5CHEE

Crystal structure of arabidopsis glutamyl-trna reductase in complex with its regulatory proteins
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
119
structure length
119
Chain Sequence
EPKKQELISKLKTGKTFLRNQEPEKAYTEFKIALELAQSLKDPTEEKKAARGLGASLQRQGKYREAIQYHSMVLAISKRESEDSGITEAYGAIADCYTELGDLEKAGKFYDTYIARLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Arabidopsis glutamyl-tRNA reductase (GluTR) forms a ternary complex with FLU and GluTR-binding protein
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords Glutamyl-tRNA reductase 1, chloroplastic
total genus 47
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5cheE00
3ZN3A 3QDNA 3JYSA 3S7JA 4EQFA 4AIFA 5LCWC 2LNIA 4RG6A 1WM5A 3CVLA 4U0ZA 3BEEA 3TG5A 3OXFA 4UQYA 2FI7A 2FO7A 5BNWA 3KAEA 2Q7FA 2PZIA 4KYOB 4U0SA 5FZSA 4BTAA 1ZU2A 4JA7A 4CDRA 5FT9A 5JJTA 2HR2A 5KJNA 2XGSA 2L6JA 3FWVA 3MV2B 1E96B 3GZ1A 2XCBA 1A17A 2HYZA 3ASHA 4GCNA 4KXKB 2IF4A 3ULQA 2E2EA 1WAO1 3Q5MA 3LY9A 2V5FA 3RO3A 2NC9A 4NRHB 4UI9C 4Y6CA 4GZ3A 2Y4UA 3RJVA 3OXLA 4GZ6A 4GYWA 4F3VA 3OXGA 2WQHA 2BUGA 3QOUA 4UI9K 4HOTA 3U4TA 3KS2A 3TG4A 3CK8A 1QZ2A 5CCLA 1IYGA 2VGXB 3K9IA 5G05J 4HOQA 4LEUA 1TJCA 2FBNA 2ONDA 4J8FA 2WPVA 3S7FA 1QQEA 5DIZA 1KT1A 2PQNA 3LPZA 4GYYA 3E4BA 4NQ0A 2GW1A 4KBQA 5FZQA 5AYWD 4I1AA 3RIBA 4WUYA 4BTBA 3UPVA 4YVQC 4XIFA 3QWWA 4BT9A 3MV3B 3CEQA 3ASGA 4HOUA 1OUVA 1P5QA 2VGXA 4H7YA 3CKCA 4ME2A 5KJKA 5M72A 4N3AA 3RU0A 5D0QD 3LY8A 5KJMA 4JL0A 3GW4A 5JJ6A 4G23A 2YQ8A 4ABNA 4I2WA 2PL2A 4G24A 4N39A 2I6HA 4AM9A 4UQZA 3UQ3A 3NF1A 4N2QA 3FFLA 2UWJG 2VSNA 3CK9A 4BT8A 2YHCA 5A6CA 3ESKA 4GCOA 4HORA 4UI9J 2LSVA 3AS4A 1ELRA 3WXXA 4A1SA 3Q47B 4XI0A 3ZGQA 1W3BA 3Q49B 2C0LA 3CV0A 2MHKA 3Q4AB 4I9CA 3RO2A 3S7BA 4APOA 5LCWJ 4G26A 3GYZA 4J8EA 3FP3A 4UQXA 2DBAA 4J8DA 5DBKA 5A7DB 3SZ7A 1KLXA 2VYIA 3MKRA 3LY7A 2UY1B 1HXIA 3GZ2A 5EKQD 3LCAA 2JLBA 4N2SA 2KC7A 2XGOA 4XI9A 1FCHA 5HI7A 1KT0A 2J9QA 3LKUA 2XEVA 3S7DA 4I9EA 3VTXA 3UUXA 4WNEA 5KJLA 3QWVA 2KATA 4WNFA 4YVOA 5EX0A 5FTPA 2LSUA 2C0MA 2FEZA 1NA3A 4N3BA 2AVPA 2HO1A 2P58C 2OOEA 3CKBA 4HOSA 5G05C 2C2LA 4GZ5A 4JHRA 3R9AB 1NA0A 4BWRA 3URZA 4CGWA 2R5SA 4I2ZA 3AS8A 4AY5A 3HYMB 2PQRA 3KD7A 3RKVA 3EDTB 5BW8C 1XNFA 4JA9A 3TGOA 2IFUA 3Q15A 4CGVA 4G1TA 1Y8MA 3CVNA 2VSYA 5CCMA 3ASDA 4WNDA 3CVPA 5CHEE 1NZNA 1ELWA 5FZRA 4N5CA 3TAXA 3U3WA 2FF4A 3CK7A 5HQ8A 4GPKA 3ZFWA 4GA1A 2KCKA 3LYAA 3PE3A 4GYOA 1IHGA 2VQ2A 2Y4TA 2XCCA 3PDNA 4WNGA 3N71A 5ARGA 4H7XA 3PE4A 2UY1A 3ZPJA 5ARFA 3SF4A 4U07A 5FJYA 5BT1A 5G04J 5C1DA 5JJ7A 4G2VA 2KCLA 1PC2A 2QFCA 3ASFA 2KCVA 3ZHEB 3MA5A 4O6FA 1YA0A 4U04A 4G25A 4GA0A 1HH8A 3CVQA 3QKYA 4YNDA 4J0UA 4AY6A 4W9RA 3VTYA 3IEGA 1HZ4A 3AS5A 1B89A 4B94A 3MEKA 5EX3A 1ZBPA 4I17A 3O48A 4N3CA 5D0OD 5G04C 3QWPA 4U0UA 4IN3B 4GA2A 4RG9A 2VGYA 2XPIA 4Y6WA 3ZHEA 2XGMA
chains in the Genus database with same CATH superfamily
5LOZA 3JQ0A 3I5PA 4TXRA 4JEHA 3PUJA 3IHYA 3APFA 1DVPA 3ABLE 1WDYA 4JA7A 2Y1LE 3LS8A 1MHQA 2H6FA 5EIDA 5HRYA 4GZCA 4Y6CA 3LJ3A 2H6IA 3OXGA 3C5RA 2OVFA 3SFXA 4JB8P 3CR3A 3C3RA 2JABA 3FY4A 4DX5D 4FLHA 2YHEA 2YQ8A 3B7SA 3CQCB 2KXPC 2PM7A 2QYUA 4A1GA 3CHPA 3FFLA 2WXPA 4TUUA 2WXJA 5FQ6A 2FULA 2E0IA 1OT8A 4N2SA 3VLFA 1FCHA 3L13A 1UOHA 3MJWA 4N3BA 3ZYQA 1D8DA 3R9AB 1NA0A 3DPDA 3HYMB 1EPUA 3RRNB 1HO8A 4J7WA 3G2SA 2V4HC 5AJLA 3ZYLA 3TGOA 4KZ0A 4BESA 3PNLB 1JPLA 4DX7D 3T9KA 1NZNA 4KZCA 4OAUC 3ABKE 3FH5A 4URKA 1DC2A 3ONLA 1ELKA 3NQPA 3WG7E 3ZHEB 3PEUB 3D3MA 4F7AA 3PS6A 3TXMA 5BPPA 4MBGA 2EILE 2J08A 5KNGA 1U2VG 3JXJA 3TJPA 2OEVA 4JEUA 3V79K 2HR2A 4GU5A 1H2UA 3ULQA 2EQXA 3ML9A 3T5XA 5CMYA 2IEJA 3FHEA 5AQ7A 4U8YD 5ANRA 1D9SA 2FBNA 4NIKA 3ASNE 4BTBA 3AJIA 4BT9A 1OUVA 3CKCA 1E8WA 3TWUA 3B13A 3ASOE 4AM9A 4APFA 3DSXA 1IXVA 2LAIA 2ZISA 3MZLB 3SZ7A 3MKRA 2I2OA 2PNNA 4I9EA 3UUXA 4WNFA 4O1OA 3HG0D 4LSZE 3CKBA 4PS7A 3TWTA 1S63A 4F1PA 4MRUA 2WXOA 1Y8MA 3UT8A 4IULA 5LP0A 1X81A 4ZHBA 2X6FA 2Y4TA 1N52A 2P9IG 2J4BA 5ENTD 3SF4A 4L2YA 2CFUA 1NL4A 3X2QE 2VSXE 2OVBA 4HB5A 2ILRA 1MX4A 4UWLA 3JYSA 3S7JA 4TV3A 3BEEA 2P9KG 3B7TA 1K1BA 1KZPA 3MKQA 4F53A 3AG2E 3MV2B 1L5JA 2LO6A 4RQIA 3FUNA 3Q5MA 3PZ1A 2Y4UA 4KVOA 4B89A 3W9FA 3UIOC 3U4TA 3CK8A 3D9KA 4LEUA 4ACLA 4UWKA 3S7FA 1S70B 5FZQA 4YDEA 3L22A 3RK6A 4N3AA 2F37A 2XQ0A 3CQGB 5JHAA 1D8EA 2DYSE 3C72A 1WY6A 2AXZA 4ANXA 4NURA 2I6HA 3ZXSA 5J90A 2A4ZA 4HLEA 3JUIA 5LCWJ 3G2TA 4OVUA 2CHXA 4GPKA 4J8DA 3D9PA 4YDOA 5FIOA 2EIKE 3V2XA 3ULEG 3HRAA 4FP7A 2RD0A 3QARA 4TXQA 3TWRA 3S7DA 3VLDA 2R17C 4CYMD 4WNEA 5FQ7A 5EX0A 1DNPA 3O4ZA 3P1UA 4U63A 2R5SA 4UWFA 3SHFA 3KD7A 4JA9A 4UWGA 2AXVA 4WWOA 2H6HA 5JMND 2XENA 1PAQA 3CHMA 4B8CB 3U3WA 4I6EA 4G8LA 2ETAA 4AP2A 4G25A 4HS2A 3NOCD 5A23A 3NBNB 1Y6IA 4GA2A 3DEOA 3ZYKA 5FZSA 1Z3YA 2WXNA 1BI8B 3BU8A 3DEPA 4NRHB 4AEZC 4G8KA 3IKOB 1MYOA 5KCMA 3Q73A 4KBQA 1OCOE 4XIFA 5M72A 3SNXA 5KJKA 3R7QA 3GW4A 1V54E 2GRLA 1OXJA 4HVBA 3PUKA 3CK9A 1BI7B 3BQOA 3SY2A 2WB2A 4HORA 4GTQA 4A1SA 2J09A 2C0LA 4ZFHA 3UM2A 5A7DB 4GTVA 5EKQD 2F8YA 2NSZA 1IKND 1G3NB 3SFZA 3SBSA 4HXIA 2FEZA 4ATZD 2WXLA 4K0RA 4BWRA 1JCSA 1OCZE 4L7TA 4JC8A 2P2CP 2LXLA 4GA1A 3PE3A 4OAVB 1VDYA 2OV8A 3B7RL 4FLBA 4DX2A 2DVWA 5BXUA 5G04J 3HXFA 3QKYA 4F1SA 3FTZA 4DK5A 4BEPA 5EX3A 3O48A 5CBOA 1JWFA 5E75A 1ZB1A 2I9CA 2WXMA 3MGBA 2X6JA 4KYOB 4U95D 4A55A 4GPMA 3AG3E 5B1BE 4KVMA 3QJZA 4GZ6A 2CFZA 3FTYA 1IYGA 1TJCA 3CIAA 3WXXA 4UWHA 2IQCA 5AQAA 4FADA 3C98A 4YVQC 4WWPA 3RJVA 4ME2A 1P5QA 2YINA 1WG0A 1FVHA 4ILGA 5JA4D 4JXTA 5JHBA 3FUJA 3B7UX 3D9NA 1GW6A 2YHCA 3FUFA 2R02A 3DPYA 3I3NA 2P9UG 3FULA 3GZ2A 5HI7A 2OEWA 2EINE 2R2LA 5EYLA 3QWVA 5AN8A 3SBTB 2OOEA 5EIBE 3FUIA 1NI1A 4CGWA 2XZDG 1Z6TA 1IHBA 2RFAA 3PH0C 5FZRA 1TEZA 2AXUA 2M63A 3MKQB 4FU3A 4LRZA 2UY1A 2IO2C 4TUMA 4ACKA 5H7PA 3MA5A 1LTXA 3VTYA 1TN8A 4ANWA 4CT0A 5BUZA 3ASHA 4BY6A 4PS3A 4RSYA 2LNIA 4KMOA 4U0ZA 3V2OA 2XPZA 4HI8A 4WWNA 4X8QA 3UKRG 3B95A 4HBDA 1TYQG 3RO3A 2H6GA 3EUVA 4DRXE 1QZ2A 3FTWA 1JCQA 3UT7A 3KEAA 2L0IA 2VGXA 1E7UA 2V4LA 2J49A 4I2WA 4UQZA 1HS6A 2I1JA 1EYHA 3ESKA 3EIJA 3E33A 3GYZA 3PZ3A 5FWQA 4XKCA 3EHRA 1BU9A 2P9LG 5CRVA 3OTNA 1Z3XA 3LVQE 1MJ0A 3T8MA 2PM6A 2PQRA 5BW8C 2XRZA 2VSYA 4MLPA 1LF8A 4Q94A 3ZPJA 2KCLA 2WXRA 4FHJA 3L82A 2X6IA 1HZ4A 2XS1A 2EIME 3MEKA 1ZBPA 2LUHA 3JXIA 3TWXA 2DCPA 4I1MA 2ETCA 3QDNA 4HRLA 3L16A 4AIFA 3DWLG 5BXOA 2AW6A 2L6JA 3TL5A 1E8ZA 4GB9A 1WAO1 4FJYA 3LY9A 2BKKB 3HXDA 3L54A 3Q75A 1QNFA 4PS8A 2VGXB 4HI9A 3KEZA 1YYHA 1H6KA 3HXCA 3UPVA 4Q96A 3IHVA 3NB2A 4H7YA 4C9BB 3RU0A 1AWCB 4QQIA 3FUDA 4N39A 4GTTA 1ELRA 4MKTA 3Q4AB 3UINC 2MHKA 4G26A 2DYRE 4UQXA 3SI5A 2VYIA 3LY7A 2KC7A 2KATA 1HF8A 2VTBB 3CHSA 2HO1A 3DXKG 2C2LA 2IOSA 3SD5A 3CVXA 2IY0C 2AWIA 4CRWA 1KZOA 1TNZA 5CHEE 4N5CA 4GYOA 5ARGA 5C1DA 4U07A 3FTVA 3UM3A 4GMLA 4GMJA 2DWZA 3HDXA 4J0UA 1OWMA 3I4GA 4AVXA 3AS5A 3FU5A 2X6HA 3QWPA 1KPSB 4EECA 2LAHA 4NACA 3CVLA 3IBEA 2Q7FA 1ZU2A 5FT9A 3CHRA 5KJNA 2AJAA 3FWVA 3TWVA 1O1SA 3UIPC 2V5FA 3J5PA 4D10C 4A3TA 2V0PA 1SVXA 5CRUA 5EDSA 1O5MA 2P9PG 3FUHA 3QC1A 5CERB 3QWWA 3UMVA 3APDA 4M3OA 4LCTA 3QNKA 1Q2ZA 3R7RA 4XEIG 3NF1A 2WQ6A 2GRPB 4N5QA 3ZKJA 1OY3D 4HRMB 1H19A 2MOWA 3ISMC 3Q47B 1N4SA 2XEHA 4JHJA 3AU4A 3CV0A 3S7BA 4B0ZA 2I1KA 4GAAA 4EZKA 4HFGA 4AV7A 2Y3AA 2WXGA 3T8KA 2AVPA 1A5EA 4I2ZA 4BSXA 5CBNA 2A5UA 3Q15A 3CVNA 3U9WA 4GTPA 4L1BA 3EHMA 1PC2A 2QFCA 2BF0X 4YNDA 4CCAA 4I17A 1HX8A 1JUQA 4N3CA 3ESLA 2DIWA 3HXEA 3UM0A 3JQ1A 1TNYA 4J6IA 1TNBA 3OXFA 5ITZF 2VGEA 5JJTA 1U3DA 2E2EA 3FUKA 4TRQA 3OXLA 2DZOA 3QOUA 5T4YA 2ONDA 2KBXA 2WPVA 4FJZA 4GYYA 1IQRA 3F6QA 2CG2A 2ZU6B 2WXHA 2WXQA 1TNOA 4I43A 5J08A 4QFVA 1LD8A 4GTOA 4E6HA 2LSVA 1O1RA 1UJJA 4ATGA 4CZ2D 3T5VA 1MX2A 2WMNA 2WMOA 2F0YA 2ZGGA 2GRNB 3URZA 5AQ9A 3RKVA 4CGVA 3EU5A 5CEAA 1QBQA 4DI4A 3LYAA 3FEYA 2J8SD 4GTMA 1FVFA 3ASFA 4BFRA 4AY6A 3AU5A 3VLEA 4B94A 5LX8A 3ML8A 3HXBA 3ZRHA 4U0UA 5LFAA 4AXHA 3C3QA 4BX8A 4BTAA 1OWPA 4U0SA 4Z68A 4ILIA 2XGSA 1A17A 1UW4B 5FQ8A 5HKPA 1H6OA 2BKGA 3UX4A 3NAWA 5B1AE 5G05J 2RG8A 3CHQA 5AYWD 1TJFA 4LNUD 3HVEB 5B3SE 4LUNU 4U8HA 2VTBA 4DI3A 5CMWA 3FU3A 2R03A 5JJ6A 2X3MA 1H0AA 3UQ3A 2UWJG 2ZGDA 3AS4A 4EBAA 3FUEA 3LXUX 1UJKA 4EBAG 5ENQD 2X38A 1E8XA 4LNBA 1KT0A 2XEVA 4I1OB 2C0MA 4YDYA 4P29A 4HOSA 4JHRA 3Q79A 4GTSA 1XNFA 4AJWA 1H2VC 1DCQA 3NZUA 3CVPA 4JPSA 2BEDA 2GGFA 2XCCA 5FJYA 1LD7A 3L08A 5ANLA 3TWSA 3TXNA 1HH8A 3CVQA 4W9RA 1MQSA 4JHKA 5D0OD 5G04C 2VGYA 2XPIA 3GZSA 3L6AA 3EHQA 4EQFA 4OYSA 3LVRE 3TG5A 5D2MC 4CDRA 3CVVA 4JD2G 3ZNGA 3ULYA 1E96B 4GCNA 3PZ4A 2IF4A 3FTSA 1Z5SC 4ANUA 1UG3A 2WQHA 2BUGA 3AG1E 2P9SG 2PQNA 4NQ0A 1MX6A 3CVUA 4WUYA 3MCXA 3MV3B 3CEQA 3ASGA 1S0PA 5D0QD 2WQ7A 2MRIA 2JEKA 4G23A 2VJ8A 4BT8A 3CVYA 3J5QB 2QY7A 1EDUA 2BTDA 2P9NG 2DBAA 4FC8A 2JLBA 2XGOA 2HM8A 4XI9A 5AAOA 1FPPA 3QAQA 2LSUA 4ILHB 1NA3A 5E76A 2P58C 4FULA 2OCCE 3JCKC 3BUAA 3CSFA 1UN9A 4G1TA 3CSTA 1X5BA 2A5EA 4TXPA 2FF4A 3CVWA 3PDNA 1QYMA 3ZXPA 4A3VA 3PE4A 4LNGA 2V5QC 5JJ7A 5ARFA 2KM4A 4CDNA 3ZVVA 4O6FA 4EHMA 4C0EA 2CHZA 2WXIA 4EPZA 2XGMA 3CHOA 2HE0A 3JUEA 5AIJA 2RFMA 2QC9A 3SGHA 2FI7A 2FO7A 3KAEA 4BSZB 4M7CA 3FTUA 3PZ2A 4GTRA 3E32A 1N54A 2X6KA 5T8IA 5BV0A 2WXFA 4K5AB 4XE0A 2XEEA 2VSOE 3FTXA 4EZJA 1HG5A 1RZ4A 2DZNA 4LG6A 3UTMA 2PL2A 2MYOA 4IRUA 5ENSD 1O1TA 4PH4B 4GCOA 4UI9J 2WVIA 2GRRB 3CGHA 4I9CA 3E30A 1E90A 2QYJA 3ZYMA 3LKUA 1HG2A 1SQMA 3S2AA 5BV1A 2F8XK 3PZDA 3ASDA 1HFAA 3DSWA 3ZFWA 2J4DA 2VQ2A 4OVVA 4WNGA 4G11A 1OWOA 1BLXB 1K1AA 5EN5D 5CEDB 1YA0A 3L17A 4L2LA 1B89A 4K5CA 4EZLA 3UT4A 5C2YA 2B0OE 1K3ZD 3DXMG 3B7BA 1WM5A 2PZIA 5KNHD 3NOGD 3Q78A 3FU6A 4J8SA 3GZ1A 3SQVA 4UI9C 4F3VA 4UI9K 3IV0A 3ONKA 4PDXA 2YNQA 3LEWA 2CG3A 3SO8A 5D66A 3HIZA 1TNUA 5HS0A 4O1PA 1SZAA 3E34A 3APCA 4U7EB 1JWGA 3UXGA 5A6CA 3FH8A 1NP7A 4PUCA 1W3BA 2GROB 3Q49B 1N0RA 4APOA 3UKUG 4L23A 1OCRE 3EJNA 1OWLA 3IXEA 3ZUVB 2J9QA 2R05A 4K03A 3Q7FA 3D9MA 4B8AA 4HNAD 5AQBA 5G05C 3ZW3A 3EDTB 4K5BA 1ELWA 1YCSB 3CK7A 4DLOA 4O60A 1IHGA 5KBAA 3RAUA 4G2VA 5FQ4A 4JVSA 2EIJE 3TWWA 2XZTG 4MS6A 3PRZA 3C3OA 4DJAA 1K8KG 3PREA 4JW1A 1YMPA 5LCWC 1PY1A 2XCBA 5KWDA 4U96D 1N0QA 2RKKA 3ZU7B 1N4RA 3Q9UC 2XRYA 3ABME 3KS2A 3QK0A 3K9IA 5G2NA 3V31A 3FEXA 1H6PA 4I1AA 3G2WA 3L9TA 3FUMA 4DX6D 2WM9A 2GRMA 2J07A 2L6BA 4JL0A 3NZSA 4N2QA 4DLQA 4DPRA 3TWQA 3BG0B 4R7LA 3RO2A 1BPOA 1TN7A 4XX5A 5DBKA 1HU3A 4B93B 1HXIA 4DX1A 4HLLA 4BETA 4YVOA 3PEVB 5FTPA 2KZTB 5AARA 3MYVA 3EIQC 3AS8A 4AY5A 5ENRD 4I6JA 3FDHA 3PVLA 1SZ9A 3QB2A 3DBSA 3D9LA 2NXPA 3LDZA 3UI2A 3N71A 4H7XA 1N11A 2B6CA 5BT1A 3FU0A 1U3CA 3AAAC 4RLYA 2KCVA 5IY5E 3Q9NC 4CEMA 2Y69E 5ENNA 4RG9A 4Y6WA 2ZXWE 3G2UA 4UQYA 3V30A 2GRQB 3ZGQA 1IQUA 2NC9A 4GZ3A 4GYWA 4UUCA 1NFIE 5FINA 4HOTA 1N9AA 3TG4A 4XZ4A 3W9GA 4HOQA 1QQEA 1OCCE 3LPZA 3E4BA 3RIBA 2GW1A 2WXKA 4DUIA 2FO1E 1AP7A 3AG4E 4GMRA 5KJMA 4CT4A 3EHNA 1E7VA 4G24A 4A63B 3RRUA 4XI0A 4XKBA 3ENEA 1JCRA 2KZTA 1KLXA 5ENPD 2LXMA 3LCAA 3HVEA 5ENOD 2XPYA 3VTXA 1UN8A 5KJLA 5EILA 4WAFA 4RVBA 3D9HA 1TR4A 3LJNA 2CHWA 4BX9A 4HRNA 2IFUA 1FT1A 1S64A 1EF1C 5T3RA 5AENA 3U64A 4C48B 4C0MA 3DRAA 3BG1B 3KSLA 4U04A 1TN6A 1DCEA 2L0TB 2IOLA 1N4QA 4IN3B 4V3IA 4YDWA 3E37A 4RG6A 5BNWA 2Y0BG 2L9BA 4BERA 4E85A 4LERA 3Q7AA 1RW2A 3ZN3A 3DSVA 2HYZA 4J8YA 4KXKB 2IO3C 1INZA 1SA5A 3I4RB 4CDMA 5CCLA 1OWNA 4KT6B 5EYPF 4F6RD 4J8FA 1E8YA 5DIZA 1KT1A 4Q69A 5G55A 4U8VD 2R59A 4HOUA 3RRMB 2XHEA 3EU9A 3KSQA 3D9IA 3LY8A 3G2VA 3MX3A 4ABNA 1SA4A 4FHKA 1H2TC 1XGWA 4AOFA 3P2BA 2VSNA 3D9OA 1BD8A 4J8EA 3FP3A 2QZAA 2UY1B 2IONA 1MZCA 2IJGX 2ZIRA 3PNTB 3HHMA 3DSTA 3DSUA 4FA6A 3FH7A 4JZYA 1FT2A 1SW6A 4L9PA 2IU1A 4GZ5A 4I6GA 1V55E 3U66A 3ZIMA 4HQDA 2ETBA 5CCMA 3UM1A 4WNDA 3DSSA 3TAXA 4GZDA 3R9MA 3ZEFA 5HQ8A 3D9JA 2KCKA 4IYPA 1N95A 4ANVA 5CECB 2NYJA 2V8SE 1HE8A 1N4PA 4GA0A 5AJDA 3SFYA 3IEGA 2XS8A 3RSEG 3CLJA 3OAWA 1N94A 3ZHEA
chains in the Genus database with same CATH topology
4J6IA 5LOZA 2I9CA 2WXMA 3I5PA 3JQ0A 4JEHA 1WM5A 3MGBA 3IHYA 3PUJA 3APFA 3OXFA 1DVPA 2PZIA 2X6JA 4KYOB 5JJTA 4JA7A 1U3DA 4A55A 3LS8A 1MHQA 3FU6A 4J8SA 3GZ1A 2E2EA 3FUKA 4TRQA 4GZCA 4UI9C 4Y6CA 3LJ3A 4KVMA 3OXLA 3QJZA 4GZ6A 4F3VA 3OXGA 2CFZA 3QOUA 4UI9K 3FTYA 3IV0A 1IYGA 3ONKA 4PDXA 2OVFA 5T4YA 2YNQA 1TJCA 2ONDA 3LEWA 3CIAA 2WPVA 4FJZA 3WXXA 4GYYA 4UWHA 2CG3A 2IQCA 4FADA 1IQRA 3C98A 4YVQC 4WWPA 3RJVA 4ME2A 1P5QA 2YINA 3CR3A 3HIZA 1FVHA 2CG2A 2ZU6B 4ILGA 3FY4A 4FLHA 4JXTA 1SZAA 5JHBA 2WXHA 2YHEA 2YQ8A 3B7SA 3FUJA 3CQCB 2WXQA 3B7UX 3D9NA 1GW6A 2PM7A 4I43A 3ZHEA 3APCA 4A1GA 3CHPA 3FFLA 4QFVA 5J08A 4E6HA 1JWGA 2WXPA 2YHCA 5A6CA 3FH8A 1NP7A 2LSVA 4TUUA 2WXJA 4PUCA 3FUFA 5FQ6A 2FULA 1W3BA 3Q49B 4APOA 3I3NA 4L23A 2E0IA 1UJJA 3FULA 4ATGA 3EJNA 1OWLA 3GZ2A 4N2SA 3VLFA 5HI7A 1FCHA 3L13A 2J9QA 3T5VA 4K03A 3D9MA 3MJWA 4B8AA 3QWVA 2WMNA 2WMOA 4N3BA 3SBTB 3ZYQA 2OOEA 5G05C 3R9AB 3ZW3A 3FUIA 1NA0A 3DPDA 3URZA 4CGWA 3HYMB 1EPUA 3RRNB 3RKVA 3EDTB 1HO8A 3G2SA 5AJLA 3ZYLA 1Z6TA 4CGVA 3TGOA 4KZ0A 3PH0C 1JPLA 3PNLB 1NZNA 1ELWA 5FZRA 1TEZA 2AXUA 2M63A 3MKQB 4KZCA 4FU3A 3CK7A 4LRZA 4DI4A 4DLOA 3LYAA 3FEYA 1IHGA 3FH5A 4URKA 2UY1A 1FVFA 3ONLA 1ELKA 3NQPA 4G2VA 4ACKA 3ASFA 5FQ4A 4BFRA 4JVSA 3ZHEB 3MA5A 3D3MA 3PEUB 2VTBB 4AY6A 4F7AA 3AU5A 3PS6A 3VLEA 3TXMA 3VTYA 4B94A 5BPPA 3ML8A 4ANWA 5LX8A 3ZRHA 4MS6A 3PRZA 4U0UA 5LFAA 4CT0A 4DJAA 5BUZA 3ASHA 2J08A 3PREA 4JW1A 4BY6A 4PS3A 4AXHA 4RSYA 5LCWC 2LNIA 4KMOA 3TJPA 4BX8A 4U0ZA 1PY1A 2XPZA 4JEUA 4BTAA 1OWPA 4U0SA 4WWNA 2HR2A 4ILIA 2XGSA 4GU5A 1H2UA 3ULQA 2EQXA 2XCBA 1A17A 1UW4B 3ML9A 3T5XA 5CMYA 5FQ8A 3RO3A 3FHEA 5ANRA 2XRYA 3UX4A 3KS2A 3QK0A 1QZ2A 3K9IA 5G05J 2RG8A 5G2NA 3CHQA 2FBNA 3FTWA 3FEXA 5AYWD 3UT7A 1TJFA 4I1AA 2L0IA 4BTBA 3G2WA 3FUMA 3HVEB 4BT9A 1OUVA 2VGXA 2WM9A 1E7UA 3CKCA 4LUNU 1E8WA 2GRMA 3B13A 4U8HA 2J07A 2VTBA 4DI3A 5CMWA 3FU3A 2V4LA 4JL0A 2J49A 5JJ6A 2X3MA 4I2WA 3NZSA 1H0AA 4AM9A 4UQZA 1HS6A 2I1JA 3UQ3A 4APFA 4N2QA 2UWJG 4DLQA 4DPRA 1EYHA 3ESKA 3AS4A 3BG0B 4R7LA 4EBAA 3EIJA 2LAIA 3FUEA 3RO2A 1BPOA 3LXUX 1UJKA 4EBAG 3GYZA 4XX5A 2X38A 5DBKA 1HU3A 3MZLB 3SZ7A 1E8XA 3MKRA 5FWQA 1HXIA 4XKCA 2I2OA 1KT0A 2XEVA 4I9EA 5E75A 3UUXA 4WNFA 3PEVB 4YVOA 4I1OB 5FTPA 2C0MA 2KZTB 3OTNA 1Z3XA 4P29A 3CKBA 4HOSA 4JHRA 4PS7A 3LVQE 3MYVA 3EIQC 3T8MA 3AS8A 4AY5A 2PM6A 2PQRA 5BW8C 1XNFA 4I6JA 3FDHA 4MRUA 4AJWA 3PVLA 2WXOA 1H2VC 1SZ9A 1Y8MA 2VSYA 4MLPA 1LF8A 3NZUA 3CVPA 4IULA 4JPSA 3UT8A 5LP0A 3QB2A 3DBSA 3D9LA 2NXPA 2GGFA 3LDZA 4Q94A 2X6FA 2Y4TA 2XCCA 1N52A 3N71A 4H7XA 2J4BA 3ZPJA 3SF4A 5BT1A 5FJYA 3FU0A 2CFUA 4L2YA 1U3CA 2KCLA 2KCVA 2WXRA 3L08A 5ANLA 3TXNA 4FHJA 1HH8A 3CVQA 4W9RA 2X6IA 1HZ4A 4CEMA 1MQSA 2VSXE 3MEKA 1ZBPA 4JHKA 5D0OD 5G04C 2OVBA 5ENNA 2ILRA 4RG9A 2VGYA 4UWLA 2XPIA 2DCPA 3GZSA 4Y6WA 3L6AA 4I1MA 4EQFA 3QDNA 3JYSA 3S7JA 4OYSA 3G2UA 3L16A 3LVRE 4AIFA 4TV3A 3TG5A 3BEEA 4UQYA 3B7TA 3MKQA 4CDRA 3CVVA 4F53A 2AW6A 2L6JA 3MV2B 3TL5A 1E96B 1L5JA 2LO6A 4GCNA 3ZGQA 3FUNA 2IF4A 1E8ZA 3FTSA 4GB9A 1WAO1 3Q5MA 3LY9A 1IQUA 4FJYA 2NC9A 4GZ3A 4ANUA 1UG3A 2Y4UA 4KVOA 4GYWA 3L54A 4B89A 2WQHA 2BUGA 1QNFA 4HOTA 3U4TA 3TG4A 4XZ4A 3CK8A 4PS8A 3D9KA 2VGXB 4HOQA 4LEUA 4ACLA 4UWKA 3S7FA 1QQEA 2PQNA 3KEZA 3LPZA 1H6KA 3E4BA 2GW1A 2WXKA 4NQ0A 5FZQA 3RIBA 3UPVA 4WUYA 3CVUA 3L22A 4Q96A 3MCXA 3MV3B 3CEQA 3ASGA 3IHVA 3RK6A 4H7YA 4C9BB 4N3AA 1S0PA 2XQ0A 3RU0A 3CQGB 5D0QD 5JHAA 2WQ7A 5KJMA 2MRIA 1WY6A 4CT4A 2AXZA 2JEKA 3EHNA 4G23A 4ANXA 1E7VA 3FUDA 4NURA 4G24A 4N39A 2I6HA 3ZXSA 2VJ8A 5J90A 2A4ZA 4BT8A 4HLEA 3CVYA 2QY7A 1ELRA 1EDUA 4MKTA 3RRUA 3JUIA 4XI0A 3Q4AB 4XKBA 2BTDA 5LCWJ 2MHKA 3ENEA 3G2TA 4G26A 4OVUA 2CHXA 4UQXA 2DBAA 4J8DA 3D9PA 3SI5A 2KZTA 1KLXA 2VYIA 4FC8A 3LY7A 4GPKA 3LCAA 2JLBA 2KC7A 2HM8A 2XGOA 3HVEA 4XI9A 4FP7A 2XPYA 2RD0A 3QARA 3VLDA 3S7DA 3VTXA 2R17C 4WNEA 1UN8A 5KJLA 2KATA 1HF8A 5FQ7A 5EX0A 1DNPA 2LSUA 3QAQA 3O4ZA 4ILHB 4WAFA 1NA3A 3P1UA 4U63A 3CHSA 2HO1A 2P58C 4FULA 4RVBA 5E76A 2C2LA 2IOSA 3JCKC 3SD5A 2R5SA 4UWFA 3CSFA 3SHFA 3CVXA 3KD7A 2CHWA 4BX9A 4JA9A 1UN9A 2AWIA 2IFUA 4G1TA 4UWGA 1EF1C 2AXVA 4WWOA 4CRWA 3CSTA 1X5BA 5T3RA 5CHEE 1PAQA 3CHMA 4N5CA 4B8CB 3U3WA 2FF4A 4I6EA 3CVWA 4GYOA 5ARGA 5AENA 3PDNA 4A3VA 3PE4A 3U64A 5ARFA 5C1DA 4U07A 5JJ7A 2KM4A 3FTVA 4CDNA 4C0MA 3BG1B 3ZVVA 4GMLA 4AP2A 4O6FA 4GMJA 4G25A 4U04A 3HDXA 4J0UA 4HS2A 1OWMA 3I4GA 4AVXA 3AS5A 5A23A 2L0TB 2IOLA 3FU5A 4C0EA 1Y6IA 2X6HA 3QWPA 2CHZA 4IN3B 4GA2A 2WXIA 4V3IA 4EPZA 2XGMA 3CHOA 4EECA 3ZYKA 2LAHA 4NACA 5AIJA 4RG6A 3CVLA 3SGHA 3IBEA 2FI7A 2FO7A 5BNWA 3KAEA 2Q7FA 2L9BA 4E85A 5FZSA 1ZU2A 4LERA 5FT9A 3CHRA 5KJNA 3ZN3A 3FWVA 1Z3YA 2WXNA 2HYZA 4KXKB 3FTUA 1INZA 2V5FA 4NRHB 4AEZC 4D10C 3I4RB 4A3TA 1N54A 2V0PA 4CDMA 5EDSA 2X6KA 5T8IA 5CCLA 1OWNA 3FUHA 4KT6B 3QC1A 3IKOB 5BV0A 4J8FA 1E8YA 5DIZA 2WXFA 1KT1A 5KCMA 4KBQA 4Q69A 5G55A 4XE0A 4XIFA 3QWWA 2R59A 4HOUA 3UMVA 2XRZA 2VSOE 5M72A 3FTXA 3RRMB 3SNXA 2XHEA 3APDA 4M3OA 5KJKA 4EZJA 1HG5A 3D9IA 4LCTA 3QNKA 3R7QA 3LY8A 3R7RA 3G2VA 3GW4A 3MX3A 4ABNA 2GRLA 4FHKA 2PL2A 1H2TC 1XGWA 4AOFA 3NF1A 3P2BA 4IRUA 2WQ6A 4HVBA 3PUKA 2VSNA 3CK9A 3D9OA 4PH4B 2WB2A 4GCOA 4HORA 4UI9J 2WVIA 1H19A 2MOWA 3CGHA 3Q47B 4A1SA 2J09A 4JHJA 3AU4A 2C0LA 3CV0A 4I9CA 3S7BA 4B0ZA 4J8EA 3FP3A 5A7DB 2I1KA 4GAAA 4EZKA 4HFGA 4AV7A 2UY1B 5EKQD 2IONA 2NSZA 2IJGX 3PNTB 2Y3AA 3SFZA 1E90A 2WXGA 3ZYMA 3HHMA 3SBSA 3LKUA 4FA6A 4HXIA 3FH7A 4JZYA 2FEZA 2WXLA 2AVPA 1HG2A 4K0RA 2IU1A 4GZ5A 4BWRA 1SQMA 3S2AA 4I2ZA 4I6GA 5BV1A 4BSXA 3PZDA 3ZIMA 3U66A 2A5UA 3Q15A 3CVNA 5CCMA 4L7TA 3ASDA 1HFAA 4WNDA 4JC8A 3TAXA 4GZDA 3U9WA 3ZEFA 4L1BA 5HQ8A 3ZFWA 3D9JA 4GA1A 2KCKA 2J4DA 3PE3A 4IYPA 1VDYA 2VQ2A 4OVVA 2OV8A 4WNGA 3B7RL 4ANVA 4FLBA 3EHMA 4G11A 1OWOA 5G04J 2V8SE 1HE8A 1PC2A 2QFCA 2BF0X 4YNDA 1YA0A 4CCAA 4GA0A 3L17A 3OAWA 3QKYA 5AJDA 4F1SA 3FTZA 3IEGA 4L2LA 1B89A 4DK5A 5EX3A 4I17A 1HX8A 1JUQA 3O48A 4N3CA 3ESLA 2DIWA 3CLJA 3UT4A 1JWFA 4EZLA 5C2YA 3JQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZN3 A;  3QDN A;  3JYS A;  3S7J A;  4EQF A;  4AIF A;  5LCW C;  2LNI A;  4RG6 A;  1WM5 A;  3CVL A;  4U0Z A;  3BEE A;  3TG5 A;  3OXF A;  4UQY A;  2FI7 A;  2FO7 A;  5BNW A;  3KAE A;  2Q7F A;  2PZI A;  4KYO B;  4U0S A;  5FZS A;  4BTA A;  1ZU2 A;  4JA7 A;  4CDR A;  5FT9 A;  5JJT A;  2HR2 A;  5KJN A;  2XGS A;  2L6J A;  3FWV A;  3MV2 B;  1E96 B;  3GZ1 A;  2XCB A;  1A17 A;  2HYZ A;  3ASH A;  4GCN A;  4KXK B;  2IF4 A;  3ULQ A;  2E2E A;  1WAO 1;  3Q5M A;  3LY9 A;  2V5F A;  3RO3 A;  2NC9 A;  4NRH B;  4UI9 C;  4Y6C A;  4GZ3 A;  2Y4U A;  3RJV A;  3OXL A;  4GZ6 A;  4GYW A;  4F3V A;  3OXG A;  2WQH A;  2BUG A;  3QOU A;  4UI9 K;  4HOT A;  3U4T A;  3KS2 A;  3TG4 A;  3CK8 A;  1QZ2 A;  5CCL A;  1IYG A;  2VGX B;  3K9I A;  5G05 J;  4HOQ A;  4LEU A;  1TJC A;  2FBN A;  2OND A;  4J8F A;  2WPV A;  3S7F A;  1QQE A;  5DIZ A;  1KT1 A;  2PQN A;  3LPZ A;  4GYY A;  3E4B A;  4NQ0 A;  2GW1 A;  4KBQ A;  5FZQ A;  5AYW D;  4I1A A;  3RIB A;  4WUY A;  4BTB A;  3UPV A;  4YVQ C;  4XIF A;  3QWW A;  4BT9 A;  3MV3 B;  3CEQ A;  3ASG A;  4HOU A;  1OUV A;  1P5Q A;  2VGX A;  4H7Y A;  3CKC A;  4ME2 A;  5KJK A;  5M72 A;  4N3A A;  3RU0 A;  5D0Q D;  3LY8 A;  5KJM A;  4JL0 A;  3GW4 A;  5JJ6 A;  4G23 A;  2YQ8 A;  4ABN A;  4I2W A;  2PL2 A;  4G24 A;  4N39 A;  2I6H A;  4AM9 A;  4UQZ A;  3UQ3 A;  3NF1 A;  4N2Q A;  3FFL A;  2UWJ G;  2VSN A;  3CK9 A;  4BT8 A;  2YHC A;  5A6C A;  3ESK A;  4GCO A;  4HOR A;  4UI9 J;  2LSV A;  3AS4 A;  1ELR A;  3WXX A;  4A1S A;  3Q47 B;  4XI0 A;  3ZGQ A;  1W3B A;  3Q49 B;  2C0L A;  3CV0 A;  2MHK A;  3Q4A B;  4I9C A;  3RO2 A;  3S7B A;  4APO A;  5LCW J;  4G26 A;  3GYZ A;  4J8E A;  3FP3 A;  4UQX A;  2DBA A;  4J8D A;  5DBK A;  5A7D B;  3SZ7 A;  1KLX A;  2VYI A;  3MKR A;  3LY7 A;  2UY1 B;  1HXI A;  3GZ2 A;  5EKQ D;  3LCA A;  2JLB A;  4N2S A;  2KC7 A;  2XGO A;  4XI9 A;  1FCH A;  5HI7 A;  1KT0 A;  2J9Q A;  3LKU A;  2XEV A;  3S7D A;  4I9E A;  3VTX A;  3UUX A;  4WNE A;  5KJL A;  3QWV A;  2KAT A;  4WNF A;  4YVO A;  5EX0 A;  5FTP A;  2LSU A;  2C0M A;  2FEZ A;  1NA3 A;  4N3B A;  2AVP A;  2HO1 A;  2P58 C;  2OOE A;  3CKB A;  4HOS A;  5G05 C;  2C2L A;  4GZ5 A;  4JHR A;  3R9A B;  1NA0 A;  4BWR A;  3URZ A;  4CGW A;  2R5S A;  4I2Z A;  3AS8 A;  4AY5 A;  3HYM B;  2PQR A;  3KD7 A;  3RKV A;  3EDT B;  5BW8 C;  1XNF A;  4JA9 A;  3TGO A;  2IFU A;  3Q15 A;  4CGV A;  4G1T A;  1Y8M A;  3CVN A;  2VSY A;  5CCM A;  3ASD A;  4WND A;  3CVP A;  5CHE E;  1NZN A;  1ELW A;  5FZR A;  4N5C A;  3TAX A;  3U3W A;  2FF4 A;  3CK7 A;  5HQ8 A;  4GPK A;  3ZFW A;  4GA1 A;  2KCK A;  3LYA A;  3PE3 A;  4GYO A;  1IHG A;  2VQ2 A;  2Y4T A;  2XCC A;  3PDN A;  4WNG A;  3N71 A;  5ARG A;  4H7X A;  3PE4 A;  2UY1 A;  3ZPJ A;  5ARF A;  3SF4 A;  4U07 A;  5FJY A;  5BT1 A;  5G04 J;  5C1D A;  5JJ7 A;  4G2V A;  2KCL A;  1PC2 A;  2QFC A;  3ASF A;  2KCV A;  3ZHE B;  3MA5 A;  4O6F A;  1YA0 A;  4U04 A;  4G25 A;  4GA0 A;  1HH8 A;  3CVQ A;  3QKY A;  4YND A;  4J0U A;  4AY6 A;  4W9R A;  3VTY A;  3IEG A;  1HZ4 A;  3AS5 A;  1B89 A;  4B94 A;  3MEK A;  5EX3 A;  1ZBP A;  4I17 A;  3O48 A;  4N3C A;  5D0O D;  5G04 C;  3QWP A;  4U0U A;  4IN3 B;  4GA2 A;  4RG9 A;  2VGY A;  2XPI A;  4Y6W A;  3ZHE A;  2XGM A; 
#chains in the Genus database with same CATH topology
 5LOZ A;  3JQ0 A;  3I5P A;  4TXR A;  4JEH A;  3PUJ A;  3IHY A;  3APF A;  1DVP A;  3ABL E;  1WDY A;  4JA7 A;  2Y1L E;  3LS8 A;  1MHQ A;  2H6F A;  5EID A;  5HRY A;  4GZC A;  4Y6C A;  3LJ3 A;  2H6I A;  3OXG A;  3C5R A;  2OVF A;  3SFX A;  4JB8 P;  3CR3 A;  3C3R A;  2JAB A;  3FY4 A;  4DX5 D;  4FLH A;  2YHE A;  2YQ8 A;  3B7S A;  3CQC B;  2KXP C;  2PM7 A;  2QYU A;  4A1G A;  3CHP A;  3FFL A;  2WXP A;  4TUU A;  2WXJ A;  5FQ6 A;  2FUL A;  2E0I A;  1OT8 A;  4N2S A;  3VLF A;  1FCH A;  3L13 A;  1UOH A;  3MJW A;  4N3B A;  3ZYQ A;  1D8D A;  3R9A B;  1NA0 A;  3DPD A;  3HYM B;  1EPU A;  3RRN B;  1HO8 A;  4J7W A;  3G2S A;  2V4H C;  5AJL A;  3ZYL A;  3TGO A;  4KZ0 A;  4BES A;  3PNL B;  1JPL A;  4DX7 D;  3T9K A;  1NZN A;  4KZC A;  4OAU C;  3ABK E;  3FH5 A;  4URK A;  1DC2 A;  3ONL A;  1ELK A;  3NQP A;  3WG7 E;  3ZHE B;  3PEU B;  3D3M A;  4F7A A;  3PS6 A;  3TXM A;  5BPP A;  4MBG A;  2EIL E;  2J08 A;  5KNG A;  1U2V G;  3JXJ A;  3TJP A;  2OEV A;  4JEU A;  3V79 K;  2HR2 A;  4GU5 A;  1H2U A;  3ULQ A;  2EQX A;  3ML9 A;  3T5X A;  5CMY A;  2IEJ A;  3FHE A;  5AQ7 A;  4U8Y D;  5ANR A;  1D9S A;  2FBN A;  4NIK A;  3ASN E;  4BTB A;  3AJI A;  4BT9 A;  1OUV A;  3CKC A;  1E8W A;  3TWU A;  3B13 A;  3ASO E;  4AM9 A;  4APF A;  3DSX A;  1IXV A;  2LAI A;  2ZIS A;  3MZL B;  3SZ7 A;  3MKR A;  2I2O A;  2PNN A;  4I9E A;  3UUX A;  4WNF A;  4O1O A;  3HG0 D;  4LSZ E;  3CKB A;  4PS7 A;  3TWT A;  1S63 A;  4F1P A;  4MRU A;  2WXO A;  1Y8M A;  3UT8 A;  4IUL A;  5LP0 A;  1X81 A;  4ZHB A;  2X6F A;  2Y4T A;  1N52 A;  2P9I G;  2J4B A;  5ENT D;  3SF4 A;  4L2Y A;  2CFU A;  1NL4 A;  3X2Q E;  2VSX E;  2OVB A;  4HB5 A;  2ILR A;  1MX4 A;  4UWL A;  3JYS A;  3S7J A;  4TV3 A;  3BEE A;  2P9K G;  3B7T A;  1K1B A;  1KZP A;  3MKQ A;  4F53 A;  3AG2 E;  3MV2 B;  1L5J A;  2LO6 A;  4RQI A;  3FUN A;  3Q5M A;  3PZ1 A;  2Y4U A;  4KVO A;  4B89 A;  3W9F A;  3UIO C;  3U4T A;  3CK8 A;  3D9K A;  4LEU A;  4ACL A;  4UWK A;  3S7F A;  1S70 B;  5FZQ A;  4YDE A;  3L22 A;  3RK6 A;  4N3A A;  2F37 A;  2XQ0 A;  3CQG B;  5JHA A;  1D8E A;  2DYS E;  3C72 A;  1WY6 A;  2AXZ A;  4ANX A;  4NUR A;  2I6H A;  3ZXS A;  5J90 A;  2A4Z A;  4HLE A;  3JUI A;  5LCW J;  3G2T A;  4OVU A;  2CHX A;  4GPK A;  4J8D A;  3D9P A;  4YDO A;  5FIO A;  2EIK E;  3V2X A;  3ULE G;  3HRA A;  4FP7 A;  2RD0 A;  3QAR A;  4TXQ A;  3TWR A;  3S7D A;  3VLD A;  2R17 C;  4CYM D;  4WNE A;  5FQ7 A;  5EX0 A;  1DNP A;  3O4Z A;  3P1U A;  4U63 A;  2R5S A;  4UWF A;  3SHF A;  3KD7 A;  4JA9 A;  4UWG A;  2AXV A;  4WWO A;  2H6H A;  5JMN D;  2XEN A;  1PAQ A;  3CHM A;  4B8C B;  3U3W A;  4I6E A;  4G8L A;  2ETA A;  4AP2 A;  4G25 A;  4HS2 A;  3NOC D;  5A23 A;  3NBN B;  1Y6I A;  4GA2 A;  3DEO A;  3ZYK A;  5FZS A;  1Z3Y A;  2WXN A;  1BI8 B;  3BU8 A;  3DEP A;  4NRH B;  4AEZ C;  4G8K A;  3IKO B;  1MYO A;  5KCM A;  3Q73 A;  4KBQ A;  1OCO E;  4XIF A;  5M72 A;  3SNX A;  5KJK A;  3R7Q A;  3GW4 A;  1V54 E;  2GRL A;  1OXJ A;  4HVB A;  3PUK A;  3CK9 A;  1BI7 B;  3BQO A;  3SY2 A;  2WB2 A;  4HOR A;  4GTQ A;  4A1S A;  2J09 A;  2C0L A;  4ZFH A;  3UM2 A;  5A7D B;  4GTV A;  5EKQ D;  2F8Y A;  2NSZ A;  1IKN D;  1G3N B;  3SFZ A;  3SBS A;  4HXI A;  2FEZ A;  4ATZ D;  2WXL A;  4K0R A;  4BWR A;  1JCS A;  1OCZ E;  4L7T A;  4JC8 A;  2P2C P;  2LXL A;  4GA1 A;  3PE3 A;  4OAV B;  1VDY A;  2OV8 A;  3B7R L;  4FLB A;  4DX2 A;  2DVW A;  5BXU A;  5G04 J;  3HXF A;  3QKY A;  4F1S A;  3FTZ A;  4DK5 A;  4BEP A;  5EX3 A;  3O48 A;  5CBO A;  1JWF A;  5E75 A;  1ZB1 A;  2I9C A;  2WXM A;  3MGB A;  2X6J A;  4KYO B;  4U95 D;  4A55 A;  4GPM A;  3AG3 E;  5B1B E;  4KVM A;  3QJZ A;  4GZ6 A;  2CFZ A;  3FTY A;  1IYG A;  1TJC A;  3CIA A;  3WXX A;  4UWH A;  2IQC A;  5AQA A;  4FAD A;  3C98 A;  4YVQ C;  4WWP A;  3RJV A;  4ME2 A;  1P5Q A;  2YIN A;  1WG0 A;  1FVH A;  4ILG A;  5JA4 D;  4JXT A;  5JHB A;  3FUJ A;  3B7U X;  3D9N A;  1GW6 A;  2YHC A;  3FUF A;  2R02 A;  3DPY A;  3I3N A;  2P9U G;  3FUL A;  3GZ2 A;  5HI7 A;  2OEW A;  2EIN E;  2R2L A;  5EYL A;  3QWV A;  5AN8 A;  3SBT B;  2OOE A;  5EIB E;  3FUI A;  1NI1 A;  4CGW A;  2XZD G;  1Z6T A;  1IHB A;  2RFA A;  3PH0 C;  5FZR A;  1TEZ A;  2AXU A;  2M63 A;  3MKQ B;  4FU3 A;  4LRZ A;  2UY1 A;  2IO2 C;  4TUM A;  4ACK A;  5H7P A;  3MA5 A;  1LTX A;  3VTY A;  1TN8 A;  4ANW A;  4CT0 A;  5BUZ A;  3ASH A;  4BY6 A;  4PS3 A;  4RSY A;  2LNI A;  4KMO A;  4U0Z A;  3V2O A;  2XPZ A;  4HI8 A;  4WWN A;  4X8Q A;  3UKR G;  3B95 A;  4HBD A;  1TYQ G;  3RO3 A;  2H6G A;  3EUV A;  4DRX E;  1QZ2 A;  3FTW A;  1JCQ A;  3UT7 A;  3KEA A;  2L0I A;  2VGX A;  1E7U A;  2V4L A;  2J49 A;  4I2W A;  4UQZ A;  1HS6 A;  2I1J A;  1EYH A;  3ESK A;  3EIJ A;  3E33 A;  3GYZ A;  3PZ3 A;  5FWQ A;  4XKC A;  3EHR A;  1BU9 A;  2P9L G;  5CRV A;  3OTN A;  1Z3X A;  3LVQ E;  1MJ0 A;  3T8M A;  2PM6 A;  2PQR A;  5BW8 C;  2XRZ A;  2VSY A;  4MLP A;  1LF8 A;  4Q94 A;  3ZPJ A;  2KCL A;  2WXR A;  4FHJ A;  3L82 A;  2X6I A;  1HZ4 A;  2XS1 A;  2EIM E;  3MEK A;  1ZBP A;  2LUH A;  3JXI A;  3TWX A;  2DCP A;  4I1M A;  2ETC A;  3QDN A;  4HRL A;  3L16 A;  4AIF A;  3DWL G;  5BXO A;  2AW6 A;  2L6J A;  3TL5 A;  1E8Z A;  4GB9 A;  1WAO 1;  4FJY A;  3LY9 A;  2BKK B;  3HXD A;  3L54 A;  3Q75 A;  1QNF A;  4PS8 A;  2VGX B;  4HI9 A;  3KEZ A;  1YYH A;  1H6K A;  3HXC A;  3UPV A;  4Q96 A;  3IHV A;  3NB2 A;  4H7Y A;  4C9B B;  3RU0 A;  1AWC B;  4QQI A;  3FUD A;  4N39 A;  4GTT A;  1ELR A;  4MKT A;  3Q4A B;  3UIN C;  2MHK A;  4G26 A;  2DYR E;  4UQX A;  3SI5 A;  2VYI A;  3LY7 A;  2KC7 A;  2KAT A;  1HF8 A;  2VTB B;  3CHS A;  2HO1 A;  3DXK G;  2C2L A;  2IOS A;  3SD5 A;  3CVX A;  2IY0 C;  2AWI A;  4CRW A;  1KZO A;  1TNZ A;  5CHE E;  4N5C A;  4GYO A;  5ARG A;  5C1D A;  4U07 A;  3FTV A;  3UM3 A;  4GML A;  4GMJ A;  2DWZ A;  3HDX A;  4J0U A;  1OWM A;  3I4G A;  4AVX A;  3AS5 A;  3FU5 A;  2X6H A;  3QWP A;  1KPS B;  4EEC A;  2LAH A;  4NAC A;  3CVL A;  3IBE A;  2Q7F A;  1ZU2 A;  5FT9 A;  3CHR A;  5KJN A;  2AJA A;  3FWV A;  3TWV A;  1O1S A;  3UIP C;  2V5F A;  3J5P A;  4D10 C;  4A3T A;  2V0P A;  1SVX A;  5CRU A;  5EDS A;  1O5M A;  2P9P G;  3FUH A;  3QC1 A;  5CER B;  3QWW A;  3UMV A;  3APD A;  4M3O A;  4LCT A;  3QNK A;  1Q2Z A;  3R7R A;  4XEI G;  3NF1 A;  2WQ6 A;  2GRP B;  4N5Q A;  3ZKJ A;  1OY3 D;  4HRM B;  1H19 A;  2MOW A;  3ISM C;  3Q47 B;  1N4S A;  2XEH A;  4JHJ A;  3AU4 A;  3CV0 A;  3S7B A;  4B0Z A;  2I1K A;  4GAA A;  4EZK A;  4HFG A;  4AV7 A;  2Y3A A;  2WXG A;  3T8K A;  2AVP A;  1A5E A;  4I2Z A;  4BSX A;  5CBN A;  2A5U A;  3Q15 A;  3CVN A;  3U9W A;  4GTP A;  4L1B A;  3EHM A;  1PC2 A;  2QFC A;  2BF0 X;  4YND A;  4CCA A;  4I17 A;  1HX8 A;  1JUQ A;  4N3C A;  3ESL A;  2DIW A;  3HXE A;  3UM0 A;  3JQ1 A;  1TNY A;  4J6I A;  1TNB A;  3OXF A;  5ITZ F;  2VGE A;  5JJT A;  1U3D A;  2E2E A;  3FUK A;  4TRQ A;  3OXL A;  2DZO A;  3QOU A;  5T4Y A;  2OND A;  2KBX A;  2WPV A;  4FJZ A;  4GYY A;  1IQR A;  3F6Q A;  2CG2 A;  2ZU6 B;  2WXH A;  2WXQ A;  1TNO A;  4I43 A;  5J08 A;  4QFV A;  1LD8 A;  4GTO A;  4E6H A;  2LSV A;  1O1R A;  1UJJ A;  4ATG A;  4CZ2 D;  3T5V A;  1MX2 A;  2WMN A;  2WMO A;  2F0Y A;  2ZGG A;  2GRN B;  3URZ A;  5AQ9 A;  3RKV A;  4CGV A;  3EU5 A;  5CEA A;  1QBQ A;  4DI4 A;  3LYA A;  3FEY A;  2J8S D;  4GTM A;  1FVF A;  3ASF A;  4BFR A;  4AY6 A;  3AU5 A;  3VLE A;  4B94 A;  5LX8 A;  3ML8 A;  3HXB A;  3ZRH A;  4U0U A;  5LFA A;  4AXH A;  3C3Q A;  4BX8 A;  4BTA A;  1OWP A;  4U0S A;  4Z68 A;  4ILI A;  2XGS A;  1A17 A;  1UW4 B;  5FQ8 A;  5HKP A;  1H6O A;  2BKG A;  3UX4 A;  3NAW A;  5B1A E;  5G05 J;  2RG8 A;  3CHQ A;  5AYW D;  1TJF A;  4LNU D;  3HVE B;  5B3S E;  4LUN U;  4U8H A;  2VTB A;  4DI3 A;  5CMW A;  3FU3 A;  2R03 A;  5JJ6 A;  2X3M A;  1H0A A;  3UQ3 A;  2UWJ G;  2ZGD A;  3AS4 A;  4EBA A;  3FUE A;  3LXU X;  1UJK A;  4EBA G;  5ENQ D;  2X38 A;  1E8X A;  4LNB A;  1KT0 A;  2XEV A;  4I1O B;  2C0M A;  4YDY A;  4P29 A;  4HOS A;  4JHR A;  3Q79 A;  4GTS A;  1XNF A;  4AJW A;  1H2V C;  1DCQ A;  3NZU A;  3CVP A;  4JPS A;  2BED A;  2GGF A;  2XCC A;  5FJY A;  1LD7 A;  3L08 A;  5ANL A;  3TWS A;  3TXN A;  1HH8 A;  3CVQ A;  4W9R A;  1MQS A;  4JHK A;  5D0O D;  5G04 C;  2VGY A;  2XPI A;  3GZS A;  3L6A A;  3EHQ A;  4EQF A;  4OYS A;  3LVR E;  3TG5 A;  5D2M C;  4CDR A;  3CVV A;  4JD2 G;  3ZNG A;  3ULY A;  1E96 B;  4GCN A;  3PZ4 A;  2IF4 A;  3FTS A;  1Z5S C;  4ANU A;  1UG3 A;  2WQH A;  2BUG A;  3AG1 E;  2P9S G;  2PQN A;  4NQ0 A;  1MX6 A;  3CVU A;  4WUY A;  3MCX A;  3MV3 B;  3CEQ A;  3ASG A;  1S0P A;  5D0Q D;  2WQ7 A;  2MRI A;  2JEK A;  4G23 A;  2VJ8 A;  4BT8 A;  3CVY A;  3J5Q B;  2QY7 A;  1EDU A;  2BTD A;  2P9N G;  2DBA A;  4FC8 A;  2JLB A;  2XGO A;  2HM8 A;  4XI9 A;  5AAO A;  1FPP A;  3QAQ A;  2LSU A;  4ILH B;  1NA3 A;  5E76 A;  2P58 C;  4FUL A;  2OCC E;  3JCK C;  3BUA A;  3CSF A;  1UN9 A;  4G1T A;  3CST A;  1X5B A;  2A5E A;  4TXP A;  2FF4 A;  3CVW A;  3PDN A;  1QYM A;  3ZXP A;  4A3V A;  3PE4 A;  4LNG A;  2V5Q C;  5JJ7 A;  5ARF A;  2KM4 A;  4CDN A;  3ZVV A;  4O6F A;  4EHM A;  4C0E A;  2CHZ A;  2WXI A;  4EPZ A;  2XGM A;  3CHO A;  2HE0 A;  3JUE A;  5AIJ A;  2RFM A;  2QC9 A;  3SGH A;  2FI7 A;  2FO7 A;  3KAE A;  4BSZ B;  4M7C A;  3FTU A;  3PZ2 A;  4GTR A;  3E32 A;  1N54 A;  2X6K A;  5T8I A;  5BV0 A;  2WXF A;  4K5A B;  4XE0 A;  2XEE A;  2VSO E;  3FTX A;  4EZJ A;  1HG5 A;  1RZ4 A;  2DZN A;  4LG6 A;  3UTM A;  2PL2 A;  2MYO A;  4IRU A;  5ENS D;  1O1T A;  4PH4 B;  4GCO A;  4UI9 J;  2WVI A;  2GRR B;  3CGH A;  4I9C A;  3E30 A;  1E90 A;  2QYJ A;  3ZYM A;  3LKU A;  1HG2 A;  1SQM A;  3S2A A;  5BV1 A;  2F8X K;  3PZD A;  3ASD A;  1HFA A;  3DSW A;  3ZFW A;  2J4D A;  2VQ2 A;  4OVV A;  4WNG A;  4G11 A;  1OWO A;  1BLX B;  1K1A A;  5EN5 D;  5CED B;  1YA0 A;  3L17 A;  4L2L A;  1B89 A;  4K5C A;  4EZL A;  3UT4 A;  5C2Y A;  2B0O E;  1K3Z D;  3DXM G;  3B7B A;  1WM5 A;  2PZI A;  5KNH D;  3NOG D;  3Q78 A;  3FU6 A;  4J8S A;  3GZ1 A;  3SQV A;  4UI9 C;  4F3V A;  4UI9 K;  3IV0 A;  3ONK A;  4PDX A;  2YNQ A;  3LEW A;  2CG3 A;  3SO8 A;  5D66 A;  3HIZ A;  1TNU A;  5HS0 A;  4O1P A;  1SZA A;  3E34 A;  3APC A;  4U7E B;  1JWG A;  3UXG A;  5A6C A;  3FH8 A;  1NP7 A;  4PUC A;  1W3B A;  2GRO B;  3Q49 B;  1N0R A;  4APO A;  3UKU G;  4L23 A;  1OCR E;  3EJN A;  1OWL A;  3IXE A;  3ZUV B;  2J9Q A;  2R05 A;  4K03 A;  3Q7F A;  3D9M A;  4B8A A;  4HNA D;  5AQB A;  5G05 C;  3ZW3 A;  3EDT B;  4K5B A;  1ELW A;  1YCS B;  3CK7 A;  4DLO A;  4O60 A;  1IHG A;  5KBA A;  3RAU A;  4G2V A;  5FQ4 A;  4JVS A;  2EIJ E;  3TWW A;  2XZT G;  4MS6 A;  3PRZ A;  3C3O A;  4DJA A;  1K8K G;  3PRE A;  4JW1 A;  1YMP A;  5LCW C;  1PY1 A;  2XCB A;  5KWD A;  4U96 D;  1N0Q A;  2RKK A;  3ZU7 B;  1N4R A;  3Q9U C;  2XRY A;  3ABM E;  3KS2 A;  3QK0 A;  3K9I A;  5G2N A;  3V31 A;  3FEX A;  1H6P A;  4I1A A;  3G2W A;  3L9T A;  3FUM A;  4DX6 D;  2WM9 A;  2GRM A;  2J07 A;  2L6B A;  4JL0 A;  3NZS A;  4N2Q A;  4DLQ A;  4DPR A;  3TWQ A;  3BG0 B;  4R7L A;  3RO2 A;  1BPO A;  1TN7 A;  4XX5 A;  5DBK A;  1HU3 A;  4B93 B;  1HXI A;  4DX1 A;  4HLL A;  4BET A;  4YVO A;  3PEV B;  5FTP A;  2KZT B;  5AAR A;  3MYV A;  3EIQ C;  3AS8 A;  4AY5 A;  5ENR D;  4I6J A;  3FDH A;  3PVL A;  1SZ9 A;  3QB2 A;  3DBS A;  3D9L A;  2NXP A;  3LDZ A;  3UI2 A;  3N71 A;  4H7X A;  1N11 A;  2B6C A;  5BT1 A;  3FU0 A;  1U3C A;  3AAA C;  4RLY A;  2KCV A;  5IY5 E;  3Q9N C;  4CEM A;  2Y69 E;  5ENN A;  4RG9 A;  4Y6W A;  2ZXW E;  3G2U A;  4UQY A;  3V30 A;  2GRQ B;  3ZGQ A;  1IQU A;  2NC9 A;  4GZ3 A;  4GYW A;  4UUC A;  1NFI E;  5FIN A;  4HOT A;  1N9A A;  3TG4 A;  4XZ4 A;  3W9G A;  4HOQ A;  1QQE A;  1OCC E;  3LPZ A;  3E4B A;  3RIB A;  2GW1 A;  2WXK A;  4DUI A;  2FO1 E;  1AP7 A;  3AG4 E;  4GMR A;  5KJM A;  4CT4 A;  3EHN A;  1E7V A;  4G24 A;  4A63 B;  3RRU A;  4XI0 A;  4XKB A;  3ENE A;  1JCR A;  2KZT A;  1KLX A;  5ENP D;  2LXM A;  3LCA A;  3HVE A;  5ENO D;  2XPY A;  3VTX A;  1UN8 A;  5KJL A;  5EIL A;  4WAF A;  4RVB A;  3D9H A;  1TR4 A;  3LJN A;  2CHW A;  4BX9 A;  4HRN A;  2IFU A;  1FT1 A;  1S64 A;  1EF1 C;  5T3R A;  5AEN A;  3U64 A;  4C48 B;  4C0M A;  3DRA A;  3BG1 B;  3KSL A;  4U04 A;  1TN6 A;  1DCE A;  2L0T B;  2IOL A;  1N4Q A;  4IN3 B;  4V3I A;  4YDW A;  3E37 A;  4RG6 A;  5BNW A;  2Y0B G;  2L9B A;  4BER A;  4E85 A;  4LER A;  3Q7A A;  1RW2 A;  3ZN3 A;  3DSV A;  2HYZ A;  4J8Y A;  4KXK B;  2IO3 C;  1INZ A;  1SA5 A;  3I4R B;  4CDM A;  5CCL A;  1OWN A;  4KT6 B;  5EYP F;  4F6R D;  4J8F A;  1E8Y A;  5DIZ A;  1KT1 A;  4Q69 A;  5G55 A;  4U8V D;  2R59 A;  4HOU A;  3RRM B;  2XHE A;  3EU9 A;  3KSQ A;  3D9I A;  3LY8 A;  3G2V A;  3MX3 A;  4ABN A;  1SA4 A;  4FHK A;  1H2T C;  1XGW A;  4AOF A;  3P2B A;  2VSN A;  3D9O A;  1BD8 A;  4J8E A;  3FP3 A;  2QZA A;  2UY1 B;  2ION A;  1MZC A;  2IJG X;  2ZIR A;  3PNT B;  3HHM A;  3DST A;  3DSU A;  4FA6 A;  3FH7 A;  4JZY A;  1FT2 A;  1SW6 A;  4L9P A;  2IU1 A;  4GZ5 A;  4I6G A;  1V55 E;  3U66 A;  3ZIM A;  4HQD A;  2ETB A;  5CCM A;  3UM1 A;  4WND A;  3DSS A;  3TAX A;  4GZD A;  3R9M A;  3ZEF A;  5HQ8 A;  3D9J A;  2KCK A;  4IYP A;  1N95 A;  4ANV A;  5CEC B;  2NYJ A;  2V8S E;  1HE8 A;  1N4P A;  4GA0 A;  5AJD A;  3SFY A;  3IEG A;  2XS8 A;  3RSE G;  3CLJ A;  3OAW A;  1N94 A;  3ZHE A; 
#chains in the Genus database with same CATH homology
 4J6I A;  5LOZ A;  2I9C A;  2WXM A;  3I5P A;  3JQ0 A;  4JEH A;  1WM5 A;  3MGB A;  3IHY A;  3PUJ A;  3APF A;  3OXF A;  1DVP A;  2PZI A;  2X6J A;  4KYO B;  5JJT A;  4JA7 A;  1U3D A;  4A55 A;  3LS8 A;  1MHQ A;  3FU6 A;  4J8S A;  3GZ1 A;  2E2E A;  3FUK A;  4TRQ A;  4GZC A;  4UI9 C;  4Y6C A;  3LJ3 A;  4KVM A;  3OXL A;  3QJZ A;  4GZ6 A;  4F3V A;  3OXG A;  2CFZ A;  3QOU A;  4UI9 K;  3FTY A;  3IV0 A;  1IYG A;  3ONK A;  4PDX A;  2OVF A;  5T4Y A;  2YNQ A;  1TJC A;  2OND A;  3LEW A;  3CIA A;  2WPV A;  4FJZ A;  3WXX A;  4GYY A;  4UWH A;  2CG3 A;  2IQC A;  4FAD A;  1IQR A;  3C98 A;  4YVQ C;  4WWP A;  3RJV A;  4ME2 A;  1P5Q A;  2YIN A;  3CR3 A;  3HIZ A;  1FVH A;  2CG2 A;  2ZU6 B;  4ILG A;  3FY4 A;  4FLH A;  4JXT A;  1SZA A;  5JHB A;  2WXH A;  2YHE A;  2YQ8 A;  3B7S A;  3FUJ A;  3CQC B;  2WXQ A;  3B7U X;  3D9N A;  1GW6 A;  2PM7 A;  4I43 A;  3ZHE A;  3APC A;  4A1G A;  3CHP A;  3FFL A;  4QFV A;  5J08 A;  4E6H A;  1JWG A;  2WXP A;  2YHC A;  5A6C A;  3FH8 A;  1NP7 A;  2LSV A;  4TUU A;  2WXJ A;  4PUC A;  3FUF A;  5FQ6 A;  2FUL A;  1W3B A;  3Q49 B;  4APO A;  3I3N A;  4L23 A;  2E0I A;  1UJJ A;  3FUL A;  4ATG A;  3EJN A;  1OWL A;  3GZ2 A;  4N2S A;  3VLF A;  5HI7 A;  1FCH A;  3L13 A;  2J9Q A;  3T5V A;  4K03 A;  3D9M A;  3MJW A;  4B8A A;  3QWV A;  2WMN A;  2WMO A;  4N3B A;  3SBT B;  3ZYQ A;  2OOE A;  5G05 C;  3R9A B;  3ZW3 A;  3FUI A;  1NA0 A;  3DPD A;  3URZ A;  4CGW A;  3HYM B;  1EPU A;  3RRN B;  3RKV A;  3EDT B;  1HO8 A;  3G2S A;  5AJL A;  3ZYL A;  1Z6T A;  4CGV A;  3TGO A;  4KZ0 A;  3PH0 C;  1JPL A;  3PNL B;  1NZN A;  1ELW A;  5FZR A;  1TEZ A;  2AXU A;  2M63 A;  3MKQ B;  4KZC A;  4FU3 A;  3CK7 A;  4LRZ A;  4DI4 A;  4DLO A;  3LYA A;  3FEY A;  1IHG A;  3FH5 A;  4URK A;  2UY1 A;  1FVF A;  3ONL A;  1ELK A;  3NQP A;  4G2V A;  4ACK A;  3ASF A;  5FQ4 A;  4BFR A;  4JVS A;  3ZHE B;  3MA5 A;  3D3M A;  3PEU B;  2VTB B;  4AY6 A;  4F7A A;  3AU5 A;  3PS6 A;  3VLE A;  3TXM A;  3VTY A;  4B94 A;  5BPP A;  3ML8 A;  4ANW A;  5LX8 A;  3ZRH A;  4MS6 A;  3PRZ A;  4U0U A;  5LFA A;  4CT0 A;  4DJA A;  5BUZ A;  3ASH A;  2J08 A;  3PRE A;  4JW1 A;  4BY6 A;  4PS3 A;  4AXH A;  4RSY A;  5LCW C;  2LNI A;  4KMO A;  3TJP A;  4BX8 A;  4U0Z A;  1PY1 A;  2XPZ A;  4JEU A;  4BTA A;  1OWP A;  4U0S A;  4WWN A;  2HR2 A;  4ILI A;  2XGS A;  4GU5 A;  1H2U A;  3ULQ A;  2EQX A;  2XCB A;  1A17 A;  1UW4 B;  3ML9 A;  3T5X A;  5CMY A;  5FQ8 A;  3RO3 A;  3FHE A;  5ANR A;  2XRY A;  3UX4 A;  3KS2 A;  3QK0 A;  1QZ2 A;  3K9I A;  5G05 J;  2RG8 A;  5G2N A;  3CHQ A;  2FBN A;  3FTW A;  3FEX A;  5AYW D;  3UT7 A;  1TJF A;  4I1A A;  2L0I A;  4BTB A;  3G2W A;  3FUM A;  3HVE B;  4BT9 A;  1OUV A;  2VGX A;  2WM9 A;  1E7U A;  3CKC A;  4LUN U;  1E8W A;  2GRM A;  3B13 A;  4U8H A;  2J07 A;  2VTB A;  4DI3 A;  5CMW A;  3FU3 A;  2V4L A;  4JL0 A;  2J49 A;  5JJ6 A;  2X3M A;  4I2W A;  3NZS A;  1H0A A;  4AM9 A;  4UQZ A;  1HS6 A;  2I1J A;  3UQ3 A;  4APF A;  4N2Q A;  2UWJ G;  4DLQ A;  4DPR A;  1EYH A;  3ESK A;  3AS4 A;  3BG0 B;  4R7L A;  4EBA A;  3EIJ A;  2LAI A;  3FUE A;  3RO2 A;  1BPO A;  3LXU X;  1UJK A;  4EBA G;  3GYZ A;  4XX5 A;  2X38 A;  5DBK A;  1HU3 A;  3MZL B;  3SZ7 A;  1E8X A;  3MKR A;  5FWQ A;  1HXI A;  4XKC A;  2I2O A;  1KT0 A;  2XEV A;  4I9E A;  5E75 A;  3UUX A;  4WNF A;  3PEV B;  4YVO A;  4I1O B;  5FTP A;  2C0M A;  2KZT B;  3OTN A;  1Z3X A;  4P29 A;  3CKB A;  4HOS A;  4JHR A;  4PS7 A;  3LVQ E;  3MYV A;  3EIQ C;  3T8M A;  3AS8 A;  4AY5 A;  2PM6 A;  2PQR A;  5BW8 C;  1XNF A;  4I6J A;  3FDH A;  4MRU A;  4AJW A;  3PVL A;  2WXO A;  1H2V C;  1SZ9 A;  1Y8M A;  2VSY A;  4MLP A;  1LF8 A;  3NZU A;  3CVP A;  4IUL A;  4JPS A;  3UT8 A;  5LP0 A;  3QB2 A;  3DBS A;  3D9L A;  2NXP A;  2GGF A;  3LDZ A;  4Q94 A;  2X6F A;  2Y4T A;  2XCC A;  1N52 A;  3N71 A;  4H7X A;  2J4B A;  3ZPJ A;  3SF4 A;  5BT1 A;  5FJY A;  3FU0 A;  2CFU A;  4L2Y A;  1U3C A;  2KCL A;  2KCV A;  2WXR A;  3L08 A;  5ANL A;  3TXN A;  4FHJ A;  1HH8 A;  3CVQ A;  4W9R A;  2X6I A;  1HZ4 A;  4CEM A;  1MQS A;  2VSX E;  3MEK A;  1ZBP A;  4JHK A;  5D0O D;  5G04 C;  2OVB A;  5ENN A;  2ILR A;  4RG9 A;  2VGY A;  4UWL A;  2XPI A;  2DCP A;  3GZS A;  4Y6W A;  3L6A A;  4I1M A;  4EQF A;  3QDN A;  3JYS A;  3S7J A;  4OYS A;  3G2U A;  3L16 A;  3LVR E;  4AIF A;  4TV3 A;  3TG5 A;  3BEE A;  4UQY A;  3B7T A;  3MKQ A;  4CDR A;  3CVV A;  4F53 A;  2AW6 A;  2L6J A;  3MV2 B;  3TL5 A;  1E96 B;  1L5J A;  2LO6 A;  4GCN A;  3ZGQ A;  3FUN A;  2IF4 A;  1E8Z A;  3FTS A;  4GB9 A;  1WAO 1;  3Q5M A;  3LY9 A;  1IQU A;  4FJY A;  2NC9 A;  4GZ3 A;  4ANU A;  1UG3 A;  2Y4U A;  4KVO A;  4GYW A;  3L54 A;  4B89 A;  2WQH A;  2BUG A;  1QNF A;  4HOT A;  3U4T A;  3TG4 A;  4XZ4 A;  3CK8 A;  4PS8 A;  3D9K A;  2VGX B;  4HOQ A;  4LEU A;  4ACL A;  4UWK A;  3S7F A;  1QQE A;  2PQN A;  3KEZ A;  3LPZ A;  1H6K A;  3E4B A;  2GW1 A;  2WXK A;  4NQ0 A;  5FZQ A;  3RIB A;  3UPV A;  4WUY A;  3CVU A;  3L22 A;  4Q96 A;  3MCX A;  3MV3 B;  3CEQ A;  3ASG A;  3IHV A;  3RK6 A;  4H7Y A;  4C9B B;  4N3A A;  1S0P A;  2XQ0 A;  3RU0 A;  3CQG B;  5D0Q D;  5JHA A;  2WQ7 A;  5KJM A;  2MRI A;  1WY6 A;  4CT4 A;  2AXZ A;  2JEK A;  3EHN A;  4G23 A;  4ANX A;  1E7V A;  3FUD A;  4NUR A;  4G24 A;  4N39 A;  2I6H A;  3ZXS A;  2VJ8 A;  5J90 A;  2A4Z A;  4BT8 A;  4HLE A;  3CVY A;  2QY7 A;  1ELR A;  1EDU A;  4MKT A;  3RRU A;  3JUI A;  4XI0 A;  3Q4A B;  4XKB A;  2BTD A;  5LCW J;  2MHK A;  3ENE A;  3G2T A;  4G26 A;  4OVU A;  2CHX A;  4UQX A;  2DBA A;  4J8D A;  3D9P A;  3SI5 A;  2KZT A;  1KLX A;  2VYI A;  4FC8 A;  3LY7 A;  4GPK A;  3LCA A;  2JLB A;  2KC7 A;  2HM8 A;  2XGO A;  3HVE A;  4XI9 A;  4FP7 A;  2XPY A;  2RD0 A;  3QAR A;  3VLD A;  3S7D A;  3VTX A;  2R17 C;  4WNE A;  1UN8 A;  5KJL A;  2KAT A;  1HF8 A;  5FQ7 A;  5EX0 A;  1DNP A;  2LSU A;  3QAQ A;  3O4Z A;  4ILH B;  4WAF A;  1NA3 A;  3P1U A;  4U63 A;  3CHS A;  2HO1 A;  2P58 C;  4FUL A;  4RVB A;  5E76 A;  2C2L A;  2IOS A;  3JCK C;  3SD5 A;  2R5S A;  4UWF A;  3CSF A;  3SHF A;  3CVX A;  3KD7 A;  2CHW A;  4BX9 A;  4JA9 A;  1UN9 A;  2AWI A;  2IFU A;  4G1T A;  4UWG A;  1EF1 C;  2AXV A;  4WWO A;  4CRW A;  3CST A;  1X5B A;  5T3R A;  5CHE E;  1PAQ A;  3CHM A;  4N5C A;  4B8C B;  3U3W A;  2FF4 A;  4I6E A;  3CVW A;  4GYO A;  5ARG A;  5AEN A;  3PDN A;  4A3V A;  3PE4 A;  3U64 A;  5ARF A;  5C1D A;  4U07 A;  5JJ7 A;  2KM4 A;  3FTV A;  4CDN A;  4C0M A;  3BG1 B;  3ZVV A;  4GML A;  4AP2 A;  4O6F A;  4GMJ A;  4G25 A;  4U04 A;  3HDX A;  4J0U A;  4HS2 A;  1OWM A;  3I4G A;  4AVX A;  3AS5 A;  5A23 A;  2L0T B;  2IOL A;  3FU5 A;  4C0E A;  1Y6I A;  2X6H A;  3QWP A;  2CHZ A;  4IN3 B;  4GA2 A;  2WXI A;  4V3I A;  4EPZ A;  2XGM A;  3CHO A;  4EEC A;  3ZYK A;  2LAH A;  4NAC A;  5AIJ A;  4RG6 A;  3CVL A;  3SGH A;  3IBE A;  2FI7 A;  2FO7 A;  5BNW A;  3KAE A;  2Q7F A;  2L9B A;  4E85 A;  5FZS A;  1ZU2 A;  4LER A;  5FT9 A;  3CHR A;  5KJN A;  3ZN3 A;  3FWV A;  1Z3Y A;  2WXN A;  2HYZ A;  4KXK B;  3FTU A;  1INZ A;  2V5F A;  4NRH B;  4AEZ C;  4D10 C;  3I4R B;  4A3T A;  1N54 A;  2V0P A;  4CDM A;  5EDS A;  2X6K A;  5T8I A;  5CCL A;  1OWN A;  3FUH A;  4KT6 B;  3QC1 A;  3IKO B;  5BV0 A;  4J8F A;  1E8Y A;  5DIZ A;  2WXF A;  1KT1 A;  5KCM A;  4KBQ A;  4Q69 A;  5G55 A;  4XE0 A;  4XIF A;  3QWW A;  2R59 A;  4HOU A;  3UMV A;  2XRZ A;  2VSO E;  5M72 A;  3FTX A;  3RRM B;  3SNX A;  2XHE A;  3APD A;  4M3O A;  5KJK A;  4EZJ A;  1HG5 A;  3D9I A;  4LCT A;  3QNK A;  3R7Q A;  3LY8 A;  3R7R A;  3G2V A;  3GW4 A;  3MX3 A;  4ABN A;  2GRL A;  4FHK A;  2PL2 A;  1H2T C;  1XGW A;  4AOF A;  3NF1 A;  3P2B A;  4IRU A;  2WQ6 A;  4HVB A;  3PUK A;  2VSN A;  3CK9 A;  3D9O A;  4PH4 B;  2WB2 A;  4GCO A;  4HOR A;  4UI9 J;  2WVI A;  1H19 A;  2MOW A;  3CGH A;  3Q47 B;  4A1S A;  2J09 A;  4JHJ A;  3AU4 A;  2C0L A;  3CV0 A;  4I9C A;  3S7B A;  4B0Z A;  4J8E A;  3FP3 A;  5A7D B;  2I1K A;  4GAA A;  4EZK A;  4HFG A;  4AV7 A;  2UY1 B;  5EKQ D;  2ION A;  2NSZ A;  2IJG X;  3PNT B;  2Y3A A;  3SFZ A;  1E90 A;  2WXG A;  3ZYM A;  3HHM A;  3SBS A;  3LKU A;  4FA6 A;  4HXI A;  3FH7 A;  4JZY A;  2FEZ A;  2WXL A;  2AVP A;  1HG2 A;  4K0R A;  2IU1 A;  4GZ5 A;  4BWR A;  1SQM A;  3S2A A;  4I2Z A;  4I6G A;  5BV1 A;  4BSX A;  3PZD A;  3ZIM A;  3U66 A;  2A5U A;  3Q15 A;  3CVN A;  5CCM A;  4L7T A;  3ASD A;  1HFA A;  4WND A;  4JC8 A;  3TAX A;  4GZD A;  3U9W A;  3ZEF A;  4L1B A;  5HQ8 A;  3ZFW A;  3D9J A;  4GA1 A;  2KCK A;  2J4D A;  3PE3 A;  4IYP A;  1VDY A;  2VQ2 A;  4OVV A;  2OV8 A;  4WNG A;  3B7R L;  4ANV A;  4FLB A;  3EHM A;  4G11 A;  1OWO A;  5G04 J;  2V8S E;  1HE8 A;  1PC2 A;  2QFC A;  2BF0 X;  4YND A;  1YA0 A;  4CCA A;  4GA0 A;  3L17 A;  3OAW A;  3QKY A;  5AJD A;  4F1S A;  3FTZ A;  3IEG A;  4L2L A;  1B89 A;  4DK5 A;  5EX3 A;  4I17 A;  1HX8 A;  1JUQ A;  3O48 A;  4N3C A;  3ESL A;  2DIW A;  3CLJ A;  3UT4 A;  1JWF A;  4EZL A;  5C2Y A;  3JQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...