4I9CA

Crystal structure of aspartyl phosphate phosphatase f from b.subtilis in complex with its inhibitory peptide
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
372
structure length
372
Chain Sequence
GVISSSSIGEKINEWYMYIRRFSIPDAEYLRREIKQELDQMEEDQDLHLYYSLMEFRHNLMLEYLEPLEKMRIEEQPRLSDLLLEIDKKQARLTGLLEYYFNFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEESNILPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQKAGDVIYLSEFEFLKSLYLSGPDEEAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYFLKVEQVRQLIQGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of Rap phosphatase inhibition by Phr peptides
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
total genus 157
structure length 372
sequence length 372
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i9cA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i9cA02
2KCVA 4GZ3A 2HR2A 4GCOA 2Q7FA 4N3CA 2VGXA 4WNGA 4BT9A 3FFLA 3FWVA 5G05J 3NF1A 2WQHA 4EQFA 3ESKA 1KT1A 5G04J 3QWPA 2FEZA 4KBQA 4N2SA 5DBKA 2LSVA 5ARGA 4UI9C 5EX3A 2HYZA 3ZGQA 2P58C 3FP3A 1HH8A 2PZIA 3QWVA 4A1SA 3ULQA 4HOQA 4HOSA 3LPZA 2KATA 3LY7A 3MEKA 3KS2A 2LSUA 3UPVA 3CV0A 4U0UA 4G26A 5JJ7A 3QDNA 2WPVA 4KYOB 4BT8A 4ME2A 3RIBA 2IFUA 4AY6A 3LCAA 3URZA 3R9AB 2KCKA 4G2VA 4HOUA 4LEUA 2L6JA 1QZ2A 4AY5A 3RO2A 4UI9J 3OXGA 2VGXB 3U3WA 4G24A 4GZ5A 3Q4AB 2FI7A 4N3BA 3BEEA 3Q47B 3LKUA 4UQZA 3CK9A 3N71A 4RG9A 3Q49B 4J8EA 3E4BA 2AVPA 5M72A 1TJCA 3LYAA 5D0QD 3CVLA 3KAEA 1XNFA 5KJLA 1OUVA 3UUXA 1YA0A 3AS4A 4JA9A 4UI9K 2C0MA 4U0SA 4I9EA 1KT0A 4WNDA 1Y8MA 3OXFA 2YHCA 4YVOA 3TG5A 4J0UA 4WUYA 2VSNA 2GW1A 2FBNA 4HORA 3Q15A 3ASHA 1P5QA 2XGSA 4CGVA 1WAO1 5FZRA 3PDNA 1KLXA 3GW4A 4BWRA 2YQ8A 2UY1A 5KJMA 1ELRA 1QQEA 4O6FA 4G25A 4N5CA 1W3BA 4G1TA 3RKVA 3QKYA 4AIFA 2MHKA 1IYGA 2R5SA 2I6HA 2XEVA 4ABNA 4N3AA 5LCWJ 4NQ0A 3VTXA 3ZHEA 4CDRA 4RG6A 4F3VA 1A17A 4I1AA 3HYMB 2XGMA 1NA3A 4GYYA 3KD7A 3IEGA 2VQ2A 4AM9A 4J8DA 5JJ6A 3VTYA 4WNEA 3ZFWA 3QWWA 5D0OD 4GYOA 3ASFA 4GA2A 2XCCA 3UQ3A 4U0ZA 2JLBA 5KJKA 2FF4A 5FZSA 1ZBPA 1NZNA 2J9QA 2BUGA 4Y6WA 1HXIA 1IHGA 4H7YA 1HZ4A 3RJVA 2UWJG 5CCLA 3S7FA 4APOA 1WM5A 3ASGA 3CVQA 2IF4A 5HI7A 3Q5MA 5LCWC 5A7DB 3MKRA 1PC2A 3CK7A 2NC9A 4HOTA 3GZ1A 2VGYA 4I2ZA 5FZQA 3U4TA 4N39A 2ONDA 4UQXA 4GPKA 3QOUA 3LY9A 4GCNA 5BNWA 4BTAA 3CK8A 5CHEE 4GA0A 4W9RA 4JHRA 3ASDA 5BW8C 1ELWA 5FTPA 5BT1A 5AYWD 4J8FA 1NA0A 2Y4TA 3CVPA 3S7DA 3WXXA 4N2QA 4I9CA 5KJNA 5CCMA 4XI0A 2HO1A 3CVNA 3MV2B 4YVQC 4GZ6A 2XGOA 4U07A 2VSYA 5ARFA 4GA1A 2VYIA 3CEQA 2OOEA 3CKBA 3MA5A 5JJTA 4XI9A 4YNDA 2C0LA 2V5FA 3TAXA 3MV3B 3RU0A 3EDTB 3RO3A 3CKCA 5HQ8A 3ZN3A 1ZU2A 3GZ2A 4JL0A 3SF4A 3AS8A 5FJYA 4Y6CA 2XCBA 5FT9A 5DIZA 3ZPJA 5EKQD 3SZ7A 3OXLA 4I17A 3LY8A 2DBAA 2KC7A 4IN3B 2LNIA 3AS5A 3PE4A 3S7BA 3TG4A 4U04A 3S7JA 4JA7A 5G05C 3PE3A 2PL2A 4BTBA 2E2EA 3TGOA 5G04C 2UY1B 4H7XA 4WNFA 4NRHB 1FCHA 2PQRA 1E96B 4I2WA 2QFCA 5A6CA 2KCLA 3K9IA 2Y4UA 4GYWA 5C1DA 2FO7A 2C2LA 2XPIA 3ZHEB 4KXKB 4UQYA 5EX0A 3GYZA 4B94A 3JYSA 1B89A 3O48A 4XIFA 2PQNA 4CGWA 4G23A
chains in the Genus database with same CATH superfamily
2FULA 4GAAA 4GZ3A 4BSZB 3TWQA 5HRYA 2VGEA 2BEDA 2Q7FA 4N3CA 2J4BA 2VGXA 2J08A 4JHKA 3QNKA 4F6RD 1TN8A 5G05J 3SNXA 3ZXPA 3QWPA 4U8VD 4KBQA 3ZIMA 2QY7A 1K1AA 2J09A 3L08A 2LSVA 3B7TA 3HVEA 2P58C 4BX9A 4EPZA 3KSQA 3FP3A 1HH8A 2IOSA 4LCTA 4A1SA 2XHEA 3UINC 2KATA 4V3IA 3EHRA 2LSUA 3CV0A 2J07A 2Y1LE 2YINA 4ACKA 4U96D 2XS8A 4ILGA 1N4QA 2Y69E 4JD2G 3JUEA 2WPVA 2I9CA 2NYJA 3FH8A 3NAWA 1SA5A 2KZTB 2LUHA 4HBDA 4BSXA 3TJPA 3E37A 3SFZA 1EDUA 2VJ8A 1JUQA 4NIKA 3ZU7B 1Z3XA 3DEOA 2FO1E 4R7LA 3FU6A 4CT4A 3V31A 1QZ2A 4IRUA 3OXGA 2VGXB 4G24A 3Q4AB 2WXNA 2E0IA 1UJKA 3BEEA 3CSTA 3MZLB 3CLJA 3N71A 2CG2A 2P9LG 2V4LA 5BXUA 3MGBA 3D9NA 2EINE 2DWZA 2RFMA 4F53A 2H6GA 1XNFA 1SZAA 3UIPC 2KM4A 4U0SA 4I9EA 3FH7A 5JHAA 3UX4A 2VSNA 2GW1A 4HORA 4LSZE 1AP7A 1P5QA 3EHMA 1MX6A 2RG8A 4FU3A 4PS8A 3GW4A 3DSUA 3T9KA 2ILRA 5KJMA 1ELRA 1QQEA 2EQXA 2R2LA 2WXMA 1E8ZA 4FLHA 2QYUA 4TUMA 2WXLA 1Z3YA 4N5CA 4B8CB 3FH5A 3TXNA 3U64A 2HE0A 4TXRA 2WMNA 3B13A 3G2SA 3SHFA 4L1BA 4Z68A 2EILE 4AVXA 4ABNA 3ZHEA 1A17A 4FP7A 5CBOA 3HYMB 3G2UA 3PZ3A 5KCMA 3T5XA 2ZGGA 3SO8A 4PH4B 3ZXSA 4DX7D 2ZISA 2HM8A 3KD7A 3IEGA 4J8DA 2PM7A 5LX8A 4WNEA 4WAFA 3ZFWA 5D0OD 1EPUA 2A5UA 3Q7FA 3ML8A 2JLBA 3UKRG 1NZNA 4HRLA 3OTNA 2NSZA 4K5CA 2WXIA 1K3ZD 2CHWA 3FEXA 4APOA 4MLPA 3TWRA 3C5RA 1TNUA 1WM5A 3ASGA 4K0RA 3IHYA 3MKRA 2I1KA 4EZKA 3C3OA 4I2ZA 4Q69A 3CHMA 3EJNA 5ENPD 3Q75A 4N39A 4KVOA 2H6FA 1FT1A 4GCNA 5BNWA 4I1OB 3SD5A 1PY1A 3IHVA 3E34A 3PREA 4YDYA 4WWPA 1MQSA 4FADA 2OVFA 5BV1A 2PNNA 3L82A 5BT1A 1E8YA 4N2QA 4IYPA 4XI0A 4CZ2D 3DPYA 1SW6A 3MYVA 3J5PA 3KEZA 4TRQA 3DBSA 5ARFA 3CHPA 4XE0A 4GTSA 2WXOA 2F0YA 2OOEA 5ENNA 3ML9A 2EIME 4HQDA 3TAXA 3MV3B 3FULA 3RU0A 1K8KG 3RO3A 4Q96A 4JL0A 3SF4A 2OEWA 4AEZC 2XCBA 4LRZA 3Q9NC 3ZPJA 5EKQD 3SZ7A 2WM9A 3HG0D 4HVBA 2DBAA 3J5QB 4IN3B 2LNIA 2P9UG 3PUJA 4U04A 1H0AA 3PE3A 2E2EA 4HB5A 3TGOA 3APFA 2V4HC 4TV3A 4L2YA 2OVBA 4FJYA 3B95A 2DZNA 1E96B 3V30A 3RSEG 4DJAA 4F7AA 4FC8A 2QFCA 3CVXA 4AV7A 2KCLA 3K9IA 2Y4UA 3KEAA 5C1DA 1AWCB 5G55A 3PEUB 4JW1A 4UQYA 3BG0B 2JABA 3JYSA 3FEYA 3PH0C 2PQNA 2GRMA 4G23A 1N94A 3ABKE 3DEPA 4JHJA 4GCOA 4EBAG 1TEZA 3AAAC 2VSOE 2CFUA 3FFLA 3UTMA 3NF1A 5LOZA 3AG3E 4EHMA 2VTBA 3NZUA 4A3TA 5ARGA 2AXUA 3CSFA 4B0ZA 4HNAD 2ZXWE 2LO6A 3MKQA 4XX5A 2QZAA 3G2VA 2WXKA 1H2UA 3FUFA 2ETCA 4EBAA 3UI2A 3FHEA 1OWMA 3MEKA 3UT7A 5FINA 3PZDA 3CVYA 4U0UA 1OCOE 3T8MA 1O5MA 4BT8A 3LS8A 5ENQD 3LVRE 5CERB 2ZIRA 3RIBA 2WMOA 3U66A 1V54E 1Q2ZA 3SBSA 4LEUA 3IBEA 2WB2A 1H6OA 5KNGA 4AY5A 4GTMA 3JQ0A 3U3WA 4GMRA 3O4ZA 2FI7A 3D9HA 1OY3D 2WXHA 1INZA 3Q47B 3C72A 4RG9A 2VTBB 4WWNA 3FTWA 4J8EA 3I3NA 1JWFA 3SY2A 1TJCA 2X3MA 4ATZD 2IO3C 4BESA 3PUKA 3KAEA 2JEKA 5KJLA 3IV0A 1OUVA 1TN6A 1TJFA 3UUXA 1YA0A 4OAUC 5FWQA 3APDA 3C3RA 2C0MA 3P2BA 4M3OA 3BG1B 1YCSB 1VDYA 5EIDA 1BI7B 4EZJA 4I43A 4CGVA 1WAO1 5FZRA 4JXTA 2H6HA 1BD8A 3LJ3A 3UM3A 5KBAA 3CQGB 3SFXA 4RSYA 1OWPA 3LJNA 3SGHA 4O6FA 1A5EA 3DRAA 4DX6D 1QBQA 5ENOD 3ZW3A 1S70B 3FTZA 2R02A 4AIFA 2MHKA 1KZPA 2R5SA 3ZYQA 4BY6A 3T5VA 4L23A 2A5EA 4RG6A 4MKTA 4F3VA 1X5BA 3HXCA 1MZCA 2QC9A 1NA3A 3ZYMA 4GYYA 4F1PA 4UWLA 2VQ2A 4WWOA 4GZCA 3QWWA 2WXFA 3L22A 1UJJA 3DWLG 4DUIA 3FUDA 4K03A 1H6KA 4GA2A 2XCCA 3UQ3A 1NL4A 4N5QA 3FTSA 5KJKA 2IOLA 2J9QA 4I6JA 4F1SA 3CVUA 4Y6WA 3ESLA 1HZ4A 4HXIA 3HVEB 4K5BA 2UWJG 3SFYA 3EHQA 5CCLA 2DIWA 3S7FA 3NB2A 1TR4A 4UWHA 3SBTB 4GB9A 3T8KA 3UMVA 3PNLB 4EZLA 5A7DB 3ZVVA 1PC2A 2NC9A 3MJWA 3C98A 3GZ1A 5B1BE 1HX8A 3U4TA 3UKUG 2GGFA 5EDSA 1JCRA 4MS6A 1IKND 3ASDA 1NA0A 3CVPA 5AJDA 4OYSA 5KJNA 4JZYA 1YMPA 3CVNA 1HFAA 2X6IA 2YHEA 2KXPC 4YVQC 4GZ6A 2DVWA 3AU5A 4NURA 2I2OA 3PS6A 4U07A 3FUKA 4IULA 3EU5A 4ANWA 2VSYA 3ULYA 5ENRD 3IXEA 4FJZA 1ZB1A 4DX1A 1D8EA 4KVMA 1MHQA 5AQAA 1IXVA 1N95A 3RRUA 3MA5A 3SI5A 5JJTA 4URKA 5FIOA 4YNDA 2V5FA 3WG7E 1O1SA 1HU3A 1UN8A 1U3DA 3PZ2A 2AXZA 4GTPA 3UT4A 1EYHA 3GZ2A 2VSXE 2ZGDA 3D9KA 2V0PA 4QQIA 4LERA 5FT9A 3AU4A 1LD8A 2MRIA 3AG1E 3FTXA 3APCA 4DI4A 3PVLA 3PE4A 2P9SG 3E30A 4DRXE 1MX2A 2OEVA 5G04C 3CR3A 1FCHA 1KPSB 2PQRA 3NOGD 2AXVA 4Q94A 4KZ0A 2MYOA 4I2WA 5FQ6A 4C9BB 5A6CA 2L0IA 2I1JA 3DSWA 4HRMB 3UT8A 3HXEA 1BI8B 5J90A 2J8SD 3ZHEB 1EF1C 4KXKB 3ONKA 5JMND 2H6IA 1OWNA 2F8YA 4B94A 5AIJA 3O48A 5CMWA 5JA4D 4YDOA 2GRNB 4LNBA 1DC2A 4GTOA 5ANRA 3E32A 1HE8A 3ENEA 3G2TA 5CEDB 2KCVA 4A1GA 2XEEA 4CCAA 3HHMA 1U2VG 4BT9A 4DLQA 3MX3A 3FWVA 2WQHA 1X81A 3ESKA 5G04J 1H2TC 4OVUA 1LD7A 4N2SA 5EN5D 3E33A 1OWLA 3ABME 4UWFA 4CDNA 3ZGQA 3ZRHA 3D9PA 5E76A 2R05A 3QWVA 4XKCA 2CHZA 5IY5E 1E7VA 3ULQA 4HOQA 3LPZA 4RVBA 3B7BA 2P9NG 4QFVA 1Z5SC 1OCCE 4G26A 5JJ7A 3BU8A 3TXMA 1DVPA 3D9LA 4ACLA 1HF8A 1SVXA 1IQRA 4KYOB 2EIJE 3I4GA 5AQ9A 1WG0A 1JWGA 3URZA 2KCKA 4G2VA 4HOUA 4JVSA 2L6JA 3ONLA 2ZU6B 4G8KA 1OT8A 3TWSA 4GZ5A 3UM1A 4N3BA 2IU1A 3LKUA 4FHJA 2DZOA 1N11A 4L9PA 3Q49B 2AVPA 1IQUA 4J6IA 4B8AA 3LYAA 1D8DA 1Z6TA 1V55E 4GTRA 3EHNA 1SZ9A 3QJZA 4JA9A 3HDXA 2XS1A 2AWIA 3LXUX 1NI1A 4HI8A 1Y8MA 3OXFA 1H2VC 2XZDG 3FTYA 2YHCA 2WQ7A 3TG5A 1QNFA 4J0UA 4WUYA 3JCKC 3PZ1A 3Q15A 3ASHA 3D3MA 2P2CP 3FUEA 3PDNA 1KLXA 1SA4A 4AP2A 2RKKA 4BETA 2UY1A 1Y6IA 5BPPA 3RAUA 4I1MA 3RKVA 3QKYA 1E8XA 3PEVB 4GTQA 4CEMA 3CGHA 4N3AA 5LCWJ 3VTXA 5ENSD 4CDRA 4TXPA 5AAOA 4ILIA 2IY0C 3OAWA 4LG6A 4RLYA 4B89A 1LF8A 5ANLA 5D66A 4X8QA 2XQ0A 4CT0A 3V2XA 2F8XK 4G8LA 2WXJA 5JJ6A 3ULEG 3L16A 4DLOA 4AJWA 5AJLA 4J7WA 4LNGA 4PUCA 3B7RL 3CVWA 3S2AA 4JEUA 1N0RA 4CDMA 1N0QA 2PM6A 3IKOB 2B6CA 4KMOA 2BUGA 4OAVB 1HXIA 1IHGA 4FLBA 4JEHA 4P29A 3ASNE 4C0MA 3DSXA 1HS6A 3MKQB 2OV8A 4GMLA 4UWKA 3B7SA 3CVQA 3Q5MA 1UOHA 3JQ1A 3CK7A 1HG5A 4GTVA 4JPSA 2VGYA 2J4DA 3BQOA 4XEIG 1OCZE 3EU9A 2ONDA 1N4RA 4UQXA 5CRUA 1E7UA 4BTAA 5CEAA 5BW8C 1N9AA 4AOFA 1ELWA 1JCQA 5FTPA 1WY6A 4ZFHA 1BU9A 5AYWD 2X38A 4J8FA 1UG3A 5J08A 2Y4TA 3S7DA 3WXXA 4I9CA 5T8IA 5CCMA 5CRVA 2LAHA 4FA6A 3ZKJA 4LUNU 2X6JA 5AENA 3L13A 2DYSE 2CHXA 3QARA 3LDZA 3UIOC 3LVQE 3KSLA 2XEHA 4GU5A 4I6EA 2ETAA 3CEQA 2V8SE 1TNOA 4ANUA 4XI9A 1TN7A 4RQIA 2F37A 1MJ0A 1BPOA 2RD0A 1FT2A 4KZCA 3EDTB 3B7UX 1E8WA 5HQ8A 2BKKB 1O1TA 2P9PG 4TXQA 5FJYA 4Y6CA 2IJGX 3L6AA 4HLLA 5EILA 5G2NA 4E6HA 4I17A 3MCXA 1FVHA 2KC7A 3LEWA 4L2LA 2L0TB 2DYRE 3AS5A 4GMJA 3S7BA 1S0PA 1U3CA 3S7JA 4JA7A 2PL2A 3NQPA 4BTBA 3V79K 1DCQA 1KZOA 4APFA 4H7XA 4WNFA 1IHBA 1N54A 4JB8P 3FTVA 4DI3A 3R7QA 3DSSA 3VLDA 4L7TA 4GYWA 1N4PA 4U7EB 3D9JA 2FO7A 4FULA 4YDWA 5CMYA 2C2LA 1FVFA 2XPIA 3NZSA 2OCCE 4HRNA 4BERA 5EX0A 1JCSA 2KBXA 4FHKA 3JXIA 3P1UA 4XIFA 4CGWA 1E90A 2NXPA 3ZNGA 3R9MA 1WDYA 3PRZA 5H7PA 5LFAA 3TL5A 2L6BA 3FU5A 2HR2A 2X6FA 4K5AB 1RW2A 4JC8A 4WNGA 1TNBA 2R03A 1G3NB 3DSTA 4CYMD 1BLXB 4EQFA 1KT1A 3FUIA 1TYQG 3CHSA 2FEZA 3CHQA 4TUUA 5DBKA 3Q73A 4ILHB 4UI9C 2XPZA 5EX3A 4CRWA 1TNYA 2HYZA 1QYMA 3FU3A 2GRPB 3PZ4A 3GZSA 2PZIA 3HXBA 3L9TA 4HOSA 1OXJA 4D10C 3LY7A 2WQ6A 4DX5D 3KS2A 1SQMA 2GRLA 5HKPA 4O1OA 3UPVA 2IONA 2RFAA 2XENA 3Q78A 3QC1A 3QDNA 4MBGA 5T4YA 3PNTB 2GRRB 4ME2A 3AG4E 4E85A 2IFUA 3VLEA 4AY6A 3LCAA 3R9AB 3RRNB 4J8YA 2BF0X 3DPDA 4GZDA 2ETBA 4UI9J 3RO2A 2AW6A 2P9IG 4ANXA 4HFGA 3TWVA 3ZUVB 4UQZA 3CK9A 4BEPA 3NOCD 3C3QA 3TWXA 4AXHA 3E4BA 1K1BA 5M72A 4O60A 5ITZF 1UN9A 2GRQB 1UW4B 1D9SA 5D0QD 3Q7AA 3JUIA 4GPMA 3CVLA 3ZYKA 3HIZA 5CBNA 3AS4A 2Y3AA 4UWGA 1OWOA 4UI9K 5B3SE 3FUNA 4G11A 3D9OA 2Y0BG 3FY4A 1KT0A 4WNDA 3L17A 3CVVA 4YVOA 5ENTD 4I6GA 4XKBA 2EIKE 4PDXA 2FBNA 2WXPA 2XGSA 3CIAA 4BX8A 5FQ7A 3ZEFA 5BXOA 4BWRA 5KNHD 3AG2E 2YQ8A 4GTTA 3TWUA 3W9GA 2YNQA 1HG2A 4A63B 1MYOA 4G25A 1W3BA 4G1TA 4U95D 2XZTG 2MOWA 3I5PA 2X6HA 5AARA 1IYGA 2I6HA 1O1RA 2XEVA 3L54A 4U8YD 2XRYA 5CECB 1DNPA 4NQ0A 1S63A 2LXMA 4ANVA 4I1AA 2QYJA 4B93B 3Q79A 3G2WA 1TNZA 2XGMA 1XGWA 2X6KA 4PS7A 2J49A 4AM9A 4UUCA 3Q9UC 3HRAA 3VTYA 2CFZA 1S64A 3FUJA 4A3VA 3W9FA 3EIJA 5FQ8A 2IQCA 4GYOA 4KT6B 5AN8A 3ASFA 3UXGA 4C0EA 3V2OA 4BFRA 4U0ZA 2FF4A 2BTDA 5FZSA 2XPYA 5B1AE 2BKGA 4EECA 1ZBPA 5C2YA 3BUAA 1NFIE 2B0OE 3FDHA 3TWWA 4H7YA 1NP7A 5EYLA 3DXKG 2CG3A 3RJVA 2L9BA 3ZYLA 2R17C 4ATGA 4ZHBA 3FU0A 2AJAA 2LXLA 3UM0A 4XZ4A 5BUZA 5EIBE 2XRZA 2IF4A 5HI7A 5LCWC 2LAIA 1LTXA 3ASOE 5HS0A 4HOTA 5FZQA 2DCPA 2WXRA 4GPKA 3QOUA 3LY9A 5EYPF 1PAQA 3DXMG 3CK8A 5CHEE 4GA0A 4NACA 4W9RA 3TWTA 1H19A 4JHRA 1L5JA 3EIQC 1YYHA 3R7RA 4DX2A 3RRMB 4YDEA 3RK6A 3F6QA 2R59A 5AQBA 2HO1A 3AJIA 3DSVA 3ABLE 2IO2C 4J8SA 3MV2B 3FUMA 4PS3A 2XGOA 4A55A 1N52A 1MX4A 2P9KG 1FPPA 4GA1A 4U8HA 4M7CA 3UM2A 3I4RB 5E75A 2VYIA 1HO8A 2M63A 5T3RA 3CKBA 4HI9A 3D9MA 3HXFA 2WXGA 3JXJA 3QK0A 2C0LA 2A4ZA 3EUVA 3CKCA 3U9WA 3NBNB 3ZN3A 1N4SA 1ZU2A 3ISMC 1ELKA 3AS8A 3QB2A 5DIZA 1H6PA 3CQCB 4MRUA 5D2MC 2WVIA 3OXLA 3LY8A 5BV0A 3HXDA 4U63A 1JPLA 2GROB 4HS2A 4DPRA 3TG4A 1DCEA 5G05C 2UY1B 2WXQA 3QAQA 4NRHB 3VLFA 3CHOA 5KWDA 4DK5A 4OVVA 3SQVA 1RZ4A 5A23A 2V5QC 4O1PA 5JHBA 2IEJA 3D9IA 3CHRA 4LNUD 3FUHA 1GW6A 1OCRE 5AQ7A 3FTUA 3GYZA 3X2QE 5FQ4A 4C48B 2KZTA 5LP0A 1B89A 4HLEA
chains in the Genus database with same CATH topology
2FULA 2KCVA 3PRZA 4GAAA 4A1GA 4GZ3A 5LFAA 4CCAA 3TL5A 3HHMA 3FU5A 2HR2A 4GCOA 4JHJA 2X6FA 2Q7FA 4N3CA 4EBAG 2J4BA 4JC8A 2VGXA 2J08A 4WNGA 4BT9A 4DLQA 4JHKA 3QNKA 1TEZA 2VSOE 2CFUA 3FFLA 3MX3A 3FWVA 5G05J 3SNXA 3NF1A 5LOZA 2WQHA 4EQFA 3ESKA 1KT1A 5G04J 1H2TC 4OVUA 3FUIA 3QWPA 3CHSA 2FEZA 4KBQA 3CHQA 3ZIMA 2VTBA 4N2SA 4TUUA 2QY7A 5DBKA 2J09A 1OWLA 3L08A 3NZUA 4ILHB 2LSVA 4UWFA 4A3TA 4UI9C 2XPZA 5ARGA 2AXUA 5EX3A 4CDNA 4CRWA 3B7TA 2HYZA 3HVEA 3ZGQA 3CSFA 3ZRHA 4B0ZA 2P58C 3D9PA 2LO6A 3MKQA 4BX9A 4XX5A 3FU3A 4EPZA 3FP3A 3GZSA 3G2VA 1HH8A 5E76A 2PZIA 2WXKA 1H2UA 2IOSA 3FUFA 3QWVA 2CHZA 4XKCA 4LCTA 4A1SA 1E7VA 4EBAA 3ULQA 2XHEA 4HOQA 4HOSA 4D10C 3LPZA 3FHEA 4RVBA 2KATA 3LY7A 1OWMA 2WQ6A 3MEKA 4V3IA 3KS2A 2LSUA 1SQMA 2GRLA 3UT7A 3UPVA 3PZDA 3CV0A 2IONA 3CVYA 2J07A 2YINA 4ACKA 4QFVA 4U0UA 4G26A 5JJ7A 4ILGA 3TXMA 1DVPA 3QC1A 3D9LA 3QDNA 4ACLA 1HF8A 2WPVA 2I9CA 5T4YA 3T8MA 1IQRA 3PNTB 3FH8A 4KYOB 3I4GA 4BT8A 3LS8A 2KZTB 4BSXA 4ME2A 3TJPA 3LVRE 3SFZA 1EDUA 3RIBA 4E85A 2WMOA 2IFUA 1JWGA 3VLEA 4AY6A 2VJ8A 1JUQA 3LCAA 3U66A 3URZA 3R9AB 2KCKA 4G2VA 4HOUA 3SBSA 4JVSA 1Z3XA 4LEUA 3RRNB 3IBEA 4R7LA 2L6JA 3FU6A 4CT4A 2BF0X 2WB2A 3DPDA 4GZDA 1QZ2A 4AY5A 4IRUA 4UI9J 3OXGA 3ONLA 3RO2A 2VGXB 2ZU6B 3JQ0A 3U3WA 4G24A 2AW6A 3Q4AB 2WXNA 4GZ5A 3O4ZA 2FI7A 2E0IA 4N3BA 4ANXA 1UJKA 3BEEA 2WXHA 1INZA 3Q47B 2IU1A 4HFGA 3CSTA 3LKUA 3MZLB 3CLJA 4UQZA 3CK9A 4FHJA 3N71A 4RG9A 2VTBB 2CG2A 4WWNA 2V4LA 3FTWA 3MGBA 3Q49B 4J8EA 3I3NA 3D9NA 3E4BA 4AXHA 2AVPA 1JWFA 5M72A 1IQUA 4J6IA 4B8AA 1TJCA 2X3MA 3LYAA 1Z6TA 1UN9A 4F53A 1UW4B 5D0QD 3PUKA 3JUIA 3CVLA 3ZYKA 3KAEA 2JEKA 1XNFA 3EHNA 3IV0A 5KJLA 1OUVA 3HIZA 1SZAA 1TJFA 3UUXA 1YA0A 1SZ9A 3AS4A 5FWQA 2Y3AA 3QJZA 2KM4A 4JA9A 1OWOA 4UI9K 4UWGA 3FUNA 3HDXA 3APDA 4G11A 2AWIA 3D9OA 3FY4A 2C0MA 3LXUX 4U0SA 4I9EA 1KT0A 4WNDA 1Y8MA 3FH7A 3OXFA 1H2VC 3L17A 3CVVA 3FTYA 2YHCA 3P2BA 4YVOA 2WQ7A 4M3OA 3TG5A 1QNFA 3BG1B 5JHAA 4I6GA 4J0UA 4WUYA 4XKBA 3UX4A 2VSNA 1VDYA 2GW1A 3JCKC 4PDXA 2FBNA 4EZJA 4HORA 3Q15A 3ASHA 1P5QA 2WXPA 2XGSA 3D3MA 3CIAA 4I43A 4CGVA 4BX8A 1WAO1 5FZRA 3EHMA 4JXTA 3FUEA 3PDNA 4PS8A 2RG8A 4FU3A 5FQ7A 3ZEFA 3LJ3A 1KLXA 3CQGB 3GW4A 4BWRA 2YQ8A 4AP2A 4RSYA 1OWPA 2ILRA 2YNQA 2UY1A 5KJMA 1ELRA 1QQEA 1HG2A 3SGHA 2EQXA 2WXMA 1E8ZA 4O6FA 4G25A 4FLHA 1Y6IA 5BPPA 2WXLA 1Z3YA 4N5CA 4B8CB 3FH5A 1W3BA 4G1TA 4I1MA 3TXNA 2MOWA 3ZW3A 3U64A 3FTZA 2X6HA 3I5PA 3QKYA 3RKVA 4AIFA 2MHKA 1IYGA 1E8XA 2WMNA 3PEVB 2R5SA 3B13A 3G2SA 2I6HA 3SHFA 3ZYQA 2XEVA 4BY6A 4CEMA 3T5VA 3CGHA 3L54A 4L1BA 4L23A 4AVXA 4ABNA 2XRYA 4N3AA 1DNPA 4NQ0A 3VTXA 3ZHEA 5LCWJ 4CDRA 4RG6A 4MKTA 4F3VA 1A17A 1X5BA 4I1AA 4ANVA 4FP7A 3HYMB 3G2UA 3G2WA 4ILIA 3OAWA 2XGMA 1XGWA 5KCMA 3T5XA 2X6KA 4B89A 1LF8A 5ANLA 4PH4B 4PS7A 2J49A 3ZXSA 1NA3A 3ZYMA 2XQ0A 4GYYA 4CT0A 2HM8A 3KD7A 4UWLA 3IEGA 2VQ2A 4AM9A 4J8DA 2PM7A 2WXJA 5LX8A 4WWOA 5JJ6A 3VTYA 4GZCA 4WNEA 4WAFA 2CFZA 3ZFWA 3FUJA 4A3VA 3EIJA 3L16A 2WXFA 3L22A 3QWWA 1UJJA 5D0OD 4DLOA 4AJWA 5AJLA 1EPUA 2IQCA 4GYOA 5FQ8A 4PUCA 2A5UA 4KT6B 3FUDA 4C0EA 3ASFA 4K03A 3B7RL 1H6KA 4GA2A 2XCCA 3CVWA 3S2AA 3UQ3A 3ML8A 4JEUA 4BFRA 3FTSA 4CDMA 4U0ZA 2JLBA 5KJKA 2FF4A 2PM6A 2BTDA 5FZSA 2XPYA 3IKOB 2IOLA 4KMOA 3G2TA 4EECA 1ZBPA 1NZNA 5C2YA 2J9QA 2BUGA 4I6JA 3FDHA 3OTNA 4F1SA 3CVUA 4Y6WA 1HXIA 1IHGA 2NSZA 3ESLA 4H7YA 1NP7A 1HZ4A 4FLBA 2WXIA 4JEHA 4P29A 4HXIA 4C0MA 2CG3A 3HVEB 2CHWA 3RJVA 2UWJG 5CCLA 2DIWA 2L9BA 1HS6A 2R17C 3FEXA 3MKQB 2OV8A 3S7FA 3ZYLA 4MLPA 4APOA 4GMLA 4ATGA 4UWKA 3FU0A 4UWHA 3SBTB 1WM5A 3ASGA 4GB9A 4K0RA 3B7SA 4XZ4A 5BUZA 2XRZA 3CVQA 3UMVA 3IHYA 3PNLB 2IF4A 5HI7A 3Q5MA 4EZLA 5LCWC 5A7DB 3ZVVA 3JQ1A 3MKRA 2LAIA 1PC2A 2I1KA 1HG5A 2NC9A 3CK7A 4EZKA 4HOTA 3MJWA 5FJYA 3C98A 4JPSA 3GZ1A 2VGYA 2J4DA 4I2ZA 1HX8A 4Q69A 3CHMA 3EJNA 5FZQA 3U4TA 2DCPA 4N39A 2ONDA 2GGFA 2WXRA 4UQXA 4KVOA 4GPKA 3QOUA 3LY9A 4GCNA 5BNWA 1E7UA 4I1OB 4BTAA 5EDSA 1PAQA 3SD5A 1PY1A 3CK8A 3IHVA 5CHEE 4MS6A 4GA0A 4NACA 4W9RA 1H19A 3PREA 4JHRA 1L5JA 3ASDA 3EIQC 4WWPA 5BW8C 1MQSA 4FADA 2OVFA 5BV1A 4AOFA 1ELWA 5FTPA 1WY6A 5BT1A 5AYWD 2X38A 4J8FA 1UG3A 5J08A 1NA0A 2Y4TA 3CVPA 3R7RA 1E8YA 3RRMB 3S7DA 3WXXA 4AEZC 5AJDA 4OYSA 4I9CA 4N2QA 5KJNA 5T8IA 5CCMA 3RK6A 4IYPA 2LAHA 2R59A 4XI0A 2HO1A 4JZYA 4FA6A 4LUNU 2X6JA 3CVNA 4J8SA 5AENA 3L13A 1HFAA 3MV2B 2X6IA 3FUMA 2YHEA 4YVQC 4GZ6A 3MYVA 3AU5A 4NURA 4PS3A 3KEZA 2CHXA 2I2OA 3PS6A 2XGOA 4TRQA 4U07A 3QARA 3FUKA 3LDZA 4IULA 4A55A 1N52A 3DBSA 4ANWA 2VSYA 3CHPA 3LVQE 4XE0A 5ARFA 4GA1A 4FJZA 4U8HA 3I4RB 1MHQA 4KVMA 5E75A 2VYIA 1HO8A 2WXOA 4GU5A 4I6EA 3CEQA 2M63A 2V8SE 2OOEA 5ENNA 3CKBA 3ML9A 5T3RA 3RRUA 4ANUA 3D9MA 2WXGA 3MA5A 3SI5A 5JJTA 4URKA 4XI9A 3QK0A 4YNDA 2C0LA 2V5FA 2A4ZA 1HU3A 1UN8A 1U3DA 3TAXA 1BPOA 2RD0A 3MV3B 3FULA 3RU0A 2AXZA 4KZCA 3EDTB 3UT4A 3RO3A 3CKCA 3U9WA 1EYHA 3B7UX 4Q96A 1E8WA 5HQ8A 3ZN3A 1ZU2A 3GZ2A 4JL0A 2VSXE 3SF4A 3D9KA 1ELKA 3AS8A 3QB2A 2IJGX 2V0PA 2XCBA 4LERA 3AU4A 3L6AA 4Y6CA 5DIZA 4LRZA 5FT9A 3ZPJA 3CQCB 4MRUA 5EKQD 5G2NA 3SZ7A 4E6HA 2WVIA 2WM9A 2MRIA 3OXLA 4I17A 3MCXA 3LY8A 3FTXA 1FVHA 2DBAA 4HVBA 2KC7A 5BV0A 3APCA 3LEWA 4U63A 1JPLA 4IN3B 4DI4A 4HS2A 2LNIA 4L2LA 4DPRA 2L0TB 3PVLA 3AS5A 3PUJA 3PE4A 4GMJA 3S7BA 3TG4A 1S0PA 4U04A 1U3CA 1H0AA 3S7JA 4JA7A 5G05C 3PE3A 2PL2A 3NQPA 4BTBA 2E2EA 3TGOA 5G04C 3APFA 3CR3A 2UY1B 2WXQA 4APFA 4TV3A 3QAQA 4H7XA 4L2YA 4WNFA 2OVBA 4NRHB 1FCHA 1N54A 3CHOA 3VLFA 2PQRA 4FJYA 3FTVA 4DK5A 2AXVA 1E96B 4OVVA 4DI3A 3R7QA 4DJAA 4Q94A 4F7AA 4KZ0A 5A23A 5FQ6A 4I2WA 3VLDA 4FC8A 4C9BB 2QFCA 5JHBA 5A6CA 4AV7A 3CVXA 4L7TA 2KCLA 2L0IA 2I1JA 3K9IA 2Y4UA 4GYWA 3D9IA 3UT8A 3CHRA 5C1DA 3D9JA 2FO7A 4FULA 5J90A 5G55A 3FUHA 5CMYA 2C2LA 3PEUB 1FVFA 1GW6A 2XPIA 3ZHEB 4JW1A 1EF1C 3NZSA 4KXKB 4UQYA 3ONKA 5EX0A 3FTUA 3GYZA 4FHKA 3BG0B 5FQ4A 1OWNA 2KZTA 5LP0A 4B94A 5AIJA 3JYSA 1B89A 3O48A 3P1UA 4XIFA 3FEYA 5CMWA 3PH0C 2PQNA 4CGWA 2GRMA 1E90A 5ANRA 1HE8A 2NXPA 4HLEA 4G23A 3ENEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCV A;  4GZ3 A;  2HR2 A;  4GCO A;  2Q7F A;  4N3C A;  2VGX A;  4WNG A;  4BT9 A;  3FFL A;  3FWV A;  5G05 J;  3NF1 A;  2WQH A;  4EQF A;  3ESK A;  1KT1 A;  5G04 J;  3QWP A;  2FEZ A;  4KBQ A;  4N2S A;  5DBK A;  2LSV A;  5ARG A;  4UI9 C;  5EX3 A;  2HYZ A;  3ZGQ A;  2P58 C;  3FP3 A;  1HH8 A;  2PZI A;  3QWV A;  4A1S A;  3ULQ A;  4HOQ A;  4HOS A;  3LPZ A;  2KAT A;  3LY7 A;  3MEK A;  3KS2 A;  2LSU A;  3UPV A;  3CV0 A;  4U0U A;  4G26 A;  5JJ7 A;  3QDN A;  2WPV A;  4KYO B;  4BT8 A;  4ME2 A;  3RIB A;  2IFU A;  4AY6 A;  3LCA A;  3URZ A;  3R9A B;  2KCK A;  4G2V A;  4HOU A;  4LEU A;  2L6J A;  1QZ2 A;  4AY5 A;  3RO2 A;  4UI9 J;  3OXG A;  2VGX B;  3U3W A;  4G24 A;  4GZ5 A;  3Q4A B;  2FI7 A;  4N3B A;  3BEE A;  3Q47 B;  3LKU A;  4UQZ A;  3CK9 A;  3N71 A;  4RG9 A;  3Q49 B;  4J8E A;  3E4B A;  2AVP A;  5M72 A;  1TJC A;  3LYA A;  5D0Q D;  3CVL A;  3KAE A;  1XNF A;  5KJL A;  1OUV A;  3UUX A;  1YA0 A;  3AS4 A;  4JA9 A;  4UI9 K;  2C0M A;  4U0S A;  4I9E A;  1KT0 A;  4WND A;  1Y8M A;  3OXF A;  2YHC A;  4YVO A;  3TG5 A;  4J0U A;  4WUY A;  2VSN A;  2GW1 A;  2FBN A;  4HOR A;  3Q15 A;  3ASH A;  1P5Q A;  2XGS A;  4CGV A;  1WAO 1;  5FZR A;  3PDN A;  1KLX A;  3GW4 A;  4BWR A;  2YQ8 A;  2UY1 A;  5KJM A;  1ELR A;  1QQE A;  4O6F A;  4G25 A;  4N5C A;  1W3B A;  4G1T A;  3RKV A;  3QKY A;  4AIF A;  2MHK A;  1IYG A;  2R5S A;  2I6H A;  2XEV A;  4ABN A;  4N3A A;  5LCW J;  4NQ0 A;  3VTX A;  3ZHE A;  4CDR A;  4RG6 A;  4F3V A;  1A17 A;  4I1A A;  3HYM B;  2XGM A;  1NA3 A;  4GYY A;  3KD7 A;  3IEG A;  2VQ2 A;  4AM9 A;  4J8D A;  5JJ6 A;  3VTY A;  4WNE A;  3ZFW A;  3QWW A;  5D0O D;  4GYO A;  3ASF A;  4GA2 A;  2XCC A;  3UQ3 A;  4U0Z A;  2JLB A;  5KJK A;  2FF4 A;  5FZS A;  1ZBP A;  1NZN A;  2J9Q A;  2BUG A;  4Y6W A;  1HXI A;  1IHG A;  4H7Y A;  1HZ4 A;  3RJV A;  2UWJ G;  5CCL A;  3S7F A;  4APO A;  1WM5 A;  3ASG A;  3CVQ A;  2IF4 A;  5HI7 A;  3Q5M A;  5LCW C;  5A7D B;  3MKR A;  1PC2 A;  3CK7 A;  2NC9 A;  4HOT A;  3GZ1 A;  2VGY A;  4I2Z A;  5FZQ A;  3U4T A;  4N39 A;  2OND A;  4UQX A;  4GPK A;  3QOU A;  3LY9 A;  4GCN A;  5BNW A;  4BTA A;  3CK8 A;  5CHE E;  4GA0 A;  4W9R A;  4JHR A;  3ASD A;  5BW8 C;  1ELW A;  5FTP A;  5BT1 A;  5AYW D;  4J8F A;  1NA0 A;  2Y4T A;  3CVP A;  3S7D A;  3WXX A;  4N2Q A;  4I9C A;  5KJN A;  5CCM A;  4XI0 A;  2HO1 A;  3CVN A;  3MV2 B;  4YVQ C;  4GZ6 A;  2XGO A;  4U07 A;  2VSY A;  5ARF A;  4GA1 A;  2VYI A;  3CEQ A;  2OOE A;  3CKB A;  3MA5 A;  5JJT A;  4XI9 A;  4YND A;  2C0L A;  2V5F A;  3TAX A;  3MV3 B;  3RU0 A;  3EDT B;  3RO3 A;  3CKC A;  5HQ8 A;  3ZN3 A;  1ZU2 A;  3GZ2 A;  4JL0 A;  3SF4 A;  3AS8 A;  5FJY A;  4Y6C A;  2XCB A;  5FT9 A;  5DIZ A;  3ZPJ A;  5EKQ D;  3SZ7 A;  3OXL A;  4I17 A;  3LY8 A;  2DBA A;  2KC7 A;  4IN3 B;  2LNI A;  3AS5 A;  3PE4 A;  3S7B A;  3TG4 A;  4U04 A;  3S7J A;  4JA7 A;  5G05 C;  3PE3 A;  2PL2 A;  4BTB A;  2E2E A;  3TGO A;  5G04 C;  2UY1 B;  4H7X A;  4WNF A;  4NRH B;  1FCH A;  2PQR A;  1E96 B;  4I2W A;  2QFC A;  5A6C A;  2KCL A;  3K9I A;  2Y4U A;  4GYW A;  5C1D A;  2FO7 A;  2C2L A;  2XPI A;  3ZHE B;  4KXK B;  4UQY A;  5EX0 A;  3GYZ A;  4B94 A;  3JYS A;  1B89 A;  3O48 A;  4XIF A;  2PQN A;  4CGW A;  4G23 A; 
#chains in the Genus database with same CATH topology
 2FUL A;  4GAA A;  4GZ3 A;  4BSZ B;  3TWQ A;  5HRY A;  2VGE A;  2BED A;  2Q7F A;  4N3C A;  2J4B A;  2VGX A;  2J08 A;  4JHK A;  3QNK A;  4F6R D;  1TN8 A;  5G05 J;  3SNX A;  3ZXP A;  3QWP A;  4U8V D;  4KBQ A;  3ZIM A;  2QY7 A;  1K1A A;  2J09 A;  3L08 A;  2LSV A;  3B7T A;  3HVE A;  2P58 C;  4BX9 A;  4EPZ A;  3KSQ A;  3FP3 A;  1HH8 A;  2IOS A;  4LCT A;  4A1S A;  2XHE A;  3UIN C;  2KAT A;  4V3I A;  3EHR A;  2LSU A;  3CV0 A;  2J07 A;  2Y1L E;  2YIN A;  4ACK A;  4U96 D;  2XS8 A;  4ILG A;  1N4Q A;  2Y69 E;  4JD2 G;  3JUE A;  2WPV A;  2I9C A;  2NYJ A;  3FH8 A;  3NAW A;  1SA5 A;  2KZT B;  2LUH A;  4HBD A;  4BSX A;  3TJP A;  3E37 A;  3SFZ A;  1EDU A;  2VJ8 A;  1JUQ A;  4NIK A;  3ZU7 B;  1Z3X A;  3DEO A;  2FO1 E;  4R7L A;  3FU6 A;  4CT4 A;  3V31 A;  1QZ2 A;  4IRU A;  3OXG A;  2VGX B;  4G24 A;  3Q4A B;  2WXN A;  2E0I A;  1UJK A;  3BEE A;  3CST A;  3MZL B;  3CLJ A;  3N71 A;  2CG2 A;  2P9L G;  2V4L A;  5BXU A;  3MGB A;  3D9N A;  2EIN E;  2DWZ A;  2RFM A;  4F53 A;  2H6G A;  1XNF A;  1SZA A;  3UIP C;  2KM4 A;  4U0S A;  4I9E A;  3FH7 A;  5JHA A;  3UX4 A;  2VSN A;  2GW1 A;  4HOR A;  4LSZ E;  1AP7 A;  1P5Q A;  3EHM A;  1MX6 A;  2RG8 A;  4FU3 A;  4PS8 A;  3GW4 A;  3DSU A;  3T9K A;  2ILR A;  5KJM A;  1ELR A;  1QQE A;  2EQX A;  2R2L A;  2WXM A;  1E8Z A;  4FLH A;  2QYU A;  4TUM A;  2WXL A;  1Z3Y A;  4N5C A;  4B8C B;  3FH5 A;  3TXN A;  3U64 A;  2HE0 A;  4TXR A;  2WMN A;  3B13 A;  3G2S A;  3SHF A;  4L1B A;  4Z68 A;  2EIL E;  4AVX A;  4ABN A;  3ZHE A;  1A17 A;  4FP7 A;  5CBO A;  3HYM B;  3G2U A;  3PZ3 A;  5KCM A;  3T5X A;  2ZGG A;  3SO8 A;  4PH4 B;  3ZXS A;  4DX7 D;  2ZIS A;  2HM8 A;  3KD7 A;  3IEG A;  4J8D A;  2PM7 A;  5LX8 A;  4WNE A;  4WAF A;  3ZFW A;  5D0O D;  1EPU A;  2A5U A;  3Q7F A;  3ML8 A;  2JLB A;  3UKR G;  1NZN A;  4HRL A;  3OTN A;  2NSZ A;  4K5C A;  2WXI A;  1K3Z D;  2CHW A;  3FEX A;  4APO A;  4MLP A;  3TWR A;  3C5R A;  1TNU A;  1WM5 A;  3ASG A;  4K0R A;  3IHY A;  3MKR A;  2I1K A;  4EZK A;  3C3O A;  4I2Z A;  4Q69 A;  3CHM A;  3EJN A;  5ENP D;  3Q75 A;  4N39 A;  4KVO A;  2H6F A;  1FT1 A;  4GCN A;  5BNW A;  4I1O B;  3SD5 A;  1PY1 A;  3IHV A;  3E34 A;  3PRE A;  4YDY A;  4WWP A;  1MQS A;  4FAD A;  2OVF A;  5BV1 A;  2PNN A;  3L82 A;  5BT1 A;  1E8Y A;  4N2Q A;  4IYP A;  4XI0 A;  4CZ2 D;  3DPY A;  1SW6 A;  3MYV A;  3J5P A;  3KEZ A;  4TRQ A;  3DBS A;  5ARF A;  3CHP A;  4XE0 A;  4GTS A;  2WXO A;  2F0Y A;  2OOE A;  5ENN A;  3ML9 A;  2EIM E;  4HQD A;  3TAX A;  3MV3 B;  3FUL A;  3RU0 A;  1K8K G;  3RO3 A;  4Q96 A;  4JL0 A;  3SF4 A;  2OEW A;  4AEZ C;  2XCB A;  4LRZ A;  3Q9N C;  3ZPJ A;  5EKQ D;  3SZ7 A;  2WM9 A;  3HG0 D;  4HVB A;  2DBA A;  3J5Q B;  4IN3 B;  2LNI A;  2P9U G;  3PUJ A;  4U04 A;  1H0A A;  3PE3 A;  2E2E A;  4HB5 A;  3TGO A;  3APF A;  2V4H C;  4TV3 A;  4L2Y A;  2OVB A;  4FJY A;  3B95 A;  2DZN A;  1E96 B;  3V30 A;  3RSE G;  4DJA A;  4F7A A;  4FC8 A;  2QFC A;  3CVX A;  4AV7 A;  2KCL A;  3K9I A;  2Y4U A;  3KEA A;  5C1D A;  1AWC B;  5G55 A;  3PEU B;  4JW1 A;  4UQY A;  3BG0 B;  2JAB A;  3JYS A;  3FEY A;  3PH0 C;  2PQN A;  2GRM A;  4G23 A;  1N94 A;  3ABK E;  3DEP A;  4JHJ A;  4GCO A;  4EBA G;  1TEZ A;  3AAA C;  2VSO E;  2CFU A;  3FFL A;  3UTM A;  3NF1 A;  5LOZ A;  3AG3 E;  4EHM A;  2VTB A;  3NZU A;  4A3T A;  5ARG A;  2AXU A;  3CSF A;  4B0Z A;  4HNA D;  2ZXW E;  2LO6 A;  3MKQ A;  4XX5 A;  2QZA A;  3G2V A;  2WXK A;  1H2U A;  3FUF A;  2ETC A;  4EBA A;  3UI2 A;  3FHE A;  1OWM A;  3MEK A;  3UT7 A;  5FIN A;  3PZD A;  3CVY A;  4U0U A;  1OCO E;  3T8M A;  1O5M A;  4BT8 A;  3LS8 A;  5ENQ D;  3LVR E;  5CER B;  2ZIR A;  3RIB A;  2WMO A;  3U66 A;  1V54 E;  1Q2Z A;  3SBS A;  4LEU A;  3IBE A;  2WB2 A;  1H6O A;  5KNG A;  4AY5 A;  4GTM A;  3JQ0 A;  3U3W A;  4GMR A;  3O4Z A;  2FI7 A;  3D9H A;  1OY3 D;  2WXH A;  1INZ A;  3Q47 B;  3C72 A;  4RG9 A;  2VTB B;  4WWN A;  3FTW A;  4J8E A;  3I3N A;  1JWF A;  3SY2 A;  1TJC A;  2X3M A;  4ATZ D;  2IO3 C;  4BES A;  3PUK A;  3KAE A;  2JEK A;  5KJL A;  3IV0 A;  1OUV A;  1TN6 A;  1TJF A;  3UUX A;  1YA0 A;  4OAU C;  5FWQ A;  3APD A;  3C3R A;  2C0M A;  3P2B A;  4M3O A;  3BG1 B;  1YCS B;  1VDY A;  5EID A;  1BI7 B;  4EZJ A;  4I43 A;  4CGV A;  1WAO 1;  5FZR A;  4JXT A;  2H6H A;  1BD8 A;  3LJ3 A;  3UM3 A;  5KBA A;  3CQG B;  3SFX A;  4RSY A;  1OWP A;  3LJN A;  3SGH A;  4O6F A;  1A5E A;  3DRA A;  4DX6 D;  1QBQ A;  5ENO D;  3ZW3 A;  1S70 B;  3FTZ A;  2R02 A;  4AIF A;  2MHK A;  1KZP A;  2R5S A;  3ZYQ A;  4BY6 A;  3T5V A;  4L23 A;  2A5E A;  4RG6 A;  4MKT A;  4F3V A;  1X5B A;  3HXC A;  1MZC A;  2QC9 A;  1NA3 A;  3ZYM A;  4GYY A;  4F1P A;  4UWL A;  2VQ2 A;  4WWO A;  4GZC A;  3QWW A;  2WXF A;  3L22 A;  1UJJ A;  3DWL G;  4DUI A;  3FUD A;  4K03 A;  1H6K A;  4GA2 A;  2XCC A;  3UQ3 A;  1NL4 A;  4N5Q A;  3FTS A;  5KJK A;  2IOL A;  2J9Q A;  4I6J A;  4F1S A;  3CVU A;  4Y6W A;  3ESL A;  1HZ4 A;  4HXI A;  3HVE B;  4K5B A;  2UWJ G;  3SFY A;  3EHQ A;  5CCL A;  2DIW A;  3S7F A;  3NB2 A;  1TR4 A;  4UWH A;  3SBT B;  4GB9 A;  3T8K A;  3UMV A;  3PNL B;  4EZL A;  5A7D B;  3ZVV A;  1PC2 A;  2NC9 A;  3MJW A;  3C98 A;  3GZ1 A;  5B1B E;  1HX8 A;  3U4T A;  3UKU G;  2GGF A;  5EDS A;  1JCR A;  4MS6 A;  1IKN D;  3ASD A;  1NA0 A;  3CVP A;  5AJD A;  4OYS A;  5KJN A;  4JZY A;  1YMP A;  3CVN A;  1HFA A;  2X6I A;  2YHE A;  2KXP C;  4YVQ C;  4GZ6 A;  2DVW A;  3AU5 A;  4NUR A;  2I2O A;  3PS6 A;  4U07 A;  3FUK A;  4IUL A;  3EU5 A;  4ANW A;  2VSY A;  3ULY A;  5ENR D;  3IXE A;  4FJZ A;  1ZB1 A;  4DX1 A;  1D8E A;  4KVM A;  1MHQ A;  5AQA A;  1IXV A;  1N95 A;  3RRU A;  3MA5 A;  3SI5 A;  5JJT A;  4URK A;  5FIO A;  4YND A;  2V5F A;  3WG7 E;  1O1S A;  1HU3 A;  1UN8 A;  1U3D A;  3PZ2 A;  2AXZ A;  4GTP A;  3UT4 A;  1EYH A;  3GZ2 A;  2VSX E;  2ZGD A;  3D9K A;  2V0P A;  4QQI A;  4LER A;  5FT9 A;  3AU4 A;  1LD8 A;  2MRI A;  3AG1 E;  3FTX A;  3APC A;  4DI4 A;  3PVL A;  3PE4 A;  2P9S G;  3E30 A;  4DRX E;  1MX2 A;  2OEV A;  5G04 C;  3CR3 A;  1FCH A;  1KPS B;  2PQR A;  3NOG D;  2AXV A;  4Q94 A;  4KZ0 A;  2MYO A;  4I2W A;  5FQ6 A;  4C9B B;  5A6C A;  2L0I A;  2I1J A;  3DSW A;  4HRM B;  3UT8 A;  3HXE A;  1BI8 B;  5J90 A;  2J8S D;  3ZHE B;  1EF1 C;  4KXK B;  3ONK A;  5JMN D;  2H6I A;  1OWN A;  2F8Y A;  4B94 A;  5AIJ A;  3O48 A;  5CMW A;  5JA4 D;  4YDO A;  2GRN B;  4LNB A;  1DC2 A;  4GTO A;  5ANR A;  3E32 A;  1HE8 A;  3ENE A;  3G2T A;  5CED B;  2KCV A;  4A1G A;  2XEE A;  4CCA A;  3HHM A;  1U2V G;  4BT9 A;  4DLQ A;  3MX3 A;  3FWV A;  2WQH A;  1X81 A;  3ESK A;  5G04 J;  1H2T C;  4OVU A;  1LD7 A;  4N2S A;  5EN5 D;  3E33 A;  1OWL A;  3ABM E;  4UWF A;  4CDN A;  3ZGQ A;  3ZRH A;  3D9P A;  5E76 A;  2R05 A;  3QWV A;  4XKC A;  2CHZ A;  5IY5 E;  1E7V A;  3ULQ A;  4HOQ A;  3LPZ A;  4RVB A;  3B7B A;  2P9N G;  4QFV A;  1Z5S C;  1OCC E;  4G26 A;  5JJ7 A;  3BU8 A;  3TXM A;  1DVP A;  3D9L A;  4ACL A;  1HF8 A;  1SVX A;  1IQR A;  4KYO B;  2EIJ E;  3I4G A;  5AQ9 A;  1WG0 A;  1JWG A;  3URZ A;  2KCK A;  4G2V A;  4HOU A;  4JVS A;  2L6J A;  3ONL A;  2ZU6 B;  4G8K A;  1OT8 A;  3TWS A;  4GZ5 A;  3UM1 A;  4N3B A;  2IU1 A;  3LKU A;  4FHJ A;  2DZO A;  1N11 A;  4L9P A;  3Q49 B;  2AVP A;  1IQU A;  4J6I A;  4B8A A;  3LYA A;  1D8D A;  1Z6T A;  1V55 E;  4GTR A;  3EHN A;  1SZ9 A;  3QJZ A;  4JA9 A;  3HDX A;  2XS1 A;  2AWI A;  3LXU X;  1NI1 A;  4HI8 A;  1Y8M A;  3OXF A;  1H2V C;  2XZD G;  3FTY A;  2YHC A;  2WQ7 A;  3TG5 A;  1QNF A;  4J0U A;  4WUY A;  3JCK C;  3PZ1 A;  3Q15 A;  3ASH A;  3D3M A;  2P2C P;  3FUE A;  3PDN A;  1KLX A;  1SA4 A;  4AP2 A;  2RKK A;  4BET A;  2UY1 A;  1Y6I A;  5BPP A;  3RAU A;  4I1M A;  3RKV A;  3QKY A;  1E8X A;  3PEV B;  4GTQ A;  4CEM A;  3CGH A;  4N3A A;  5LCW J;  3VTX A;  5ENS D;  4CDR A;  4TXP A;  5AAO A;  4ILI A;  2IY0 C;  3OAW A;  4LG6 A;  4RLY A;  4B89 A;  1LF8 A;  5ANL A;  5D66 A;  4X8Q A;  2XQ0 A;  4CT0 A;  3V2X A;  2F8X K;  4G8L A;  2WXJ A;  5JJ6 A;  3ULE G;  3L16 A;  4DLO A;  4AJW A;  5AJL A;  4J7W A;  4LNG A;  4PUC A;  3B7R L;  3CVW A;  3S2A A;  4JEU A;  1N0R A;  4CDM A;  1N0Q A;  2PM6 A;  3IKO B;  2B6C A;  4KMO A;  2BUG A;  4OAV B;  1HXI A;  1IHG A;  4FLB A;  4JEH A;  4P29 A;  3ASN E;  4C0M A;  3DSX A;  1HS6 A;  3MKQ B;  2OV8 A;  4GML A;  4UWK A;  3B7S A;  3CVQ A;  3Q5M A;  1UOH A;  3JQ1 A;  3CK7 A;  1HG5 A;  4GTV A;  4JPS A;  2VGY A;  2J4D A;  3BQO A;  4XEI G;  1OCZ E;  3EU9 A;  2OND A;  1N4R A;  4UQX A;  5CRU A;  1E7U A;  4BTA A;  5CEA A;  5BW8 C;  1N9A A;  4AOF A;  1ELW A;  1JCQ A;  5FTP A;  1WY6 A;  4ZFH A;  1BU9 A;  5AYW D;  2X38 A;  4J8F A;  1UG3 A;  5J08 A;  2Y4T A;  3S7D A;  3WXX A;  4I9C A;  5T8I A;  5CCM A;  5CRV A;  2LAH A;  4FA6 A;  3ZKJ A;  4LUN U;  2X6J A;  5AEN A;  3L13 A;  2DYS E;  2CHX A;  3QAR A;  3LDZ A;  3UIO C;  3LVQ E;  3KSL A;  2XEH A;  4GU5 A;  4I6E A;  2ETA A;  3CEQ A;  2V8S E;  1TNO A;  4ANU A;  4XI9 A;  1TN7 A;  4RQI A;  2F37 A;  1MJ0 A;  1BPO A;  2RD0 A;  1FT2 A;  4KZC A;  3EDT B;  3B7U X;  1E8W A;  5HQ8 A;  2BKK B;  1O1T A;  2P9P G;  4TXQ A;  5FJY A;  4Y6C A;  2IJG X;  3L6A A;  4HLL A;  5EIL A;  5G2N A;  4E6H A;  4I17 A;  3MCX A;  1FVH A;  2KC7 A;  3LEW A;  4L2L A;  2L0T B;  2DYR E;  3AS5 A;  4GMJ A;  3S7B A;  1S0P A;  1U3C A;  3S7J A;  4JA7 A;  2PL2 A;  3NQP A;  4BTB A;  3V79 K;  1DCQ A;  1KZO A;  4APF A;  4H7X A;  4WNF A;  1IHB A;  1N54 A;  4JB8 P;  3FTV A;  4DI3 A;  3R7Q A;  3DSS A;  3VLD A;  4L7T A;  4GYW A;  1N4P A;  4U7E B;  3D9J A;  2FO7 A;  4FUL A;  4YDW A;  5CMY A;  2C2L A;  1FVF A;  2XPI A;  3NZS A;  2OCC E;  4HRN A;  4BER A;  5EX0 A;  1JCS A;  2KBX A;  4FHK A;  3JXI A;  3P1U A;  4XIF A;  4CGW A;  1E90 A;  2NXP A;  3ZNG A;  3R9M A;  1WDY A;  3PRZ A;  5H7P A;  5LFA A;  3TL5 A;  2L6B A;  3FU5 A;  2HR2 A;  2X6F A;  4K5A B;  1RW2 A;  4JC8 A;  4WNG A;  1TNB A;  2R03 A;  1G3N B;  3DST A;  4CYM D;  1BLX B;  4EQF A;  1KT1 A;  3FUI A;  1TYQ G;  3CHS A;  2FEZ A;  3CHQ A;  4TUU A;  5DBK A;  3Q73 A;  4ILH B;  4UI9 C;  2XPZ A;  5EX3 A;  4CRW A;  1TNY A;  2HYZ A;  1QYM A;  3FU3 A;  2GRP B;  3PZ4 A;  3GZS A;  2PZI A;  3HXB A;  3L9T A;  4HOS A;  1OXJ A;  4D10 C;  3LY7 A;  2WQ6 A;  4DX5 D;  3KS2 A;  1SQM A;  2GRL A;  5HKP A;  4O1O A;  3UPV A;  2ION A;  2RFA A;  2XEN A;  3Q78 A;  3QC1 A;  3QDN A;  4MBG A;  5T4Y A;  3PNT B;  2GRR B;  4ME2 A;  3AG4 E;  4E85 A;  2IFU A;  3VLE A;  4AY6 A;  3LCA A;  3R9A B;  3RRN B;  4J8Y A;  2BF0 X;  3DPD A;  4GZD A;  2ETB A;  4UI9 J;  3RO2 A;  2AW6 A;  2P9I G;  4ANX A;  4HFG A;  3TWV A;  3ZUV B;  4UQZ A;  3CK9 A;  4BEP A;  3NOC D;  3C3Q A;  3TWX A;  4AXH A;  3E4B A;  1K1B A;  5M72 A;  4O60 A;  5ITZ F;  1UN9 A;  2GRQ B;  1UW4 B;  1D9S A;  5D0Q D;  3Q7A A;  3JUI A;  4GPM A;  3CVL A;  3ZYK A;  3HIZ A;  5CBN A;  3AS4 A;  2Y3A A;  4UWG A;  1OWO A;  4UI9 K;  5B3S E;  3FUN A;  4G11 A;  3D9O A;  2Y0B G;  3FY4 A;  1KT0 A;  4WND A;  3L17 A;  3CVV A;  4YVO A;  5ENT D;  4I6G A;  4XKB A;  2EIK E;  4PDX A;  2FBN A;  2WXP A;  2XGS A;  3CIA A;  4BX8 A;  5FQ7 A;  3ZEF A;  5BXO A;  4BWR A;  5KNH D;  3AG2 E;  2YQ8 A;  4GTT A;  3TWU A;  3W9G A;  2YNQ A;  1HG2 A;  4A63 B;  1MYO A;  4G25 A;  1W3B A;  4G1T A;  4U95 D;  2XZT G;  2MOW A;  3I5P A;  2X6H A;  5AAR A;  1IYG A;  2I6H A;  1O1R A;  2XEV A;  3L54 A;  4U8Y D;  2XRY A;  5CEC B;  1DNP A;  4NQ0 A;  1S63 A;  2LXM A;  4ANV A;  4I1A A;  2QYJ A;  4B93 B;  3Q79 A;  3G2W A;  1TNZ A;  2XGM A;  1XGW A;  2X6K A;  4PS7 A;  2J49 A;  4AM9 A;  4UUC A;  3Q9U C;  3HRA A;  3VTY A;  2CFZ A;  1S64 A;  3FUJ A;  4A3V A;  3W9F A;  3EIJ A;  5FQ8 A;  2IQC A;  4GYO A;  4KT6 B;  5AN8 A;  3ASF A;  3UXG A;  4C0E A;  3V2O A;  4BFR A;  4U0Z A;  2FF4 A;  2BTD A;  5FZS A;  2XPY A;  5B1A E;  2BKG A;  4EEC A;  1ZBP A;  5C2Y A;  3BUA A;  1NFI E;  2B0O E;  3FDH A;  3TWW A;  4H7Y A;  1NP7 A;  5EYL A;  3DXK G;  2CG3 A;  3RJV A;  2L9B A;  3ZYL A;  2R17 C;  4ATG A;  4ZHB A;  3FU0 A;  2AJA A;  2LXL A;  3UM0 A;  4XZ4 A;  5BUZ A;  5EIB E;  2XRZ A;  2IF4 A;  5HI7 A;  5LCW C;  2LAI A;  1LTX A;  3ASO E;  5HS0 A;  4HOT A;  5FZQ A;  2DCP A;  2WXR A;  4GPK A;  3QOU A;  3LY9 A;  5EYP F;  1PAQ A;  3DXM G;  3CK8 A;  5CHE E;  4GA0 A;  4NAC A;  4W9R A;  3TWT A;  1H19 A;  4JHR A;  1L5J A;  3EIQ C;  1YYH A;  3R7R A;  4DX2 A;  3RRM B;  4YDE A;  3RK6 A;  3F6Q A;  2R59 A;  5AQB A;  2HO1 A;  3AJI A;  3DSV A;  3ABL E;  2IO2 C;  4J8S A;  3MV2 B;  3FUM A;  4PS3 A;  2XGO A;  4A55 A;  1N52 A;  1MX4 A;  2P9K G;  1FPP A;  4GA1 A;  4U8H A;  4M7C A;  3UM2 A;  3I4R B;  5E75 A;  2VYI A;  1HO8 A;  2M63 A;  5T3R A;  3CKB A;  4HI9 A;  3D9M A;  3HXF A;  2WXG A;  3JXJ A;  3QK0 A;  2C0L A;  2A4Z A;  3EUV A;  3CKC A;  3U9W A;  3NBN B;  3ZN3 A;  1N4S A;  1ZU2 A;  3ISM C;  1ELK A;  3AS8 A;  3QB2 A;  5DIZ A;  1H6P A;  3CQC B;  4MRU A;  5D2M C;  2WVI A;  3OXL A;  3LY8 A;  5BV0 A;  3HXD A;  4U63 A;  1JPL A;  2GRO B;  4HS2 A;  4DPR A;  3TG4 A;  1DCE A;  5G05 C;  2UY1 B;  2WXQ A;  3QAQ A;  4NRH B;  3VLF A;  3CHO A;  5KWD A;  4DK5 A;  4OVV A;  3SQV A;  1RZ4 A;  5A23 A;  2V5Q C;  4O1P A;  5JHB A;  2IEJ A;  3D9I A;  3CHR A;  4LNU D;  3FUH A;  1GW6 A;  1OCR E;  5AQ7 A;  3FTU A;  3GYZ A;  3X2Q E;  5FQ4 A;  4C48 B;  2KZT A;  5LP0 A;  1B89 A;  4HLE A; 
#chains in the Genus database with same CATH homology
 2FUL A;  2KCV A;  3PRZ A;  4GAA A;  4A1G A;  4GZ3 A;  5LFA A;  4CCA A;  3TL5 A;  3HHM A;  3FU5 A;  2HR2 A;  4GCO A;  4JHJ A;  2X6F A;  2Q7F A;  4N3C A;  4EBA G;  2J4B A;  4JC8 A;  2VGX A;  2J08 A;  4WNG A;  4BT9 A;  4DLQ A;  4JHK A;  3QNK A;  1TEZ A;  2VSO E;  2CFU A;  3FFL A;  3MX3 A;  3FWV A;  5G05 J;  3SNX A;  3NF1 A;  5LOZ A;  2WQH A;  4EQF A;  3ESK A;  1KT1 A;  5G04 J;  1H2T C;  4OVU A;  3FUI A;  3QWP A;  3CHS A;  2FEZ A;  4KBQ A;  3CHQ A;  3ZIM A;  2VTB A;  4N2S A;  4TUU A;  2QY7 A;  5DBK A;  2J09 A;  1OWL A;  3L08 A;  3NZU A;  4ILH B;  2LSV A;  4UWF A;  4A3T A;  4UI9 C;  2XPZ A;  5ARG A;  2AXU A;  5EX3 A;  4CDN A;  4CRW A;  3B7T A;  2HYZ A;  3HVE A;  3ZGQ A;  3CSF A;  3ZRH A;  4B0Z A;  2P58 C;  3D9P A;  2LO6 A;  3MKQ A;  4BX9 A;  4XX5 A;  3FU3 A;  4EPZ A;  3FP3 A;  3GZS A;  3G2V A;  1HH8 A;  5E76 A;  2PZI A;  2WXK A;  1H2U A;  2IOS A;  3FUF A;  3QWV A;  2CHZ A;  4XKC A;  4LCT A;  4A1S A;  1E7V A;  4EBA A;  3ULQ A;  2XHE A;  4HOQ A;  4HOS A;  4D10 C;  3LPZ A;  3FHE A;  4RVB A;  2KAT A;  3LY7 A;  1OWM A;  2WQ6 A;  3MEK A;  4V3I A;  3KS2 A;  2LSU A;  1SQM A;  2GRL A;  3UT7 A;  3UPV A;  3PZD A;  3CV0 A;  2ION A;  3CVY A;  2J07 A;  2YIN A;  4ACK A;  4QFV A;  4U0U A;  4G26 A;  5JJ7 A;  4ILG A;  3TXM A;  1DVP A;  3QC1 A;  3D9L A;  3QDN A;  4ACL A;  1HF8 A;  2WPV A;  2I9C A;  5T4Y A;  3T8M A;  1IQR A;  3PNT B;  3FH8 A;  4KYO B;  3I4G A;  4BT8 A;  3LS8 A;  2KZT B;  4BSX A;  4ME2 A;  3TJP A;  3LVR E;  3SFZ A;  1EDU A;  3RIB A;  4E85 A;  2WMO A;  2IFU A;  1JWG A;  3VLE A;  4AY6 A;  2VJ8 A;  1JUQ A;  3LCA A;  3U66 A;  3URZ A;  3R9A B;  2KCK A;  4G2V A;  4HOU A;  3SBS A;  4JVS A;  1Z3X A;  4LEU A;  3RRN B;  3IBE A;  4R7L A;  2L6J A;  3FU6 A;  4CT4 A;  2BF0 X;  2WB2 A;  3DPD A;  4GZD A;  1QZ2 A;  4AY5 A;  4IRU A;  4UI9 J;  3OXG A;  3ONL A;  3RO2 A;  2VGX B;  2ZU6 B;  3JQ0 A;  3U3W A;  4G24 A;  2AW6 A;  3Q4A B;  2WXN A;  4GZ5 A;  3O4Z A;  2FI7 A;  2E0I A;  4N3B A;  4ANX A;  1UJK A;  3BEE A;  2WXH A;  1INZ A;  3Q47 B;  2IU1 A;  4HFG A;  3CST A;  3LKU A;  3MZL B;  3CLJ A;  4UQZ A;  3CK9 A;  4FHJ A;  3N71 A;  4RG9 A;  2VTB B;  2CG2 A;  4WWN A;  2V4L A;  3FTW A;  3MGB A;  3Q49 B;  4J8E A;  3I3N A;  3D9N A;  3E4B A;  4AXH A;  2AVP A;  1JWF A;  5M72 A;  1IQU A;  4J6I A;  4B8A A;  1TJC A;  2X3M A;  3LYA A;  1Z6T A;  1UN9 A;  4F53 A;  1UW4 B;  5D0Q D;  3PUK A;  3JUI A;  3CVL A;  3ZYK A;  3KAE A;  2JEK A;  1XNF A;  3EHN A;  3IV0 A;  5KJL A;  1OUV A;  3HIZ A;  1SZA A;  1TJF A;  3UUX A;  1YA0 A;  1SZ9 A;  3AS4 A;  5FWQ A;  2Y3A A;  3QJZ A;  2KM4 A;  4JA9 A;  1OWO A;  4UI9 K;  4UWG A;  3FUN A;  3HDX A;  3APD A;  4G11 A;  2AWI A;  3D9O A;  3FY4 A;  2C0M A;  3LXU X;  4U0S A;  4I9E A;  1KT0 A;  4WND A;  1Y8M A;  3FH7 A;  3OXF A;  1H2V C;  3L17 A;  3CVV A;  3FTY A;  2YHC A;  3P2B A;  4YVO A;  2WQ7 A;  4M3O A;  3TG5 A;  1QNF A;  3BG1 B;  5JHA A;  4I6G A;  4J0U A;  4WUY A;  4XKB A;  3UX4 A;  2VSN A;  1VDY A;  2GW1 A;  3JCK C;  4PDX A;  2FBN A;  4EZJ A;  4HOR A;  3Q15 A;  3ASH A;  1P5Q A;  2WXP A;  2XGS A;  3D3M A;  3CIA A;  4I43 A;  4CGV A;  4BX8 A;  1WAO 1;  5FZR A;  3EHM A;  4JXT A;  3FUE A;  3PDN A;  4PS8 A;  2RG8 A;  4FU3 A;  5FQ7 A;  3ZEF A;  3LJ3 A;  1KLX A;  3CQG B;  3GW4 A;  4BWR A;  2YQ8 A;  4AP2 A;  4RSY A;  1OWP A;  2ILR A;  2YNQ A;  2UY1 A;  5KJM A;  1ELR A;  1QQE A;  1HG2 A;  3SGH A;  2EQX A;  2WXM A;  1E8Z A;  4O6F A;  4G25 A;  4FLH A;  1Y6I A;  5BPP A;  2WXL A;  1Z3Y A;  4N5C A;  4B8C B;  3FH5 A;  1W3B A;  4G1T A;  4I1M A;  3TXN A;  2MOW A;  3ZW3 A;  3U64 A;  3FTZ A;  2X6H A;  3I5P A;  3QKY A;  3RKV A;  4AIF A;  2MHK A;  1IYG A;  1E8X A;  2WMN A;  3PEV B;  2R5S A;  3B13 A;  3G2S A;  2I6H A;  3SHF A;  3ZYQ A;  2XEV A;  4BY6 A;  4CEM A;  3T5V A;  3CGH A;  3L54 A;  4L1B A;  4L23 A;  4AVX A;  4ABN A;  2XRY A;  4N3A A;  1DNP A;  4NQ0 A;  3VTX A;  3ZHE A;  5LCW J;  4CDR A;  4RG6 A;  4MKT A;  4F3V A;  1A17 A;  1X5B A;  4I1A A;  4ANV A;  4FP7 A;  3HYM B;  3G2U A;  3G2W A;  4ILI A;  3OAW A;  2XGM A;  1XGW A;  5KCM A;  3T5X A;  2X6K A;  4B89 A;  1LF8 A;  5ANL A;  4PH4 B;  4PS7 A;  2J49 A;  3ZXS A;  1NA3 A;  3ZYM A;  2XQ0 A;  4GYY A;  4CT0 A;  2HM8 A;  3KD7 A;  4UWL A;  3IEG A;  2VQ2 A;  4AM9 A;  4J8D A;  2PM7 A;  2WXJ A;  5LX8 A;  4WWO A;  5JJ6 A;  3VTY A;  4GZC A;  4WNE A;  4WAF A;  2CFZ A;  3ZFW A;  3FUJ A;  4A3V A;  3EIJ A;  3L16 A;  2WXF A;  3L22 A;  3QWW A;  1UJJ A;  5D0O D;  4DLO A;  4AJW A;  5AJL A;  1EPU A;  2IQC A;  4GYO A;  5FQ8 A;  4PUC A;  2A5U A;  4KT6 B;  3FUD A;  4C0E A;  3ASF A;  4K03 A;  3B7R L;  1H6K A;  4GA2 A;  2XCC A;  3CVW A;  3S2A A;  3UQ3 A;  3ML8 A;  4JEU A;  4BFR A;  3FTS A;  4CDM A;  4U0Z A;  2JLB A;  5KJK A;  2FF4 A;  2PM6 A;  2BTD A;  5FZS A;  2XPY A;  3IKO B;  2IOL A;  4KMO A;  3G2T A;  4EEC A;  1ZBP A;  1NZN A;  5C2Y A;  2J9Q A;  2BUG A;  4I6J A;  3FDH A;  3OTN A;  4F1S A;  3CVU A;  4Y6W A;  1HXI A;  1IHG A;  2NSZ A;  3ESL A;  4H7Y A;  1NP7 A;  1HZ4 A;  4FLB A;  2WXI A;  4JEH A;  4P29 A;  4HXI A;  4C0M A;  2CG3 A;  3HVE B;  2CHW A;  3RJV A;  2UWJ G;  5CCL A;  2DIW A;  2L9B A;  1HS6 A;  2R17 C;  3FEX A;  3MKQ B;  2OV8 A;  3S7F A;  3ZYL A;  4MLP A;  4APO A;  4GML A;  4ATG A;  4UWK A;  3FU0 A;  4UWH A;  3SBT B;  1WM5 A;  3ASG A;  4GB9 A;  4K0R A;  3B7S A;  4XZ4 A;  5BUZ A;  2XRZ A;  3CVQ A;  3UMV A;  3IHY A;  3PNL B;  2IF4 A;  5HI7 A;  3Q5M A;  4EZL A;  5LCW C;  5A7D B;  3ZVV A;  3JQ1 A;  3MKR A;  2LAI A;  1PC2 A;  2I1K A;  1HG5 A;  2NC9 A;  3CK7 A;  4EZK A;  4HOT A;  3MJW A;  5FJY A;  3C98 A;  4JPS A;  3GZ1 A;  2VGY A;  2J4D A;  4I2Z A;  1HX8 A;  4Q69 A;  3CHM A;  3EJN A;  5FZQ A;  3U4T A;  2DCP A;  4N39 A;  2OND A;  2GGF A;  2WXR A;  4UQX A;  4KVO A;  4GPK A;  3QOU A;  3LY9 A;  4GCN A;  5BNW A;  1E7U A;  4I1O B;  4BTA A;  5EDS A;  1PAQ A;  3SD5 A;  1PY1 A;  3CK8 A;  3IHV A;  5CHE E;  4MS6 A;  4GA0 A;  4NAC A;  4W9R A;  1H19 A;  3PRE A;  4JHR A;  1L5J A;  3ASD A;  3EIQ C;  4WWP A;  5BW8 C;  1MQS A;  4FAD A;  2OVF A;  5BV1 A;  4AOF A;  1ELW A;  5FTP A;  1WY6 A;  5BT1 A;  5AYW D;  2X38 A;  4J8F A;  1UG3 A;  5J08 A;  1NA0 A;  2Y4T A;  3CVP A;  3R7R A;  1E8Y A;  3RRM B;  3S7D A;  3WXX A;  4AEZ C;  5AJD A;  4OYS A;  4I9C A;  4N2Q A;  5KJN A;  5T8I A;  5CCM A;  3RK6 A;  4IYP A;  2LAH A;  2R59 A;  4XI0 A;  2HO1 A;  4JZY A;  4FA6 A;  4LUN U;  2X6J A;  3CVN A;  4J8S A;  5AEN A;  3L13 A;  1HFA A;  3MV2 B;  2X6I A;  3FUM A;  2YHE A;  4YVQ C;  4GZ6 A;  3MYV A;  3AU5 A;  4NUR A;  4PS3 A;  3KEZ A;  2CHX A;  2I2O A;  3PS6 A;  2XGO A;  4TRQ A;  4U07 A;  3QAR A;  3FUK A;  3LDZ A;  4IUL A;  4A55 A;  1N52 A;  3DBS A;  4ANW A;  2VSY A;  3CHP A;  3LVQ E;  4XE0 A;  5ARF A;  4GA1 A;  4FJZ A;  4U8H A;  3I4R B;  1MHQ A;  4KVM A;  5E75 A;  2VYI A;  1HO8 A;  2WXO A;  4GU5 A;  4I6E A;  3CEQ A;  2M63 A;  2V8S E;  2OOE A;  5ENN A;  3CKB A;  3ML9 A;  5T3R A;  3RRU A;  4ANU A;  3D9M A;  2WXG A;  3MA5 A;  3SI5 A;  5JJT A;  4URK A;  4XI9 A;  3QK0 A;  4YND A;  2C0L A;  2V5F A;  2A4Z A;  1HU3 A;  1UN8 A;  1U3D A;  3TAX A;  1BPO A;  2RD0 A;  3MV3 B;  3FUL A;  3RU0 A;  2AXZ A;  4KZC A;  3EDT B;  3UT4 A;  3RO3 A;  3CKC A;  3U9W A;  1EYH A;  3B7U X;  4Q96 A;  1E8W A;  5HQ8 A;  3ZN3 A;  1ZU2 A;  3GZ2 A;  4JL0 A;  2VSX E;  3SF4 A;  3D9K A;  1ELK A;  3AS8 A;  3QB2 A;  2IJG X;  2V0P A;  2XCB A;  4LER A;  3AU4 A;  3L6A A;  4Y6C A;  5DIZ A;  4LRZ A;  5FT9 A;  3ZPJ A;  3CQC B;  4MRU A;  5EKQ D;  5G2N A;  3SZ7 A;  4E6H A;  2WVI A;  2WM9 A;  2MRI A;  3OXL A;  4I17 A;  3MCX A;  3LY8 A;  3FTX A;  1FVH A;  2DBA A;  4HVB A;  2KC7 A;  5BV0 A;  3APC A;  3LEW A;  4U63 A;  1JPL A;  4IN3 B;  4DI4 A;  4HS2 A;  2LNI A;  4L2L A;  4DPR A;  2L0T B;  3PVL A;  3AS5 A;  3PUJ A;  3PE4 A;  4GMJ A;  3S7B A;  3TG4 A;  1S0P A;  4U04 A;  1U3C A;  1H0A A;  3S7J A;  4JA7 A;  5G05 C;  3PE3 A;  2PL2 A;  3NQP A;  4BTB A;  2E2E A;  3TGO A;  5G04 C;  3APF A;  3CR3 A;  2UY1 B;  2WXQ A;  4APF A;  4TV3 A;  3QAQ A;  4H7X A;  4L2Y A;  4WNF A;  2OVB A;  4NRH B;  1FCH A;  1N54 A;  3CHO A;  3VLF A;  2PQR A;  4FJY A;  3FTV A;  4DK5 A;  2AXV A;  1E96 B;  4OVV A;  4DI3 A;  3R7Q A;  4DJA A;  4Q94 A;  4F7A A;  4KZ0 A;  5A23 A;  5FQ6 A;  4I2W A;  3VLD A;  4FC8 A;  4C9B B;  2QFC A;  5JHB A;  5A6C A;  4AV7 A;  3CVX A;  4L7T A;  2KCL A;  2L0I A;  2I1J A;  3K9I A;  2Y4U A;  4GYW A;  3D9I A;  3UT8 A;  3CHR A;  5C1D A;  3D9J A;  2FO7 A;  4FUL A;  5J90 A;  5G55 A;  3FUH A;  5CMY A;  2C2L A;  3PEU B;  1FVF A;  1GW6 A;  2XPI A;  3ZHE B;  4JW1 A;  1EF1 C;  3NZS A;  4KXK B;  4UQY A;  3ONK A;  5EX0 A;  3FTU A;  3GYZ A;  4FHK A;  3BG0 B;  5FQ4 A;  1OWN A;  2KZT A;  5LP0 A;  4B94 A;  5AIJ A;  3JYS A;  1B89 A;  3O48 A;  3P1U A;  4XIF A;  3FEY A;  5CMW A;  3PH0 C;  2PQN A;  4CGW A;  2GRM A;  1E90 A;  5ANR A;  1HE8 A;  2NXP A;  4HLE A;  4G23 A;  3ENE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...