4I9CA

Crystal structure of aspartyl phosphate phosphatase f from b.subtilis in complex with its inhibitory peptide
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
372
structure length
372
Chain Sequence
GVISSSSIGEKINEWYMYIRRFSIPDAEYLRREIKQELDQMEEDQDLHLYYSLMEFRHNLMLEYLEPLEKMRIEEQPRLSDLLLEIDKKQARLTGLLEYYFNFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEESNILPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQKAGDVIYLSEFEFLKSLYLSGPDEEAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYFLKVEQVRQLIQGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of Rap phosphatase inhibition by Phr peptides
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
total genus 157
structure length 372
sequence length 372
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i9cA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i9cA02
2IFUA 4EQFA 1QZ2A 5FZRA 5G04J 4RG9A 3PE4A 2C2LA 5BW8C 3LY7A 4GZ5A 2FO7A 3OXLA 3CKBA 1QQEA 1NZNA 1B89A 3RIBA 4XI0A 1IYGA 3N71A 3BEEA 3S7DA 4ABNA 2KATA 1P5QA 4BT8A 1WM5A 2UY1A 4J8FA 1A17A 4BTAA 3Q49B 2MHKA 4UQXA 2ONDA 3WXXA 3LYAA 2XGOA 4G1TA 4AIFA 4HOSA 1Y8MA 3S7BA 3U3WA 2J9QA 3KAEA 4KBQA 4YVQC 4LEUA 3RKVA 2KCLA 5BT1A 4W9RA 3CVLA 4Y6CA 4GYOA 1TJCA 4G26A 3ASHA 3URZA 4O6FA 1KT0A 3QDNA 3CK8A 3CV0A 5EX0A 2IF4A 2L6JA 4U04A 4JA9A 3MA5A 4I9EA 2Q7FA 5G04C 3LY8A 4RG6A 1WAO1 3ZFWA 2PZIA 2VSNA 5HI7A 4YNDA 3JYSA 2R5SA 4HOUA 3S7FA 3UUXA 4N39A 4GYWA 3R9AB 3ASFA 2FF4A 5JJ6A 4WNEA 2VYIA 4YVOA 2E2EA 1PC2A 4F3VA 3S7JA 4N2SA 4G2VA 5G05J 3NF1A 3TAXA 5FZSA 3ULQA 2HYZA 4JHRA 4WNGA 3QWWA 4NRHB 4G23A 4CDRA 5BNWA 4J8DA 4IN3B 2KCVA 3QWPA 3SF4A 2XCBA 4B94A 4N5CA 5FJYA 1FCHA 1YA0A 3LPZA 2GW1A 4GA0A 4AM9A 4U07A 5FTPA 1E96B 1XNFA 3GZ1A 4I9CA 2V5FA 5LCWJ 3RU0A 3TGOA 5KJMA 3ASDA 4N3AA 3ZN3A 4BTBA 2Y4TA 2PL2A 4XI9A 4ME2A 2UWJG 3QKYA 4GCNA 4WNFA 5EKQD 1ELWA 2VQ2A 2XPIA 5D0QD 5FT9A 2KC7A 5HQ8A 2DBAA 5KJNA 3MV2B 4GA2A 3QOUA 5G05C 2VGXA 3CVQA 3CVNA 4KXKB 2WPVA 4GA1A 2UY1B 3ZHEA 2KCKA 3ZPJA 4CGVA 3FP3A 2BUGA 2JLBA 1NA0A 2C0MA 5DIZA 3VTXA 1KT1A 2XCCA 4WUYA 3ZGQA 2PQRA 3KS2A 3Q47B 5AYWD 2WQHA 3Q4AB 3RJVA 2YQ8A 3AS8A 2FEZA 4BT9A 5LCWC 4HOQA 5KJLA 2AVPA 4AY6A 3MKRA 4WNDA 4UQZA 2VSYA 4U0ZA 4AY5A 4GYYA 3UPVA 1ELRA 5KJKA 3CVPA 2I6HA 3AS5A 3CKCA 2PQNA 1ZU2A 3LKUA 2QFCA 2HO1A 4H7YA 3Q5MA 4J0UA 3UQ3A 4N3CA 4APOA 4UI9J 3E4BA 4G25A 3RO3A 2FI7A 3GW4A 2HR2A 3MEKA 2XGMA 2LSUA 4UQYA 3CK9A 3PDNA 4UI9K 5ARGA 3HYMB 3EDTB 3TG4A 4A1SA 5C1DA 1OUVA 2C0LA 5ARFA 5A7DB 3FWVA 3PE3A 3GZ2A 4N2QA 3Q15A 3OXFA 2XGSA 2XEVA 3LCAA 4U0SA 3LY9A 2LNIA 2NC9A 3ASGA 4GPKA 4N3BA 4XIFA 5JJ7A 5DBKA 4JA7A 2OOEA 3OXGA 1HZ4A 2VGYA 5EX3A 3K9IA 4CGWA 2FBNA 4KYOB 5JJTA 3GYZA 4J8EA 4UI9C 5FZQA 4GCOA 5D0OD 5CCMA 4I17A 4Y6WA 2YHCA 2P58C 1IHGA 3FFLA 4U0UA 3VTYA 4GZ3A 1HH8A 4NQ0A 3TG5A 2LSVA 5A6CA 1ZBPA 4JL0A 5CCLA 3CEQA 1W3BA 3ESKA 2VGXB 4I2ZA 4I2WA 4BWRA 5M72A 3KD7A 1HXIA 4I1AA 3MV3B 3U4TA 4GZ6A 3ZHEB 1NA3A 4H7XA 2Y4UA 3CK7A 3QWVA 5CHEE 3O48A 4HORA 3RO2A 3SZ7A 1KLXA 4G24A 3AS4A 3IEGA 4HOTA
chains in the Genus database with same CATH superfamily
3SHFA 1K8KG 4L7TA 5J90A 4LCTA 3TWXA 1QZ2A 5G04J 2BEDA 5BXOA 1JCRA 3W9FA 1N52A 5CEAA 1NZNA 3VLEA 4DK5A 1IYGA 2HE0A 3FULA 2MYOA 3N71A 4ZFHA 3C72A 4CZ2D 3PZDA 3RRUA 4ANUA 1P5QA 3AU5A 1WM5A 4GPMA 4J8FA 1U2VG 4GTRA 4CT0A 2KM4A 1QYMA 4K5AB 4JEUA 2LUHA 3UMVA 2H6HA 2IJGX 4DLOA 5CBOA 5BV1A 2BF0X 4WAFA 2OV8A 3CVLA 4Y6CA 4GTQA 1TJCA 2X6KA 4ZHBA 3ASHA 1EF1C 2NXPA 2XEHA 4JA9A 3OAWA 4LNUD 2YHEA 2Q7FA 4EHMA 3DXKG 1O1SA 4RLYA 4FP7A 2PZIA 4UWLA 4PS7A 3LVQE 5HI7A 2L0IA 2EINE 3CVUA 1BI8B 2IEJA 4HOUA 1ELKA 3C3RA 4FJYA 3UUXA 1UJJA 3R9MA 1O1TA 2IU1A 3I3NA 3LJNA 4YVOA 4V3IA 2E0IA 3KSQA 4QQIA 3GZSA 5HRYA 3NF1A 2WXOA 3T5XA 4I6JA 2OCCE 3D9LA 3SI5A 4JHRA 3MGBA 4FA6A 4WNGA 2I1KA 1JWGA 4J8DA 4IN3B 3ZXPA 3V79K 3AG2E 3F6QA 3FDHA 1HS6A 3DEPA 3E33A 5T3RA 1H19A 2IOSA 3SF4A 4B94A 4N5CA 1NI1A 5ENRD 2IQCA 2V8SE 4AM9A 4GA0A 1MQSA 4HRLA 4U07A 4BY6A 3ZYLA 4I9CA 1UN9A 3L08A 4AXHA 1EYHA 3LJ3A 3ASDA 4HQDA 3D9JA 4BTBA 2Y4TA 2PL2A 4ME2A 1N54A 4DUIA 4BETA 4C48B 4OVUA 4FJZA 4J7WA 5AIJA 2VJ8A 3FHEA 3FUEA 3SD5A 2XQ0A 4HI8A 3NOCD 4IRUA 5HQ8A 5T4YA 4JVSA 5G05C 1HO8A 1EPUA 2VGXA 2V4HC 2RD0A 2LO6A 2WPVA 4GA1A 4RQIA 3RAUA 4M3OA 1JUQA 3ZHEA 3FU6A 1SW6A 2ETBA 1EDUA 2R05A 4IYPA 4GTOA 4APFA 5EIDA 1H2VC 3JUIA 2F8YA 3J5PA 3KS2A 3Q47B 2AW6A 1OCOE 2YINA 2NYJA 2IONA 2GRRB 4LNGA 2RFAA 2Y1LE 4TXPA 3G2UA 2FEZA 4CDMA 1TN8A 1Z6TA 1NP7A 3TWVA 4J8YA 3CHRA 4AV7A 3L9TA 2VTBB 4A55A 4MRUA 1ELRA 3PZ4A 1WG0A 1MYOA 1LF8A 3CKCA 3FUKA 3KEZA 1OWLA 2HO1A 3QAQA 2QC9A 3FH5A 3SNXA 5D66A 3FUIA 4JXTA 2IO3C 4OVVA 3CK9A 3PDNA 4UI9K 1S64A 1E8WA 3HYMB 3PVLA 3FUJA 5ENTD 4JEHA 3TG4A 2I2OA 1OUVA 3FUNA 2X6FA 3BQOA 3ULYA 3FWVA 4O1OA 4TV3A 3U66A 3D9OA 5FQ4A 2NSZA 2H6FA 1IXVA 3TWRA 2XEVA 3FTZA 3VLDA 4A3TA 4JHKA 4N3BA 5JJ7A 1LD7A 3OXGA 1HZ4A 5JHBA 4F53A 2FBNA 4KT6B 5ANLA 3ZW3A 5FIOA 5FZQA 5CERB 1TN7A 5CCMA 4I17A 3FTSA 2A4ZA 1N9AA 5EDSA 3VTYA 1E8YA 2F37A 5CECB 5JA4D 5C2YA 2WXIA 4C0MA 1Y6IA 5CCLA 3EU5A 3UM3A 3PZ1A 4BWRA 4HFGA 4D10C 3FUDA 4UWKA 4ANXA 3MV3B 1JWFA 4H7XA 2R59A 3D9IA 4ILHB 4HORA 3RO2A 1OT8A 3PZ2A 3TXNA 2XEEA 2IFUA 4G8KA 3DSVA 4LG6A 3QB2A 4ATGA 4EQFA 2P9IG 2GRNB 4J6IA 5BW8C 4G8LA 4GZCA 3LY7A 4GZ5A 4EBAA 3CKBA 3WG7E 4BSZB 1B89A 3RIBA 5AJDA 2L9BA 3SGHA 3FU3A 2KATA 2WVIA 5CRVA 3MX3A 3EHMA 4WWNA 1A17A 4BTAA 3Q49B 2R02A 1G3NB 2MHKA 3HXCA 3WXXA 4K5BA 3JUEA 4JB8P 4CRWA 4AIFA 1BU9A 3P2BA 2IOLA 2XENA 1H6KA 2RKKA 1NL4A 4KBQA 1OCCE 2GRQB 4UWGA 4YVQC 4KZ0A 4LEUA 3Q7AA 2H6GA 4GYOA 4G26A 3QDNA 2AWIA 3CK8A 3DPDA 3CHSA 3CV0A 2IF4A 3IKOB 1K1AA 3RSEG 4I9EA 4L1BA 4YDYA 1IHBA 3LY8A 1D8DA 2VSNA 2ZGDA 3JYSA 1FT1A 4BERA 2X38A 1YMPA 3ONKA 4GMJA 2XZDG 5EILA 4U8HA 3ASFA 1MX2A 4FC8A 1E8ZA 3FUFA 5JJ6A 3SFYA 4F1SA 1PC2A 3Q73A 2F0YA 1H2TC 1OCRE 4HLEA 3PH0C 3TAXA 3EHQA 5E75A 1IQUA 3NZUA 4DX2A 3ULQA 2DCPA 2HYZA 2ZIRA 3PNLB 3ZYMA 3Q7FA 3LXUX 5ITZF 1SVXA 3AG3E 3QNKA 4G23A 5BNWA 5B1BE 3EHRA 4QFVA 2CG2A 4HS2A 3PRZA 3FTWA 2DVWA 2RFMA 5FJYA 1YA0A 2CHZA 4K03A 1TNBA 2AXVA 5FTPA 3GZ1A 1XNFA 3DSTA 2V5FA 1SZ9A 1FVHA 1IQRA 3AU4A 3TGOA 2WXGA 5KJMA 4N3AA 2MOWA 3ZU7B 3UT8A 3I4GA 2ETCA 3FH7A 1YYHA 1SQMA 1S63A 1RW2A 2VQ2A 4EZLA 2XPIA 5ENQD 1TNOA 1BI7B 2WXHA 3UM2A 5FT9A 4GAAA 3CSTA 5ENSD 5KJNA 5ANRA 4GA2A 3QOUA 2Y0BG 3HG0D 4DLQA 1N94A 4HBDA 4XKBA 2OEWA 2UY1B 4AEZC 3G2SA 1N0QA 2KCKA 4Q69A 4CGVA 4ILGA 2XPZA 4EZKA 2BUGA 4U8VD 1NA0A 3HVEA 3SQVA 2C0MA 2ETAA 4C9BB 2EILE 2P9PG 2XCCA 3FEXA 3G2VA 3FEYA 2DWZA 4FU3A 2XRYA 3DSUA 2JABA 2WQHA 2P9LG 3MJWA 4AJWA 3RJVA 2YQ8A 3AS8A 3ZNGA 4BT9A 2LXLA 4Z68A 5LCWC 2X6IA 5KJLA 3ZYKA 2AVPA 5FINA 3MKRA 3CVVA 4TXRA 4PUCA 2WXLA 4WNDA 3V31A 3UKRG 3FUHA 5KBAA 3T5VA 2VSYA 2WXKA 4CDNA 4GYYA 3HRAA 3Q75A 3QK0A 2WQ7A 3UI2A 3NOGD 3LKUA 2QFCA 4O60A 5A23A 4H7YA 3UQ3A 1H6PA 4N3CA 4CCAA 2EQXA 4I6GA 5EYPF 3PREA 2JEKA 3GW4A 1OY3D 3E37A 3JXIA 3EU9A 3BG1B 3L16A 3Q9NC 4UWHA 1VDYA 3DSWA 3R7RA 3SO8A 1KZOA 5AJLA 4A1SA 4TUUA 5LP0A 1MZCA 2OEVA 4YDEA 4ACKA 3HXFA 4N2QA 1N4SA 2J08A 5AQ7A 3LY9A 3ASGA 1Z5SC 3JXJA 1DCQA 5ENNA 5EN5D 2BKGA 1OCZE 2WXRA 5LOZA 2VGYA 2YNQA 4X8QA 1N95A 2P9UG 3CR3A 3LEWA 5EYLA 4NURA 3CVYA 3L22A 4I43A 2WMNA 4MKTA 4U96D 3OTNA 4UI9C 3B7RL 5D0OD 3SFXA 3UTMA 2A5EA 4BEPA 4BX9A 2YHCA 3HHMA 1IHGA 4FHJA 2Y3AA 4XX5A 1LTXA 4GZ3A 3EJNA 2LSVA 3L6AA 3CHPA 5IY5E 2PNNA 2Y69E 4YDOA 2DZNA 1FT2A 1O1RA 4I2ZA 1OWNA 3QJZA 3D9MA 3KD7A 1HXIA 3UIOC 4I1AA 3U4TA 4GZ6A 1NA3A 3IBEA 3L82A 3SZ7A 4G24A 4GMLA 3IEGA 4L2LA 3AG4E 4R7LA 2WXQA 3TWTA 4RG9A 2V4LA 2FO7A 5EIBE 3OXLA 2B0OE 2ZU6B 4B89A 4UUCA 4XI0A 3C5RA 3S7DA 2IY0C 3FU5A 3ASOE 1V54E 3ABLE 5T8IA 2P9KG 3X2QE 3PNTB 2KBXA 2QY7A 4UQXA 4O1PA 5B3SE 3LYAA 2XGOA 3UT4A 4BSXA 1H6OA 4OAUC 3S7BA 2L0TB 3BUAA 3B7TA 3KAEA 4JW1A 1DC2A 4NIKA 5BXUA 4BX8A 5BT1A 2AXUA 4F6RD 1SA4A 3URZA 5ENPD 5HKPA 4ANWA 4F7AA 4EZJA 2L6JA 4U04A 1RZ4A 2BKKB 2VTBA 5G04C 3RK6A 1WAO1 3ZFWA 4FULA 3CQCB 5KNHD 3ULEG 2XS8A 2R5SA 4JC8A 3TWSA 2A5UA 3EHNA 4GYWA 1MX6A 3R9AB 4Q94A 4B93B 2LAIA 4GTPA 3ISMC 3L17A 2V5QC 2GRMA 4WNEA 2J07A 2VYIA 4AOFA 4F3VA 2OVBA 3BG0B 4G2VA 5G05J 5E76A 2X6HA 4L23A 3PUJA 3MCXA 2CG3A 4HRNA 2L6BA 3Q9UC 3HIZA 4NRHB 4CT4A 5CBNA 1UN8A 1WDYA 2KCVA 4KVMA 2RG8A 2XCBA 3ML8A 3DPYA 3MKQB 4DX1A 3DEOA 4DX7D 1N4PA 4UWFA 4K5CA 3RRMB 1E96B 1KZPA 3AG1E 3UINC 3ZN3A 2DZOA 2GRLA 5CRUA 2PM7A 2UWJG 1QBQA 1V55E 3ENEA 5LFAA 3PEVB 3JQ0A 3S2AA 3CGHA 4HNAD 2KC7A 4ACLA 4WWOA 1HE8A 4F1PA 4N5QA 3P1UA 1DNPA 2DIWA 4C0EA 3CVQA 3QARA 1Z3XA 3J5QB 4XE0A 2JLBA 4URKA 4FADA 1H0AA 1E8XA 5DIZA 3VTXA 5AQBA 3NB2A 3CQGB 3IHYA 2PQRA 5BPPA 2WB2A 4KMOA 3UM0A 5AYWD 2LXMA 3CSFA 4PH4B 3CVWA 5FQ8A 3HDXA 3BU8A 2XS1A 4HOQA 2M63A 3RRNB 4AY6A 1GW6A 4PS3A 2WXNA 5AQAA 1OWPA 3TWWA 4A3VA 4UQZA 4U0ZA 1N0RA 3APFA 3UPVA 5KJKA 3TXMA 3CVPA 4AVXA 1U3DA 2I6HA 2F8XK 3AS5A 3UT7A 4E6HA 3FTUA 2PQNA 1ZU2A 4MBGA 1UW4B 2BTDA 1QNFA 3LDZA 4J0UA 2J8SD 5AQ9A 3E4BA 3ZXSA 1HU3A 2FI7A 3QC1A 2HR2A 1AWCB 2XGMA 2LSUA 2VSXE 4EECA 4DJAA 3EDTB 5C1DA 1KPSB 5G55A 1Z3YA 2C0LA 5A7DB 4DI4A 3FTVA 1OXJA 2QYJA 2ZISA 3FY4A 4KVOA 3Q15A 3OXFA 4HXIA 2XGSA 2WXFA 4L9PA 3LCAA 2R17C 3AJIA 2R03A 4KZCA 3NBNB 3IHVA 4XIFA 1O5MA 3CVXA 2KZTA 3R7QA 5EX3A 3KSLA 3K9IA 1TEZA 4KYOB 3GYZA 4J8EA 3PUKA 1X81A 1E7VA 4HB5A 1ZB1A 3NZSA 4FLHA 4B8AA 3O4ZA 1HX8A 4TRQA 1S70B 4EBAG 3FFLA 4U0UA 4GTMA 4OAVB 3B95A 3SY2A 4NQ0A 3E34A 2XHEA 1ZBPA 2CHWA 3C3OA 5JHAA 3V2OA 4Q96A 3CEQA 1W3BA 1UJKA 1N4QA 2VGXB 3CLJA 5D2MC 4I2WA 5M72A 4HVBA 4LSZE 4DRXE 1E90A 4EPZA 4RSYA 4TXQA 3ZHEB 1K1BA 5CHEE 3VLFA 3O48A 4P29A 3AS4A 5FQ6A 4OYSA 4CEMA 1TJFA 5FZRA 4MLPA 3PE4A 1TNZA 2C2LA 1OWMA 2QZAA 4M7CA 5HS0A 2FULA 2X6JA 1QQEA 4I6EA 2B6CA 5AENA 2CHXA 2EIJE 3BEEA 3T8MA 3SBTB 4ABNA 4BT8A 2XZTG 2UY1A 5CMYA 3C98A 4GZDA 1U3CA 1HG5A 2WXPA 2ONDA 1BD8A 5G2NA 2I9CA 4G1TA 2EIME 3KEAA 4HOSA 1Y8MA 3JQ1A 4B0ZA 2GRPB 3U3WA 2J9QA 5B1AE 3RKVA 2KCLA 4YDWA 4W9RA 3FH8A 3NAWA 4O6FA 1KT0A 3FUMA 5EX0A 2J4BA 2LAHA 5H7PA 3UM1A 3FTYA 1N4RA 3MZLB 3MA5A 3IV0A 3EUVA 4RG6A 2WXJA 3D9NA 3V2XA 1JCSA 2AXZA 4A1GA 4RVBA 5ENOD 2VGEA 4YNDA 1INZA 1TYQG 3ABKE 4DPRA 3B7BA 4E85A 1XGWA 4CYMD 3S7FA 3B7UX 4N39A 1L5JA 2XPYA 4K0RA 3LS8A 1UOHA 4XZ4A 3D3MA 2FF4A 4LRZA 1N11A 1BLXB 3IXEA 2E2EA 1YCSB 3S7JA 4N2SA 3DWLG 1FVFA 1TNYA 3DXMG 5FZSA 4U8YD 2P9SG 2V0PA 2FO1E 1D8EA 2ZGGA 3QWWA 3E32A 1D9SA 4CDRA 3TJPA 1UG3A 3QWPA 3PZ3A 1FCHA 4U63A 3LPZA 2GW1A 1NFIE 1JPLA 3E30A 4HRMB 3ABME 3W9GA 3U64A 3LVRE 2AJAA 3RU0A 5J08A 5LCWJ 2I1JA 5CMWA 3EIQC 3ZRHA 3ZEFA 4XI9A 2DYSE 4GU5A 3ZUVB 3QKYA 3EIJA 4GCNA 3C3QA 3B13A 3D9KA 5LX8A 3ZVVA 4WNFA 1MHQA 5EKQD 1ELWA 5D0QD 4U95D 4I1MA 2DBAA 3MV2B 2J09A 2IO2C 3DSSA 1HFAA 2H6IA 4DX6D 5AN8A 3HXBA 3CVNA 4KXKB 1HF8A 3Q79A 4JZYA 4HLLA 3ZPJA 3FP3A 5AARA 4GTTA 1E7UA 3ONLA 3PEUB 1KT1A 4NACA 1WY6A 4XEIG 4WUYA 3SFZA 2PM6A 1TR4A 2P2CP 4FLBA 1TNUA 4PDXA 3ZGQA 5BUZA 3UIPC 1PY1A 4ILIA 2QYUA 3U9WA 3MYVA 4JPSA 4GTSA 1IKND 3Q4AB 4DX5D 4BESA 4ATZD 3SBSA 1DCEA 5CEDB 1OWOA 2CFUA 1MX4A 2ILRA 4AY5A 1H2UA 4A63B 4AP2A 2VSOE 2GROB 2P9NG 1DVPA 3D9HA 4DI3A 1X5BA 5FWQA 3L13A 2WMOA 4LERA 2MRIA 3Q5MA 5KWDA 3ML9A 5BV0A 2XRZA 4HI9A 4APOA 3L54A 4UI9J 1Q2ZA 2EIKE 3ZIMA 4G25A 3PS6A 3RO3A 3UKUG 3ESLA 3DBSA 2WQ6A 3MEKA 4UQYA 3UXGA 3APCA 5ARGA 1SA5A 1SZAA 1K3ZD 3T9KA 3UX4A 3ZKJA 1HG2A 2HM8A 3HXDA 5FQ7A 4J8SA 5ARFA 2J49A 4GB9A 2GGFA 3PE3A 3I5PA 3GZ2A 4XKCA 4GMRA 3G2WA 3FTXA 4IULA 3APDA 4JHJA 3T8KA 2WM9A 4U0SA 3D9PA 1AP7A 5AAOA 2R2LA 3JCKC 2LNIA 2NC9A 4BFRA 4GPKA 3HXEA 3Q78A 1MJ0A 1TN6A 3G2TA 4B8CB 2KXPC 5KCMA 3DRAA 4TUMA 3ZYQA 5DBKA 4JA7A 2OOEA 2OVFA 3CHOA 4CGWA 2DYRE 2CFZA 4G11A 1A5EA 2WXMA 5JJTA 3DSXA 1FPPA 3TWUA 4I1OB 3TWQA 1BPOA 4GCOA 2ZXWE 1S0PA 4LUNU 3CIAA 1LD8A 3ASNE 4Y6WA 4L2YA 2P58C 4LNBA 3V30A 3AAAC 1HH8A 4GTVA 3TG5A 3CHMA 5A6CA 4JL0A 3TL5A 3ESKA 3MKQA 2KZTB 1PAQA 4PS8A 3NQPA 4FHKA 4JD2G 1JCQA 2J4DA 4U7EB 5JMND 2Y4UA 4MS6A 3CK7A 3QWVA 3FU0A 2X3MA 3B7SA 4ANVA 3I4RB 3HVEB 1KLXA 5KNGA 4WWPA 4HOTA 3CHQA
chains in the Genus database with same CATH topology
2IFUA 4OYSA 4L2LA 3SHFA 4CEMA 4R7LA 4L7TA 5J90A 3QB2A 4ATGA 4LCTA 4EQFA 1QZ2A 1TJFA 2WXQA 5FZRA 5G04J 4MLPA 4RG9A 3PE4A 4J6IA 2C2LA 5BW8C 2V4LA 1OWMA 4GZCA 3LY7A 4GZ5A 2FO7A 1N52A 3OXLA 4EBAA 2FULA 2X6JA 2ZU6B 3CKBA 1QQEA 4I6EA 1NZNA 4B89A 1B89A 3RIBA 3VLEA 4XI0A 5AJDA 4DK5A 5AENA 1IYGA 2CHXA 3FULA 2L9BA 3BEEA 3N71A 3PZDA 3T8MA 3S7DA 3SGHA 3SBTB 3FU5A 3FU3A 3RRUA 4ABNA 4ANUA 2KATA 2WVIA 1P5QA 3AU5A 4BT8A 5T8IA 3MX3A 1WM5A 2UY1A 5CMYA 3EHMA 4WWNA 3C98A 4GZDA 4J8FA 1A17A 4BTAA 3Q49B 2MHKA 1U3CA 1HG5A 2WXPA 3PNTB 2QY7A 4UQXA 2ONDA 3WXXA 4CT0A 3LYAA 2XGOA 3UT4A 4BSXA 2KM4A 5G2NA 2I9CA 4CRWA 4G1TA 4AIFA 3P2BA 4HOSA 1Y8MA 3JQ1A 4B0ZA 3S7BA 2IOLA 2L0TB 4JEUA 3B7TA 1H6KA 2J9QA 3KAEA 4KBQA 3UMVA 3U3WA 2IJGX 4JW1A 4DLOA 4UWGA 5BV1A 4YVQC 4KZ0A 4LEUA 2BF0X 3RKVA 2KCLA 4BX8A 5BT1A 2AXUA 4WAFA 4W9RA 2OV8A 3FH8A 3CVLA 4Y6CA 4GYOA 1TJCA 2X6KA 4G26A 3ASHA 3URZA 4O6FA 1KT0A 3FUMA 1EF1C 3QDNA 4ANWA 2AWIA 3CK8A 3DPDA 3CHSA 2NXPA 3CV0A 5EX0A 4F7AA 2IF4A 2J4BA 3IKOB 4EZJA 2L6JA 4U04A 2LAHA 4JA9A 3FTYA 3MZLB 3OAWA 3MA5A 4I9EA 2YHEA 4L1BA 2VTBA 2Q7FA 3IV0A 5G04C 3LY8A 4RG6A 3RK6A 1WAO1 4FP7A 2WXJA 3D9NA 3ZFWA 2PZIA 4FULA 4UWLA 2AXZA 4PS7A 3LVQE 2VSNA 5HI7A 2L0IA 3CQCB 4A1GA 3CVUA 4RVBA 4YNDA 3JYSA 2R5SA 4JC8A 1INZA 2A5UA 2X38A 4DPRA 4HOUA 4E85A 1XGWA 1ELKA 4FJYA 3EHNA 3ONKA 4GMJA 3S7FA 3UUXA 1UJJA 3B7UX 4GYWA 1L5JA 4N39A 2XPYA 4K0RA 3R9AB 3LS8A 4Q94A 2LAIA 4XZ4A 3D3MA 4U8HA 3L17A 3ASFA 2FF4A 2IU1A 4LRZA 3I3NA 4FC8A 1E8ZA 3FUFA 2GRMA 5JJ6A 4WNEA 2J07A 2VYIA 4YVOA 4V3IA 4AOFA 4F1SA 2E2EA 1PC2A 2E0IA 4F3VA 3S7JA 4N2SA 2OVBA 3GZSA 3BG0B 1H2TC 4G2VA 5G05J 1FVFA 5E76A 4HLEA 3NF1A 3PH0C 3TAXA 5FZSA 2WXOA 3T5XA 4I6JA 1IQUA 3NZUA 5E75A 2X6HA 3ULQA 2DCPA 2HYZA 2V0PA 3D9LA 3PNLB 3SI5A 3ZYMA 4JHRA 3MGBA 4FA6A 4WNGA 4L23A 3PUJA 3QWWA 2I1KA 3LXUX 3MCXA 2CG3A 1JWGA 3HIZA 3QNKA 4NRHB 4G23A 4CDRA 5BNWA 4J8DA 4IN3B 4CT4A 1UN8A 4QFVA 2KCVA 3TJPA 2CG2A 1UG3A 4HS2A 3FDHA 3PRZA 4KVMA 1HS6A 3FTWA 5T3RA 1H19A 3QWPA 2IOSA 2RG8A 3SF4A 2XCBA 3ML8A 4B94A 4N5CA 5FJYA 1FCHA 3MKQB 1YA0A 2IQCA 2CHZA 4U63A 2V8SE 3LPZA 4K03A 2GW1A 4GA0A 4AM9A 1JPLA 1MQSA 4U07A 2AXVA 5FTPA 4UWFA 3RRMB 4BY6A 1E96B 1XNFA 3GZ1A 3U64A 3ZYLA 4I9CA 3LVRE 1UN9A 2V5FA 3L08A 1SZ9A 1FVHA 1IQRA 3AU4A 3RU0A 5J08A 5LCWJ 3TGOA 2WXGA 4AXHA 5KJMA 1EYHA 3LJ3A 3ASDA 4N3AA 3ZN3A 3D9JA 2I1JA 5CMWA 2MOWA 3EIQC 4BTBA 3ZRHA 2Y4TA 2GRLA 2PL2A 3ZEFA 4XI9A 3UT8A 3I4GA 4ME2A 1N54A 2PM7A 4GU5A 3FH7A 2UWJG 4OVUA 4FJZA 3QKYA 3EIJA 1SQMA 4GCNA 3ENEA 3B13A 3D9KA 5LX8A 3ZVVA 5LFAA 4WNFA 1MHQA 5EKQD 4DI3A 5AIJA 1ELWA 2VJ8A 2VQ2A 3PEVB 2XPIA 4EZLA 5D0QD 3FHEA 3JQ0A 3S2AA 3FUEA 2WXHA 3CGHA 5FT9A 2XQ0A 3SD5A 4GAAA 2KC7A 3CSTA 4IRUA 4I1MA 4WWOA 4ACLA 5HQ8A 2DBAA 5KJNA 5ANRA 3MV2B 2J09A 4GA2A 5T4YA 3QOUA 1HE8A 4JVSA 1HFAA 5G05C 1HO8A 1EPUA 4DLQA 2VGXA 3P1UA 1DNPA 2DIWA 2RD0A 4C0EA 4XKBA 3CVQA 3QARA 3CVNA 2LO6A 2WPVA 4GA1A 2UY1B 1HF8A 4KXKB 4AEZC 1Z3XA 3G2SA 4M3OA 1JUQA 4XE0A 4JZYA 3ZHEA 2KCKA 3ZPJA 4Q69A 4CGVA 3FU6A 3FP3A 4ILGA 2XPZA 4EZKA 2BUGA 2JLBA 4URKA 4FADA 1NA0A 1E7UA 3HVEA 1H0AA 3ONLA 2C0MA 3PEUB 1EDUA 1E8XA 5DIZA 4IYPA 4C9BB 3VTXA 1KT1A 4NACA 1WY6A 2XCCA 3FEXA 4WUYA 4APFA 3SFZA 1H2VC 2PM6A 3G2VA 3JUIA 3CQGB 3FEYA 3IHYA 4FLBA 4PDXA 3ZGQA 5BUZA 2PQRA 4FU3A 5BPPA 2WB2A 1PY1A 2XRYA 4KMOA 4ILIA 3KS2A 3Q47B 2AW6A 5AYWD 3U9WA 3CSFA 2YINA 3MYVA 2IONA 2WQHA 4JPSA 4PH4B 3MJWA 3Q4AB 4AJWA 3CVWA 3RJVA 2YQ8A 3AS8A 5FQ8A 3G2UA 3HDXA 2FEZA 4BT9A 4CDMA 5LCWC 2X6IA 4HOQA 2M63A 3ZYKA 3SBSA 1Z6TA 2AVPA 3RRNB 5KJLA 4AY6A 1NP7A 1GW6A 3MKRA 4PS3A 3CVVA 2WXNA 4PUCA 2WXLA 1OWPA 4WNDA 1OWOA 4A3VA 3FUHA 4UQZA 3CHRA 3T5VA 2CFUA 2VSYA 4U0ZA 2WXKA 3APFA 4AV7A 2ILRA 4CDNA 4AY5A 1H2UA 2VTBB 4GYYA 4A55A 4MRUA 3UPVA 1ELRA 5KJKA 3QK0A 3CVPA 3TXMA 4AVXA 2WQ7A 1U3DA 2I6HA 4AP2A 2VSOE 1DVPA 3AS5A 1LF8A 3UT7A 4E6HA 3CKCA 3FUKA 3FTUA 1X5BA 2PQNA 1ZU2A 3L13A 3KEZA 3LKUA 5FWQA 2WMOA 2QFCA 1OWLA 1UW4B 2HO1A 2BTDA 3QAQA 1QNFA 5A23A 4LERA 4H7YA 3LDZA 2MRIA 3Q5MA 3FH5A 4J0UA 3UQ3A 3ML9A 5BV0A 2XRZA 4N3CA 4CCAA 2EQXA 3L54A 4UI9J 3SNXA 4I6GA 4APOA 3FUIA 3E4BA 3PREA 3ZIMA 4G25A 4JXTA 3ZXSA 2JEKA 3PS6A 3RO3A 1HU3A 2FI7A 3GW4A 3QC1A 2HR2A 3ESLA 3DBSA 2WQ6A 3MEKA 2XGMA 4OVVA 2LSUA 4UQYA 3CK9A 3PDNA 2VSXE 3BG1B 3L16A 4UI9K 3APCA 5ARGA 4EECA 4UWHA 1VDYA 1E8WA 4DJAA 1SZAA 3HYMB 3R7RA 3UX4A 3EDTB 3PVLA 1HG2A 2HM8A 3FUJA 4JEHA 3TG4A 5AJLA 4A1SA 4TUUA 5C1DA 5G55A 2I2OA 5FQ7A 1OUVA 5LP0A 3FUNA 1Z3YA 2C0LA 2X6FA 4J8SA 5ARFA 2J49A 5A7DB 4DI4A 3FWVA 4GB9A 3FTVA 4TV3A 2GGFA 3PE3A 3U66A 3I5PA 3FY4A 3D9OA 3GZ2A 4KVOA 4XKCA 5FQ4A 2NSZA 3G2WA 4ACKA 3FTXA 4N2QA 4IULA 3APDA 3Q15A 3OXFA 4HXIA 2XGSA 4JHJA 2WXFA 2J08A 2WM9A 2XEVA 3LCAA 4U0SA 3D9PA 2R17C 3JCKC 3LY9A 2LNIA 3FTZA 2NC9A 3ASGA 4KZCA 4BFRA 4GPKA 3VLDA 4A3TA 3IHVA 4JHKA 4N3BA 4XIFA 3G2TA 4B8CB 5KCMA 5ENNA 5JJ7A 3ZYQA 5DBKA 3CVXA 2KZTA 4JA7A 2OOEA 3OXGA 2WXRA 1HZ4A 2OVFA 5LOZA 2VGYA 3R7QA 3CHOA 5EX3A 5JHBA 3K9IA 2YNQA 4CGWA 1TEZA 2CFZA 4F53A 2FBNA 4G11A 4KT6B 3CR3A 3LEWA 4NURA 4KYOB 5ANLA 2WXMA 5JJTA 3CVYA 3L22A 4I43A 3GYZA 3ZW3A 2WMNA 4J8EA 4MKTA 3PUKA 4I1OB 1BPOA 3OTNA 4UI9C 3B7RL 1E7VA 5FZQA 4GCOA 3NZSA 4FLHA 5D0OD 5CCMA 4I17A 1S0PA 2A4ZA 3FTSA 4LUNU 3CIAA 4B8AA 4Y6WA 3O4ZA 4BX9A 4L2YA 1HX8A 2YHCA 2P58C 3HHMA 4TRQA 4EBAG 1IHGA 3FFLA 4U0UA 5EDSA 4FHJA 3VTYA 1E8YA 2Y3AA 4XX5A 4GZ3A 3EJNA 1HH8A 4NQ0A 3TG5A 5C2YA 2LSVA 2XHEA 3CHMA 5A6CA 1ZBPA 2CHWA 3CHPA 2WXIA 3L6AA 4C0MA 4JL0A 3TL5A 1Y6IA 5JHAA 5CCLA 4Q96A 3CEQA 1W3BA 3ESKA 1UJKA 3MKQA 2VGXB 3CLJA 4I2ZA 4I2WA 1OWNA 2KZTB 3QJZA 4BWRA 1PAQA 4PS8A 4HVBA 3D9MA 5M72A 3KD7A 3NQPA 4HFGA 4D10C 1HXIA 3FUDA 4UWKA 4ANXA 4FHKA 1E90A 4I1AA 3MV3B 4EPZA 3U4TA 2J4DA 4RSYA 4GZ6A 1JWFA 3ZHEB 1NA3A 4H7XA 3IBEA 2Y4UA 4MS6A 3CK7A 2R59A 3D9IA 3FU0A 3QWVA 2X3MA 3B7SA 5CHEE 4ILHB 3O48A 3VLFA 4ANVA 3I4RB 3RO2A 4HORA 3SZ7A 3HVEB 4P29A 1KLXA 4G24A 4GMLA 3AS4A 3IEGA 3TXNA 5FQ6A 4WWPA 4HOTA 3CHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFU A;  4EQF A;  1QZ2 A;  5FZR A;  5G04 J;  4RG9 A;  3PE4 A;  2C2L A;  5BW8 C;  3LY7 A;  4GZ5 A;  2FO7 A;  3OXL A;  3CKB A;  1QQE A;  1NZN A;  1B89 A;  3RIB A;  4XI0 A;  1IYG A;  3N71 A;  3BEE A;  3S7D A;  4ABN A;  2KAT A;  1P5Q A;  4BT8 A;  1WM5 A;  2UY1 A;  4J8F A;  1A17 A;  4BTA A;  3Q49 B;  2MHK A;  4UQX A;  2OND A;  3WXX A;  3LYA A;  2XGO A;  4G1T A;  4AIF A;  4HOS A;  1Y8M A;  3S7B A;  3U3W A;  2J9Q A;  3KAE A;  4KBQ A;  4YVQ C;  4LEU A;  3RKV A;  2KCL A;  5BT1 A;  4W9R A;  3CVL A;  4Y6C A;  4GYO A;  1TJC A;  4G26 A;  3ASH A;  3URZ A;  4O6F A;  1KT0 A;  3QDN A;  3CK8 A;  3CV0 A;  5EX0 A;  2IF4 A;  2L6J A;  4U04 A;  4JA9 A;  3MA5 A;  4I9E A;  2Q7F A;  5G04 C;  3LY8 A;  4RG6 A;  1WAO 1;  3ZFW A;  2PZI A;  2VSN A;  5HI7 A;  4YND A;  3JYS A;  2R5S A;  4HOU A;  3S7F A;  3UUX A;  4N39 A;  4GYW A;  3R9A B;  3ASF A;  2FF4 A;  5JJ6 A;  4WNE A;  2VYI A;  4YVO A;  2E2E A;  1PC2 A;  4F3V A;  3S7J A;  4N2S A;  4G2V A;  5G05 J;  3NF1 A;  3TAX A;  5FZS A;  3ULQ A;  2HYZ A;  4JHR A;  4WNG A;  3QWW A;  4NRH B;  4G23 A;  4CDR A;  5BNW A;  4J8D A;  4IN3 B;  2KCV A;  3QWP A;  3SF4 A;  2XCB A;  4B94 A;  4N5C A;  5FJY A;  1FCH A;  1YA0 A;  3LPZ A;  2GW1 A;  4GA0 A;  4AM9 A;  4U07 A;  5FTP A;  1E96 B;  1XNF A;  3GZ1 A;  4I9C A;  2V5F A;  5LCW J;  3RU0 A;  3TGO A;  5KJM A;  3ASD A;  4N3A A;  3ZN3 A;  4BTB A;  2Y4T A;  2PL2 A;  4XI9 A;  4ME2 A;  2UWJ G;  3QKY A;  4GCN A;  4WNF A;  5EKQ D;  1ELW A;  2VQ2 A;  2XPI A;  5D0Q D;  5FT9 A;  2KC7 A;  5HQ8 A;  2DBA A;  5KJN A;  3MV2 B;  4GA2 A;  3QOU A;  5G05 C;  2VGX A;  3CVQ A;  3CVN A;  4KXK B;  2WPV A;  4GA1 A;  2UY1 B;  3ZHE A;  2KCK A;  3ZPJ A;  4CGV A;  3FP3 A;  2BUG A;  2JLB A;  1NA0 A;  2C0M A;  5DIZ A;  3VTX A;  1KT1 A;  2XCC A;  4WUY A;  3ZGQ A;  2PQR A;  3KS2 A;  3Q47 B;  5AYW D;  2WQH A;  3Q4A B;  3RJV A;  2YQ8 A;  3AS8 A;  2FEZ A;  4BT9 A;  5LCW C;  4HOQ A;  5KJL A;  2AVP A;  4AY6 A;  3MKR A;  4WND A;  4UQZ A;  2VSY A;  4U0Z A;  4AY5 A;  4GYY A;  3UPV A;  1ELR A;  5KJK A;  3CVP A;  2I6H A;  3AS5 A;  3CKC A;  2PQN A;  1ZU2 A;  3LKU A;  2QFC A;  2HO1 A;  4H7Y A;  3Q5M A;  4J0U A;  3UQ3 A;  4N3C A;  4APO A;  4UI9 J;  3E4B A;  4G25 A;  3RO3 A;  2FI7 A;  3GW4 A;  2HR2 A;  3MEK A;  2XGM A;  2LSU A;  4UQY A;  3CK9 A;  3PDN A;  4UI9 K;  5ARG A;  3HYM B;  3EDT B;  3TG4 A;  4A1S A;  5C1D A;  1OUV A;  2C0L A;  5ARF A;  5A7D B;  3FWV A;  3PE3 A;  3GZ2 A;  4N2Q A;  3Q15 A;  3OXF A;  2XGS A;  2XEV A;  3LCA A;  4U0S A;  3LY9 A;  2LNI A;  2NC9 A;  3ASG A;  4GPK A;  4N3B A;  4XIF A;  5JJ7 A;  5DBK A;  4JA7 A;  2OOE A;  3OXG A;  1HZ4 A;  2VGY A;  5EX3 A;  3K9I A;  4CGW A;  2FBN A;  4KYO B;  5JJT A;  3GYZ A;  4J8E A;  4UI9 C;  5FZQ A;  4GCO A;  5D0O D;  5CCM A;  4I17 A;  4Y6W A;  2YHC A;  2P58 C;  1IHG A;  3FFL A;  4U0U A;  3VTY A;  4GZ3 A;  1HH8 A;  4NQ0 A;  3TG5 A;  2LSV A;  5A6C A;  1ZBP A;  4JL0 A;  5CCL A;  3CEQ A;  1W3B A;  3ESK A;  2VGX B;  4I2Z A;  4I2W A;  4BWR A;  5M72 A;  3KD7 A;  1HXI A;  4I1A A;  3MV3 B;  3U4T A;  4GZ6 A;  3ZHE B;  1NA3 A;  4H7X A;  2Y4U A;  3CK7 A;  3QWV A;  5CHE E;  3O48 A;  4HOR A;  3RO2 A;  3SZ7 A;  1KLX A;  4G24 A;  3AS4 A;  3IEG A;  4HOT A; 
#chains in the Genus database with same CATH topology
 3SHF A;  1K8K G;  4L7T A;  5J90 A;  4LCT A;  3TWX A;  1QZ2 A;  5G04 J;  2BED A;  5BXO A;  1JCR A;  3W9F A;  1N52 A;  5CEA A;  1NZN A;  3VLE A;  4DK5 A;  1IYG A;  2HE0 A;  3FUL A;  2MYO A;  3N71 A;  4ZFH A;  3C72 A;  4CZ2 D;  3PZD A;  3RRU A;  4ANU A;  1P5Q A;  3AU5 A;  1WM5 A;  4GPM A;  4J8F A;  1U2V G;  4GTR A;  4CT0 A;  2KM4 A;  1QYM A;  4K5A B;  4JEU A;  2LUH A;  3UMV A;  2H6H A;  2IJG X;  4DLO A;  5CBO A;  5BV1 A;  2BF0 X;  4WAF A;  2OV8 A;  3CVL A;  4Y6C A;  4GTQ A;  1TJC A;  2X6K A;  4ZHB A;  3ASH A;  1EF1 C;  2NXP A;  2XEH A;  4JA9 A;  3OAW A;  4LNU D;  2YHE A;  2Q7F A;  4EHM A;  3DXK G;  1O1S A;  4RLY A;  4FP7 A;  2PZI A;  4UWL A;  4PS7 A;  3LVQ E;  5HI7 A;  2L0I A;  2EIN E;  3CVU A;  1BI8 B;  2IEJ A;  4HOU A;  1ELK A;  3C3R A;  4FJY A;  3UUX A;  1UJJ A;  3R9M A;  1O1T A;  2IU1 A;  3I3N A;  3LJN A;  4YVO A;  4V3I A;  2E0I A;  3KSQ A;  4QQI A;  3GZS A;  5HRY A;  3NF1 A;  2WXO A;  3T5X A;  4I6J A;  2OCC E;  3D9L A;  3SI5 A;  4JHR A;  3MGB A;  4FA6 A;  4WNG A;  2I1K A;  1JWG A;  4J8D A;  4IN3 B;  3ZXP A;  3V79 K;  3AG2 E;  3F6Q A;  3FDH A;  1HS6 A;  3DEP A;  3E33 A;  5T3R A;  1H19 A;  2IOS A;  3SF4 A;  4B94 A;  4N5C A;  1NI1 A;  5ENR D;  2IQC A;  2V8S E;  4AM9 A;  4GA0 A;  1MQS A;  4HRL A;  4U07 A;  4BY6 A;  3ZYL A;  4I9C A;  1UN9 A;  3L08 A;  4AXH A;  1EYH A;  3LJ3 A;  3ASD A;  4HQD A;  3D9J A;  4BTB A;  2Y4T A;  2PL2 A;  4ME2 A;  1N54 A;  4DUI A;  4BET A;  4C48 B;  4OVU A;  4FJZ A;  4J7W A;  5AIJ A;  2VJ8 A;  3FHE A;  3FUE A;  3SD5 A;  2XQ0 A;  4HI8 A;  3NOC D;  4IRU A;  5HQ8 A;  5T4Y A;  4JVS A;  5G05 C;  1HO8 A;  1EPU A;  2VGX A;  2V4H C;  2RD0 A;  2LO6 A;  2WPV A;  4GA1 A;  4RQI A;  3RAU A;  4M3O A;  1JUQ A;  3ZHE A;  3FU6 A;  1SW6 A;  2ETB A;  1EDU A;  2R05 A;  4IYP A;  4GTO A;  4APF A;  5EID A;  1H2V C;  3JUI A;  2F8Y A;  3J5P A;  3KS2 A;  3Q47 B;  2AW6 A;  1OCO E;  2YIN A;  2NYJ A;  2ION A;  2GRR B;  4LNG A;  2RFA A;  2Y1L E;  4TXP A;  3G2U A;  2FEZ A;  4CDM A;  1TN8 A;  1Z6T A;  1NP7 A;  3TWV A;  4J8Y A;  3CHR A;  4AV7 A;  3L9T A;  2VTB B;  4A55 A;  4MRU A;  1ELR A;  3PZ4 A;  1WG0 A;  1MYO A;  1LF8 A;  3CKC A;  3FUK A;  3KEZ A;  1OWL A;  2HO1 A;  3QAQ A;  2QC9 A;  3FH5 A;  3SNX A;  5D66 A;  3FUI A;  4JXT A;  2IO3 C;  4OVV A;  3CK9 A;  3PDN A;  4UI9 K;  1S64 A;  1E8W A;  3HYM B;  3PVL A;  3FUJ A;  5ENT D;  4JEH A;  3TG4 A;  2I2O A;  1OUV A;  3FUN A;  2X6F A;  3BQO A;  3ULY A;  3FWV A;  4O1O A;  4TV3 A;  3U66 A;  3D9O A;  5FQ4 A;  2NSZ A;  2H6F A;  1IXV A;  3TWR A;  2XEV A;  3FTZ A;  3VLD A;  4A3T A;  4JHK A;  4N3B A;  5JJ7 A;  1LD7 A;  3OXG A;  1HZ4 A;  5JHB A;  4F53 A;  2FBN A;  4KT6 B;  5ANL A;  3ZW3 A;  5FIO A;  5FZQ A;  5CER B;  1TN7 A;  5CCM A;  4I17 A;  3FTS A;  2A4Z A;  1N9A A;  5EDS A;  3VTY A;  1E8Y A;  2F37 A;  5CEC B;  5JA4 D;  5C2Y A;  2WXI A;  4C0M A;  1Y6I A;  5CCL A;  3EU5 A;  3UM3 A;  3PZ1 A;  4BWR A;  4HFG A;  4D10 C;  3FUD A;  4UWK A;  4ANX A;  3MV3 B;  1JWF A;  4H7X A;  2R59 A;  3D9I A;  4ILH B;  4HOR A;  3RO2 A;  1OT8 A;  3PZ2 A;  3TXN A;  2XEE A;  2IFU A;  4G8K A;  3DSV A;  4LG6 A;  3QB2 A;  4ATG A;  4EQF A;  2P9I G;  2GRN B;  4J6I A;  5BW8 C;  4G8L A;  4GZC A;  3LY7 A;  4GZ5 A;  4EBA A;  3CKB A;  3WG7 E;  4BSZ B;  1B89 A;  3RIB A;  5AJD A;  2L9B A;  3SGH A;  3FU3 A;  2KAT A;  2WVI A;  5CRV A;  3MX3 A;  3EHM A;  4WWN A;  1A17 A;  4BTA A;  3Q49 B;  2R02 A;  1G3N B;  2MHK A;  3HXC A;  3WXX A;  4K5B A;  3JUE A;  4JB8 P;  4CRW A;  4AIF A;  1BU9 A;  3P2B A;  2IOL A;  2XEN A;  1H6K A;  2RKK A;  1NL4 A;  4KBQ A;  1OCC E;  2GRQ B;  4UWG A;  4YVQ C;  4KZ0 A;  4LEU A;  3Q7A A;  2H6G A;  4GYO A;  4G26 A;  3QDN A;  2AWI A;  3CK8 A;  3DPD A;  3CHS A;  3CV0 A;  2IF4 A;  3IKO B;  1K1A A;  3RSE G;  4I9E A;  4L1B A;  4YDY A;  1IHB A;  3LY8 A;  1D8D A;  2VSN A;  2ZGD A;  3JYS A;  1FT1 A;  4BER A;  2X38 A;  1YMP A;  3ONK A;  4GMJ A;  2XZD G;  5EIL A;  4U8H A;  3ASF A;  1MX2 A;  4FC8 A;  1E8Z A;  3FUF A;  5JJ6 A;  3SFY A;  4F1S A;  1PC2 A;  3Q73 A;  2F0Y A;  1H2T C;  1OCR E;  4HLE A;  3PH0 C;  3TAX A;  3EHQ A;  5E75 A;  1IQU A;  3NZU A;  4DX2 A;  3ULQ A;  2DCP A;  2HYZ A;  2ZIR A;  3PNL B;  3ZYM A;  3Q7F A;  3LXU X;  5ITZ F;  1SVX A;  3AG3 E;  3QNK A;  4G23 A;  5BNW A;  5B1B E;  3EHR A;  4QFV A;  2CG2 A;  4HS2 A;  3PRZ A;  3FTW A;  2DVW A;  2RFM A;  5FJY A;  1YA0 A;  2CHZ A;  4K03 A;  1TNB A;  2AXV A;  5FTP A;  3GZ1 A;  1XNF A;  3DST A;  2V5F A;  1SZ9 A;  1FVH A;  1IQR A;  3AU4 A;  3TGO A;  2WXG A;  5KJM A;  4N3A A;  2MOW A;  3ZU7 B;  3UT8 A;  3I4G A;  2ETC A;  3FH7 A;  1YYH A;  1SQM A;  1S63 A;  1RW2 A;  2VQ2 A;  4EZL A;  2XPI A;  5ENQ D;  1TNO A;  1BI7 B;  2WXH A;  3UM2 A;  5FT9 A;  4GAA A;  3CST A;  5ENS D;  5KJN A;  5ANR A;  4GA2 A;  3QOU A;  2Y0B G;  3HG0 D;  4DLQ A;  1N94 A;  4HBD A;  4XKB A;  2OEW A;  2UY1 B;  4AEZ C;  3G2S A;  1N0Q A;  2KCK A;  4Q69 A;  4CGV A;  4ILG A;  2XPZ A;  4EZK A;  2BUG A;  4U8V D;  1NA0 A;  3HVE A;  3SQV A;  2C0M A;  2ETA A;  4C9B B;  2EIL E;  2P9P G;  2XCC A;  3FEX A;  3G2V A;  3FEY A;  2DWZ A;  4FU3 A;  2XRY A;  3DSU A;  2JAB A;  2WQH A;  2P9L G;  3MJW A;  4AJW A;  3RJV A;  2YQ8 A;  3AS8 A;  3ZNG A;  4BT9 A;  2LXL A;  4Z68 A;  5LCW C;  2X6I A;  5KJL A;  3ZYK A;  2AVP A;  5FIN A;  3MKR A;  3CVV A;  4TXR A;  4PUC A;  2WXL A;  4WND A;  3V31 A;  3UKR G;  3FUH A;  5KBA A;  3T5V A;  2VSY A;  2WXK A;  4CDN A;  4GYY A;  3HRA A;  3Q75 A;  3QK0 A;  2WQ7 A;  3UI2 A;  3NOG D;  3LKU A;  2QFC A;  4O60 A;  5A23 A;  4H7Y A;  3UQ3 A;  1H6P A;  4N3C A;  4CCA A;  2EQX A;  4I6G A;  5EYP F;  3PRE A;  2JEK A;  3GW4 A;  1OY3 D;  3E37 A;  3JXI A;  3EU9 A;  3BG1 B;  3L16 A;  3Q9N C;  4UWH A;  1VDY A;  3DSW A;  3R7R A;  3SO8 A;  1KZO A;  5AJL A;  4A1S A;  4TUU A;  5LP0 A;  1MZC A;  2OEV A;  4YDE A;  4ACK A;  3HXF A;  4N2Q A;  1N4S A;  2J08 A;  5AQ7 A;  3LY9 A;  3ASG A;  1Z5S C;  3JXJ A;  1DCQ A;  5ENN A;  5EN5 D;  2BKG A;  1OCZ E;  2WXR A;  5LOZ A;  2VGY A;  2YNQ A;  4X8Q A;  1N95 A;  2P9U G;  3CR3 A;  3LEW A;  5EYL A;  4NUR A;  3CVY A;  3L22 A;  4I43 A;  2WMN A;  4MKT A;  4U96 D;  3OTN A;  4UI9 C;  3B7R L;  5D0O D;  3SFX A;  3UTM A;  2A5E A;  4BEP A;  4BX9 A;  2YHC A;  3HHM A;  1IHG A;  4FHJ A;  2Y3A A;  4XX5 A;  1LTX A;  4GZ3 A;  3EJN A;  2LSV A;  3L6A A;  3CHP A;  5IY5 E;  2PNN A;  2Y69 E;  4YDO A;  2DZN A;  1FT2 A;  1O1R A;  4I2Z A;  1OWN A;  3QJZ A;  3D9M A;  3KD7 A;  1HXI A;  3UIO C;  4I1A A;  3U4T A;  4GZ6 A;  1NA3 A;  3IBE A;  3L82 A;  3SZ7 A;  4G24 A;  4GML A;  3IEG A;  4L2L A;  3AG4 E;  4R7L A;  2WXQ A;  3TWT A;  4RG9 A;  2V4L A;  2FO7 A;  5EIB E;  3OXL A;  2B0O E;  2ZU6 B;  4B89 A;  4UUC A;  4XI0 A;  3C5R A;  3S7D A;  2IY0 C;  3FU5 A;  3ASO E;  1V54 E;  3ABL E;  5T8I A;  2P9K G;  3X2Q E;  3PNT B;  2KBX A;  2QY7 A;  4UQX A;  4O1P A;  5B3S E;  3LYA A;  2XGO A;  3UT4 A;  4BSX A;  1H6O A;  4OAU C;  3S7B A;  2L0T B;  3BUA A;  3B7T A;  3KAE A;  4JW1 A;  1DC2 A;  4NIK A;  5BXU A;  4BX8 A;  5BT1 A;  2AXU A;  4F6R D;  1SA4 A;  3URZ A;  5ENP D;  5HKP A;  4ANW A;  4F7A A;  4EZJ A;  2L6J A;  4U04 A;  1RZ4 A;  2BKK B;  2VTB A;  5G04 C;  3RK6 A;  1WAO 1;  3ZFW A;  4FUL A;  3CQC B;  5KNH D;  3ULE G;  2XS8 A;  2R5S A;  4JC8 A;  3TWS A;  2A5U A;  3EHN A;  4GYW A;  1MX6 A;  3R9A B;  4Q94 A;  4B93 B;  2LAI A;  4GTP A;  3ISM C;  3L17 A;  2V5Q C;  2GRM A;  4WNE A;  2J07 A;  2VYI A;  4AOF A;  4F3V A;  2OVB A;  3BG0 B;  4G2V A;  5G05 J;  5E76 A;  2X6H A;  4L23 A;  3PUJ A;  3MCX A;  2CG3 A;  4HRN A;  2L6B A;  3Q9U C;  3HIZ A;  4NRH B;  4CT4 A;  5CBN A;  1UN8 A;  1WDY A;  2KCV A;  4KVM A;  2RG8 A;  2XCB A;  3ML8 A;  3DPY A;  3MKQ B;  4DX1 A;  3DEO A;  4DX7 D;  1N4P A;  4UWF A;  4K5C A;  3RRM B;  1E96 B;  1KZP A;  3AG1 E;  3UIN C;  3ZN3 A;  2DZO A;  2GRL A;  5CRU A;  2PM7 A;  2UWJ G;  1QBQ A;  1V55 E;  3ENE A;  5LFA A;  3PEV B;  3JQ0 A;  3S2A A;  3CGH A;  4HNA D;  2KC7 A;  4ACL A;  4WWO A;  1HE8 A;  4F1P A;  4N5Q A;  3P1U A;  1DNP A;  2DIW A;  4C0E A;  3CVQ A;  3QAR A;  1Z3X A;  3J5Q B;  4XE0 A;  2JLB A;  4URK A;  4FAD A;  1H0A A;  1E8X A;  5DIZ A;  3VTX A;  5AQB A;  3NB2 A;  3CQG B;  3IHY A;  2PQR A;  5BPP A;  2WB2 A;  4KMO A;  3UM0 A;  5AYW D;  2LXM A;  3CSF A;  4PH4 B;  3CVW A;  5FQ8 A;  3HDX A;  3BU8 A;  2XS1 A;  4HOQ A;  2M63 A;  3RRN B;  4AY6 A;  1GW6 A;  4PS3 A;  2WXN A;  5AQA A;  1OWP A;  3TWW A;  4A3V A;  4UQZ A;  4U0Z A;  1N0R A;  3APF A;  3UPV A;  5KJK A;  3TXM A;  3CVP A;  4AVX A;  1U3D A;  2I6H A;  2F8X K;  3AS5 A;  3UT7 A;  4E6H A;  3FTU A;  2PQN A;  1ZU2 A;  4MBG A;  1UW4 B;  2BTD A;  1QNF A;  3LDZ A;  4J0U A;  2J8S D;  5AQ9 A;  3E4B A;  3ZXS A;  1HU3 A;  2FI7 A;  3QC1 A;  2HR2 A;  1AWC B;  2XGM A;  2LSU A;  2VSX E;  4EEC A;  4DJA A;  3EDT B;  5C1D A;  1KPS B;  5G55 A;  1Z3Y A;  2C0L A;  5A7D B;  4DI4 A;  3FTV A;  1OXJ A;  2QYJ A;  2ZIS A;  3FY4 A;  4KVO A;  3Q15 A;  3OXF A;  4HXI A;  2XGS A;  2WXF A;  4L9P A;  3LCA A;  2R17 C;  3AJI A;  2R03 A;  4KZC A;  3NBN B;  3IHV A;  4XIF A;  1O5M A;  3CVX A;  2KZT A;  3R7Q A;  5EX3 A;  3KSL A;  3K9I A;  1TEZ A;  4KYO B;  3GYZ A;  4J8E A;  3PUK A;  1X81 A;  1E7V A;  4HB5 A;  1ZB1 A;  3NZS A;  4FLH A;  4B8A A;  3O4Z A;  1HX8 A;  4TRQ A;  1S70 B;  4EBA G;  3FFL A;  4U0U A;  4GTM A;  4OAV B;  3B95 A;  3SY2 A;  4NQ0 A;  3E34 A;  2XHE A;  1ZBP A;  2CHW A;  3C3O A;  5JHA A;  3V2O A;  4Q96 A;  3CEQ A;  1W3B A;  1UJK A;  1N4Q A;  2VGX B;  3CLJ A;  5D2M C;  4I2W A;  5M72 A;  4HVB A;  4LSZ E;  4DRX E;  1E90 A;  4EPZ A;  4RSY A;  4TXQ A;  3ZHE B;  1K1B A;  5CHE E;  3VLF A;  3O48 A;  4P29 A;  3AS4 A;  5FQ6 A;  4OYS A;  4CEM A;  1TJF A;  5FZR A;  4MLP A;  3PE4 A;  1TNZ A;  2C2L A;  1OWM A;  2QZA A;  4M7C A;  5HS0 A;  2FUL A;  2X6J A;  1QQE A;  4I6E A;  2B6C A;  5AEN A;  2CHX A;  2EIJ E;  3BEE A;  3T8M A;  3SBT B;  4ABN A;  4BT8 A;  2XZT G;  2UY1 A;  5CMY A;  3C98 A;  4GZD A;  1U3C A;  1HG5 A;  2WXP A;  2OND A;  1BD8 A;  5G2N A;  2I9C A;  4G1T A;  2EIM E;  3KEA A;  4HOS A;  1Y8M A;  3JQ1 A;  4B0Z A;  2GRP B;  3U3W A;  2J9Q A;  5B1A E;  3RKV A;  2KCL A;  4YDW A;  4W9R A;  3FH8 A;  3NAW A;  4O6F A;  1KT0 A;  3FUM A;  5EX0 A;  2J4B A;  2LAH A;  5H7P A;  3UM1 A;  3FTY A;  1N4R A;  3MZL B;  3MA5 A;  3IV0 A;  3EUV A;  4RG6 A;  2WXJ A;  3D9N A;  3V2X A;  1JCS A;  2AXZ A;  4A1G A;  4RVB A;  5ENO D;  2VGE A;  4YND A;  1INZ A;  1TYQ G;  3ABK E;  4DPR A;  3B7B A;  4E85 A;  1XGW A;  4CYM D;  3S7F A;  3B7U X;  4N39 A;  1L5J A;  2XPY A;  4K0R A;  3LS8 A;  1UOH A;  4XZ4 A;  3D3M A;  2FF4 A;  4LRZ A;  1N11 A;  1BLX B;  3IXE A;  2E2E A;  1YCS B;  3S7J A;  4N2S A;  3DWL G;  1FVF A;  1TNY A;  3DXM G;  5FZS A;  4U8Y D;  2P9S G;  2V0P A;  2FO1 E;  1D8E A;  2ZGG A;  3QWW A;  3E32 A;  1D9S A;  4CDR A;  3TJP A;  1UG3 A;  3QWP A;  3PZ3 A;  1FCH A;  4U63 A;  3LPZ A;  2GW1 A;  1NFI E;  1JPL A;  3E30 A;  4HRM B;  3ABM E;  3W9G A;  3U64 A;  3LVR E;  2AJA A;  3RU0 A;  5J08 A;  5LCW J;  2I1J A;  5CMW A;  3EIQ C;  3ZRH A;  3ZEF A;  4XI9 A;  2DYS E;  4GU5 A;  3ZUV B;  3QKY A;  3EIJ A;  4GCN A;  3C3Q A;  3B13 A;  3D9K A;  5LX8 A;  3ZVV A;  4WNF A;  1MHQ A;  5EKQ D;  1ELW A;  5D0Q D;  4U95 D;  4I1M A;  2DBA A;  3MV2 B;  2J09 A;  2IO2 C;  3DSS A;  1HFA A;  2H6I A;  4DX6 D;  5AN8 A;  3HXB A;  3CVN A;  4KXK B;  1HF8 A;  3Q79 A;  4JZY A;  4HLL A;  3ZPJ A;  3FP3 A;  5AAR A;  4GTT A;  1E7U A;  3ONL A;  3PEU B;  1KT1 A;  4NAC A;  1WY6 A;  4XEI G;  4WUY A;  3SFZ A;  2PM6 A;  1TR4 A;  2P2C P;  4FLB A;  1TNU A;  4PDX A;  3ZGQ A;  5BUZ A;  3UIP C;  1PY1 A;  4ILI A;  2QYU A;  3U9W A;  3MYV A;  4JPS A;  4GTS A;  1IKN D;  3Q4A B;  4DX5 D;  4BES A;  4ATZ D;  3SBS A;  1DCE A;  5CED B;  1OWO A;  2CFU A;  1MX4 A;  2ILR A;  4AY5 A;  1H2U A;  4A63 B;  4AP2 A;  2VSO E;  2GRO B;  2P9N G;  1DVP A;  3D9H A;  4DI3 A;  1X5B A;  5FWQ A;  3L13 A;  2WMO A;  4LER A;  2MRI A;  3Q5M A;  5KWD A;  3ML9 A;  5BV0 A;  2XRZ A;  4HI9 A;  4APO A;  3L54 A;  4UI9 J;  1Q2Z A;  2EIK E;  3ZIM A;  4G25 A;  3PS6 A;  3RO3 A;  3UKU G;  3ESL A;  3DBS A;  2WQ6 A;  3MEK A;  4UQY A;  3UXG A;  3APC A;  5ARG A;  1SA5 A;  1SZA A;  1K3Z D;  3T9K A;  3UX4 A;  3ZKJ A;  1HG2 A;  2HM8 A;  3HXD A;  5FQ7 A;  4J8S A;  5ARF A;  2J49 A;  4GB9 A;  2GGF A;  3PE3 A;  3I5P A;  3GZ2 A;  4XKC A;  4GMR A;  3G2W A;  3FTX A;  4IUL A;  3APD A;  4JHJ A;  3T8K A;  2WM9 A;  4U0S A;  3D9P A;  1AP7 A;  5AAO A;  2R2L A;  3JCK C;  2LNI A;  2NC9 A;  4BFR A;  4GPK A;  3HXE A;  3Q78 A;  1MJ0 A;  1TN6 A;  3G2T A;  4B8C B;  2KXP C;  5KCM A;  3DRA A;  4TUM A;  3ZYQ A;  5DBK A;  4JA7 A;  2OOE A;  2OVF A;  3CHO A;  4CGW A;  2DYR E;  2CFZ A;  4G11 A;  1A5E A;  2WXM A;  5JJT A;  3DSX A;  1FPP A;  3TWU A;  4I1O B;  3TWQ A;  1BPO A;  4GCO A;  2ZXW E;  1S0P A;  4LUN U;  3CIA A;  1LD8 A;  3ASN E;  4Y6W A;  4L2Y A;  2P58 C;  4LNB A;  3V30 A;  3AAA C;  1HH8 A;  4GTV A;  3TG5 A;  3CHM A;  5A6C A;  4JL0 A;  3TL5 A;  3ESK A;  3MKQ A;  2KZT B;  1PAQ A;  4PS8 A;  3NQP A;  4FHK A;  4JD2 G;  1JCQ A;  2J4D A;  4U7E B;  5JMN D;  2Y4U A;  4MS6 A;  3CK7 A;  3QWV A;  3FU0 A;  2X3M A;  3B7S A;  4ANV A;  3I4R B;  3HVE B;  1KLX A;  5KNG A;  4WWP A;  4HOT A;  3CHQ A; 
#chains in the Genus database with same CATH homology
 2IFU A;  4OYS A;  4L2L A;  3SHF A;  4CEM A;  4R7L A;  4L7T A;  5J90 A;  3QB2 A;  4ATG A;  4LCT A;  4EQF A;  1QZ2 A;  1TJF A;  2WXQ A;  5FZR A;  5G04 J;  4MLP A;  4RG9 A;  3PE4 A;  4J6I A;  2C2L A;  5BW8 C;  2V4L A;  1OWM A;  4GZC A;  3LY7 A;  4GZ5 A;  2FO7 A;  1N52 A;  3OXL A;  4EBA A;  2FUL A;  2X6J A;  2ZU6 B;  3CKB A;  1QQE A;  4I6E A;  1NZN A;  4B89 A;  1B89 A;  3RIB A;  3VLE A;  4XI0 A;  5AJD A;  4DK5 A;  5AEN A;  1IYG A;  2CHX A;  3FUL A;  2L9B A;  3BEE A;  3N71 A;  3PZD A;  3T8M A;  3S7D A;  3SGH A;  3SBT B;  3FU5 A;  3FU3 A;  3RRU A;  4ABN A;  4ANU A;  2KAT A;  2WVI A;  1P5Q A;  3AU5 A;  4BT8 A;  5T8I A;  3MX3 A;  1WM5 A;  2UY1 A;  5CMY A;  3EHM A;  4WWN A;  3C98 A;  4GZD A;  4J8F A;  1A17 A;  4BTA A;  3Q49 B;  2MHK A;  1U3C A;  1HG5 A;  2WXP A;  3PNT B;  2QY7 A;  4UQX A;  2OND A;  3WXX A;  4CT0 A;  3LYA A;  2XGO A;  3UT4 A;  4BSX A;  2KM4 A;  5G2N A;  2I9C A;  4CRW A;  4G1T A;  4AIF A;  3P2B A;  4HOS A;  1Y8M A;  3JQ1 A;  4B0Z A;  3S7B A;  2IOL A;  2L0T B;  4JEU A;  3B7T A;  1H6K A;  2J9Q A;  3KAE A;  4KBQ A;  3UMV A;  3U3W A;  2IJG X;  4JW1 A;  4DLO A;  4UWG A;  5BV1 A;  4YVQ C;  4KZ0 A;  4LEU A;  2BF0 X;  3RKV A;  2KCL A;  4BX8 A;  5BT1 A;  2AXU A;  4WAF A;  4W9R A;  2OV8 A;  3FH8 A;  3CVL A;  4Y6C A;  4GYO A;  1TJC A;  2X6K A;  4G26 A;  3ASH A;  3URZ A;  4O6F A;  1KT0 A;  3FUM A;  1EF1 C;  3QDN A;  4ANW A;  2AWI A;  3CK8 A;  3DPD A;  3CHS A;  2NXP A;  3CV0 A;  5EX0 A;  4F7A A;  2IF4 A;  2J4B A;  3IKO B;  4EZJ A;  2L6J A;  4U04 A;  2LAH A;  4JA9 A;  3FTY A;  3MZL B;  3OAW A;  3MA5 A;  4I9E A;  2YHE A;  4L1B A;  2VTB A;  2Q7F A;  3IV0 A;  5G04 C;  3LY8 A;  4RG6 A;  3RK6 A;  1WAO 1;  4FP7 A;  2WXJ A;  3D9N A;  3ZFW A;  2PZI A;  4FUL A;  4UWL A;  2AXZ A;  4PS7 A;  3LVQ E;  2VSN A;  5HI7 A;  2L0I A;  3CQC B;  4A1G A;  3CVU A;  4RVB A;  4YND A;  3JYS A;  2R5S A;  4JC8 A;  1INZ A;  2A5U A;  2X38 A;  4DPR A;  4HOU A;  4E85 A;  1XGW A;  1ELK A;  4FJY A;  3EHN A;  3ONK A;  4GMJ A;  3S7F A;  3UUX A;  1UJJ A;  3B7U X;  4GYW A;  1L5J A;  4N39 A;  2XPY A;  4K0R A;  3R9A B;  3LS8 A;  4Q94 A;  2LAI A;  4XZ4 A;  3D3M A;  4U8H A;  3L17 A;  3ASF A;  2FF4 A;  2IU1 A;  4LRZ A;  3I3N A;  4FC8 A;  1E8Z A;  3FUF A;  2GRM A;  5JJ6 A;  4WNE A;  2J07 A;  2VYI A;  4YVO A;  4V3I A;  4AOF A;  4F1S A;  2E2E A;  1PC2 A;  2E0I A;  4F3V A;  3S7J A;  4N2S A;  2OVB A;  3GZS A;  3BG0 B;  1H2T C;  4G2V A;  5G05 J;  1FVF A;  5E76 A;  4HLE A;  3NF1 A;  3PH0 C;  3TAX A;  5FZS A;  2WXO A;  3T5X A;  4I6J A;  1IQU A;  3NZU A;  5E75 A;  2X6H A;  3ULQ A;  2DCP A;  2HYZ A;  2V0P A;  3D9L A;  3PNL B;  3SI5 A;  3ZYM A;  4JHR A;  3MGB A;  4FA6 A;  4WNG A;  4L23 A;  3PUJ A;  3QWW A;  2I1K A;  3LXU X;  3MCX A;  2CG3 A;  1JWG A;  3HIZ A;  3QNK A;  4NRH B;  4G23 A;  4CDR A;  5BNW A;  4J8D A;  4IN3 B;  4CT4 A;  1UN8 A;  4QFV A;  2KCV A;  3TJP A;  2CG2 A;  1UG3 A;  4HS2 A;  3FDH A;  3PRZ A;  4KVM A;  1HS6 A;  3FTW A;  5T3R A;  1H19 A;  3QWP A;  2IOS A;  2RG8 A;  3SF4 A;  2XCB A;  3ML8 A;  4B94 A;  4N5C A;  5FJY A;  1FCH A;  3MKQ B;  1YA0 A;  2IQC A;  2CHZ A;  4U63 A;  2V8S E;  3LPZ A;  4K03 A;  2GW1 A;  4GA0 A;  4AM9 A;  1JPL A;  1MQS A;  4U07 A;  2AXV A;  5FTP A;  4UWF A;  3RRM B;  4BY6 A;  1E96 B;  1XNF A;  3GZ1 A;  3U64 A;  3ZYL A;  4I9C A;  3LVR E;  1UN9 A;  2V5F A;  3L08 A;  1SZ9 A;  1FVH A;  1IQR A;  3AU4 A;  3RU0 A;  5J08 A;  5LCW J;  3TGO A;  2WXG A;  4AXH A;  5KJM A;  1EYH A;  3LJ3 A;  3ASD A;  4N3A A;  3ZN3 A;  3D9J A;  2I1J A;  5CMW A;  2MOW A;  3EIQ C;  4BTB A;  3ZRH A;  2Y4T A;  2GRL A;  2PL2 A;  3ZEF A;  4XI9 A;  3UT8 A;  3I4G A;  4ME2 A;  1N54 A;  2PM7 A;  4GU5 A;  3FH7 A;  2UWJ G;  4OVU A;  4FJZ A;  3QKY A;  3EIJ A;  1SQM A;  4GCN A;  3ENE A;  3B13 A;  3D9K A;  5LX8 A;  3ZVV A;  5LFA A;  4WNF A;  1MHQ A;  5EKQ D;  4DI3 A;  5AIJ A;  1ELW A;  2VJ8 A;  2VQ2 A;  3PEV B;  2XPI A;  4EZL A;  5D0Q D;  3FHE A;  3JQ0 A;  3S2A A;  3FUE A;  2WXH A;  3CGH A;  5FT9 A;  2XQ0 A;  3SD5 A;  4GAA A;  2KC7 A;  3CST A;  4IRU A;  4I1M A;  4WWO A;  4ACL A;  5HQ8 A;  2DBA A;  5KJN A;  5ANR A;  3MV2 B;  2J09 A;  4GA2 A;  5T4Y A;  3QOU A;  1HE8 A;  4JVS A;  1HFA A;  5G05 C;  1HO8 A;  1EPU A;  4DLQ A;  2VGX A;  3P1U A;  1DNP A;  2DIW A;  2RD0 A;  4C0E A;  4XKB A;  3CVQ A;  3QAR A;  3CVN A;  2LO6 A;  2WPV A;  4GA1 A;  2UY1 B;  1HF8 A;  4KXK B;  4AEZ C;  1Z3X A;  3G2S A;  4M3O A;  1JUQ A;  4XE0 A;  4JZY A;  3ZHE A;  2KCK A;  3ZPJ A;  4Q69 A;  4CGV A;  3FU6 A;  3FP3 A;  4ILG A;  2XPZ A;  4EZK A;  2BUG A;  2JLB A;  4URK A;  4FAD A;  1NA0 A;  1E7U A;  3HVE A;  1H0A A;  3ONL A;  2C0M A;  3PEU B;  1EDU A;  1E8X A;  5DIZ A;  4IYP A;  4C9B B;  3VTX A;  1KT1 A;  4NAC A;  1WY6 A;  2XCC A;  3FEX A;  4WUY A;  4APF A;  3SFZ A;  1H2V C;  2PM6 A;  3G2V A;  3JUI A;  3CQG B;  3FEY A;  3IHY A;  4FLB A;  4PDX A;  3ZGQ A;  5BUZ A;  2PQR A;  4FU3 A;  5BPP A;  2WB2 A;  1PY1 A;  2XRY A;  4KMO A;  4ILI A;  3KS2 A;  3Q47 B;  2AW6 A;  5AYW D;  3U9W A;  3CSF A;  2YIN A;  3MYV A;  2ION A;  2WQH A;  4JPS A;  4PH4 B;  3MJW A;  3Q4A B;  4AJW A;  3CVW A;  3RJV A;  2YQ8 A;  3AS8 A;  5FQ8 A;  3G2U A;  3HDX A;  2FEZ A;  4BT9 A;  4CDM A;  5LCW C;  2X6I A;  4HOQ A;  2M63 A;  3ZYK A;  3SBS A;  1Z6T A;  2AVP A;  3RRN B;  5KJL A;  4AY6 A;  1NP7 A;  1GW6 A;  3MKR A;  4PS3 A;  3CVV A;  2WXN A;  4PUC A;  2WXL A;  1OWP A;  4WND A;  1OWO A;  4A3V A;  3FUH A;  4UQZ A;  3CHR A;  3T5V A;  2CFU A;  2VSY A;  4U0Z A;  2WXK A;  3APF A;  4AV7 A;  2ILR A;  4CDN A;  4AY5 A;  1H2U A;  2VTB B;  4GYY A;  4A55 A;  4MRU A;  3UPV A;  1ELR A;  5KJK A;  3QK0 A;  3CVP A;  3TXM A;  4AVX A;  2WQ7 A;  1U3D A;  2I6H A;  4AP2 A;  2VSO E;  1DVP A;  3AS5 A;  1LF8 A;  3UT7 A;  4E6H A;  3CKC A;  3FUK A;  3FTU A;  1X5B A;  2PQN A;  1ZU2 A;  3L13 A;  3KEZ A;  3LKU A;  5FWQ A;  2WMO A;  2QFC A;  1OWL A;  1UW4 B;  2HO1 A;  2BTD A;  3QAQ A;  1QNF A;  5A23 A;  4LER A;  4H7Y A;  3LDZ A;  2MRI A;  3Q5M A;  3FH5 A;  4J0U A;  3UQ3 A;  3ML9 A;  5BV0 A;  2XRZ A;  4N3C A;  4CCA A;  2EQX A;  3L54 A;  4UI9 J;  3SNX A;  4I6G A;  4APO A;  3FUI A;  3E4B A;  3PRE A;  3ZIM A;  4G25 A;  4JXT A;  3ZXS A;  2JEK A;  3PS6 A;  3RO3 A;  1HU3 A;  2FI7 A;  3GW4 A;  3QC1 A;  2HR2 A;  3ESL A;  3DBS A;  2WQ6 A;  3MEK A;  2XGM A;  4OVV A;  2LSU A;  4UQY A;  3CK9 A;  3PDN A;  2VSX E;  3BG1 B;  3L16 A;  4UI9 K;  3APC A;  5ARG A;  4EEC A;  4UWH A;  1VDY A;  1E8W A;  4DJA A;  1SZA A;  3HYM B;  3R7R A;  3UX4 A;  3EDT B;  3PVL A;  1HG2 A;  2HM8 A;  3FUJ A;  4JEH A;  3TG4 A;  5AJL A;  4A1S A;  4TUU A;  5C1D A;  5G55 A;  2I2O A;  5FQ7 A;  1OUV A;  5LP0 A;  3FUN A;  1Z3Y A;  2C0L A;  2X6F A;  4J8S A;  5ARF A;  2J49 A;  5A7D B;  4DI4 A;  3FWV A;  4GB9 A;  3FTV A;  4TV3 A;  2GGF A;  3PE3 A;  3U66 A;  3I5P A;  3FY4 A;  3D9O A;  3GZ2 A;  4KVO A;  4XKC A;  5FQ4 A;  2NSZ A;  3G2W A;  4ACK A;  3FTX A;  4N2Q A;  4IUL A;  3APD A;  3Q15 A;  3OXF A;  4HXI A;  2XGS A;  4JHJ A;  2WXF A;  2J08 A;  2WM9 A;  2XEV A;  3LCA A;  4U0S A;  3D9P A;  2R17 C;  3JCK C;  3LY9 A;  2LNI A;  3FTZ A;  2NC9 A;  3ASG A;  4KZC A;  4BFR A;  4GPK A;  3VLD A;  4A3T A;  3IHV A;  4JHK A;  4N3B A;  4XIF A;  3G2T A;  4B8C B;  5KCM A;  5ENN A;  5JJ7 A;  3ZYQ A;  5DBK A;  3CVX A;  2KZT A;  4JA7 A;  2OOE A;  3OXG A;  2WXR A;  1HZ4 A;  2OVF A;  5LOZ A;  2VGY A;  3R7Q A;  3CHO A;  5EX3 A;  5JHB A;  3K9I A;  2YNQ A;  4CGW A;  1TEZ A;  2CFZ A;  4F53 A;  2FBN A;  4G11 A;  4KT6 B;  3CR3 A;  3LEW A;  4NUR A;  4KYO B;  5ANL A;  2WXM A;  5JJT A;  3CVY A;  3L22 A;  4I43 A;  3GYZ A;  3ZW3 A;  2WMN A;  4J8E A;  4MKT A;  3PUK A;  4I1O B;  1BPO A;  3OTN A;  4UI9 C;  3B7R L;  1E7V A;  5FZQ A;  4GCO A;  3NZS A;  4FLH A;  5D0O D;  5CCM A;  4I17 A;  1S0P A;  2A4Z A;  3FTS A;  4LUN U;  3CIA A;  4B8A A;  4Y6W A;  3O4Z A;  4BX9 A;  4L2Y A;  1HX8 A;  2YHC A;  2P58 C;  3HHM A;  4TRQ A;  4EBA G;  1IHG A;  3FFL A;  4U0U A;  5EDS A;  4FHJ A;  3VTY A;  1E8Y A;  2Y3A A;  4XX5 A;  4GZ3 A;  3EJN A;  1HH8 A;  4NQ0 A;  3TG5 A;  5C2Y A;  2LSV A;  2XHE A;  3CHM A;  5A6C A;  1ZBP A;  2CHW A;  3CHP A;  2WXI A;  3L6A A;  4C0M A;  4JL0 A;  3TL5 A;  1Y6I A;  5JHA A;  5CCL A;  4Q96 A;  3CEQ A;  1W3B A;  3ESK A;  1UJK A;  3MKQ A;  2VGX B;  3CLJ A;  4I2Z A;  4I2W A;  1OWN A;  2KZT B;  3QJZ A;  4BWR A;  1PAQ A;  4PS8 A;  4HVB A;  3D9M A;  5M72 A;  3KD7 A;  3NQP A;  4HFG A;  4D10 C;  1HXI A;  3FUD A;  4UWK A;  4ANX A;  4FHK A;  1E90 A;  4I1A A;  3MV3 B;  4EPZ A;  3U4T A;  2J4D A;  4RSY A;  4GZ6 A;  1JWF A;  3ZHE B;  1NA3 A;  4H7X A;  3IBE A;  2Y4U A;  4MS6 A;  3CK7 A;  2R59 A;  3D9I A;  3FU0 A;  3QWV A;  2X3M A;  3B7S A;  5CHE E;  4ILH B;  3O48 A;  3VLF A;  4ANV A;  3I4R B;  3RO2 A;  4HOR A;  3SZ7 A;  3HVE B;  4P29 A;  1KLX A;  4G24 A;  4GML A;  3AS4 A;  3IEG A;  3TXN A;  5FQ6 A;  4WWP A;  4HOT A;  3CHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...