ZGQA 3OXFA 2J4BA 3MEKA 3FY4A 2XRZA 3UT7A 4F1SA 5FT9A 4AP2A 2V8SE 3SF4A 5T3RA 3E4BA 5ARFA 4BSXA 1ELWA 3CVWA 3PH0C 3APDA 4G11A 4U0ZA 3S7JA 4EECA 2BTDA 4B8CB 1DVPA 3QARA 2R5SA 2VJ8A 1JWFA 3B7UX 2X38A 4LRZA 5CHEE 4EBAG 2VTBA 3CVYA 4TUUA 4A1GA 4FLBA 3ASFA 4FJZA 1E8XA 1WY6A 4NQ0A 2GRLA 3FFLA 4FJYA 4I1OB 2WXPA 4UWLA 1EF1C 2WQ7A 3APCA 3FWVA 4J8SA 3CQGB 1P5QA 3ZFWA 3FTYA 5EDSA 3DPDA 3CSFA 1Y8MA 2C0MA 5G04C 3U9WA 4CEMA 4GA1A 2PQRA 4GPKA 4I1MA 1NZNA 4KMOA 2Y3AA 3FTUA 4AVXA 2IFUA 3GZSA 4WAFA 3CHQA 3SNXA 4UQZA 4A55A 3HDXA 4AIFA 3L08A 2AXZA 3SGHA 4XE0A 3JQ1A 3LCAA 4EZKA 1E8ZA 3MZLB 2I6HA 3ML8A 3PEVB 5FWQA 1EYHA 1H2TC 4ANWA 3D9PA 1NP7A 4I2ZA 3SD5A 4WNGA 3FUIA 4WWNA 5JJ6A 5J90A 3FUFA 1FCHA 4TRQA 4L7TA 4CDNA 4GZCA 3KAEA 3LJ3A 3ZHEB 4ILGA 4JZYA 2L6JA 4N3AA 3FUEA 1HXIA 4QFVA 3UT8A 4CGVA 4AY6A 2YHCA 1U3DA 4ABNA 3G2UA 3KD7A 4Y6WA 3FTZA 4Q96A 4P29A 3S7FA 4BWRA 2LAIA 2J07A 3PE4A 3PS6A 3EIQC 3FTXA 1TJCA 2CHZA 4XI9A 2J08A 2Q7FA 5A23A 5D0QD 1JUQA 4GZ6A 5CCLA 3RRNB 4H7YA 3G2SA 3ZYMA 5AJLA 3FDHA 1OWPA 4G24A 4LEUA 5ANRA 2IONA 3FULA 5LCWJ 3HHMA 3DBSA 4G26A 2LNIA 2EQXA 3L6AA 2WXQA 1NA0A 2DCPA 3CHSA 2C0LA 4WNFA 3CHRA 5EKQD 1JPLA 4UI9J 4E6HA 3CLJA 2XEVA 5ENNA 4B89A 3QB2A 3OXGA 4APFA 4JEHA 2NSZA 3CHPA 3MKQA 3B7TA 5G55A 5KJKA 2Y4TA 1ELRA 3ZIMA 2V4LA 2LAHA 2VQ2A 2WXHA 4G25A 1HH8A 3APFA 3CVPA 5JHAA 3CHOA 3UQ3A 4UQYA 3GZ2A 4J8EA 4GYOA 3AS8A 4E85A 1IYGA 3PZDA 4PS8A 1HFAA 3UMVA 1UJKA 1UN8A 2HM8A 2WXLA 3ASDA 3QWVA 5KCMA 3VTYA 1QZ2A 3VLDA 4IULA 5JHBA 1OWOA 4R7LA 3U3WA 5G2NA 4F7AA 5G05J 4C0EA 5BW8C 1LF8A 5ANLA 3EHMA 2A4ZA 2XGMA 3N71A 3CK8A 1E8WA 2LSVA 3B13A 3K9IA 3QKYA 4GZDA 1OWMA 1E96B 3LXUX 2VSYA 1MHQA 3R7QA 5KJLA 4ACKA 2LO6A 2R17C 4CGWA 1TJFA 2VYIA 4KVOA 3FH7A 5LOZA 4CDMA 2XQ0A 4BX8A 1H19A 4XIFA 2VGXB 1SZ9A 3FP3A 4JL0A 2WMNA 5J08A 3FUKA 2GW1A 2WXIA 3GW4A 4UWFA 2KZTA 5BT1A 5FZRA 4WNEA 4FHKA 4OVVA 5KJNA 2CHXA 1N54A 1E90A 3FTSA 2WPVA 3FUDA 3LY8A 4U0UA 4N39A 4RG6A 4G23A 3ASHA 4KXKB 3FHEA 1Z3XA 2J9QA 3L54A 3O48A 4ANXA 5JJ7A 4GYWA 4PDXA 5CCMA 3FUHA 2BF0X 4XX5A 1ELKA 2GGFA 3LVRE 3CVLA 4BT8A 3SBTB 2WXRA 3UT4A 4I43A 3MV2B 4XKBA 5AIJA 1E8YA 1H6KA 2M63A 2VSNA 3D9IA 3FEXA 4KT6B 4I17A 4G2VA 2FO7A 5LFAA 2CFZA 1B89A 3NF1A 1H2VC 2AXUA 2L9BA 4FU3A 5BNWA 4YNDA 3CVQA 3CSTA 3IKOB 3GYZA 2R59A 4URKA 4RG9A 3T5VA 3TAXA 3UPVA 2QFCA 5FQ7A 2WXNA 4XI0A 4FULA 4HOTA 3CVUA 4N2QA 3MJWA 4FP7A 1OWNA 3ML9A 3QJZA 3NQPA 1FVHA 3D9LA 2IOSA 2WM9A 3C98A 2OVBA 4JPSA 2XPYA 3QNKA 4IN3B 2IF4A 3ULQA 1XGWA 2AXVA 3ZXSA 4EBAA 4BTAA 4HOSA 4ACLA 3CVXA 2LSUA 1BPOA 4G1TA 1XNFA 4GAAA 3FEYA 2I1KA 2E0IA 4GU5A 2P58C 5FZQA 2FI7A 3D9OA 4D10C 1UW4B 4U07A 3NZUA 3L17A 3CKCA 3G2TA 4U63A 4YVOA 3Q47B 2NXPA 1L5JA 2XPIA 2VTBB 4PH4B 3ZYQA 5BV1A 2VSOE 2WXJA 1OWLA 3NZSA 1PY1A 3FUNA 4FC8A 4L2YA 3CKBA 3RO2A 5BUZA 1ZBPA 3CV0A 1PC2A 3TG4A 5CMWA 3L13A 2JLBA 3ESLA 3IV0A 2NC9A 3G2WA 1EDUA 1SQMA 1KT0A 3EJNA 3BG1B 2YHEA 3FUJA 3ZYLA 4XKCA 3SZ7A 3FTWA 4ILIA 2PQNA 2X6FA 2UY1A 4JHRA 1HG5A 2KCVA 2WXOA 3LY7A 4L23A 2FF4A 2VGYA 4PS7A 1PAQA 2WVIA 3EDTB 4RVBA 3U64A 2CFUA 5E76A 4A3TA 1HU3A 5FQ6A 1UG3A 1UJJA 4L2LA 3RIBA 2KCKA 1QNFA 2C2LA 4Q69A 3RRMB 1QQEA 4JXTA 4XZ4A 3R7RA 2ONDA 3PREA 1TEZA 4UWGA 4GMLA 5DBKA 4CDRA 1X5BA 2IU1A 3JUIA 3KS2A 1Z3YA 2CG3A 2WB2A 3IEGA 2WXFA 4KZCA 4HORA 3LEWA 1YA0A 4HLEA 3PNTB 5EX0A 2AW6A 3ZPJA 3KEZA 4AJWA 3ZW3A 3OXLA 4AM9A 3I5PA 2AVPA 3HVEA 2X6HA 5G04J 4M3OA 4CCAA 4ME2A 2HR2A 3PEUB 2JEKA 4FA6A 1N52A 4C9BB 4UI9K 4A3VA 3QWWA 4DPRA 4PS3A 3VTXA 2V0PA 1Y6IA 3TJPA 3MKRA 1OUVA 3D9JA 4DK5A 3RO3A 4I6JA 3IHYA 4WNDA 3FTVA 2DIWA 2OOEA 3D3MA 4ILHB 3T5XA 4GCNA 1HX8A 3CR3A 5FQ8A 4HFGA 1A17A 3FH5A 4B8AA 4U0SA 5M72A 1HF8A 3U66A 3EIJA 2XRYA 3RRUA 1ZU2A 1HE8A 2XHEA 1HS6A 3MGBA 3P1UA 4ANVA 4B0ZA 1WM5A 3MKQB 4LERA 5D0OD 4EPZA 2FBNA 2PZIA 3GZ1A 4BX9A 5FJYA 3MYVA 4NRHB 4FADA 3QAQA 3S7BA 3Q49B 3TG5A 3EHNA 3T8MA 4U8HA 1U3CA 1UN9A 3RJVA 4HOQA 4J8FA 2HO1A 4I2WA 4EZJA 2KATA 3UUXA 4N5CA 4GA2A 2BUGA 3OTNA 3G2VA 1INZA 4L1BA 2X6IA 4DLQA 1H2UA 3Q4AB 1FVFA 4GA0A 2Y4UA 4HS2A 3FU5A 4YVQC 3QOUA 2XPZA 4J6IA 4N3BA 5AYWD 4JHKA 3PUKA 2E2EA 3URZA 1E7VA 2L0IA 4APOA 3WXXA 3LYAA 3PUJA 4ANUA 3QC1A 2IQCA 3CVNA 4JA7A 3D9MA 4H7XA 2ILRA 4GCOA 2CG2A 4U04A 4MLPA 5HQ8A 2WXGA 5LCWC 1KLXA 4O6FA 4JHJA 4JW1A 2XCBA 1HG2A 2J4DA 2KZTB 1NA3A 3D9KA 3I4GA 3PDNA 4AEZC 2WQ6A 5FZSA 2FEZA 4GB9A 3ZHEA 2J49A 3D9NA 3ZVVA 2UWJG 4UI9C 3L22A 4CT4A 4FLHA 3ASGA 3O4ZA 4V3IA 4AY5A 4BY6A 4HVBA 3LY9A 4ATGA 3QDNA 4A1SA 1DNPA 1KT1A 3S7DA 5A6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N2S A;  1W3B A;  4GYY A;  3PE3 A;  4KBQ A;  4F3V A;  4J8D A;  3AS5 A;  3LPZ A;  3CK9 A;  4BT9 A;  4WUY A;  5KJM A;  3RU0 A;  5EX3 A;  5A7D B;  1WAO 1;  5G05 C;  3MA5 A;  3ESK A;  2KC7 A;  4GZ5 A;  3RKV A;  4J0U A;  2MHK A;  4BTB A;  4I9C A;  3LKU A;  4B94 A;  4EQF A;  1IHG A;  2XCC A;  3TGO A;  5JJT A;  2XGO A;  3CK7 A;  3MV3 B;  4KYO B;  5HI7 A;  2YQ8 A;  4I9E A;  5C1D A;  3Q15 A;  3QWP A;  1HZ4 A;  4UQX A;  2UY1 B;  4N3C A;  5DIZ A;  3JYS A;  2VGX A;  2PL2 A;  4Y6C A;  3CEQ A;  4I1A A;  5FTP A;  4HOU A;  2WQH A;  4GZ3 A;  2XGS A;  2DBA A;  3AS4 A;  2HYZ A;  3BEE A;  4JA9 A;  3ZN3 A;  2KCL A;  5ARG A;  4W9R A;  3Q5M A;  3HYM B;  2V5F A;  3R9A B;  3U4T A;  3ZGQ A;  3OXF A;  3MEK A;  5FT9 A;  3SF4 A;  3E4B A;  5ARF A;  1ELW A;  4U0Z A;  3S7J A;  2R5S A;  5CHE E;  3ASF A;  4NQ0 A;  3FFL A;  3FWV A;  3ZFW A;  1P5Q A;  1Y8M A;  2C0M A;  5G04 C;  4GA1 A;  2PQR A;  4GPK A;  1NZN A;  2IFU A;  4UQZ A;  4AIF A;  3LCA A;  2I6H A;  4I2Z A;  4WNG A;  5JJ6 A;  1FCH A;  3KAE A;  3ZHE B;  2L6J A;  4N3A A;  1HXI A;  4CGV A;  4AY6 A;  2YHC A;  4ABN A;  3KD7 A;  4Y6W A;  3S7F A;  4BWR A;  3PE4 A;  1TJC A;  4XI9 A;  2Q7F A;  5D0Q D;  4GZ6 A;  5CCL A;  4H7Y A;  4G24 A;  4LEU A;  5LCW J;  4G26 A;  2LNI A;  1NA0 A;  2C0L A;  4WNF A;  5EKQ D;  4UI9 J;  2XEV A;  3OXG A;  5KJK A;  2Y4T A;  1ELR A;  2VQ2 A;  4G25 A;  1HH8 A;  3CVP A;  3UQ3 A;  4UQY A;  3GZ2 A;  4J8E A;  4GYO A;  3AS8 A;  1IYG A;  3ASD A;  3QWV A;  3VTY A;  1QZ2 A;  3U3W A;  5G05 J;  5BW8 C;  2XGM A;  3N71 A;  3CK8 A;  2LSV A;  3K9I A;  3QKY A;  1E96 B;  2VSY A;  5KJL A;  4CGW A;  2VYI A;  4XIF A;  2VGX B;  4JL0 A;  3FP3 A;  2GW1 A;  3GW4 A;  5BT1 A;  5FZR A;  4WNE A;  5KJN A;  4U0U A;  3LY8 A;  2WPV A;  4N39 A;  4RG6 A;  4G23 A;  3ASH A;  4KXK B;  3O48 A;  2J9Q A;  5JJ7 A;  4GYW A;  5CCM A;  4BT8 A;  3CVL A;  3MV2 B;  2VSN A;  4I17 A;  4G2V A;  2FO7 A;  1B89 A;  3NF1 A;  5BNW A;  4YND A;  3CVQ A;  3GYZ A;  4RG9 A;  3TAX A;  3UPV A;  2QFC A;  4XI0 A;  4HOT A;  4N2Q A;  4IN3 B;  2IF4 A;  3ULQ A;  4HOS A;  4BTA A;  2LSU A;  4G1T A;  1XNF A;  2P58 C;  5FZQ A;  2FI7 A;  4U07 A;  3CKC A;  4YVO A;  3Q47 B;  2XPI A;  3CKB A;  3RO2 A;  1ZBP A;  3CV0 A;  1PC2 A;  3TG4 A;  2JLB A;  2NC9 A;  1KT0 A;  3SZ7 A;  2PQN A;  2UY1 A;  4JHR A;  2KCV A;  3LY7 A;  2FF4 A;  2VGY A;  3EDT B;  3RIB A;  2KCK A;  2C2L A;  1QQE A;  2OND A;  5DBK A;  4CDR A;  3KS2 A;  4HOR A;  3IEG A;  1YA0 A;  5EX0 A;  3ZPJ A;  3OXL A;  4AM9 A;  2AVP A;  5G04 J;  4ME2 A;  2HR2 A;  4UI9 K;  3QWW A;  3VTX A;  3MKR A;  1OUV A;  3RO3 A;  4WND A;  2OOE A;  4GCN A;  1A17 A;  4U0S A;  5M72 A;  1ZU2 A;  1WM5 A;  5D0O D;  2FBN A;  2PZI A;  3GZ1 A;  5FJY A;  4NRH B;  3S7B A;  3Q49 B;  3TG5 A;  3RJV A;  4HOQ A;  4J8F A;  2HO1 A;  4I2W A;  2KAT A;  3UUX A;  4N5C A;  4GA2 A;  2BUG A;  3Q4A B;  4GA0 A;  2Y4U A;  4YVQ C;  3QOU A;  4N3B A;  5AYW D;  2E2E A;  3URZ A;  4APO A;  3WXX A;  3LYA A;  3CVN A;  4JA7 A;  4H7X A;  4GCO A;  4U04 A;  5HQ8 A;  5LCW C;  1KLX A;  4O6F A;  2XCB A;  1NA3 A;  3PDN A;  5FZS A;  2FEZ A;  3ZHE A;  2UWJ G;  4UI9 C;  3ASG A;  4AY5 A;  3LY9 A;  3QDN A;  4A1S A;  1KT1 A;  3S7D A;  5A6C A; 
#chains in the Genus database with same CATH topology
 4GYY A;  2L6B A;  3BUA A;  2A5U A;  3JCK C;  3NB2 A;  4BT9 A;  2GRM A;  5KJM A;  3RU0 A;  4TXQ A;  3I3N A;  3PZ4 A;  3UX4 A;  3SI5 A;  2P9K G;  2R2L A;  5ENQ D;  5A7D B;  5G05 C;  3UIP C;  2P9L G;  2IO2 C;  1DC2 A;  3AG4 E;  3AU5 A;  2EIL E;  4I9C A;  4LUN U;  2QY7 A;  3Q7F A;  3ONK A;  2AWI A;  1JCR A;  1D8E A;  3QK0 A;  4DI3 A;  3CIA A;  5HI7 A;  4GTM A;  4I9E A;  3Q15 A;  1LTX A;  2I1J A;  1EPU A;  2WMO A;  4A63 B;  2BKG A;  3DWL G;  4N3C A;  4DUI A;  4K0R A;  4UWH A;  3LVQ E;  4KVM A;  3I4R B;  4JB8 P;  3RSE G;  3CEQ A;  5C2Y A;  2YNQ A;  4OYS A;  2IJG X;  3DSS A;  3D9H A;  2DVW A;  4NIK A;  2X6J A;  3VLF A;  3E34 A;  5T8I A;  3SBS A;  2FUL A;  1OCO E;  4KZ0 A;  4HXI A;  4Q94 A;  4CRW A;  4K03 A;  4UUC A;  4JC8 A;  4RSY A;  2ETC A;  2J09 A;  3FU3 A;  4AOF A;  4J8Y A;  2QYU A;  4DLO A;  4AP2 A;  2V8S E;  5T3R A;  4BSX A;  3CVW A;  3S7J A;  4EEC A;  3C3O A;  1FT1 A;  4LRZ A;  5CHE E;  4TUU A;  3ASF A;  1WY6 A;  2GRL A;  5HKP A;  4UWL A;  2WQ7 A;  4U96 D;  3FTY A;  5EDS A;  1Y8M A;  3T8K A;  5G04 C;  1AWC B;  1OY3 D;  2PQR A;  4GPK A;  1NZN A;  4GTP A;  1MYO A;  4UQZ A;  2AXZ A;  3SGH A;  3JQ1 A;  1H2T C;  5AN8 A;  4GZC A;  3ZHE B;  4HRN A;  4N3A A;  5KNH D;  3FUE A;  3SQV A;  1WDY A;  4CGV A;  3AJI A;  4AY6 A;  2YHC A;  4P29 A;  2J07 A;  1KZP A;  3EIQ C;  3FTX A;  1IKN D;  1TJC A;  2CHZ A;  2Q7F A;  5A23 A;  2ZIS A;  4GZ6 A;  1TNZ A;  4H7Y A;  3ZYM A;  4BES A;  5AJL A;  1MJ0 A;  4ZHB A;  5LCW J;  4G26 A;  3DBS A;  2LNI A;  2EQX A;  3L6A A;  2WXQ A;  3ABL E;  2DCP A;  3CLJ A;  3QB2 A;  4APF A;  3CHP A;  3MKQ A;  2PNN A;  4G25 A;  1HH8 A;  4E85 A;  1UJK A;  2WXL A;  5KCM A;  1WG0 A;  2V5Q C;  1LF8 A;  4K5B A;  4B93 B;  1E8W A;  2LSV A;  3B13 A;  3K9I A;  4GZD A;  1E96 B;  3LXU X;  2VSY A;  4CGW A;  3FH7 A;  5LOZ A;  2XQ0 A;  4JL0 A;  5CEC B;  4DX6 D;  3FUK A;  3GW4 A;  5BT1 A;  4WNE A;  4OVV A;  5KJN A;  3RRM B;  3ASH A;  5IY5 E;  3JUE A;  4PDX A;  4OAU C;  3J5Q B;  2KBX A;  4BT8 A;  2WXR A;  1E8Y A;  2M63 A;  2VSN A;  3D9I A;  5LFA A;  4G2V A;  2CFZ A;  1B89 A;  1H2V C;  3IKO B;  3GYZ A;  4URK A;  4RG9 A;  3TAX A;  3UPV A;  2WXN A;  4XI0 A;  4N2Q A;  3MJW A;  3QJZ A;  2QYJ A;  4CYM D;  3D9L A;  2DZN A;  2OVB A;  2IF4 A;  3ULQ A;  3UXG A;  2AXV A;  4EBA A;  4ACL A;  1BPO A;  1XNF A;  4GU5 A;  2P58 C;  5BXU A;  1L5J A;  5BV1 A;  5EID A;  1N95 A;  2WXJ A;  4L2Y A;  3FUN A;  3TG4 A;  5CMW A;  3ESL A;  3DRA A;  3G2W A;  3R9M A;  4XKC A;  1HG5 A;  3B7B A;  1K1A A;  2BKK B;  1HU3 A;  1UG3 A;  3RIB A;  3DSW A;  2KCK A;  3AG3 E;  4Q69 A;  3PRE A;  1TEZ A;  1U2V G;  2KXP C;  5DBK A;  3Q79 A;  3KS2 A;  2R02 A;  4HOR A;  4KZC A;  5EYP F;  3E30 A;  2AW6 A;  3AAA C;  4AJW A;  3I5P A;  2AVP A;  2HR2 A;  3UI2 A;  2JEK A;  2RFA A;  3QWW A;  1OUV A;  3RO3 A;  3IHY A;  4WND A;  3D3M A;  4ILH B;  3TWR A;  4GCN A;  1HX8 A;  1KZO A;  5FQ8 A;  4B8A A;  1HF8 A;  3EIJ A;  2XRY A;  1HS6 A;  3P1U A;  4B0Z A;  1WM5 A;  3DXM G;  5D0O D;  3QAQ A;  3TWX A;  1UN9 A;  3UTM A;  2HO1 A;  3E37 A;  2KAT A;  2BUG A;  3G2V A;  5H7P A;  1MX4 A;  3QOU A;  3PUK A;  2F8Y A;  2L0I A;  3WXX A;  3CVN A;  2ILR A;  1MX6 A;  4O1O A;  2CG2 A;  2RFM A;  5HQ8 A;  4N5Q A;  5LCW C;  2WQ6 A;  3PDN A;  1FT2 A;  3ZHE A;  3ZVV A;  3D9N A;  4CT4 A;  4BY6 A;  3O4Z A;  4AY5 A;  4ATG A;  4A1S A;  4K5A B;  1SVX A;  2VGE A;  2QC9 A;  2VSX E;  3PE3 A;  3CQC B;  3P2B A;  2DYR E;  3CK9 A;  5T4Y A;  4DX2 A;  1SZA A;  1OCC E;  2LXM A;  4YDW A;  5ENT D;  3JXI A;  4MKT A;  3ABM E;  2KC7 A;  2MRI A;  3L16 A;  3IBE A;  2PM6 A;  4GZ5 A;  4WWP A;  3MX3 A;  5LX8 A;  4C0M A;  4WWO A;  1D9S A;  2XCC A;  5JJT A;  3SHF A;  3HXF A;  4HRM B;  3AU4 A;  3TXM A;  3ISM C;  5AJD A;  1VDY A;  2YQ8 A;  1IQU A;  2I9C A;  1HZ4 A;  2ZU6 B;  1GW6 A;  5BPP A;  3ZYK A;  4UWK A;  3JYS A;  3ZU7 B;  2J8S D;  4HQD A;  3PVL A;  3TWQ A;  3EU9 A;  4Y6C A;  5BV0 A;  4I1A A;  3MCX A;  2WXK A;  3DXK G;  5FTP A;  3SFZ A;  2OVF A;  4GTT A;  2V4H C;  4JEU A;  4F53 A;  3HVE B;  2IOL A;  2CHW A;  3VLE A;  2HYZ A;  4JA9 A;  3CVV A;  2KCL A;  2L0T B;  4CT0 A;  5ARG A;  3FU0 A;  4DJA A;  4Z68 A;  4GMJ A;  4BEP A;  3HYM B;  2NYJ A;  2X3M A;  3CHM A;  1BI8 B;  5E75 A;  3U4T A;  3ZGQ A;  2J4B A;  2GRN B;  4F1S A;  5FT9 A;  3SF4 A;  1ELW A;  2H6G A;  3QAR A;  2X38 A;  3CVY A;  1A5E A;  2XZT G;  4FJZ A;  1YCS B;  3UM1 A;  1E8X A;  5EYL A;  3FFL A;  4FJY A;  4I1O B;  2QZA A;  3APC A;  3FWV A;  1P5Q A;  3CSF A;  2C0M A;  3U9W A;  4CEM A;  4I1M A;  4RLY A;  1K3Z D;  3IXE A;  4K5C A;  3GZS A;  2ZGD A;  3ML8 A;  2XEH A;  4I2Z A;  3SD5 A;  5JJ6 A;  4WWN A;  1FCH A;  4CDN A;  2L6J A;  4QFV A;  2BED A;  4ABN A;  3G2U A;  3KD7 A;  3FTZ A;  4Q96 A;  3S7F A;  4BWR A;  4HI9 A;  4TUM A;  1JUQ A;  3RRN B;  3G2S A;  4LEU A;  3FUL A;  2A5E A;  2XS1 A;  3HRA A;  3V31 A;  4WNF A;  4UI9 J;  2OEW A;  4JEH A;  2NSZ A;  3B7T A;  4GPM A;  2WXH A;  2XEE A;  1UOH A;  3UQ3 A;  4UQY A;  4J8E A;  3AS8 A;  3PZD A;  3UMV A;  3ASD A;  1UN8 A;  2HM8 A;  3QWV A;  3TWW A;  3VTY A;  1QZ2 A;  3U3W A;  1OWO A;  4GTV A;  3EHM A;  3ZXP A;  2XZD G;  3R7Q A;  4ACK A;  2LO6 A;  2R17 C;  1TJF A;  4KVO A;  4CDM A;  1H19 A;  4XIF A;  1RW2 A;  3SY2 A;  3NAW A;  2WXI A;  4UWF A;  4TXR A;  1N54 A;  3FUD A;  3LY8 A;  4RG6 A;  4G23 A;  5JJ7 A;  5CCM A;  3FUH A;  3LVR E;  1JCQ A;  3SBT B;  3UT4 A;  3W9F A;  3MV2 B;  5AIJ A;  1H6K A;  3FEX A;  4KT6 B;  2FO7 A;  5JA4 D;  3NF1 A;  5CRV A;  2AXU A;  4FU3 A;  4O1P A;  3CST A;  1DCQ A;  1SW6 A;  5AAR A;  1D8D A;  1AP7 A;  4FP7 A;  3ML9 A;  2DZO A;  3NQP A;  5HRY A;  4IN3 B;  4QQI A;  2LSU A;  4G1T A;  5FZQ A;  2FI7 A;  3D9O A;  3NZU A;  3L17 A;  3CVU A;  3G2T A;  4U63 A;  4YVO A;  3Q47 B;  2NXP A;  2VTB B;  4PH4 B;  2VSO E;  1OWL A;  3NZS A;  1PY1 A;  3TWV A;  3HXC A;  5BUZ A;  1ZBP A;  3CV0 A;  3IV0 A;  4G8K A;  2NC9 A;  1LD7 A;  2B0O E;  1TYQ G;  3ZYL A;  3SZ7 A;  3FTW A;  2X6F A;  4JHR A;  2KCV A;  4L23 A;  3U64 A;  1Z5S C;  4L2L A;  5AQ9 A;  3RAU A;  2EIK E;  3UM0 A;  3R7R A;  3V30 A;  1X5B A;  3JUI A;  1Z3Y A;  2WXF A;  4HLE A;  3PNT B;  5EX0 A;  2P9S G;  2ZXW E;  3HVE A;  2X6H A;  4C48 B;  3PEU B;  1N52 A;  4C9B B;  4UI9 K;  4A3V A;  4PS3 A;  2LXL A;  4U7E B;  3NOG D;  3MKR A;  4I6J A;  2DIW A;  2OOE A;  3T5X A;  4GTS A;  3CR3 A;  1ZB1 A;  1FPP A;  4GTO A;  1ZU2 A;  2XHE A;  4ANV A;  4LER A;  2FBN A;  2PZI A;  3Q49 B;  1N9A A;  3UKR G;  4U8Y D;  5FIO A;  2X6I A;  3Q4A B;  4HS2 A;  2Y4U A;  4YVQ C;  5AYW D;  3URZ A;  1E7V A;  3LYA A;  4ANU A;  3QC1 A;  4H7X A;  1N4R A;  4GCO A;  4MLP A;  4O6F A;  1O1R A;  4JHJ A;  4JW1 A;  2XCB A;  1G3N B;  2KZT B;  5FZS A;  2FEZ A;  4GB9 A;  3PZ1 A;  4UI9 C;  3ASG A;  4V3I A;  3QDN A;  3J5P A;  4A1G A;  1W3B A;  1H0A A;  2GRQ B;  4FHJ A;  3CGH A;  4F3V A;  4J8D A;  3LPZ A;  5FQ4 A;  4WUY A;  1JWG A;  1N11 A;  1IQR A;  4MRU A;  3TL5 A;  3MA5 A;  5LP0 A;  5CMY A;  1N4P A;  1TN7 A;  4J0U A;  3LKU A;  4B94 A;  4EQF A;  1IHG A;  3E32 A;  3FH8 A;  2PM7 A;  3CK7 A;  4ATZ D;  4KYO B;  2KM4 A;  3PRZ A;  2MOW A;  2IEJ A;  5C1D A;  3QWP A;  1BD8 A;  4UQX A;  1X81 A;  2UY1 B;  3RK6 A;  1OCR E;  5DIZ A;  5AEN A;  3ONL A;  2F0Y A;  3LJN A;  2OV8 A;  2PL2 A;  1V55 E;  5ENS D;  5EIB E;  4LNB A;  4GZ3 A;  3FU6 A;  3HXE A;  2DBA A;  4F6R D;  2EIN E;  4YDY A;  3AS4 A;  4TV3 A;  3JQ0 A;  3TWU A;  3BEE A;  3ENE A;  3HIZ A;  4HB5 A;  3PNL B;  1JCS A;  4NUR A;  4W9R A;  4JD2 G;  4IYP A;  3Q5M A;  3B7S A;  4MS6 A;  2V5F A;  3R9A B;  1H6P A;  3OAW A;  2RD0 A;  4IRU A;  3OXF A;  2XRZ A;  3UT7 A;  3E33 A;  3T9K A;  3Q7A A;  4L9P A;  5ARF A;  3PH0 C;  3APD A;  4G11 A;  4B8C B;  2BTD A;  1DVP A;  2VTB A;  3V79 K;  3ZFW A;  4J8S A;  3CQG B;  5KNG A;  4KMO A;  2Y3A A;  3C5R A;  2IFU A;  1K8K G;  3C3Q A;  3L08 A;  4ZFH A;  4EZK A;  3MZL B;  5FWQ A;  2I6H A;  3PEV B;  1EYH A;  4ANW A;  3D9P A;  4BSZ B;  3FUI A;  3X2Q E;  1TNO A;  3BU8 A;  3B95 A;  3SFX A;  5CED B;  5ENP D;  3KAE A;  4ILG A;  1HXI A;  3UT8 A;  1S63 A;  1U3D A;  5AQ7 A;  2LAI A;  2GRO B;  3PE4 A;  2FO1 E;  1K1B A;  4XI9 A;  4RQI A;  1OWP A;  4G24 A;  5ANR A;  3DSX A;  3HHM A;  1NA0 A;  2C0L A;  3ZKJ A;  5CBO A;  3OXG A;  4CZ2 D;  5KJK A;  2Y4T A;  1ELR A;  3ZIM A;  2LAH A;  4YDE A;  2VQ2 A;  1BU9 A;  2IO3 C;  3APF A;  5JHA A;  3GZ2 A;  4PS8 A;  3VLD A;  5JHB A;  4C0E A;  5ANL A;  2A4Z A;  3ULY A;  2XGM A;  5AQB A;  3QKY A;  5KJL A;  1MHQ A;  4BET A;  2VYI A;  4BX8 A;  3DEO A;  2VGX B;  3FP3 A;  5D66 A;  2WMN A;  2KZT A;  4O60 A;  5FZR A;  2CHX A;  3FTS A;  1E90 A;  1YMP A;  4U0U A;  4KXK B;  3FHE A;  3O48 A;  2J9Q A;  3L54 A;  3TWS A;  4GTR A;  2BF0 X;  4XX5 A;  1ELK A;  3CVL A;  3EU5 A;  4I43 A;  4I17 A;  1DCE A;  2L9B A;  5B1B E;  3EHQ A;  5BNW A;  3CVQ A;  1SA4 A;  4GTQ A;  2R59 A;  3T5V A;  3DSU A;  4FUL A;  4F1P A;  3EHR A;  3AG1 E;  1OWN A;  5CRU A;  3QNK A;  4HOS A;  4BTA A;  3FEY A;  1TN6 A;  4D10 C;  2DYS E;  5B1A E;  2XPI A;  3ZYQ A;  4FC8 A;  3RO2 A;  3DSV A;  1PC2 A;  3L13 A;  2JLB A;  1SQM A;  3FUJ A;  1IHB A;  1O5M A;  3EUV A;  4ILI A;  2UY1 A;  1TNB A;  2WXO A;  5FIN A;  2FF4 A;  1PAQ A;  2WVI A;  3EDT B;  4RVB A;  4A3T A;  2CFU A;  3ZUV B;  1UJJ A;  1O1T A;  3Q9U C;  4XZ4 A;  3NBN B;  4GML A;  2IU1 A;  3IEG A;  3L82 A;  1YA0 A;  2ETA A;  3ULE G;  4AM9 A;  3SO8 A;  1N4Q A;  4HRL A;  4M3O A;  5EN5 D;  4FA6 A;  3V2X A;  3ASO E;  4DPR A;  3VTX A;  1OCZ E;  2Y0B G;  1LD8 A;  1IXV A;  3W9G A;  5KWD A;  2IY0 C;  2P9I G;  3ZNG A;  4U8V D;  1HE8 A;  4EPZ A;  4BX9 A;  5FJY A;  3MYV A;  5EIL A;  3T8M A;  4U8H A;  3RJV A;  4HOQ A;  4J8F A;  4I2W A;  4EZJ A;  4N5C A;  3OTN A;  2ETB A;  4L1B A;  4DLQ A;  4GA0 A;  1FVF A;  3C3R A;  4TXP A;  1MZC A;  2XPZ A;  4N3B A;  4JHK A;  3WG7 E;  5KBA A;  2E2E A;  3PUJ A;  3TWT A;  2IQC A;  4JA7 A;  3Q75 A;  5ENR D;  2J4D A;  1HG2 A;  3I4G A;  1NA3 A;  4DX5 D;  1TNU A;  3Q78 A;  1TN8 A;  3NOC D;  4FLH A;  3LY9 A;  1DNP A;  3S7D A;  5A6C A;  4N2S A;  2JAB A;  4AXH A;  3KSQ A;  4KBQ A;  3AS5 A;  3LS8 A;  4HLL A;  1O1S A;  3LDZ A;  1N0Q A;  5HS0 A;  5CBN A;  5EX3 A;  3Q9N C;  4JVS A;  4NAC A;  1WAO 1;  3ESK A;  4OVU A;  1H6O A;  1S70 B;  3BG0 B;  3RKV A;  1E7U A;  2MHK A;  4BTB A;  3PZ2 A;  3DST A;  2RG8 A;  2F8X K;  3TXN A;  2YIN A;  2I2O A;  2XEN A;  3TGO A;  2XGO A;  3MV3 B;  4LSZ E;  1OXJ A;  4LCT A;  3F6Q A;  4PUC A;  4HNA D;  1MQS A;  2X6K A;  4AV7 A;  1Z6T A;  2WXM A;  3ZEF A;  2VGX A;  3B7R L;  3ZRH A;  2H6I A;  3S2A A;  2GRR B;  4G8L A;  4BFR A;  4HOU A;  2WQH A;  2XGS A;  2XS8 A;  4EZL A;  1Q2Z A;  4I6G A;  3ZN3 A;  2P9U G;  3UIO C;  3FUM A;  1HO8 A;  1S0P A;  2OEV A;  4I6E A;  4DI4 A;  3IHV A;  3MEK A;  3FY4 A;  3E4B A;  1NI1 A;  4U0Z A;  2R5S A;  2VJ8 A;  1JWF A;  3B7U X;  4EBA G;  4FLB A;  2LUH A;  4NQ0 A;  2WXP A;  1EF1 C;  4BER A;  1KPS B;  3DPD A;  5CER B;  4GMR A;  4GA1 A;  3FTU A;  4AVX A;  4WAF A;  3CHQ A;  2R05 A;  3SNX A;  4A55 A;  3HDX A;  4AIF A;  4XE0 A;  3LCA A;  1E8Z A;  1NP7 A;  4EHM A;  4WNG A;  5J90 A;  1MX2 A;  3FUF A;  5ITZ F;  4TRQ A;  1N0R A;  2MYO A;  4L7T A;  3LJ3 A;  4JZY A;  3KSL A;  2GRP B;  3KEA A;  3SFY A;  4DRX E;  2P9N G;  4Y6W A;  4J7W A;  1V54 E;  3PS6 A;  2J08 A;  4HBD A;  5D0Q D;  2HE0 A;  5CCL A;  3FDH A;  4YDO A;  2H6H A;  2ION A;  3AG2 E;  4HI8 A;  3C72 A;  1N4S A;  2Y69 E;  3CHS A;  3CHR A;  4LNG A;  5EKQ D;  1JPL A;  4E6H A;  2XEV A;  5ENN A;  4B89 A;  5D2M C;  5G55 A;  3UKU G;  2V4L A;  3CVP A;  1TR4 A;  3BQO A;  3CHO A;  4GYO A;  1IYG A;  1BI7 B;  1HFA A;  2P9P G;  4IUL A;  4R7L A;  5G2N A;  4F7A A;  5G05 J;  5BW8 C;  5CEA A;  4LNU D;  3N71 A;  2H6F A;  3CK8 A;  3L9T A;  1OWM A;  3HXB A;  1OT8 A;  1SZ9 A;  5J08 A;  2GW1 A;  4DX1 A;  2Y1L E;  4FHK A;  2EIM E;  2WPV A;  4N39 A;  4ANX A;  1Z3X A;  3UM2 A;  4GYW A;  2GGF A;  2R03 A;  2ZIR A;  4XKB A;  4MBG A;  4YND A;  2QFC A;  5FQ7 A;  4HOT A;  3ASN E;  1FVH A;  2IOS A;  2WM9 A;  3C98 A;  4JPS A;  2XPY A;  1SA5 A;  1XGW A;  3ZXS A;  3CVX A;  4XEI G;  4GAA A;  2I1K A;  2E0I A;  5ENO D;  4M7C A;  1UW4 B;  4U07 A;  3CKC A;  2ZGG A;  4DX7 D;  3CKB A;  3Q73 A;  1EDU A;  3JXJ A;  1KT0 A;  4X8Q A;  3ABK E;  1TNY A;  3EJN A;  3BG1 B;  2YHE A;  1RZ4 A;  3DPY A;  2PQN A;  3LY7 A;  4PS7 A;  2VGY A;  5E76 A;  5FQ6 A;  4U95 D;  1QBQ A;  1QNF A;  2C2L A;  1QQE A;  4JXT A;  2P2C P;  2OND A;  4UWG A;  4CDR A;  2CG3 A;  2WB2 A;  2AJA A;  3LEW A;  3ZPJ A;  3KEZ A;  3ZW3 A;  3OXL A;  5G04 J;  4CCA A;  2F37 A;  4ME2 A;  5B3S E;  1QYM A;  1NFI E;  1NL4 A;  4OAV B;  2V0P A;  5JMN D;  1Y6I A;  3TJP A;  3D9J A;  4DK5 A;  3HXD A;  3FTV A;  4HFG A;  1A17 A;  3FH5 A;  4U0S A;  5M72 A;  3U66 A;  3DEP A;  5AQA A;  3RRU A;  1YYH A;  3MGB A;  3MKQ B;  3GZ1 A;  2DWZ A;  4NRH B;  4FAD A;  3S7B A;  3TG5 A;  3EHN A;  1U3C A;  3UUX A;  4GA2 A;  2B6C A;  1INZ A;  1BLX B;  1H2U A;  3PZ3 A;  3FU5 A;  3V2O A;  5AAO A;  4J6I A;  1N94 A;  1S64 A;  2EIJ E;  4APO A;  3UIN C;  4LG6 A;  3D9M A;  2OCC E;  3UM3 A;  4U04 A;  2WXG A;  5BXO A;  1KLX A;  3D9K A;  4AEZ C;  2J49 A;  2UWJ G;  3L22 A;  4HVB A;  3HG0 D;  1KT1 A;  2RKK A; 
#chains in the Genus database with same CATH homology
 4N2S A;  1W3B A;  1H0A A;  4GYY A;  2VSX E;  3PE3 A;  4AXH A;  4FHJ A;  4KBQ A;  3CQC B;  2A5U A;  3P2B A;  3CGH A;  4F3V A;  4J8D A;  3AS5 A;  3JCK C;  3LPZ A;  3CK9 A;  3LS8 A;  5FQ4 A;  5T4Y A;  4WUY A;  4BT9 A;  2GRM A;  5KJM A;  3RU0 A;  1JWG A;  3I3N A;  3LDZ A;  1SZA A;  1IQR A;  5EX3 A;  3UX4 A;  3SI5 A;  4MRU A;  3TL5 A;  4JVS A;  4NAC A;  5A7D B;  4MKT A;  1WAO 1;  5G05 C;  3MA5 A;  3ESK A;  5LP0 A;  4OVU A;  2KC7 A;  2MRI A;  5CMY A;  3L16 A;  3IBE A;  3AU5 A;  2PM6 A;  4GZ5 A;  3BG0 B;  3RKV A;  4J0U A;  1E7U A;  2MHK A;  4BTB A;  4I9C A;  4WWP A;  2RG8 A;  3LKU A;  4B94 A;  3MX3 A;  5LX8 A;  3TXN A;  2YIN A;  4LUN U;  4C0M A;  2QY7 A;  2I2O A;  4EQF A;  4WWO A;  1IHG A;  3ONK A;  2AWI A;  2XCC A;  3FH8 A;  3TGO A;  2PM7 A;  5JJT A;  3SHF A;  2XGO A;  3CK7 A;  3MV3 B;  3QK0 A;  4KYO B;  2KM4 A;  3AU4 A;  4DI3 A;  3TXM A;  3CIA A;  3PRZ A;  5HI7 A;  5AJD A;  1VDY A;  4LCT A;  2YQ8 A;  1IQU A;  2MOW A;  2I9C A;  4I9E A;  5C1D A;  3Q15 A;  2I1J A;  3QWP A;  4PUC A;  1EPU A;  1MQS A;  1HZ4 A;  2WMO A;  2X6K A;  2ZU6 B;  4UQX A;  4AV7 A;  1Z6T A;  2UY1 B;  4N3C A;  3RK6 A;  1GW6 A;  5DIZ A;  5BPP A;  3ZYK A;  4UWK A;  4K0R A;  4UWH A;  3JYS A;  2WXM A;  3ZEF A;  2VGX A;  3B7R L;  3ZRH A;  5AEN A;  3LVQ E;  4KVM A;  3I4R B;  3ONL A;  3S2A A;  3PVL A;  2OV8 A;  2PL2 A;  4Y6C A;  5BV0 A;  4BFR A;  3CEQ A;  5C2Y A;  4I1A A;  2YNQ A;  3MCX A;  2WXK A;  5FTP A;  4HOU A;  3SFZ A;  2WQH A;  2OVF A;  4GZ3 A;  3FU6 A;  4OYS A;  2XGS A;  2DBA A;  4JEU A;  3AS4 A;  4F53 A;  4EZL A;  2IJG X;  3HVE B;  2IOL A;  4TV3 A;  3JQ0 A;  2CHW A;  4I6G A;  3VLE A;  2HYZ A;  3BEE A;  4JA9 A;  3ENE A;  3ZN3 A;  3CVV A;  3HIZ A;  2KCL A;  2X6J A;  2L0T B;  3PNL B;  4CT0 A;  3VLF A;  3FUM A;  5T8I A;  4NUR A;  3SBS A;  5ARG A;  2FUL A;  1HO8 A;  4KZ0 A;  4HXI A;  1S0P A;  3FU0 A;  4Q94 A;  4W9R A;  4CRW A;  4K03 A;  4IYP A;  4JC8 A;  4DJA A;  4GMJ A;  4I6E A;  3Q5M A;  3B7S A;  4RSY A;  3HYM B;  4MS6 A;  4DI4 A;  2J09 A;  2V5F A;  3R9A B;  2X3M A;  3CHM A;  3FU3 A;  5E75 A;  3IHV A;  3OAW A;  4AOF A;  2RD0 A;  3U4T A;  4DLO A;  4IRU A;  3ZGQ A;  3OXF A;  2J4B A;  3MEK A;  3FY4 A;  2XRZ A;  3UT7 A;  4F1S A;  5FT9 A;  4AP2 A;  2V8S E;  3SF4 A;  5T3R A;  3E4B A;  5ARF A;  4BSX A;  1ELW A;  3CVW A;  3PH0 C;  3APD A;  4G11 A;  4U0Z A;  3S7J A;  4EEC A;  2BTD A;  4B8C B;  1DVP A;  3QAR A;  2R5S A;  2VJ8 A;  1JWF A;  3B7U X;  2X38 A;  4LRZ A;  5CHE E;  4EBA G;  2VTB A;  3CVY A;  4TUU A;  4A1G A;  4FLB A;  3ASF A;  4FJZ A;  1E8X A;  1WY6 A;  4NQ0 A;  2GRL A;  3FFL A;  4FJY A;  4I1O B;  2WXP A;  4UWL A;  1EF1 C;  2WQ7 A;  3APC A;  3FWV A;  4J8S A;  3CQG B;  1P5Q A;  3ZFW A;  3FTY A;  5EDS A;  3DPD A;  3CSF A;  1Y8M A;  2C0M A;  5G04 C;  3U9W A;  4CEM A;  4GA1 A;  2PQR A;  4GPK A;  4I1M A;  1NZN A;  4KMO A;  2Y3A A;  3FTU A;  4AVX A;  2IFU A;  3GZS A;  4WAF A;  3CHQ A;  3SNX A;  4UQZ A;  4A55 A;  3HDX A;  4AIF A;  3L08 A;  2AXZ A;  3SGH A;  4XE0 A;  3JQ1 A;  3LCA A;  4EZK A;  1E8Z A;  3MZL B;  2I6H A;  3ML8 A;  3PEV B;  5FWQ A;  1EYH A;  1H2T C;  4ANW A;  3D9P A;  1NP7 A;  4I2Z A;  3SD5 A;  4WNG A;  3FUI A;  4WWN A;  5JJ6 A;  5J90 A;  3FUF A;  1FCH A;  4TRQ A;  4L7T A;  4CDN A;  4GZC A;  3KAE A;  3LJ3 A;  3ZHE B;  4ILG A;  4JZY A;  2L6J A;  4N3A A;  3FUE A;  1HXI A;  4QFV A;  3UT8 A;  4CGV A;  4AY6 A;  2YHC A;  1U3D A;  4ABN A;  3G2U A;  3KD7 A;  4Y6W A;  3FTZ A;  4Q96 A;  4P29 A;  3S7F A;  4BWR A;  2LAI A;  2J07 A;  3PE4 A;  3PS6 A;  3EIQ C;  3FTX A;  1TJC A;  2CHZ A;  4XI9 A;  2J08 A;  2Q7F A;  5A23 A;  5D0Q D;  1JUQ A;  4GZ6 A;  5CCL A;  3RRN B;  4H7Y A;  3G2S A;  3ZYM A;  5AJL A;  3FDH A;  1OWP A;  4G24 A;  4LEU A;  5ANR A;  2ION A;  3FUL A;  5LCW J;  3HHM A;  3DBS A;  4G26 A;  2LNI A;  2EQX A;  3L6A A;  2WXQ A;  1NA0 A;  2DCP A;  3CHS A;  2C0L A;  4WNF A;  3CHR A;  5EKQ D;  1JPL A;  4UI9 J;  4E6H A;  3CLJ A;  2XEV A;  5ENN A;  4B89 A;  3QB2 A;  3OXG A;  4APF A;  4JEH A;  2NSZ A;  3CHP A;  3MKQ A;  3B7T A;  5G55 A;  5KJK A;  2Y4T A;  1ELR A;  3ZIM A;  2V4L A;  2LAH A;  2VQ2 A;  2WXH A;  4G25 A;  1HH8 A;  3APF A;  3CVP A;  5JHA A;  3CHO A;  3UQ3 A;  4UQY A;  3GZ2 A;  4J8E A;  4GYO A;  3AS8 A;  4E85 A;  1IYG A;  3PZD A;  4PS8 A;  1HFA A;  3UMV A;  1UJK A;  1UN8 A;  2HM8 A;  2WXL A;  3ASD A;  3QWV A;  5KCM A;  3VTY A;  1QZ2 A;  3VLD A;  4IUL A;  5JHB A;  1OWO A;  4R7L A;  3U3W A;  5G2N A;  4F7A A;  5G05 J;  4C0E A;  5BW8 C;  1LF8 A;  5ANL A;  3EHM A;  2A4Z A;  2XGM A;  3N71 A;  3CK8 A;  1E8W A;  2LSV A;  3B13 A;  3K9I A;  3QKY A;  4GZD A;  1OWM A;  1E96 B;  3LXU X;  2VSY A;  1MHQ A;  3R7Q A;  5KJL A;  4ACK A;  2LO6 A;  2R17 C;  4CGW A;  1TJF A;  2VYI A;  4KVO A;  3FH7 A;  5LOZ A;  4CDM A;  2XQ0 A;  4BX8 A;  1H19 A;  4XIF A;  2VGX B;  1SZ9 A;  3FP3 A;  4JL0 A;  2WMN A;  5J08 A;  3FUK A;  2GW1 A;  2WXI A;  3GW4 A;  4UWF A;  2KZT A;  5BT1 A;  5FZR A;  4WNE A;  4FHK A;  4OVV A;  5KJN A;  2CHX A;  1N54 A;  1E90 A;  3FTS A;  2WPV A;  3FUD A;  3LY8 A;  4U0U A;  4N39 A;  4RG6 A;  4G23 A;  3ASH A;  4KXK B;  3FHE A;  1Z3X A;  2J9Q A;  3L54 A;  3O48 A;  4ANX A;  5JJ7 A;  4GYW A;  4PDX A;  5CCM A;  3FUH A;  2BF0 X;  4XX5 A;  1ELK A;  2GGF A;  3LVR E;  3CVL A;  4BT8 A;  3SBT B;  2WXR A;  3UT4 A;  4I43 A;  3MV2 B;  4XKB A;  5AIJ A;  1E8Y A;  1H6K A;  2M63 A;  2VSN A;  3D9I A;  3FEX A;  4KT6 B;  4I17 A;  4G2V A;  2FO7 A;  5LFA A;  2CFZ A;  1B89 A;  3NF1 A;  1H2V C;  2AXU A;  2L9B A;  4FU3 A;  5BNW A;  4YND A;  3CVQ A;  3CST A;  3IKO B;  3GYZ A;  2R59 A;  4URK A;  4RG9 A;  3T5V A;  3TAX A;  3UPV A;  2QFC A;  5FQ7 A;  2WXN A;  4XI0 A;  4FUL A;  4HOT A;  3CVU A;  4N2Q A;  3MJW A;  4FP7 A;  1OWN A;  3ML9 A;  3QJZ A;  3NQP A;  1FVH A;  3D9L A;  2IOS A;  2WM9 A;  3C98 A;  2OVB A;  4JPS A;  2XPY A;  3QNK A;  4IN3 B;  2IF4 A;  3ULQ A;  1XGW A;  2AXV A;  3ZXS A;  4EBA A;  4BTA A;  4HOS A;  4ACL A;  3CVX A;  2LSU A;  1BPO A;  4G1T A;  1XNF A;  4GAA A;  3FEY A;  2I1K A;  2E0I A;  4GU5 A;  2P58 C;  5FZQ A;  2FI7 A;  3D9O A;  4D10 C;  1UW4 B;  4U07 A;  3NZU A;  3L17 A;  3CKC A;  3G2T A;  4U63 A;  4YVO A;  3Q47 B;  2NXP A;  1L5J A;  2XPI A;  2VTB B;  4PH4 B;  3ZYQ A;  5BV1 A;  2VSO E;  2WXJ A;  1OWL A;  3NZS A;  1PY1 A;  3FUN A;  4FC8 A;  4L2Y A;  3CKB A;  3RO2 A;  5BUZ A;  1ZBP A;  3CV0 A;  1PC2 A;  3TG4 A;  5CMW A;  3L13 A;  2JLB A;  3ESL A;  3IV0 A;  2NC9 A;  3G2W A;  1EDU A;  1SQM A;  1KT0 A;  3EJN A;  3BG1 B;  2YHE A;  3FUJ A;  3ZYL A;  4XKC A;  3SZ7 A;  3FTW A;  4ILI A;  2PQN A;  2X6F A;  2UY1 A;  4JHR A;  1HG5 A;  2KCV A;  2WXO A;  3LY7 A;  4L23 A;  2FF4 A;  2VGY A;  4PS7 A;  1PAQ A;  2WVI A;  3EDT B;  4RVB A;  3U64 A;  2CFU A;  5E76 A;  4A3T A;  1HU3 A;  5FQ6 A;  1UG3 A;  1UJJ A;  4L2L A;  3RIB A;  2KCK A;  1QNF A;  2C2L A;  4Q69 A;  3RRM B;  1QQE A;  4JXT A;  4XZ4 A;  3R7R A;  2OND A;  3PRE A;  1TEZ A;  4UWG A;  4GML A;  5DBK A;  4CDR A;  1X5B A;  2IU1 A;  3JUI A;  3KS2 A;  1Z3Y A;  2CG3 A;  2WB2 A;  3IEG A;  2WXF A;  4KZC A;  4HOR A;  3LEW A;  1YA0 A;  4HLE A;  3PNT B;  5EX0 A;  2AW6 A;  3ZPJ A;  3KEZ A;  4AJW A;  3ZW3 A;  3OXL A;  4AM9 A;  3I5P A;  2AVP A;  3HVE A;  2X6H A;  5G04 J;  4M3O A;  4CCA A;  4ME2 A;  2HR2 A;  3PEU B;  2JEK A;  4FA6 A;  1N52 A;  4C9B B;  4UI9 K;  4A3V A;  3QWW A;  4DPR A;  4PS3 A;  3VTX A;  2V0P A;  1Y6I A;  3TJP A;  3MKR A;  1OUV A;  3D9J A;  4DK5 A;  3RO3 A;  4I6J A;  3IHY A;  4WND A;  3FTV A;  2DIW A;  2OOE A;  3D3M A;  4ILH B;  3T5X A;  4GCN A;  1HX8 A;  3CR3 A;  5FQ8 A;  4HFG A;  1A17 A;  3FH5 A;  4B8A A;  4U0S A;  5M72 A;  1HF8 A;  3U66 A;  3EIJ A;  2XRY A;  3RRU A;  1ZU2 A;  1HE8 A;  2XHE A;  1HS6 A;  3MGB A;  3P1U A;  4ANV A;  4B0Z A;  1WM5 A;  3MKQ B;  4LER A;  5D0O D;  4EPZ A;  2FBN A;  2PZI A;  3GZ1 A;  4BX9 A;  5FJY A;  3MYV A;  4NRH B;  4FAD A;  3QAQ A;  3S7B A;  3Q49 B;  3TG5 A;  3EHN A;  3T8M A;  4U8H A;  1U3C A;  1UN9 A;  3RJV A;  4HOQ A;  4J8F A;  2HO1 A;  4I2W A;  4EZJ A;  2KAT A;  3UUX A;  4N5C A;  4GA2 A;  2BUG A;  3OTN A;  3G2V A;  1INZ A;  4L1B A;  2X6I A;  4DLQ A;  1H2U A;  3Q4A B;  1FVF A;  4GA0 A;  2Y4U A;  4HS2 A;  3FU5 A;  4YVQ C;  3QOU A;  2XPZ A;  4J6I A;  4N3B A;  5AYW D;  4JHK A;  3PUK A;  2E2E A;  3URZ A;  1E7V A;  2L0I A;  4APO A;  3WXX A;  3LYA A;  3PUJ A;  4ANU A;  3QC1 A;  2IQC A;  3CVN A;  4JA7 A;  3D9M A;  4H7X A;  2ILR A;  4GCO A;  2CG2 A;  4U04 A;  4MLP A;  5HQ8 A;  2WXG A;  5LCW C;  1KLX A;  4O6F A;  4JHJ A;  4JW1 A;  2XCB A;  1HG2 A;  2J4D A;  2KZT B;  1NA3 A;  3D9K A;  3I4G A;  3PDN A;  4AEZ C;  2WQ6 A;  5FZS A;  2FEZ A;  4GB9 A;  3ZHE A;  2J49 A;  3D9N A;  3ZVV A;  2UWJ G;  4UI9 C;  3L22 A;  4CT4 A;  4FLH A;  3ASG A;  3O4Z A;  4V3I A;  4AY5 A;  4BY6 A;  4HVB A;  3LY9 A;  4ATG A;  3QDN A;  4A1S A;  1DNP A;  1KT1 A;  3S7D A;  5A6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...