5CHEE

Crystal structure of arabidopsis glutamyl-trna reductase in complex with its regulatory proteins
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
119
structure length
119
Chain Sequence
EPKKQELISKLKTGKTFLRNQEPEKAYTEFKIALELAQSLKDPTEEKKAARGLGASLQRQGKYREAIQYHSMVLAISKRESEDSGITEAYGAIADCYTELGDLEKAGKFYDTYIARLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Glutamyl-tRNA reductase 1, chloroplastic
publication title The Arabidopsis glutamyl-tRNA reductase (GluTR) forms a ternary complex with FLU and GluTR-binding protein
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 47
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5cheE00
4BT9A 3AS4A 3S7BA 3LKUA 2KCKA 4JHRA 5FZSA 2C2LA 5A7DB 4I9CA 3K9IA 3LPZA 2GW1A 5KJMA 3AS5A 2MHKA 3FP3A 4HORA 2R5SA 4AIFA 3CK7A 5FJYA 4B94A 3QKYA 2IFUA 4G2VA 3QWPA 4W9RA 4GCNA 5BT1A 2HO1A 4AY6A 4YNDA 3GW4A 2ONDA 4A1SA 4G1TA 1P5QA 3RJVA 5CCMA 2KCLA 1A17A 4GZ6A 5JJ6A 2Y4UA 4N3BA 5KJKA 4I2WA 4WNEA 4G23A 2FI7A 3ZHEB 3U4TA 4N3CA 4I2ZA 1ZU2A 2KCVA 1WM5A 3BEEA 3LY9A 2LSVA 4U07A 5ARFA 2UY1A 4CDRA 4HOTA 2C0MA 2E2EA 5LCWJ 2AVPA 1KT0A 4N39A 3NF1A 4EQFA 2Q7FA 3RO2A 3PE4A 2XCBA 2XGSA 3S7JA 3GYZA 4GA2A 1WAO1 4GYYA 4ABNA 3ZPJA 4JA7A 5HQ8A 2QFCA 5BW8C 4YVQC 1B89A 2BUGA 2YHCA 4GCOA 4H7YA 4YVOA 3LYAA 4UI9C 3Q15A 4U04A 3ASGA 3ASFA 2XEVA 1KT1A 5FZQA 4JL0A 4KBQA 3CV0A 3RO3A 4N3AA 2YQ8A 1ELWA 1YA0A 3WXXA 5AYWD 3QWVA 4NRHB 4WUYA 5JJ7A 3VTXA 3SZ7A 2XGMA 1Y8MA 2J9QA 4Y6CA 5M72A 3R9AB 3RIBA 4Y6WA 1QZ2A 2LNIA 2L6JA 3KD7A 1PC2A 3QOUA 4UI9K 3OXLA 3EDTB 1OUVA 5C1DA 2FEZA 1HH8A 2PL2A 3IEGA 1IHGA 1NA3A 2WQHA 5G04J 2KATA 4J8EA 2FBNA 4XIFA 5CHEE 4XI9A 3KAEA 4XI0A 2C0LA 3Q4AB 3CVPA 3ZHEA 5G05J 3TG4A 1ZBPA 3VTYA 3CEQA 2VGXB 3LY7A 4GA0A 5LCWC 1IYGA 2VGYA 3N71A 3CVNA 3PDNA 3CK8A 5A6CA 4N5CA 5EX3A 3ESKA 4G25A 4O6FA 4J8FA 3MKRA 3Q49B 4H7XA 4KYOB 2FO7A 1NA0A 4GZ3A 4BWRA 2P58C 1W3BA 4GA1A 3CKCA 2WPVA 1TJCA 2XGOA 3GZ1A 2LSUA 5EKQD 3UQ3A 3UUXA 3ASDA 2HR2A 4WNDA 3LCAA 1ELRA 3O48A 4UI9J 3URZA 4UQZA 5FT9A 3MV3B 4APOA 4GPKA 3FFLA 4BTBA 3OXFA 4AY5A 4CGVA 5DIZA 5FTPA 3GZ2A 4JA9A 3LY8A 4GYOA 4J0UA 2PZIA 2KC7A 4U0UA 3FWVA 1KLXA 2XCCA 4LEUA 2VSNA 1XNFA 3QWWA 3PE3A 1HXIA 2OOEA 3ZFWA 2V5FA 1HZ4A 4N2QA 4IN3B 3CVLA 2Y4TA 3ZN3A 4U0SA 4NQ0A 4F3VA 5KJNA 5CCLA 1NZNA 3JYSA 4HOQA 5FZRA 3MV2B 5EX0A 2VQ2A 4I1AA 2NC9A 3TG5A 3Q5MA 3S7DA 2UY1B 3ASHA 4I17A 4UQYA 4G24A 3MEKA 3U3WA 5G04C 4RG6A 3HYMB 2FF4A 4GYWA 3SF4A 4HOUA 4HOSA 4GZ5A 1QQEA 5BNWA 3AS8A 2VYIA 5D0OD 5DBKA 4CGWA 3CK9A 5G05C 2HYZA 4AM9A 5KJLA 1E96B 2DBAA 3CKBA 3Q47B 2PQNA 3KS2A 3E4BA 4BTAA 4RG9A 2VGXA 3ZGQA 4N2SA 3TAXA 3QDNA 1FCHA 2IF4A 3RU0A 3MA5A 4U0ZA 4G26A 3OXGA 5HI7A 3RKVA 4J8DA 2UWJG 5JJTA 5ARGA 3S7FA 4I9EA 2JLBA 4WNFA 4WNGA 5D0QD 3TGOA 4ME2A 2PQRA 4UQXA 2I6HA 3CVQA 2VSYA 4BT8A 3UPVA 3ULQA 2XPIA 4KXKB
chains in the Genus database with same CATH superfamily
1H0AA 3AS4A 4UWGA 3LKUA 2KCKA 3CQGB 1H6PA 1TYQG 4I6JA 4R7LA 1JUQA 1LD8A 2DCPA 2MHKA 3UM3A 2WXLA 3FTYA 5FJYA 3ASOE 4GTMA 2WXJA 2KZTA 1UOHA 4W9RA 4GCNA 2VJ8A 1E8YA 4B0ZA 4AOFA 4RSYA 2WXFA 2HO1A 1SW6A 5FQ4A 2I1KA 4J8YA 4C48B 3QAQA 1KPSB 4G1TA 2CHZA 5CMYA 5KCMA 2EIME 4J6IA 1BI8B 4N3BA 3D3MA 2J49A 3UKRG 1OCRE 3DSSA 3DSTA 1OWMA 3T8KA 4DUIA 4FLBA 1DC2A 1TN8A 3EU5A 2M63A 1WM5A 1H2UA 2UY1A 4CDRA 1LF8A 2CG3A 1O1TA 1Y6IA 2P2CP 4ILGA 5LCWJ 5D2MC 3Q7FA 4AXHA 1KT0A 1OCCE 4DX5D 5AENA 3UM2A 1N54A 1BLXB 5FWQA 1JCRA 3RO2A 2EILE 4OVUA 2I1JA 2XGSA 4FA6A 3FUJA 1OWPA 3QJZA 4B93B 3L9TA 2IO3C 5HQ8A 4TRQA 4LNBA 3D9KA 1Z5SC 3L6AA 2P9LG 5LFAA 4I43A 2Y1LE 5E76A 4IULA 4MLPA 4H7YA 4L2YA 4XKCA 1LD7A 4DX1A 4Q69A 1N52A 2A5EA 5ANLA 3SI5A 3ZYLA 4BERA 3IHYA 3ASFA 3AJIA 5AQ7A 1DNPA 1FT1A 4HLLA 1NI1A 4PH4B 1KZOA 4JL0A 3CLJA 4CT0A 2WXQA 4TUMA 4F1SA 1Z3YA 2RFAA 2QC9A 5AJDA 4N3AA 2LAHA 4UWHA 5FQ6A 4CYMD 2YQ8A 4JPSA 2J4DA 3FEXA 1K1AA 3CVUA 5JJ7A 4JZYA 2XGMA 5M72A 3DSVA 3B7SA 5JA4D 2F0YA 3R9AB 5EN5D 2IY0C 3RIBA 3Q78A 3RAUA 1PC2A 1BI7B 4A1GA 3FUKA 3OXLA 2LXMA 1E7UA 3ZXSA 1OUVA 3QNKA 4XX5A 5B1BE 5C1DA 2FEZA 2PL2A 3ESLA 3WG7E 1IHGA 2I9CA 5G04J 5ANRA 3FUEA 3CSFA 1MZCA 5CHEE 4EECA 3FH8A 4BFRA 2C0LA 2H6IA 3ZHEA 1N0RA 3CVVA 5BXOA 2P9UG 1EDUA 3LY7A 3LVRE 3SQVA 4NACA 3TWQA 3N71A 4URKA 3PDNA 4GZCA 1HE8A 3VLDA 4ATZD 2FO1E 4G25A 4JVSA 4J8FA 5ENQD 3FULA 3NAWA 3FU3A 4BWRA 3UXGA 4ACLA 2P58C 1EF1C 1W3BA 1G3NB 3NOGD 4XKBA 2JABA 4KVMA 2LSUA 1H2TC 4HXIA 4JHJA 4EPZA 4GTRA 2HR2A 2XZDG 1EPUA 4QFVA 4Z68A 2WQ6A 1DCQA 2MYOA 3FFLA 2AXZA 3FU5A 3UI2A 1FT2A 3LJ3A 4J0UA 3EIQC 4CRWA 3FWVA 4LEUA 2GRPB 1BD8A 2P9NG 1H19A 3QWWA 3PE3A 2DZNA 3JUIA 3TWRA 4DPRA 2V5FA 2WXMA 4N2QA 3BQOA 2I2OA 2Y4TA 3C5RA 5AJLA 3BG0B 4F3VA 4WAFA 5KJNA 3ULYA 1N95A 3EU9A 5CCLA 1Q2ZA 3I4RB 3ZNGA 1AP7A 1E90A 3J5QB 3PUKA 4UQYA 1UJJA 3FTWA 3MYVA 2DYSE 4I17A 3TWUA 4G24A 4GAAA 3U3WA 4RG6A 2FF4A 1U3DA 4GYWA 4HOUA 3NB2A 3MJWA 3ZU7B 5H7PA 5D0OD 2A4ZA 3UIOC 4CGWA 1TN6A 3CK9A 4JW1A 4AM9A 3T5VA 1TNUA 3PEVB 5LP0A 4TXPA 5CBNA 2R2LA 1Z6TA 3Q47B 2PQNA 3KS2A 3ONLA 4N2SA 3G2UA 4JEHA 1FCHA 4J7WA 4U95D 3R7QA 4Q96A 4M3OA 4AP2A 4G26A 2IO2C 1RZ4A 3T5XA 2WQ7A 1YCSB 4DK5A 3UM1A 1H2VC 3S7FA 3UINC 1MQSA 2P9KG 2PQRA 3HVEA 3CHMA 4JB8P 2WXPA 5HKPA 2XPZA 4PDXA 3CVYA 3S7BA 2AXVA 2MOWA 3CHOA 3HXDA 4I9CA 3LPZA 2GW1A 1N4PA 1UJKA 3PZ3A 1S0PA 3FP3A 2R5SA 4C9BB 3QKYA 3SFXA 3QWPA 2WXIA 3FH5A 3FDHA 3PZ4A 3QC1A 3E37A 3EJNA 1SZAA 2JEKA 4AY6A 1FPPA 5E75A 4A1SA 1X81A 3RJVA 5CCMA 2MRIA 2WXNA 1A17A 2DIWA 1V55E 3ZYMA 4DX6D 4I2WA 2X38A 4WNEA 3V2XA 4F6RD 2AWIA 4DLOA 4MRUA 3SBSA 2P9PG 1OCOE 4UWLA 1OXJA 4XZ4A 4ANXA 1O5MA 2PM7A 1L5JA 3D9IA 5ARFA 2C0MA 2YNQA 3UKUG 3NZUA 1DVPA 3AU5A 4JHKA 2AVPA 4U96D 3NF1A 5AQBA 1D9SA 2B6CA 3PE4A 5AIJA 3S7JA 3FUHA 4GTSA 3GYZA 3LJNA 1K8KG 2GRLA 1WAO1 3DBSA 3B7RL 3ZPJA 2R59A 3C98A 3UM0A 5KWDA 4YVQC 1B89A 3FEYA 2YHCA 1X5BA 1IKND 2X6JA 4BEPA 3B13A 5IY5E 4B89A 3C72A 5ENPD 4HRNA 4UI9C 3RK6A 3ONKA 3DSWA 3ASGA 2X6FA 3CHQA 2AXUA 2WXGA 1KT1A 2NXPA 3IBEA 1N94A 3CV0A 4FJYA 5BPPA 2J09A 1JWGA 5G2NA 2WMNA 3TWVA 3Q75A 4I1OB 2LO6A 1WG0A 4I6EA 4U7EB 3WXXA 3VLFA 5D66A 4IYPA 3SZ7A 1TR4A 5BUZA 4Y6CA 5AARA 5BV0A 3SFZA 2ZGDA 3DRAA 4GTVA 4ACKA 4UI9K 2BTDA 4EZKA 5CEAA 4APFA 2FULA 4U8YD 2R17C 4AVXA 4FP7A 4J8EA 5HRYA 4XIFA 5AQ9A 3V30A 3G2VA 3KAEA 4I6GA 5G05J 3TG4A 3VTYA 4LSZE 3FUMA 4L2LA 3CEQA 3L17A 3LVQE 3TXMA 4GPMA 3MGBA 5LCWC 3ASNE 2IEJA 2RFMA 3QK0A 3CVNA 3I5PA 1PAQA 3QARA 3CK8A 5A6CA 5EX3A 4F53A 3HXFA 4G8KA 3UIPC 4O1PA 4ILIA 3Q49B 3ISMC 3FU0A 2QY7A 4H7XA 2VTBA 4ZHBA 4V3IA 3BU8A 4P29A 3Q9UC 5EKQD 4TUUA 3TXNA 3C3OA 4CDNA 3ABKE 1EYHA 2EQXA 5FT9A 1BPOA 5CRUA 1PY1A 4L23A 2OCCE 4GPKA 2IONA 4BTBA 3PNTB 3AG4E 2OVFA 4AY5A 4LCTA 2X3MA 3UT8A 3GZ2A 3LY8A 1RW2A 2PZIA 1KLXA 2RD0A 2VSNA 1XNFA 1ZB1A 2XRYA 1HXIA 3DXMG 2HE0A 3ENEA 3C3QA 5HS0A 2OOEA 1U2VG 4F1PA 3CVWA 5CBOA 3LXUX 2LUHA 3PH0C 4NQ0A 3ZUVB 3SNXA 1NZNA 4HOQA 4JD2G 4K0RA 5EX0A 5AN8A 2QYJA 3APDA 4M7CA 3TG5A 3Q5MA 3S7DA 2L6BA 4U63A 5G04C 3HYMB 1NFIE 3SF4A 2EIJE 1QQEA 2V4LA 2CFZA 2XEHA 4RVBA 5DBKA 3PVLA 2V5QC 1TNBA 3CQCB 4X8QA 2P9IG 2WMOA 3TWXA 1K1BA 2DBAA 4GZDA 3RRNB 3CKBA 1ELKA 1SQMA 3MKQA 4CEMA 4BTAA 3ZGQA 2J07A 2L0IA 3MA5A 2OVBA 2GRRB 4YDOA 2J4BA 4F7AA 3LEWA 3OXGA 5HI7A 4J8DA 4FHKA 5ENSD 4E6HA 2CHWA 2UWJG 2R02A 4LNUD 1VDYA 5CECB 4KZ0A 4ATGA 4LNGA 2XENA 2I6HA 4ILHB 2VSYA 4A55A 4G8LA 3UPVA 2XPIA 3CVXA 1N11A 3U9WA 4LG6A 3DEPA 3SO8A 1XGWA 4JHRA 5FZSA 2C2LA 2DYRE 1E8XA 3TWTA 3FTSA 4HBDA 5KJMA 4HORA 2VGEA 5KNHD 1N0QA 1MX2A 3HIZA 4DX2A 3FTVA 1O1RA 4EBAG 3CSTA 4FU3A 1OY3D 5BT1A 3B7TA 2H6GA 3QB2A 1JCSA 2B0OE 1P5QA 4BETA 3L82A 1IHBA 5JJ6A 3F6QA 5JHAA 2XQ0A 4HS2A 4L1BA 4G23A 2FI7A 3DXKG 4QQIA 1SA4A 1TEZA 4ZFHA 2DWZA 2KCVA 2WB2A 1UG3A 3HXEA 3BEEA 3LY9A 2LSVA 4HOTA 4B8AA 2CFUA 5T3RA 4N39A 3UMVA 2J08A 3X2QE 2AW6A 4EQFA 2XCBA 4KT6B 2L0TB 2Y69E 4UWFA 4GA2A 3C3RA 1UW4B 2ILRA 3T8MA 1NP7A 1IQUA 4GYYA 3HG0D 2XZTG 3D9NA 4OYSA 3UT7A 3ZYQA 4WWOA 4CZ2D 3ZYKA 4FHJA 5T4YA 4GCOA 3G2SA 2X6KA 4DI4A 4YVOA 5EIBE 3EHNA 3Q15A 3NBNB 2LAIA 2XPYA 1TNZA 5FZQA 3JXIA 2WVIA 1YYHA 1MJ0A 5ENTD 4O1OA 2R03A 2OEWA 3RO3A 2GGFA 3ZW3A 1QNFA 4DJAA 1YA0A 5AYWD 1HU3A 3QWVA 4NRHB 3VTXA 2RKKA 5FINA 1Y8MA 3KEZA 2GRNB 5ITZF 1E7VA 1NL4A 2V0PA 3PRZA 2LNIA 2L6JA 2QYUA 3QOUA 1OWNA 3IHVA 3EDTB 4K03A 4E85A 3EHQA 1S64A 3AG2E 4CT4A 3IEGA 4TXQA 2XS8A 1HG2A 4BSZB 4ANUA 1NA3A 4OAVB 2KATA 3D9LA 2FBNA 3IXEA 1HS6A 4K5BA 4YDEA 4XI9A 3SGHA 4XI0A 4BSXA 4MKTA 3Q4AB 4GTOA 1ZBPA 1E8ZA 3DPYA 2VGXB 4EZLA 4GA0A 3FHEA 1IYGA 2VGYA 5AAOA 4FC8A 3U64A 4O6FA 3D9JA 4KYOB 3RRUA 4PUCA 4GZ3A 1A5EA 4HRMB 3CHPA 4YDYA 4GA1A 2QZAA 4CCAA 2WPVA 5EYPF 1TJCA 2XGOA 2ETBA 3PREA 3SBTB 3UQ3A 3CHSA 1H6OA 1BU9A 3W9FA 2NSZA 3ASDA 4WNDA 2ZU6B 4UI9J 5T8IA 4UQZA 2E0IA 2AJAA 2XS1A 3MV3B 4APOA 4EBAA 4FJZA 3HHMA 2KXPC 4GTTA 4GTQA 3FY4A 4CGVA 5FTPA 5BV1A 2KZTB 2DZOA 4C0EA 5EDSA 5EYLA 3PS6A 4GYOA 3E34A 2KC7A 3CIAA 4JEUA 4O60A 3SY2A 1GW6A 3L08A 4KVOA 4RQIA 2GRMA 5J08A 3Q9NC 1HZ4A 3FH7A 4IN3B 2OV8A 3CVLA 3FUIA 3FUFA 3IV0A 2WXHA 1YMPA 3GZSA 2DVWA 4HQDA 1TN7A 3P2BA 4UWKA 3JYSA 2PM6A 5FZRA 3U66A 3TWWA 2OEVA 4Q94A 2VQ2A 1O1SA 5CERB 4I1AA 2IQCA 2UY1B 1D8EA 3MEKA 2ZXWE 4L7TA 4U8VD 3NZSA 3DWLG 3TJPA 4GZ5A 5BNWA 3PZDA 3AS8A 2VYIA 1N4RA 3ML9A 1AWCB 5G05C 2HYZA 2J8SD 2IOLA 2ZIRA 3ABLE 5A23A 2KBXA 1KZPA 4GB9A 2VTBB 3E4BA 3QDNA 4GMRA 3APFA 2IF4A 3MCXA 1MX6A 3W9GA 3O4ZA 3D9HA 4LERA 3PZ2A 3RKVA 2IJGX 3B95A 3E30A 5JJTA 5ARGA 3PNLB 3L54A 2JLBA 4WNFA 5D0QD 4GMJA 2H6FA 4ME2A 3JQ1A 4UQXA 3CVQA 5KBAA 5ENNA 1HFAA 4BT9A 3V2OA 5A7DB 2ZISA 3K9IA 3D9OA 1INZA 2V8SE 3G2WA 3AS5A 1H6KA 3SHFA 3ZEFA 2WXOA 4AIFA 3CK7A 4FULA 4B94A 1WY6A 2PNNA 2NYJA 4GU5A 2IFUA 3MX3A 4G2VA 4DI3A 4HLEA 1OCZE 3CHRA 3E33A 4MS6A 4XEIG 3UTMA 3L22A 1LTXA 3UT4A 4YNDA 3GW4A 1FVFA 2ONDA 4J8SA 4NURA 5C2YA 4HB5A 2KCLA 3PEUB 1SVXA 3HRAA 1JPLA 4GZ6A 3V31A 2Y4UA 1E8WA 1DCEA 5KJKA 1TNOA 2GROB 4HFGA 5BXUA 3ZHEB 3U4TA 4N3CA 4IRUA 4I2ZA 1ZU2A 1OWLA 4I1MA 3D9MA 4BX8A 5G55A 1IQRA 4U07A 2EINE 4CDMA 2L9BA 3D9PA 3TWSA 2E2EA 2BF0X 3EHMA 2WXRA 3MKQB 2Q7FA 2KM4A 4OAUC 3ABME 3AU4A 1MHQA 3B7BA 2IOSA 3AG1E 4AEZC 4EZJA 3DEOA 3B7UX 4ABNA 4JA7A 2QFCA 1S70B 5BW8C 3APCA 1Z3XA 1UN9A 2BKGA 2BUGA 4MBGA 4GTPA 2GRQB 4A3VA 4OVVA 3EUVA 3ZRHA 3LYAA 5J90A 3EHRA 4U04A 5FQ8A 4JC8A 1FVHA 2XEVA 5B3SE 3BUAA 3SFYA 2Y3AA 3AAAC 3ZIMA 3FUNA 4KBQA 2VSXE 3KEAA 4PS8A 3FUDA 3Q79A 4FADA 3HXCA 4D10C 3JXJA 1ELWA 4ANVA 4WUYA 1IXVA 3ULEG 1QBQA 2J9QA 3E32A 2LXLA 4Y6WA 3NOCD 2HM8A 4BX9A 1QZ2A 3DSXA 3KD7A 3Q73A 4LRZA 1V54E 1U3CA 5KNGA 3OTNA 1HH8A 1N4SA 3HXBA 2F37A 2WQHA 4HVBA 1MYOA 3NQPA 2EIKE 3ZKJA 3OAWA 1HG5A 4DX7D 3ML8A 3L13A 3FTZA 3RRMB 3CVPA 5B1AE 4RLYA 1HX8A 2X6IA 2BEDA 4PS3A 3PZ1A 4HI8A 5CMWA 2YHEA 4U8HA 4A63B 4G11A 1TJFA 3ZVVA 4LUNU 4N5CA 3ESKA 3KSQA 4BESA 1SZ9A 3MKRA 3KSLA 2FO7A 1NA0A 1SA5A 1HF8A 2IU1A 5ENOD 2R05A 3CKCA 3VLEA 3HDXA 1WDYA 3GZ1A 3HVEB 3UUXA 1JCQA 4WWNA 3FTUA 1OWOA 3LCAA 2CG2A 1ELRA 3O48A 3URZA 2X6HA 3ZXPA 3JQ0A 5CRVA 4AV7A 2A5UA 3I3NA 3LDZA 4DRXE 4WWPA 1QYMA 3OXFA 2ETAA 3DSUA 3FTXA 2WM9A 3Q7AA 5DIZA 2VSOE 3CGHA 2RG8A 4JA9A 3FU6A 3IKOB 4TXRA 2F8YA 1TNYA 4U0UA 2H6HA 4JXTA 5EIDA 2XCCA 1N9AA 2F8XK 4B8CB 4KMOA 2BKKB 3SD5A 2Y0BG 4PS7A 3ZFWA 5ENRD 5CEDB 1MX4A 3LS8A 4K5AB 3J5PA 3ZN3A 5JHBA 4U0SA 3P1UA 3EIJA 5AQAA 3R7RA 4HRLA 3L16A 3MV2B 4UUCA 3MZLB 3G2TA 2NC9A 4KZCA 4N5QA 3ASHA 4C0MA 4A3TA 1OT8A 2ETCA 2ZGGA 2YINA 3PUJA 4NIKA 3T9KA 5JMND 1UN8A 4HOSA 2XRZA 3JUEA 4ANWA 2XEEA 3I4GA 3R9MA 5KJLA 1E96B 1N4QA 4TV3A 4DLQA 4BY6A 2CHXA 1D8DA 5LX8A 3TL5A 4RG9A 2VGXA 4HNAD 4K5CA 3TAXA 5FQ7A 3CR3A 4AJWA 5LOZA 3RU0A 3JCKC 2P9SG 2V4HC 4GMLA 4U0ZA 3DPDA 3AG3E 1S63A 3V79K 4XE0A 3S2AA 3UX4A 5FIOA 1JWFA 1HO8A 1K3ZD 2XHEA 3BG1B 4HI9A 5EILA 4I9EA 4WNGA 4EHMA 3TGOA 4FLHA 4YDWA 4BT8A 4L9PA 2WXKA 3ULQA 3RSEG 4KXKB
chains in the Genus database with same CATH topology
3CVXA 2XPZA 5ENNA 4PDXA 3U9WA 3CVYA 1H0AA 1HFAA 3AS4A 3S7BA 4UWGA 4BT9A 3LKUA 2KCKA 1XGWA 2AXVA 2MOWA 3CHOA 4JHRA 5FZSA 2C2LA 3CQGB 5A7DB 4I9CA 1E8XA 3K9IA 3LPZA 2GW1A 1UJKA 3D9OA 3FTSA 1INZA 4I6JA 4R7LA 1S0PA 2V8SE 1JUQA 3G2WA 5KJMA 3AS5A 1H6KA 2DCPA 3SHFA 3ZEFA 2MHKA 3FP3A 4HORA 2R5SA 2WXOA 4AIFA 2WXLA 3CK7A 3FTYA 4FULA 5FJYA 4B94A 1WY6A 4C9BB 3QKYA 3HIZA 4GU5A 2IFUA 2KZTA 2WXJA 3FTVA 3MX3A 4G2VA 4DI3A 3QWPA 2WXIA 4HLEA 3FH5A 4EBAG 4W9RA 4GCNA 3CSTA 4FU3A 3FDHA 2VJ8A 1E8YA 3QC1A 4AOFA 3EJNA 4RSYA 4B0ZA 5BT1A 2WXFA 3B7TA 3CHRA 1SZAA 2HO1A 2JEKA 4AY6A 4MS6A 3QB2A 5E75A 3L22A 5FQ4A 2I1KA 3UT4A 4YNDA 3GW4A 1FVFA 3QAQA 2ONDA 4A1SA 4G1TA 4J8SA 4NURA 2CHZA 5CMYA 5C2YA 1P5QA 3RJVA 5CCMA 2KCLA 2MRIA 3PEUB 5KCMA 2WXNA 1JPLA 1A17A 2DIWA 4GZ6A 5JJ6A 3ZYMA 2Y4UA 4J6IA 1E8WA 2XQ0A 5JHAA 4N3BA 5KJKA 3D3MA 4HS2A 2J49A 4I2WA 4L1BA 2X38A 4WNEA 4G23A 2FI7A 4HFGA 1OWMA 3ZHEB 2AWIA 4DLOA 4MRUA 3U4TA 3SBSA 4N3CA 1TEZA 4FLBA 4IRUA 4I2ZA 4UWLA 1ZU2A 4XZ4A 1OWLA 2KCVA 2WB2A 1UG3A 4ANXA 2PM7A 4I1MA 3D9MA 4BX8A 1L5JA 2M63A 5G55A 1IQRA 1WM5A 1H2UA 3BEEA 3D9IA 3LY9A 2LSVA 4U07A 5ARFA 2UY1A 4CDMA 4CDRA 4HOTA 2C0MA 1LF8A 2CG3A 1Y6IA 2YNQA 2L9BA 3NZUA 4ILGA 3D9PA 4B8AA 1DVPA 2CFUA 3AU5A 4JHKA 5T3RA 2E2EA 5LCWJ 2AVPA 4AXHA 1KT0A 4N39A 3NF1A 3UMVA 2BF0X 5AENA 2J08A 3EHMA 2WXRA 3MKQB 1N54A 5FWQA 2AW6A 4EQFA 2Q7FA 3RO2A 3PE4A 2XCBA 4KT6B 2I1JA 2XGSA 4OVUA 4FA6A 2KM4A 3FUJA 5AIJA 3S7JA 2L0TB 3FUHA 3GYZA 3AU4A 4UWFA 1MHQA 4GA2A 2GRLA 1WAO1 1OWPA 1UW4B 2ILRA 3T8MA 3QJZA 2IOSA 1NP7A 1IQUA 3DBSA 4GYYA 4AEZC 4EZJA 3B7UX 3B7RL 4ABNA 3ZPJA 3D9NA 4OYSA 2R59A 3C98A 4JA7A 3UT7A 5HQ8A 4TRQA 2QFCA 3ZYQA 3D9KA 4WWOA 4YVQC 1B89A 3APCA 5BW8C 3L6AA 1Z3XA 1UN9A 3FEYA 2BUGA 4I43A 3ZYKA 4FHJA 2YHCA 5LFAA 5E76A 1X5BA 4IULA 5T4YA 2X6JA 3B13A 4GCOA 4A3VA 3G2SA 2X6KA 4MLPA 4H7YA 4DI4A 4L2YA 4YVOA 4OVVA 4XKCA 4B89A 3EHNA 4Q69A 1N52A 3ZRHA 3LYAA 4UI9C 5J90A 3RK6A 3ONKA 3Q15A 5ANLA 3SI5A 3ZYLA 4U04A 5FQ8A 3ASGA 3IHYA 4JC8A 1FVHA 2X6FA 2XEVA 3ASFA 3CHQA 2AXUA 2WXGA 2LAIA 2XPYA 1DNPA 1KT1A 2Y3AA 5FZQA 2NXPA 2WVIA 4PH4B 3ZIMA 3IBEA 3FUNA 4JL0A 3CLJA 4CT0A 4KBQA 2VSXE 2WXQA 3CV0A 4FJYA 4F1SA 5BPPA 2J09A 1JWGA 1Z3YA 5G2NA 2WMNA 4PS8A 5AJDA 3RO3A 4N3AA 4I1OB 4UWHA 2GGFA 3FUDA 5FQ6A 4FADA 3ZW3A 1QNFA 2LO6A 2YQ8A 4D10C 1ELWA 4DJAA 4I6EA 1YA0A 3WXXA 3VLFA 5AYWD 1HU3A 3QWVA 4JPSA 2J4DA 4ANVA 4NRHB 4IYPA 3FEXA 4WUYA 3CVUA 5JJ7A 3VTXA 3SZ7A 4JZYA 2XGMA 5BUZA 1Y8MA 2J9QA 3KEZA 4Y6CA 5M72A 3B7SA 5BV0A 3R9AB 3SFZA 3RIBA 1E7VA 4Y6WA 2HM8A 2V0PA 3PRZA 4BX9A 1QZ2A 2LNIA 4ACKA 2L6JA 3KD7A 1PC2A 3QOUA 4UI9K 2BTDA 4LRZA 3ZVVA 4EZKA 1OWNA 4A1GA 3IHVA 4APFA 3FUKA 2FULA 1U3CA 3OXLA 1E7UA 3EDTB 3ZXSA 1OUVA 3QNKA 4K03A 4XX5A 4E85A 2FEZA 5C1DA 2R17C 3OTNA 1HH8A 4CT4A 2PL2A 3ESLA 3IEGA 1IHGA 2I9CA 1HG2A 4ANUA 4AVXA 1NA3A 2WQHA 5G04J 4HVBA 2KATA 3NQPA 5ANRA 4FP7A 3D9LA 4J8EA 2FBNA 3FUEA 4XIFA 3CSFA 1HS6A 5CHEE 4EECA 3OAWA 1HG5A 3FH8A 3G2VA 4BFRA 4XI9A 3SGHA 3ML8A 3KAEA 4XI0A 4BSXA 3L13A 2C0LA 3FTZA 4MKTA 3RRMB 3Q4AB 3CVPA 4I6GA 3ZHEA 5G05J 3TG4A 1ZBPA 3VTYA 1E8ZA 3FUMA 4L2LA 3CVVA 1HX8A 3CEQA 3L17A 3LVQE 2VGXB 1EDUA 3TXMA 2X6IA 3LY7A 3LVRE 4EZLA 4GA0A 3MGBA 4NACA 3FHEA 5LCWC 1IYGA 4PS3A 5CMWA 2VGYA 2YHEA 3N71A 4U8HA 3QK0A 3CVNA 4G11A 4URKA 3PDNA 4GZCA 1HE8A 1TJFA 3I5PA 4FC8A 1PAQA 3QARA 4LUNU 3CK8A 3VLDA 4N5CA 5EX3A 3ESKA 4F53A 4G25A 4JVSA 3U64A 5A6CA 4O6FA 4J8FA 1SZ9A 3D9JA 3MKRA 3FULA 3Q49B 4ILIA 3FU0A 2QY7A 4H7XA 4KYOB 2FO7A 3RRUA 2VTBA 4PUCA 1NA0A 3FU3A 4GZ3A 4BWRA 1HF8A 4ACLA 2P58C 3CHPA 1EF1C 1W3BA 2IU1A 4GA1A 4V3IA 4CCAA 3CKCA 4P29A 4XKBA 2WPVA 1TJCA 2XGOA 3VLEA 3HDXA 4KVMA 3GZ1A 2LSUA 3HVEB 5EKQD 3PREA 3SBTB 3UQ3A 1H2TC 4TUUA 3CHSA 4HXIA 3UUXA 3TXNA 4JHJA 4EPZA 4CDNA 2NSZA 3ASDA 2HR2A 4WNDA 4WWNA 1EYHA 2ZU6B 3FTUA 1OWOA 3LCAA 2CG2A 1ELRA 3O48A 2EQXA 4UI9J 3URZA 5T8IA 2X6HA 4UQZA 5FT9A 1EPUA 1BPOA 2E0IA 3MV3B 1PY1A 4L23A 4QFVA 4APOA 3JQ0A 4EBAA 4AV7A 4GPKA 2WQ6A 2A5UA 3I3NA 3LDZA 3HHMA 3FFLA 4FJZA 4WWPA 2IONA 4BTBA 3PNTB 2OVFA 3OXFA 4AY5A 4LCTA 2AXZA 3FTXA 2WM9A 2XPIA 2X3MA 3FU5A 3FY4A 5DIZA 4CGVA 2VSOE 5FTPA 3UT8A 3GZ2A 3CGHA 2RG8A 5BV1A 2KZTB 4JA9A 3FU6A 5EDSA 4C0EA 3LJ3A 3IKOB 3PS6A 3LY8A 4GYOA 4J0UA 2PZIA 2KC7A 3CIAA 3EIQC 4JEUA 4U0UA 4CRWA 4JXTA 3FWVA 1KLXA 2XCCA 4LEUA 1GW6A 2RD0A 2VSNA 3L08A 4KVOA 1XNFA 1H19A 3QWWA 4B8CB 2XRYA 3PE3A 1HXIA 2GRMA 3ENEA 4KMOA 3SD5A 2OOEA 5J08A 3JUIA 4PS7A 4DPRA 3ZFWA 2V5FA 1HZ4A 3CVWA 2WXMA 3FH7A 4N2QA 4IN3B 2OV8A 3LS8A 3LXUX 3CVLA 3FUIA 3FUFA 3IV0A 2I2OA 2Y4TA 5AJLA 3BG0B 2WXHA 3ZN3A 5JHBA 3GZSA 3PH0C 4U0SA 4NQ0A 4F3VA 4WAFA 5KJNA 3P1UA 3EIJA 3SNXA 3P2BA 5CCLA 3R7RA 4UWKA 1NZNA 3JYSA 2PM6A 3I4RB 3L16A 4HOQA 5FZRA 3U66A 3MV2B 4K0RA 5EX0A 3APDA 4Q94A 2VQ2A 1E90A 3PUKA 3MZLB 4I1AA 3G2TA 2NC9A 4KZCA 3TG5A 3Q5MA 3S7DA 2IQCA 1UJJA 2UY1B 3ASHA 3FTWA 3MYVA 4I17A 4UQYA 4A3TA 4G24A 4C0MA 4U63A 3MEKA 4GAAA 3U3WA 2YINA 5G04C 4RG6A 4L7TA 3HYMB 2FF4A 1U3DA 3PUJA 3NZSA 4GYWA 3SF4A 4HOUA 1UN8A 3TJPA 4HOSA 2XRZA 4GZ5A 3MJWA 1QQEA 2V4LA 4ANWA 5BNWA 2CFZA 3PZDA 3AS8A 3I4GA 4RVBA 2VYIA 2A4ZA 5D0OD 3ML9A 5DBKA 4CGWA 3PVLA 3CK9A 3CQCB 5G05C 2HYZA 2WMOA 4JW1A 4AM9A 5KJLA 1E96B 4TV3A 2DBAA 4DLQA 3T5VA 2IOLA 4GZDA 3RRNB 3PEVB 3CKBA 4BY6A 5A23A 1ELKA 5LP0A 1SQMA 1Z6TA 2CHXA 3Q47B 4GB9A 3MKQA 4CEMA 5LX8A 2PQNA 3KS2A 3E4BA 2VTBB 3ONLA 4RG9A 2VGXA 3G2UA 3TL5A 3TAXA 5FQ7A 3ZGQA 4BTAA 4N2SA 2J07A 3CR3A 3QDNA 4JEHA 1FCHA 2L0IA 4AJWA 5LOZA 3APFA 2IF4A 3MCXA 3MA5A 3R7QA 3RU0A 2OVBA 3JCKC 4GMLA 2J4BA 4F7AA 3LEWA 4U0ZA 3DPDA 3O4ZA 4Q96A 4M3OA 4XE0A 4LERA 4G26A 3S2AA 4AP2A 3OXGA 5HI7A 3UX4A 3T5XA 2WQ7A 3RKVA 4J8DA 4FHKA 2IJGX 4E6HA 2CHWA 2UWJG 1JWFA 4DK5A 1HO8A 5JJTA 1H2VC 5ARGA 2XHEA 3BG1B 3PNLB 3S7FA 3L54A 4I9EA 2JLBA 1MQSA 4WNFA 4WNGA 1VDYA 4GMJA 5D0QD 3TGOA 4ME2A 4KZ0A 4ATGA 2PQRA 3JQ1A 4UQXA 2I6HA 3CVQA 4FLHA 4ILHB 2VSYA 3HVEA 4A55A 3CHMA 4BT8A 2WXPA 3UPVA 2WXKA 3ULQA 2LAHA 4KXKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BT9 A;  3AS4 A;  3S7B A;  3LKU A;  2KCK A;  4JHR A;  5FZS A;  2C2L A;  5A7D B;  4I9C A;  3K9I A;  3LPZ A;  2GW1 A;  5KJM A;  3AS5 A;  2MHK A;  3FP3 A;  4HOR A;  2R5S A;  4AIF A;  3CK7 A;  5FJY A;  4B94 A;  3QKY A;  2IFU A;  4G2V A;  3QWP A;  4W9R A;  4GCN A;  5BT1 A;  2HO1 A;  4AY6 A;  4YND A;  3GW4 A;  2OND A;  4A1S A;  4G1T A;  1P5Q A;  3RJV A;  5CCM A;  2KCL A;  1A17 A;  4GZ6 A;  5JJ6 A;  2Y4U A;  4N3B A;  5KJK A;  4I2W A;  4WNE A;  4G23 A;  2FI7 A;  3ZHE B;  3U4T A;  4N3C A;  4I2Z A;  1ZU2 A;  2KCV A;  1WM5 A;  3BEE A;  3LY9 A;  2LSV A;  4U07 A;  5ARF A;  2UY1 A;  4CDR A;  4HOT A;  2C0M A;  2E2E A;  5LCW J;  2AVP A;  1KT0 A;  4N39 A;  3NF1 A;  4EQF A;  2Q7F A;  3RO2 A;  3PE4 A;  2XCB A;  2XGS A;  3S7J A;  3GYZ A;  4GA2 A;  1WAO 1;  4GYY A;  4ABN A;  3ZPJ A;  4JA7 A;  5HQ8 A;  2QFC A;  5BW8 C;  4YVQ C;  1B89 A;  2BUG A;  2YHC A;  4GCO A;  4H7Y A;  4YVO A;  3LYA A;  4UI9 C;  3Q15 A;  4U04 A;  3ASG A;  3ASF A;  2XEV A;  1KT1 A;  5FZQ A;  4JL0 A;  4KBQ A;  3CV0 A;  3RO3 A;  4N3A A;  2YQ8 A;  1ELW A;  1YA0 A;  3WXX A;  5AYW D;  3QWV A;  4NRH B;  4WUY A;  5JJ7 A;  3VTX A;  3SZ7 A;  2XGM A;  1Y8M A;  2J9Q A;  4Y6C A;  5M72 A;  3R9A B;  3RIB A;  4Y6W A;  1QZ2 A;  2LNI A;  2L6J A;  3KD7 A;  1PC2 A;  3QOU A;  4UI9 K;  3OXL A;  3EDT B;  1OUV A;  5C1D A;  2FEZ A;  1HH8 A;  2PL2 A;  3IEG A;  1IHG A;  1NA3 A;  2WQH A;  5G04 J;  2KAT A;  4J8E A;  2FBN A;  4XIF A;  5CHE E;  4XI9 A;  3KAE A;  4XI0 A;  2C0L A;  3Q4A B;  3CVP A;  3ZHE A;  5G05 J;  3TG4 A;  1ZBP A;  3VTY A;  3CEQ A;  2VGX B;  3LY7 A;  4GA0 A;  5LCW C;  1IYG A;  2VGY A;  3N71 A;  3CVN A;  3PDN A;  3CK8 A;  5A6C A;  4N5C A;  5EX3 A;  3ESK A;  4G25 A;  4O6F A;  4J8F A;  3MKR A;  3Q49 B;  4H7X A;  4KYO B;  2FO7 A;  1NA0 A;  4GZ3 A;  4BWR A;  2P58 C;  1W3B A;  4GA1 A;  3CKC A;  2WPV A;  1TJC A;  2XGO A;  3GZ1 A;  2LSU A;  5EKQ D;  3UQ3 A;  3UUX A;  3ASD A;  2HR2 A;  4WND A;  3LCA A;  1ELR A;  3O48 A;  4UI9 J;  3URZ A;  4UQZ A;  5FT9 A;  3MV3 B;  4APO A;  4GPK A;  3FFL A;  4BTB A;  3OXF A;  4AY5 A;  4CGV A;  5DIZ A;  5FTP A;  3GZ2 A;  4JA9 A;  3LY8 A;  4GYO A;  4J0U A;  2PZI A;  2KC7 A;  4U0U A;  3FWV A;  1KLX A;  2XCC A;  4LEU A;  2VSN A;  1XNF A;  3QWW A;  3PE3 A;  1HXI A;  2OOE A;  3ZFW A;  2V5F A;  1HZ4 A;  4N2Q A;  4IN3 B;  3CVL A;  2Y4T A;  3ZN3 A;  4U0S A;  4NQ0 A;  4F3V A;  5KJN A;  5CCL A;  1NZN A;  3JYS A;  4HOQ A;  5FZR A;  3MV2 B;  5EX0 A;  2VQ2 A;  4I1A A;  2NC9 A;  3TG5 A;  3Q5M A;  3S7D A;  2UY1 B;  3ASH A;  4I17 A;  4UQY A;  4G24 A;  3MEK A;  3U3W A;  5G04 C;  4RG6 A;  3HYM B;  2FF4 A;  4GYW A;  3SF4 A;  4HOU A;  4HOS A;  4GZ5 A;  1QQE A;  5BNW A;  3AS8 A;  2VYI A;  5D0O D;  5DBK A;  4CGW A;  3CK9 A;  5G05 C;  2HYZ A;  4AM9 A;  5KJL A;  1E96 B;  2DBA A;  3CKB A;  3Q47 B;  2PQN A;  3KS2 A;  3E4B A;  4BTA A;  4RG9 A;  2VGX A;  3ZGQ A;  4N2S A;  3TAX A;  3QDN A;  1FCH A;  2IF4 A;  3RU0 A;  3MA5 A;  4U0Z A;  4G26 A;  3OXG A;  5HI7 A;  3RKV A;  4J8D A;  2UWJ G;  5JJT A;  5ARG A;  3S7F A;  4I9E A;  2JLB A;  4WNF A;  4WNG A;  5D0Q D;  3TGO A;  4ME2 A;  2PQR A;  4UQX A;  2I6H A;  3CVQ A;  2VSY A;  4BT8 A;  3UPV A;  3ULQ A;  2XPI A;  4KXK B; 
#chains in the Genus database with same CATH topology
 1H0A A;  3AS4 A;  4UWG A;  3LKU A;  2KCK A;  3CQG B;  1H6P A;  1TYQ G;  4I6J A;  4R7L A;  1JUQ A;  1LD8 A;  2DCP A;  2MHK A;  3UM3 A;  2WXL A;  3FTY A;  5FJY A;  3ASO E;  4GTM A;  2WXJ A;  2KZT A;  1UOH A;  4W9R A;  4GCN A;  2VJ8 A;  1E8Y A;  4B0Z A;  4AOF A;  4RSY A;  2WXF A;  2HO1 A;  1SW6 A;  5FQ4 A;  2I1K A;  4J8Y A;  4C48 B;  3QAQ A;  1KPS B;  4G1T A;  2CHZ A;  5CMY A;  5KCM A;  2EIM E;  4J6I A;  1BI8 B;  4N3B A;  3D3M A;  2J49 A;  3UKR G;  1OCR E;  3DSS A;  3DST A;  1OWM A;  3T8K A;  4DUI A;  4FLB A;  1DC2 A;  1TN8 A;  3EU5 A;  2M63 A;  1WM5 A;  1H2U A;  2UY1 A;  4CDR A;  1LF8 A;  2CG3 A;  1O1T A;  1Y6I A;  2P2C P;  4ILG A;  5LCW J;  5D2M C;  3Q7F A;  4AXH A;  1KT0 A;  1OCC E;  4DX5 D;  5AEN A;  3UM2 A;  1N54 A;  1BLX B;  5FWQ A;  1JCR A;  3RO2 A;  2EIL E;  4OVU A;  2I1J A;  2XGS A;  4FA6 A;  3FUJ A;  1OWP A;  3QJZ A;  4B93 B;  3L9T A;  2IO3 C;  5HQ8 A;  4TRQ A;  4LNB A;  3D9K A;  1Z5S C;  3L6A A;  2P9L G;  5LFA A;  4I43 A;  2Y1L E;  5E76 A;  4IUL A;  4MLP A;  4H7Y A;  4L2Y A;  4XKC A;  1LD7 A;  4DX1 A;  4Q69 A;  1N52 A;  2A5E A;  5ANL A;  3SI5 A;  3ZYL A;  4BER A;  3IHY A;  3ASF A;  3AJI A;  5AQ7 A;  1DNP A;  1FT1 A;  4HLL A;  1NI1 A;  4PH4 B;  1KZO A;  4JL0 A;  3CLJ A;  4CT0 A;  2WXQ A;  4TUM A;  4F1S A;  1Z3Y A;  2RFA A;  2QC9 A;  5AJD A;  4N3A A;  2LAH A;  4UWH A;  5FQ6 A;  4CYM D;  2YQ8 A;  4JPS A;  2J4D A;  3FEX A;  1K1A A;  3CVU A;  5JJ7 A;  4JZY A;  2XGM A;  5M72 A;  3DSV A;  3B7S A;  5JA4 D;  2F0Y A;  3R9A B;  5EN5 D;  2IY0 C;  3RIB A;  3Q78 A;  3RAU A;  1PC2 A;  1BI7 B;  4A1G A;  3FUK A;  3OXL A;  2LXM A;  1E7U A;  3ZXS A;  1OUV A;  3QNK A;  4XX5 A;  5B1B E;  5C1D A;  2FEZ A;  2PL2 A;  3ESL A;  3WG7 E;  1IHG A;  2I9C A;  5G04 J;  5ANR A;  3FUE A;  3CSF A;  1MZC A;  5CHE E;  4EEC A;  3FH8 A;  4BFR A;  2C0L A;  2H6I A;  3ZHE A;  1N0R A;  3CVV A;  5BXO A;  2P9U G;  1EDU A;  3LY7 A;  3LVR E;  3SQV A;  4NAC A;  3TWQ A;  3N71 A;  4URK A;  3PDN A;  4GZC A;  1HE8 A;  3VLD A;  4ATZ D;  2FO1 E;  4G25 A;  4JVS A;  4J8F A;  5ENQ D;  3FUL A;  3NAW A;  3FU3 A;  4BWR A;  3UXG A;  4ACL A;  2P58 C;  1EF1 C;  1W3B A;  1G3N B;  3NOG D;  4XKB A;  2JAB A;  4KVM A;  2LSU A;  1H2T C;  4HXI A;  4JHJ A;  4EPZ A;  4GTR A;  2HR2 A;  2XZD G;  1EPU A;  4QFV A;  4Z68 A;  2WQ6 A;  1DCQ A;  2MYO A;  3FFL A;  2AXZ A;  3FU5 A;  3UI2 A;  1FT2 A;  3LJ3 A;  4J0U A;  3EIQ C;  4CRW A;  3FWV A;  4LEU A;  2GRP B;  1BD8 A;  2P9N G;  1H19 A;  3QWW A;  3PE3 A;  2DZN A;  3JUI A;  3TWR A;  4DPR A;  2V5F A;  2WXM A;  4N2Q A;  3BQO A;  2I2O A;  2Y4T A;  3C5R A;  5AJL A;  3BG0 B;  4F3V A;  4WAF A;  5KJN A;  3ULY A;  1N95 A;  3EU9 A;  5CCL A;  1Q2Z A;  3I4R B;  3ZNG A;  1AP7 A;  1E90 A;  3J5Q B;  3PUK A;  4UQY A;  1UJJ A;  3FTW A;  3MYV A;  2DYS E;  4I17 A;  3TWU A;  4G24 A;  4GAA A;  3U3W A;  4RG6 A;  2FF4 A;  1U3D A;  4GYW A;  4HOU A;  3NB2 A;  3MJW A;  3ZU7 B;  5H7P A;  5D0O D;  2A4Z A;  3UIO C;  4CGW A;  1TN6 A;  3CK9 A;  4JW1 A;  4AM9 A;  3T5V A;  1TNU A;  3PEV B;  5LP0 A;  4TXP A;  5CBN A;  2R2L A;  1Z6T A;  3Q47 B;  2PQN A;  3KS2 A;  3ONL A;  4N2S A;  3G2U A;  4JEH A;  1FCH A;  4J7W A;  4U95 D;  3R7Q A;  4Q96 A;  4M3O A;  4AP2 A;  4G26 A;  2IO2 C;  1RZ4 A;  3T5X A;  2WQ7 A;  1YCS B;  4DK5 A;  3UM1 A;  1H2V C;  3S7F A;  3UIN C;  1MQS A;  2P9K G;  2PQR A;  3HVE A;  3CHM A;  4JB8 P;  2WXP A;  5HKP A;  2XPZ A;  4PDX A;  3CVY A;  3S7B A;  2AXV A;  2MOW A;  3CHO A;  3HXD A;  4I9C A;  3LPZ A;  2GW1 A;  1N4P A;  1UJK A;  3PZ3 A;  1S0P A;  3FP3 A;  2R5S A;  4C9B B;  3QKY A;  3SFX A;  3QWP A;  2WXI A;  3FH5 A;  3FDH A;  3PZ4 A;  3QC1 A;  3E37 A;  3EJN A;  1SZA A;  2JEK A;  4AY6 A;  1FPP A;  5E75 A;  4A1S A;  1X81 A;  3RJV A;  5CCM A;  2MRI A;  2WXN A;  1A17 A;  2DIW A;  1V55 E;  3ZYM A;  4DX6 D;  4I2W A;  2X38 A;  4WNE A;  3V2X A;  4F6R D;  2AWI A;  4DLO A;  4MRU A;  3SBS A;  2P9P G;  1OCO E;  4UWL A;  1OXJ A;  4XZ4 A;  4ANX A;  1O5M A;  2PM7 A;  1L5J A;  3D9I A;  5ARF A;  2C0M A;  2YNQ A;  3UKU G;  3NZU A;  1DVP A;  3AU5 A;  4JHK A;  2AVP A;  4U96 D;  3NF1 A;  5AQB A;  1D9S A;  2B6C A;  3PE4 A;  5AIJ A;  3S7J A;  3FUH A;  4GTS A;  3GYZ A;  3LJN A;  1K8K G;  2GRL A;  1WAO 1;  3DBS A;  3B7R L;  3ZPJ A;  2R59 A;  3C98 A;  3UM0 A;  5KWD A;  4YVQ C;  1B89 A;  3FEY A;  2YHC A;  1X5B A;  1IKN D;  2X6J A;  4BEP A;  3B13 A;  5IY5 E;  4B89 A;  3C72 A;  5ENP D;  4HRN A;  4UI9 C;  3RK6 A;  3ONK A;  3DSW A;  3ASG A;  2X6F A;  3CHQ A;  2AXU A;  2WXG A;  1KT1 A;  2NXP A;  3IBE A;  1N94 A;  3CV0 A;  4FJY A;  5BPP A;  2J09 A;  1JWG A;  5G2N A;  2WMN A;  3TWV A;  3Q75 A;  4I1O B;  2LO6 A;  1WG0 A;  4I6E A;  4U7E B;  3WXX A;  3VLF A;  5D66 A;  4IYP A;  3SZ7 A;  1TR4 A;  5BUZ A;  4Y6C A;  5AAR A;  5BV0 A;  3SFZ A;  2ZGD A;  3DRA A;  4GTV A;  4ACK A;  4UI9 K;  2BTD A;  4EZK A;  5CEA A;  4APF A;  2FUL A;  4U8Y D;  2R17 C;  4AVX A;  4FP7 A;  4J8E A;  5HRY A;  4XIF A;  5AQ9 A;  3V30 A;  3G2V A;  3KAE A;  4I6G A;  5G05 J;  3TG4 A;  3VTY A;  4LSZ E;  3FUM A;  4L2L A;  3CEQ A;  3L17 A;  3LVQ E;  3TXM A;  4GPM A;  3MGB A;  5LCW C;  3ASN E;  2IEJ A;  2RFM A;  3QK0 A;  3CVN A;  3I5P A;  1PAQ A;  3QAR A;  3CK8 A;  5A6C A;  5EX3 A;  4F53 A;  3HXF A;  4G8K A;  3UIP C;  4O1P A;  4ILI A;  3Q49 B;  3ISM C;  3FU0 A;  2QY7 A;  4H7X A;  2VTB A;  4ZHB A;  4V3I A;  3BU8 A;  4P29 A;  3Q9U C;  5EKQ D;  4TUU A;  3TXN A;  3C3O A;  4CDN A;  3ABK E;  1EYH A;  2EQX A;  5FT9 A;  1BPO A;  5CRU A;  1PY1 A;  4L23 A;  2OCC E;  4GPK A;  2ION A;  4BTB A;  3PNT B;  3AG4 E;  2OVF A;  4AY5 A;  4LCT A;  2X3M A;  3UT8 A;  3GZ2 A;  3LY8 A;  1RW2 A;  2PZI A;  1KLX A;  2RD0 A;  2VSN A;  1XNF A;  1ZB1 A;  2XRY A;  1HXI A;  3DXM G;  2HE0 A;  3ENE A;  3C3Q A;  5HS0 A;  2OOE A;  1U2V G;  4F1P A;  3CVW A;  5CBO A;  3LXU X;  2LUH A;  3PH0 C;  4NQ0 A;  3ZUV B;  3SNX A;  1NZN A;  4HOQ A;  4JD2 G;  4K0R A;  5EX0 A;  5AN8 A;  2QYJ A;  3APD A;  4M7C A;  3TG5 A;  3Q5M A;  3S7D A;  2L6B A;  4U63 A;  5G04 C;  3HYM B;  1NFI E;  3SF4 A;  2EIJ E;  1QQE A;  2V4L A;  2CFZ A;  2XEH A;  4RVB A;  5DBK A;  3PVL A;  2V5Q C;  1TNB A;  3CQC B;  4X8Q A;  2P9I G;  2WMO A;  3TWX A;  1K1B A;  2DBA A;  4GZD A;  3RRN B;  3CKB A;  1ELK A;  1SQM A;  3MKQ A;  4CEM A;  4BTA A;  3ZGQ A;  2J07 A;  2L0I A;  3MA5 A;  2OVB A;  2GRR B;  4YDO A;  2J4B A;  4F7A A;  3LEW A;  3OXG A;  5HI7 A;  4J8D A;  4FHK A;  5ENS D;  4E6H A;  2CHW A;  2UWJ G;  2R02 A;  4LNU D;  1VDY A;  5CEC B;  4KZ0 A;  4ATG A;  4LNG A;  2XEN A;  2I6H A;  4ILH B;  2VSY A;  4A55 A;  4G8L A;  3UPV A;  2XPI A;  3CVX A;  1N11 A;  3U9W A;  4LG6 A;  3DEP A;  3SO8 A;  1XGW A;  4JHR A;  5FZS A;  2C2L A;  2DYR E;  1E8X A;  3TWT A;  3FTS A;  4HBD A;  5KJM A;  4HOR A;  2VGE A;  5KNH D;  1N0Q A;  1MX2 A;  3HIZ A;  4DX2 A;  3FTV A;  1O1R A;  4EBA G;  3CST A;  4FU3 A;  1OY3 D;  5BT1 A;  3B7T A;  2H6G A;  3QB2 A;  1JCS A;  2B0O E;  1P5Q A;  4BET A;  3L82 A;  1IHB A;  5JJ6 A;  3F6Q A;  5JHA A;  2XQ0 A;  4HS2 A;  4L1B A;  4G23 A;  2FI7 A;  3DXK G;  4QQI A;  1SA4 A;  1TEZ A;  4ZFH A;  2DWZ A;  2KCV A;  2WB2 A;  1UG3 A;  3HXE A;  3BEE A;  3LY9 A;  2LSV A;  4HOT A;  4B8A A;  2CFU A;  5T3R A;  4N39 A;  3UMV A;  2J08 A;  3X2Q E;  2AW6 A;  4EQF A;  2XCB A;  4KT6 B;  2L0T B;  2Y69 E;  4UWF A;  4GA2 A;  3C3R A;  1UW4 B;  2ILR A;  3T8M A;  1NP7 A;  1IQU A;  4GYY A;  3HG0 D;  2XZT G;  3D9N A;  4OYS A;  3UT7 A;  3ZYQ A;  4WWO A;  4CZ2 D;  3ZYK A;  4FHJ A;  5T4Y A;  4GCO A;  3G2S A;  2X6K A;  4DI4 A;  4YVO A;  5EIB E;  3EHN A;  3Q15 A;  3NBN B;  2LAI A;  2XPY A;  1TNZ A;  5FZQ A;  3JXI A;  2WVI A;  1YYH A;  1MJ0 A;  5ENT D;  4O1O A;  2R03 A;  2OEW A;  3RO3 A;  2GGF A;  3ZW3 A;  1QNF A;  4DJA A;  1YA0 A;  5AYW D;  1HU3 A;  3QWV A;  4NRH B;  3VTX A;  2RKK A;  5FIN A;  1Y8M A;  3KEZ A;  2GRN B;  5ITZ F;  1E7V A;  1NL4 A;  2V0P A;  3PRZ A;  2LNI A;  2L6J A;  2QYU A;  3QOU A;  1OWN A;  3IHV A;  3EDT B;  4K03 A;  4E85 A;  3EHQ A;  1S64 A;  3AG2 E;  4CT4 A;  3IEG A;  4TXQ A;  2XS8 A;  1HG2 A;  4BSZ B;  4ANU A;  1NA3 A;  4OAV B;  2KAT A;  3D9L A;  2FBN A;  3IXE A;  1HS6 A;  4K5B A;  4YDE A;  4XI9 A;  3SGH A;  4XI0 A;  4BSX A;  4MKT A;  3Q4A B;  4GTO A;  1ZBP A;  1E8Z A;  3DPY A;  2VGX B;  4EZL A;  4GA0 A;  3FHE A;  1IYG A;  2VGY A;  5AAO A;  4FC8 A;  3U64 A;  4O6F A;  3D9J A;  4KYO B;  3RRU A;  4PUC A;  4GZ3 A;  1A5E A;  4HRM B;  3CHP A;  4YDY A;  4GA1 A;  2QZA A;  4CCA A;  2WPV A;  5EYP F;  1TJC A;  2XGO A;  2ETB A;  3PRE A;  3SBT B;  3UQ3 A;  3CHS A;  1H6O A;  1BU9 A;  3W9F A;  2NSZ A;  3ASD A;  4WND A;  2ZU6 B;  4UI9 J;  5T8I A;  4UQZ A;  2E0I A;  2AJA A;  2XS1 A;  3MV3 B;  4APO A;  4EBA A;  4FJZ A;  3HHM A;  2KXP C;  4GTT A;  4GTQ A;  3FY4 A;  4CGV A;  5FTP A;  5BV1 A;  2KZT B;  2DZO A;  4C0E A;  5EDS A;  5EYL A;  3PS6 A;  4GYO A;  3E34 A;  2KC7 A;  3CIA A;  4JEU A;  4O60 A;  3SY2 A;  1GW6 A;  3L08 A;  4KVO A;  4RQI A;  2GRM A;  5J08 A;  3Q9N C;  1HZ4 A;  3FH7 A;  4IN3 B;  2OV8 A;  3CVL A;  3FUI A;  3FUF A;  3IV0 A;  2WXH A;  1YMP A;  3GZS A;  2DVW A;  4HQD A;  1TN7 A;  3P2B A;  4UWK A;  3JYS A;  2PM6 A;  5FZR A;  3U66 A;  3TWW A;  2OEV A;  4Q94 A;  2VQ2 A;  1O1S A;  5CER B;  4I1A A;  2IQC A;  2UY1 B;  1D8E A;  3MEK A;  2ZXW E;  4L7T A;  4U8V D;  3NZS A;  3DWL G;  3TJP A;  4GZ5 A;  5BNW A;  3PZD A;  3AS8 A;  2VYI A;  1N4R A;  3ML9 A;  1AWC B;  5G05 C;  2HYZ A;  2J8S D;  2IOL A;  2ZIR A;  3ABL E;  5A23 A;  2KBX A;  1KZP A;  4GB9 A;  2VTB B;  3E4B A;  3QDN A;  4GMR A;  3APF A;  2IF4 A;  3MCX A;  1MX6 A;  3W9G A;  3O4Z A;  3D9H A;  4LER A;  3PZ2 A;  3RKV A;  2IJG X;  3B95 A;  3E30 A;  5JJT A;  5ARG A;  3PNL B;  3L54 A;  2JLB A;  4WNF A;  5D0Q D;  4GMJ A;  2H6F A;  4ME2 A;  3JQ1 A;  4UQX A;  3CVQ A;  5KBA A;  5ENN A;  1HFA A;  4BT9 A;  3V2O A;  5A7D B;  2ZIS A;  3K9I A;  3D9O A;  1INZ A;  2V8S E;  3G2W A;  3AS5 A;  1H6K A;  3SHF A;  3ZEF A;  2WXO A;  4AIF A;  3CK7 A;  4FUL A;  4B94 A;  1WY6 A;  2PNN A;  2NYJ A;  4GU5 A;  2IFU A;  3MX3 A;  4G2V A;  4DI3 A;  4HLE A;  1OCZ E;  3CHR A;  3E33 A;  4MS6 A;  4XEI G;  3UTM A;  3L22 A;  1LTX A;  3UT4 A;  4YND A;  3GW4 A;  1FVF A;  2OND A;  4J8S A;  4NUR A;  5C2Y A;  4HB5 A;  2KCL A;  3PEU B;  1SVX A;  3HRA A;  1JPL A;  4GZ6 A;  3V31 A;  2Y4U A;  1E8W A;  1DCE A;  5KJK A;  1TNO A;  2GRO B;  4HFG A;  5BXU A;  3ZHE B;  3U4T A;  4N3C A;  4IRU A;  4I2Z A;  1ZU2 A;  1OWL A;  4I1M A;  3D9M A;  4BX8 A;  5G55 A;  1IQR A;  4U07 A;  2EIN E;  4CDM A;  2L9B A;  3D9P A;  3TWS A;  2E2E A;  2BF0 X;  3EHM A;  2WXR A;  3MKQ B;  2Q7F A;  2KM4 A;  4OAU C;  3ABM E;  3AU4 A;  1MHQ A;  3B7B A;  2IOS A;  3AG1 E;  4AEZ C;  4EZJ A;  3DEO A;  3B7U X;  4ABN A;  4JA7 A;  2QFC A;  1S70 B;  5BW8 C;  3APC A;  1Z3X A;  1UN9 A;  2BKG A;  2BUG A;  4MBG A;  4GTP A;  2GRQ B;  4A3V A;  4OVV A;  3EUV A;  3ZRH A;  3LYA A;  5J90 A;  3EHR A;  4U04 A;  5FQ8 A;  4JC8 A;  1FVH A;  2XEV A;  5B3S E;  3BUA A;  3SFY A;  2Y3A A;  3AAA C;  3ZIM A;  3FUN A;  4KBQ A;  2VSX E;  3KEA A;  4PS8 A;  3FUD A;  3Q79 A;  4FAD A;  3HXC A;  4D10 C;  3JXJ A;  1ELW A;  4ANV A;  4WUY A;  1IXV A;  3ULE G;  1QBQ A;  2J9Q A;  3E32 A;  2LXL A;  4Y6W A;  3NOC D;  2HM8 A;  4BX9 A;  1QZ2 A;  3DSX A;  3KD7 A;  3Q73 A;  4LRZ A;  1V54 E;  1U3C A;  5KNG A;  3OTN A;  1HH8 A;  1N4S A;  3HXB A;  2F37 A;  2WQH A;  4HVB A;  1MYO A;  3NQP A;  2EIK E;  3ZKJ A;  3OAW A;  1HG5 A;  4DX7 D;  3ML8 A;  3L13 A;  3FTZ A;  3RRM B;  3CVP A;  5B1A E;  4RLY A;  1HX8 A;  2X6I A;  2BED A;  4PS3 A;  3PZ1 A;  4HI8 A;  5CMW A;  2YHE A;  4U8H A;  4A63 B;  4G11 A;  1TJF A;  3ZVV A;  4LUN U;  4N5C A;  3ESK A;  3KSQ A;  4BES A;  1SZ9 A;  3MKR A;  3KSL A;  2FO7 A;  1NA0 A;  1SA5 A;  1HF8 A;  2IU1 A;  5ENO D;  2R05 A;  3CKC A;  3VLE A;  3HDX A;  1WDY A;  3GZ1 A;  3HVE B;  3UUX A;  1JCQ A;  4WWN A;  3FTU A;  1OWO A;  3LCA A;  2CG2 A;  1ELR A;  3O48 A;  3URZ A;  2X6H A;  3ZXP A;  3JQ0 A;  5CRV A;  4AV7 A;  2A5U A;  3I3N A;  3LDZ A;  4DRX E;  4WWP A;  1QYM A;  3OXF A;  2ETA A;  3DSU A;  3FTX A;  2WM9 A;  3Q7A A;  5DIZ A;  2VSO E;  3CGH A;  2RG8 A;  4JA9 A;  3FU6 A;  3IKO B;  4TXR A;  2F8Y A;  1TNY A;  4U0U A;  2H6H A;  4JXT A;  5EID A;  2XCC A;  1N9A A;  2F8X K;  4B8C B;  4KMO A;  2BKK B;  3SD5 A;  2Y0B G;  4PS7 A;  3ZFW A;  5ENR D;  5CED B;  1MX4 A;  3LS8 A;  4K5A B;  3J5P A;  3ZN3 A;  5JHB A;  4U0S A;  3P1U A;  3EIJ A;  5AQA A;  3R7R A;  4HRL A;  3L16 A;  3MV2 B;  4UUC A;  3MZL B;  3G2T A;  2NC9 A;  4KZC A;  4N5Q A;  3ASH A;  4C0M A;  4A3T A;  1OT8 A;  2ETC A;  2ZGG A;  2YIN A;  3PUJ A;  4NIK A;  3T9K A;  5JMN D;  1UN8 A;  4HOS A;  2XRZ A;  3JUE A;  4ANW A;  2XEE A;  3I4G A;  3R9M A;  5KJL A;  1E96 B;  1N4Q A;  4TV3 A;  4DLQ A;  4BY6 A;  2CHX A;  1D8D A;  5LX8 A;  3TL5 A;  4RG9 A;  2VGX A;  4HNA D;  4K5C A;  3TAX A;  5FQ7 A;  3CR3 A;  4AJW A;  5LOZ A;  3RU0 A;  3JCK C;  2P9S G;  2V4H C;  4GML A;  4U0Z A;  3DPD A;  3AG3 E;  1S63 A;  3V79 K;  4XE0 A;  3S2A A;  3UX4 A;  5FIO A;  1JWF A;  1HO8 A;  1K3Z D;  2XHE A;  3BG1 B;  4HI9 A;  5EIL A;  4I9E A;  4WNG A;  4EHM A;  3TGO A;  4FLH A;  4YDW A;  4BT8 A;  4L9P A;  2WXK A;  3ULQ A;  3RSE G;  4KXK B; 
#chains in the Genus database with same CATH homology
 3CVX A;  2XPZ A;  5ENN A;  4PDX A;  3U9W A;  3CVY A;  1H0A A;  1HFA A;  3AS4 A;  3S7B A;  4UWG A;  4BT9 A;  3LKU A;  2KCK A;  1XGW A;  2AXV A;  2MOW A;  3CHO A;  4JHR A;  5FZS A;  2C2L A;  3CQG B;  5A7D B;  4I9C A;  1E8X A;  3K9I A;  3LPZ A;  2GW1 A;  1UJK A;  3D9O A;  3FTS A;  1INZ A;  4I6J A;  4R7L A;  1S0P A;  2V8S E;  1JUQ A;  3G2W A;  5KJM A;  3AS5 A;  1H6K A;  2DCP A;  3SHF A;  3ZEF A;  2MHK A;  3FP3 A;  4HOR A;  2R5S A;  2WXO A;  4AIF A;  2WXL A;  3CK7 A;  3FTY A;  4FUL A;  5FJY A;  4B94 A;  1WY6 A;  4C9B B;  3QKY A;  3HIZ A;  4GU5 A;  2IFU A;  2KZT A;  2WXJ A;  3FTV A;  3MX3 A;  4G2V A;  4DI3 A;  3QWP A;  2WXI A;  4HLE A;  3FH5 A;  4EBA G;  4W9R A;  4GCN A;  3CST A;  4FU3 A;  3FDH A;  2VJ8 A;  1E8Y A;  3QC1 A;  4AOF A;  3EJN A;  4RSY A;  4B0Z A;  5BT1 A;  2WXF A;  3B7T A;  3CHR A;  1SZA A;  2HO1 A;  2JEK A;  4AY6 A;  4MS6 A;  3QB2 A;  5E75 A;  3L22 A;  5FQ4 A;  2I1K A;  3UT4 A;  4YND A;  3GW4 A;  1FVF A;  3QAQ A;  2OND A;  4A1S A;  4G1T A;  4J8S A;  4NUR A;  2CHZ A;  5CMY A;  5C2Y A;  1P5Q A;  3RJV A;  5CCM A;  2KCL A;  2MRI A;  3PEU B;  5KCM A;  2WXN A;  1JPL A;  1A17 A;  2DIW A;  4GZ6 A;  5JJ6 A;  3ZYM A;  2Y4U A;  4J6I A;  1E8W A;  2XQ0 A;  5JHA A;  4N3B A;  5KJK A;  3D3M A;  4HS2 A;  2J49 A;  4I2W A;  4L1B A;  2X38 A;  4WNE A;  4G23 A;  2FI7 A;  4HFG A;  1OWM A;  3ZHE B;  2AWI A;  4DLO A;  4MRU A;  3U4T A;  3SBS A;  4N3C A;  1TEZ A;  4FLB A;  4IRU A;  4I2Z A;  4UWL A;  1ZU2 A;  4XZ4 A;  1OWL A;  2KCV A;  2WB2 A;  1UG3 A;  4ANX A;  2PM7 A;  4I1M A;  3D9M A;  4BX8 A;  1L5J A;  2M63 A;  5G55 A;  1IQR A;  1WM5 A;  1H2U A;  3BEE A;  3D9I A;  3LY9 A;  2LSV A;  4U07 A;  5ARF A;  2UY1 A;  4CDM A;  4CDR A;  4HOT A;  2C0M A;  1LF8 A;  2CG3 A;  1Y6I A;  2YNQ A;  2L9B A;  3NZU A;  4ILG A;  3D9P A;  4B8A A;  1DVP A;  2CFU A;  3AU5 A;  4JHK A;  5T3R A;  2E2E A;  5LCW J;  2AVP A;  4AXH A;  1KT0 A;  4N39 A;  3NF1 A;  3UMV A;  2BF0 X;  5AEN A;  2J08 A;  3EHM A;  2WXR A;  3MKQ B;  1N54 A;  5FWQ A;  2AW6 A;  4EQF A;  2Q7F A;  3RO2 A;  3PE4 A;  2XCB A;  4KT6 B;  2I1J A;  2XGS A;  4OVU A;  4FA6 A;  2KM4 A;  3FUJ A;  5AIJ A;  3S7J A;  2L0T B;  3FUH A;  3GYZ A;  3AU4 A;  4UWF A;  1MHQ A;  4GA2 A;  2GRL A;  1WAO 1;  1OWP A;  1UW4 B;  2ILR A;  3T8M A;  3QJZ A;  2IOS A;  1NP7 A;  1IQU A;  3DBS A;  4GYY A;  4AEZ C;  4EZJ A;  3B7U X;  3B7R L;  4ABN A;  3ZPJ A;  3D9N A;  4OYS A;  2R59 A;  3C98 A;  4JA7 A;  3UT7 A;  5HQ8 A;  4TRQ A;  2QFC A;  3ZYQ A;  3D9K A;  4WWO A;  4YVQ C;  1B89 A;  3APC A;  5BW8 C;  3L6A A;  1Z3X A;  1UN9 A;  3FEY A;  2BUG A;  4I43 A;  3ZYK A;  4FHJ A;  2YHC A;  5LFA A;  5E76 A;  1X5B A;  4IUL A;  5T4Y A;  2X6J A;  3B13 A;  4GCO A;  4A3V A;  3G2S A;  2X6K A;  4MLP A;  4H7Y A;  4DI4 A;  4L2Y A;  4YVO A;  4OVV A;  4XKC A;  4B89 A;  3EHN A;  4Q69 A;  1N52 A;  3ZRH A;  3LYA A;  4UI9 C;  5J90 A;  3RK6 A;  3ONK A;  3Q15 A;  5ANL A;  3SI5 A;  3ZYL A;  4U04 A;  5FQ8 A;  3ASG A;  3IHY A;  4JC8 A;  1FVH A;  2X6F A;  2XEV A;  3ASF A;  3CHQ A;  2AXU A;  2WXG A;  2LAI A;  2XPY A;  1DNP A;  1KT1 A;  2Y3A A;  5FZQ A;  2NXP A;  2WVI A;  4PH4 B;  3ZIM A;  3IBE A;  3FUN A;  4JL0 A;  3CLJ A;  4CT0 A;  4KBQ A;  2VSX E;  2WXQ A;  3CV0 A;  4FJY A;  4F1S A;  5BPP A;  2J09 A;  1JWG A;  1Z3Y A;  5G2N A;  2WMN A;  4PS8 A;  5AJD A;  3RO3 A;  4N3A A;  4I1O B;  4UWH A;  2GGF A;  3FUD A;  5FQ6 A;  4FAD A;  3ZW3 A;  1QNF A;  2LO6 A;  2YQ8 A;  4D10 C;  1ELW A;  4DJA A;  4I6E A;  1YA0 A;  3WXX A;  3VLF A;  5AYW D;  1HU3 A;  3QWV A;  4JPS A;  2J4D A;  4ANV A;  4NRH B;  4IYP A;  3FEX A;  4WUY A;  3CVU A;  5JJ7 A;  3VTX A;  3SZ7 A;  4JZY A;  2XGM A;  5BUZ A;  1Y8M A;  2J9Q A;  3KEZ A;  4Y6C A;  5M72 A;  3B7S A;  5BV0 A;  3R9A B;  3SFZ A;  3RIB A;  1E7V A;  4Y6W A;  2HM8 A;  2V0P A;  3PRZ A;  4BX9 A;  1QZ2 A;  2LNI A;  4ACK A;  2L6J A;  3KD7 A;  1PC2 A;  3QOU A;  4UI9 K;  2BTD A;  4LRZ A;  3ZVV A;  4EZK A;  1OWN A;  4A1G A;  3IHV A;  4APF A;  3FUK A;  2FUL A;  1U3C A;  3OXL A;  1E7U A;  3EDT B;  3ZXS A;  1OUV A;  3QNK A;  4K03 A;  4XX5 A;  4E85 A;  2FEZ A;  5C1D A;  2R17 C;  3OTN A;  1HH8 A;  4CT4 A;  2PL2 A;  3ESL A;  3IEG A;  1IHG A;  2I9C A;  1HG2 A;  4ANU A;  4AVX A;  1NA3 A;  2WQH A;  5G04 J;  4HVB A;  2KAT A;  3NQP A;  5ANR A;  4FP7 A;  3D9L A;  4J8E A;  2FBN A;  3FUE A;  4XIF A;  3CSF A;  1HS6 A;  5CHE E;  4EEC A;  3OAW A;  1HG5 A;  3FH8 A;  3G2V A;  4BFR A;  4XI9 A;  3SGH A;  3ML8 A;  3KAE A;  4XI0 A;  4BSX A;  3L13 A;  2C0L A;  3FTZ A;  4MKT A;  3RRM B;  3Q4A B;  3CVP A;  4I6G A;  3ZHE A;  5G05 J;  3TG4 A;  1ZBP A;  3VTY A;  1E8Z A;  3FUM A;  4L2L A;  3CVV A;  1HX8 A;  3CEQ A;  3L17 A;  3LVQ E;  2VGX B;  1EDU A;  3TXM A;  2X6I A;  3LY7 A;  3LVR E;  4EZL A;  4GA0 A;  3MGB A;  4NAC A;  3FHE A;  5LCW C;  1IYG A;  4PS3 A;  5CMW A;  2VGY A;  2YHE A;  3N71 A;  4U8H A;  3QK0 A;  3CVN A;  4G11 A;  4URK A;  3PDN A;  4GZC A;  1HE8 A;  1TJF A;  3I5P A;  4FC8 A;  1PAQ A;  3QAR A;  4LUN U;  3CK8 A;  3VLD A;  4N5C A;  5EX3 A;  3ESK A;  4F53 A;  4G25 A;  4JVS A;  3U64 A;  5A6C A;  4O6F A;  4J8F A;  1SZ9 A;  3D9J A;  3MKR A;  3FUL A;  3Q49 B;  4ILI A;  3FU0 A;  2QY7 A;  4H7X A;  4KYO B;  2FO7 A;  3RRU A;  2VTB A;  4PUC A;  1NA0 A;  3FU3 A;  4GZ3 A;  4BWR A;  1HF8 A;  4ACL A;  2P58 C;  3CHP A;  1EF1 C;  1W3B A;  2IU1 A;  4GA1 A;  4V3I A;  4CCA A;  3CKC A;  4P29 A;  4XKB A;  2WPV A;  1TJC A;  2XGO A;  3VLE A;  3HDX A;  4KVM A;  3GZ1 A;  2LSU A;  3HVE B;  5EKQ D;  3PRE A;  3SBT B;  3UQ3 A;  1H2T C;  4TUU A;  3CHS A;  4HXI A;  3UUX A;  3TXN A;  4JHJ A;  4EPZ A;  4CDN A;  2NSZ A;  3ASD A;  2HR2 A;  4WND A;  4WWN A;  1EYH A;  2ZU6 B;  3FTU A;  1OWO A;  3LCA A;  2CG2 A;  1ELR A;  3O48 A;  2EQX A;  4UI9 J;  3URZ A;  5T8I A;  2X6H A;  4UQZ A;  5FT9 A;  1EPU A;  1BPO A;  2E0I A;  3MV3 B;  1PY1 A;  4L23 A;  4QFV A;  4APO A;  3JQ0 A;  4EBA A;  4AV7 A;  4GPK A;  2WQ6 A;  2A5U A;  3I3N A;  3LDZ A;  3HHM A;  3FFL A;  4FJZ A;  4WWP A;  2ION A;  4BTB A;  3PNT B;  2OVF A;  3OXF A;  4AY5 A;  4LCT A;  2AXZ A;  3FTX A;  2WM9 A;  2XPI A;  2X3M A;  3FU5 A;  3FY4 A;  5DIZ A;  4CGV A;  2VSO E;  5FTP A;  3UT8 A;  3GZ2 A;  3CGH A;  2RG8 A;  5BV1 A;  2KZT B;  4JA9 A;  3FU6 A;  5EDS A;  4C0E A;  3LJ3 A;  3IKO B;  3PS6 A;  3LY8 A;  4GYO A;  4J0U A;  2PZI A;  2KC7 A;  3CIA A;  3EIQ C;  4JEU A;  4U0U A;  4CRW A;  4JXT A;  3FWV A;  1KLX A;  2XCC A;  4LEU A;  1GW6 A;  2RD0 A;  2VSN A;  3L08 A;  4KVO A;  1XNF A;  1H19 A;  3QWW A;  4B8C B;  2XRY A;  3PE3 A;  1HXI A;  2GRM A;  3ENE A;  4KMO A;  3SD5 A;  2OOE A;  5J08 A;  3JUI A;  4PS7 A;  4DPR A;  3ZFW A;  2V5F A;  1HZ4 A;  3CVW A;  2WXM A;  3FH7 A;  4N2Q A;  4IN3 B;  2OV8 A;  3LS8 A;  3LXU X;  3CVL A;  3FUI A;  3FUF A;  3IV0 A;  2I2O A;  2Y4T A;  5AJL A;  3BG0 B;  2WXH A;  3ZN3 A;  5JHB A;  3GZS A;  3PH0 C;  4U0S A;  4NQ0 A;  4F3V A;  4WAF A;  5KJN A;  3P1U A;  3EIJ A;  3SNX A;  3P2B A;  5CCL A;  3R7R A;  4UWK A;  1NZN A;  3JYS A;  2PM6 A;  3I4R B;  3L16 A;  4HOQ A;  5FZR A;  3U66 A;  3MV2 B;  4K0R A;  5EX0 A;  3APD A;  4Q94 A;  2VQ2 A;  1E90 A;  3PUK A;  3MZL B;  4I1A A;  3G2T A;  2NC9 A;  4KZC A;  3TG5 A;  3Q5M A;  3S7D A;  2IQC A;  1UJJ A;  2UY1 B;  3ASH A;  3FTW A;  3MYV A;  4I17 A;  4UQY A;  4A3T A;  4G24 A;  4C0M A;  4U63 A;  3MEK A;  4GAA A;  3U3W A;  2YIN A;  5G04 C;  4RG6 A;  4L7T A;  3HYM B;  2FF4 A;  1U3D A;  3PUJ A;  3NZS A;  4GYW A;  3SF4 A;  4HOU A;  1UN8 A;  3TJP A;  4HOS A;  2XRZ A;  4GZ5 A;  3MJW A;  1QQE A;  2V4L A;  4ANW A;  5BNW A;  2CFZ A;  3PZD A;  3AS8 A;  3I4G A;  4RVB A;  2VYI A;  2A4Z A;  5D0O D;  3ML9 A;  5DBK A;  4CGW A;  3PVL A;  3CK9 A;  3CQC B;  5G05 C;  2HYZ A;  2WMO A;  4JW1 A;  4AM9 A;  5KJL A;  1E96 B;  4TV3 A;  2DBA A;  4DLQ A;  3T5V A;  2IOL A;  4GZD A;  3RRN B;  3PEV B;  3CKB A;  4BY6 A;  5A23 A;  1ELK A;  5LP0 A;  1SQM A;  1Z6T A;  2CHX A;  3Q47 B;  4GB9 A;  3MKQ A;  4CEM A;  5LX8 A;  2PQN A;  3KS2 A;  3E4B A;  2VTB B;  3ONL A;  4RG9 A;  2VGX A;  3G2U A;  3TL5 A;  3TAX A;  5FQ7 A;  3ZGQ A;  4BTA A;  4N2S A;  2J07 A;  3CR3 A;  3QDN A;  4JEH A;  1FCH A;  2L0I A;  4AJW A;  5LOZ A;  3APF A;  2IF4 A;  3MCX A;  3MA5 A;  3R7Q A;  3RU0 A;  2OVB A;  3JCK C;  4GML A;  2J4B A;  4F7A A;  3LEW A;  4U0Z A;  3DPD A;  3O4Z A;  4Q96 A;  4M3O A;  4XE0 A;  4LER A;  4G26 A;  3S2A A;  4AP2 A;  3OXG A;  5HI7 A;  3UX4 A;  3T5X A;  2WQ7 A;  3RKV A;  4J8D A;  4FHK A;  2IJG X;  4E6H A;  2CHW A;  2UWJ G;  1JWF A;  4DK5 A;  1HO8 A;  5JJT A;  1H2V C;  5ARG A;  2XHE A;  3BG1 B;  3PNL B;  3S7F A;  3L54 A;  4I9E A;  2JLB A;  1MQS A;  4WNF A;  4WNG A;  1VDY A;  4GMJ A;  5D0Q D;  3TGO A;  4ME2 A;  4KZ0 A;  4ATG A;  2PQR A;  3JQ1 A;  4UQX A;  2I6H A;  3CVQ A;  4FLH A;  4ILH B;  2VSY A;  3HVE A;  4A55 A;  3CHM A;  4BT8 A;  2WXP A;  3UPV A;  2WXK A;  3ULQ A;  2LAH A;  4KXK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...