4I9CA

Crystal structure of aspartyl phosphate phosphatase f from b.subtilis in complex with its inhibitory peptide
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
372
structure length
372
Chain Sequence
GVISSSSIGEKINEWYMYIRRFSIPDAEYLRREIKQELDQMEEDQDLHLYYSLMEFRHNLMLEYLEPLEKMRIEEQPRLSDLLLEIDKKQARLTGLLEYYFNFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEESNILPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQKAGDVIYLSEFEFLKSLYLSGPDEEAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYFLKVEQVRQLIQGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of Rap phosphatase inhibition by Phr peptides
pubmed doi rcsb
source organism Bacillus subtilis
total genus 157
structure length 372
sequence length 372
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i9cA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i9cA02
4XI0A 4ME2A 4JL0A 4BTAA 3LCAA 3S7FA 3AS4A 3ASFA 1HH8A 4I2ZA 5FZRA 2XEVA 4AIFA 4GZ3A 4U0ZA 4UI9C 4H7XA 2IFUA 2KCVA 2XGOA 5EX0A 3QWVA 4GA2A 5LCWJ 3CK7A 1XNFA 3SF4A 5ARFA 3S7JA 5A6CA 3PE3A 5BW8C 3VTYA 2LSUA 3Q47B 4J8DA 5DBKA 4I2WA 4HOUA 3VTXA 5M72A 3Q5MA 1QZ2A 2C0MA 1IYGA 4G1TA 3R9AB 4BTBA 3U3WA 4G2VA 3ZGQA 2FBNA 4WNDA 4B94A 2L6JA 2Y4TA 4NRHB 1W3BA 4J0UA 4WNFA 3ULQA 2J9QA 2C0LA 1PC2A 4BWRA 2PL2A 4RG9A 3KS2A 1FCHA 3MV2B 2P58C 3UQ3A 2KCLA 4EQFA 3LKUA 4RG6A 2VGYA 3N71A 4HOQA 2XGMA 4U0SA 3E4BA 2PQRA 3TG5A 4GYOA 2Y4UA 4GA0A 2NC9A 4I9CA 4UI9K 4GCNA 5G05J 4AY5A 3ASGA 3UUXA 5D0OD 2AVPA 3MKRA 3NF1A 2FO7A 5ARGA 2UY1A 3CEQA 5JJTA 3CK9A 4JA7A 4BT9A 4GA1A 4AM9A 5HI7A 5EKQD 3ZN3A 4YVQC 3OXGA 3ZHEB 3JYSA 4CGWA 2BUGA 3RKVA 5CCLA 4WNEA 3CKBA 3U4TA 4HOSA 4F3VA 2WQHA 4AY6A 2PZIA 2HO1A 2IF4A 4LEUA 4O6FA 3GYZA 5G04J 3QWPA 2FI7A 3S7DA 5G05C 3TG4A 2VSYA 4NQ0A 4GYYA 2UWJG 3PDNA 3OXFA 2I6HA 3LY7A 5JJ6A 4ABNA 3K9IA 3Q4AB 3LY8A 2YQ8A 4Y6CA 2PQNA 3GZ2A 4HOTA 2OOEA 4GZ5A 2VSNA 4APOA 5KJMA 2KC7A 3UPVA 3ZPJA 1E96B 4WNGA 1KT0A 1ZBPA 2MHKA 5KJNA 4I1AA 2LNIA 4UQYA 3LPZA 5D0QD 4W9RA 3HYMB 1ELRA 4KYOB 4XIFA 5KJKA 3RO2A 3MEKA 3LYAA 4J8EA 4N3CA 3RIBA 2YHCA 5G04C 4N2QA 1KT1A 2C2LA 4G26A 3WXXA 3MA5A 2DBAA 3QWWA 4YVOA 3Q15A 3RO3A 3CVPA 3TGOA 2HR2A 4Y6WA 5AYWD 1QQEA 1NA0A 4N3AA 2ONDA 4YNDA 4N2SA 4JA9A 3URZA 2FF4A 3FWVA 2XCCA 5HQ8A 4I9EA 2XCBA 4KXKB 5BT1A 4N5CA 4KBQA 1HZ4A 2Q7FA 4N39A 1HXIA 2FEZA 5FJYA 5CCMA 1ELWA 3QDNA 4GPKA 4CGVA 3EDTB 1A17A 4WUYA 4J8FA 4UQXA 1WM5A 4U0UA 1NA3A 3CV0A 3Q49B 4G24A 5FZSA 1YA0A 2VGXB 3SZ7A 2E2EA 4CDRA 3PE4A 2R5SA 4N3BA 5FT9A 1KLXA 3CVQA 3AS8A 4XI9A 4G25A 2HYZA 3ASDA 5FZQA 1WAO1 1IHGA 5CHEE 5DIZA 2LSVA 3AS5A 3IEGA 4IN3B 3RU0A 2JLBA 3CVNA 4G23A 1P5QA 4GZ6A 3GW4A 4HORA 2UY1B 2VYIA 4A1SA 3S7BA 3TAXA 5A7DB 3GZ1A 3MV3B 3FP3A 3FFLA 2KCKA 3ASHA 3O48A 3LY9A 4GYWA 1NZNA 1ZU2A 4U07A 5EX3A 3ZFWA 2QFCA 3ZHEA 5BNWA 3QOUA 3OXLA 4BT8A 4H7YA 3ESKA 2KATA 5LCWC 4JHRA 3BEEA 3CKCA 5C1DA 3KAEA 2XPIA 3KD7A 4UI9J 4UQZA 1OUVA 1Y8MA 2GW1A 5FTPA 2VGXA 4U04A 3RJVA 3CVLA 4GCOA 3CK8A 2XGSA 2WPVA 5JJ7A 5KJLA 1B89A 2V5FA 1TJCA 4I17A 3QKYA 2VQ2A
chains in the Genus database with same CATH superfamily
4EPZA 4XI0A 1N11A 4YDYA 3CQCB 1H2VC 3NOGD 4D10C 1N52A 5AQBA 3S7FA 4WWNA 3ZKJA 3CQGB 3ASFA 4I2ZA 4CDMA 2P9SG 3CHSA 2ZISA 4UI9C 4K03A 4Z68A 1K1AA 1O5MA 2XPZA 4XE0A 3QWVA 4GA2A 2L6BA 3CK7A 2WXGA 3MCXA 1S70B 3ZXPA 2NSZA 4DLOA 2LSUA 1O1RA 2VJ8A 3Q47B 1N4RA 4DI3A 1TN8A 4HOUA 2WXQA 1QZ2A 4BESA 4G1TA 3R9AB 4ATGA 1V54E 3MKQB 3ZGQA 3EUVA 4WNDA 3DXKG 1EDUA 4U95D 4NRHB 5BXOA 2X6FA 1D8EA 1W3BA 4J0UA 4PS3A 2WXPA 4WNFA 2P9PG 1N0QA 2P9UG 1PC2A 4BWRA 1Q2ZA 4M3OA 3LXUX 3KS2A 1SW6A 2OV8A 1TN6A 1DVPA 2AXVA 4LNBA 4HOQA 2WXFA 3L22A 2XGMA 2WB2A 2XZTG 1IXVA 3ASNE 3TWRA 5KCMA 4TUMA 4GCNA 4EZLA 3Q7FA 2RD0A 2GGFA 1HG2A 3LJNA 3NF1A 4KVMA 2UY1A 4L2LA 4JHKA 5JJTA 2XZDG 4L2YA 3PNLB 4YVQC 4AEZC 3OXGA 4A1GA 2JABA 4UWFA 2EQXA 4O60A 1QYMA 4ILHB 4QQIA 5HKPA 2AJAA 4CYMD 4DJAA 4UWHA 4TUUA 5BXUA 2WXLA 3T8MA 3GZSA 1SQMA 3UT7A 3QWPA 4PDXA 5EYPF 2VSYA 4NQ0A 4HFGA 1QNFA 3LVRE 2UWJG 3B13A 2I6HA 3EIQC 5JJ6A 1E90A 1IKND 2F8YA 1NL4A 1TNOA 4Y6CA 5LFAA 3FU0A 2PQNA 5T8IA 2OOEA 2VSNA 3U66A 3EU5A 2KC7A 2PM6A 1E96B 4U8VD 1ZBPA 3ZW3A 1IQRA 5KJNA 5LOZA 1Z5SC 4EBAA 1PAQA 1SVXA 2GRRB 3LPZA 2R2LA 5D0QD 4CT4A 4GTQA 3FTWA 3LYAA 4RQIA 1KPSB 3HXDA 3WXXA 2A4ZA 2OVFA 3HG0D 4IYPA 1JCQA 1LF8A 3F6QA 3TGOA 5AYWD 3PZ2A 1NA0A 4N2SA 3ESLA 1MJ0A 2XCCA 2XCBA 2XS8A 3I5PA 3FTSA 4KXKB 3AG4E 1OWLA 5BT1A 3FY4A 3PREA 4N5CA 4ILGA 4N39A 5CCMA 5FJYA 1N4SA 3EIJA 3P2BA 1HFAA 2IY0C 1HO8A 3SD5A 3APFA 3HHMA 3CV0A 4HLEA 5FZSA 3IKOB 4C9BB 4O1OA 3UT4A 1YA0A 2E2EA 3DPDA 2H6GA 3UIOC 3RRUA 2KZTA 3BG1B 4HVBA 2A5EA 4N3BA 1MQSA 1KLXA 2V0PA 3L16A 5BUZA 2DYRE 4JD2G 1JUQA 2MRIA 4PS7A 4BERA 4AVXA 1WAO1 3PEUB 3OAWA 3JUEA 4BSXA 5AIJA 4CZ2D 3RU0A 4I6GA 5ITZF 1FPPA 4HORA 4XKBA 3GZ1A 3SY2A 1MZCA 4L23A 2R05A 3FTXA 3LY9A 3DSTA 2CG2A 3TWVA 3EHNA 1ZU2A 1BPOA 3UIPC 3ZHEA 5FINA 5ENPD 4DX2A 1AWCB 3ESKA 5LCWC 4YDOA 3E34A 3FEXA 2V4HC 3QJZA 3KEAA 4F1PA 1Y8MA 4ILIA 5E76A 3CVLA 1E7VA 2OCCE 2XEEA 4LUNU 4GCOA 2J07A 3CK8A 3UKUG 1JCSA 5BV1A 2GRMA 2CHXA 4C48B 4I17A 3FTVA 4EZKA 2VQ2A 2WXOA 4X8QA 3KSLA 4FU3A 5FQ7A 3V2OA 4JL0A 3C5RA 3AS4A 2J49A 2XEVA 4AIFA 1JPLA 3PZDA 3AU4A 4GZ3A 2AW6A 3TWQA 4U0ZA 3AAAC 1TJFA 4H7XA 2IFUA 2KCVA 4U63A 2LXMA 2QZAA 3HIZA 1OT8A 5LCWJ 2XRZA 1XNFA 3SF4A 3BU8A 3PZ4A 4WWPA 1N95A 3DEOA 2ETCA 1WDYA 2QYUA 2BKGA 5DBKA 4FJYA 5M72A 3SHFA 2C0MA 3ONLA 2OVBA 4AXHA 3C98A 1SZ9A 3Q9UC 4GZDA 3SGHA 3FEYA 2F0YA 3DBSA 3MZLB 2KBXA 4GTMA 3IHVA 3TXNA 3U64A 2WMOA 3ZYMA 4URKA 1O1SA 3Q75A 4GTSA 4JHJA 2J9QA 3FUIA 3BUAA 4RG9A 4OVVA 4GAAA 1FCHA 3MV2B 2I1KA 2P2CP 4EECA 4WAFA 4BFRA 3UQ3A 4JEHA 2KCLA 4EQFA 2VGYA 3UM2A 4U0SA 3CR3A 3MYVA 3CIAA 3DSUA 2CG3A 3G2WA 2NC9A 4QFVA 1N0RA 5CECB 4U8YD 4UWLA 3I3NA 3B7RL 1XGWA 3FH8A 5AJDA 2X6KA 1NFIE 1HX8A 2WXRA 5G05J 3LDZA 5J90A 1YMPA 1OWOA 3ASOE 4PUCA 3R7RA 3UUXA 2WXKA 3HVEB 2AVPA 2F8XK 2FO7A 4BSZB 1DC2A 3HXBA 3IBEA 5AN8A 3V31A 1H0AA 4GTTA 2BUGA 5CCLA 4WNEA 3DRAA 3U4TA 5G2NA 4HOSA 4G8LA 2HO1A 4XX5A 3Q7AA 2AXZA 5CRUA 5D66A 1JWFA 2DZOA 2IF4A 4F6RD 2OEVA 5G04J 1FVFA 3TG4A 2E0IA 1U3DA 4FA6A 3PDNA 3UXGA 4GMJA 3LY7A 4ABNA 3K9IA 4LNUD 3JQ0A 1NI1A 3KSQA 1UN8A 4TRQA 3HXCA 4N5QA 2IU1A 1D9SA 3FUJA 5CRVA 4FP7A 1LTXA 4B0ZA 4WNGA 5CEAA 5B1BE 1H2TC 2BEDA 4IULA 2XS1A 4I6JA 3R9MA 4J8YA 3CVXA 2DZNA 2DVWA 3PVLA 1S64A 4Q69A 4N3CA 2YINA 4J8EA 2IOLA 5ENRD 1MX4A 4FULA 5B1AE 4LRZA 5AARA 3DSVA 4G26A 1LD8A 3D9KA 3VLEA 3UKRG 3AG3E 4APFA 4B89A 1OCOE 4L9PA 3CGHA 1QQEA 4N3AA 4YNDA 3CVUA 3HXFA 2WMNA 4EBAG 4KMOA 3V30A 5BV0A 5HQ8A 3LJ3A 3MKQA 1WY6A 3G2TA 3FUMA 3QC1A 1HS6A 1H19A 3G2UA 2FEZA 1ELWA 3SFYA 5JA4D 3UMVA 2A5UA 1U3CA 4J8FA 3C3RA 2B0OE 3DSWA 3W9GA 1WM5A 1Z3YA 2L0TB 2V4LA 5LP0A 2MOWA 3DSSA 3SZ7A 1BU9A 3PE4A 2VGEA 4JW1A 4DK5A 4MLPA 5EIBE 3AS8A 4G25A 4E85A 3JXIA 4TXQA 2LO6A 5FZQA 1IHGA 5CHEE 2Y1LE 2EIME 3IEGA 1MX6A 2JLBA 4G23A 1E8YA 4GZ6A 3B7TA 3GW4A 2VYIA 4A1SA 3CVYA 3S7BA 4WWOA 1S63A 5CBOA 3FFLA 5CMWA 3D9PA 5ANRA 3O48A 3G2SA 1FVHA 3I4GA 3FDHA 1OY3D 4PH4B 2QFCA 5BNWA 1AP7A 3HRAA 2ILRA 3ABME 2KATA 4JHRA 3BEEA 3CKCA 2RFAA 4ANWA 4C0MA 4DI4A 5C1DA 4F1SA 2P9KG 3KAEA 2J4DA 4UQZA 3T9KA 2RKKA 3ZUVB 2GW1A 3UM1A 4A63B 2ZIRA 2B6CA 2XGSA 2JEKA 5JJ7A 3ULYA 1BI8B 1EYHA 3HDXA 2P9LG 3BQOA 2V5FA 2F37A 1TJCA 4ZHBA 4DRXE 1DCQA 3MGBA 3AU5A 4RLYA 4BTAA 4A55A 1IHBA 1Z3XA 4U7EB 2YHEA 4BEPA 5CMYA 2IO2C 2RFMA 4BX9A 1HH8A 4UUCA 3IHYA 5FZRA 3FUHA 3X2QE 3JXJA 2XGOA 4ACKA 3QNKA 3TXMA 3PH0C 2M63A 2J09A 3ISMC 3L82A 5FQ6A 5A6CA 4FHJA 1WG0A 3DSXA 3D9HA 3IXEA 2GRPB 3PNTB 1O1TA 3PE3A 5BW8C 4ANXA 2NYJA 3T5XA 4I2WA 3J5PA 4BTBA 4HBDA 4ACLA 3U3WA 1YCSB 3L13A 3NOCD 4B94A 3D9OA 4C0EA 4B8CB 3D9LA 5ENSD 1YYHA 5FIOA 1E8ZA 3CHQA 3ULQA 1FT1A 4LSZE 3B7BA 2PL2A 3L54A 4LNGA 5CEDB 4KVOA 3FU5A 3SI5A 4MRUA 2H6IA 1H6PA 3PZ1A 3CHPA 2IEJA 2LAIA 4I1OB 4FC8A 1BD8A 4GYOA 4LG6A 1ZB1A 4A3VA 4GA0A 3T5VA 4I1MA 2EIJE 3OTNA 2Y0BG 4I9CA 3NZUA 4HLLA 2X6HA 1RZ4A 3HXEA 4AV7A 5A23A 1Y6IA 3UM3A 3ASGA 5T4YA 2H6FA 4O1PA 4G8KA 3ABLE 5ARGA 4LCTA 4KZ0A 4NURA 3I4RB 3CK9A 3LS8A 2FO1E 4Q94A 3RRMB 4GA1A 3FUKA 1MYOA 1VDYA 3ZN3A 3ZEFA 3L17A 3JYSA 1N4QA 3RKVA 2HM8A 3B7SA 3NQPA 1KZPA 5EN5D 4F3VA 1OCRE 2X6IA 1H6KA 4OAUC 3C72A 2KXPC 5HS0A 4K5BA 4O6FA 2DIWA 3FH7A 4OVUA 5G05C 3CHOA 1HG5A 4GYYA 3NAWA 3NZSA 1OCCE 1DCEA 1TNBA 3AG1E 3DWLG 1K1BA 3E32A 1IQUA 3Q4AB 5D2MC 3LY8A 3AJIA 4CCAA 2YQ8A 3LEWA 3ZVVA 3ONKA 2QY7A 2XPYA 4APOA 5KJMA 4HNAD 3V2XA 4OAVB 1HF8A 3QK0A 2CFUA 1KT0A 4DX1A 3V79K 3TWTA 3FH5A 3JCKC 5EIDA 4UQYA 2XRYA 3TWXA 1E8WA 4W9RA 3ML9A 1BLXB 1ELRA 2IQCA 4CRWA 3FUFA 1X5BA 3RO2A 3MEKA 3RIBA 4TXPA 3UM0A 5G04C 5JHBA 4DUIA 1KT1A 2R02A 1LD7A 3FTUA 5EYLA 3PUKA 2V8SE 2WXIA 1INZA 4YVOA 3Q9NC 4BY6A 4GTOA 4GZCA 3CVPA 2VTBB 3ML8A 2HR2A 3L6AA 2ONDA 3EHMA 1E8XA 4JA9A 1D8DA 2I9CA 2FF4A 3FUDA 3FWVA 3ZYQA 4ATZD 2EILE 3FUEA 3CHMA 3JUIA 1NP7A 3CSTA 1KZOA 3SFXA 1TN7A 3QDNA 3CLJA 5KNGA 4CEMA 4GPKA 1TNYA 4GTRA 3AG2E 4GU5A 4CGVA 2QYJA 1X81A 4ANUA 3CVVA 4U0UA 3CHRA 1NA3A 3Q49B 2EINE 5ENNA 2VGXB 3C3QA 3DXMG 3E30A 4L1BA 4FLHA 5IY5E 2Y69E 3ZXSA 4MBGA 4JZYA 2R03A 3ASDA 3JQ1A 3EHRA 2VTBA 3UINC 5DIZA 3AS5A 2ETBA 2QC9A 3APCA 3QB2A 1QBQA 1OCZE 2UY1B 2BF0X 3HVEA 2WM9A 5A7DB 4HS2A 3FU6A 1EF1C 5C2YA 3MV3B 4HRNA 2KCKA 2LAHA 3ASHA 5JMND 4MS6A 4GYWA 1FT2A 2LUHA 3ZRHA 5T3RA 4U07A 3EU9A 2ZGDA 3O4ZA 3OXLA 4A3TA 3PS6A 2VSXE 3RAUA 4BT8A 3PUJA 2WQ7A 4CT0A 4AJWA 3L08A 2FULA 1HU3A 4UI9J 4M7CA 1OUVA 2P9IG 4TV3A 5FTPA 2VGXA 2J4BA 3FTYA 4K0RA 1S0PA 3RJVA 3ABKE 2GROB 4TXRA 4HRLA 2WPVA 2YNQA 4GMLA 2R17C 5KJLA 2WXMA 3D9JA 4Q96A 2KM4A 3ENEA 4DX7D 4JXTA 4B93B 3UT8A 3VLDA 4ME2A 2ETAA 4GPMA 4U96D 3LCAA 5AQ7A 3ZIMA 1UJKA 4YDEA 1BI7B 3NB2A 4HXIA 1HE8A 3RRNB 2ZU6B 5EX0A 3VLFA 1UG3A 5ARFA 3S7JA 3SBSA 1OWMA 1MHQA 3VTYA 2WQ6A 4FHKA 1V55E 3PEVB 4J8DA 4L7TA 5EDSA 2Y3AA 4JEUA 3VTXA 5KNHD 4K5AB 1DNPA 4FADA 5EILA 5FWQA 3Q5MA 2CHWA 1IYGA 5FQ8A 3ZNGA 4G2VA 3CSFA 3PZ3A 3FU3A 2FBNA 4I6EA 2L6JA 5ENTD 2Y4TA 4JB8P 2L9BA 4UWGA 1K3ZD 5KWDA 4HRMB 3FULA 1UW4B 3D9IA 3LVQE 2XEHA 2C0LA 5E75A 1PY1A 4P29A 3Q79A 3R7QA 4DX6D 4BX8A 4ZFHA 2P58C 1UOHA 5J08A 3LKUA 3E37A 4RG6A 4LERA 3N71A 2KZTB 5AJLA 3E4BA 2PQRA 3MJWA 3TG5A 2Y4UA 3G2VA 4RSYA 3D3MA 4RVBA 4J6IA 3TWWA 1TNUA 4UI9K 2DYSE 2XQ0A 3FTZA 2XHEA 3SBTB 1H2UA 2WXNA 4ANVA 4AY5A 1N9AA 3J5QB 3Q73A 5CERB 5D0OD 3WG7E 3DEPA 3MKRA 4J7WA 4KT6B 3QARA 5AQAA 2PNNA 3CEQA 2VSOE 4JA7A 5AQ9A 5HRYA 4BT9A 4AM9A 5HI7A 5EKQD 2GRNB 5ENQD 3ZHEB 4AP2A 1UJJA 4FLBA 3SNXA 4CGWA 3QAQA 3CKBA 4HI9A 2NXPA 2WQHA 4AY6A 2PZIA 5AAOA 1N54A 3IV0A 5ENOD 4CDNA 4V3IA 2MYOA 4KZCA 2IONA 1N4PA 2IOSA 4LEUA 4E6HA 3GYZA 2FI7A 3PRZA 3S7DA 3TWUA 2V5QC 4HB5A 2WVIA 2BTDA 3Q78A 2ZGGA 2ZXWE 2BKKB 3OXFA 2IJGX 1H6OA 3D9MA 3UX4A 5CBNA 2AXUA 2WXJA 1Z6TA 3GZ2A 4HOTA 2P9NG 2R59A 4GZ5A 3ZU7B 4EZJA 2CFZA 3UPVA 4DPRA 1OXJA 2PM7A 4F7AA 3ZPJA 1E7UA 3SFZA 4JVSA 2MHKA 3ZYKA 2DWZA 4IRUA 3TWSA 2EIKE 4I1AA 2LNIA 3B7UX 3HYMB 4K5CA 4KYOB 4XIFA 3UI2A 5KJKA 1N94A 3U9WA 2YHCA 4N2QA 3EJNA 2J08A 2C2LA 3MA5A 1L5JA 2DBAA 3QWWA 2I1JA 3Q15A 2X3MA 3RO3A 2AWIA 4GTPA 4OYSA 4R7LA 1G3NB 3EHQA 4NIKA 4XZ4A 5H7PA 4Y6WA 3FHEA 3B95A 4I43A 1SA5A 2J8SD 4XEIG 3URZA 1JWGA 4JPSA 4I9EA 1U2VG 2WXHA 4MKTA 1OWPA 3S2AA 4KBQA 1HZ4A 2Q7FA 1HXIA 3C3OA 5AENA 4HI8A 4JC8A 3EDTB 1A17A 1EPUA 2HE0A 4WUYA 1RW2A 2OEWA 4UQXA 2H6HA 5FQ4A 2GRQB 2GRLA 4G24A 4AOFA 2L0IA 1TYQG 4CDRA 4UWKA 1TEZA 3SQVA 3TL5A 1TR4A 2R5SA 2RG8A 4GMRA 5FT9A 3SO8A 2LXLA 1MX2A 3CVQA 4XI9A 4G11A 2XENA 2HYZA 3ULEG 4GTVA 4B8AA 3NBNB 3DPYA 1SZAA 4U8HA 2LSVA 4IN3B 1K8KG 2DCPA 3CVNA 1P5QA 5BPPA 3TAXA 5KBAA 3FP3A 3KEZA 3T8KA 1JCRA 2CHZA 4HQDA 4PS8A 1NZNA 4GB9A 5EX3A 3ZFWA 3CVWA 3FUNA 4DLQA 5ANLA 3QOUA 3UTMA 4XKCA 5JHAA 1GW6A 5LX8A 3MX3A 2IO3C 4EHMA 4H7YA 1A5EA 1SA4A 4NACA 1ELKA 5G55A 4J8SA 4BETA 2I2OA 1TNZA 3L9TA 3ZYLA 2XPIA 3KD7A 3W9FA 3BG0B 3APDA 4U04A 2X38A 4F53A 4FJZA 4YDWA 3TJPA 4DX5D 3D9NA 1B89A 2X6JA 5B3SE 1OWNA 1UN9A 3E33A 3P1UA 3RSEG 3RK6A 3QKYA
chains in the Genus database with same CATH topology
4EPZA 4FU3A 4XI0A 3UT8A 3VLDA 5FQ7A 4ME2A 4JL0A 3MGBA 3CQCB 3AU5A 1H2VC 4BTAA 4D10C 4A55A 1Z3XA 1N52A 3LCAA 3S7FA 2YHEA 5CMYA 4WWNA 3CQGB 3AS4A 3ASFA 4BX9A 1HH8A 4I2ZA 3ZIMA 4CDMA 1UJKA 3IHYA 2J49A 5FZRA 2XEVA 4AIFA 1JPLA 3CHSA 3PZDA 3AU4A 4GZ3A 3FUHA 4HXIA 2AW6A 4U0ZA 4UI9C 4K03A 1HE8A 3RRNB 1TJFA 4H7XA 2IFUA 2KCVA 2XGOA 2ZU6B 4U63A 5EX0A 2XPZA 4ACKA 4XE0A 3QWVA 3QNKA 4GA2A 3HIZA 3TXMA 3VLFA 3PH0C 5LCWJ 2M63A 3CK7A 1XNFA 1UG3A 2WXGA 3SF4A 2XRZA 2J09A 3MCXA 5ARFA 3S7JA 5FQ6A 5A6CA 4FHJA 4WWPA 2NSZA 4DLOA 3PNTB 3SBSA 1OWMA 3PE3A 1MHQA 5BW8C 2LSUA 3VTYA 2WQ6A 4ANXA 4FHKA 2VJ8A 3Q47B 3T5XA 3PEVB 4J8DA 4L7TA 5DBKA 4I2WA 2Y3AA 4FJYA 4JEUA 4HOUA 3VTXA 4DI3A 5EDSA 3SHFA 5M72A 1DNPA 4FADA 2WXQA 5FWQA 3Q5MA 1QZ2A 2C0MA 3ONLA 2CHWA 4G1TA 3R9AB 4BTBA 1IYGA 4ATGA 5FQ8A 4ACLA 2OVBA 4AXHA 3U3WA 4G2VA 3CSFA 3L13A 3C98A 3MKQB 1SZ9A 3FU3A 3RU0A 3ZGQA 2FBNA 4I6EA 4WNDA 4B94A 2L6JA 3D9OA 2Y4TA 1EDUA 4GZDA 4NRHB 3SGHA 2X6FA 2L9BA 4UWGA 4C0EA 4B8CB 3FEYA 1W3BA 3DBSA 3MZLB 3D9LA 4J0UA 3FULA 4PS3A 3IHVA 1UW4B 3TXNA 3D9IA 3U64A 1E8ZA 2WXPA 4WNFA 3CHQA 2WMOA 3ZYMA 3LVQE 4URKA 4JHJA 3ULQA 2J9QA 3FUIA 2C0LA 1PC2A 5E75A 4BWRA 1PY1A 2PL2A 4P29A 4RG9A 4M3OA 3L54A 4OVVA 3LXUX 4GAAA 3KS2A 1FCHA 3R7QA 4BX8A 3MV2B 2OV8A 2I1KA 2P58C 4KVOA 3FU5A 3SI5A 4MRUA 4EECA 1DVPA 4WAFA 2AXVA 4BFRA 3CHPA 3UQ3A 4JEHA 2KCLA 4EQFA 3LKUA 5J08A 2LAIA 4RG6A 4LERA 2VGYA 3N71A 2KZTB 4HOQA 4I1OB 2WXFA 3L22A 5AJLA 2XGMA 4U0SA 3E4BA 2PQRA 3MJWA 4FC8A 3TG5A 3CR3A 3MYVA 4GYOA 2Y4UA 3G2VA 3CIAA 4A3VA 4GA0A 3D3MA 4RSYA 2WB2A 2CG3A 3G2WA 3T5VA 4I1MA 4RVBA 4J6IA 3OTNA 2NC9A 4QFVA 4I9CA 4UWLA 3NZUA 3I3NA 4UI9K 3B7RL 1XGWA 3FH8A 5KCMA 5AJDA 2X6KA 2XQ0A 2X6HA 3FTZA 2XHEA 3SBTB 1HX8A 4GCNA 4AV7A 1H2UA 2WXRA 5G05J 1Y6IA 3LDZA 2WXNA 2RD0A 4ANVA 4AY5A 5A23A 5J90A 2GGFA 1OWOA 4PUCA 3R7RA 3ASGA 3UUXA 5D0OD 5T4YA 1HG2A 2WXKA 3HVEB 2AVPA 3MKRA 3NF1A 4KT6B 2FO7A 3QARA 5ARGA 4LCTA 4KVMA 4KZ0A 2UY1A 4NURA 3CEQA 3I4RB 4L2LA 4JHKA 2VSOE 3CK9A 3LS8A 5JJTA 3IBEA 4Q94A 4JA7A 4BT9A 4L2YA 3RRMB 3PNLB 4GA1A 4AM9A 3FUKA 5HI7A 5EKQD 1VDYA 3ZN3A 4YVQC 3ZEFA 4AEZC 3OXGA 3L17A 1H0AA 3ZHEB 4A1GA 1UJJA 4AP2A 4FLBA 3JYSA 4UWFA 2EQXA 3SNXA 4CGWA 4ILHB 2BUGA 3RKVA 3QAQA 5CCLA 2HM8A 3B7SA 4WNEA 3NQPA 3CKBA 3U4TA 2NXPA 5G2NA 4HOSA 4DJAA 4F3VA 2WQHA 4UWHA 4AY6A 2PZIA 2HO1A 4TUUA 4XX5A 1N54A 2X6IA 2AXZA 2WXLA 3IV0A 1H6KA 3T8MA 4CDNA 3GZSA 1JWFA 4V3IA 4KZCA 2IONA 2IOSA 2IF4A 4LEUA 4O6FA 1SQMA 4E6HA 3GYZA 3UT7A 5G04J 3QWPA 4PDXA 2DIWA 2FI7A 3FH7A 3PRZA 1FVFA 3S7DA 4OVUA 5G05C 3TG4A 2VSYA 3CHOA 4NQ0A 1HG5A 2E0IA 4HFGA 2WVIA 1QNFA 1U3DA 3NZSA 3LVRE 2BTDA 4GYYA 2UWJG 4FA6A 3PDNA 3OXFA 3B13A 2IJGX 2I6HA 3LY7A 4GMJA 3EIQC 5JJ6A 1IQUA 4ABNA 1E90A 3K9IA 3Q4AB 3JQ0A 3D9MA 3LY8A 4CCAA 3UX4A 1UN8A 2AXUA 2WXJA 2YQ8A 3LEWA 4TRQA 4Y6CA 5LFAA 3FU0A 3ZVVA 2PQNA 2IU1A 1Z6TA 3GZ2A 3ONKA 3FUJA 5T8IA 2XPYA 2QY7A 2OOEA 4HOTA 2R59A 4GZ5A 2VSNA 4APOA 3U66A 4EZJA 2CFZA 5KJMA 2KC7A 2PM6A 4FP7A 4DPRA 3UPVA 2PM7A 1HF8A 4F7AA 3QK0A 3ZPJA 1E7UA 3SFZA 1E96B 4B0ZA 4WNGA 2CFUA 4JVSA 1KT0A 1ZBPA 1H2TC 2MHKA 3ZYKA 3FH5A 3JCKC 4IRUA 4IULA 1IQRA 3ZW3A 5KJNA 5LOZA 4EBAA 4I1AA 2LNIA 4I6JA 1PAQA 4UQYA 2XRYA 3LPZA 1E8WA 5D0QD 4W9RA 3ML9A 3CVXA 3B7UX 3HYMB 1ELRA 2IQCA 4KYOB 4CRWA 4XIFA 3FUFA 3PVLA 4CT4A 3FTWA 5KJKA 1X5BA 3RO2A 3MEKA 4Q69A 3LYAA 2YINA 4J8EA 4N3CA 3RIBA 3U9WA 2YHCA 2IOLA 4FULA 5G04C 5JHBA 4N2QA 1KT1A 3EJNA 2J08A 4LRZA 2C2LA 3FTUA 4G26A 3WXXA 3MA5A 1L5JA 3PUKA 2V8SE 2WXIA 3D9KA 2A4ZA 2DBAA 3QWWA 3VLEA 1INZA 4YVOA 2OVFA 2I1JA 4IYPA 4BY6A 3Q15A 2X3MA 3RO3A 1LF8A 2AWIA 4OYSA 4R7LA 4APFA 4GZCA 4B89A 3CVPA 2VTBB 3TGOA 4XZ4A 3ML8A 2HR2A 3CGHA 4Y6WA 3FHEA 1QQEA 3L6AA 1NA0A 4N3AA 5AYWD 2ONDA 4YNDA 3EHMA 4N2SA 1E8XA 3ESLA 3CVUA 4I43A 4JA9A 2WMNA 3URZA 2I9CA 2FF4A 3FUDA 4EBAG 1JWGA 3FWVA 3ZYQA 4KMOA 2XCCA 5BV0A 4JPSA 5HQ8A 3FUEA 4I9EA 2XCBA 3CHMA 3I5PA 3FTSA 3LJ3A 4KXKB 3MKQA 1WY6A 1OWLA 3G2TA 3FUMA 3QC1A 3JUIA 5BT1A 1NP7A 2WXHA 1HS6A 4MKTA 3FY4A 3CSTA 1H19A 1OWPA 3PREA 4N5CA 3S2AA 3G2UA 4ILGA 4KBQA 1HZ4A 2Q7FA 4N39A 1HXIA 2FEZA 5FJYA 5CCMA 1ELWA 3EIJA 3QDNA 3CLJA 4CEMA 3P2BA 5AENA 4GPKA 1HFAA 4JC8A 4GU5A 4CGVA 3EDTB 1A17A 1EPUA 3UMVA 1HO8A 2A5UA 3SD5A 4WUYA 1U3CA 4J8FA 4ANUA 4UQXA 3CVVA 3APFA 1WM5A 4U0UA 3CHRA 5FQ4A 1NA3A 1Z3YA 2GRLA 3HHMA 3CV0A 3Q49B 4HLEA 4G24A 4AOFA 2L0IA 2L0TB 2V4LA 3IKOB 5ENNA 5FZSA 4C9BB 5LP0A 2MOWA 3UT4A 1YA0A 2VGXB 3SZ7A 2E2EA 3DPDA 4UWKA 4CDRA 1TEZA 3RRUA 3TL5A 2KZTA 3PE4A 4L1BA 3BG1B 4HVBA 4FLHA 2R5SA 2RG8A 4N3BA 5FT9A 1MQSA 4JW1A 4DK5A 1KLXA 3ZXSA 4MLPA 2V0PA 3L16A 4JZYA 3CVQA 5BUZA 3AS8A 4XI9A 1JUQA 4G25A 4E85A 4G11A 2LO6A 2HYZA 2MRIA 4PS7A 3ASDA 3JQ1A 5FZQA 1WAO1 4AVXA 4B8AA 3PEUB 2VTBA 1IHGA 3OAWA 5CHEE 5DIZA 1SZAA 4BSXA 4U8HA 5AIJA 2LSVA 3AS5A 3IEGA 4IN3B 3APCA 3QB2A 2DCPA 2JLBA 1E8YA 3CVNA 4G23A 1P5QA 4GZ6A 4I6GA 3B7TA 3GW4A 4HORA 2UY1B 2VYIA 4A1SA 2BF0X 5BPPA 3CVYA 4XKBA 3HVEA 4WWOA 3S7BA 2WM9A 3TAXA 5A7DB 4HS2A 3FU6A 1EF1C 3GZ1A 5C2YA 3MV3B 3FP3A 3FFLA 2KCKA 2LAHA 3KEZA 3ASHA 4L23A 5CMWA 4MS6A 3D9PA 5ANRA 3O48A 3FTXA 3LY9A 2CHZA 3G2SA 2CG2A 4GYWA 1FVHA 3I4GA 3EHNA 4PS8A 3FDHA 1NZNA 3ZRHA 1ZU2A 1BPOA 5T3RA 4U07A 4GB9A 4PH4B 5EX3A 3ZFWA 3CVWA 2QFCA 3FUNA 3ZHEA 4DLQA 5ANLA 3O4ZA 5BNWA 3QOUA 4XKCA 3OXLA 4A3TA 5JHAA 1GW6A 5LX8A 3MX3A 3PS6A 2VSXE 2ILRA 4BT8A 4H7YA 3ESKA 3PUJA 2KATA 2WQ7A 4CT0A 4NACA 5LCWC 1ELKA 4JHRA 4AJWA 3BEEA 3L08A 3CKCA 4J8SA 5G55A 4ANWA 4C0MA 4DI4A 4EZLA 5C1DA 2FULA 2I2OA 4F1SA 3FEXA 3KAEA 3ZYLA 2J4DA 2XPIA 1HU3A 3KD7A 4UI9J 3QJZA 4UQZA 1OUVA 1Y8MA 2GW1A 4TV3A 5FTPA 2VGXA 3BG0B 2J4BA 3FTYA 4ILIA 1S0PA 3APDA 4K0RA 2X38A 4U04A 5E76A 3RJVA 3CVLA 1E7VA 4LUNU 4F53A 4GCOA 2J07A 4FJZA 3CK8A 2XGSA 2JEKA 2WPVA 5JJ7A 2YNQA 4GMLA 2R17C 3TJPA 3D9NA 5KJLA 1B89A 5BV1A 2X6JA 2GRMA 2CHXA 1OWNA 2WXMA 3D9JA 4Q96A 1EYHA 1UN9A 3HDXA 2V5FA 2KM4A 3ENEA 3P1UA 1TJCA 4I17A 3RK6A 3FTVA 3QKYA 4JXTA 4EZKA 2VQ2A 2WXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XI0 A;  4ME2 A;  4JL0 A;  4BTA A;  3LCA A;  3S7F A;  3AS4 A;  3ASF A;  1HH8 A;  4I2Z A;  5FZR A;  2XEV A;  4AIF A;  4GZ3 A;  4U0Z A;  4UI9 C;  4H7X A;  2IFU A;  2KCV A;  2XGO A;  5EX0 A;  3QWV A;  4GA2 A;  5LCW J;  3CK7 A;  1XNF A;  3SF4 A;  5ARF A;  3S7J A;  5A6C A;  3PE3 A;  5BW8 C;  3VTY A;  2LSU A;  3Q47 B;  4J8D A;  5DBK A;  4I2W A;  4HOU A;  3VTX A;  5M72 A;  3Q5M A;  1QZ2 A;  2C0M A;  1IYG A;  4G1T A;  3R9A B;  4BTB A;  3U3W A;  4G2V A;  3ZGQ A;  2FBN A;  4WND A;  4B94 A;  2L6J A;  2Y4T A;  4NRH B;  1W3B A;  4J0U A;  4WNF A;  3ULQ A;  2J9Q A;  2C0L A;  1PC2 A;  4BWR A;  2PL2 A;  4RG9 A;  3KS2 A;  1FCH A;  3MV2 B;  2P58 C;  3UQ3 A;  2KCL A;  4EQF A;  3LKU A;  4RG6 A;  2VGY A;  3N71 A;  4HOQ A;  2XGM A;  4U0S A;  3E4B A;  2PQR A;  3TG5 A;  4GYO A;  2Y4U A;  4GA0 A;  2NC9 A;  4I9C A;  4UI9 K;  4GCN A;  5G05 J;  4AY5 A;  3ASG A;  3UUX A;  5D0O D;  2AVP A;  3MKR A;  3NF1 A;  2FO7 A;  5ARG A;  2UY1 A;  3CEQ A;  5JJT A;  3CK9 A;  4JA7 A;  4BT9 A;  4GA1 A;  4AM9 A;  5HI7 A;  5EKQ D;  3ZN3 A;  4YVQ C;  3OXG A;  3ZHE B;  3JYS A;  4CGW A;  2BUG A;  3RKV A;  5CCL A;  4WNE A;  3CKB A;  3U4T A;  4HOS A;  4F3V A;  2WQH A;  4AY6 A;  2PZI A;  2HO1 A;  2IF4 A;  4LEU A;  4O6F A;  3GYZ A;  5G04 J;  3QWP A;  2FI7 A;  3S7D A;  5G05 C;  3TG4 A;  2VSY A;  4NQ0 A;  4GYY A;  2UWJ G;  3PDN A;  3OXF A;  2I6H A;  3LY7 A;  5JJ6 A;  4ABN A;  3K9I A;  3Q4A B;  3LY8 A;  2YQ8 A;  4Y6C A;  2PQN A;  3GZ2 A;  4HOT A;  2OOE A;  4GZ5 A;  2VSN A;  4APO A;  5KJM A;  2KC7 A;  3UPV A;  3ZPJ A;  1E96 B;  4WNG A;  1KT0 A;  1ZBP A;  2MHK A;  5KJN A;  4I1A A;  2LNI A;  4UQY A;  3LPZ A;  5D0Q D;  4W9R A;  3HYM B;  1ELR A;  4KYO B;  4XIF A;  5KJK A;  3RO2 A;  3MEK A;  3LYA A;  4J8E A;  4N3C A;  3RIB A;  2YHC A;  5G04 C;  4N2Q A;  1KT1 A;  2C2L A;  4G26 A;  3WXX A;  3MA5 A;  2DBA A;  3QWW A;  4YVO A;  3Q15 A;  3RO3 A;  3CVP A;  3TGO A;  2HR2 A;  4Y6W A;  5AYW D;  1QQE A;  1NA0 A;  4N3A A;  2OND A;  4YND A;  4N2S A;  4JA9 A;  3URZ A;  2FF4 A;  3FWV A;  2XCC A;  5HQ8 A;  4I9E A;  2XCB A;  4KXK B;  5BT1 A;  4N5C A;  4KBQ A;  1HZ4 A;  2Q7F A;  4N39 A;  1HXI A;  2FEZ A;  5FJY A;  5CCM A;  1ELW A;  3QDN A;  4GPK A;  4CGV A;  3EDT B;  1A17 A;  4WUY A;  4J8F A;  4UQX A;  1WM5 A;  4U0U A;  1NA3 A;  3CV0 A;  3Q49 B;  4G24 A;  5FZS A;  1YA0 A;  2VGX B;  3SZ7 A;  2E2E A;  4CDR A;  3PE4 A;  2R5S A;  4N3B A;  5FT9 A;  1KLX A;  3CVQ A;  3AS8 A;  4XI9 A;  4G25 A;  2HYZ A;  3ASD A;  5FZQ A;  1WAO 1;  1IHG A;  5CHE E;  5DIZ A;  2LSV A;  3AS5 A;  3IEG A;  4IN3 B;  3RU0 A;  2JLB A;  3CVN A;  4G23 A;  1P5Q A;  4GZ6 A;  3GW4 A;  4HOR A;  2UY1 B;  2VYI A;  4A1S A;  3S7B A;  3TAX A;  5A7D B;  3GZ1 A;  3MV3 B;  3FP3 A;  3FFL A;  2KCK A;  3ASH A;  3O48 A;  3LY9 A;  4GYW A;  1NZN A;  1ZU2 A;  4U07 A;  5EX3 A;  3ZFW A;  2QFC A;  3ZHE A;  5BNW A;  3QOU A;  3OXL A;  4BT8 A;  4H7Y A;  3ESK A;  2KAT A;  5LCW C;  4JHR A;  3BEE A;  3CKC A;  5C1D A;  3KAE A;  2XPI A;  3KD7 A;  4UI9 J;  4UQZ A;  1OUV A;  1Y8M A;  2GW1 A;  5FTP A;  2VGX A;  4U04 A;  3RJV A;  3CVL A;  4GCO A;  3CK8 A;  2XGS A;  2WPV A;  5JJ7 A;  5KJL A;  1B89 A;  2V5F A;  1TJC A;  4I17 A;  3QKY A;  2VQ2 A; 
#chains in the Genus database with same CATH topology
 4EPZ A;  4XI0 A;  1N11 A;  4YDY A;  3CQC B;  1H2V C;  3NOG D;  4D10 C;  1N52 A;  5AQB A;  3S7F A;  4WWN A;  3ZKJ A;  3CQG B;  3ASF A;  4I2Z A;  4CDM A;  2P9S G;  3CHS A;  2ZIS A;  4UI9 C;  4K03 A;  4Z68 A;  1K1A A;  1O5M A;  2XPZ A;  4XE0 A;  3QWV A;  4GA2 A;  2L6B A;  3CK7 A;  2WXG A;  3MCX A;  1S70 B;  3ZXP A;  2NSZ A;  4DLO A;  2LSU A;  1O1R A;  2VJ8 A;  3Q47 B;  1N4R A;  4DI3 A;  1TN8 A;  4HOU A;  2WXQ A;  1QZ2 A;  4BES A;  4G1T A;  3R9A B;  4ATG A;  1V54 E;  3MKQ B;  3ZGQ A;  3EUV A;  4WND A;  3DXK G;  1EDU A;  4U95 D;  4NRH B;  5BXO A;  2X6F A;  1D8E A;  1W3B A;  4J0U A;  4PS3 A;  2WXP A;  4WNF A;  2P9P G;  1N0Q A;  2P9U G;  1PC2 A;  4BWR A;  1Q2Z A;  4M3O A;  3LXU X;  3KS2 A;  1SW6 A;  2OV8 A;  1TN6 A;  1DVP A;  2AXV A;  4LNB A;  4HOQ A;  2WXF A;  3L22 A;  2XGM A;  2WB2 A;  2XZT G;  1IXV A;  3ASN E;  3TWR A;  5KCM A;  4TUM A;  4GCN A;  4EZL A;  3Q7F A;  2RD0 A;  2GGF A;  1HG2 A;  3LJN A;  3NF1 A;  4KVM A;  2UY1 A;  4L2L A;  4JHK A;  5JJT A;  2XZD G;  4L2Y A;  3PNL B;  4YVQ C;  4AEZ C;  3OXG A;  4A1G A;  2JAB A;  4UWF A;  2EQX A;  4O60 A;  1QYM A;  4ILH B;  4QQI A;  5HKP A;  2AJA A;  4CYM D;  4DJA A;  4UWH A;  4TUU A;  5BXU A;  2WXL A;  3T8M A;  3GZS A;  1SQM A;  3UT7 A;  3QWP A;  4PDX A;  5EYP F;  2VSY A;  4NQ0 A;  4HFG A;  1QNF A;  3LVR E;  2UWJ G;  3B13 A;  2I6H A;  3EIQ C;  5JJ6 A;  1E90 A;  1IKN D;  2F8Y A;  1NL4 A;  1TNO A;  4Y6C A;  5LFA A;  3FU0 A;  2PQN A;  5T8I A;  2OOE A;  2VSN A;  3U66 A;  3EU5 A;  2KC7 A;  2PM6 A;  1E96 B;  4U8V D;  1ZBP A;  3ZW3 A;  1IQR A;  5KJN A;  5LOZ A;  1Z5S C;  4EBA A;  1PAQ A;  1SVX A;  2GRR B;  3LPZ A;  2R2L A;  5D0Q D;  4CT4 A;  4GTQ A;  3FTW A;  3LYA A;  4RQI A;  1KPS B;  3HXD A;  3WXX A;  2A4Z A;  2OVF A;  3HG0 D;  4IYP A;  1JCQ A;  1LF8 A;  3F6Q A;  3TGO A;  5AYW D;  3PZ2 A;  1NA0 A;  4N2S A;  3ESL A;  1MJ0 A;  2XCC A;  2XCB A;  2XS8 A;  3I5P A;  3FTS A;  4KXK B;  3AG4 E;  1OWL A;  5BT1 A;  3FY4 A;  3PRE A;  4N5C A;  4ILG A;  4N39 A;  5CCM A;  5FJY A;  1N4S A;  3EIJ A;  3P2B A;  1HFA A;  2IY0 C;  1HO8 A;  3SD5 A;  3APF A;  3HHM A;  3CV0 A;  4HLE A;  5FZS A;  3IKO B;  4C9B B;  4O1O A;  3UT4 A;  1YA0 A;  2E2E A;  3DPD A;  2H6G A;  3UIO C;  3RRU A;  2KZT A;  3BG1 B;  4HVB A;  2A5E A;  4N3B A;  1MQS A;  1KLX A;  2V0P A;  3L16 A;  5BUZ A;  2DYR E;  4JD2 G;  1JUQ A;  2MRI A;  4PS7 A;  4BER A;  4AVX A;  1WAO 1;  3PEU B;  3OAW A;  3JUE A;  4BSX A;  5AIJ A;  4CZ2 D;  3RU0 A;  4I6G A;  5ITZ F;  1FPP A;  4HOR A;  4XKB A;  3GZ1 A;  3SY2 A;  1MZC A;  4L23 A;  2R05 A;  3FTX A;  3LY9 A;  3DST A;  2CG2 A;  3TWV A;  3EHN A;  1ZU2 A;  1BPO A;  3UIP C;  3ZHE A;  5FIN A;  5ENP D;  4DX2 A;  1AWC B;  3ESK A;  5LCW C;  4YDO A;  3E34 A;  3FEX A;  2V4H C;  3QJZ A;  3KEA A;  4F1P A;  1Y8M A;  4ILI A;  5E76 A;  3CVL A;  1E7V A;  2OCC E;  2XEE A;  4LUN U;  4GCO A;  2J07 A;  3CK8 A;  3UKU G;  1JCS A;  5BV1 A;  2GRM A;  2CHX A;  4C48 B;  4I17 A;  3FTV A;  4EZK A;  2VQ2 A;  2WXO A;  4X8Q A;  3KSL A;  4FU3 A;  5FQ7 A;  3V2O A;  4JL0 A;  3C5R A;  3AS4 A;  2J49 A;  2XEV A;  4AIF A;  1JPL A;  3PZD A;  3AU4 A;  4GZ3 A;  2AW6 A;  3TWQ A;  4U0Z A;  3AAA C;  1TJF A;  4H7X A;  2IFU A;  2KCV A;  4U63 A;  2LXM A;  2QZA A;  3HIZ A;  1OT8 A;  5LCW J;  2XRZ A;  1XNF A;  3SF4 A;  3BU8 A;  3PZ4 A;  4WWP A;  1N95 A;  3DEO A;  2ETC A;  1WDY A;  2QYU A;  2BKG A;  5DBK A;  4FJY A;  5M72 A;  3SHF A;  2C0M A;  3ONL A;  2OVB A;  4AXH A;  3C98 A;  1SZ9 A;  3Q9U C;  4GZD A;  3SGH A;  3FEY A;  2F0Y A;  3DBS A;  3MZL B;  2KBX A;  4GTM A;  3IHV A;  3TXN A;  3U64 A;  2WMO A;  3ZYM A;  4URK A;  1O1S A;  3Q75 A;  4GTS A;  4JHJ A;  2J9Q A;  3FUI A;  3BUA A;  4RG9 A;  4OVV A;  4GAA A;  1FCH A;  3MV2 B;  2I1K A;  2P2C P;  4EEC A;  4WAF A;  4BFR A;  3UQ3 A;  4JEH A;  2KCL A;  4EQF A;  2VGY A;  3UM2 A;  4U0S A;  3CR3 A;  3MYV A;  3CIA A;  3DSU A;  2CG3 A;  3G2W A;  2NC9 A;  4QFV A;  1N0R A;  5CEC B;  4U8Y D;  4UWL A;  3I3N A;  3B7R L;  1XGW A;  3FH8 A;  5AJD A;  2X6K A;  1NFI E;  1HX8 A;  2WXR A;  5G05 J;  3LDZ A;  5J90 A;  1YMP A;  1OWO A;  3ASO E;  4PUC A;  3R7R A;  3UUX A;  2WXK A;  3HVE B;  2AVP A;  2F8X K;  2FO7 A;  4BSZ B;  1DC2 A;  3HXB A;  3IBE A;  5AN8 A;  3V31 A;  1H0A A;  4GTT A;  2BUG A;  5CCL A;  4WNE A;  3DRA A;  3U4T A;  5G2N A;  4HOS A;  4G8L A;  2HO1 A;  4XX5 A;  3Q7A A;  2AXZ A;  5CRU A;  5D66 A;  1JWF A;  2DZO A;  2IF4 A;  4F6R D;  2OEV A;  5G04 J;  1FVF A;  3TG4 A;  2E0I A;  1U3D A;  4FA6 A;  3PDN A;  3UXG A;  4GMJ A;  3LY7 A;  4ABN A;  3K9I A;  4LNU D;  3JQ0 A;  1NI1 A;  3KSQ A;  1UN8 A;  4TRQ A;  3HXC A;  4N5Q A;  2IU1 A;  1D9S A;  3FUJ A;  5CRV A;  4FP7 A;  1LTX A;  4B0Z A;  4WNG A;  5CEA A;  5B1B E;  1H2T C;  2BED A;  4IUL A;  2XS1 A;  4I6J A;  3R9M A;  4J8Y A;  3CVX A;  2DZN A;  2DVW A;  3PVL A;  1S64 A;  4Q69 A;  4N3C A;  2YIN A;  4J8E A;  2IOL A;  5ENR D;  1MX4 A;  4FUL A;  5B1A E;  4LRZ A;  5AAR A;  3DSV A;  4G26 A;  1LD8 A;  3D9K A;  3VLE A;  3UKR G;  3AG3 E;  4APF A;  4B89 A;  1OCO E;  4L9P A;  3CGH A;  1QQE A;  4N3A A;  4YND A;  3CVU A;  3HXF A;  2WMN A;  4EBA G;  4KMO A;  3V30 A;  5BV0 A;  5HQ8 A;  3LJ3 A;  3MKQ A;  1WY6 A;  3G2T A;  3FUM A;  3QC1 A;  1HS6 A;  1H19 A;  3G2U A;  2FEZ A;  1ELW A;  3SFY A;  5JA4 D;  3UMV A;  2A5U A;  1U3C A;  4J8F A;  3C3R A;  2B0O E;  3DSW A;  3W9G A;  1WM5 A;  1Z3Y A;  2L0T B;  2V4L A;  5LP0 A;  2MOW A;  3DSS A;  3SZ7 A;  1BU9 A;  3PE4 A;  2VGE A;  4JW1 A;  4DK5 A;  4MLP A;  5EIB E;  3AS8 A;  4G25 A;  4E85 A;  3JXI A;  4TXQ A;  2LO6 A;  5FZQ A;  1IHG A;  5CHE E;  2Y1L E;  2EIM E;  3IEG A;  1MX6 A;  2JLB A;  4G23 A;  1E8Y A;  4GZ6 A;  3B7T A;  3GW4 A;  2VYI A;  4A1S A;  3CVY A;  3S7B A;  4WWO A;  1S63 A;  5CBO A;  3FFL A;  5CMW A;  3D9P A;  5ANR A;  3O48 A;  3G2S A;  1FVH A;  3I4G A;  3FDH A;  1OY3 D;  4PH4 B;  2QFC A;  5BNW A;  1AP7 A;  3HRA A;  2ILR A;  3ABM E;  2KAT A;  4JHR A;  3BEE A;  3CKC A;  2RFA A;  4ANW A;  4C0M A;  4DI4 A;  5C1D A;  4F1S A;  2P9K G;  3KAE A;  2J4D A;  4UQZ A;  3T9K A;  2RKK A;  3ZUV B;  2GW1 A;  3UM1 A;  4A63 B;  2ZIR A;  2B6C A;  2XGS A;  2JEK A;  5JJ7 A;  3ULY A;  1BI8 B;  1EYH A;  3HDX A;  2P9L G;  3BQO A;  2V5F A;  2F37 A;  1TJC A;  4ZHB A;  4DRX E;  1DCQ A;  3MGB A;  3AU5 A;  4RLY A;  4BTA A;  4A55 A;  1IHB A;  1Z3X A;  4U7E B;  2YHE A;  4BEP A;  5CMY A;  2IO2 C;  2RFM A;  4BX9 A;  1HH8 A;  4UUC A;  3IHY A;  5FZR A;  3FUH A;  3X2Q E;  3JXJ A;  2XGO A;  4ACK A;  3QNK A;  3TXM A;  3PH0 C;  2M63 A;  2J09 A;  3ISM C;  3L82 A;  5FQ6 A;  5A6C A;  4FHJ A;  1WG0 A;  3DSX A;  3D9H A;  3IXE A;  2GRP B;  3PNT B;  1O1T A;  3PE3 A;  5BW8 C;  4ANX A;  2NYJ A;  3T5X A;  4I2W A;  3J5P A;  4BTB A;  4HBD A;  4ACL A;  3U3W A;  1YCS B;  3L13 A;  3NOC D;  4B94 A;  3D9O A;  4C0E A;  4B8C B;  3D9L A;  5ENS D;  1YYH A;  5FIO A;  1E8Z A;  3CHQ A;  3ULQ A;  1FT1 A;  4LSZ E;  3B7B A;  2PL2 A;  3L54 A;  4LNG A;  5CED B;  4KVO A;  3FU5 A;  3SI5 A;  4MRU A;  2H6I A;  1H6P A;  3PZ1 A;  3CHP A;  2IEJ A;  2LAI A;  4I1O B;  4FC8 A;  1BD8 A;  4GYO A;  4LG6 A;  1ZB1 A;  4A3V A;  4GA0 A;  3T5V A;  4I1M A;  2EIJ E;  3OTN A;  2Y0B G;  4I9C A;  3NZU A;  4HLL A;  2X6H A;  1RZ4 A;  3HXE A;  4AV7 A;  5A23 A;  1Y6I A;  3UM3 A;  3ASG A;  5T4Y A;  2H6F A;  4O1P A;  4G8K A;  3ABL E;  5ARG A;  4LCT A;  4KZ0 A;  4NUR A;  3I4R B;  3CK9 A;  3LS8 A;  2FO1 E;  4Q94 A;  3RRM B;  4GA1 A;  3FUK A;  1MYO A;  1VDY A;  3ZN3 A;  3ZEF A;  3L17 A;  3JYS A;  1N4Q A;  3RKV A;  2HM8 A;  3B7S A;  3NQP A;  1KZP A;  5EN5 D;  4F3V A;  1OCR E;  2X6I A;  1H6K A;  4OAU C;  3C72 A;  2KXP C;  5HS0 A;  4K5B A;  4O6F A;  2DIW A;  3FH7 A;  4OVU A;  5G05 C;  3CHO A;  1HG5 A;  4GYY A;  3NAW A;  3NZS A;  1OCC E;  1DCE A;  1TNB A;  3AG1 E;  3DWL G;  1K1B A;  3E32 A;  1IQU A;  3Q4A B;  5D2M C;  3LY8 A;  3AJI A;  4CCA A;  2YQ8 A;  3LEW A;  3ZVV A;  3ONK A;  2QY7 A;  2XPY A;  4APO A;  5KJM A;  4HNA D;  3V2X A;  4OAV B;  1HF8 A;  3QK0 A;  2CFU A;  1KT0 A;  4DX1 A;  3V79 K;  3TWT A;  3FH5 A;  3JCK C;  5EID A;  4UQY A;  2XRY A;  3TWX A;  1E8W A;  4W9R A;  3ML9 A;  1BLX B;  1ELR A;  2IQC A;  4CRW A;  3FUF A;  1X5B A;  3RO2 A;  3MEK A;  3RIB A;  4TXP A;  3UM0 A;  5G04 C;  5JHB A;  4DUI A;  1KT1 A;  2R02 A;  1LD7 A;  3FTU A;  5EYL A;  3PUK A;  2V8S E;  2WXI A;  1INZ A;  4YVO A;  3Q9N C;  4BY6 A;  4GTO A;  4GZC A;  3CVP A;  2VTB B;  3ML8 A;  2HR2 A;  3L6A A;  2OND A;  3EHM A;  1E8X A;  4JA9 A;  1D8D A;  2I9C A;  2FF4 A;  3FUD A;  3FWV A;  3ZYQ A;  4ATZ D;  2EIL E;  3FUE A;  3CHM A;  3JUI A;  1NP7 A;  3CST A;  1KZO A;  3SFX A;  1TN7 A;  3QDN A;  3CLJ A;  5KNG A;  4CEM A;  4GPK A;  1TNY A;  4GTR A;  3AG2 E;  4GU5 A;  4CGV A;  2QYJ A;  1X81 A;  4ANU A;  3CVV A;  4U0U A;  3CHR A;  1NA3 A;  3Q49 B;  2EIN E;  5ENN A;  2VGX B;  3C3Q A;  3DXM G;  3E30 A;  4L1B A;  4FLH A;  5IY5 E;  2Y69 E;  3ZXS A;  4MBG A;  4JZY A;  2R03 A;  3ASD A;  3JQ1 A;  3EHR A;  2VTB A;  3UIN C;  5DIZ A;  3AS5 A;  2ETB A;  2QC9 A;  3APC A;  3QB2 A;  1QBQ A;  1OCZ E;  2UY1 B;  2BF0 X;  3HVE A;  2WM9 A;  5A7D B;  4HS2 A;  3FU6 A;  1EF1 C;  5C2Y A;  3MV3 B;  4HRN A;  2KCK A;  2LAH A;  3ASH A;  5JMN D;  4MS6 A;  4GYW A;  1FT2 A;  2LUH A;  3ZRH A;  5T3R A;  4U07 A;  3EU9 A;  2ZGD A;  3O4Z A;  3OXL A;  4A3T A;  3PS6 A;  2VSX E;  3RAU A;  4BT8 A;  3PUJ A;  2WQ7 A;  4CT0 A;  4AJW A;  3L08 A;  2FUL A;  1HU3 A;  4UI9 J;  4M7C A;  1OUV A;  2P9I G;  4TV3 A;  5FTP A;  2VGX A;  2J4B A;  3FTY A;  4K0R A;  1S0P A;  3RJV A;  3ABK E;  2GRO B;  4TXR A;  4HRL A;  2WPV A;  2YNQ A;  4GML A;  2R17 C;  5KJL A;  2WXM A;  3D9J A;  4Q96 A;  2KM4 A;  3ENE A;  4DX7 D;  4JXT A;  4B93 B;  3UT8 A;  3VLD A;  4ME2 A;  2ETA A;  4GPM A;  4U96 D;  3LCA A;  5AQ7 A;  3ZIM A;  1UJK A;  4YDE A;  1BI7 B;  3NB2 A;  4HXI A;  1HE8 A;  3RRN B;  2ZU6 B;  5EX0 A;  3VLF A;  1UG3 A;  5ARF A;  3S7J A;  3SBS A;  1OWM A;  1MHQ A;  3VTY A;  2WQ6 A;  4FHK A;  1V55 E;  3PEV B;  4J8D A;  4L7T A;  5EDS A;  2Y3A A;  4JEU A;  3VTX A;  5KNH D;  4K5A B;  1DNP A;  4FAD A;  5EIL A;  5FWQ A;  3Q5M A;  2CHW A;  1IYG A;  5FQ8 A;  3ZNG A;  4G2V A;  3CSF A;  3PZ3 A;  3FU3 A;  2FBN A;  4I6E A;  2L6J A;  5ENT D;  2Y4T A;  4JB8 P;  2L9B A;  4UWG A;  1K3Z D;  5KWD A;  4HRM B;  3FUL A;  1UW4 B;  3D9I A;  3LVQ E;  2XEH A;  2C0L A;  5E75 A;  1PY1 A;  4P29 A;  3Q79 A;  3R7Q A;  4DX6 D;  4BX8 A;  4ZFH A;  2P58 C;  1UOH A;  5J08 A;  3LKU A;  3E37 A;  4RG6 A;  4LER A;  3N71 A;  2KZT B;  5AJL A;  3E4B A;  2PQR A;  3MJW A;  3TG5 A;  2Y4U A;  3G2V A;  4RSY A;  3D3M A;  4RVB A;  4J6I A;  3TWW A;  1TNU A;  4UI9 K;  2DYS E;  2XQ0 A;  3FTZ A;  2XHE A;  3SBT B;  1H2U A;  2WXN A;  4ANV A;  4AY5 A;  1N9A A;  3J5Q B;  3Q73 A;  5CER B;  5D0O D;  3WG7 E;  3DEP A;  3MKR A;  4J7W A;  4KT6 B;  3QAR A;  5AQA A;  2PNN A;  3CEQ A;  2VSO E;  4JA7 A;  5AQ9 A;  5HRY A;  4BT9 A;  4AM9 A;  5HI7 A;  5EKQ D;  2GRN B;  5ENQ D;  3ZHE B;  4AP2 A;  1UJJ A;  4FLB A;  3SNX A;  4CGW A;  3QAQ A;  3CKB A;  4HI9 A;  2NXP A;  2WQH A;  4AY6 A;  2PZI A;  5AAO A;  1N54 A;  3IV0 A;  5ENO D;  4CDN A;  4V3I A;  2MYO A;  4KZC A;  2ION A;  1N4P A;  2IOS A;  4LEU A;  4E6H A;  3GYZ A;  2FI7 A;  3PRZ A;  3S7D A;  3TWU A;  2V5Q C;  4HB5 A;  2WVI A;  2BTD A;  3Q78 A;  2ZGG A;  2ZXW E;  2BKK B;  3OXF A;  2IJG X;  1H6O A;  3D9M A;  3UX4 A;  5CBN A;  2AXU A;  2WXJ A;  1Z6T A;  3GZ2 A;  4HOT A;  2P9N G;  2R59 A;  4GZ5 A;  3ZU7 B;  4EZJ A;  2CFZ A;  3UPV A;  4DPR A;  1OXJ A;  2PM7 A;  4F7A A;  3ZPJ A;  1E7U A;  3SFZ A;  4JVS A;  2MHK A;  3ZYK A;  2DWZ A;  4IRU A;  3TWS A;  2EIK E;  4I1A A;  2LNI A;  3B7U X;  3HYM B;  4K5C A;  4KYO B;  4XIF A;  3UI2 A;  5KJK A;  1N94 A;  3U9W A;  2YHC A;  4N2Q A;  3EJN A;  2J08 A;  2C2L A;  3MA5 A;  1L5J A;  2DBA A;  3QWW A;  2I1J A;  3Q15 A;  2X3M A;  3RO3 A;  2AWI A;  4GTP A;  4OYS A;  4R7L A;  1G3N B;  3EHQ A;  4NIK A;  4XZ4 A;  5H7P A;  4Y6W A;  3FHE A;  3B95 A;  4I43 A;  1SA5 A;  2J8S D;  4XEI G;  3URZ A;  1JWG A;  4JPS A;  4I9E A;  1U2V G;  2WXH A;  4MKT A;  1OWP A;  3S2A A;  4KBQ A;  1HZ4 A;  2Q7F A;  1HXI A;  3C3O A;  5AEN A;  4HI8 A;  4JC8 A;  3EDT B;  1A17 A;  1EPU A;  2HE0 A;  4WUY A;  1RW2 A;  2OEW A;  4UQX A;  2H6H A;  5FQ4 A;  2GRQ B;  2GRL A;  4G24 A;  4AOF A;  2L0I A;  1TYQ G;  4CDR A;  4UWK A;  1TEZ A;  3SQV A;  3TL5 A;  1TR4 A;  2R5S A;  2RG8 A;  4GMR A;  5FT9 A;  3SO8 A;  2LXL A;  1MX2 A;  3CVQ A;  4XI9 A;  4G11 A;  2XEN A;  2HYZ A;  3ULE G;  4GTV A;  4B8A A;  3NBN B;  3DPY A;  1SZA A;  4U8H A;  2LSV A;  4IN3 B;  1K8K G;  2DCP A;  3CVN A;  1P5Q A;  5BPP A;  3TAX A;  5KBA A;  3FP3 A;  3KEZ A;  3T8K A;  1JCR A;  2CHZ A;  4HQD A;  4PS8 A;  1NZN A;  4GB9 A;  5EX3 A;  3ZFW A;  3CVW A;  3FUN A;  4DLQ A;  5ANL A;  3QOU A;  3UTM A;  4XKC A;  5JHA A;  1GW6 A;  5LX8 A;  3MX3 A;  2IO3 C;  4EHM A;  4H7Y A;  1A5E A;  1SA4 A;  4NAC A;  1ELK A;  5G55 A;  4J8S A;  4BET A;  2I2O A;  1TNZ A;  3L9T A;  3ZYL A;  2XPI A;  3KD7 A;  3W9F A;  3BG0 B;  3APD A;  4U04 A;  2X38 A;  4F53 A;  4FJZ A;  4YDW A;  3TJP A;  4DX5 D;  3D9N A;  1B89 A;  2X6J A;  5B3S E;  1OWN A;  1UN9 A;  3E33 A;  3P1U A;  3RSE G;  3RK6 A;  3QKY A; 
#chains in the Genus database with same CATH homology
 4EPZ A;  4FU3 A;  4XI0 A;  3UT8 A;  3VLD A;  5FQ7 A;  4ME2 A;  4JL0 A;  3MGB A;  3CQC B;  3AU5 A;  1H2V C;  4BTA A;  4D10 C;  4A55 A;  1Z3X A;  1N52 A;  3LCA A;  3S7F A;  2YHE A;  5CMY A;  4WWN A;  3CQG B;  3AS4 A;  3ASF A;  4BX9 A;  1HH8 A;  4I2Z A;  3ZIM A;  4CDM A;  1UJK A;  3IHY A;  2J49 A;  5FZR A;  2XEV A;  4AIF A;  1JPL A;  3CHS A;  3PZD A;  3AU4 A;  4GZ3 A;  3FUH A;  4HXI A;  2AW6 A;  4U0Z A;  4UI9 C;  4K03 A;  1HE8 A;  3RRN B;  1TJF A;  4H7X A;  2IFU A;  2KCV A;  2XGO A;  2ZU6 B;  4U63 A;  5EX0 A;  2XPZ A;  4ACK A;  4XE0 A;  3QWV A;  3QNK A;  4GA2 A;  3HIZ A;  3TXM A;  3VLF A;  3PH0 C;  5LCW J;  2M63 A;  3CK7 A;  1XNF A;  1UG3 A;  2WXG A;  3SF4 A;  2XRZ A;  2J09 A;  3MCX A;  5ARF A;  3S7J A;  5FQ6 A;  5A6C A;  4FHJ A;  4WWP A;  2NSZ A;  4DLO A;  3PNT B;  3SBS A;  1OWM A;  3PE3 A;  1MHQ A;  5BW8 C;  2LSU A;  3VTY A;  2WQ6 A;  4ANX A;  4FHK A;  2VJ8 A;  3Q47 B;  3T5X A;  3PEV B;  4J8D A;  4L7T A;  5DBK A;  4I2W A;  2Y3A A;  4FJY A;  4JEU A;  4HOU A;  3VTX A;  4DI3 A;  5EDS A;  3SHF A;  5M72 A;  1DNP A;  4FAD A;  2WXQ A;  5FWQ A;  3Q5M A;  1QZ2 A;  2C0M A;  3ONL A;  2CHW A;  4G1T A;  3R9A B;  4BTB A;  1IYG A;  4ATG A;  5FQ8 A;  4ACL A;  2OVB A;  4AXH A;  3U3W A;  4G2V A;  3CSF A;  3L13 A;  3C98 A;  3MKQ B;  1SZ9 A;  3FU3 A;  3RU0 A;  3ZGQ A;  2FBN A;  4I6E A;  4WND A;  4B94 A;  2L6J A;  3D9O A;  2Y4T A;  1EDU A;  4GZD A;  4NRH B;  3SGH A;  2X6F A;  2L9B A;  4UWG A;  4C0E A;  4B8C B;  3FEY A;  1W3B A;  3DBS A;  3MZL B;  3D9L A;  4J0U A;  3FUL A;  4PS3 A;  3IHV A;  1UW4 B;  3TXN A;  3D9I A;  3U64 A;  1E8Z A;  2WXP A;  4WNF A;  3CHQ A;  2WMO A;  3ZYM A;  3LVQ E;  4URK A;  4JHJ A;  3ULQ A;  2J9Q A;  3FUI A;  2C0L A;  1PC2 A;  5E75 A;  4BWR A;  1PY1 A;  2PL2 A;  4P29 A;  4RG9 A;  4M3O A;  3L54 A;  4OVV A;  3LXU X;  4GAA A;  3KS2 A;  1FCH A;  3R7Q A;  4BX8 A;  3MV2 B;  2OV8 A;  2I1K A;  2P58 C;  4KVO A;  3FU5 A;  3SI5 A;  4MRU A;  4EEC A;  1DVP A;  4WAF A;  2AXV A;  4BFR A;  3CHP A;  3UQ3 A;  4JEH A;  2KCL A;  4EQF A;  3LKU A;  5J08 A;  2LAI A;  4RG6 A;  4LER A;  2VGY A;  3N71 A;  2KZT B;  4HOQ A;  4I1O B;  2WXF A;  3L22 A;  5AJL A;  2XGM A;  4U0S A;  3E4B A;  2PQR A;  3MJW A;  4FC8 A;  3TG5 A;  3CR3 A;  3MYV A;  4GYO A;  2Y4U A;  3G2V A;  3CIA A;  4A3V A;  4GA0 A;  3D3M A;  4RSY A;  2WB2 A;  2CG3 A;  3G2W A;  3T5V A;  4I1M A;  4RVB A;  4J6I A;  3OTN A;  2NC9 A;  4QFV A;  4I9C A;  4UWL A;  3NZU A;  3I3N A;  4UI9 K;  3B7R L;  1XGW A;  3FH8 A;  5KCM A;  5AJD A;  2X6K A;  2XQ0 A;  2X6H A;  3FTZ A;  2XHE A;  3SBT B;  1HX8 A;  4GCN A;  4AV7 A;  1H2U A;  2WXR A;  5G05 J;  1Y6I A;  3LDZ A;  2WXN A;  2RD0 A;  4ANV A;  4AY5 A;  5A23 A;  5J90 A;  2GGF A;  1OWO A;  4PUC A;  3R7R A;  3ASG A;  3UUX A;  5D0O D;  5T4Y A;  1HG2 A;  2WXK A;  3HVE B;  2AVP A;  3MKR A;  3NF1 A;  4KT6 B;  2FO7 A;  3QAR A;  5ARG A;  4LCT A;  4KVM A;  4KZ0 A;  2UY1 A;  4NUR A;  3CEQ A;  3I4R B;  4L2L A;  4JHK A;  2VSO E;  3CK9 A;  3LS8 A;  5JJT A;  3IBE A;  4Q94 A;  4JA7 A;  4BT9 A;  4L2Y A;  3RRM B;  3PNL B;  4GA1 A;  4AM9 A;  3FUK A;  5HI7 A;  5EKQ D;  1VDY A;  3ZN3 A;  4YVQ C;  3ZEF A;  4AEZ C;  3OXG A;  3L17 A;  1H0A A;  3ZHE B;  4A1G A;  1UJJ A;  4AP2 A;  4FLB A;  3JYS A;  4UWF A;  2EQX A;  3SNX A;  4CGW A;  4ILH B;  2BUG A;  3RKV A;  3QAQ A;  5CCL A;  2HM8 A;  3B7S A;  4WNE A;  3NQP A;  3CKB A;  3U4T A;  2NXP A;  5G2N A;  4HOS A;  4DJA A;  4F3V A;  2WQH A;  4UWH A;  4AY6 A;  2PZI A;  2HO1 A;  4TUU A;  4XX5 A;  1N54 A;  2X6I A;  2AXZ A;  2WXL A;  3IV0 A;  1H6K A;  3T8M A;  4CDN A;  3GZS A;  1JWF A;  4V3I A;  4KZC A;  2ION A;  2IOS A;  2IF4 A;  4LEU A;  4O6F A;  1SQM A;  4E6H A;  3GYZ A;  3UT7 A;  5G04 J;  3QWP A;  4PDX A;  2DIW A;  2FI7 A;  3FH7 A;  3PRZ A;  1FVF A;  3S7D A;  4OVU A;  5G05 C;  3TG4 A;  2VSY A;  3CHO A;  4NQ0 A;  1HG5 A;  2E0I A;  4HFG A;  2WVI A;  1QNF A;  1U3D A;  3NZS A;  3LVR E;  2BTD A;  4GYY A;  2UWJ G;  4FA6 A;  3PDN A;  3OXF A;  3B13 A;  2IJG X;  2I6H A;  3LY7 A;  4GMJ A;  3EIQ C;  5JJ6 A;  1IQU A;  4ABN A;  1E90 A;  3K9I A;  3Q4A B;  3JQ0 A;  3D9M A;  3LY8 A;  4CCA A;  3UX4 A;  1UN8 A;  2AXU A;  2WXJ A;  2YQ8 A;  3LEW A;  4TRQ A;  4Y6C A;  5LFA A;  3FU0 A;  3ZVV A;  2PQN A;  2IU1 A;  1Z6T A;  3GZ2 A;  3ONK A;  3FUJ A;  5T8I A;  2XPY A;  2QY7 A;  2OOE A;  4HOT A;  2R59 A;  4GZ5 A;  2VSN A;  4APO A;  3U66 A;  4EZJ A;  2CFZ A;  5KJM A;  2KC7 A;  2PM6 A;  4FP7 A;  4DPR A;  3UPV A;  2PM7 A;  1HF8 A;  4F7A A;  3QK0 A;  3ZPJ A;  1E7U A;  3SFZ A;  1E96 B;  4B0Z A;  4WNG A;  2CFU A;  4JVS A;  1KT0 A;  1ZBP A;  1H2T C;  2MHK A;  3ZYK A;  3FH5 A;  3JCK C;  4IRU A;  4IUL A;  1IQR A;  3ZW3 A;  5KJN A;  5LOZ A;  4EBA A;  4I1A A;  2LNI A;  4I6J A;  1PAQ A;  4UQY A;  2XRY A;  3LPZ A;  1E8W A;  5D0Q D;  4W9R A;  3ML9 A;  3CVX A;  3B7U X;  3HYM B;  1ELR A;  2IQC A;  4KYO B;  4CRW A;  4XIF A;  3FUF A;  3PVL A;  4CT4 A;  3FTW A;  5KJK A;  1X5B A;  3RO2 A;  3MEK A;  4Q69 A;  3LYA A;  2YIN A;  4J8E A;  4N3C A;  3RIB A;  3U9W A;  2YHC A;  2IOL A;  4FUL A;  5G04 C;  5JHB A;  4N2Q A;  1KT1 A;  3EJN A;  2J08 A;  4LRZ A;  2C2L A;  3FTU A;  4G26 A;  3WXX A;  3MA5 A;  1L5J A;  3PUK A;  2V8S E;  2WXI A;  3D9K A;  2A4Z A;  2DBA A;  3QWW A;  3VLE A;  1INZ A;  4YVO A;  2OVF A;  2I1J A;  4IYP A;  4BY6 A;  3Q15 A;  2X3M A;  3RO3 A;  1LF8 A;  2AWI A;  4OYS A;  4R7L A;  4APF A;  4GZC A;  4B89 A;  3CVP A;  2VTB B;  3TGO A;  4XZ4 A;  3ML8 A;  2HR2 A;  3CGH A;  4Y6W A;  3FHE A;  1QQE A;  3L6A A;  1NA0 A;  4N3A A;  5AYW D;  2OND A;  4YND A;  3EHM A;  4N2S A;  1E8X A;  3ESL A;  3CVU A;  4I43 A;  4JA9 A;  2WMN A;  3URZ A;  2I9C A;  2FF4 A;  3FUD A;  4EBA G;  1JWG A;  3FWV A;  3ZYQ A;  4KMO A;  2XCC A;  5BV0 A;  4JPS A;  5HQ8 A;  3FUE A;  4I9E A;  2XCB A;  3CHM A;  3I5P A;  3FTS A;  3LJ3 A;  4KXK B;  3MKQ A;  1WY6 A;  1OWL A;  3G2T A;  3FUM A;  3QC1 A;  3JUI A;  5BT1 A;  1NP7 A;  2WXH A;  1HS6 A;  4MKT A;  3FY4 A;  3CST A;  1H19 A;  1OWP A;  3PRE A;  4N5C A;  3S2A A;  3G2U A;  4ILG A;  4KBQ A;  1HZ4 A;  2Q7F A;  4N39 A;  1HXI A;  2FEZ A;  5FJY A;  5CCM A;  1ELW A;  3EIJ A;  3QDN A;  3CLJ A;  4CEM A;  3P2B A;  5AEN A;  4GPK A;  1HFA A;  4JC8 A;  4GU5 A;  4CGV A;  3EDT B;  1A17 A;  1EPU A;  3UMV A;  1HO8 A;  2A5U A;  3SD5 A;  4WUY A;  1U3C A;  4J8F A;  4ANU A;  4UQX A;  3CVV A;  3APF A;  1WM5 A;  4U0U A;  3CHR A;  5FQ4 A;  1NA3 A;  1Z3Y A;  2GRL A;  3HHM A;  3CV0 A;  3Q49 B;  4HLE A;  4G24 A;  4AOF A;  2L0I A;  2L0T B;  2V4L A;  3IKO B;  5ENN A;  5FZS A;  4C9B B;  5LP0 A;  2MOW A;  3UT4 A;  1YA0 A;  2VGX B;  3SZ7 A;  2E2E A;  3DPD A;  4UWK A;  4CDR A;  1TEZ A;  3RRU A;  3TL5 A;  2KZT A;  3PE4 A;  4L1B A;  3BG1 B;  4HVB A;  4FLH A;  2R5S A;  2RG8 A;  4N3B A;  5FT9 A;  1MQS A;  4JW1 A;  4DK5 A;  1KLX A;  3ZXS A;  4MLP A;  2V0P A;  3L16 A;  4JZY A;  3CVQ A;  5BUZ A;  3AS8 A;  4XI9 A;  1JUQ A;  4G25 A;  4E85 A;  4G11 A;  2LO6 A;  2HYZ A;  2MRI A;  4PS7 A;  3ASD A;  3JQ1 A;  5FZQ A;  1WAO 1;  4AVX A;  4B8A A;  3PEU B;  2VTB A;  1IHG A;  3OAW A;  5CHE E;  5DIZ A;  1SZA A;  4BSX A;  4U8H A;  5AIJ A;  2LSV A;  3AS5 A;  3IEG A;  4IN3 B;  3APC A;  3QB2 A;  2DCP A;  2JLB A;  1E8Y A;  3CVN A;  4G23 A;  1P5Q A;  4GZ6 A;  4I6G A;  3B7T A;  3GW4 A;  4HOR A;  2UY1 B;  2VYI A;  4A1S A;  2BF0 X;  5BPP A;  3CVY A;  4XKB A;  3HVE A;  4WWO A;  3S7B A;  2WM9 A;  3TAX A;  5A7D B;  4HS2 A;  3FU6 A;  1EF1 C;  3GZ1 A;  5C2Y A;  3MV3 B;  3FP3 A;  3FFL A;  2KCK A;  2LAH A;  3KEZ A;  3ASH A;  4L23 A;  5CMW A;  4MS6 A;  3D9P A;  5ANR A;  3O48 A;  3FTX A;  3LY9 A;  2CHZ A;  3G2S A;  2CG2 A;  4GYW A;  1FVH A;  3I4G A;  3EHN A;  4PS8 A;  3FDH A;  1NZN A;  3ZRH A;  1ZU2 A;  1BPO A;  5T3R A;  4U07 A;  4GB9 A;  4PH4 B;  5EX3 A;  3ZFW A;  3CVW A;  2QFC A;  3FUN A;  3ZHE A;  4DLQ A;  5ANL A;  3O4Z A;  5BNW A;  3QOU A;  4XKC A;  3OXL A;  4A3T A;  5JHA A;  1GW6 A;  5LX8 A;  3MX3 A;  3PS6 A;  2VSX E;  2ILR A;  4BT8 A;  4H7Y A;  3ESK A;  3PUJ A;  2KAT A;  2WQ7 A;  4CT0 A;  4NAC A;  5LCW C;  1ELK A;  4JHR A;  4AJW A;  3BEE A;  3L08 A;  3CKC A;  4J8S A;  5G55 A;  4ANW A;  4C0M A;  4DI4 A;  4EZL A;  5C1D A;  2FUL A;  2I2O A;  4F1S A;  3FEX A;  3KAE A;  3ZYL A;  2J4D A;  2XPI A;  1HU3 A;  3KD7 A;  4UI9 J;  3QJZ A;  4UQZ A;  1OUV A;  1Y8M A;  2GW1 A;  4TV3 A;  5FTP A;  2VGX A;  3BG0 B;  2J4B A;  3FTY A;  4ILI A;  1S0P A;  3APD A;  4K0R A;  2X38 A;  4U04 A;  5E76 A;  3RJV A;  3CVL A;  1E7V A;  4LUN U;  4F53 A;  4GCO A;  2J07 A;  4FJZ A;  3CK8 A;  2XGS A;  2JEK A;  2WPV A;  5JJ7 A;  2YNQ A;  4GML A;  2R17 C;  3TJP A;  3D9N A;  5KJL A;  1B89 A;  5BV1 A;  2X6J A;  2GRM A;  2CHX A;  1OWN A;  2WXM A;  3D9J A;  4Q96 A;  1EYH A;  1UN9 A;  3HDX A;  2V5F A;  2KM4 A;  3ENE A;  3P1U A;  1TJC A;  4I17 A;  3RK6 A;  3FTV A;  3QKY A;  4JXT A;  4EZK A;  2VQ2 A;  2WXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...