5CHEE

Crystal structure of arabidopsis glutamyl-trna reductase in complex with its regulatory proteins
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
119
structure length
119
Chain Sequence
EPKKQELISKLKTGKTFLRNQEPEKAYTEFKIALELAQSLKDPTEEKKAARGLGASLQRQGKYREAIQYHSMVLAISKRESEDSGITEAYGAIADCYTELGDLEKAGKFYDTYIARLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamyl-tRNA reductase 1, chloroplastic
publication title The Arabidopsis glutamyl-tRNA reductase (GluTR) forms a ternary complex with FLU and GluTR-binding protein
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 47
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5cheE00
3CVPA 5FZRA 5KJKA 2PZIA 4GCNA 3EDTB 3GW4A 1KT1A 2J9QA 4BTBA 3LKUA 3PE3A 1IYGA 4BT8A 3RO2A 1ELRA 4GZ6A 1ZBPA 2QFCA 3UQ3A 4YVQC 3UPVA 3JYSA 4I1AA 3ASFA 2V5FA 2VQ2A 2YQ8A 5BT1A 3CKCA 3LPZA 4AIFA 4BTAA 3PE4A 3CEQA 2R5SA 4G2VA 2GW1A 2ONDA 4N2SA 4BT9A 5JJTA 2XGMA 2KCLA 4CGVA 3GZ2A 4GZ3A 1XNFA 4I9CA 2VGYA 3FP3A 1QQEA 3BEEA 3S7FA 3ZN3A 3LCAA 4UQZA 5G05J 2XGSA 4XI0A 4J8EA 4KXKB 4ABNA 4LEUA 4UI9C 3Q4AB 3ULQA 3MEKA 2KCKA 3TGOA 4BWRA 2LSUA 4GYYA 5FTPA 4RG9A 1P5QA 4WNFA 3S7JA 4U0SA 5KJLA 3QDNA 3ZPJA 3CVLA 4Y6CA 3AS4A 3PDNA 5G05C 2HYZA 4Y6WA 1FCHA 4G26A 2FO7A 1OUVA 3QOUA 3KD7A 4JA9A 5CHEE 5CCMA 5LCWC 2VSYA 4N39A 4CGWA 5AYWD 3LY9A 4KBQA 3RO3A 3CK7A 4GA0A 4J8FA 3Q47B 4AY5A 5CCLA 1QZ2A 3MV2B 4UQYA 3CV0A 1HH8A 4GCOA 3CVNA 3Q15A 2VSNA 4GZ5A 2LNIA 4GYWA 3K9IA 4N3AA 4AY6A 1A17A 3AS8A 5ARGA 3S7DA 2WPVA 1WM5A 4HOTA 3CK8A 2PQNA 2XPIA 2NC9A 3MKRA 4WNEA 4GA1A 3UUXA 2KATA 5FT9A 1ZU2A 4NQ0A 4KYOB 1YA0A 3ASDA 3ZGQA 4I17A 2BUGA 4G24A 1HZ4A 2XCBA 5JJ6A 4IN3B 3Q49B 3KS2A 4U0UA 5BW8C 1TJCA 2HR2A 4N3BA 3TG4A 3HYMB 2VGXB 2Y4UA 2Y4TA 3LY7A 3TG5A 3ZFWA 5EX3A 2JLBA 5EX0A 3QKYA 3SZ7A 3LY8A 3WXXA 2XEVA 2KC7A 4GYOA 3OXFA 5DBKA 5G04J 2E2EA 2LSVA 4GPKA 2C0LA 2Q7FA 5DIZA 4UI9K 4I2ZA 5EKQD 2HO1A 3N71A 3MV3B 4H7XA 4F3VA 2AVPA 5FZQA 4G1TA 4U07A 2VYIA 3ESKA 3URZA 4AM9A 3TAXA 4N2QA 3CVQA 5HQ8A 3IEGA 1PC2A 4W9RA 3S7BA 5KJNA 3VTYA 1KT0A 4JA7A 3ZHEB 5ARFA 2XGOA 4XI9A 4I9EA 4NRHB 4CDRA 1NA3A 2VGXA 4HOQA 5D0QD 5JJ7A 1HXIA 4ME2A 3E4BA 4G25A 3U3WA 2PL2A 3QWPA 4U04A 1NZNA 3RU0A 1NA0A 3RIBA 5D0OD 5KJMA 4H7YA 4U0ZA 4APOA 3ASHA 4J0UA 3Q5MA 3LYAA 3U4TA 4WNDA 4UI9J 2WQHA 2FI7A 4N5CA 1WAO1 2FF4A 1B89A 5FZSA 2C0MA 2C2LA 2XCCA 3GZ1A 2YHCA 2I6HA 3FWVA 2UY1B 4JL0A 4JHRA 2UWJG 3OXLA 4HOUA 5A7DB 1KLXA 1IHGA 3SF4A 3ZHEA 4RG6A 3ASGA 3KAEA 3R9AB 5LCWJ 2DBAA 4N3CA 4I2WA 3RJVA 2L6JA 5M72A 3QWWA 5C1DA 2PQRA 4J8DA 4A1SA 5BNWA 3O48A 4G23A 4GA2A 3RKVA 2KCVA 4XIFA 3AS5A 3GYZA 3FFLA 2FEZA 3OXGA 3QWVA 2IFUA 4EQFA 4WUYA 3NF1A 2MHKA 5FJYA 2OOEA 2IF4A 4O6FA 4HORA 4B94A 3CK9A 1E96B 3VTXA 2P58C 1Y8MA 3CKBA 1W3BA 4HOSA 1ELWA 4YNDA 5A6CA 3MA5A 5HI7A 2UY1A 4WNGA 5G04C 2FBNA 4UQXA 4YVOA
chains in the Genus database with same CATH superfamily
2IU1A 5FZRA 5KJKA 4GCNA 4DX7D 2CHZA 3U66A 2J9QA 3PE3A 1IYGA 3RO2A 1ELRA 4Z68A 4DLQA 2J08A 5BXUA 2QFCA 3DXKG 3MKQA 1H6KA 2BKGA 4EPZA 2AW6A 5BT1A 2CFZA 2JABA 4PH4B 2P9SG 3B7RL 2R5SA 4FHKA 4U96D 5JJTA 4ILHB 2KCLA 1TJFA 5AENA 3JUEA 3D9MA 3MGBA 3RRUA 4O1OA 4CCAA 4I9CA 3BG1B 2Y69E 3FP3A 3BEEA 3S7FA 3LCAA 2F0YA 3V2OA 3DSTA 1SZ9A 2XGSA 4K0RA 3MYVA 3C3OA 4J8EA 4BETA 1TEZA 5CRUA 1KPSB 1AWCB 2DCPA 4UI9C 3Q4AB 1SA5A 3SBTB 4ANXA 5G2NA 2EILE 2JEKA 1VDYA 3AG1E 3B7BA 5T8IA 3SFYA 4BESA 4K5CA 2IO3C 4WNFA 3S7JA 4GU5A 4PS7A 3TWSA 4L9PA 1MX4A 3CVLA 3PZ1A 4FULA 3PDNA 5G05C 4CT4A 2XEEA 2ZU6B 3JQ1A 4G26A 3AAAC 2FO7A 4AJWA 3NZSA 3JXJA 1OUVA 1L5JA 3QOUA 3JXIA 2WXNA 3W9GA 4U95D 5LCWC 3VLEA 3I4RB 1N0RA 2IONA 2XS8A 2F37A 3CHQA 3NZUA 5J08A 4TXQA 5EYLA 5AYWD 2V8SE 4HBDA 3ASNE 3LY9A 4KBQA 1O1TA 1FT2A 3DSSA 5EIDA 5CCLA 4WAFA 1V54E 4JB8P 3OTNA 2WB2A 3LDZA 2VSNA 4EECA 1FVHA 2EIJE 3ENEA 4NACA 3D9OA 5ITZF 1FVFA 3FTXA 3I4GA 4DJAA 1S70B 2RKKA 2P9IG 1WM5A 4HOTA 3CVXA 4A55A 2NC9A 2V0PA 4TXPA 5EDSA 4LSZE 1H6OA 5D66A 5LOZA 2H6IA 2V4HC 5E76A 2LUHA 4GTRA 4ATGA 1IQUA 2P9KG 3UKRG 4JC8A 4JW1A 2PM6A 2XCBA 5KWDA 3SBSA 1YYHA 3TWRA 3KS2A 1TJCA 2HR2A 3T8KA 3CR3A 1FPPA 5ENNA 2Y4UA 3SFZA 3G2UA 1Z5SC 1E8ZA 3ZYQA 1EDUA 2JLBA 5ENPD 1Z6TA 4DX5D 2GRLA 3RAUA 3SZ7A 4FA6A 4E6HA 5DBKA 5CMWA 2E2EA 2R03A 4J7WA 5G55A 5T3RA 4NURA 5BV1A 3DEPA 3TXMA 1TNBA 2HO1A 2LAIA 5AARA 3MV3B 2RFAA 4ANVA 4URKA 2FO1E 5FZQA 3F6QA 5IY5E 1O5MA 4G1TA 3ESKA 3HRAA 3HXEA 1HS6A 2QY7A 3TWQA 2GRQB 3ABKE 2VSXE 4FHJA 3OAWA 2XRZA 2KM4A 5KJNA 3V79K 1KT0A 1JCSA 3ZHEB 2XPZA 4V3IA 3DEOA 3HG0D 3FU6A 4P29A 5CRVA 2OV8A 4ME2A 3C3RA 4G25A 1H6PA 1Q2ZA 2GRNB 4ANUA 1NZNA 3FUKA 3RIBA 5KJMA 4H7YA 2XHEA 3RRNB 3ASHA 4XEIG 1PAQA 4C0EA 3U4TA 2R17C 3L54A 4JXTA 1WAO1 4IYPA 2WMNA 1HF8A 4GTTA 2B0OE 3L17A 4GPMA 3FTVA 2C0MA 2DZNA 4PS8A 1OWPA 4U8HA 4TV3A 4LCTA 2I6HA 2UY1B 4JL0A 2X6IA 2AXVA 1HE8A 4EZKA 4EBAA 1E90A 4EBAG 4ZFHA 3SF4A 3FULA 3ZHEA 5BPPA 5ENQD 5BUZA 1Y6IA 3EJNA 2XQ0A 3ASGA 3R9AB 3ZYKA 2DWZA 2J07A 5B1BE 1N4RA 2L6JA 3QWWA 2PQRA 3D9IA 4A1SA 5BNWA 3TWXA 4XIFA 2KCVA 3C3QA 1E8YA 3GYZA 2EQXA 4ATZD 4I1MA 2FEZA 2QZAA 3PUJA 3NF1A 1U3CA 4M7CA 2IF4A 4JVSA 3VTXA 4M3OA 4LNUD 2MOWA 3D9JA 1XGWA 5FQ4A 5CBOA 3HXFA 3UI2A 2AJAA 3TWVA 5JMND 4MBGA 1TYQG 2UY1A 5G04C 2R59A 2FBNA 4KT6B 3FTUA 4L7TA 2VTBB 3PRZA 4YDEA 1KT1A 3LKUA 3GZSA 4R7LA 1HFAA 3UIPC 4QQIA 1ZBPA 2I9CA 2XEHA 5AN8A 4HI8A 3UQ3A 3Q73A 3R7RA 1KZPA 1UG3A 2V5FA 3J5PA 3CKCA 3FU5A 3C72A 1OT8A 4G2VA 3HXDA 2PM7A 2XGMA 4B89A 4CEMA 4LERA 3CHRA 1IXVA 4GZ3A 4DK5A 2DYSE 1LD8A 4GTMA 3U64A 1N4QA 2VGYA 1QQEA 2R02A 4ACLA 4FLBA 3CLJA 3TXNA 4Q96A 2X38A 4AP2A 1S64A 1BLXB 4DX2A 3ESLA 3AU5A 5D2MC 2VTBA 5CMYA 3G2WA 4K03A 3BUAA 2LSUA 1AP7A 5EILA 5FTPA 4PS3A 1WDYA 3Q9UC 4U0SA 3SHFA 3L22A 1HG2A 5HRYA 2WXRA 4BX8A 1MQSA 3DPYA 4F1SA 1N52A 4OAVB 2IQCA 1MZCA 3AG2E 3UIOC 5CCMA 4YDYA 3PNTB 4A3VA 3SQVA 2WXQA 3FUMA 3ML8A 2VSYA 4CDNA 4N39A 3U9WA 3RO3A 4KVMA 5LX8A 3CK7A 4GA0A 4BSZB 2H6FA 4EHMA 3DXMG 5H7PA 4B8AA 3FUNA 2WXOA 1QZ2A 3D9KA 3ZUVB 2I1JA 2AWIA 3CVNA 2X6FA 4CDMA 3I5PA 2LNIA 2ZIRA 4GYWA 4N3AA 4GMJA 4AY6A 3HHMA 3DPDA 3PH0C 4JD2G 3AS8A 1A5EA 1ELKA 2IEJA 2WPVA 3TWTA 4J8YA 3CK8A 1EPUA 2PQNA 4WNEA 4GA1A 1N4PA 3CVWA 2QYJA 1TR4A 4OVUA 5FT9A 1WY6A 2CFUA 4FADA 1N54A 4G24A 3ZU7B 4IN3B 2CG2A 3Q49B 1SA4A 3BG0B 4G11A 5FQ6A 4ANWA 2Y4TA 2Y1LE 5EX3A 5EX0A 1H2TC 3QKYA 3LY8A 3CHPA 3WXXA 3MX3A 3ML9A 2WXPA 4AXHA 4HI9A 2YINA 5HS0A 4B93B 3UM0A 2LSVA 4GPKA 4B0ZA 4TUUA 5DIZA 3NB2A 3VLFA 3N71A 3ZKJA 3J5QB 4H7XA 2J4BA 3DSUA 3FH7A 1YCSB 2GROB 4DLOA 2XPYA 3URZA 4AM9A 4N2QA 3CVQA 2GRPB 3PZ4A 4U7EB 1PC2A 3LXUX 3S7BA 3VTYA 2P9UG 4JA7A 5ARFA 2XGOA 3FUFA 4XI9A 3EHMA 4NRHB 2DZOA 5JA4D 1N0QA 4CDRA 1NA3A 5KCMA 2CHWA 1PY1A 3PUKA 4HOQA 3BQOA 2WMOA 3L13A 3QWPA 4U04A 3RRMB 5CECB 5BXOA 2WXMA 4I43A 3RU0A 1NA0A 4QFVA 2E0IA 4FJYA 4ILIA 5D0OD 4U0ZA 4APOA 1OXJA 3LYAA 4UI9J 4KZCA 5KBAA 2FF4A 2L6BA 4OVVA 3ULYA 1LF8A 2GRRB 2AXZA 3D9LA 1SZAA 4UUCA 3W9FA 4UWHA 4HRNA 3GZ1A 1QNFA 4OYSA 2MYOA 3CVVA 2J49A 5C2YA 2WXFA 4IRUA 2UWJG 3OXLA 3Q9NC 3R9MA 3G2VA 2VJ8A 5A7DB 2X3MA 2XZDG 1KLXA 1IHGA 3CHOA 2EIKE 2YNQA 3D9PA 4L2LA 3JQ0A 3FUHA 5LCWJ 2I2OA 2V4LA 2F8XK 2LO6A 4HFGA 5EYPF 5M72A 3B13A 3O48A 4K5AB 1GW6A 3APFA 2KXPC 1N95A 3FFLA 4XX5A 2AXUA 3SI5A 3EHRA 3RSEG 3E32A 2L9BA 5FJYA 5FIOA 3FUIA 3V31A 4HORA 3L08A 3IHVA 4O60A 3ZNGA 1RW2A 3CKBA 1UN8A 2WXIA 3FUDA 4AOFA 4D10C 3QK0A 3CSFA 4L23A 1BD8A 1DCEA 3LS8A 4KVOA 3IHYA 5CEDB 1K1AA 4WNGA 3CVPA 2Y0BG 4FP7A 4LRZA 1V55E 4BY6A 4BFRA 4RSYA 4GTVA 2X6KA 3EDTB 3L82A 1OCRE 4PDXA 2BF0X 2J8SD 5JHBA 4GZ6A 3MZLB 3DRAA 3SO8A 3FH8A 3FH5A 4G8LA 3JYSA 3LEWA 1BU9A 4I1AA 3ZEFA 3ASFA 1U3DA 1UJJA 2BTDA 2VQ2A 2YQ8A 4GTQA 1LD7A 2I1KA 3EUVA 2NXPA 3G2SA 4DUIA 3CEQA 3ZRHA 2LXLA 4TRQA 4N2SA 3V30A 4BT9A 2L0TB 4A63B 2QYUA 1HG5A 1MYOA 3GZ2A 3HVEB 4LNBA 5ANRA 3TWWA 4L2YA 3O4ZA 3JUIA 3ZN3A 2ZISA 3UX4A 4N5QA 4RVBA 4HLEA 4ABNA 1DVPA 3VLDA 1NFIE 5A23A 5EN5D 4I1OB 4GZDA 3FUEA 3MEKA 1S63A 4JEUA 4FLHA 3SFXA 3RK6A 4BWRA 3PS6A 1BI7B 3KSQA 1OWMA 4Q69A 4JHJA 4AVXA 4HS2A 3EU5A 1E7VA 3PEVB 2IY0C 1P5QA 3UM1A 5KJLA 4DPRA 2F8YA 3QDNA 3ZPJA 4Y6CA 4UWLA 3AS4A 5ENRD 3IXEA 4WWOA 4Y6WA 1FCHA 3TWUA 5FWQA 3CIAA 1UOHA 3KD7A 4GMLA 3ZYLA 1OCOE 3QNKA 1D8EA 3D3MA 4F6RD 3PZ3A 4OAUC 3HVEA 3UXGA 4CGWA 2EIME 2P2CP 1OWLA 3ASOE 3FTYA 4J8FA 1HO8A 3APDA 4J6IA 3QB2A 3MV2B 1EF1C 1G3NB 3CV0A 4J8SA 3CVYA 1HH8A 2ETAA 4GCOA 1N4SA 3HXBA 4AEZC 3MJWA 3HXCA 3FTWA 1A17A 5AQ9A 1DC2A 5KNGA 3DWLG 3E33A 1OWOA 5ARGA 4K5BA 3IKOB 3B7UX 2A4ZA 1K1BA 3LJ3A 4ACKA 5CEAA 2GRMA 2J09A 1K8KG 3UT7A 2WQ6A 3BU8A 3APCA 2H6GA 4HLLA 2WQ7A 4EZJA 1YA0A 3ASDA 3ZGQA 4DX6D 2BUGA 1HZ4A 3CGHA 5JJ6A 5AQAA 2HE0A 4YDWA 1UJKA 2M63A 3PZ2A 1TN6A 1MHQA 5FQ7A 4U0UA 5BW8C 2MRIA 3TG4A 4YDOA 3HYMB 2VGXB 4BERA 3ONLA 3Q7AA 3B7SA 3FHEA 3LY7A 3TG5A 3TL5A 2ETBA 1BPOA 1O1SA 2IOSA 2KC7A 4GYOA 3OXFA 5G04J 3ONKA 3PVLA 2Q7FA 4UI9K 3L16A 1QBQA 2KBXA 4CYMD 5CERB 4U07A 2ZGGA 3SNXA 3C5RA 1K3ZD 1IQRA 3L9TA 3AU4A 5FQ8A 3T5XA 5ENSD 1INZA 3IBEA 4W9RA 1N11A 3AG3E 5AJDA 1ZB1A 4JPSA 1Z3XA 4KZ0A 3R7QA 4BEPA 4EZLA 3UTMA 2VGXA 4IULA 1DNPA 1UN9A 4GTSA 5JJ7A 2PNNA 2CHXA 3E4BA 3U3WA 4JZYA 2PL2A 3E37A 1TNOA 3LVRE 3Q7FA 4FC8A 2ILRA 4F53A 4CT0A 1TNYA 2P9PG 3FTSA 3QJZA 2EINE 3V2XA 2RFMA 4WNDA 2FI7A 1SQMA 3SY2A 1JCRA 2XZTG 1B89A 4CRWA 5B1AE 5FZSA 3UKUG 2XCCA 4F1PA 4GAAA 4MKTA 3E30A 3UINC 2YHCA 3NOGD 3FWVA 3HIZA 1E7UA 1OCCE 3QC1A 3KEAA 4C9BB 1U2VG 1SW6A 2VSOE 4A1GA 4RG6A 3UM2A 2IO2C 2OEWA 4Q94A 1N9AA 1D9SA 4I2WA 3RJVA 3KEZA 1HU3A 4FJZA 3CQGB 2HM8A 2RD0A 3UT4A 4JEHA 2P9NG 3DSVA 2RG8A 4G23A 4GA2A 3RKVA 1BI8B 2NSZA 3JCKC 3QWVA 4E85A 4TXRA 2MHKA 4F7AA 2OCCE 4O6FA 2OVBA 1X81A 3EHNA 1NP7A 1W3BA 3KSLA 1ELWA 3DSWA 2FULA 1MX6A 4XKBA 5A6CA 3MA5A 3D9NA 2WM9A 4HRMB 5FINA 4HRLA 2PZIA 4HB5A 2BKKB 3GW4A 4RLYA 4BTBA 2Y3AA 3LVQE 4BT8A 3D9HA 3FY4A 4NIKA 4I6JA 1D8DA 3T8MA 4YVQC 3CVUA 3FU0A 3UPVA 1EYHA 1Z3YA 4JHKA 1KZOA 3G2TA 3LPZA 4AIFA 4BTAA 3PE4A 3NQPA 2GW1A 2ONDA 2A5UA 3CQCB 2H6HA 3EHQA 3PZDA 3Q75A 4CGVA 5HKPA 3EU9A 1XNFA 1E8XA 3QAQA 3MCXA 2IJGX 5KNHD 4UQZA 4GTOA 5G05J 4TUMA 4XI0A 3CHMA 3ZYMA 3C98A 4KXKB 4LEUA 3ISMC 2OVFA 3ULEG 3ULQA 5CBNA 4LG6A 2KCKA 2V5QC 3TGOA 3Q79A 4GYYA 2WXHA 4RG9A 1LTXA 1IHBA 2A5EA 2IOLA 2YHEA 2R05A 2HYZA 3B7TA 5AAOA 2LAHA 4U8YD 1O1RA 4JA9A 4UWFA 5CHEE 3T9KA 3I3NA 3CHSA 1JPLA 2WXJA 2DVWA 1JUQA 4O1PA 3AJIA 4ILGA 3EIQC 3IV0A 2WXGA 4UWGA 1H2VC 4B8CB 4BX9A 3Q47B 4AY5A 2ZGDA 4UQYA 4MRUA 4HXIA 2QC9A 3Q15A 1TNZA 1NL4A 3PREA 3AG4E 4GZ5A 3ZXSA 5AJLA 3HDXA 4GMRA 1MJ0A 4PUCA 3K9IA 4G8KA 4XE0A 5LFAA 4BSXA 4DI3A 3S7DA 4C0MA 1JWFA 2X6HA 2XPIA 3MKRA 1UW4B 3UUXA 2KATA 1JCQA 2DIWA 1WG0A 4DI4A 3P1UA 4LUNU 1ZU2A 4NQ0A 4HVBA 1TN8A 4KYOB 5T4YA 4WWNA 4I17A 1JWGA 4U8VD 3E34A 3UMVA 2OEVA 4GTPA 4GB9A 2P9LG 1H0AA 2J4DA 5LP0A 5JHAA 4N3BA 3FEXA 3Q78A 1NI1A 1SVXA 2ZXWE 4U63A 4KMOA 3ZFWA 1E8WA 1OCZE 3UM3A 2XEVA 4C48B 2DYRE 3LJNA 3DSXA 3EIJA 5ANLA 2NYJA 2C0LA 3B95A 4I2ZA 3QARA 5EKQD 3UT8A 1YMPA 2BEDA 3P2BA 3SGHA 4F3VA 2AVPA 2L0IA 1TN7A 2ETCA 2VGEA 2VYIA 1HX8A 3ZW3A 3PEUB 3TAXA 2KZTB 4CZ2D 5HQ8A 2WXKA 3IEGA 1FT1A 1RZ4A 1TNUA 3FU3A 3CSTA 4I9EA 4RQIA 3ZXPA 4GZCA 2LXMA 4APFA 1IKND 5D0QD 1HXIA 3L6AA 4I6GA 2R2LA 3FUJA 4L1BA 2XENA 5AQ7A 1QYMA 4J0UA 3Q5MA 2WQHA 4N5CA 5EIBE 3WG7E 1H19A 3TJPA 4DX1A 2C2LA 2WXLA 1MX2A 1X5BA 3T5VA 3FTZA 4MS6A 2KZTA 4JHRA 3S2AA 4LNGA 5ENOD 4ZHBA 4A3TA 3FEYA 4HOUA 3FDHA 4WWPA 4AV7A 5J90A 2XS1A 3KAEA 2DBAA 4XZ4A 4N3CA 4HQDA 3MKQB 4FU3A 1OWNA 5C1DA 3NBNB 4XKCA 3ZVVA 4J8DA 4I6EA 1N94A 3DBSA 3NAWA 1S0PA 2GGFA 1DCQA 1H2UA 3NOCD 3AS5A 3X2QE 3OXGA 2X6JA 4DRXE 5B3SE 4HNAD 2IFUA 4EQFA 4WUYA 5AQBA 4X8QA 4UWKA 5E75A 2OOEA 4B94A 3CK9A 1E96B 2P58C 1Y8MA 5AIJA 2B6CA 4HOSA 2WVIA 3PNLB 4MLPA 3SD5A 4YNDA 2CG3A 5BV0A 1OY3D 5ENTD 3ABLE 5HI7A 3ZIMA 3ABME 2XRYA 4UQXA 4YVOA
chains in the Genus database with same CATH topology
2IU1A 3CVPA 4KT6B 3FTUA 5FZRA 4FP7A 5KJKA 4LRZA 4L7TA 2PZIA 4BY6A 4GCNA 4BFRA 2VTBB 3PRZA 4RSYA 2X6KA 3EDTB 3GW4A 4PDXA 1KT1A 2BF0X 2CHZA 3U66A 2J9QA 4BTBA 2Y3AA 3GZSA 3LKUA 1HFAA 3LVQE 4R7LA 5JHBA 3PE3A 1IYGA 4BT8A 3RO2A 1ELRA 4GZ6A 1ZBPA 3MZLB 4DLQA 2J08A 3FY4A 2I9CA 2QFCA 3MKQA 4I6JA 3FH8A 3FH5A 3UQ3A 1H6KA 3T8MA 4YVQC 3R7RA 3FU0A 3UPVA 3JYSA 3CVUA 4EPZA 1EYHA 3LEWA 4I1AA 3ZEFA 1UG3A 2AW6A 1Z3YA 3ASFA 4JHKA 2V5FA 1U3DA 1UJJA 2BTDA 2VQ2A 2YQ8A 3G2TA 5BT1A 3CKCA 3LPZA 4AIFA 4BTAA 2CFZA 2I1KA 3FU5A 4PH4B 2NXPA 3G2SA 3PE4A 3B7RL 2R5SA 3CEQA 3NQPA 4G2VA 3ZRHA 2GW1A 2ONDA 4FHKA 4TRQA 4N2SA 2PM7A 4BT9A 2A5UA 2L0TB 3CQCB 5JJTA 2XGMA 4B89A 3PZDA 4CEMA 4ILHB 2KCLA 1HG5A 4LERA 4CGVA 3CHRA 3GZ2A 4GZ3A 1TJFA 4DK5A 5AENA 3D9MA 3MGBA 1XNFA 3HVEB 3RRUA 5ANRA 4I9CA 3U64A 3BG1B 4CCAA 1E8XA 2VGYA 3FP3A 2IJGX 3MCXA 3QAQA 4L2YA 1QQEA 3BEEA 3O4ZA 3JUIA 3S7FA 3ZN3A 3LCAA 4UQZA 5G05J 1SZ9A 2XGSA 4ACLA 4FLBA 4K0RA 3MYVA 3CLJA 4XI0A 4J8EA 3UX4A 3TXNA 3CHMA 4Q96A 3ZYMA 2X38A 3C98A 4KXKB 4RVBA 4AP2A 4HLEA 1TEZA 4ABNA 4LEUA 1DVPA 3VLDA 2DCPA 2OVFA 5A23A 4UI9C 4I1OB 3Q4AB 4GZDA 3ULQA 3FUEA 3MEKA 3SBTB 4ANXA 3ESLA 4JEUA 5G2NA 4DLOA 3AU5A 2KCKA 4FLHA 5CMYA 2VTBA 2JEKA 3TGOA 3RK6A 4BWRA 3G2WA 4K03A 1VDYA 3PS6A 2LSUA 4GYYA 1OWMA 4Q69A 2WXHA 5T8IA 4JHJA 5FTPA 4PS3A 4AVXA 4HS2A 4RG9A 1E7VA 3PEVB 1P5QA 4WNFA 3S7JA 4GU5A 4U0SA 4PS7A 3SHFA 5KJLA 5J90A 4DPRA 3L22A 1HG2A 3QDNA 2IOLA 3ZPJA 2YHEA 3CVLA 4Y6CA 2WXRA 3AS4A 4UWLA 4FULA 3PDNA 4BX8A 4WWOA 5G05C 2HYZA 4CT4A 4Y6WA 3B7TA 2ZU6B 3JQ1A 1FCHA 4G26A 1MQSA 2LAHA 2FO7A 4AJWA 3NZSA 4F1SA 1N52A 2IQCA 5FWQA 3CIAA 1OUVA 1L5JA 3QOUA 3KD7A 2WXNA 4JA9A 4UWFA 4GMLA 5CHEE 3I3NA 3CHSA 3ZYLA 5CCMA 5LCWC 3QNKA 1JPLA 3VLEA 2WXJA 3D3MA 3I4RB 3PNTB 4A3VA 1JUQA 2WXQA 2IONA 3FUMA 4ILGA 3ML8A 3CHQA 3EIQC 3IV0A 2VSYA 2WXGA 3NZUA 4CDNA 4UWGA 5J08A 4N39A 3HVEA 1H2VC 4CGWA 5AYWD 4B8CB 2V8SE 3U9WA 3LY9A 4KBQA 3RO3A 4KVMA 4BX9A 5LX8A 3CK7A 4GA0A 1OWLA 3FTYA 4J8FA 3Q47B 1HO8A 4B8AA 3APDA 4AY5A 5CCLA 3FUNA 4J6IA 2WXOA 1QZ2A 3D9KA 3MV2B 3QB2A 4WAFA 4UQYA 1EF1C 3CV0A 4J8SA 4MRUA 3CVYA 1HH8A 4HXIA 3OTNA 4GCOA 2WB2A 4YVOA 2I1JA 2AWIA 3CVNA 3LDZA 3Q15A 2VSNA 4EECA 1FVHA 2X6FA 4CDMA 3PREA 4GZ5A 3I5PA 3ZXSA 5AJLA 3HDXA 4AEZC 2LNIA 4GYWA 3MJWA 4PUCA 3K9IA 3ENEA 3FTWA 4NACA 4GMJA 4N3AA 4AY6A 3HHMA 3DPDA 3PH0C 1A17A 3D9OA 4XE0A 1FVFA 3AS8A 3FTXA 5LFAA 3I4GA 1OWOA 5ARGA 4BSXA 4DJAA 1ELKA 4DI3A 3IKOB 3B7UX 3S7DA 2WPVA 2A4ZA 4C0MA 1WM5A 1JWFA 2X6HA 4HOTA 3CVXA 3CK8A 1EPUA 4A55A 2PQNA 2XPIA 2NC9A 3MKRA 4WNEA 2V0PA 3LJ3A 1UW4B 4GA1A 4ACKA 3UUXA 2KATA 5EDSA 2GRMA 2J09A 2DIWA 3CVWA 3UT7A 2WQ6A 4DI4A 3P1UA 4OVUA 5FT9A 4LUNU 1WY6A 3APCA 1ZU2A 2CFUA 4NQ0A 5LOZA 2WQ7A 4EZJA 4FADA 4HVBA 4KYOB 1YA0A 1N54A 3ASDA 5E76A 3ZGQA 5T4YA 4ATGA 1IQUA 4WWNA 4I17A 1JWGA 2BUGA 4G24A 4JC8A 1HZ4A 4JW1A 2PM6A 2XCBA 3UMVA 5JJ6A 4IN3B 2CG2A 3SBSA 4GB9A 3Q49B 1H0AA 2M63A 2J4DA 1UJKA 3BG0B 4G11A 1MHQA 5FQ7A 5LP0A 3KS2A 4U0UA 5BW8C 1TJCA 2HR2A 2MRIA 3CR3A 4N3BA 5JHAA 5FQ6A 3FEXA 3TG4A 5ENNA 3HYMB 2VGXB 2Y4UA 3SFZA 4ANWA 2Y4TA 3ONLA 3G2UA 3B7SA 4U63A 3FHEA 1E8ZA 3LY7A 4KMOA 3TG5A 3ZFWA 3ZYQA 1EDUA 1E8WA 3TL5A 5EX3A 2JLBA 5EX0A 1Z6TA 1BPOA 2GRLA 1H2TC 3QKYA 3SZ7A 3LY8A 3CHPA 3WXXA 3MX3A 3ML9A 2XEVA 2IOSA 4FA6A 2WXPA 2KC7A 4GYOA 3OXFA 4AXHA 4E6HA 5DBKA 2YINA 5G04J 5CMWA 3EIJA 2E2EA 5ANLA 2LSVA 5G55A 3ONKA 4GPKA 4B0ZA 5T3RA 2C0LA 3PVLA 4NURA 5BV1A 4TUUA 2Q7FA 5DIZA 3TXMA 4UI9K 4I2ZA 3QARA 5EKQD 3UT8A 2HO1A 2LAIA 3L16A 3VLFA 3P2BA 3N71A 3MV3B 3SGHA 4H7XA 4F3VA 2AVPA 2J4BA 2L0IA 3FH7A 4ANVA 4URKA 5FZQA 4G1TA 4U07A 2VYIA 1HX8A 2XPYA 3ESKA 3PEUB 3SNXA 3ZW3A 3URZA 4AM9A 3TAXA 2KZTB 4N2QA 3CVQA 1HS6A 5HQ8A 2QY7A 1IQRA 3AU4A 2WXKA 3IEGA 1PC2A 5FQ8A 3LXUX 3T5XA 2VSXE 4FHJA 1INZA 3IBEA 3OAWA 4W9RA 3S7BA 2XRZA 2KM4A 5AJDA 3VTYA 5KJNA 1KT0A 4JA7A 3ZHEB 4JPSA 5ARFA 1Z3XA 3FU3A 3CSTA 2XGOA 4KZ0A 2XPZA 3FUFA 3EHMA 4I9EA 4NRHB 4XI9A 4V3IA 3R7QA 4CDRA 4GZCA 1NA3A 5KCMA 2CHWA 1PY1A 3FU6A 4EZLA 3PUKA 2VGXA 4IULA 4APFA 4P29A 4HOQA 1DNPA 2OV8A 1UN9A 5D0QD 5JJ7A 2WMOA 1HXIA 4ME2A 2CHXA 3E4BA 3L6AA 4G25A 2PL2A 3L13A 4JZYA 3U3WA 3QWPA 4I6GA 4ANUA 4U04A 3RRMB 2WXMA 1NZNA 3LVRE 3FUJA 4I43A 3RU0A 1NA0A 3FUKA 4FC8A 4QFVA 4L1BA 2E0IA 2ILRA 4FJYA 4ILIA 3RIBA 5D0OD 4F53A 4CT0A 4H7YA 5KJMA 2XHEA 3FTSA 4U0ZA 3QJZA 3RRNB 3ASHA 4APOA 4J0UA 1PAQA 4C0EA 3Q5MA 3LYAA 3U4TA 2R17C 4WNDA 4UI9J 4KZCA 2WQHA 3L54A 2FI7A 4N5CA 4JXTA 1WAO1 4IYPA 1SQMA 2FF4A 2WMNA 4OVVA 1HF8A 1LF8A 3L17A 1B89A 4CRWA 1H19A 2AXZA 3D9LA 3TJPA 5FZSA 3FTVA 1SZAA 2C0MA 2C2LA 2XCCA 2WXLA 4GAAA 4MKTA 4PS8A 4UWHA 1X5BA 1OWPA 4U8HA 3GZ1A 4TV3A 3T5VA 1QNFA 2YHCA 4LCTA 3FTZA 2I6HA 3FWVA 2UY1B 4OYSA 4JL0A 4MS6A 3CVVA 2X6IA 2J49A 3HIZA 2KZTA 1E7UA 4JHRA 5C2YA 2WXFA 4IRUA 3S2AA 2UWJG 2AXVA 3OXLA 1HE8A 4A3TA 4EZKA 3FEYA 4HOUA 3FDHA 3QC1A 3G2VA 4EBAA 1E90A 4WWPA 4EBAG 4C9BB 2VJ8A 5A7DB 2X3MA 4AV7A 1KLXA 1IHGA 2VSOE 3CHOA 3FULA 3D9PA 2YNQA 3SF4A 3ZHEA 4RG6A 4A1GA 1Y6IA 5BPPA 5BUZA 3EJNA 2XQ0A 3ASGA 3KAEA 3R9AB 4Q94A 4L2LA 3JQ0A 3FUHA 2DBAA 4XZ4A 3ZYKA 2J07A 4N3CA 5LCWJ 2I2OA 4I2WA 2V4LA 3RJVA 3MKQB 3KEZA 1HU3A 2LO6A 2L6JA 3CQGB 4FJZA 4HFGA 4FU3A 1OWNA 5M72A 3B13A 3QWWA 5C1DA 2HM8A 2PQRA 4XKCA 3ZVVA 2RD0A 3UT4A 3D9IA 4JEHA 4J8DA 4A1SA 4I6EA 5BNWA 2RG8A 3DBSA 3O48A 1S0PA 2GGFA 4G23A 1H2UA 4GA2A 3RKVA 1GW6A 2KCVA 3APFA 4XIFA 1E8YA 2NSZA 3AS5A 3JCKC 3GYZA 3FFLA 2EQXA 4XX5A 4I1MA 2AXUA 2FEZA 3OXGA 2X6JA 3QWVA 3SI5A 2IFUA 3PUJA 4E85A 4WUYA 4EQFA 2L9BA 3NF1A 2MHKA 4UWKA 5FJYA 4F7AA 1U3CA 5E75A 2OOEA 3FUIA 2IF4A 4O6FA 4HORA 2OVBA 3L08A 4JVSA 4B94A 3IHVA 3CK9A 1E96B 3VTXA 2P58C 1Y8MA 5AIJA 3CKBA 1UN8A 2WXIA 4M3OA 3EHNA 1NP7A 2MOWA 3D9JA 1W3BA 3FUDA 1XGWA 4AOFA 4HOSA 2WVIA 4D10C 3QK0A 3PNLB 5FQ4A 1ELWA 4MLPA 3CSFA 4L23A 3SD5A 2FULA 4YNDA 2CG3A 4XKBA 5BV0A 3LS8A 5A6CA 3MA5A 4KVOA 5HI7A 3IHYA 3D9NA 2UY1A 3ZIMA 4WNGA 5G04C 2R59A 2FBNA 2XRYA 4UQXA 2WM9A 3CGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVP A;  5FZR A;  5KJK A;  2PZI A;  4GCN A;  3EDT B;  3GW4 A;  1KT1 A;  2J9Q A;  4BTB A;  3LKU A;  3PE3 A;  1IYG A;  4BT8 A;  3RO2 A;  1ELR A;  4GZ6 A;  1ZBP A;  2QFC A;  3UQ3 A;  4YVQ C;  3UPV A;  3JYS A;  4I1A A;  3ASF A;  2V5F A;  2VQ2 A;  2YQ8 A;  5BT1 A;  3CKC A;  3LPZ A;  4AIF A;  4BTA A;  3PE4 A;  3CEQ A;  2R5S A;  4G2V A;  2GW1 A;  2OND A;  4N2S A;  4BT9 A;  5JJT A;  2XGM A;  2KCL A;  4CGV A;  3GZ2 A;  4GZ3 A;  1XNF A;  4I9C A;  2VGY A;  3FP3 A;  1QQE A;  3BEE A;  3S7F A;  3ZN3 A;  3LCA A;  4UQZ A;  5G05 J;  2XGS A;  4XI0 A;  4J8E A;  4KXK B;  4ABN A;  4LEU A;  4UI9 C;  3Q4A B;  3ULQ A;  3MEK A;  2KCK A;  3TGO A;  4BWR A;  2LSU A;  4GYY A;  5FTP A;  4RG9 A;  1P5Q A;  4WNF A;  3S7J A;  4U0S A;  5KJL A;  3QDN A;  3ZPJ A;  3CVL A;  4Y6C A;  3AS4 A;  3PDN A;  5G05 C;  2HYZ A;  4Y6W A;  1FCH A;  4G26 A;  2FO7 A;  1OUV A;  3QOU A;  3KD7 A;  4JA9 A;  5CHE E;  5CCM A;  5LCW C;  2VSY A;  4N39 A;  4CGW A;  5AYW D;  3LY9 A;  4KBQ A;  3RO3 A;  3CK7 A;  4GA0 A;  4J8F A;  3Q47 B;  4AY5 A;  5CCL A;  1QZ2 A;  3MV2 B;  4UQY A;  3CV0 A;  1HH8 A;  4GCO A;  3CVN A;  3Q15 A;  2VSN A;  4GZ5 A;  2LNI A;  4GYW A;  3K9I A;  4N3A A;  4AY6 A;  1A17 A;  3AS8 A;  5ARG A;  3S7D A;  2WPV A;  1WM5 A;  4HOT A;  3CK8 A;  2PQN A;  2XPI A;  2NC9 A;  3MKR A;  4WNE A;  4GA1 A;  3UUX A;  2KAT A;  5FT9 A;  1ZU2 A;  4NQ0 A;  4KYO B;  1YA0 A;  3ASD A;  3ZGQ A;  4I17 A;  2BUG A;  4G24 A;  1HZ4 A;  2XCB A;  5JJ6 A;  4IN3 B;  3Q49 B;  3KS2 A;  4U0U A;  5BW8 C;  1TJC A;  2HR2 A;  4N3B A;  3TG4 A;  3HYM B;  2VGX B;  2Y4U A;  2Y4T A;  3LY7 A;  3TG5 A;  3ZFW A;  5EX3 A;  2JLB A;  5EX0 A;  3QKY A;  3SZ7 A;  3LY8 A;  3WXX A;  2XEV A;  2KC7 A;  4GYO A;  3OXF A;  5DBK A;  5G04 J;  2E2E A;  2LSV A;  4GPK A;  2C0L A;  2Q7F A;  5DIZ A;  4UI9 K;  4I2Z A;  5EKQ D;  2HO1 A;  3N71 A;  3MV3 B;  4H7X A;  4F3V A;  2AVP A;  5FZQ A;  4G1T A;  4U07 A;  2VYI A;  3ESK A;  3URZ A;  4AM9 A;  3TAX A;  4N2Q A;  3CVQ A;  5HQ8 A;  3IEG A;  1PC2 A;  4W9R A;  3S7B A;  5KJN A;  3VTY A;  1KT0 A;  4JA7 A;  3ZHE B;  5ARF A;  2XGO A;  4XI9 A;  4I9E A;  4NRH B;  4CDR A;  1NA3 A;  2VGX A;  4HOQ A;  5D0Q D;  5JJ7 A;  1HXI A;  4ME2 A;  3E4B A;  4G25 A;  3U3W A;  2PL2 A;  3QWP A;  4U04 A;  1NZN A;  3RU0 A;  1NA0 A;  3RIB A;  5D0O D;  5KJM A;  4H7Y A;  4U0Z A;  4APO A;  3ASH A;  4J0U A;  3Q5M A;  3LYA A;  3U4T A;  4WND A;  4UI9 J;  2WQH A;  2FI7 A;  4N5C A;  1WAO 1;  2FF4 A;  1B89 A;  5FZS A;  2C0M A;  2C2L A;  2XCC A;  3GZ1 A;  2YHC A;  2I6H A;  3FWV A;  2UY1 B;  4JL0 A;  4JHR A;  2UWJ G;  3OXL A;  4HOU A;  5A7D B;  1KLX A;  1IHG A;  3SF4 A;  3ZHE A;  4RG6 A;  3ASG A;  3KAE A;  3R9A B;  5LCW J;  2DBA A;  4N3C A;  4I2W A;  3RJV A;  2L6J A;  5M72 A;  3QWW A;  5C1D A;  2PQR A;  4J8D A;  4A1S A;  5BNW A;  3O48 A;  4G23 A;  4GA2 A;  3RKV A;  2KCV A;  4XIF A;  3AS5 A;  3GYZ A;  3FFL A;  2FEZ A;  3OXG A;  3QWV A;  2IFU A;  4EQF A;  4WUY A;  3NF1 A;  2MHK A;  5FJY A;  2OOE A;  2IF4 A;  4O6F A;  4HOR A;  4B94 A;  3CK9 A;  1E96 B;  3VTX A;  2P58 C;  1Y8M A;  3CKB A;  1W3B A;  4HOS A;  1ELW A;  4YND A;  5A6C A;  3MA5 A;  5HI7 A;  2UY1 A;  4WNG A;  5G04 C;  2FBN A;  4UQX A;  4YVO A; 
#chains in the Genus database with same CATH topology
 2IU1 A;  5FZR A;  5KJK A;  4GCN A;  4DX7 D;  2CHZ A;  3U66 A;  2J9Q A;  3PE3 A;  1IYG A;  3RO2 A;  1ELR A;  4Z68 A;  4DLQ A;  2J08 A;  5BXU A;  2QFC A;  3DXK G;  3MKQ A;  1H6K A;  2BKG A;  4EPZ A;  2AW6 A;  5BT1 A;  2CFZ A;  2JAB A;  4PH4 B;  2P9S G;  3B7R L;  2R5S A;  4FHK A;  4U96 D;  5JJT A;  4ILH B;  2KCL A;  1TJF A;  5AEN A;  3JUE A;  3D9M A;  3MGB A;  3RRU A;  4O1O A;  4CCA A;  4I9C A;  3BG1 B;  2Y69 E;  3FP3 A;  3BEE A;  3S7F A;  3LCA A;  2F0Y A;  3V2O A;  3DST A;  1SZ9 A;  2XGS A;  4K0R A;  3MYV A;  3C3O A;  4J8E A;  4BET A;  1TEZ A;  5CRU A;  1KPS B;  1AWC B;  2DCP A;  4UI9 C;  3Q4A B;  1SA5 A;  3SBT B;  4ANX A;  5G2N A;  2EIL E;  2JEK A;  1VDY A;  3AG1 E;  3B7B A;  5T8I A;  3SFY A;  4BES A;  4K5C A;  2IO3 C;  4WNF A;  3S7J A;  4GU5 A;  4PS7 A;  3TWS A;  4L9P A;  1MX4 A;  3CVL A;  3PZ1 A;  4FUL A;  3PDN A;  5G05 C;  4CT4 A;  2XEE A;  2ZU6 B;  3JQ1 A;  4G26 A;  3AAA C;  2FO7 A;  4AJW A;  3NZS A;  3JXJ A;  1OUV A;  1L5J A;  3QOU A;  3JXI A;  2WXN A;  3W9G A;  4U95 D;  5LCW C;  3VLE A;  3I4R B;  1N0R A;  2ION A;  2XS8 A;  2F37 A;  3CHQ A;  3NZU A;  5J08 A;  4TXQ A;  5EYL A;  5AYW D;  2V8S E;  4HBD A;  3ASN E;  3LY9 A;  4KBQ A;  1O1T A;  1FT2 A;  3DSS A;  5EID A;  5CCL A;  4WAF A;  1V54 E;  4JB8 P;  3OTN A;  2WB2 A;  3LDZ A;  2VSN A;  4EEC A;  1FVH A;  2EIJ E;  3ENE A;  4NAC A;  3D9O A;  5ITZ F;  1FVF A;  3FTX A;  3I4G A;  4DJA A;  1S70 B;  2RKK A;  2P9I G;  1WM5 A;  4HOT A;  3CVX A;  4A55 A;  2NC9 A;  2V0P A;  4TXP A;  5EDS A;  4LSZ E;  1H6O A;  5D66 A;  5LOZ A;  2H6I A;  2V4H C;  5E76 A;  2LUH A;  4GTR A;  4ATG A;  1IQU A;  2P9K G;  3UKR G;  4JC8 A;  4JW1 A;  2PM6 A;  2XCB A;  5KWD A;  3SBS A;  1YYH A;  3TWR A;  3KS2 A;  1TJC A;  2HR2 A;  3T8K A;  3CR3 A;  1FPP A;  5ENN A;  2Y4U A;  3SFZ A;  3G2U A;  1Z5S C;  1E8Z A;  3ZYQ A;  1EDU A;  2JLB A;  5ENP D;  1Z6T A;  4DX5 D;  2GRL A;  3RAU A;  3SZ7 A;  4FA6 A;  4E6H A;  5DBK A;  5CMW A;  2E2E A;  2R03 A;  4J7W A;  5G55 A;  5T3R A;  4NUR A;  5BV1 A;  3DEP A;  3TXM A;  1TNB A;  2HO1 A;  2LAI A;  5AAR A;  3MV3 B;  2RFA A;  4ANV A;  4URK A;  2FO1 E;  5FZQ A;  3F6Q A;  5IY5 E;  1O5M A;  4G1T A;  3ESK A;  3HRA A;  3HXE A;  1HS6 A;  2QY7 A;  3TWQ A;  2GRQ B;  3ABK E;  2VSX E;  4FHJ A;  3OAW A;  2XRZ A;  2KM4 A;  5KJN A;  3V79 K;  1KT0 A;  1JCS A;  3ZHE B;  2XPZ A;  4V3I A;  3DEO A;  3HG0 D;  3FU6 A;  4P29 A;  5CRV A;  2OV8 A;  4ME2 A;  3C3R A;  4G25 A;  1H6P A;  1Q2Z A;  2GRN B;  4ANU A;  1NZN A;  3FUK A;  3RIB A;  5KJM A;  4H7Y A;  2XHE A;  3RRN B;  3ASH A;  4XEI G;  1PAQ A;  4C0E A;  3U4T A;  2R17 C;  3L54 A;  4JXT A;  1WAO 1;  4IYP A;  2WMN A;  1HF8 A;  4GTT A;  2B0O E;  3L17 A;  4GPM A;  3FTV A;  2C0M A;  2DZN A;  4PS8 A;  1OWP A;  4U8H A;  4TV3 A;  4LCT A;  2I6H A;  2UY1 B;  4JL0 A;  2X6I A;  2AXV A;  1HE8 A;  4EZK A;  4EBA A;  1E90 A;  4EBA G;  4ZFH A;  3SF4 A;  3FUL A;  3ZHE A;  5BPP A;  5ENQ D;  5BUZ A;  1Y6I A;  3EJN A;  2XQ0 A;  3ASG A;  3R9A B;  3ZYK A;  2DWZ A;  2J07 A;  5B1B E;  1N4R A;  2L6J A;  3QWW A;  2PQR A;  3D9I A;  4A1S A;  5BNW A;  3TWX A;  4XIF A;  2KCV A;  3C3Q A;  1E8Y A;  3GYZ A;  2EQX A;  4ATZ D;  4I1M A;  2FEZ A;  2QZA A;  3PUJ A;  3NF1 A;  1U3C A;  4M7C A;  2IF4 A;  4JVS A;  3VTX A;  4M3O A;  4LNU D;  2MOW A;  3D9J A;  1XGW A;  5FQ4 A;  5CBO A;  3HXF A;  3UI2 A;  2AJA A;  3TWV A;  5JMN D;  4MBG A;  1TYQ G;  2UY1 A;  5G04 C;  2R59 A;  2FBN A;  4KT6 B;  3FTU A;  4L7T A;  2VTB B;  3PRZ A;  4YDE A;  1KT1 A;  3LKU A;  3GZS A;  4R7L A;  1HFA A;  3UIP C;  4QQI A;  1ZBP A;  2I9C A;  2XEH A;  5AN8 A;  4HI8 A;  3UQ3 A;  3Q73 A;  3R7R A;  1KZP A;  1UG3 A;  2V5F A;  3J5P A;  3CKC A;  3FU5 A;  3C72 A;  1OT8 A;  4G2V A;  3HXD A;  2PM7 A;  2XGM A;  4B89 A;  4CEM A;  4LER A;  3CHR A;  1IXV A;  4GZ3 A;  4DK5 A;  2DYS E;  1LD8 A;  4GTM A;  3U64 A;  1N4Q A;  2VGY A;  1QQE A;  2R02 A;  4ACL A;  4FLB A;  3CLJ A;  3TXN A;  4Q96 A;  2X38 A;  4AP2 A;  1S64 A;  1BLX B;  4DX2 A;  3ESL A;  3AU5 A;  5D2M C;  2VTB A;  5CMY A;  3G2W A;  4K03 A;  3BUA A;  2LSU A;  1AP7 A;  5EIL A;  5FTP A;  4PS3 A;  1WDY A;  3Q9U C;  4U0S A;  3SHF A;  3L22 A;  1HG2 A;  5HRY A;  2WXR A;  4BX8 A;  1MQS A;  3DPY A;  4F1S A;  1N52 A;  4OAV B;  2IQC A;  1MZC A;  3AG2 E;  3UIO C;  5CCM A;  4YDY A;  3PNT B;  4A3V A;  3SQV A;  2WXQ A;  3FUM A;  3ML8 A;  2VSY A;  4CDN A;  4N39 A;  3U9W A;  3RO3 A;  4KVM A;  5LX8 A;  3CK7 A;  4GA0 A;  4BSZ B;  2H6F A;  4EHM A;  3DXM G;  5H7P A;  4B8A A;  3FUN A;  2WXO A;  1QZ2 A;  3D9K A;  3ZUV B;  2I1J A;  2AWI A;  3CVN A;  2X6F A;  4CDM A;  3I5P A;  2LNI A;  2ZIR A;  4GYW A;  4N3A A;  4GMJ A;  4AY6 A;  3HHM A;  3DPD A;  3PH0 C;  4JD2 G;  3AS8 A;  1A5E A;  1ELK A;  2IEJ A;  2WPV A;  3TWT A;  4J8Y A;  3CK8 A;  1EPU A;  2PQN A;  4WNE A;  4GA1 A;  1N4P A;  3CVW A;  2QYJ A;  1TR4 A;  4OVU A;  5FT9 A;  1WY6 A;  2CFU A;  4FAD A;  1N54 A;  4G24 A;  3ZU7 B;  4IN3 B;  2CG2 A;  3Q49 B;  1SA4 A;  3BG0 B;  4G11 A;  5FQ6 A;  4ANW A;  2Y4T A;  2Y1L E;  5EX3 A;  5EX0 A;  1H2T C;  3QKY A;  3LY8 A;  3CHP A;  3WXX A;  3MX3 A;  3ML9 A;  2WXP A;  4AXH A;  4HI9 A;  2YIN A;  5HS0 A;  4B93 B;  3UM0 A;  2LSV A;  4GPK A;  4B0Z A;  4TUU A;  5DIZ A;  3NB2 A;  3VLF A;  3N71 A;  3ZKJ A;  3J5Q B;  4H7X A;  2J4B A;  3DSU A;  3FH7 A;  1YCS B;  2GRO B;  4DLO A;  2XPY A;  3URZ A;  4AM9 A;  4N2Q A;  3CVQ A;  2GRP B;  3PZ4 A;  4U7E B;  1PC2 A;  3LXU X;  3S7B A;  3VTY A;  2P9U G;  4JA7 A;  5ARF A;  2XGO A;  3FUF A;  4XI9 A;  3EHM A;  4NRH B;  2DZO A;  5JA4 D;  1N0Q A;  4CDR A;  1NA3 A;  5KCM A;  2CHW A;  1PY1 A;  3PUK A;  4HOQ A;  3BQO A;  2WMO A;  3L13 A;  3QWP A;  4U04 A;  3RRM B;  5CEC B;  5BXO A;  2WXM A;  4I43 A;  3RU0 A;  1NA0 A;  4QFV A;  2E0I A;  4FJY A;  4ILI A;  5D0O D;  4U0Z A;  4APO A;  1OXJ A;  3LYA A;  4UI9 J;  4KZC A;  5KBA A;  2FF4 A;  2L6B A;  4OVV A;  3ULY A;  1LF8 A;  2GRR B;  2AXZ A;  3D9L A;  1SZA A;  4UUC A;  3W9F A;  4UWH A;  4HRN A;  3GZ1 A;  1QNF A;  4OYS A;  2MYO A;  3CVV A;  2J49 A;  5C2Y A;  2WXF A;  4IRU A;  2UWJ G;  3OXL A;  3Q9N C;  3R9M A;  3G2V A;  2VJ8 A;  5A7D B;  2X3M A;  2XZD G;  1KLX A;  1IHG A;  3CHO A;  2EIK E;  2YNQ A;  3D9P A;  4L2L A;  3JQ0 A;  3FUH A;  5LCW J;  2I2O A;  2V4L A;  2F8X K;  2LO6 A;  4HFG A;  5EYP F;  5M72 A;  3B13 A;  3O48 A;  4K5A B;  1GW6 A;  3APF A;  2KXP C;  1N95 A;  3FFL A;  4XX5 A;  2AXU A;  3SI5 A;  3EHR A;  3RSE G;  3E32 A;  2L9B A;  5FJY A;  5FIO A;  3FUI A;  3V31 A;  4HOR A;  3L08 A;  3IHV A;  4O60 A;  3ZNG A;  1RW2 A;  3CKB A;  1UN8 A;  2WXI A;  3FUD A;  4AOF A;  4D10 C;  3QK0 A;  3CSF A;  4L23 A;  1BD8 A;  1DCE A;  3LS8 A;  4KVO A;  3IHY A;  5CED B;  1K1A A;  4WNG A;  3CVP A;  2Y0B G;  4FP7 A;  4LRZ A;  1V55 E;  4BY6 A;  4BFR A;  4RSY A;  4GTV A;  2X6K A;  3EDT B;  3L82 A;  1OCR E;  4PDX A;  2BF0 X;  2J8S D;  5JHB A;  4GZ6 A;  3MZL B;  3DRA A;  3SO8 A;  3FH8 A;  3FH5 A;  4G8L A;  3JYS A;  3LEW A;  1BU9 A;  4I1A A;  3ZEF A;  3ASF A;  1U3D A;  1UJJ A;  2BTD A;  2VQ2 A;  2YQ8 A;  4GTQ A;  1LD7 A;  2I1K A;  3EUV A;  2NXP A;  3G2S A;  4DUI A;  3CEQ A;  3ZRH A;  2LXL A;  4TRQ A;  4N2S A;  3V30 A;  4BT9 A;  2L0T B;  4A63 B;  2QYU A;  1HG5 A;  1MYO A;  3GZ2 A;  3HVE B;  4LNB A;  5ANR A;  3TWW A;  4L2Y A;  3O4Z A;  3JUI A;  3ZN3 A;  2ZIS A;  3UX4 A;  4N5Q A;  4RVB A;  4HLE A;  4ABN A;  1DVP A;  3VLD A;  1NFI E;  5A23 A;  5EN5 D;  4I1O B;  4GZD A;  3FUE A;  3MEK A;  1S63 A;  4JEU A;  4FLH A;  3SFX A;  3RK6 A;  4BWR A;  3PS6 A;  1BI7 B;  3KSQ A;  1OWM A;  4Q69 A;  4JHJ A;  4AVX A;  4HS2 A;  3EU5 A;  1E7V A;  3PEV B;  2IY0 C;  1P5Q A;  3UM1 A;  5KJL A;  4DPR A;  2F8Y A;  3QDN A;  3ZPJ A;  4Y6C A;  4UWL A;  3AS4 A;  5ENR D;  3IXE A;  4WWO A;  4Y6W A;  1FCH A;  3TWU A;  5FWQ A;  3CIA A;  1UOH A;  3KD7 A;  4GML A;  3ZYL A;  1OCO E;  3QNK A;  1D8E A;  3D3M A;  4F6R D;  3PZ3 A;  4OAU C;  3HVE A;  3UXG A;  4CGW A;  2EIM E;  2P2C P;  1OWL A;  3ASO E;  3FTY A;  4J8F A;  1HO8 A;  3APD A;  4J6I A;  3QB2 A;  3MV2 B;  1EF1 C;  1G3N B;  3CV0 A;  4J8S A;  3CVY A;  1HH8 A;  2ETA A;  4GCO A;  1N4S A;  3HXB A;  4AEZ C;  3MJW A;  3HXC A;  3FTW A;  1A17 A;  5AQ9 A;  1DC2 A;  5KNG A;  3DWL G;  3E33 A;  1OWO A;  5ARG A;  4K5B A;  3IKO B;  3B7U X;  2A4Z A;  1K1B A;  3LJ3 A;  4ACK A;  5CEA A;  2GRM A;  2J09 A;  1K8K G;  3UT7 A;  2WQ6 A;  3BU8 A;  3APC A;  2H6G A;  4HLL A;  2WQ7 A;  4EZJ A;  1YA0 A;  3ASD A;  3ZGQ A;  4DX6 D;  2BUG A;  1HZ4 A;  3CGH A;  5JJ6 A;  5AQA A;  2HE0 A;  4YDW A;  1UJK A;  2M63 A;  3PZ2 A;  1TN6 A;  1MHQ A;  5FQ7 A;  4U0U A;  5BW8 C;  2MRI A;  3TG4 A;  4YDO A;  3HYM B;  2VGX B;  4BER A;  3ONL A;  3Q7A A;  3B7S A;  3FHE A;  3LY7 A;  3TG5 A;  3TL5 A;  2ETB A;  1BPO A;  1O1S A;  2IOS A;  2KC7 A;  4GYO A;  3OXF A;  5G04 J;  3ONK A;  3PVL A;  2Q7F A;  4UI9 K;  3L16 A;  1QBQ A;  2KBX A;  4CYM D;  5CER B;  4U07 A;  2ZGG A;  3SNX A;  3C5R A;  1K3Z D;  1IQR A;  3L9T A;  3AU4 A;  5FQ8 A;  3T5X A;  5ENS D;  1INZ A;  3IBE A;  4W9R A;  1N11 A;  3AG3 E;  5AJD A;  1ZB1 A;  4JPS A;  1Z3X A;  4KZ0 A;  3R7Q A;  4BEP A;  4EZL A;  3UTM A;  2VGX A;  4IUL A;  1DNP A;  1UN9 A;  4GTS A;  5JJ7 A;  2PNN A;  2CHX A;  3E4B A;  3U3W A;  4JZY A;  2PL2 A;  3E37 A;  1TNO A;  3LVR E;  3Q7F A;  4FC8 A;  2ILR A;  4F53 A;  4CT0 A;  1TNY A;  2P9P G;  3FTS A;  3QJZ A;  2EIN E;  3V2X A;  2RFM A;  4WND A;  2FI7 A;  1SQM A;  3SY2 A;  1JCR A;  2XZT G;  1B89 A;  4CRW A;  5B1A E;  5FZS A;  3UKU G;  2XCC A;  4F1P A;  4GAA A;  4MKT A;  3E30 A;  3UIN C;  2YHC A;  3NOG D;  3FWV A;  3HIZ A;  1E7U A;  1OCC E;  3QC1 A;  3KEA A;  4C9B B;  1U2V G;  1SW6 A;  2VSO E;  4A1G A;  4RG6 A;  3UM2 A;  2IO2 C;  2OEW A;  4Q94 A;  1N9A A;  1D9S A;  4I2W A;  3RJV A;  3KEZ A;  1HU3 A;  4FJZ A;  3CQG B;  2HM8 A;  2RD0 A;  3UT4 A;  4JEH A;  2P9N G;  3DSV A;  2RG8 A;  4G23 A;  4GA2 A;  3RKV A;  1BI8 B;  2NSZ A;  3JCK C;  3QWV A;  4E85 A;  4TXR A;  2MHK A;  4F7A A;  2OCC E;  4O6F A;  2OVB A;  1X81 A;  3EHN A;  1NP7 A;  1W3B A;  3KSL A;  1ELW A;  3DSW A;  2FUL A;  1MX6 A;  4XKB A;  5A6C A;  3MA5 A;  3D9N A;  2WM9 A;  4HRM B;  5FIN A;  4HRL A;  2PZI A;  4HB5 A;  2BKK B;  3GW4 A;  4RLY A;  4BTB A;  2Y3A A;  3LVQ E;  4BT8 A;  3D9H A;  3FY4 A;  4NIK A;  4I6J A;  1D8D A;  3T8M A;  4YVQ C;  3CVU A;  3FU0 A;  3UPV A;  1EYH A;  1Z3Y A;  4JHK A;  1KZO A;  3G2T A;  3LPZ A;  4AIF A;  4BTA A;  3PE4 A;  3NQP A;  2GW1 A;  2OND A;  2A5U A;  3CQC B;  2H6H A;  3EHQ A;  3PZD A;  3Q75 A;  4CGV A;  5HKP A;  3EU9 A;  1XNF A;  1E8X A;  3QAQ A;  3MCX A;  2IJG X;  5KNH D;  4UQZ A;  4GTO A;  5G05 J;  4TUM A;  4XI0 A;  3CHM A;  3ZYM A;  3C98 A;  4KXK B;  4LEU A;  3ISM C;  2OVF A;  3ULE G;  3ULQ A;  5CBN A;  4LG6 A;  2KCK A;  2V5Q C;  3TGO A;  3Q79 A;  4GYY A;  2WXH A;  4RG9 A;  1LTX A;  1IHB A;  2A5E A;  2IOL A;  2YHE A;  2R05 A;  2HYZ A;  3B7T A;  5AAO A;  2LAH A;  4U8Y D;  1O1R A;  4JA9 A;  4UWF A;  5CHE E;  3T9K A;  3I3N A;  3CHS A;  1JPL A;  2WXJ A;  2DVW A;  1JUQ A;  4O1P A;  3AJI A;  4ILG A;  3EIQ C;  3IV0 A;  2WXG A;  4UWG A;  1H2V C;  4B8C B;  4BX9 A;  3Q47 B;  4AY5 A;  2ZGD A;  4UQY A;  4MRU A;  4HXI A;  2QC9 A;  3Q15 A;  1TNZ A;  1NL4 A;  3PRE A;  3AG4 E;  4GZ5 A;  3ZXS A;  5AJL A;  3HDX A;  4GMR A;  1MJ0 A;  4PUC A;  3K9I A;  4G8K A;  4XE0 A;  5LFA A;  4BSX A;  4DI3 A;  3S7D A;  4C0M A;  1JWF A;  2X6H A;  2XPI A;  3MKR A;  1UW4 B;  3UUX A;  2KAT A;  1JCQ A;  2DIW A;  1WG0 A;  4DI4 A;  3P1U A;  4LUN U;  1ZU2 A;  4NQ0 A;  4HVB A;  1TN8 A;  4KYO B;  5T4Y A;  4WWN A;  4I17 A;  1JWG A;  4U8V D;  3E34 A;  3UMV A;  2OEV A;  4GTP A;  4GB9 A;  2P9L G;  1H0A A;  2J4D A;  5LP0 A;  5JHA A;  4N3B A;  3FEX A;  3Q78 A;  1NI1 A;  1SVX A;  2ZXW E;  4U63 A;  4KMO A;  3ZFW A;  1E8W A;  1OCZ E;  3UM3 A;  2XEV A;  4C48 B;  2DYR E;  3LJN A;  3DSX A;  3EIJ A;  5ANL A;  2NYJ A;  2C0L A;  3B95 A;  4I2Z A;  3QAR A;  5EKQ D;  3UT8 A;  1YMP A;  2BED A;  3P2B A;  3SGH A;  4F3V A;  2AVP A;  2L0I A;  1TN7 A;  2ETC A;  2VGE A;  2VYI A;  1HX8 A;  3ZW3 A;  3PEU B;  3TAX A;  2KZT B;  4CZ2 D;  5HQ8 A;  2WXK A;  3IEG A;  1FT1 A;  1RZ4 A;  1TNU A;  3FU3 A;  3CST A;  4I9E A;  4RQI A;  3ZXP A;  4GZC A;  2LXM A;  4APF A;  1IKN D;  5D0Q D;  1HXI A;  3L6A A;  4I6G A;  2R2L A;  3FUJ A;  4L1B A;  2XEN A;  5AQ7 A;  1QYM A;  4J0U A;  3Q5M A;  2WQH A;  4N5C A;  5EIB E;  3WG7 E;  1H19 A;  3TJP A;  4DX1 A;  2C2L A;  2WXL A;  1MX2 A;  1X5B A;  3T5V A;  3FTZ A;  4MS6 A;  2KZT A;  4JHR A;  3S2A A;  4LNG A;  5ENO D;  4ZHB A;  4A3T A;  3FEY A;  4HOU A;  3FDH A;  4WWP A;  4AV7 A;  5J90 A;  2XS1 A;  3KAE A;  2DBA A;  4XZ4 A;  4N3C A;  4HQD A;  3MKQ B;  4FU3 A;  1OWN A;  5C1D A;  3NBN B;  4XKC A;  3ZVV A;  4J8D A;  4I6E A;  1N94 A;  3DBS A;  3NAW A;  1S0P A;  2GGF A;  1DCQ A;  1H2U A;  3NOC D;  3AS5 A;  3X2Q E;  3OXG A;  2X6J A;  4DRX E;  5B3S E;  4HNA D;  2IFU A;  4EQF A;  4WUY A;  5AQB A;  4X8Q A;  4UWK A;  5E75 A;  2OOE A;  4B94 A;  3CK9 A;  1E96 B;  2P58 C;  1Y8M A;  5AIJ A;  2B6C A;  4HOS A;  2WVI A;  3PNL B;  4MLP A;  3SD5 A;  4YND A;  2CG3 A;  5BV0 A;  1OY3 D;  5ENT D;  3ABL E;  5HI7 A;  3ZIM A;  3ABM E;  2XRY A;  4UQX A;  4YVO A; 
#chains in the Genus database with same CATH homology
 2IU1 A;  3CVP A;  4KT6 B;  3FTU A;  5FZR A;  4FP7 A;  5KJK A;  4LRZ A;  4L7T A;  2PZI A;  4BY6 A;  4GCN A;  4BFR A;  2VTB B;  3PRZ A;  4RSY A;  2X6K A;  3EDT B;  3GW4 A;  4PDX A;  1KT1 A;  2BF0 X;  2CHZ A;  3U66 A;  2J9Q A;  4BTB A;  2Y3A A;  3GZS A;  3LKU A;  1HFA A;  3LVQ E;  4R7L A;  5JHB A;  3PE3 A;  1IYG A;  4BT8 A;  3RO2 A;  1ELR A;  4GZ6 A;  1ZBP A;  3MZL B;  4DLQ A;  2J08 A;  3FY4 A;  2I9C A;  2QFC A;  3MKQ A;  4I6J A;  3FH8 A;  3FH5 A;  3UQ3 A;  1H6K A;  3T8M A;  4YVQ C;  3R7R A;  3FU0 A;  3UPV A;  3JYS A;  3CVU A;  4EPZ A;  1EYH A;  3LEW A;  4I1A A;  3ZEF A;  1UG3 A;  2AW6 A;  1Z3Y A;  3ASF A;  4JHK A;  2V5F A;  1U3D A;  1UJJ A;  2BTD A;  2VQ2 A;  2YQ8 A;  3G2T A;  5BT1 A;  3CKC A;  3LPZ A;  4AIF A;  4BTA A;  2CFZ A;  2I1K A;  3FU5 A;  4PH4 B;  2NXP A;  3G2S A;  3PE4 A;  3B7R L;  2R5S A;  3CEQ A;  3NQP A;  4G2V A;  3ZRH A;  2GW1 A;  2OND A;  4FHK A;  4TRQ A;  4N2S A;  2PM7 A;  4BT9 A;  2A5U A;  2L0T B;  3CQC B;  5JJT A;  2XGM A;  4B89 A;  3PZD A;  4CEM A;  4ILH B;  2KCL A;  1HG5 A;  4LER A;  4CGV A;  3CHR A;  3GZ2 A;  4GZ3 A;  1TJF A;  4DK5 A;  5AEN A;  3D9M A;  3MGB A;  1XNF A;  3HVE B;  3RRU A;  5ANR A;  4I9C A;  3U64 A;  3BG1 B;  4CCA A;  1E8X A;  2VGY A;  3FP3 A;  2IJG X;  3MCX A;  3QAQ A;  4L2Y A;  1QQE A;  3BEE A;  3O4Z A;  3JUI A;  3S7F A;  3ZN3 A;  3LCA A;  4UQZ A;  5G05 J;  1SZ9 A;  2XGS A;  4ACL A;  4FLB A;  4K0R A;  3MYV A;  3CLJ A;  4XI0 A;  4J8E A;  3UX4 A;  3TXN A;  3CHM A;  4Q96 A;  3ZYM A;  2X38 A;  3C98 A;  4KXK B;  4RVB A;  4AP2 A;  4HLE A;  1TEZ A;  4ABN A;  4LEU A;  1DVP A;  3VLD A;  2DCP A;  2OVF A;  5A23 A;  4UI9 C;  4I1O B;  3Q4A B;  4GZD A;  3ULQ A;  3FUE A;  3MEK A;  3SBT B;  4ANX A;  3ESL A;  4JEU A;  5G2N A;  4DLO A;  3AU5 A;  2KCK A;  4FLH A;  5CMY A;  2VTB A;  2JEK A;  3TGO A;  3RK6 A;  4BWR A;  3G2W A;  4K03 A;  1VDY A;  3PS6 A;  2LSU A;  4GYY A;  1OWM A;  4Q69 A;  2WXH A;  5T8I A;  4JHJ A;  5FTP A;  4PS3 A;  4AVX A;  4HS2 A;  4RG9 A;  1E7V A;  3PEV B;  1P5Q A;  4WNF A;  3S7J A;  4GU5 A;  4U0S A;  4PS7 A;  3SHF A;  5KJL A;  5J90 A;  4DPR A;  3L22 A;  1HG2 A;  3QDN A;  2IOL A;  3ZPJ A;  2YHE A;  3CVL A;  4Y6C A;  2WXR A;  3AS4 A;  4UWL A;  4FUL A;  3PDN A;  4BX8 A;  4WWO A;  5G05 C;  2HYZ A;  4CT4 A;  4Y6W A;  3B7T A;  2ZU6 B;  3JQ1 A;  1FCH A;  4G26 A;  1MQS A;  2LAH A;  2FO7 A;  4AJW A;  3NZS A;  4F1S A;  1N52 A;  2IQC A;  5FWQ A;  3CIA A;  1OUV A;  1L5J A;  3QOU A;  3KD7 A;  2WXN A;  4JA9 A;  4UWF A;  4GML A;  5CHE E;  3I3N A;  3CHS A;  3ZYL A;  5CCM A;  5LCW C;  3QNK A;  1JPL A;  3VLE A;  2WXJ A;  3D3M A;  3I4R B;  3PNT B;  4A3V A;  1JUQ A;  2WXQ A;  2ION A;  3FUM A;  4ILG A;  3ML8 A;  3CHQ A;  3EIQ C;  3IV0 A;  2VSY A;  2WXG A;  3NZU A;  4CDN A;  4UWG A;  5J08 A;  4N39 A;  3HVE A;  1H2V C;  4CGW A;  5AYW D;  4B8C B;  2V8S E;  3U9W A;  3LY9 A;  4KBQ A;  3RO3 A;  4KVM A;  4BX9 A;  5LX8 A;  3CK7 A;  4GA0 A;  1OWL A;  3FTY A;  4J8F A;  3Q47 B;  1HO8 A;  4B8A A;  3APD A;  4AY5 A;  5CCL A;  3FUN A;  4J6I A;  2WXO A;  1QZ2 A;  3D9K A;  3MV2 B;  3QB2 A;  4WAF A;  4UQY A;  1EF1 C;  3CV0 A;  4J8S A;  4MRU A;  3CVY A;  1HH8 A;  4HXI A;  3OTN A;  4GCO A;  2WB2 A;  4YVO A;  2I1J A;  2AWI A;  3CVN A;  3LDZ A;  3Q15 A;  2VSN A;  4EEC A;  1FVH A;  2X6F A;  4CDM A;  3PRE A;  4GZ5 A;  3I5P A;  3ZXS A;  5AJL A;  3HDX A;  4AEZ C;  2LNI A;  4GYW A;  3MJW A;  4PUC A;  3K9I A;  3ENE A;  3FTW A;  4NAC A;  4GMJ A;  4N3A A;  4AY6 A;  3HHM A;  3DPD A;  3PH0 C;  1A17 A;  3D9O A;  4XE0 A;  1FVF A;  3AS8 A;  3FTX A;  5LFA A;  3I4G A;  1OWO A;  5ARG A;  4BSX A;  4DJA A;  1ELK A;  4DI3 A;  3IKO B;  3B7U X;  3S7D A;  2WPV A;  2A4Z A;  4C0M A;  1WM5 A;  1JWF A;  2X6H A;  4HOT A;  3CVX A;  3CK8 A;  1EPU A;  4A55 A;  2PQN A;  2XPI A;  2NC9 A;  3MKR A;  4WNE A;  2V0P A;  3LJ3 A;  1UW4 B;  4GA1 A;  4ACK A;  3UUX A;  2KAT A;  5EDS A;  2GRM A;  2J09 A;  2DIW A;  3CVW A;  3UT7 A;  2WQ6 A;  4DI4 A;  3P1U A;  4OVU A;  5FT9 A;  4LUN U;  1WY6 A;  3APC A;  1ZU2 A;  2CFU A;  4NQ0 A;  5LOZ A;  2WQ7 A;  4EZJ A;  4FAD A;  4HVB A;  4KYO B;  1YA0 A;  1N54 A;  3ASD A;  5E76 A;  3ZGQ A;  5T4Y A;  4ATG A;  1IQU A;  4WWN A;  4I17 A;  1JWG A;  2BUG A;  4G24 A;  4JC8 A;  1HZ4 A;  4JW1 A;  2PM6 A;  2XCB A;  3UMV A;  5JJ6 A;  4IN3 B;  2CG2 A;  3SBS A;  4GB9 A;  3Q49 B;  1H0A A;  2M63 A;  2J4D A;  1UJK A;  3BG0 B;  4G11 A;  1MHQ A;  5FQ7 A;  5LP0 A;  3KS2 A;  4U0U A;  5BW8 C;  1TJC A;  2HR2 A;  2MRI A;  3CR3 A;  4N3B A;  5JHA A;  5FQ6 A;  3FEX A;  3TG4 A;  5ENN A;  3HYM B;  2VGX B;  2Y4U A;  3SFZ A;  4ANW A;  2Y4T A;  3ONL A;  3G2U A;  3B7S A;  4U63 A;  3FHE A;  1E8Z A;  3LY7 A;  4KMO A;  3TG5 A;  3ZFW A;  3ZYQ A;  1EDU A;  1E8W A;  3TL5 A;  5EX3 A;  2JLB A;  5EX0 A;  1Z6T A;  1BPO A;  2GRL A;  1H2T C;  3QKY A;  3SZ7 A;  3LY8 A;  3CHP A;  3WXX A;  3MX3 A;  3ML9 A;  2XEV A;  2IOS A;  4FA6 A;  2WXP A;  2KC7 A;  4GYO A;  3OXF A;  4AXH A;  4E6H A;  5DBK A;  2YIN A;  5G04 J;  5CMW A;  3EIJ A;  2E2E A;  5ANL A;  2LSV A;  5G55 A;  3ONK A;  4GPK A;  4B0Z A;  5T3R A;  2C0L A;  3PVL A;  4NUR A;  5BV1 A;  4TUU A;  2Q7F A;  5DIZ A;  3TXM A;  4UI9 K;  4I2Z A;  3QAR A;  5EKQ D;  3UT8 A;  2HO1 A;  2LAI A;  3L16 A;  3VLF A;  3P2B A;  3N71 A;  3MV3 B;  3SGH A;  4H7X A;  4F3V A;  2AVP A;  2J4B A;  2L0I A;  3FH7 A;  4ANV A;  4URK A;  5FZQ A;  4G1T A;  4U07 A;  2VYI A;  1HX8 A;  2XPY A;  3ESK A;  3PEU B;  3SNX A;  3ZW3 A;  3URZ A;  4AM9 A;  3TAX A;  2KZT B;  4N2Q A;  3CVQ A;  1HS6 A;  5HQ8 A;  2QY7 A;  1IQR A;  3AU4 A;  2WXK A;  3IEG A;  1PC2 A;  5FQ8 A;  3LXU X;  3T5X A;  2VSX E;  4FHJ A;  1INZ A;  3IBE A;  3OAW A;  4W9R A;  3S7B A;  2XRZ A;  2KM4 A;  5AJD A;  3VTY A;  5KJN A;  1KT0 A;  4JA7 A;  3ZHE B;  4JPS A;  5ARF A;  1Z3X A;  3FU3 A;  3CST A;  2XGO A;  4KZ0 A;  2XPZ A;  3FUF A;  3EHM A;  4I9E A;  4NRH B;  4XI9 A;  4V3I A;  3R7Q A;  4CDR A;  4GZC A;  1NA3 A;  5KCM A;  2CHW A;  1PY1 A;  3FU6 A;  4EZL A;  3PUK A;  2VGX A;  4IUL A;  4APF A;  4P29 A;  4HOQ A;  1DNP A;  2OV8 A;  1UN9 A;  5D0Q D;  5JJ7 A;  2WMO A;  1HXI A;  4ME2 A;  2CHX A;  3E4B A;  3L6A A;  4G25 A;  2PL2 A;  3L13 A;  4JZY A;  3U3W A;  3QWP A;  4I6G A;  4ANU A;  4U04 A;  3RRM B;  2WXM A;  1NZN A;  3LVR E;  3FUJ A;  4I43 A;  3RU0 A;  1NA0 A;  3FUK A;  4FC8 A;  4QFV A;  4L1B A;  2E0I A;  2ILR A;  4FJY A;  4ILI A;  3RIB A;  5D0O D;  4F53 A;  4CT0 A;  4H7Y A;  5KJM A;  2XHE A;  3FTS A;  4U0Z A;  3QJZ A;  3RRN B;  3ASH A;  4APO A;  4J0U A;  1PAQ A;  4C0E A;  3Q5M A;  3LYA A;  3U4T A;  2R17 C;  4WND A;  4UI9 J;  4KZC A;  2WQH A;  3L54 A;  2FI7 A;  4N5C A;  4JXT A;  1WAO 1;  4IYP A;  1SQM A;  2FF4 A;  2WMN A;  4OVV A;  1HF8 A;  1LF8 A;  3L17 A;  1B89 A;  4CRW A;  1H19 A;  2AXZ A;  3D9L A;  3TJP A;  5FZS A;  3FTV A;  1SZA A;  2C0M A;  2C2L A;  2XCC A;  2WXL A;  4GAA A;  4MKT A;  4PS8 A;  4UWH A;  1X5B A;  1OWP A;  4U8H A;  3GZ1 A;  4TV3 A;  3T5V A;  1QNF A;  2YHC A;  4LCT A;  3FTZ A;  2I6H A;  3FWV A;  2UY1 B;  4OYS A;  4JL0 A;  4MS6 A;  3CVV A;  2X6I A;  2J49 A;  3HIZ A;  2KZT A;  1E7U A;  4JHR A;  5C2Y A;  2WXF A;  4IRU A;  3S2A A;  2UWJ G;  2AXV A;  3OXL A;  1HE8 A;  4A3T A;  4EZK A;  3FEY A;  4HOU A;  3FDH A;  3QC1 A;  3G2V A;  4EBA A;  1E90 A;  4WWP A;  4EBA G;  4C9B B;  2VJ8 A;  5A7D B;  2X3M A;  4AV7 A;  1KLX A;  1IHG A;  2VSO E;  3CHO A;  3FUL A;  3D9P A;  2YNQ A;  3SF4 A;  3ZHE A;  4RG6 A;  4A1G A;  1Y6I A;  5BPP A;  5BUZ A;  3EJN A;  2XQ0 A;  3ASG A;  3KAE A;  3R9A B;  4Q94 A;  4L2L A;  3JQ0 A;  3FUH A;  2DBA A;  4XZ4 A;  3ZYK A;  2J07 A;  4N3C A;  5LCW J;  2I2O A;  4I2W A;  2V4L A;  3RJV A;  3MKQ B;  3KEZ A;  1HU3 A;  2LO6 A;  2L6J A;  3CQG B;  4FJZ A;  4HFG A;  4FU3 A;  1OWN A;  5M72 A;  3B13 A;  3QWW A;  5C1D A;  2HM8 A;  2PQR A;  4XKC A;  3ZVV A;  2RD0 A;  3UT4 A;  3D9I A;  4JEH A;  4J8D A;  4A1S A;  4I6E A;  5BNW A;  2RG8 A;  3DBS A;  3O48 A;  1S0P A;  2GGF A;  4G23 A;  1H2U A;  4GA2 A;  3RKV A;  1GW6 A;  2KCV A;  3APF A;  4XIF A;  1E8Y A;  2NSZ A;  3AS5 A;  3JCK C;  3GYZ A;  3FFL A;  2EQX A;  4XX5 A;  4I1M A;  2AXU A;  2FEZ A;  3OXG A;  2X6J A;  3QWV A;  3SI5 A;  2IFU A;  3PUJ A;  4E85 A;  4WUY A;  4EQF A;  2L9B A;  3NF1 A;  2MHK A;  4UWK A;  5FJY A;  4F7A A;  1U3C A;  5E75 A;  2OOE A;  3FUI A;  2IF4 A;  4O6F A;  4HOR A;  2OVB A;  3L08 A;  4JVS A;  4B94 A;  3IHV A;  3CK9 A;  1E96 B;  3VTX A;  2P58 C;  1Y8M A;  5AIJ A;  3CKB A;  1UN8 A;  2WXI A;  4M3O A;  3EHN A;  1NP7 A;  2MOW A;  3D9J A;  1W3B A;  3FUD A;  1XGW A;  4AOF A;  4HOS A;  2WVI A;  4D10 C;  3QK0 A;  3PNL B;  5FQ4 A;  1ELW A;  4MLP A;  3CSF A;  4L23 A;  3SD5 A;  2FUL A;  4YND A;  2CG3 A;  4XKB A;  5BV0 A;  3LS8 A;  5A6C A;  3MA5 A;  4KVO A;  5HI7 A;  3IHY A;  3D9N A;  2UY1 A;  3ZIM A;  4WNG A;  5G04 C;  2R59 A;  2FBN A;  2XRY A;  4UQX A;  2WM9 A;  3CGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...