5CHEE

Crystal structure of arabidopsis glutamyl-trna reductase in complex with its regulatory proteins
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
119
structure length
119
Chain Sequence
EPKKQELISKLKTGKTFLRNQEPEKAYTEFKIALELAQSLKDPTEEKKAARGLGASLQRQGKYREAIQYHSMVLAISKRESEDSGITEAYGAIADCYTELGDLEKAGKFYDTYIARLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Arabidopsis glutamyl-tRNA reductase (GluTR) forms a ternary complex with FLU and GluTR-binding protein
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords Glutamyl-tRNA reductase 1, chloroplastic
total genus 47
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5cheE00
2FO7A 3JYSA 2PZIA 4XI0A 4UI9C 4GA0A 3MA5A 1QZ2A 4WUYA 4GA1A 3TG4A 2XGSA 5DIZA 3U4TA 3E4BA 2VYIA 3CV0A 4BTAA 5JJTA 2KC7A 2XCCA 2J9QA 2FEZA 2ONDA 3GYZA 3RKVA 4U07A 4BT9A 1E96B 3TGOA 3PE4A 1Y8MA 4XI9A 3QKYA 3LYAA 3LKUA 2LNIA 3WXXA 1KT1A 3HYMB 4GA2A 3KS2A 4KYOB 1W3BA 1ZU2A 5KJMA 3QWVA 4WNDA 2P58C 4LEUA 5HI7A 5DBKA 2GW1A 2FI7A 3ASHA 4AIFA 4UQYA 4HOTA 2VSNA 2WPVA 5G05C 5HQ8A 2XCBA 3PDNA 2VGXA 2C0MA 3EDTB 4G24A 4G26A 4HORA 3OXFA 3QWPA 3MKRA 3S7DA 3UUXA 3ZFWA 1NA0A 5CCMA 3ASDA 5KJKA 4GPKA 5LCWC 4UQXA 4H7XA 4N3AA 4WNGA 1ELWA 1NA3A 3UQ3A 5G04C 3N71A 3CK7A 4Y6WA 4IN3B 2XPIA 2Y4UA 3ZHEB 1KLXA 5FT9A 3LY8A 2Y4TA 2KATA 5BT1A 4G23A 5LCWJ 2L6JA 2KCVA 1NZNA 5A6CA 3OXGA 4ME2A 5FJYA 5ARFA 3PE3A 4WNFA 3ZPJA 3RJVA 1IHGA 2XGMA 2Q7FA 2YHCA 4JL0A 4J0UA 2UWJG 4RG6A 1YA0A 3ESKA 4N2SA 2PQNA 3CEQA 3LPZA 4RG9A 5A7DB 2I6HA 5EKQD 4JA9A 5G04J 3S7FA 3SZ7A 3MV2B 3ZN3A 4GZ3A 3S7BA 4JHRA 1XNFA 2LSVA 4APOA 3RO2A 5C1DA 3VTXA 5JJ6A 3UPVA 2JLBA 4BWRA 3TAXA 4YNDA 3Q4AB 2E2EA 3CK9A 2FBNA 4AY5A 4G25A 4G1TA 1P5QA 3AS8A 2AVPA 3RU0A 5FZSA 5FZRA 4BT8A 4WNEA 2DBAA 1TJCA 2HR2A 2FF4A 2PQRA 3K9IA 2MHKA 5KJLA 4YVOA 5JJ7A 3R9AB 3FP3A 4GZ5A 1B89A 2IFUA 3CVNA 4U0UA 4GYYA 1ELRA 1QQEA 4N3CA 4I1AA 3GZ2A 3OXLA 4HOSA 4B94A 4XIFA 2IF4A 4O6FA 3MEKA 5FZQA 4U0ZA 3CKCA 4GCOA 4UQZA 1KT0A 3AS4A 4KXKB 5FTPA 5CCLA 2UY1B 2QFCA 3Q47B 4GYOA 5D0QD 2HO1A 4A1SA 3BEEA 2C2LA 2LSUA 4W9RA 3Q49B 4I17A 3MV3B 3AS5A 4G2VA 4GYWA 4HOQA 3ULQA 3ZGQA 4YVQC 3ASGA 4JA7A 1WAO1 5G05J 4H7YA 4J8EA 3GW4A 5KJNA 3LY7A 1HH8A 3RIBA 1OUVA 2WQHA 5ARGA 3S7JA 5M72A 3CKBA 3TG5A 4CGVA 1HXIA 4CGWA 1IYGA 3VTYA 4I9CA 4N2QA 4KBQA 4I2WA 3RO3A 5EX3A 4HOUA 5AYWD 1PC2A 2PL2A 3CVLA 2OOEA 3FFLA 4J8FA 4NRHB 4Y6CA 2BUGA 4CDRA 3Q15A 3QOUA 4N3BA 3Q5MA 4U0SA 2YQ8A 3LCAA 3QWWA 1A17A 3QDNA 4U04A 3NF1A 3CVPA 4UI9J 4ABNA 3ZHEA 2XGOA 3KD7A 3URZA 5BNWA 4GCNA 3LY9A 3CK8A 3ASFA 2UY1A 3GZ1A 4N39A 4EQFA 1FCHA 2KCLA 4F3VA 2R5SA 2C0LA 5CHEE 2VQ2A 2VGYA 3KAEA 5D0OD 2KCKA 3SF4A 4N5CA 5BW8C 3U3WA 4J8DA 2XEVA 3O48A 2VGXB 5EX0A 4UI9K 4I9EA 1WM5A 4I2ZA 3CVQA 4AY6A 4GZ6A 3FWVA 1HZ4A 2HYZA 4NQ0A 1ZBPA 4AM9A 2VSYA 2NC9A 3IEGA 4BTBA 2V5FA
chains in the Genus database with same CATH superfamily
2X6FA 3QJZA 1U3DA 3ULEG 3DEPA 1Y8MA 5JMND 2WM9A 1EYHA 3PRZA 3FH7A 4EECA 3FHEA 2WQ6A 2R2LA 2EQXA 3EDTB 4G24A 3ZFWA 3G2VA 1NL4A 4DK5A 1D8EA 1LD7A 2GRMA 5LCWJ 5C2YA 4WNFA 1O1TA 3FDHA 4L1BA 2VSXE 1DCEA 5CRUA 2GRRB 2X6HA 4CEMA 2V4HC 3D9IA 4GMLA 3QK0A 4FJYA 2FF4A 4KZCA 3CHMA 3C3QA 4OYSA 5T3RA 3VLFA 4C9BB 3V31A 2IF4A 3OAWA 2XRYA 3PZ4A 3W9FA 3B13A 3BEEA 1S63A 4G8KA 2AWIA 3BQOA 1WAO1 3FH8A 1Y6IA 4WWPA 1U2VG 4GTPA 4BT8A 5BPPA 4OVVA 4AJWA 5LOZA 1FCHA 2J09A 4OAUC 4TRQA 4WWOA 3AG3E 3UX4A 2DYRE 1OXJA 2VSYA 3PREA 5B1BE 4I6EA 1U3CA 1QZ2A 2DYSE 4PS8A 3D9KA 2L6BA 4C0EA 4E85A 1OCOE 1W3BA 4FA6A 5ANRA 2GW1A 4V3IA 3FTWA 4U95D 1S0PA 3KSQA 5BT1A 2L6JA 5ENSD 5A6CA 1IHGA 3BUAA 5EDSA 3PVLA 4P29A 4GZ3A 5KNHD 2JLBA 5J90A 3EU5A 3IBEA 1QQEA 4BSZB 3UXGA 3OXLA 2HE0A 3SFXA 4B94A 1X5BA 4L2YA 4HFGA 5FZQA 4U0ZA 4GCOA 2YNQA 4HLEA 2QFCA 3BG0B 3Q49B 4IYPA 4GYWA 2L0IA 3ZYKA 3FUFA 2X6JA 3D3MA 3FTUA 4EZJA 4U7EB 3FUKA 1N54A 1MHQA 3EUVA 2CFUA 3HG0D 4Q96A 4J7WA 5D0OD 2HM8A 1Z3YA 3FUNA 2IOLA 2NC9A 2V5FA 2XHEA 3DSVA 2J08A 2FO1E 4EZKA 1SZ9A 2X38A 3CVUA 4I1MA 4XI9A 3QKYA 1KT1A 3EHNA 3DSTA 4LEUA 4PS7A 2WPVA 3T8KA 3S7DA 4FULA 4N3AA 4HRLA 4XX5A 2GRLA 1UW4B 2F8XK 4TUMA 3FU0A 2GROB 2XZTG 2PQNA 3S7FA 1H0AA 5EKQD 4LUNU 1HG2A 2GRPB 1AWCB 2PNNA 3PZ2A 4HNAD 2E2EA 4G25A 4O1PA 5CBNA 3V2XA 4HVBA 2IO2C 3MKQA 2XEEA 3GZ2A 4HOSA 3PZDA 2F0YA 2LAHA 3RSEG 2QYJA 3ULQA 3ASGA 4F1SA 3ZVVA 2J4DA 3LXUX 2EIJE 3QOUA 3APFA 3ZHEA 3CK8A 2UY1A 4FHKA 4ILGA 2Y1LE 1FVFA 4M3OA 4BETA 4R7LA 4N5CA 3HDXA 1HU3A 1ZBPA 2JABA 5AENA 4HI9A 3DRAA 2PZIA 2RG8A 2WXHA 4BTAA 3FEXA 3TWTA 3TWUA 1TJFA 3JUIA 4GAAA 1ZU2A 2BF0X 4WNDA 3LVQE 4U96D 2RKKA 4EBAG 2VSNA 4MRUA 2C0MA 3UQ3A 4URKA 1HE8A 5G04C 1N4QA 2XPIA 2Y4UA 4A55A 3AAAC 3MGBA 4KT6B 3SNXA 2XGMA 1EDUA 5G04J 4HS2A 4LSZE 5D66A 3ZN3A 4ANUA 3SHFA 1JUQA 4B93B 4AY5A 2DVWA 4DJAA 3AS8A 2XEHA 4CDMA 3K9IA 5AJDA 4B8AA 1HS6A 2XS1A 3CSFA 5ANLA 4XIFA 1H19A 1E8ZA 2I2OA 3CHOA 5E76A 2OVFA 2WMNA 2UY1B 3IV0A 2LO6A 4FJZA 3L82A 1FT2A 2LSUA 3MV3B 4HOQA 1OCCE 3ISMC 3L54A 1OUVA 1TNYA 4CGVA 1HXIA 3QNKA 4I9CA 4HLLA 2BUGA 2KXPC 2Y3AA 2OCCE 1A17A 1NP7A 3URZA 5G55A 2C0LA 2VQ2A 2QZAA 2KBXA 4KZ0A 3CVQA 2DCPA 4AY6A 4GZ6A 3DPYA 4BTBA 4UWLA 4XI0A 1BLXB 5FQ7A 2LAIA 4F6RD 3CVYA 1TN7A 2BKKB 3GYZA 3RKVA 1N94A 3LKUA 3WXXA 2KZTB 1DVPA 2EILE 3ASHA 3R7QA 5HQ8A 3TWXA 3Q75A 4F53A 3HXEA 2IEJA 1FT1A 2WMOA 3AG4E 3GZSA 3UM0A 2AXVA 3PNLB 3U66A 1XNFA 3MZLB 3VTXA 2XPYA 5LP0A 1SA5A 4K0RA 2DZNA 4GMJA 2WQ7A 3RRUA 5ENOD 3AU4A 5AQAA 5AARA 2R59A 1UJJA 2ZGGA 4A1SA 2GRQB 4APFA 1H2VC 5FQ8A 4UWHA 4JEUA 3GW4A 1IQUA 3LY7A 5BV1A 1N4PA 1ELKA 1GW6A 1PC2A 4CDNA 4J8FA 4CDRA 3TWVA 2R17C 4EZLA 3Q5MA 4AP2A 2ILRA 1OWMA 1K1AA 2AXZA 1DC2A 1H6OA 1N95A 5CMWA 1N9AA 3ASFA 1HO8A 4N39A 3P1UA 3ZIMA 3CHRA 1WM5A 5FIOA 4G8LA 3DXMG 1X81A 3ABKE 4FC8A 1LD8A 4BFRA 4CT0A 5AAOA 5J08A 2P9SG 3OTNA 4NACA 2V5QC 3DXKG 1E96B 3CHQA 3FTVA 2WXRA 4G11A 3UI2A 2WXJA 2L0TB 3IHVA 3QWPA 3UUXA 3D9PA 1UOHA 2PM7A 2CHXA 3RK6A 2Y0BG 5T8IA 3FTYA 5T4YA 3LPZA 5JHAA 5AQBA 4L2LA 2VJ8A 3E32A 1OWNA 3FUDA 3RO2A 1SA4A 3SGHA 1MX6A 3G2UA 4PH4B 3Q4AB 3E33A 1QYMA 3JXIA 2DBAA 2WXOA 3Q73A 5HS0A 3MEKA 4Z68A 3AU5A 3ZNGA 4KXKB 4GZDA 5CCLA 1N4RA 4IULA 3TWRA 3CHPA 3UIPC 1UG3A 4XZ4A 3FTSA 1UN8A 2OVBA 2KZTA 2NYJA 3AG1E 2YQ8A 4JVSA 3L08A 3UKUG 4J8YA 4QFVA 1E90A 4BEPA 3FWVA 4F1PA 4ATGA 1ZB1A 2AJAA 2FO7A 2VYIA 2XCCA 4LG6A 2BEDA 5ENPD 3PE4A 3LYAA 4PDXA 1O1SA 3ZKJA 4FHJA 4G26A 5CCMA 3NOGD 3N71A 2IO3C 3EIJA 2NXPA 3MCXA 4CT4A 4RLYA 5FJYA 5ENTD 2WXLA 4J0UA 5BUZA 4N2SA 2I6HA 4LRZA 3UTMA 3LJ3A 4G1TA 3R9AB 1N11A 2I9CA 3D9MA 5ITZF 3PZ1A 4QQIA 3J5PA 2YHEA 3UIOC 2HO1A 2Y69E 3ASOE 5G05J 5CECB 3TG5A 5KNGA 2ZU6B 1UJKA 4XKBA 1MX4A 1S64A 3AJIA 5CEAA 1IYGA 3CVPA 4UI9J 5IY5E 2WXQA 5CHEE 5FQ6A 3O48A 4LNUD 4GTRA 4JHKA 4UI9C 3PH0C 3I4GA 3QAQA 1H6PA 1PAQA 2J9QA 4BT9A 4DX5D 3HXCA 4EBAA 3KS2A 3QWVA 2R03A 2I1KA 4AIFA 5G05C 1FPPA 1NA0A 2B0OE 2FULA 4M7CA 4ILIA 3EHRA 2MRIA 5KBAA 4RSYA 3HXBA 3RJVA 2EIME 2UWJG 4JA9A 3B7TA 2IJGX 3FTXA 4C0MA 3DSWA 2XQ0A 3KEZA 5HKPA 1P5QA 5FZSA 3CR3A 5JJ7A 4ANWA 1SVXA 3T9KA 1MZCA 4ACLA 4UQZA 1L5JA 3SFZA 1YMPA 2GGFA 2P9KG 4G2VA 4K5BA 1JCRA 1NI1A 3UT8A 4H7YA 1WG0A 4J8EA 5KJNA 1BI8B 3UPVA 2PM6A 5M72A 2AXUA 4E6HA 4U0SA 4ABNA 2XENA 4J6IA 1LTXA 5EIDA 1TN6A 4EQFA 5G2NA 3KAEA 3ESLA 1TN8A 3APDA 3I4RB 4JC8A 4AM9A 4DPRA 3ABME 2CG3A 2ZGDA 5JJTA 5FQ4A 4NURA 4U07A 5BXOA 2WXGA 3S2AA 5KJMA 2P58C 4GU5A 1UN9A 2OEWA 4UQYA 1D8DA 2ZIRA 3FH5A 3EJNA 3QB2A 3JCKC 4WNGA 1KPSB 2WXKA 1E7VA 4U8HA 3ZHEB 4EPZA 3OXGA 3PE3A 4JL0A 4XEIG 3KEAA 3RRMB 4FLBA 5C1DA 2WVIA 3LEWA 2DWZA 3RU0A 2X3MA 4B0ZA 5KJLA 4GZ5A 4U0UA 1K1BA 3G2TA 4AEZC 3D9NA 5FTPA 3Q47B 3BG1B 3FUMA 1BI7B 3B7UX 1HH8A 3JQ0A 3ZEFA 3MX3A 4N3BA 3FUIA 3NF1A 1TNBA 3LY9A 4DX6D 4UWGA 3TWSA 4GPKA 3SF4A 3CQGB 4RVBA 4DI3A 2LXMA 4HRNA 3ZYQA 2E0IA 3ZYLA 2MOWA 3B7SA 1KZOA 2WXNA 3LS8A 2FEZA 5EYPF 3CLJA 3U3WA 5HI7A 4F7AA 3MKRA 3FUJA 4X8QA 4LERA 1HFAA 3CK7A 3FU6A 4FLHA 5CEDB 5JA4D 4JB8P 2CHZA 2Q7FA 4PS3A 4RG6A 3ZW3A 4Q69A 3HVEA 1MYOA 1SQMA 4JHRA 5JJ6A 3Q9UC 4TXPA 2RD0A 1BPOA 2FBNA 4WNEA 3L16A 4YVOA 4D10C 3FP3A 3B7RL 3E34A 3ZUVB 3C5RA 3EHMA 2BTDA 3NQPA 4GTQA 2WXFA 3WG7E 3LJNA 4IRUA 4HQDA 5ARGA 2H6FA 3HVEB 2M63A 4GTTA 1JCQA 2X6IA 2P2CP 3Q15A 4U04A 3QDNA 3KD7A 1PY1A 3DPDA 1OWLA 4N5QA 1SZAA 2CFZA 2LUHA 5FINA 5BW8C 1O5MA 2WXIA 3CQCB 4I6GA 4I9EA 3NBNB 1HZ4A 1JWGA 4JXTA 2XPZA 3MA5A 3DEOA 3U4TA 3ZU7B 5JHBA 3HYMB 4HOTA 1BD8A 2VGXA 4JZYA 4HORA 4GTMA 4ZFHA 5KJKA 4DI4A 2WXMA 4Y6WA 5FT9A 4C48B 3HRAA 4G23A 3ABLE 2KCVA 5ARFA 1H2UA 3IHYA 5AQ7A 4APOA 4U8VD 4BWRA 3CK9A 1E7UA 1S70B 1KZPA 3VLEA 4L23A 2F8YA 3R9MA 3SD5A 4N3CA 3U64A 2X6KA 4I43A 2H6GA 4BX8A 3Q9NC 4OAVB 3AS4A 4GYOA 2IONA 3NAWA 2J49A 1N0QA 3PEUB 3S7JA 2WQHA 3UT4A 4UWKA 3T5VA 3RO3A 3NZSA 5AYWD 4Y6CA 5B3SE 3APCA 5AN8A 3LCAA 4YDEA 1IQRA 3L9TA 2XRZA 3L17A 4TUUA 4J8DA 3F6QA 1INZA 2P9IG 5H7PA 4GTOA 3SFYA 4B89A 3KSLA 3JYSA 4GA0A 4HB5A 3E4BA 3DSXA 3SO8A 4MLPA 3UT7A 1YCSB 3EU9A 3DWLG 1HX8A 4O60A 3RRNB 3Q7FA 1OCRE 4K5CA 4YDOA 2P9UG 5LCWC 1ELWA 2GRNB 5KWDA 5EN5D 4KVOA 4IN3B 4PUCA 3HXFA 4ME2A 4AXHA 1DCQA 4CYMD 4TV3A 1Z3XA 5ENQD 3CIAA 4DX1A 3JUEA 4DUIA 4GB9A 4YNDA 4GPMA 1JCSA 2J8SD 3G2SA 4OVUA 2MHKA 1WY6A 3CVNA 1MX2A 4O1OA 1XGWA 2BKGA 1IKND 3NZUA 2NSZA 5EYLA 3LDZA 3C98A 2WXPA 3HHMA 4I17A 3JQ1A 1QNFA 4ILHB 4YVQC 5ENRD 3ZXPA 3SI5A 3VTYA 3L13A 4JD2G 3V30A 2WB2A 4NRHB 4AVXA 2ZXWE 5BNWA 3TXMA 3ONLA 2XZDG 3AG2E 3FU5A 4BESA 3TWWA 1JWFA 5BV0A 2H6HA 2VGXB 3TXNA 4A63B 3TG4A 4GA1A 3CVWA 2P9PG 4LCTA 2XGSA 4A3TA 5DIZA 3QARA 2ONDA 2LNIA 5HRYA 4KYOB 4GA2A 2V4LA 4I1OB 3UKRG 5DBKA 1MQSA 4GZCA 2XCBA 3OXFA 3ASDA 4MBGA 1QBQA 4H7XA 3CHSA 2KATA 3ZRHA 2YINA 1NZNA 3B95A 3ESKA 3CEQA 5A7DB 2LSVA 2JEKA 4U63A 1NFIE 5D2MC 1E8YA 3V79K 3Q79A 1TJCA 3PUKA 4GYYA 1ELRA 2A5UA 3Q78A 3MJWA 5AIJA 3IXEA 4O6FA 2ETBA 3JXJA 5B1AE 1KT0A 2OV8A 3T8MA 2P9LG 4ANVA 3C72A 3ZGQA 3ZXSA 2L9BA 1OWOA 2ETAA 4JW1A 3ML8A 1AP7A 2ZISA 4HOUA 2PL2A 3CVLA 3L22A 1O1RA 4K5AB 3TJPA 2CG2A 1IHBA 1TYQG 2HYZA 5EIBE 4J8SA 3SZ7A 4BERA 4I6JA 1Q2ZA 4JHJA 2KC7A 3TGOA 2LXLA 4GMRA 1OCZE 2FI7A 4U8YD 4BX9A 4BY6A 3BU8A 3CVXA 2P9NG 4B8CB 2QY7A 3MKQB 1NA3A 1E8WA 1WDYA 4GTSA 4BSXA 3FEYA 3LY8A 2QYUA 1N4SA 2YHCA 1VDYA 2DZOA 4RG9A 3MV2B 5CERB 4Q94A 4LNGA 2ETCA 3UINC 2VTBB 2PQRA 3HIZA 3HXDA 4WWNA 3D9JA 3ML9A 1RW2A 3FUEA 1EPUA 1DNPA 2A4ZA 5D0QD 2RFMA 3FTZA 4W9RA 2C2LA 3DSSA 3UM1A 3QC1A 1N0RA 4JA7A 3SY2A 3CKBA 5AQ9A 3PNTB 4UWFA 2OOEA 4CCAA 3QWWA 4HI8A 3L6AA 4UUCA 3VLDA 2XGOA 2F37A 1EF1C 3FU3A 4GCNA 3X2QE 4ZHBA 3CGHA 3GZ1A 4F3VA 4FADA 3U9WA 3P2BA 3PEVB 4UI9K 1OWPA 4MKTA 3ENEA 2IU1A 2VTBA 2DIWA 4DLOA 1Z5SC 2R02A 3CV0A 4K03A 4EHMA 3Q7AA 1FVHA 4LNBA 2A5EA 4ACKA 3E37A 4UQXA 4CRWA 1E8XA 1KLXA 3E30A 3I3NA 3IKOB 1YYHA 3W9GA 1YA0A 2IY0C 2IOSA 1RZ4A 4L9PA 3G2WA 4XKCA 4DLQA 5E75A 2H6IA 3ASNE 3TAXA 3V2OA 2CHWA 1H2TC 4HXIA 3T5XA 2AVPA 3B7BA 2J4BA 1A5EA 2KM4A 2IFUA 3C3OA 4MS6A 4I1AA 2XS8A 3ULYA 3FY4A 4WAFA 4KMOA 4JEHA 4GTVA 3D9HA 5AJLA 5LFAA 1TR4A 3EIQC 1MJ0A 3RIBA 1LF8A 2MYOA 3CVVA 1TNOA 4N2QA 4KBQA 5EX3A 3SQVA 2J07A 3FFLA 3I5PA 4CZ2D 1TNUA 4FU3A 3UMVA 4HBDA 4XE0A 4NIKA 2R5SA 2VGYA 2KCKA 3NOCD 3D9LA 4NQ0A 2AW6A 3PS6A 3TWQA 3IEGA 1OT8A 3DBSA 3SBSA 3UM2A 2RFAA 1D9SA 4WUYA 3NB2A 1Z6TA 3DSUA 1JPLA 3UM3A 1K8KG 5BXUA 3PZ3A 1TEZA 5KCMA 3J5QB 5A23A 4TXRA 3CSTA 1SW6A 2QC9A 3PDNA 3ONKA 4ANXA 4RQIA 1K3ZD 1V55E 4AOFA 2VGEA 2EINE 2Y4TA 2B6CA 3SBTB 2V0PA 4TXQA 3O4ZA 4AV7A 3ZPJA 3R7RA 4KVMA 1IXVA 1H6KA 3TL5A 3S7BA 4YDWA 3FUHA 3PUJA 3D9OA 5FZRA 2HR2A 3C3RA 3EHQA 5CRVA 3LVRE 4DX2A 1B89A 3RAUA 3CKCA 4DRXE 4HRMB 5CMYA 4YDYA 5ENNA 3AS5A 2V8SE 1N52A 1BU9A 1G3NB 4CGWA 1HG5A 4FP7A 4I2WA 1V54E 2R05A 1TNZA 2OEVA 4A3VA 5LX8A 2EIKE 1HF8A 5EILA 3FULA 4ATZD 1OY3D 4JPSA 2KCLA 4L7TA 5FWQA 4A1GA 4DX7D 2I1JA 2VSOE 2XEVA 5EX0A 2IQCA 3MYVA 4I2ZA 5CBOA 3ZYMA
chains in the Genus database with same CATH topology
4XI0A 3TG4A 5FQ7A 4GA1A 3CVWA 2LAIA 2X6FA 3CVYA 4DPRA 4LCTA 2XGSA 4A3TA 5DIZA 2CG3A 5JJTA 5FQ4A 3QJZA 3QARA 2ONDA 4NURA 3GYZA 3RKVA 1U3DA 4U07A 1Y8MA 3LKUA 2LNIA 2WM9A 1EYHA 2KZTB 2WXGA 3PRZA 4GA2A 4KYOB 1DVPA 3S2AA 3FH7A 2V4LA 4I1OB 2P58C 3FHEA 4GU5A 5DBKA 1UN9A 3ASHA 4EECA 1MQSA 4UQYA 2WQ6A 4GZCA 3FH5A 3R7QA 5HQ8A 2XCBA 2EQXA 3EDTB 4G24A 3EJNA 3OXFA 3QB2A 3ZFWA 3JCKC 3G2VA 3ASDA 4F53A 4H7XA 4WNGA 4DK5A 2WXKA 1E7VA 4U8HA 3CHSA 3ZHEB 4EPZA 2GRMA 2KATA 3ZRHA 5LCWJ 2WMOA 5C2YA 2YINA 1NZNA 3OXGA 3PE3A 4WNFA 4JL0A 3ESKA 3CEQA 3FDHA 3GZSA 5A7DB 4L1BA 3RRMB 4FLBA 2AXVA 2VSXE 3PNLB 3U66A 5C1DA 2WVIA 1XNFA 2LSVA 3MZLB 2JEKA 3LEWA 3VTXA 2X6HA 2XPYA 4U63A 5LP0A 4CEMA 1E8YA 3D9IA 4K0RA 4GMJA 3RU0A 4GMLA 2X3MA 3QK0A 1TJCA 4FJYA 2FF4A 4KZCA 2WQ7A 4B0ZA 5KJLA 3CHMA 4OYSA 3RRUA 5T3RA 3PUKA 4GZ5A 3AU4A 3VLFA 4U0UA 4GYYA 1ELRA 4C9BB 2A5UA 3MJWA 3G2TA 4AEZC 5AIJA 2IF4A 4O6FA 3D9NA 2XRYA 3OAWA 1KT0A 2OV8A 2R59A 1UJJA 5FTPA 3T8MA 3Q47B 3BG1B 4ANVA 3FUMA 3B13A 3BEEA 4A1SA 2AWIA 4APFA 1H2VC 3ZGQA 3ZXSA 2L9BA 1WAO1 5FQ8A 1OWOA 4UWHA 4JEUA 3FH8A 3B7UX 3GW4A 1IQUA 1HH8A 3LY7A 3ML8A 4JW1A 5BV1A 1Y6IA 1ELKA 4WWPA 1GW6A 3JQ0A 4HOUA 3ZEFA 1PC2A 2PL2A 3CVLA 3L22A 3MX3A 4J8FA 4BT8A 4CDNA 4CDRA 2R17C 5BPPA 4EZLA 4N3BA 3FUIA 3Q5MA 4OVVA 3TJPA 4AP2A 2ILRA 1OWMA 2AXZA 3NF1A 4AJWA 2CG2A 5CMWA 3LY9A 5LOZA 3ASFA 1HO8A 4N39A 4UWGA 1FCHA 4GPKA 2J09A 3SF4A 3P1UA 3ZIMA 3CQGB 3CHRA 4TRQA 1WM5A 4RVBA 4DI3A 4WWOA 4FC8A 2HYZA 3UX4A 2VSYA 4J8SA 3PREA 3ZYQA 4BFRA 3SZ7A 4CT0A 2E0IA 3ZYLA 2MOWA 3B7SA 1U3CA 4I6EA 5J08A 2WXNA 1QZ2A 3OTNA 3LS8A 4I6JA 4NACA 4PS8A 4JHJA 2KC7A 3TGOA 2FEZA 3D9KA 4C0EA 1E96B 4E85A 3CHQA 3FTVA 2WXRA 3CLJA 1W3BA 4FA6A 3U3WA 5HI7A 5ANRA 2GW1A 2FI7A 4G11A 2WXJA 4F7AA 2L0TB 4V3IA 3FTWA 4BX9A 4BY6A 3CVXA 3IHVA 3QWPA 3MKRA 3UUXA 4B8CB 3D9PA 2QY7A 3MKQB 1S0PA 3FUJA 2PM7A 1NA3A 4LERA 2CHXA 1E8WA 1HFAA 3CK7A 3FU6A 4FLHA 4BSXA 3FEYA 3RK6A 3LY8A 5BT1A 5T8IA 2L6JA 5A6CA 3FTYA 2CHZA 5T4YA 1IHGA 2YHCA 2Q7FA 4PS3A 4RG6A 1VDYA 3LPZA 3ZW3A 5EDSA 4RG9A 5JHAA 4Q69A 3HVEA 3PVLA 3MV2B 4L2LA 4P29A 1SQMA 2VJ8A 4GZ3A 4JHRA 3FUDA 1OWNA 3RO2A 5JJ6A 3SGHA 2JLBA 2RD0A 1BPOA 3G2UA 4PH4B 3Q4AB 4Q94A 5J90A 2FBNA 4WNEA 2DBAA 2VTBB 3L16A 2PQRA 3HIZA 2WXOA 4WWNA 4YVOA 4D10C 3FP3A 3D9JA 3IBEA 3ML9A 1QQEA 3B7RL 3OXLA 3FUEA 1X5BA 4B94A 1EPUA 4L2YA 4HFGA 3MEKA 5FZQA 4U0ZA 4GCOA 3AU5A 1DNPA 2A4ZA 3EHMA 4KXKB 2YNQA 4GZDA 5CCLA 4HLEA 2QFCA 3BG0B 5D0QD 2BTDA 3FTZA 3NQPA 2C2LA 4W9RA 3Q49B 4IYPA 2WXFA 2L0IA 4GYWA 3ZYKA 3QC1A 4IULA 4JA7A 3CHPA 3FUFA 1UG3A 4IRUA 2X6JA 3D3MA 4XZ4A 3FTUA 3FTSA 3CKBA 3HVEB 5ARGA 1UN8A 4EZJA 3FUKA 2OVBA 1N54A 2KZTA 2M63A 3PNTB 1MHQA 2OOEA 4UWFA 2X6IA 4CCAA 3Q15A 2YQ8A 3QWWA 4U04A 3QDNA 4JVSA 3L6AA 3L08A 3VLDA 2XGOA 3FU3A 1EF1C 3KD7A 4GCNA 1PY1A 3DPDA 3CGHA 3GZ1A 1OWLA 2CFUA 4Q96A 1SZAA 4F3VA 2CFZA 5D0OD 4FADA 3U9WA 5BW8C 3P2BA 3PEVB 2HM8A 3CQCB 2WXIA 4I6GA 4QFVA 1Z3YA 4UI9K 3FUNA 1E90A 4I9EA 1OWPA 3FWVA 4MKTA 4ATGA 1HZ4A 2IOLA 2NC9A 3ENEA 1JWGA 2V5FA 2IU1A 2VTBA 2DIWA 2FO7A 4DLOA 4JXTA 2XHEA 2XPZA 3MA5A 2J08A 3U4TA 2VYIA 4EZKA 3CV0A 5JHBA 4K03A 2XCCA 1SZ9A 2X38A 3CVUA 4I1MA 3PE4A 4XI9A 3QKYA 3LYAA 1KT1A 3HYMB 3EHNA 4PDXA 4LEUA 4PS7A 4HOTA 2WPVA 1FVHA 4FHJA 2VGXA 4JZYA 4ACKA 4G26A 4HORA 3S7DA 5CCMA 5KJKA 4FULA 4DI4A 4UQXA 4N3AA 2WXMA 4XX5A 2GRLA 3N71A 4Y6WA 4CRWA 1UW4B 3EIJA 3MCXA 1E8XA 2NXPA 1KLXA 5FT9A 4CT4A 3FU0A 4G23A 3I3NA 2KCVA 3IKOB 5FJYA 5ARFA 2WXLA 4J0UA 5BUZA 1H2UA 3IHYA 1YA0A 4N2SA 2PQNA 3S7FA 1H0AA 2I6HA 5EKQD 4LRZA 4LUNU 1HG2A 2IOSA 4APOA 3G2WA 4XKCA 4DLQA 5E75A 4BWRA 3TAXA 2E2EA 3CK9A 1E7UA 2CHWA 3LJ3A 4G25A 4G1TA 1H2TC 4HXIA 3T5XA 2AVPA 4HVBA 3VLEA 2J4BA 3MKQA 2KM4A 4L23A 3R9AB 2IFUA 2I9CA 3SD5A 4N3CA 4MS6A 4I1AA 3D9MA 3U64A 2X6KA 3GZ2A 4HOSA 3PZDA 4I43A 3FY4A 4WAFA 4KMOA 4BX8A 2YHEA 3AS4A 4JEHA 4GYOA 2HO1A 3WXXA 2LAHA 2IONA 2J49A 3ULQA 3ASGA 5G05J 4F1SA 3ZVVA 5AJLA 5LFAA 3EIQC 2J4DA 3PEUB 3S7JA 3RIBA 2WQHA 3TG5A 3UT4A 1LF8A 1UJKA 2ZU6B 4UWKA 3CVVA 3LXUX 4XKBA 3T5VA 4N2QA 4KBQA 3RO3A 5EX3A 3NZSA 5AYWD 2J07A 4Y6CA 3FFLA 3I5PA 3APCA 3QOUA 3LCAA 3APFA 1IYGA 3CVPA 4UI9J 3ZHEA 4FU3A 3UMVA 1IQRA 4XE0A 3CK8A 2XRZA 2UY1A 3L17A 4FHKA 4ILGA 5KJMA 4TUUA 2R5SA 2WXQA 1FVFA 4M3OA 2VGYA 5CHEE 5FQ6A 2KCKA 4R7LA 4N5CA 4J8DA 3O48A 1INZA 3D9LA 3HDXA 1HU3A 1ZBPA 2AW6A 3PS6A 4NQ0A 5AENA 3IEGA 4B89A 3DBSA 3SBSA 4JHKA 3JYSA 2PZIA 4UI9C 4GA0A 4WUYA 3PH0C 3I4GA 3QAQA 1Z6TA 2RG8A 2WXHA 1JPLA 3E4BA 4BTAA 3FEXA 1PAQA 2J9QA 4MLPA 3UT7A 4BT9A 1TJFA 4EBAA 3JUIA 4GAAA 1TEZA 3KS2A 1ZU2A 5KCMA 3QWVA 2BF0X 4WNDA 2I1KA 3LVQE 5A23A 4AIFA 1HX8A 2VSNA 5G05C 3RRNB 4EBAG 3CSTA 3PDNA 3ONKA 4MRUA 2C0MA 1NA0A 2FULA 4ANXA 5LCWC 3UQ3A 4URKA 1ELWA 1HE8A 4ILIA 5G04C 4AOFA 4KVOA 4IN3B 2XPIA 2Y4UA 4PUCA 4A55A 2Y4TA 2MRIA 3MGBA 3SBTB 2V0PA 4KT6B 3O4ZA 4ME2A 4RSYA 4AXHA 4AV7A 3ZPJA 3SNXA 3RJVA 2XGMA 3R7RA 4KVMA 2UWJG 1H6KA 1EDUA 3TL5A 4TV3A 4JA9A 1Z3XA 5G04J 4HS2A 3CIAA 3B7TA 2IJGX 3ZN3A 3S7BA 4ANUA 3SHFA 1JUQA 3FTXA 4GB9A 4C0MA 4YNDA 2XQ0A 3KEZA 4AY5A 1P5QA 4DJAA 3FUHA 3PUJA 3AS8A 3D9OA 5FZSA 5FZRA 2HR2A 3G2SA 4CDMA 3K9IA 3CR3A 4OVUA 2MHKA 5AJDA 4B8AA 3LVRE 1WY6A 5JJ7A 1HS6A 1B89A 3CVNA 4ANWA 3CSFA 5ANLA 1XGWA 4XIFA 1H19A 3NZUA 1E8ZA 2I2OA 2NSZA 3CKCA 3CHOA 1L5JA 2OVFA 2WMNA 4UQZA 5E76A 3SFZA 4ACLA 3LDZA 3C98A 2GGFA 2UY1B 3IV0A 2LO6A 2WXPA 4FJZA 5CMYA 2LSUA 3HHMA 4I17A 5ENNA 3MV3B 3AS5A 1QNFA 3JQ1A 4G2VA 4HOQA 4ILHB 4YVQC 2V8SE 3L54A 1N52A 3UT8A 4H7YA 4J8EA 3SI5A 5KJNA 1OUVA 3UPVA 2PM6A 5M72A 4CGVA 4CGWA 1HG5A 1HXIA 3VTYA 4FP7A 3QNKA 4I9CA 3L13A 2AXUA 4I2WA 4E6HA 4A3VA 5LX8A 4NRHB 2WB2A 2BUGA 4U0SA 2Y3AA 4ABNA 1A17A 4J6IA 4AVXA 1HF8A 5BNWA 1NP7A 3FULA 3FU5A 3ONLA 3TXMA 3URZA 5G55A 4EQFA 5G2NA 4JPSA 2KCLA 4L7TA 5FWQA 2C0LA 4A1GA 2VQ2A 3KAEA 3ESLA 1JWFA 2I1JA 2VSOE 2XEVA 5EX0A 2IQCA 2VGXB 3MYVA 5BV0A 4I2ZA 4KZ0A 3CVQA 2DCPA 3APDA 4AY6A 4GZ6A 3I4RB 3TXNA 4JC8A 4AM9A 4BTBA 3ZYMA 4UWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FO7 A;  3JYS A;  2PZI A;  4XI0 A;  4UI9 C;  4GA0 A;  3MA5 A;  1QZ2 A;  4WUY A;  4GA1 A;  3TG4 A;  2XGS A;  5DIZ A;  3U4T A;  3E4B A;  2VYI A;  3CV0 A;  4BTA A;  5JJT A;  2KC7 A;  2XCC A;  2J9Q A;  2FEZ A;  2OND A;  3GYZ A;  3RKV A;  4U07 A;  4BT9 A;  1E96 B;  3TGO A;  3PE4 A;  1Y8M A;  4XI9 A;  3QKY A;  3LYA A;  3LKU A;  2LNI A;  3WXX A;  1KT1 A;  3HYM B;  4GA2 A;  3KS2 A;  4KYO B;  1W3B A;  1ZU2 A;  5KJM A;  3QWV A;  4WND A;  2P58 C;  4LEU A;  5HI7 A;  5DBK A;  2GW1 A;  2FI7 A;  3ASH A;  4AIF A;  4UQY A;  4HOT A;  2VSN A;  2WPV A;  5G05 C;  5HQ8 A;  2XCB A;  3PDN A;  2VGX A;  2C0M A;  3EDT B;  4G24 A;  4G26 A;  4HOR A;  3OXF A;  3QWP A;  3MKR A;  3S7D A;  3UUX A;  3ZFW A;  1NA0 A;  5CCM A;  3ASD A;  5KJK A;  4GPK A;  5LCW C;  4UQX A;  4H7X A;  4N3A A;  4WNG A;  1ELW A;  1NA3 A;  3UQ3 A;  5G04 C;  3N71 A;  3CK7 A;  4Y6W A;  4IN3 B;  2XPI A;  2Y4U A;  3ZHE B;  1KLX A;  5FT9 A;  3LY8 A;  2Y4T A;  2KAT A;  5BT1 A;  4G23 A;  5LCW J;  2L6J A;  2KCV A;  1NZN A;  5A6C A;  3OXG A;  4ME2 A;  5FJY A;  5ARF A;  3PE3 A;  4WNF A;  3ZPJ A;  3RJV A;  1IHG A;  2XGM A;  2Q7F A;  2YHC A;  4JL0 A;  4J0U A;  2UWJ G;  4RG6 A;  1YA0 A;  3ESK A;  4N2S A;  2PQN A;  3CEQ A;  3LPZ A;  4RG9 A;  5A7D B;  2I6H A;  5EKQ D;  4JA9 A;  5G04 J;  3S7F A;  3SZ7 A;  3MV2 B;  3ZN3 A;  4GZ3 A;  3S7B A;  4JHR A;  1XNF A;  2LSV A;  4APO A;  3RO2 A;  5C1D A;  3VTX A;  5JJ6 A;  3UPV A;  2JLB A;  4BWR A;  3TAX A;  4YND A;  3Q4A B;  2E2E A;  3CK9 A;  2FBN A;  4AY5 A;  4G25 A;  4G1T A;  1P5Q A;  3AS8 A;  2AVP A;  3RU0 A;  5FZS A;  5FZR A;  4BT8 A;  4WNE A;  2DBA A;  1TJC A;  2HR2 A;  2FF4 A;  2PQR A;  3K9I A;  2MHK A;  5KJL A;  4YVO A;  5JJ7 A;  3R9A B;  3FP3 A;  4GZ5 A;  1B89 A;  2IFU A;  3CVN A;  4U0U A;  4GYY A;  1ELR A;  1QQE A;  4N3C A;  4I1A A;  3GZ2 A;  3OXL A;  4HOS A;  4B94 A;  4XIF A;  2IF4 A;  4O6F A;  3MEK A;  5FZQ A;  4U0Z A;  3CKC A;  4GCO A;  4UQZ A;  1KT0 A;  3AS4 A;  4KXK B;  5FTP A;  5CCL A;  2UY1 B;  2QFC A;  3Q47 B;  4GYO A;  5D0Q D;  2HO1 A;  4A1S A;  3BEE A;  2C2L A;  2LSU A;  4W9R A;  3Q49 B;  4I17 A;  3MV3 B;  3AS5 A;  4G2V A;  4GYW A;  4HOQ A;  3ULQ A;  3ZGQ A;  4YVQ C;  3ASG A;  4JA7 A;  1WAO 1;  5G05 J;  4H7Y A;  4J8E A;  3GW4 A;  5KJN A;  3LY7 A;  1HH8 A;  3RIB A;  1OUV A;  2WQH A;  5ARG A;  3S7J A;  5M72 A;  3CKB A;  3TG5 A;  4CGV A;  1HXI A;  4CGW A;  1IYG A;  3VTY A;  4I9C A;  4N2Q A;  4KBQ A;  4I2W A;  3RO3 A;  5EX3 A;  4HOU A;  5AYW D;  1PC2 A;  2PL2 A;  3CVL A;  2OOE A;  3FFL A;  4J8F A;  4NRH B;  4Y6C A;  2BUG A;  4CDR A;  3Q15 A;  3QOU A;  4N3B A;  3Q5M A;  4U0S A;  2YQ8 A;  3LCA A;  3QWW A;  1A17 A;  3QDN A;  4U04 A;  3NF1 A;  3CVP A;  4UI9 J;  4ABN A;  3ZHE A;  2XGO A;  3KD7 A;  3URZ A;  5BNW A;  4GCN A;  3LY9 A;  3CK8 A;  3ASF A;  2UY1 A;  3GZ1 A;  4N39 A;  4EQF A;  1FCH A;  2KCL A;  4F3V A;  2R5S A;  2C0L A;  5CHE E;  2VQ2 A;  2VGY A;  3KAE A;  5D0O D;  2KCK A;  3SF4 A;  4N5C A;  5BW8 C;  3U3W A;  4J8D A;  2XEV A;  3O48 A;  2VGX B;  5EX0 A;  4UI9 K;  4I9E A;  1WM5 A;  4I2Z A;  3CVQ A;  4AY6 A;  4GZ6 A;  3FWV A;  1HZ4 A;  2HYZ A;  4NQ0 A;  1ZBP A;  4AM9 A;  2VSY A;  2NC9 A;  3IEG A;  4BTB A;  2V5F A; 
#chains in the Genus database with same CATH topology
 2X6F A;  3QJZ A;  1U3D A;  3ULE G;  3DEP A;  1Y8M A;  5JMN D;  2WM9 A;  1EYH A;  3PRZ A;  3FH7 A;  4EEC A;  3FHE A;  2WQ6 A;  2R2L A;  2EQX A;  3EDT B;  4G24 A;  3ZFW A;  3G2V A;  1NL4 A;  4DK5 A;  1D8E A;  1LD7 A;  2GRM A;  5LCW J;  5C2Y A;  4WNF A;  1O1T A;  3FDH A;  4L1B A;  2VSX E;  1DCE A;  5CRU A;  2GRR B;  2X6H A;  4CEM A;  2V4H C;  3D9I A;  4GML A;  3QK0 A;  4FJY A;  2FF4 A;  4KZC A;  3CHM A;  3C3Q A;  4OYS A;  5T3R A;  3VLF A;  4C9B B;  3V31 A;  2IF4 A;  3OAW A;  2XRY A;  3PZ4 A;  3W9F A;  3B13 A;  3BEE A;  1S63 A;  4G8K A;  2AWI A;  3BQO A;  1WAO 1;  3FH8 A;  1Y6I A;  4WWP A;  1U2V G;  4GTP A;  4BT8 A;  5BPP A;  4OVV A;  4AJW A;  5LOZ A;  1FCH A;  2J09 A;  4OAU C;  4TRQ A;  4WWO A;  3AG3 E;  3UX4 A;  2DYR E;  1OXJ A;  2VSY A;  3PRE A;  5B1B E;  4I6E A;  1U3C A;  1QZ2 A;  2DYS E;  4PS8 A;  3D9K A;  2L6B A;  4C0E A;  4E85 A;  1OCO E;  1W3B A;  4FA6 A;  5ANR A;  2GW1 A;  4V3I A;  3FTW A;  4U95 D;  1S0P A;  3KSQ A;  5BT1 A;  2L6J A;  5ENS D;  5A6C A;  1IHG A;  3BUA A;  5EDS A;  3PVL A;  4P29 A;  4GZ3 A;  5KNH D;  2JLB A;  5J90 A;  3EU5 A;  3IBE A;  1QQE A;  4BSZ B;  3UXG A;  3OXL A;  2HE0 A;  3SFX A;  4B94 A;  1X5B A;  4L2Y A;  4HFG A;  5FZQ A;  4U0Z A;  4GCO A;  2YNQ A;  4HLE A;  2QFC A;  3BG0 B;  3Q49 B;  4IYP A;  4GYW A;  2L0I A;  3ZYK A;  3FUF A;  2X6J A;  3D3M A;  3FTU A;  4EZJ A;  4U7E B;  3FUK A;  1N54 A;  1MHQ A;  3EUV A;  2CFU A;  3HG0 D;  4Q96 A;  4J7W A;  5D0O D;  2HM8 A;  1Z3Y A;  3FUN A;  2IOL A;  2NC9 A;  2V5F A;  2XHE A;  3DSV A;  2J08 A;  2FO1 E;  4EZK A;  1SZ9 A;  2X38 A;  3CVU A;  4I1M A;  4XI9 A;  3QKY A;  1KT1 A;  3EHN A;  3DST A;  4LEU A;  4PS7 A;  2WPV A;  3T8K A;  3S7D A;  4FUL A;  4N3A A;  4HRL A;  4XX5 A;  2GRL A;  1UW4 B;  2F8X K;  4TUM A;  3FU0 A;  2GRO B;  2XZT G;  2PQN A;  3S7F A;  1H0A A;  5EKQ D;  4LUN U;  1HG2 A;  2GRP B;  1AWC B;  2PNN A;  3PZ2 A;  4HNA D;  2E2E A;  4G25 A;  4O1P A;  5CBN A;  3V2X A;  4HVB A;  2IO2 C;  3MKQ A;  2XEE A;  3GZ2 A;  4HOS A;  3PZD A;  2F0Y A;  2LAH A;  3RSE G;  2QYJ A;  3ULQ A;  3ASG A;  4F1S A;  3ZVV A;  2J4D A;  3LXU X;  2EIJ E;  3QOU A;  3APF A;  3ZHE A;  3CK8 A;  2UY1 A;  4FHK A;  4ILG A;  2Y1L E;  1FVF A;  4M3O A;  4BET A;  4R7L A;  4N5C A;  3HDX A;  1HU3 A;  1ZBP A;  2JAB A;  5AEN A;  4HI9 A;  3DRA A;  2PZI A;  2RG8 A;  2WXH A;  4BTA A;  3FEX A;  3TWT A;  3TWU A;  1TJF A;  3JUI A;  4GAA A;  1ZU2 A;  2BF0 X;  4WND A;  3LVQ E;  4U96 D;  2RKK A;  4EBA G;  2VSN A;  4MRU A;  2C0M A;  3UQ3 A;  4URK A;  1HE8 A;  5G04 C;  1N4Q A;  2XPI A;  2Y4U A;  4A55 A;  3AAA C;  3MGB A;  4KT6 B;  3SNX A;  2XGM A;  1EDU A;  5G04 J;  4HS2 A;  4LSZ E;  5D66 A;  3ZN3 A;  4ANU A;  3SHF A;  1JUQ A;  4B93 B;  4AY5 A;  2DVW A;  4DJA A;  3AS8 A;  2XEH A;  4CDM A;  3K9I A;  5AJD A;  4B8A A;  1HS6 A;  2XS1 A;  3CSF A;  5ANL A;  4XIF A;  1H19 A;  1E8Z A;  2I2O A;  3CHO A;  5E76 A;  2OVF A;  2WMN A;  2UY1 B;  3IV0 A;  2LO6 A;  4FJZ A;  3L82 A;  1FT2 A;  2LSU A;  3MV3 B;  4HOQ A;  1OCC E;  3ISM C;  3L54 A;  1OUV A;  1TNY A;  4CGV A;  1HXI A;  3QNK A;  4I9C A;  4HLL A;  2BUG A;  2KXP C;  2Y3A A;  2OCC E;  1A17 A;  1NP7 A;  3URZ A;  5G55 A;  2C0L A;  2VQ2 A;  2QZA A;  2KBX A;  4KZ0 A;  3CVQ A;  2DCP A;  4AY6 A;  4GZ6 A;  3DPY A;  4BTB A;  4UWL A;  4XI0 A;  1BLX B;  5FQ7 A;  2LAI A;  4F6R D;  3CVY A;  1TN7 A;  2BKK B;  3GYZ A;  3RKV A;  1N94 A;  3LKU A;  3WXX A;  2KZT B;  1DVP A;  2EIL E;  3ASH A;  3R7Q A;  5HQ8 A;  3TWX A;  3Q75 A;  4F53 A;  3HXE A;  2IEJ A;  1FT1 A;  2WMO A;  3AG4 E;  3GZS A;  3UM0 A;  2AXV A;  3PNL B;  3U66 A;  1XNF A;  3MZL B;  3VTX A;  2XPY A;  5LP0 A;  1SA5 A;  4K0R A;  2DZN A;  4GMJ A;  2WQ7 A;  3RRU A;  5ENO D;  3AU4 A;  5AQA A;  5AAR A;  2R59 A;  1UJJ A;  2ZGG A;  4A1S A;  2GRQ B;  4APF A;  1H2V C;  5FQ8 A;  4UWH A;  4JEU A;  3GW4 A;  1IQU A;  3LY7 A;  5BV1 A;  1N4P A;  1ELK A;  1GW6 A;  1PC2 A;  4CDN A;  4J8F A;  4CDR A;  3TWV A;  2R17 C;  4EZL A;  3Q5M A;  4AP2 A;  2ILR A;  1OWM A;  1K1A A;  2AXZ A;  1DC2 A;  1H6O A;  1N95 A;  5CMW A;  1N9A A;  3ASF A;  1HO8 A;  4N39 A;  3P1U A;  3ZIM A;  3CHR A;  1WM5 A;  5FIO A;  4G8L A;  3DXM G;  1X81 A;  3ABK E;  4FC8 A;  1LD8 A;  4BFR A;  4CT0 A;  5AAO A;  5J08 A;  2P9S G;  3OTN A;  4NAC A;  2V5Q C;  3DXK G;  1E96 B;  3CHQ A;  3FTV A;  2WXR A;  4G11 A;  3UI2 A;  2WXJ A;  2L0T B;  3IHV A;  3QWP A;  3UUX A;  3D9P A;  1UOH A;  2PM7 A;  2CHX A;  3RK6 A;  2Y0B G;  5T8I A;  3FTY A;  5T4Y A;  3LPZ A;  5JHA A;  5AQB A;  4L2L A;  2VJ8 A;  3E32 A;  1OWN A;  3FUD A;  3RO2 A;  1SA4 A;  3SGH A;  1MX6 A;  3G2U A;  4PH4 B;  3Q4A B;  3E33 A;  1QYM A;  3JXI A;  2DBA A;  2WXO A;  3Q73 A;  5HS0 A;  3MEK A;  4Z68 A;  3AU5 A;  3ZNG A;  4KXK B;  4GZD A;  5CCL A;  1N4R A;  4IUL A;  3TWR A;  3CHP A;  3UIP C;  1UG3 A;  4XZ4 A;  3FTS A;  1UN8 A;  2OVB A;  2KZT A;  2NYJ A;  3AG1 E;  2YQ8 A;  4JVS A;  3L08 A;  3UKU G;  4J8Y A;  4QFV A;  1E90 A;  4BEP A;  3FWV A;  4F1P A;  4ATG A;  1ZB1 A;  2AJA A;  2FO7 A;  2VYI A;  2XCC A;  4LG6 A;  2BED A;  5ENP D;  3PE4 A;  3LYA A;  4PDX A;  1O1S A;  3ZKJ A;  4FHJ A;  4G26 A;  5CCM A;  3NOG D;  3N71 A;  2IO3 C;  3EIJ A;  2NXP A;  3MCX A;  4CT4 A;  4RLY A;  5FJY A;  5ENT D;  2WXL A;  4J0U A;  5BUZ A;  4N2S A;  2I6H A;  4LRZ A;  3UTM A;  3LJ3 A;  4G1T A;  3R9A B;  1N11 A;  2I9C A;  3D9M A;  5ITZ F;  3PZ1 A;  4QQI A;  3J5P A;  2YHE A;  3UIO C;  2HO1 A;  2Y69 E;  3ASO E;  5G05 J;  5CEC B;  3TG5 A;  5KNG A;  2ZU6 B;  1UJK A;  4XKB A;  1MX4 A;  1S64 A;  3AJI A;  5CEA A;  1IYG A;  3CVP A;  4UI9 J;  5IY5 E;  2WXQ A;  5CHE E;  5FQ6 A;  3O48 A;  4LNU D;  4GTR A;  4JHK A;  4UI9 C;  3PH0 C;  3I4G A;  3QAQ A;  1H6P A;  1PAQ A;  2J9Q A;  4BT9 A;  4DX5 D;  3HXC A;  4EBA A;  3KS2 A;  3QWV A;  2R03 A;  2I1K A;  4AIF A;  5G05 C;  1FPP A;  1NA0 A;  2B0O E;  2FUL A;  4M7C A;  4ILI A;  3EHR A;  2MRI A;  5KBA A;  4RSY A;  3HXB A;  3RJV A;  2EIM E;  2UWJ G;  4JA9 A;  3B7T A;  2IJG X;  3FTX A;  4C0M A;  3DSW A;  2XQ0 A;  3KEZ A;  5HKP A;  1P5Q A;  5FZS A;  3CR3 A;  5JJ7 A;  4ANW A;  1SVX A;  3T9K A;  1MZC A;  4ACL A;  4UQZ A;  1L5J A;  3SFZ A;  1YMP A;  2GGF A;  2P9K G;  4G2V A;  4K5B A;  1JCR A;  1NI1 A;  3UT8 A;  4H7Y A;  1WG0 A;  4J8E A;  5KJN A;  1BI8 B;  3UPV A;  2PM6 A;  5M72 A;  2AXU A;  4E6H A;  4U0S A;  4ABN A;  2XEN A;  4J6I A;  1LTX A;  5EID A;  1TN6 A;  4EQF A;  5G2N A;  3KAE A;  3ESL A;  1TN8 A;  3APD A;  3I4R B;  4JC8 A;  4AM9 A;  4DPR A;  3ABM E;  2CG3 A;  2ZGD A;  5JJT A;  5FQ4 A;  4NUR A;  4U07 A;  5BXO A;  2WXG A;  3S2A A;  5KJM A;  2P58 C;  4GU5 A;  1UN9 A;  2OEW A;  4UQY A;  1D8D A;  2ZIR A;  3FH5 A;  3EJN A;  3QB2 A;  3JCK C;  4WNG A;  1KPS B;  2WXK A;  1E7V A;  4U8H A;  3ZHE B;  4EPZ A;  3OXG A;  3PE3 A;  4JL0 A;  4XEI G;  3KEA A;  3RRM B;  4FLB A;  5C1D A;  2WVI A;  3LEW A;  2DWZ A;  3RU0 A;  2X3M A;  4B0Z A;  5KJL A;  4GZ5 A;  4U0U A;  1K1B A;  3G2T A;  4AEZ C;  3D9N A;  5FTP A;  3Q47 B;  3BG1 B;  3FUM A;  1BI7 B;  3B7U X;  1HH8 A;  3JQ0 A;  3ZEF A;  3MX3 A;  4N3B A;  3FUI A;  3NF1 A;  1TNB A;  3LY9 A;  4DX6 D;  4UWG A;  3TWS A;  4GPK A;  3SF4 A;  3CQG B;  4RVB A;  4DI3 A;  2LXM A;  4HRN A;  3ZYQ A;  2E0I A;  3ZYL A;  2MOW A;  3B7S A;  1KZO A;  2WXN A;  3LS8 A;  2FEZ A;  5EYP F;  3CLJ A;  3U3W A;  5HI7 A;  4F7A A;  3MKR A;  3FUJ A;  4X8Q A;  4LER A;  1HFA A;  3CK7 A;  3FU6 A;  4FLH A;  5CED B;  5JA4 D;  4JB8 P;  2CHZ A;  2Q7F A;  4PS3 A;  4RG6 A;  3ZW3 A;  4Q69 A;  3HVE A;  1MYO A;  1SQM A;  4JHR A;  5JJ6 A;  3Q9U C;  4TXP A;  2RD0 A;  1BPO A;  2FBN A;  4WNE A;  3L16 A;  4YVO A;  4D10 C;  3FP3 A;  3B7R L;  3E34 A;  3ZUV B;  3C5R A;  3EHM A;  2BTD A;  3NQP A;  4GTQ A;  2WXF A;  3WG7 E;  3LJN A;  4IRU A;  4HQD A;  5ARG A;  2H6F A;  3HVE B;  2M63 A;  4GTT A;  1JCQ A;  2X6I A;  2P2C P;  3Q15 A;  4U04 A;  3QDN A;  3KD7 A;  1PY1 A;  3DPD A;  1OWL A;  4N5Q A;  1SZA A;  2CFZ A;  2LUH A;  5FIN A;  5BW8 C;  1O5M A;  2WXI A;  3CQC B;  4I6G A;  4I9E A;  3NBN B;  1HZ4 A;  1JWG A;  4JXT A;  2XPZ A;  3MA5 A;  3DEO A;  3U4T A;  3ZU7 B;  5JHB A;  3HYM B;  4HOT A;  1BD8 A;  2VGX A;  4JZY A;  4HOR A;  4GTM A;  4ZFH A;  5KJK A;  4DI4 A;  2WXM A;  4Y6W A;  5FT9 A;  4C48 B;  3HRA A;  4G23 A;  3ABL E;  2KCV A;  5ARF A;  1H2U A;  3IHY A;  5AQ7 A;  4APO A;  4U8V D;  4BWR A;  3CK9 A;  1E7U A;  1S70 B;  1KZP A;  3VLE A;  4L23 A;  2F8Y A;  3R9M A;  3SD5 A;  4N3C A;  3U64 A;  2X6K A;  4I43 A;  2H6G A;  4BX8 A;  3Q9N C;  4OAV B;  3AS4 A;  4GYO A;  2ION A;  3NAW A;  2J49 A;  1N0Q A;  3PEU B;  3S7J A;  2WQH A;  3UT4 A;  4UWK A;  3T5V A;  3RO3 A;  3NZS A;  5AYW D;  4Y6C A;  5B3S E;  3APC A;  5AN8 A;  3LCA A;  4YDE A;  1IQR A;  3L9T A;  2XRZ A;  3L17 A;  4TUU A;  4J8D A;  3F6Q A;  1INZ A;  2P9I G;  5H7P A;  4GTO A;  3SFY A;  4B89 A;  3KSL A;  3JYS A;  4GA0 A;  4HB5 A;  3E4B A;  3DSX A;  3SO8 A;  4MLP A;  3UT7 A;  1YCS B;  3EU9 A;  3DWL G;  1HX8 A;  4O60 A;  3RRN B;  3Q7F A;  1OCR E;  4K5C A;  4YDO A;  2P9U G;  5LCW C;  1ELW A;  2GRN B;  5KWD A;  5EN5 D;  4KVO A;  4IN3 B;  4PUC A;  3HXF A;  4ME2 A;  4AXH A;  1DCQ A;  4CYM D;  4TV3 A;  1Z3X A;  5ENQ D;  3CIA A;  4DX1 A;  3JUE A;  4DUI A;  4GB9 A;  4YND A;  4GPM A;  1JCS A;  2J8S D;  3G2S A;  4OVU A;  2MHK A;  1WY6 A;  3CVN A;  1MX2 A;  4O1O A;  1XGW A;  2BKG A;  1IKN D;  3NZU A;  2NSZ A;  5EYL A;  3LDZ A;  3C98 A;  2WXP A;  3HHM A;  4I17 A;  3JQ1 A;  1QNF A;  4ILH B;  4YVQ C;  5ENR D;  3ZXP A;  3SI5 A;  3VTY A;  3L13 A;  4JD2 G;  3V30 A;  2WB2 A;  4NRH B;  4AVX A;  2ZXW E;  5BNW A;  3TXM A;  3ONL A;  2XZD G;  3AG2 E;  3FU5 A;  4BES A;  3TWW A;  1JWF A;  5BV0 A;  2H6H A;  2VGX B;  3TXN A;  4A63 B;  3TG4 A;  4GA1 A;  3CVW A;  2P9P G;  4LCT A;  2XGS A;  4A3T A;  5DIZ A;  3QAR A;  2OND A;  2LNI A;  5HRY A;  4KYO B;  4GA2 A;  2V4L A;  4I1O B;  3UKR G;  5DBK A;  1MQS A;  4GZC A;  2XCB A;  3OXF A;  3ASD A;  4MBG A;  1QBQ A;  4H7X A;  3CHS A;  2KAT A;  3ZRH A;  2YIN A;  1NZN A;  3B95 A;  3ESK A;  3CEQ A;  5A7D B;  2LSV A;  2JEK A;  4U63 A;  1NFI E;  5D2M C;  1E8Y A;  3V79 K;  3Q79 A;  1TJC A;  3PUK A;  4GYY A;  1ELR A;  2A5U A;  3Q78 A;  3MJW A;  5AIJ A;  3IXE A;  4O6F A;  2ETB A;  3JXJ A;  5B1A E;  1KT0 A;  2OV8 A;  3T8M A;  2P9L G;  4ANV A;  3C72 A;  3ZGQ A;  3ZXS A;  2L9B A;  1OWO A;  2ETA A;  4JW1 A;  3ML8 A;  1AP7 A;  2ZIS A;  4HOU A;  2PL2 A;  3CVL A;  3L22 A;  1O1R A;  4K5A B;  3TJP A;  2CG2 A;  1IHB A;  1TYQ G;  2HYZ A;  5EIB E;  4J8S A;  3SZ7 A;  4BER A;  4I6J A;  1Q2Z A;  4JHJ A;  2KC7 A;  3TGO A;  2LXL A;  4GMR A;  1OCZ E;  2FI7 A;  4U8Y D;  4BX9 A;  4BY6 A;  3BU8 A;  3CVX A;  2P9N G;  4B8C B;  2QY7 A;  3MKQ B;  1NA3 A;  1E8W A;  1WDY A;  4GTS A;  4BSX A;  3FEY A;  3LY8 A;  2QYU A;  1N4S A;  2YHC A;  1VDY A;  2DZO A;  4RG9 A;  3MV2 B;  5CER B;  4Q94 A;  4LNG A;  2ETC A;  3UIN C;  2VTB B;  2PQR A;  3HIZ A;  3HXD A;  4WWN A;  3D9J A;  3ML9 A;  1RW2 A;  3FUE A;  1EPU A;  1DNP A;  2A4Z A;  5D0Q D;  2RFM A;  3FTZ A;  4W9R A;  2C2L A;  3DSS A;  3UM1 A;  3QC1 A;  1N0R A;  4JA7 A;  3SY2 A;  3CKB A;  5AQ9 A;  3PNT B;  4UWF A;  2OOE A;  4CCA A;  3QWW A;  4HI8 A;  3L6A A;  4UUC A;  3VLD A;  2XGO A;  2F37 A;  1EF1 C;  3FU3 A;  4GCN A;  3X2Q E;  4ZHB A;  3CGH A;  3GZ1 A;  4F3V A;  4FAD A;  3U9W A;  3P2B A;  3PEV B;  4UI9 K;  1OWP A;  4MKT A;  3ENE A;  2IU1 A;  2VTB A;  2DIW A;  4DLO A;  1Z5S C;  2R02 A;  3CV0 A;  4K03 A;  4EHM A;  3Q7A A;  1FVH A;  4LNB A;  2A5E A;  4ACK A;  3E37 A;  4UQX A;  4CRW A;  1E8X A;  1KLX A;  3E30 A;  3I3N A;  3IKO B;  1YYH A;  3W9G A;  1YA0 A;  2IY0 C;  2IOS A;  1RZ4 A;  4L9P A;  3G2W A;  4XKC A;  4DLQ A;  5E75 A;  2H6I A;  3ASN E;  3TAX A;  3V2O A;  2CHW A;  1H2T C;  4HXI A;  3T5X A;  2AVP A;  3B7B A;  2J4B A;  1A5E A;  2KM4 A;  2IFU A;  3C3O A;  4MS6 A;  4I1A A;  2XS8 A;  3ULY A;  3FY4 A;  4WAF A;  4KMO A;  4JEH A;  4GTV A;  3D9H A;  5AJL A;  5LFA A;  1TR4 A;  3EIQ C;  1MJ0 A;  3RIB A;  1LF8 A;  2MYO A;  3CVV A;  1TNO A;  4N2Q A;  4KBQ A;  5EX3 A;  3SQV A;  2J07 A;  3FFL A;  3I5P A;  4CZ2 D;  1TNU A;  4FU3 A;  3UMV A;  4HBD A;  4XE0 A;  4NIK A;  2R5S A;  2VGY A;  2KCK A;  3NOC D;  3D9L A;  4NQ0 A;  2AW6 A;  3PS6 A;  3TWQ A;  3IEG A;  1OT8 A;  3DBS A;  3SBS A;  3UM2 A;  2RFA A;  1D9S A;  4WUY A;  3NB2 A;  1Z6T A;  3DSU A;  1JPL A;  3UM3 A;  1K8K G;  5BXU A;  3PZ3 A;  1TEZ A;  5KCM A;  3J5Q B;  5A23 A;  4TXR A;  3CST A;  1SW6 A;  2QC9 A;  3PDN A;  3ONK A;  4ANX A;  4RQI A;  1K3Z D;  1V55 E;  4AOF A;  2VGE A;  2EIN E;  2Y4T A;  2B6C A;  3SBT B;  2V0P A;  4TXQ A;  3O4Z A;  4AV7 A;  3ZPJ A;  3R7R A;  4KVM A;  1IXV A;  1H6K A;  3TL5 A;  3S7B A;  4YDW A;  3FUH A;  3PUJ A;  3D9O A;  5FZR A;  2HR2 A;  3C3R A;  3EHQ A;  5CRV A;  3LVR E;  4DX2 A;  1B89 A;  3RAU A;  3CKC A;  4DRX E;  4HRM B;  5CMY A;  4YDY A;  5ENN A;  3AS5 A;  2V8S E;  1N52 A;  1BU9 A;  1G3N B;  4CGW A;  1HG5 A;  4FP7 A;  4I2W A;  1V54 E;  2R05 A;  1TNZ A;  2OEV A;  4A3V A;  5LX8 A;  2EIK E;  1HF8 A;  5EIL A;  3FUL A;  4ATZ D;  1OY3 D;  4JPS A;  2KCL A;  4L7T A;  5FWQ A;  4A1G A;  4DX7 D;  2I1J A;  2VSO E;  2XEV A;  5EX0 A;  2IQC A;  3MYV A;  4I2Z A;  5CBO A;  3ZYM A; 
#chains in the Genus database with same CATH homology
 4XI0 A;  3TG4 A;  5FQ7 A;  4GA1 A;  3CVW A;  2LAI A;  2X6F A;  3CVY A;  4DPR A;  4LCT A;  2XGS A;  4A3T A;  5DIZ A;  2CG3 A;  5JJT A;  5FQ4 A;  3QJZ A;  3QAR A;  2OND A;  4NUR A;  3GYZ A;  3RKV A;  1U3D A;  4U07 A;  1Y8M A;  3LKU A;  2LNI A;  2WM9 A;  1EYH A;  2KZT B;  2WXG A;  3PRZ A;  4GA2 A;  4KYO B;  1DVP A;  3S2A A;  3FH7 A;  2V4L A;  4I1O B;  2P58 C;  3FHE A;  4GU5 A;  5DBK A;  1UN9 A;  3ASH A;  4EEC A;  1MQS A;  4UQY A;  2WQ6 A;  4GZC A;  3FH5 A;  3R7Q A;  5HQ8 A;  2XCB A;  2EQX A;  3EDT B;  4G24 A;  3EJN A;  3OXF A;  3QB2 A;  3ZFW A;  3JCK C;  3G2V A;  3ASD A;  4F53 A;  4H7X A;  4WNG A;  4DK5 A;  2WXK A;  1E7V A;  4U8H A;  3CHS A;  3ZHE B;  4EPZ A;  2GRM A;  2KAT A;  3ZRH A;  5LCW J;  2WMO A;  5C2Y A;  2YIN A;  1NZN A;  3OXG A;  3PE3 A;  4WNF A;  4JL0 A;  3ESK A;  3CEQ A;  3FDH A;  3GZS A;  5A7D B;  4L1B A;  3RRM B;  4FLB A;  2AXV A;  2VSX E;  3PNL B;  3U66 A;  5C1D A;  2WVI A;  1XNF A;  2LSV A;  3MZL B;  2JEK A;  3LEW A;  3VTX A;  2X6H A;  2XPY A;  4U63 A;  5LP0 A;  4CEM A;  1E8Y A;  3D9I A;  4K0R A;  4GMJ A;  3RU0 A;  4GML A;  2X3M A;  3QK0 A;  1TJC A;  4FJY A;  2FF4 A;  4KZC A;  2WQ7 A;  4B0Z A;  5KJL A;  3CHM A;  4OYS A;  3RRU A;  5T3R A;  3PUK A;  4GZ5 A;  3AU4 A;  3VLF A;  4U0U A;  4GYY A;  1ELR A;  4C9B B;  2A5U A;  3MJW A;  3G2T A;  4AEZ C;  5AIJ A;  2IF4 A;  4O6F A;  3D9N A;  2XRY A;  3OAW A;  1KT0 A;  2OV8 A;  2R59 A;  1UJJ A;  5FTP A;  3T8M A;  3Q47 B;  3BG1 B;  4ANV A;  3FUM A;  3B13 A;  3BEE A;  4A1S A;  2AWI A;  4APF A;  1H2V C;  3ZGQ A;  3ZXS A;  2L9B A;  1WAO 1;  5FQ8 A;  1OWO A;  4UWH A;  4JEU A;  3FH8 A;  3B7U X;  3GW4 A;  1IQU A;  1HH8 A;  3LY7 A;  3ML8 A;  4JW1 A;  5BV1 A;  1Y6I A;  1ELK A;  4WWP A;  1GW6 A;  3JQ0 A;  4HOU A;  3ZEF A;  1PC2 A;  2PL2 A;  3CVL A;  3L22 A;  3MX3 A;  4J8F A;  4BT8 A;  4CDN A;  4CDR A;  2R17 C;  5BPP A;  4EZL A;  4N3B A;  3FUI A;  3Q5M A;  4OVV A;  3TJP A;  4AP2 A;  2ILR A;  1OWM A;  2AXZ A;  3NF1 A;  4AJW A;  2CG2 A;  5CMW A;  3LY9 A;  5LOZ A;  3ASF A;  1HO8 A;  4N39 A;  4UWG A;  1FCH A;  4GPK A;  2J09 A;  3SF4 A;  3P1U A;  3ZIM A;  3CQG B;  3CHR A;  4TRQ A;  1WM5 A;  4RVB A;  4DI3 A;  4WWO A;  4FC8 A;  2HYZ A;  3UX4 A;  2VSY A;  4J8S A;  3PRE A;  3ZYQ A;  4BFR A;  3SZ7 A;  4CT0 A;  2E0I A;  3ZYL A;  2MOW A;  3B7S A;  1U3C A;  4I6E A;  5J08 A;  2WXN A;  1QZ2 A;  3OTN A;  3LS8 A;  4I6J A;  4NAC A;  4PS8 A;  4JHJ A;  2KC7 A;  3TGO A;  2FEZ A;  3D9K A;  4C0E A;  1E96 B;  4E85 A;  3CHQ A;  3FTV A;  2WXR A;  3CLJ A;  1W3B A;  4FA6 A;  3U3W A;  5HI7 A;  5ANR A;  2GW1 A;  2FI7 A;  4G11 A;  2WXJ A;  4F7A A;  2L0T B;  4V3I A;  3FTW A;  4BX9 A;  4BY6 A;  3CVX A;  3IHV A;  3QWP A;  3MKR A;  3UUX A;  4B8C B;  3D9P A;  2QY7 A;  3MKQ B;  1S0P A;  3FUJ A;  2PM7 A;  1NA3 A;  4LER A;  2CHX A;  1E8W A;  1HFA A;  3CK7 A;  3FU6 A;  4FLH A;  4BSX A;  3FEY A;  3RK6 A;  3LY8 A;  5BT1 A;  5T8I A;  2L6J A;  5A6C A;  3FTY A;  2CHZ A;  5T4Y A;  1IHG A;  2YHC A;  2Q7F A;  4PS3 A;  4RG6 A;  1VDY A;  3LPZ A;  3ZW3 A;  5EDS A;  4RG9 A;  5JHA A;  4Q69 A;  3HVE A;  3PVL A;  3MV2 B;  4L2L A;  4P29 A;  1SQM A;  2VJ8 A;  4GZ3 A;  4JHR A;  3FUD A;  1OWN A;  3RO2 A;  5JJ6 A;  3SGH A;  2JLB A;  2RD0 A;  1BPO A;  3G2U A;  4PH4 B;  3Q4A B;  4Q94 A;  5J90 A;  2FBN A;  4WNE A;  2DBA A;  2VTB B;  3L16 A;  2PQR A;  3HIZ A;  2WXO A;  4WWN A;  4YVO A;  4D10 C;  3FP3 A;  3D9J A;  3IBE A;  3ML9 A;  1QQE A;  3B7R L;  3OXL A;  3FUE A;  1X5B A;  4B94 A;  1EPU A;  4L2Y A;  4HFG A;  3MEK A;  5FZQ A;  4U0Z A;  4GCO A;  3AU5 A;  1DNP A;  2A4Z A;  3EHM A;  4KXK B;  2YNQ A;  4GZD A;  5CCL A;  4HLE A;  2QFC A;  3BG0 B;  5D0Q D;  2BTD A;  3FTZ A;  3NQP A;  2C2L A;  4W9R A;  3Q49 B;  4IYP A;  2WXF A;  2L0I A;  4GYW A;  3ZYK A;  3QC1 A;  4IUL A;  4JA7 A;  3CHP A;  3FUF A;  1UG3 A;  4IRU A;  2X6J A;  3D3M A;  4XZ4 A;  3FTU A;  3FTS A;  3CKB A;  3HVE B;  5ARG A;  1UN8 A;  4EZJ A;  3FUK A;  2OVB A;  1N54 A;  2KZT A;  2M63 A;  3PNT B;  1MHQ A;  2OOE A;  4UWF A;  2X6I A;  4CCA A;  3Q15 A;  2YQ8 A;  3QWW A;  4U04 A;  3QDN A;  4JVS A;  3L6A A;  3L08 A;  3VLD A;  2XGO A;  3FU3 A;  1EF1 C;  3KD7 A;  4GCN A;  1PY1 A;  3DPD A;  3CGH A;  3GZ1 A;  1OWL A;  2CFU A;  4Q96 A;  1SZA A;  4F3V A;  2CFZ A;  5D0O D;  4FAD A;  3U9W A;  5BW8 C;  3P2B A;  3PEV B;  2HM8 A;  3CQC B;  2WXI A;  4I6G A;  4QFV A;  1Z3Y A;  4UI9 K;  3FUN A;  1E90 A;  4I9E A;  1OWP A;  3FWV A;  4MKT A;  4ATG A;  1HZ4 A;  2IOL A;  2NC9 A;  3ENE A;  1JWG A;  2V5F A;  2IU1 A;  2VTB A;  2DIW A;  2FO7 A;  4DLO A;  4JXT A;  2XHE A;  2XPZ A;  3MA5 A;  2J08 A;  3U4T A;  2VYI A;  4EZK A;  3CV0 A;  5JHB A;  4K03 A;  2XCC A;  1SZ9 A;  2X38 A;  3CVU A;  4I1M A;  3PE4 A;  4XI9 A;  3QKY A;  3LYA A;  1KT1 A;  3HYM B;  3EHN A;  4PDX A;  4LEU A;  4PS7 A;  4HOT A;  2WPV A;  1FVH A;  4FHJ A;  2VGX A;  4JZY A;  4ACK A;  4G26 A;  4HOR A;  3S7D A;  5CCM A;  5KJK A;  4FUL A;  4DI4 A;  4UQX A;  4N3A A;  2WXM A;  4XX5 A;  2GRL A;  3N71 A;  4Y6W A;  4CRW A;  1UW4 B;  3EIJ A;  3MCX A;  1E8X A;  2NXP A;  1KLX A;  5FT9 A;  4CT4 A;  3FU0 A;  4G23 A;  3I3N A;  2KCV A;  3IKO B;  5FJY A;  5ARF A;  2WXL A;  4J0U A;  5BUZ A;  1H2U A;  3IHY A;  1YA0 A;  4N2S A;  2PQN A;  3S7F A;  1H0A A;  2I6H A;  5EKQ D;  4LRZ A;  4LUN U;  1HG2 A;  2IOS A;  4APO A;  3G2W A;  4XKC A;  4DLQ A;  5E75 A;  4BWR A;  3TAX A;  2E2E A;  3CK9 A;  1E7U A;  2CHW A;  3LJ3 A;  4G25 A;  4G1T A;  1H2T C;  4HXI A;  3T5X A;  2AVP A;  4HVB A;  3VLE A;  2J4B A;  3MKQ A;  2KM4 A;  4L23 A;  3R9A B;  2IFU A;  2I9C A;  3SD5 A;  4N3C A;  4MS6 A;  4I1A A;  3D9M A;  3U64 A;  2X6K A;  3GZ2 A;  4HOS A;  3PZD A;  4I43 A;  3FY4 A;  4WAF A;  4KMO A;  4BX8 A;  2YHE A;  3AS4 A;  4JEH A;  4GYO A;  2HO1 A;  3WXX A;  2LAH A;  2ION A;  2J49 A;  3ULQ A;  3ASG A;  5G05 J;  4F1S A;  3ZVV A;  5AJL A;  5LFA A;  3EIQ C;  2J4D A;  3PEU B;  3S7J A;  3RIB A;  2WQH A;  3TG5 A;  3UT4 A;  1LF8 A;  1UJK A;  2ZU6 B;  4UWK A;  3CVV A;  3LXU X;  4XKB A;  3T5V A;  4N2Q A;  4KBQ A;  3RO3 A;  5EX3 A;  3NZS A;  5AYW D;  2J07 A;  4Y6C A;  3FFL A;  3I5P A;  3APC A;  3QOU A;  3LCA A;  3APF A;  1IYG A;  3CVP A;  4UI9 J;  3ZHE A;  4FU3 A;  3UMV A;  1IQR A;  4XE0 A;  3CK8 A;  2XRZ A;  2UY1 A;  3L17 A;  4FHK A;  4ILG A;  5KJM A;  4TUU A;  2R5S A;  2WXQ A;  1FVF A;  4M3O A;  2VGY A;  5CHE E;  5FQ6 A;  2KCK A;  4R7L A;  4N5C A;  4J8D A;  3O48 A;  1INZ A;  3D9L A;  3HDX A;  1HU3 A;  1ZBP A;  2AW6 A;  3PS6 A;  4NQ0 A;  5AEN A;  3IEG A;  4B89 A;  3DBS A;  3SBS A;  4JHK A;  3JYS A;  2PZI A;  4UI9 C;  4GA0 A;  4WUY A;  3PH0 C;  3I4G A;  3QAQ A;  1Z6T A;  2RG8 A;  2WXH A;  1JPL A;  3E4B A;  4BTA A;  3FEX A;  1PAQ A;  2J9Q A;  4MLP A;  3UT7 A;  4BT9 A;  1TJF A;  4EBA A;  3JUI A;  4GAA A;  1TEZ A;  3KS2 A;  1ZU2 A;  5KCM A;  3QWV A;  2BF0 X;  4WND A;  2I1K A;  3LVQ E;  5A23 A;  4AIF A;  1HX8 A;  2VSN A;  5G05 C;  3RRN B;  4EBA G;  3CST A;  3PDN A;  3ONK A;  4MRU A;  2C0M A;  1NA0 A;  2FUL A;  4ANX A;  5LCW C;  3UQ3 A;  4URK A;  1ELW A;  1HE8 A;  4ILI A;  5G04 C;  4AOF A;  4KVO A;  4IN3 B;  2XPI A;  2Y4U A;  4PUC A;  4A55 A;  2Y4T A;  2MRI A;  3MGB A;  3SBT B;  2V0P A;  4KT6 B;  3O4Z A;  4ME2 A;  4RSY A;  4AXH A;  4AV7 A;  3ZPJ A;  3SNX A;  3RJV A;  2XGM A;  3R7R A;  4KVM A;  2UWJ G;  1H6K A;  1EDU A;  3TL5 A;  4TV3 A;  4JA9 A;  1Z3X A;  5G04 J;  4HS2 A;  3CIA A;  3B7T A;  2IJG X;  3ZN3 A;  3S7B A;  4ANU A;  3SHF A;  1JUQ A;  3FTX A;  4GB9 A;  4C0M A;  4YND A;  2XQ0 A;  3KEZ A;  4AY5 A;  1P5Q A;  4DJA A;  3FUH A;  3PUJ A;  3AS8 A;  3D9O A;  5FZS A;  5FZR A;  2HR2 A;  3G2S A;  4CDM A;  3K9I A;  3CR3 A;  4OVU A;  2MHK A;  5AJD A;  4B8A A;  3LVR E;  1WY6 A;  5JJ7 A;  1HS6 A;  1B89 A;  3CVN A;  4ANW A;  3CSF A;  5ANL A;  1XGW A;  4XIF A;  1H19 A;  3NZU A;  1E8Z A;  2I2O A;  2NSZ A;  3CKC A;  3CHO A;  1L5J A;  2OVF A;  2WMN A;  4UQZ A;  5E76 A;  3SFZ A;  4ACL A;  3LDZ A;  3C98 A;  2GGF A;  2UY1 B;  3IV0 A;  2LO6 A;  2WXP A;  4FJZ A;  5CMY A;  2LSU A;  3HHM A;  4I17 A;  5ENN A;  3MV3 B;  3AS5 A;  1QNF A;  3JQ1 A;  4G2V A;  4HOQ A;  4ILH B;  4YVQ C;  2V8S E;  3L54 A;  1N52 A;  3UT8 A;  4H7Y A;  4J8E A;  3SI5 A;  5KJN A;  1OUV A;  3UPV A;  2PM6 A;  5M72 A;  4CGV A;  4CGW A;  1HG5 A;  1HXI A;  3VTY A;  4FP7 A;  3QNK A;  4I9C A;  3L13 A;  2AXU A;  4I2W A;  4E6H A;  4A3V A;  5LX8 A;  4NRH B;  2WB2 A;  2BUG A;  4U0S A;  2Y3A A;  4ABN A;  1A17 A;  4J6I A;  4AVX A;  1HF8 A;  5BNW A;  1NP7 A;  3FUL A;  3FU5 A;  3ONL A;  3TXM A;  3URZ A;  5G55 A;  4EQF A;  5G2N A;  4JPS A;  2KCL A;  4L7T A;  5FWQ A;  2C0L A;  4A1G A;  2VQ2 A;  3KAE A;  3ESL A;  1JWF A;  2I1J A;  2VSO E;  2XEV A;  5EX0 A;  2IQC A;  2VGX B;  3MYV A;  5BV0 A;  4I2Z A;  4KZ0 A;  3CVQ A;  2DCP A;  3APD A;  4AY6 A;  4GZ6 A;  3I4R B;  3TXN A;  4JC8 A;  4AM9 A;  4BTB A;  3ZYM A;  4UWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...