4UI9J

Atomic structure of the human anaphase-promoting complex
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVNGLEKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
total genus 179
structure length 504
sequence length 532
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ui9J00
5FZRA 2HO1A 2R5SA 2C0MA 4G1TA 4GZ3A 3CVPA 4HOSA 5CCMA 3S7BA 3N71A 1KT1A 2J9QA 4YVOA 4UQXA 4UI9C 2ONDA 4GYWA 4HORA 2I6HA 3ASHA 3WXXA 3Q5MA 1KT0A 4XI9A 3U4TA 3PE4A 3CK7A 5EX0A 2WQHA 5LCWC 5A6CA 4WUYA 3QKYA 4G23A 3KAEA 4GPKA 4JA7A 4ABNA 3Q49B 4H7YA 4JL0A 3NF1A 3QDNA 4Y6WA 1NZNA 3S7JA 3O48A 3VTXA 3QOUA 2P58C 4GA2A 1Y8MA 4GCOA 1ELRA 3ZHEB 1ZU2A 3E4BA 3FFLA 4GYOA 4BTAA 2KCLA 2BUGA 3QWWA 5BNWA 4HOTA 5LCWJ 4XIFA 3TG4A 1HZ4A 1ELWA 3FP3A 2XCBA 5EKQD 4A1SA 3ZPJA 5G04J 5CCLA 4G2VA 5G05C 4J8EA 3OXLA 4N2QA 4UQZA 2VYIA 2VSYA 3MEKA 4N3CA 3UQ3A 3UPVA 1NA0A 3LKUA 5M72A 1PC2A 5JJ7A 3PDNA 5A7DB 4N39A 2IF4A 3RKVA 2JLBA 1IHGA 2FI7A 2VGYA 3CK8A 4BTBA 2Y4TA 2XGOA 3HYMB 4WNFA 5ARFA 4IN3B 3RO2A 1IYGA 3ASDA 2FO7A 4HOUA 3GZ1A 4I17A 2UY1B 3ULQA 2HR2A 4H7XA 4HOQA 3CVLA 3SF4A 4LEUA 3R9AB 2VGXB 4CGWA 3MV3B 5HI7A 4I2WA 4U0ZA 3OXFA 1NA3A 2XCCA 2PL2A 1QZ2A 3UUXA 3Q15A 4APOA 1WM5A 1YA0A 3CV0A 3LPZA 3GZ2A 3VTYA 5BT1A 4YVQC 2PZIA 4KYOB 4AY6A 2YQ8A 4NQ0A 5HQ8A 4UI9J 4U0SA 4N2SA 2LSVA 2NC9A 5C1DA 3URZA 3EDTB 2C0LA 4N5CA 1QQEA 5FZQA 3CKCA 5AYWD 4WNEA 5EX3A 4Y6CA 4I2ZA 3Q4AB 4KXKB 4AIFA 4UQYA 4YNDA 5FZSA 5DIZA 2FF4A 5DBKA 4GZ5A 1HXIA 2HYZA 3IEGA 3BEEA 2KATA 4GZ6A 3TAXA 3AS8A 3ZGQA 2Q7FA 4I1AA 2UY1A 4KBQA 2PQNA 4GCNA 5D0QD 2PQRA 4J8FA 4O6FA 4U04A 2VGXA 4JHRA 3CVQA 1P5QA 5BW8C 1OUVA 2GW1A 2KCVA 3CVNA 3RJVA 1HH8A 3KD7A 2IFUA 5G05J 3S7DA 2VQ2A 5KJKA 3CKBA 4XI0A 3ESKA 4U0UA 5JJ6A 3LY7A 3LY8A 2LSUA 4BWRA 5JJTA 3ZN3A 4N3AA 3CK9A 2DBAA 3K9IA 4EQFA 5FJYA 4J0UA 2V5FA 4BT9A 4ME2A 4G25A 5ARGA 3FWVA 3ZHEA 5KJNA 4G24A 3LY9A 3QWPA 3SZ7A 1W3BA 1WAO1 2XGMA 4U07A 1E96B 4WNGA 4B94A 1KLXA 4GA0A 2KC7A 3U3WA 2E2EA 3AS4A 2XGSA 4JA9A 2QFCA 2Y4UA 3OXGA 4CDRA 1FCHA 2WPVA 5G04C 3RIBA 4I9EA 3QWVA 4G26A 1XNFA 4RG9A 2FBNA 4RG6A 2MHKA 4WNDA 3S7FA 3GYZA 2XPIA 5KJLA 3GW4A 5KJMA 3AS5A 2YHCA 1B89A 3RO3A 5D0OD 3Q47B 3KS2A 4AY5A 3RU0A 3PE3A 1ZBPA 5CHEE 3CEQA 2FEZA 3TGOA 2UWJG 5FT9A 3LCAA 4GYYA 2OOEA 3MA5A 4I9CA 2VSNA 3MKRA 3ZFWA 2AVPA 3MV2B 1A17A 4UI9K 4CGVA 4BT8A 2XEVA 4GA1A 4NRHB 4W9RA 2L6JA 3TG5A 2LNIA 5FTPA 4F3VA 2C2LA 1TJCA 3JYSA 4N3BA 3ASGA 4J8DA 4AM9A 3ASFA 3LYAA 2KCKA
chains in the Genus database with same CATH superfamily
4ANWA 2P9PG 3R9MA 1H0AA 4ILIA 3NB2A 3DRAA 4BFRA 4WWOA 4HFGA 3FULA 2L9BA 1OWOA 1U2VG 5G2NA 3C98A 4I6EA 4HORA 2I6HA 2ZGDA 3QC1A 2BTDA 3CGHA 4XI9A 3D3MA 2WQHA 2F0YA 5A6CA 3NBNB 2XS8A 3MZLB 5JMND 4WUYA 3B7BA 3C5RA 3HXBA 1N4SA 3Q49B 4JL0A 5FIOA 1MX2A 4CT0A 4J8YA 4LNGA 4WWNA 1BD8A 3JXIA 3TWWA 4FJZA 2GGFA 3QB2A 2A4ZA 4O60A 2P58C 1ELRA 5CECB 5D66A 2VSXE 3IHVA 3UIPC 5JA4D 1V54E 2P9KG 2XCBA 5EKQD 2I1JA 4RVBA 2WXQA 2WXMA 4I1MA 5CCLA 4HVBA 2FULA 3FTXA 4B0ZA 4JHJA 3IKOB 2GRRB 3D9HA 4L2LA 1YMPA 3NOGD 1HG2A 4ZHBA 3ML8A 1NFIE 2CHWA 2FI7A 4G8LA 1HU3A 2GRQB 4GPMA 2Y4TA 2ZGGA 3D9NA 1OWMA 4JW1A 1KZPA 4KZ0A 3FHEA 3SHFA 1RW2A 3ASDA 2FO7A 2WXRA 3GZ1A 3CVXA 3ULQA 5ENTD 3DXMG 3EU9A 5CEDB 2F8XK 3DXKG 4HLLA 4L7TA 1E7UA 4TXRA 3L9TA 3UM0A 2L6BA 3OXFA 2XCCA 3TWTA 2PL2A 2J49A 3UUXA 1WM5A 5EYPF 3J5QB 1LD8A 1FT2A 3FTUA 5BT1A 3X2QE 2CFZA 3SQVA 4CT4A 2PZIA 2XPZA 3RRNB 1PY1A 4HRMB 4L9PA 2J8SD 2YQ8A 1SZ9A 1X5BA 4U7EB 3TWRA 4EZKA 2KXPC 2OEVA 5LX8A 1V55E 3IBEA 4N5CA 2QY7A 5FZQA 3CKCA 5AYWD 3V79K 1INZA 1TNBA 3MKQB 4GTSA 3FUFA 3V30A 4LNUD 3B95A 4JEHA 4U63A 2E0IA 1A5EA 3QJZA 3E30A 5BUZA 4GZ5A 4CCAA 2XEHA 3IEGA 3EIJA 3FU6A 2XS1A 3CLJA 3ABME 1H6KA 4GZ6A 3BG1B 4A63B 1SQMA 3AS8A 4I1OB 5CRUA 3TWSA 2ETCA 3LDZA 4K0RA 3JQ0A 3ZW3A 4FHJA 4I1AA 2UY1A 4KBQA 2J4DA 1OT8A 4K03A 5E75A 1BPOA 2PQRA 1DNPA 4J8FA 3CHRA 2VGXA 5AIJA 2KM4A 3CVQA 1P5QA 1OUVA 5AJLA 1IHBA 3ZXPA 3Q78A 2XRZA 4OAUC 1IQRA 4FADA 3DSSA 2V5QC 5KJKA 3BG0B 1UN8A 2XRYA 4HNAD 1JCQA 3FTZA 1WY6A 4U0UA 4UWLA 3LY7A 3SFZA 1UJJA 3UIOC 1IQUA 3MYVA 4J0UA 4MKTA 4ME2A 5AARA 3FWVA 3R7QA 3ZHEA 4TXPA 5AQ7A 2LAHA 3O4ZA 3LY9A 2NXPA 2CG2A 3QWPA 3SZ7A 5CBOA 1SW6A 2XGMA 3HXDA 2J09A 4WNGA 3FU3A 4EBAA 5LP0A 2NSZA 3U3WA 3UI2A 4GZDA 3AS4A 2DVWA 1S64A 4KVOA 4BETA 2Y4UA 1E8XA 3OXGA 4IRUA 2DZNA 2GRNB 3RIBA 2X6HA 3QWVA 1FVHA 3UKUG 4HI8A 2FBNA 3V2OA 1JCRA 5D2MC 3AAAC 3ULEG 4WNDA 3NAWA 3HVEA 1G3NB 4YDWA 1N94A 1N4RA 3GW4A 4KZCA 4L1BA 3L82A 1E7VA 2GRPB 3RO3A 3APDA 3Q7FA 2XEEA 4F53A 4E6HA 3KS2A 4AY5A 3RU0A 3DSXA 3ZIMA 4JB8P 2FEZA 3DSUA 5BXUA 3CHPA 4GYYA 4J7WA 2J08A 3MA5A 4I9CA 5FQ6A 4X8QA 3L6AA 5ANRA 4BT8A 3RK6A 2XEVA 5BXOA 1JWGA 2IJGX 4GA1A 4ACKA 1UG3A 3L13A 2BKGA 4BX9A 5B1AE 2C2LA 1TJCA 3JYSA 3TWVA 2B6CA 2AWIA 3FU5A 3RSEG 3NQPA 1TNUA 3LYAA 3PZ1A 3L17A 2R5SA 4BESA 3BU8A 3VLDA 4G1TA 4HOSA 3SBSA 4B8AA 1UJKA 5FINA 4YVOA 2X6JA 3CHOA 1XGWA 2QC9A 4GYWA 2F37A 5ENPD 4CYMD 2MOWA 3Q5MA 3FUHA 1KT0A 2WXKA 3PE4A 5EX0A 3TWXA 5LCWC 2R17C 3KEZA 4HRLA 3PREA 4GPKA 3Q75A 3NF1A 4Y6WA 3ZYQA 3O48A 1OWLA 2J07A 3D9JA 5AENA 3ISMC 4PS3A 2WXLA 3CHQA 4GA2A 4B89A 2GROB 2OV8A 3TL5A 2X6KA 5BPPA 4F7AA 4BTAA 2AW6A 4I6GA 3TG4A 1HZ4A 1ELWA 5CRVA 3FP3A 4DK5A 2Y69E 4TV3A 2EINE 1Z6TA 3FTWA 1O1RA 3Q79A 4G2VA 4L2YA 4J8EA 5ENOD 3ZRHA 3UQ3A 2GRMA 1NA0A 4EPZA 4KT6B 2DZOA 1PC2A 2WXHA 5JJ7A 2IF4A 2OVBA 4F1SA 2JLBA 4C9BB 3ASNE 3BQOA 3B7TA 3HG0D 2X38A 4BTBA 4FJYA 3E33A 2V4LA 3HYMB 4WNFA 1N9AA 5B3SE 1MHQA 4DPRA 3MCXA 3C3OA 5B1BE 1TNYA 1TR4A 1IYGA 3C3RA 4HOUA 3HRAA 2RG8A 5C2YA 4WAFA 3ZUVB 3LJNA 4NIKA 1SA5A 2L0TB 4I2WA 4U0ZA 1NA3A 4PUCA 1QZ2A 2ZU6B 4BSZB 2LO6A 2BEDA 4HXIA 2EILE 4F1PA 3CV0A 1KPSB 3GZ2A 3ZYKA 3VTYA 1HFAA 3SFYA 2IEJA 4AY6A 5CBNA 4HBDA 1BI7B 4UI9J 3UM1A 3LJ3A 5ENSD 4GTMA 5C1DA 3URZA 3G2WA 4A3VA 5FWQA 5AJDA 3DPDA 1QQEA 2WXPA 3KSLA 3CR3A 4Y6CA 3Q4AB 4KXKB 1H6OA 3FUDA 3RRUA 4YNDA 1H19A 4XE0A 3EU5A 2DYSE 3D9IA 2LAIA 4WWPA 2EIME 2P9SG 3SNXA 4DUIA 1U3CA 3FUMA 4A3TA 1TNZA 2KATA 2WXIA 3QAQA 3FUJA 4AOFA 3U66A 2FO1E 2XPYA 4GB9A 1D9SA 5J08A 2Q7FA 2PQNA 2YHEA 3PVLA 4O6FA 4MLPA 4DI3A 1N0QA 2DIWA 2RKKA 1TN8A 2GW1A 2KCVA 5CERB 3CVNA 2WB2A 3MGBA 2IFUA 3ESLA 4I6JA 4XKBA 5G05J 2XENA 4BERA 2YINA 3AG2E 4GAAA 2DCPA 2V4HC 5JJ6A 2MYOA 3LY8A 3EJNA 1EYHA 1MJ0A 3ZN3A 4N3AA 3UT8A 4EQFA 3PZ2A 2WXFA 4D10C 3G2SA 4BT9A 4Q94A 5ENRD 2BF0X 4ZFHA 4C0EA 3Q73A 3MKQA 1OCZE 1WAO1 4U07A 4OYSA 3G2TA 3PH0C 2P9UG 5HKPA 2WQ6A 4FULA 3W9GA 4DLOA 4GA0A 3FH8A 3P1UA 3ZKJA 4B93B 2XGSA 1U3DA 4EZJA 4QFVA 1MYOA 1O5MA 4J6IA 2IONA 3Q7AA 4RG6A 4GTTA 3S7FA 1ELKA 2WQ7A 2H6IA 5EYLA 1DC2A 3PUJA 2VTBB 2XPIA 2J4BA 3D9KA 4L23A 4EZLA 1JPLA 4BY6A 4G11A 1LD7A 5CMYA 1TJFA 2VGEA 3Q47B 3RAUA 3CSTA 3PE3A 1SZAA 1SVXA 1N54A 5CHEE 3CEQA 3TGOA 1K8KG 2UWJG 4TUMA 5FT9A 1TNOA 3JUEA 2RFMA 3LEWA 3ABKE 3ASOE 4FA6A 5JHBA 2ZIRA 4W9RA 3TG5A 1YYHA 2M63A 3CQCB 4J8DA 2WM9A 2P9NG 2QZAA 3OTNA 1LF8A 3UXGA 3ASFA 5FZRA 3D9OA 2HO1A 4GTRA 2PM6A 1KZOA 4DLQA 3CVPA 4JC8A 5AQAA 3CVUA 1KT1A 4PS7A 4UQXA 4UI9C 1HG5A 1N52A 1TN6A 3AU4A 1BU9A 3CQGB 3WXXA 5AQ9A 3G2VA 4OAVB 2KZTB 2R03A 4G8KA 5KNGA 5IY5E 3T5XA 1LTXA 1D8EA 1MX6A 2WVIA 3PNTB 3DSVA 3I4RB 4M3OA 5KBAA 4G23A 3KAEA 4AVXA 4JA7A 4ABNA 4XX5A 4H7YA 4TRQA 4DX6D 5ENQD 3VTXA 2XZTG 3T9KA 3QOUA 1Y8MA 3ZHEB 4JVSA 3PUKA 3FFLA 4GYOA 2KCLA 4LRZA 3NZSA 5BNWA 4XEIG 1FT1A 3FUNA 2X6FA 4MBGA 3V2XA 4DX1A 4FU3A 3ZPJA 3QNKA 4EHMA 1Z3XA 1N4PA 4UWGA 5G05C 4FC8A 4ILHB 2VSYA 3VLEA 3MEKA 4N3CA 2QYJA 4GZCA 1Z3YA 3UT4A 3UPVA 3FTYA 2I2OA 4ANVA 2LXLA 3LKUA 3TWUA 3F6QA 3E37A 1H2UA 2ETAA 5A7DB 4N39A 2WXOA 3ML9A 3B7RL 4LNBA 1IHGA 4DX5D 2VGYA 4JPSA 2F8YA 3SBTB 4LERA 5ARFA 3FH5A 4IN3B 3RO2A 3D9LA 3FDHA 4OVUA 1E8WA 4I17A 4DX2A 4AXHA 4J8SA 1HE8A 2HR2A 4KMOA 3PNLB 4H7XA 4HOQA 3SF4A 3UM3A 1E8YA 3R9AB 4CGWA 4GMLA 5HI7A 4ILGA 4YDOA 3CVVA 1UW4B 3ONKA 3Q15A 4APOA 1MQSA 3LPZA 1IKND 1AWCB 3L54A 1DCQA 4YVQC 2WXJA 3EHQA 4KYOB 5AQBA 3UKRG 3L22A 4PH4B 4NQ0A 3TJPA 3MX3A 3PRZA 3ZYLA 3T8KA 3V31A 4HI9A 4U0SA 2NC9A 3EDTB 3ONLA 3MJWA 4WNEA 2EQXA 1EDUA 4I2ZA 4AIFA 3SY2A 2AXVA 2VSOE 3UINC 1HF8A 5DIZA 4P29A 3SFXA 3HHMA 3HXCA 1QBQA 4IYPA 1S0PA 1HXIA 3G2UA 2HYZA 1Y6IA 2PNNA 4JHKA 2WMOA 3CVYA 3ULYA 3BEEA 2CFUA 1JCSA 2EIJE 1O1TA 3ZVVA 2ILRA 4CRWA 2IO2C 4Q96A 2V0PA 3L16A 4GMJA 3ZGQA 4N5QA 2P9LG 4GCNA 5H7PA 3DEPA 3HXFA 4IULA 5CEAA 1HX8A 1H2VC 3ZU7B 3AJIA 1JUQA 5EN5D 2P9IG 4TXQA 3EHNA 4JHRA 1TYQG 5BW8C 3OAWA 5KNHD 3ZNGA 1HH8A 3PEVB 3KD7A 3S7DA 3I5PA 4NACA 3S2AA 2OVFA 4EBAG 3AG4E 1OY3D 4XI0A 3ESKA 2LSUA 2B0OE 4BWRA 3EIQC 4LG6A 5J90A 2V5FA 3PZDA 2LXMA 4YDYA 4G25A 1O1SA 4HRNA 5ARGA 5G55A 3QK0A 4URKA 4UWHA 2IOSA 1H6PA 1HO8A 4G24A 2XQ0A 1OWPA 4PS8A 4C48B 1E96B 3L08A 4GU5A 4B94A 3FUIA 3FUKA 3NZUA 4E85A 1KLXA 2V8SE 2KC7A 3J5PA 3FTVA 3UTMA 3IV0A 3APCA 5EIDA 3KEAA 4JA9A 4CDRA 4U95D 3HDXA 2WPVA 3FY4A 5KWDA 1SA4A 3EHMA 3NOCD 5ANLA 3IXEA 4CDMA 2MHKA 1Q2ZA 3PS6A 4GTPA 1S70B 2H6HA 3LVRE 4APFA 2CG3A 3QARA 4AV7A 2RFAA 3AS5A 2YHCA 1B89A 3B13A 5D0OD 5LFAA 3E32A 5FQ8A 1ZBPA 2IOLA 4CDNA 3UM2A 3WG7E 1D8DA 3APFA 1IXVA 3LCAA 4RQIA 3GZSA 1DVPA 1WG0A 2OOEA 3FTSA 3T8MA 4HB5A 4ATGA 3SO8A 3ZFWA 4K5BA 2CHXA 4UI9K 3UX4A 3CHMA 4LSZE 4UWKA 2LNIA 3JUIA 3I4GA 1UN9A 4LUNU 2MRIA 1RZ4A 2KCKA 3T5VA 4JD2G 1EF1C 2C0MA 3TWQA 4GZ3A 2LUHA 1DCEA 1MZCA 4I43A 3DPYA 5CCMA 1BI8B 3Q9NC 2HM8A 3S7BA 3N71A 2J9QA 3U64A 4BSXA 3DBSA 3Q9UC 2BKKB 4MRUA 5T3RA 2Y0BG 2ONDA 1YCSB 3ASHA 2NYJA 5E76A 3ZYMA 3U4TA 2VTBA 3CK7A 4DJAA 4O1PA 4R7LA 3QKYA 1MX4A 3QDNA 4F6RD 3S7JA 1NZNA 2OEWA 2XZDG 5LOZA 4DRXE 4JZYA 1AP7A 4QQIA 4GCOA 4B8CB 1ZU2A 4GTQA 2P2CP 5EIBE 3E4BA 4Z68A 2BUGA 4CZ2D 3QWWA 4HOTA 5LCWJ 4XIFA 4GMRA 2WXGA 4XZ4A 1OCCE 1E8ZA 4BX8A 4A1SA 4UUCA 4CEMA 5G04J 4AP2A 3AG3E 4N2QA 3OXLA 4UQZA 2VYIA 4DX7D 5FQ4A 4GTOA 5M72A 5AN8A 3PZ3A 3CHSA 2CHZA 5EDSA 3E34A 3PDNA 5A23A 3RKVA 4EECA 3KSQA 1NI1A 3CK8A 2XGOA 1WDYA 3RRMB 3LS8A 4Q69A 2KZTA 2Y1LE 2IO3C 1X81A 4O1OA 5BV0A 3CVWA 1OCOE 4K5CA 3DWLG 5KCMA 1OXJA 3JQ1A 2UY1B 4JEUA 3DSTA 4HS2A 4LCTA 3CVLA 2KBXA 4U8HA 5EILA 4ANUA 4LEUA 2YNQA 5AAOA 2L0IA 2VGXB 3MV3B 4U96D 2I1KA 2R05A 1BLXB 1OWNA 4FLBA 3R7RA 3B7UX 4BEPA 3ABLE 5HRYA 3JXJA 1YA0A 5T4YA 2WXNA 3ZXSA 5JHAA 2AXUA 1QNFA 2ZXWE 2H6GA 5HQ8A 4U8YD 1HS6A 2R02A 3FEYA 4N2SA 2LSVA 3BUAA 2DWZA 2X6IA 1N0RA 2C0LA 3LXUX 3FUEA 3P2BA 5EX3A 2R2LA 4JXTA 4UQYA 3I3NA 5FZSA 2ETBA 3C72A 4TUUA 2FF4A 2XHEA 4FHKA 5DBKA 4UWFA 3CSFA 2GRLA 1K1BA 3HXEA 3SI5A 2WMNA 3TAXA 2A5UA 5T8IA 4A55A 3EHRA 2OCCE 4NURA 3HIZA 2Y3AA 2X3MA 4AEZC 4MS6A 4KVMA 4FLHA 3TXMA 1E90A 5D0QD 3HVEB 2DYRE 1ZB1A 3DSWA 1GW6A 4YDEA 3RJVA 5FQ7A 4C0MA 1N95A 2VQ2A 2IY0C 3AG1E 3CKBA 1N11A 1NP7A 2R59A 1NL4A 5JJTA 3C3QA 3FU0A 5CMWA 2EIKE 2DBAA 3CK9A 3K9IA 5FJYA 2A5EA 2JABA 2H6FA 3FH7A 5ENNA 4M7CA 5KJNA 3D9MA 4RSYA 1K3ZD 3W9FA 1W3BA 3B7SA 1K1AA 1L5JA 3PZ4A 4HLEA 3TXNA 4HQDA 1FPPA 2IQCA 2E2EA 3D9PA 2QFCA 1FCHA 4V3IA 1VDYA 2AXZA 2HE0A 4K5AB 3ZEFA 5G04C 5ITZF 2ZISA 4I9EA 3UMVA 1EPUA 4G26A 3IHYA 1XNFA 4RG9A 2IU1A 2I9CA 3PEUB 3U9WA 4GTVA 3GYZA 1Z5SC 3ENEA 1UOHA 3DEOA 5KJLA 3CIAA 3SGHA 5KJMA 2PM7A 5BV1A 2QYUA 4XKCA 3LVQE 3JCKC 4RLYA 4A1GA 4ATZD 4OVVA 1TN7A 1TEZA 2JEKA 4PDXA 1H2TC 3AU5A 3VLFA 5HS0A 4ACLA 3SD5A 1S63A 2VSNA 3MKRA 4U8VD 2AJAA 4DI4A 2AVPA 3MV2B 2VJ8A 2RD0A 4ANXA 1A17A 4CGVA 4NRHB 3UT7A 2L6JA 3EUVA 3FEXA 1JWFA 1PAQA 5FTPA 4F3VA 4N3BA 3ASGA 1FVFA 1OCRE 1QYMA 4FP7A 4AJWA 4AM9A 4U04A 1N4QA
chains in the Genus database with same CATH topology
3T5VA 3L17A 5FZRA 4ANWA 3D9OA 2HO1A 2R5SA 3VLDA 1EF1C 2C0MA 1H0AA 2PM6A 4G1TA 4ILIA 4GZ3A 4DLQA 3CVPA 4I43A 4HOSA 5CCMA 4JC8A 3SBSA 2HM8A 3S7BA 3N71A 4BFRA 4B8AA 3CVUA 4WWOA 1KT1A 1UJKA 4PS7A 2J9QA 4HFGA 3FULA 4YVOA 2L9BA 2X6JA 3U64A 4BSXA 3DBSA 1OWOA 4UQXA 3CHOA 1XGWA 4UI9C 5G2NA 3C98A 4MRUA 5T3RA 2ONDA 1HG5A 1N52A 3AU4A 4GYWA 4I6EA 4HORA 3CQGB 2I6HA 3ASHA 3QC1A 2MOWA 3WXXA 3Q5MA 3G2VA 5E76A 2BTDA 3CGHA 3FUHA 1KT0A 2KZTB 4XI9A 3U4TA 3ZYMA 2WXKA 3D3MA 3PE4A 2VTBA 3CK7A 5EX0A 2WQHA 3T5XA 4DJAA 5LCWC 2R17C 3KEZA 5A6CA 3MZLB 2WVIA 3PNTB 4WUYA 3I4RB 4R7LA 3QKYA 4M3OA 4G23A 3KAEA 3PREA 4JA7A 4AVXA 4ABNA 4GPKA 3Q49B 4XX5A 4H7YA 4TRQA 4JL0A 3NF1A 4CT0A 3QDNA 4Y6WA 1NZNA 3S7JA 3ZYQA 3O48A 4WWNA 1OWLA 2J07A 3D9JA 5LOZA 3VTXA 5AENA 4PS3A 4FJZA 3QOUA 2GGFA 4JZYA 3QB2A 2A4ZA 2WXLA 3CHQA 2P58C 4GA2A 1Y8MA 4GCOA 1ELRA 4B89A 3ZHEB 4B8CB 1ZU2A 2OV8A 3TL5A 2X6KA 4JVSA 5BPPA 3PUKA 3E4BA 3FFLA 4GYOA 4F7AA 4BTAA 2KCLA 2BUGA 2VSXE 3QWWA 3IHVA 4LRZA 3NZSA 5BNWA 2AW6A 5LCWJ 4HOTA 4I6GA 4XIFA 3TG4A 2WXGA 1HZ4A 4XZ4A 3FUNA 1ELWA 1E8ZA 2X6FA 3FP3A 2XCBA 4DK5A 4TV3A 4FU3A 5EKQD 2I1JA 4A1SA 3ZPJA 1Z6TA 2WXQA 4RVBA 3QNKA 4BX8A 2WXMA 4CEMA 4I1MA 5G04J 5CCLA 3FTWA 4HVBA 2FULA 1Z3XA 4UWGA 3FTXA 4AP2A 4G2VA 4L2YA 5G05C 4J8EA 3OXLA 4FC8A 4UQZA 2VYIA 4B0ZA 4N2QA 4ILHB 3ZRHA 2VSYA 3VLEA 3MEKA 4N3CA 4JHJA 3UQ3A 3IKOB 4GZCA 1Z3YA 2GRMA 5FQ4A 1NA0A 3UT4A 3UPVA 4L2LA 3FTYA 2I2OA 4ANVA 3LKUA 5M72A 1HG2A 4EPZA 3CHSA 4KT6B 1PC2A 2CHZA 2WXHA 1H2UA 5JJ7A 5EDSA 3PDNA 5A7DB 4N39A 2IF4A 2OVBA 2WXOA 3ML8A 5A23A 4F1SA 3ML9A 3RKVA 2JLBA 4C9BB 4EECA 3B7RL 2CHWA 1IHGA 3B7TA 2FI7A 2VGYA 3CK8A 4JPSA 1HU3A 2X38A 4FJYA 4BTBA 2Y4TA 2XGOA 3D9NA 2V4LA 3RRMB 3HYMB 3LS8A 4WNFA 3SBTB 1OWMA 4JW1A 4Q69A 1MHQA 2KZTA 4LERA 5ARFA 3FH5A 4IN3B 3MCXA 4DPRA 3RO2A 3D9LA 3FDHA 4KZ0A 1IYGA 4OVUA 3FHEA 5BV0A 1E8WA 3SHFA 3CVWA 5KCMA 3ASDA 2FO7A 4HOUA 2WXRA 3JQ1A 3GZ1A 2RG8A 5C2YA 4I17A 4WAFA 4AXHA 2UY1B 4J8SA 4JEUA 3CVXA 1HE8A 3ULQA 2HR2A 4HS2A 4KMOA 3PNLB 4H7XA 4HOQA 4LCTA 3CVLA 3SF4A 4U8HA 4ANUA 1E8YA 4LEUA 2YNQA 1E7UA 4L7TA 2L0IA 3R9AB 2VGXB 4CGWA 4GMLA 3MV3B 2L0TB 5HI7A 4I2WA 3OXFA 4U0ZA 1NA3A 2XCCA 2I1KA 4PUCA 2PL2A 1OWNA 1QZ2A 2J49A 2ZU6B 4FLBA 4ILGA 3R7RA 3UUXA 3B7UX 3CVVA 1UW4B 2LO6A 3ONKA 3Q15A 4APOA 1WM5A 1MQSA 1YA0A 4HXIA 5T4YA 3CV0A 3LPZA 3GZ2A 3L54A 3ZYKA 2WXNA 3FTUA 3VTYA 1HFAA 3ZXSA 5BT1A 2CFZA 4YVQC 4CT4A 2WXJA 2PZIA 4KYOB 2XPZA 3RRNB 5JHAA 1PY1A 2AXUA 4AY6A 1QNFA 2YQ8A 3L22A 1SZ9A 1X5BA 4NQ0A 4PH4B 3MX3A 3TJPA 3PRZA 3ZYLA 5HQ8A 4UI9J 1HS6A 3LJ3A 3FEYA 4U0SA 4N2SA 2LSVA 4EZKA 2NC9A 5C1DA 3URZA 3G2WA 2X6IA 4A3VA 5FWQA 3EDTB 5AJDA 5LX8A 3DPDA 2C0LA 3IBEA 3ONLA 4N5CA 1QQEA 2QY7A 3LXUX 5FZQA 3CKCA 5AYWD 2WXPA 3FUEA 3P2BA 3CR3A 3MJWA 4WNEA 2EQXA 5EX3A 1INZA 1EDUA 4Y6CA 3Q4AB 4I2ZA 4KXKB 4AIFA 4JXTA 3MKQB 3FUDA 3RRUA 2AXVA 3I3NA 4UQYA 4YNDA 2VSOE 3FUFA 5FZSA 1H19A 1HF8A 5DIZA 4TUUA 4JEHA 4P29A 4U63A 4XE0A 2E0IA 3QJZA 2FF4A 3HHMA 2XHEA 4FHKA 5BUZA 5DBKA 3D9IA 4UWFA 4GZ5A 4CCAA 3CSFA 2LAIA 4IYPA 1S0PA 1HXIA 3G2UA 4WWPA 2HYZA 2GRLA 1Y6IA 4JHKA 3IEGA 2WMOA 3EIJA 3FU6A 3CVYA 3SNXA 1U3CA 3FUMA 4A3TA 3SI5A 3BEEA 3CLJA 2CFUA 2KATA 1H6KA 4GZ6A 3ZVVA 3BG1B 2WMNA 2WXIA 1SQMA 2A5UA 3QAQA 3FUJA 2ILRA 3AS8A 3TAXA 4AOFA 4CRWA 3U66A 5T8IA 4I1OB 2XPYA 4A55A 4GB9A 4Q96A 2V0PA 3LDZA 3L16A 4GMJA 4K0RA 4NURA 3JQ0A 3ZGQA 5J08A 3ZW3A 3HIZA 2Y3AA 2X3MA 2Q7FA 4FHJA 4AEZC 4I1AA 4MS6A 2UY1A 4KVMA 4KBQA 2PQNA 2YHEA 4FLHA 4GCNA 3PVLA 3TXMA 1E90A 2J4DA 5D0QD 3HVEB 4K03A 4IULA 5E75A 1HX8A 1BPOA 1H2VC 2PQRA 1DNPA 4J8FA 4O6FA 4MLPA 4DI3A 2DIWA 3CHRA 1JUQA 4U04A 2VGXA 5AIJA 3EHNA 4JHRA 2KM4A 3CVQA 1GW6A 1P5QA 5BW8C 1OUVA 2GW1A 3OAWA 5AJLA 2KCVA 2XRZA 3CVNA 1IQRA 3RJVA 2WB2A 1HH8A 3MGBA 5FQ7A 3PEVB 3KD7A 2IFUA 3ESLA 4I6JA 4XKBA 5G05J 3S7DA 3I5PA 4C0MA 4NACA 3S2AA 4FADA 2YINA 4GAAA 2OVFA 2VQ2A 5KJKA 4EBAG 2DCPA 3BG0B 1UN8A 2XRYA 3CKBA 3FTZA 1WY6A 4XI0A 3ESKA 4U0UA 1NP7A 4UWLA 5JJ6A 3LY7A 3LY8A 3EJNA 2R59A 3SFZA 1EYHA 2LSUA 4BWRA 1UJJA 5JJTA 3ZN3A 4N3AA 3FU0A 5CMWA 3CK9A 2DBAA 3K9IA 3UT8A 1IQUA 4EQFA 5FJYA 3MYVA 2WXFA 4J0UA 4D10C 3EIQC 5J90A 2V5FA 3G2SA 3PZDA 4BT9A 4MKTA 3FH7A 4ME2A 4G25A 5ENNA 4Q94A 5ARGA 3FWVA 3R7QA 5G55A 3ZHEA 3QK0A 4URKA 5KJNA 3D9MA 4UWHA 2BF0X 2IOSA 1HO8A 4G24A 4RSYA 2LAHA 4C0EA 3O4ZA 2XQ0A 3LY9A 2NXPA 1OWPA 2CG2A 3MKQA 3QWPA 3SZ7A 4PS8A 1W3BA 1WAO1 2XGMA 4U07A 3B7SA 1E96B 4OYSA 2J09A 3G2TA 3L08A 3PH0C 4GU5A 3FU3A 4WNGA 4B94A 2WQ6A 1L5JA 3FUIA 4FULA 3FUKA 3NZUA 4EBAA 4E85A 1KLXA 5LP0A 4HLEA 4DLOA 4GA0A 2V8SE 2KC7A 3FH8A 3P1UA 3TXNA 3FTVA 2NSZA 3U3WA 2IQCA 3IV0A 4GZDA 3APCA 2E2EA 3AS4A 2XGSA 3D9PA 4KVOA 4JA9A 2QFCA 2Y4UA 1E8XA 3OXGA 1U3DA 4IRUA 4CDRA 1FCHA 4V3IA 4EZJA 1VDYA 3HDXA 2AXZA 4QFVA 3ZEFA 2WPVA 3FY4A 5G04C 3RIBA 4I9EA 2X6HA 3UMVA 3EHMA 3QWVA 1FVHA 4J6IA 5ANLA 1EPUA 4G26A 3IHYA 1XNFA 4RG9A 2IONA 2FBNA 4CDMA 2IU1A 2MHKA 4RG6A 4WNDA 2I9CA 3HVEA 3PEUB 3PS6A 3S7FA 1ELKA 3U9WA 2WQ7A 3GYZA 3PUJA 2VTBB 2XPIA 2J4BA 3ENEA 5KJLA 3CIAA 3LVRE 4APFA 2CG3A 3GW4A 4KZCA 3SGHA 5KJMA 3QARA 4AV7A 4L1BA 3D9KA 2PM7A 5BV1A 4L23A 3AS5A 1E7VA 4XKCA 2YHCA 3LVQE 4EZLA 1JPLA 1B89A 3RO3A 4BY6A 3B13A 3JCKC 4G11A 5CMYA 1TJFA 3APDA 5D0OD 4A1GA 5LFAA 4F53A 4E6HA 3Q47B 3KS2A 3CSTA 4OVVA 4AY5A 2JEKA 1TEZA 5FQ8A 3PE3A 3RU0A 1SZAA 4PDXA 1H2TC 1ZBPA 1N54A 2IOLA 5CHEE 3ZIMA 3CEQA 3AU5A 4CDNA 2FEZA 3TGOA 3VLFA 2UWJG 3APFA 5FT9A 3CHPA 3LCAA 3GZSA 1DVPA 4GYYA 2OOEA 3FTSA 3T8MA 2J08A 3MA5A 4ACLA 4I9CA 3SD5A 5FQ6A 2VSNA 3MKRA 4ATGA 4DI4A 3ZFWA 2AVPA 3MV2B 3LEWA 2VJ8A 3L6AA 2RD0A 4ANXA 2CHXA 1A17A 4UI9K 5ANRA 4FA6A 4CGVA 4BT8A 5JHBA 3RK6A 3UX4A 2XEVA 1JWGA 2IJGX 3CHMA 4GA1A 4NRHB 4UWKA 3UT7A 4W9RA 2L6JA 3TG5A 1UG3A 3L13A 4ACKA 4BX9A 3FEXA 1JWFA 2LNIA 1PAQA 2M63A 5FTPA 2C2LA 4F3VA 1TJCA 3I4GA 3JUIA 3CQCB 3JYSA 1UN9A 3ASGA 4J8DA 2WM9A 4N3BA 1FVFA 2AWIA 3OTNA 3FU5A 4LUNU 1LF8A 4FP7A 4AJWA 4AM9A 3ASFA 2MRIA 3NQPA 3LYAA 2KCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZR A;  2HO1 A;  2R5S A;  2C0M A;  4G1T A;  4GZ3 A;  3CVP A;  4HOS A;  5CCM A;  3S7B A;  3N71 A;  1KT1 A;  2J9Q A;  4YVO A;  4UQX A;  4UI9 C;  2OND A;  4GYW A;  4HOR A;  2I6H A;  3ASH A;  3WXX A;  3Q5M A;  1KT0 A;  4XI9 A;  3U4T A;  3PE4 A;  3CK7 A;  5EX0 A;  2WQH A;  5LCW C;  5A6C A;  4WUY A;  3QKY A;  4G23 A;  3KAE A;  4GPK A;  4JA7 A;  4ABN A;  3Q49 B;  4H7Y A;  4JL0 A;  3NF1 A;  3QDN A;  4Y6W A;  1NZN A;  3S7J A;  3O48 A;  3VTX A;  3QOU A;  2P58 C;  4GA2 A;  1Y8M A;  4GCO A;  1ELR A;  3ZHE B;  1ZU2 A;  3E4B A;  3FFL A;  4GYO A;  4BTA A;  2KCL A;  2BUG A;  3QWW A;  5BNW A;  4HOT A;  5LCW J;  4XIF A;  3TG4 A;  1HZ4 A;  1ELW A;  3FP3 A;  2XCB A;  5EKQ D;  4A1S A;  3ZPJ A;  5G04 J;  5CCL A;  4G2V A;  5G05 C;  4J8E A;  3OXL A;  4N2Q A;  4UQZ A;  2VYI A;  2VSY A;  3MEK A;  4N3C A;  3UQ3 A;  3UPV A;  1NA0 A;  3LKU A;  5M72 A;  1PC2 A;  5JJ7 A;  3PDN A;  5A7D B;  4N39 A;  2IF4 A;  3RKV A;  2JLB A;  1IHG A;  2FI7 A;  2VGY A;  3CK8 A;  4BTB A;  2Y4T A;  2XGO A;  3HYM B;  4WNF A;  5ARF A;  4IN3 B;  3RO2 A;  1IYG A;  3ASD A;  2FO7 A;  4HOU A;  3GZ1 A;  4I17 A;  2UY1 B;  3ULQ A;  2HR2 A;  4H7X A;  4HOQ A;  3CVL A;  3SF4 A;  4LEU A;  3R9A B;  2VGX B;  4CGW A;  3MV3 B;  5HI7 A;  4I2W A;  4U0Z A;  3OXF A;  1NA3 A;  2XCC A;  2PL2 A;  1QZ2 A;  3UUX A;  3Q15 A;  4APO A;  1WM5 A;  1YA0 A;  3CV0 A;  3LPZ A;  3GZ2 A;  3VTY A;  5BT1 A;  4YVQ C;  2PZI A;  4KYO B;  4AY6 A;  2YQ8 A;  4NQ0 A;  5HQ8 A;  4UI9 J;  4U0S A;  4N2S A;  2LSV A;  2NC9 A;  5C1D A;  3URZ A;  3EDT B;  2C0L A;  4N5C A;  1QQE A;  5FZQ A;  3CKC A;  5AYW D;  4WNE A;  5EX3 A;  4Y6C A;  4I2Z A;  3Q4A B;  4KXK B;  4AIF A;  4UQY A;  4YND A;  5FZS A;  5DIZ A;  2FF4 A;  5DBK A;  4GZ5 A;  1HXI A;  2HYZ A;  3IEG A;  3BEE A;  2KAT A;  4GZ6 A;  3TAX A;  3AS8 A;  3ZGQ A;  2Q7F A;  4I1A A;  2UY1 A;  4KBQ A;  2PQN A;  4GCN A;  5D0Q D;  2PQR A;  4J8F A;  4O6F A;  4U04 A;  2VGX A;  4JHR A;  3CVQ A;  1P5Q A;  5BW8 C;  1OUV A;  2GW1 A;  2KCV A;  3CVN A;  3RJV A;  1HH8 A;  3KD7 A;  2IFU A;  5G05 J;  3S7D A;  2VQ2 A;  5KJK A;  3CKB A;  4XI0 A;  3ESK A;  4U0U A;  5JJ6 A;  3LY7 A;  3LY8 A;  2LSU A;  4BWR A;  5JJT A;  3ZN3 A;  4N3A A;  3CK9 A;  2DBA A;  3K9I A;  4EQF A;  5FJY A;  4J0U A;  2V5F A;  4BT9 A;  4ME2 A;  4G25 A;  5ARG A;  3FWV A;  3ZHE A;  5KJN A;  4G24 A;  3LY9 A;  3QWP A;  3SZ7 A;  1W3B A;  1WAO 1;  2XGM A;  4U07 A;  1E96 B;  4WNG A;  4B94 A;  1KLX A;  4GA0 A;  2KC7 A;  3U3W A;  2E2E A;  3AS4 A;  2XGS A;  4JA9 A;  2QFC A;  2Y4U A;  3OXG A;  4CDR A;  1FCH A;  2WPV A;  5G04 C;  3RIB A;  4I9E A;  3QWV A;  4G26 A;  1XNF A;  4RG9 A;  2FBN A;  4RG6 A;  2MHK A;  4WND A;  3S7F A;  3GYZ A;  2XPI A;  5KJL A;  3GW4 A;  5KJM A;  3AS5 A;  2YHC A;  1B89 A;  3RO3 A;  5D0O D;  3Q47 B;  3KS2 A;  4AY5 A;  3RU0 A;  3PE3 A;  1ZBP A;  5CHE E;  3CEQ A;  2FEZ A;  3TGO A;  2UWJ G;  5FT9 A;  3LCA A;  4GYY A;  2OOE A;  3MA5 A;  4I9C A;  2VSN A;  3MKR A;  3ZFW A;  2AVP A;  3MV2 B;  1A17 A;  4UI9 K;  4CGV A;  4BT8 A;  2XEV A;  4GA1 A;  4NRH B;  4W9R A;  2L6J A;  3TG5 A;  2LNI A;  5FTP A;  4F3V A;  2C2L A;  1TJC A;  3JYS A;  4N3B A;  3ASG A;  4J8D A;  4AM9 A;  3ASF A;  3LYA A;  2KCK A; 
#chains in the Genus database with same CATH topology
 4ANW A;  2P9P G;  3R9M A;  1H0A A;  4ILI A;  3NB2 A;  3DRA A;  4BFR A;  4WWO A;  4HFG A;  3FUL A;  2L9B A;  1OWO A;  1U2V G;  5G2N A;  3C98 A;  4I6E A;  4HOR A;  2I6H A;  2ZGD A;  3QC1 A;  2BTD A;  3CGH A;  4XI9 A;  3D3M A;  2WQH A;  2F0Y A;  5A6C A;  3NBN B;  2XS8 A;  3MZL B;  5JMN D;  4WUY A;  3B7B A;  3C5R A;  3HXB A;  1N4S A;  3Q49 B;  4JL0 A;  5FIO A;  1MX2 A;  4CT0 A;  4J8Y A;  4LNG A;  4WWN A;  1BD8 A;  3JXI A;  3TWW A;  4FJZ A;  2GGF A;  3QB2 A;  2A4Z A;  4O60 A;  2P58 C;  1ELR A;  5CEC B;  5D66 A;  2VSX E;  3IHV A;  3UIP C;  5JA4 D;  1V54 E;  2P9K G;  2XCB A;  5EKQ D;  2I1J A;  4RVB A;  2WXQ A;  2WXM A;  4I1M A;  5CCL A;  4HVB A;  2FUL A;  3FTX A;  4B0Z A;  4JHJ A;  3IKO B;  2GRR B;  3D9H A;  4L2L A;  1YMP A;  3NOG D;  1HG2 A;  4ZHB A;  3ML8 A;  1NFI E;  2CHW A;  2FI7 A;  4G8L A;  1HU3 A;  2GRQ B;  4GPM A;  2Y4T A;  2ZGG A;  3D9N A;  1OWM A;  4JW1 A;  1KZP A;  4KZ0 A;  3FHE A;  3SHF A;  1RW2 A;  3ASD A;  2FO7 A;  2WXR A;  3GZ1 A;  3CVX A;  3ULQ A;  5ENT D;  3DXM G;  3EU9 A;  5CED B;  2F8X K;  3DXK G;  4HLL A;  4L7T A;  1E7U A;  4TXR A;  3L9T A;  3UM0 A;  2L6B A;  3OXF A;  2XCC A;  3TWT A;  2PL2 A;  2J49 A;  3UUX A;  1WM5 A;  5EYP F;  3J5Q B;  1LD8 A;  1FT2 A;  3FTU A;  5BT1 A;  3X2Q E;  2CFZ A;  3SQV A;  4CT4 A;  2PZI A;  2XPZ A;  3RRN B;  1PY1 A;  4HRM B;  4L9P A;  2J8S D;  2YQ8 A;  1SZ9 A;  1X5B A;  4U7E B;  3TWR A;  4EZK A;  2KXP C;  2OEV A;  5LX8 A;  1V55 E;  3IBE A;  4N5C A;  2QY7 A;  5FZQ A;  3CKC A;  5AYW D;  3V79 K;  1INZ A;  1TNB A;  3MKQ B;  4GTS A;  3FUF A;  3V30 A;  4LNU D;  3B95 A;  4JEH A;  4U63 A;  2E0I A;  1A5E A;  3QJZ A;  3E30 A;  5BUZ A;  4GZ5 A;  4CCA A;  2XEH A;  3IEG A;  3EIJ A;  3FU6 A;  2XS1 A;  3CLJ A;  3ABM E;  1H6K A;  4GZ6 A;  3BG1 B;  4A63 B;  1SQM A;  3AS8 A;  4I1O B;  5CRU A;  3TWS A;  2ETC A;  3LDZ A;  4K0R A;  3JQ0 A;  3ZW3 A;  4FHJ A;  4I1A A;  2UY1 A;  4KBQ A;  2J4D A;  1OT8 A;  4K03 A;  5E75 A;  1BPO A;  2PQR A;  1DNP A;  4J8F A;  3CHR A;  2VGX A;  5AIJ A;  2KM4 A;  3CVQ A;  1P5Q A;  1OUV A;  5AJL A;  1IHB A;  3ZXP A;  3Q78 A;  2XRZ A;  4OAU C;  1IQR A;  4FAD A;  3DSS A;  2V5Q C;  5KJK A;  3BG0 B;  1UN8 A;  2XRY A;  4HNA D;  1JCQ A;  3FTZ A;  1WY6 A;  4U0U A;  4UWL A;  3LY7 A;  3SFZ A;  1UJJ A;  3UIO C;  1IQU A;  3MYV A;  4J0U A;  4MKT A;  4ME2 A;  5AAR A;  3FWV A;  3R7Q A;  3ZHE A;  4TXP A;  5AQ7 A;  2LAH A;  3O4Z A;  3LY9 A;  2NXP A;  2CG2 A;  3QWP A;  3SZ7 A;  5CBO A;  1SW6 A;  2XGM A;  3HXD A;  2J09 A;  4WNG A;  3FU3 A;  4EBA A;  5LP0 A;  2NSZ A;  3U3W A;  3UI2 A;  4GZD A;  3AS4 A;  2DVW A;  1S64 A;  4KVO A;  4BET A;  2Y4U A;  1E8X A;  3OXG A;  4IRU A;  2DZN A;  2GRN B;  3RIB A;  2X6H A;  3QWV A;  1FVH A;  3UKU G;  4HI8 A;  2FBN A;  3V2O A;  1JCR A;  5D2M C;  3AAA C;  3ULE G;  4WND A;  3NAW A;  3HVE A;  1G3N B;  4YDW A;  1N94 A;  1N4R A;  3GW4 A;  4KZC A;  4L1B A;  3L82 A;  1E7V A;  2GRP B;  3RO3 A;  3APD A;  3Q7F A;  2XEE A;  4F53 A;  4E6H A;  3KS2 A;  4AY5 A;  3RU0 A;  3DSX A;  3ZIM A;  4JB8 P;  2FEZ A;  3DSU A;  5BXU A;  3CHP A;  4GYY A;  4J7W A;  2J08 A;  3MA5 A;  4I9C A;  5FQ6 A;  4X8Q A;  3L6A A;  5ANR A;  4BT8 A;  3RK6 A;  2XEV A;  5BXO A;  1JWG A;  2IJG X;  4GA1 A;  4ACK A;  1UG3 A;  3L13 A;  2BKG A;  4BX9 A;  5B1A E;  2C2L A;  1TJC A;  3JYS A;  3TWV A;  2B6C A;  2AWI A;  3FU5 A;  3RSE G;  3NQP A;  1TNU A;  3LYA A;  3PZ1 A;  3L17 A;  2R5S A;  4BES A;  3BU8 A;  3VLD A;  4G1T A;  4HOS A;  3SBS A;  4B8A A;  1UJK A;  5FIN A;  4YVO A;  2X6J A;  3CHO A;  1XGW A;  2QC9 A;  4GYW A;  2F37 A;  5ENP D;  4CYM D;  2MOW A;  3Q5M A;  3FUH A;  1KT0 A;  2WXK A;  3PE4 A;  5EX0 A;  3TWX A;  5LCW C;  2R17 C;  3KEZ A;  4HRL A;  3PRE A;  4GPK A;  3Q75 A;  3NF1 A;  4Y6W A;  3ZYQ A;  3O48 A;  1OWL A;  2J07 A;  3D9J A;  5AEN A;  3ISM C;  4PS3 A;  2WXL A;  3CHQ A;  4GA2 A;  4B89 A;  2GRO B;  2OV8 A;  3TL5 A;  2X6K A;  5BPP A;  4F7A A;  4BTA A;  2AW6 A;  4I6G A;  3TG4 A;  1HZ4 A;  1ELW A;  5CRV A;  3FP3 A;  4DK5 A;  2Y69 E;  4TV3 A;  2EIN E;  1Z6T A;  3FTW A;  1O1R A;  3Q79 A;  4G2V A;  4L2Y A;  4J8E A;  5ENO D;  3ZRH A;  3UQ3 A;  2GRM A;  1NA0 A;  4EPZ A;  4KT6 B;  2DZO A;  1PC2 A;  2WXH A;  5JJ7 A;  2IF4 A;  2OVB A;  4F1S A;  2JLB A;  4C9B B;  3ASN E;  3BQO A;  3B7T A;  3HG0 D;  2X38 A;  4BTB A;  4FJY A;  3E33 A;  2V4L A;  3HYM B;  4WNF A;  1N9A A;  5B3S E;  1MHQ A;  4DPR A;  3MCX A;  3C3O A;  5B1B E;  1TNY A;  1TR4 A;  1IYG A;  3C3R A;  4HOU A;  3HRA A;  2RG8 A;  5C2Y A;  4WAF A;  3ZUV B;  3LJN A;  4NIK A;  1SA5 A;  2L0T B;  4I2W A;  4U0Z A;  1NA3 A;  4PUC A;  1QZ2 A;  2ZU6 B;  4BSZ B;  2LO6 A;  2BED A;  4HXI A;  2EIL E;  4F1P A;  3CV0 A;  1KPS B;  3GZ2 A;  3ZYK A;  3VTY A;  1HFA A;  3SFY A;  2IEJ A;  4AY6 A;  5CBN A;  4HBD A;  1BI7 B;  4UI9 J;  3UM1 A;  3LJ3 A;  5ENS D;  4GTM A;  5C1D A;  3URZ A;  3G2W A;  4A3V A;  5FWQ A;  5AJD A;  3DPD A;  1QQE A;  2WXP A;  3KSL A;  3CR3 A;  4Y6C A;  3Q4A B;  4KXK B;  1H6O A;  3FUD A;  3RRU A;  4YND A;  1H19 A;  4XE0 A;  3EU5 A;  2DYS E;  3D9I A;  2LAI A;  4WWP A;  2EIM E;  2P9S G;  3SNX A;  4DUI A;  1U3C A;  3FUM A;  4A3T A;  1TNZ A;  2KAT A;  2WXI A;  3QAQ A;  3FUJ A;  4AOF A;  3U66 A;  2FO1 E;  2XPY A;  4GB9 A;  1D9S A;  5J08 A;  2Q7F A;  2PQN A;  2YHE A;  3PVL A;  4O6F A;  4MLP A;  4DI3 A;  1N0Q A;  2DIW A;  2RKK A;  1TN8 A;  2GW1 A;  2KCV A;  5CER B;  3CVN A;  2WB2 A;  3MGB A;  2IFU A;  3ESL A;  4I6J A;  4XKB A;  5G05 J;  2XEN A;  4BER A;  2YIN A;  3AG2 E;  4GAA A;  2DCP A;  2V4H C;  5JJ6 A;  2MYO A;  3LY8 A;  3EJN A;  1EYH A;  1MJ0 A;  3ZN3 A;  4N3A A;  3UT8 A;  4EQF A;  3PZ2 A;  2WXF A;  4D10 C;  3G2S A;  4BT9 A;  4Q94 A;  5ENR D;  2BF0 X;  4ZFH A;  4C0E A;  3Q73 A;  3MKQ A;  1OCZ E;  1WAO 1;  4U07 A;  4OYS A;  3G2T A;  3PH0 C;  2P9U G;  5HKP A;  2WQ6 A;  4FUL A;  3W9G A;  4DLO A;  4GA0 A;  3FH8 A;  3P1U A;  3ZKJ A;  4B93 B;  2XGS A;  1U3D A;  4EZJ A;  4QFV A;  1MYO A;  1O5M A;  4J6I A;  2ION A;  3Q7A A;  4RG6 A;  4GTT A;  3S7F A;  1ELK A;  2WQ7 A;  2H6I A;  5EYL A;  1DC2 A;  3PUJ A;  2VTB B;  2XPI A;  2J4B A;  3D9K A;  4L23 A;  4EZL A;  1JPL A;  4BY6 A;  4G11 A;  1LD7 A;  5CMY A;  1TJF A;  2VGE A;  3Q47 B;  3RAU A;  3CST A;  3PE3 A;  1SZA A;  1SVX A;  1N54 A;  5CHE E;  3CEQ A;  3TGO A;  1K8K G;  2UWJ G;  4TUM A;  5FT9 A;  1TNO A;  3JUE A;  2RFM A;  3LEW A;  3ABK E;  3ASO E;  4FA6 A;  5JHB A;  2ZIR A;  4W9R A;  3TG5 A;  1YYH A;  2M63 A;  3CQC B;  4J8D A;  2WM9 A;  2P9N G;  2QZA A;  3OTN A;  1LF8 A;  3UXG A;  3ASF A;  5FZR A;  3D9O A;  2HO1 A;  4GTR A;  2PM6 A;  1KZO A;  4DLQ A;  3CVP A;  4JC8 A;  5AQA A;  3CVU A;  1KT1 A;  4PS7 A;  4UQX A;  4UI9 C;  1HG5 A;  1N52 A;  1TN6 A;  3AU4 A;  1BU9 A;  3CQG B;  3WXX A;  5AQ9 A;  3G2V A;  4OAV B;  2KZT B;  2R03 A;  4G8K A;  5KNG A;  5IY5 E;  3T5X A;  1LTX A;  1D8E A;  1MX6 A;  2WVI A;  3PNT B;  3DSV A;  3I4R B;  4M3O A;  5KBA A;  4G23 A;  3KAE A;  4AVX A;  4JA7 A;  4ABN A;  4XX5 A;  4H7Y A;  4TRQ A;  4DX6 D;  5ENQ D;  3VTX A;  2XZT G;  3T9K A;  3QOU A;  1Y8M A;  3ZHE B;  4JVS A;  3PUK A;  3FFL A;  4GYO A;  2KCL A;  4LRZ A;  3NZS A;  5BNW A;  4XEI G;  1FT1 A;  3FUN A;  2X6F A;  4MBG A;  3V2X A;  4DX1 A;  4FU3 A;  3ZPJ A;  3QNK A;  4EHM A;  1Z3X A;  1N4P A;  4UWG A;  5G05 C;  4FC8 A;  4ILH B;  2VSY A;  3VLE A;  3MEK A;  4N3C A;  2QYJ A;  4GZC A;  1Z3Y A;  3UT4 A;  3UPV A;  3FTY A;  2I2O A;  4ANV A;  2LXL A;  3LKU A;  3TWU A;  3F6Q A;  3E37 A;  1H2U A;  2ETA A;  5A7D B;  4N39 A;  2WXO A;  3ML9 A;  3B7R L;  4LNB A;  1IHG A;  4DX5 D;  2VGY A;  4JPS A;  2F8Y A;  3SBT B;  4LER A;  5ARF A;  3FH5 A;  4IN3 B;  3RO2 A;  3D9L A;  3FDH A;  4OVU A;  1E8W A;  4I17 A;  4DX2 A;  4AXH A;  4J8S A;  1HE8 A;  2HR2 A;  4KMO A;  3PNL B;  4H7X A;  4HOQ A;  3SF4 A;  3UM3 A;  1E8Y A;  3R9A B;  4CGW A;  4GML A;  5HI7 A;  4ILG A;  4YDO A;  3CVV A;  1UW4 B;  3ONK A;  3Q15 A;  4APO A;  1MQS A;  3LPZ A;  1IKN D;  1AWC B;  3L54 A;  1DCQ A;  4YVQ C;  2WXJ A;  3EHQ A;  4KYO B;  5AQB A;  3UKR G;  3L22 A;  4PH4 B;  4NQ0 A;  3TJP A;  3MX3 A;  3PRZ A;  3ZYL A;  3T8K A;  3V31 A;  4HI9 A;  4U0S A;  2NC9 A;  3EDT B;  3ONL A;  3MJW A;  4WNE A;  2EQX A;  1EDU A;  4I2Z A;  4AIF A;  3SY2 A;  2AXV A;  2VSO E;  3UIN C;  1HF8 A;  5DIZ A;  4P29 A;  3SFX A;  3HHM A;  3HXC A;  1QBQ A;  4IYP A;  1S0P A;  1HXI A;  3G2U A;  2HYZ A;  1Y6I A;  2PNN A;  4JHK A;  2WMO A;  3CVY A;  3ULY A;  3BEE A;  2CFU A;  1JCS A;  2EIJ E;  1O1T A;  3ZVV A;  2ILR A;  4CRW A;  2IO2 C;  4Q96 A;  2V0P A;  3L16 A;  4GMJ A;  3ZGQ A;  4N5Q A;  2P9L G;  4GCN A;  5H7P A;  3DEP A;  3HXF A;  4IUL A;  5CEA A;  1HX8 A;  1H2V C;  3ZU7 B;  3AJI A;  1JUQ A;  5EN5 D;  2P9I G;  4TXQ A;  3EHN A;  4JHR A;  1TYQ G;  5BW8 C;  3OAW A;  5KNH D;  3ZNG A;  1HH8 A;  3PEV B;  3KD7 A;  3S7D A;  3I5P A;  4NAC A;  3S2A A;  2OVF A;  4EBA G;  3AG4 E;  1OY3 D;  4XI0 A;  3ESK A;  2LSU A;  2B0O E;  4BWR A;  3EIQ C;  4LG6 A;  5J90 A;  2V5F A;  3PZD A;  2LXM A;  4YDY A;  4G25 A;  1O1S A;  4HRN A;  5ARG A;  5G55 A;  3QK0 A;  4URK A;  4UWH A;  2IOS A;  1H6P A;  1HO8 A;  4G24 A;  2XQ0 A;  1OWP A;  4PS8 A;  4C48 B;  1E96 B;  3L08 A;  4GU5 A;  4B94 A;  3FUI A;  3FUK A;  3NZU A;  4E85 A;  1KLX A;  2V8S E;  2KC7 A;  3J5P A;  3FTV A;  3UTM A;  3IV0 A;  3APC A;  5EID A;  3KEA A;  4JA9 A;  4CDR A;  4U95 D;  3HDX A;  2WPV A;  3FY4 A;  5KWD A;  1SA4 A;  3EHM A;  3NOC D;  5ANL A;  3IXE A;  4CDM A;  2MHK A;  1Q2Z A;  3PS6 A;  4GTP A;  1S70 B;  2H6H A;  3LVR E;  4APF A;  2CG3 A;  3QAR A;  4AV7 A;  2RFA A;  3AS5 A;  2YHC A;  1B89 A;  3B13 A;  5D0O D;  5LFA A;  3E32 A;  5FQ8 A;  1ZBP A;  2IOL A;  4CDN A;  3UM2 A;  3WG7 E;  1D8D A;  3APF A;  1IXV A;  3LCA A;  4RQI A;  3GZS A;  1DVP A;  1WG0 A;  2OOE A;  3FTS A;  3T8M A;  4HB5 A;  4ATG A;  3SO8 A;  3ZFW A;  4K5B A;  2CHX A;  4UI9 K;  3UX4 A;  3CHM A;  4LSZ E;  4UWK A;  2LNI A;  3JUI A;  3I4G A;  1UN9 A;  4LUN U;  2MRI A;  1RZ4 A;  2KCK A;  3T5V A;  4JD2 G;  1EF1 C;  2C0M A;  3TWQ A;  4GZ3 A;  2LUH A;  1DCE A;  1MZC A;  4I43 A;  3DPY A;  5CCM A;  1BI8 B;  3Q9N C;  2HM8 A;  3S7B A;  3N71 A;  2J9Q A;  3U64 A;  4BSX A;  3DBS A;  3Q9U C;  2BKK B;  4MRU A;  5T3R A;  2Y0B G;  2OND A;  1YCS B;  3ASH A;  2NYJ A;  5E76 A;  3ZYM A;  3U4T A;  2VTB A;  3CK7 A;  4DJA A;  4O1P A;  4R7L A;  3QKY A;  1MX4 A;  3QDN A;  4F6R D;  3S7J A;  1NZN A;  2OEW A;  2XZD G;  5LOZ A;  4DRX E;  4JZY A;  1AP7 A;  4QQI A;  4GCO A;  4B8C B;  1ZU2 A;  4GTQ A;  2P2C P;  5EIB E;  3E4B A;  4Z68 A;  2BUG A;  4CZ2 D;  3QWW A;  4HOT A;  5LCW J;  4XIF A;  4GMR A;  2WXG A;  4XZ4 A;  1OCC E;  1E8Z A;  4BX8 A;  4A1S A;  4UUC A;  4CEM A;  5G04 J;  4AP2 A;  3AG3 E;  4N2Q A;  3OXL A;  4UQZ A;  2VYI A;  4DX7 D;  5FQ4 A;  4GTO A;  5M72 A;  5AN8 A;  3PZ3 A;  3CHS A;  2CHZ A;  5EDS A;  3E34 A;  3PDN A;  5A23 A;  3RKV A;  4EEC A;  3KSQ A;  1NI1 A;  3CK8 A;  2XGO A;  1WDY A;  3RRM B;  3LS8 A;  4Q69 A;  2KZT A;  2Y1L E;  2IO3 C;  1X81 A;  4O1O A;  5BV0 A;  3CVW A;  1OCO E;  4K5C A;  3DWL G;  5KCM A;  1OXJ A;  3JQ1 A;  2UY1 B;  4JEU A;  3DST A;  4HS2 A;  4LCT A;  3CVL A;  2KBX A;  4U8H A;  5EIL A;  4ANU A;  4LEU A;  2YNQ A;  5AAO A;  2L0I A;  2VGX B;  3MV3 B;  4U96 D;  2I1K A;  2R05 A;  1BLX B;  1OWN A;  4FLB A;  3R7R A;  3B7U X;  4BEP A;  3ABL E;  5HRY A;  3JXJ A;  1YA0 A;  5T4Y A;  2WXN A;  3ZXS A;  5JHA A;  2AXU A;  1QNF A;  2ZXW E;  2H6G A;  5HQ8 A;  4U8Y D;  1HS6 A;  2R02 A;  3FEY A;  4N2S A;  2LSV A;  3BUA A;  2DWZ A;  2X6I A;  1N0R A;  2C0L A;  3LXU X;  3FUE A;  3P2B A;  5EX3 A;  2R2L A;  4JXT A;  4UQY A;  3I3N A;  5FZS A;  2ETB A;  3C72 A;  4TUU A;  2FF4 A;  2XHE A;  4FHK A;  5DBK A;  4UWF A;  3CSF A;  2GRL A;  1K1B A;  3HXE A;  3SI5 A;  2WMN A;  3TAX A;  2A5U A;  5T8I A;  4A55 A;  3EHR A;  2OCC E;  4NUR A;  3HIZ A;  2Y3A A;  2X3M A;  4AEZ C;  4MS6 A;  4KVM A;  4FLH A;  3TXM A;  1E90 A;  5D0Q D;  3HVE B;  2DYR E;  1ZB1 A;  3DSW A;  1GW6 A;  4YDE A;  3RJV A;  5FQ7 A;  4C0M A;  1N95 A;  2VQ2 A;  2IY0 C;  3AG1 E;  3CKB A;  1N11 A;  1NP7 A;  2R59 A;  1NL4 A;  5JJT A;  3C3Q A;  3FU0 A;  5CMW A;  2EIK E;  2DBA A;  3CK9 A;  3K9I A;  5FJY A;  2A5E A;  2JAB A;  2H6F A;  3FH7 A;  5ENN A;  4M7C A;  5KJN A;  3D9M A;  4RSY A;  1K3Z D;  3W9F A;  1W3B A;  3B7S A;  1K1A A;  1L5J A;  3PZ4 A;  4HLE A;  3TXN A;  4HQD A;  1FPP A;  2IQC A;  2E2E A;  3D9P A;  2QFC A;  1FCH A;  4V3I A;  1VDY A;  2AXZ A;  2HE0 A;  4K5A B;  3ZEF A;  5G04 C;  5ITZ F;  2ZIS A;  4I9E A;  3UMV A;  1EPU A;  4G26 A;  3IHY A;  1XNF A;  4RG9 A;  2IU1 A;  2I9C A;  3PEU B;  3U9W A;  4GTV A;  3GYZ A;  1Z5S C;  3ENE A;  1UOH A;  3DEO A;  5KJL A;  3CIA A;  3SGH A;  5KJM A;  2PM7 A;  5BV1 A;  2QYU A;  4XKC A;  3LVQ E;  3JCK C;  4RLY A;  4A1G A;  4ATZ D;  4OVV A;  1TN7 A;  1TEZ A;  2JEK A;  4PDX A;  1H2T C;  3AU5 A;  3VLF A;  5HS0 A;  4ACL A;  3SD5 A;  1S63 A;  2VSN A;  3MKR A;  4U8V D;  2AJA A;  4DI4 A;  2AVP A;  3MV2 B;  2VJ8 A;  2RD0 A;  4ANX A;  1A17 A;  4CGV A;  4NRH B;  3UT7 A;  2L6J A;  3EUV A;  3FEX A;  1JWF A;  1PAQ A;  5FTP A;  4F3V A;  4N3B A;  3ASG A;  1FVF A;  1OCR E;  1QYM A;  4FP7 A;  4AJW A;  4AM9 A;  4U04 A;  1N4Q A; 
#chains in the Genus database with same CATH homology
 3T5V A;  3L17 A;  5FZR A;  4ANW A;  3D9O A;  2HO1 A;  2R5S A;  3VLD A;  1EF1 C;  2C0M A;  1H0A A;  2PM6 A;  4G1T A;  4ILI A;  4GZ3 A;  4DLQ A;  3CVP A;  4I43 A;  4HOS A;  5CCM A;  4JC8 A;  3SBS A;  2HM8 A;  3S7B A;  3N71 A;  4BFR A;  4B8A A;  3CVU A;  4WWO A;  1KT1 A;  1UJK A;  4PS7 A;  2J9Q A;  4HFG A;  3FUL A;  4YVO A;  2L9B A;  2X6J A;  3U64 A;  4BSX A;  3DBS A;  1OWO A;  4UQX A;  3CHO A;  1XGW A;  4UI9 C;  5G2N A;  3C98 A;  4MRU A;  5T3R A;  2OND A;  1HG5 A;  1N52 A;  3AU4 A;  4GYW A;  4I6E A;  4HOR A;  3CQG B;  2I6H A;  3ASH A;  3QC1 A;  2MOW A;  3WXX A;  3Q5M A;  3G2V A;  5E76 A;  2BTD A;  3CGH A;  3FUH A;  1KT0 A;  2KZT B;  4XI9 A;  3U4T A;  3ZYM A;  2WXK A;  3D3M A;  3PE4 A;  2VTB A;  3CK7 A;  5EX0 A;  2WQH A;  3T5X A;  4DJA A;  5LCW C;  2R17 C;  3KEZ A;  5A6C A;  3MZL B;  2WVI A;  3PNT B;  4WUY A;  3I4R B;  4R7L A;  3QKY A;  4M3O A;  4G23 A;  3KAE A;  3PRE A;  4JA7 A;  4AVX A;  4ABN A;  4GPK A;  3Q49 B;  4XX5 A;  4H7Y A;  4TRQ A;  4JL0 A;  3NF1 A;  4CT0 A;  3QDN A;  4Y6W A;  1NZN A;  3S7J A;  3ZYQ A;  3O48 A;  4WWN A;  1OWL A;  2J07 A;  3D9J A;  5LOZ A;  3VTX A;  5AEN A;  4PS3 A;  4FJZ A;  3QOU A;  2GGF A;  4JZY A;  3QB2 A;  2A4Z A;  2WXL A;  3CHQ A;  2P58 C;  4GA2 A;  1Y8M A;  4GCO A;  1ELR A;  4B89 A;  3ZHE B;  4B8C B;  1ZU2 A;  2OV8 A;  3TL5 A;  2X6K A;  4JVS A;  5BPP A;  3PUK A;  3E4B A;  3FFL A;  4GYO A;  4F7A A;  4BTA A;  2KCL A;  2BUG A;  2VSX E;  3QWW A;  3IHV A;  4LRZ A;  3NZS A;  5BNW A;  2AW6 A;  5LCW J;  4HOT A;  4I6G A;  4XIF A;  3TG4 A;  2WXG A;  1HZ4 A;  4XZ4 A;  3FUN A;  1ELW A;  1E8Z A;  2X6F A;  3FP3 A;  2XCB A;  4DK5 A;  4TV3 A;  4FU3 A;  5EKQ D;  2I1J A;  4A1S A;  3ZPJ A;  1Z6T A;  2WXQ A;  4RVB A;  3QNK A;  4BX8 A;  2WXM A;  4CEM A;  4I1M A;  5G04 J;  5CCL A;  3FTW A;  4HVB A;  2FUL A;  1Z3X A;  4UWG A;  3FTX A;  4AP2 A;  4G2V A;  4L2Y A;  5G05 C;  4J8E A;  3OXL A;  4FC8 A;  4UQZ A;  2VYI A;  4B0Z A;  4N2Q A;  4ILH B;  3ZRH A;  2VSY A;  3VLE A;  3MEK A;  4N3C A;  4JHJ A;  3UQ3 A;  3IKO B;  4GZC A;  1Z3Y A;  2GRM A;  5FQ4 A;  1NA0 A;  3UT4 A;  3UPV A;  4L2L A;  3FTY A;  2I2O A;  4ANV A;  3LKU A;  5M72 A;  1HG2 A;  4EPZ A;  3CHS A;  4KT6 B;  1PC2 A;  2CHZ A;  2WXH A;  1H2U A;  5JJ7 A;  5EDS A;  3PDN A;  5A7D B;  4N39 A;  2IF4 A;  2OVB A;  2WXO A;  3ML8 A;  5A23 A;  4F1S A;  3ML9 A;  3RKV A;  2JLB A;  4C9B B;  4EEC A;  3B7R L;  2CHW A;  1IHG A;  3B7T A;  2FI7 A;  2VGY A;  3CK8 A;  4JPS A;  1HU3 A;  2X38 A;  4FJY A;  4BTB A;  2Y4T A;  2XGO A;  3D9N A;  2V4L A;  3RRM B;  3HYM B;  3LS8 A;  4WNF A;  3SBT B;  1OWM A;  4JW1 A;  4Q69 A;  1MHQ A;  2KZT A;  4LER A;  5ARF A;  3FH5 A;  4IN3 B;  3MCX A;  4DPR A;  3RO2 A;  3D9L A;  3FDH A;  4KZ0 A;  1IYG A;  4OVU A;  3FHE A;  5BV0 A;  1E8W A;  3SHF A;  3CVW A;  5KCM A;  3ASD A;  2FO7 A;  4HOU A;  2WXR A;  3JQ1 A;  3GZ1 A;  2RG8 A;  5C2Y A;  4I17 A;  4WAF A;  4AXH A;  2UY1 B;  4J8S A;  4JEU A;  3CVX A;  1HE8 A;  3ULQ A;  2HR2 A;  4HS2 A;  4KMO A;  3PNL B;  4H7X A;  4HOQ A;  4LCT A;  3CVL A;  3SF4 A;  4U8H A;  4ANU A;  1E8Y A;  4LEU A;  2YNQ A;  1E7U A;  4L7T A;  2L0I A;  3R9A B;  2VGX B;  4CGW A;  4GML A;  3MV3 B;  2L0T B;  5HI7 A;  4I2W A;  3OXF A;  4U0Z A;  1NA3 A;  2XCC A;  2I1K A;  4PUC A;  2PL2 A;  1OWN A;  1QZ2 A;  2J49 A;  2ZU6 B;  4FLB A;  4ILG A;  3R7R A;  3UUX A;  3B7U X;  3CVV A;  1UW4 B;  2LO6 A;  3ONK A;  3Q15 A;  4APO A;  1WM5 A;  1MQS A;  1YA0 A;  4HXI A;  5T4Y A;  3CV0 A;  3LPZ A;  3GZ2 A;  3L54 A;  3ZYK A;  2WXN A;  3FTU A;  3VTY A;  1HFA A;  3ZXS A;  5BT1 A;  2CFZ A;  4YVQ C;  4CT4 A;  2WXJ A;  2PZI A;  4KYO B;  2XPZ A;  3RRN B;  5JHA A;  1PY1 A;  2AXU A;  4AY6 A;  1QNF A;  2YQ8 A;  3L22 A;  1SZ9 A;  1X5B A;  4NQ0 A;  4PH4 B;  3MX3 A;  3TJP A;  3PRZ A;  3ZYL A;  5HQ8 A;  4UI9 J;  1HS6 A;  3LJ3 A;  3FEY A;  4U0S A;  4N2S A;  2LSV A;  4EZK A;  2NC9 A;  5C1D A;  3URZ A;  3G2W A;  2X6I A;  4A3V A;  5FWQ A;  3EDT B;  5AJD A;  5LX8 A;  3DPD A;  2C0L A;  3IBE A;  3ONL A;  4N5C A;  1QQE A;  2QY7 A;  3LXU X;  5FZQ A;  3CKC A;  5AYW D;  2WXP A;  3FUE A;  3P2B A;  3CR3 A;  3MJW A;  4WNE A;  2EQX A;  5EX3 A;  1INZ A;  1EDU A;  4Y6C A;  3Q4A B;  4I2Z A;  4KXK B;  4AIF A;  4JXT A;  3MKQ B;  3FUD A;  3RRU A;  2AXV A;  3I3N A;  4UQY A;  4YND A;  2VSO E;  3FUF A;  5FZS A;  1H19 A;  1HF8 A;  5DIZ A;  4TUU A;  4JEH A;  4P29 A;  4U63 A;  4XE0 A;  2E0I A;  3QJZ A;  2FF4 A;  3HHM A;  2XHE A;  4FHK A;  5BUZ A;  5DBK A;  3D9I A;  4UWF A;  4GZ5 A;  4CCA A;  3CSF A;  2LAI A;  4IYP A;  1S0P A;  1HXI A;  3G2U A;  4WWP A;  2HYZ A;  2GRL A;  1Y6I A;  4JHK A;  3IEG A;  2WMO A;  3EIJ A;  3FU6 A;  3CVY A;  3SNX A;  1U3C A;  3FUM A;  4A3T A;  3SI5 A;  3BEE A;  3CLJ A;  2CFU A;  2KAT A;  1H6K A;  4GZ6 A;  3ZVV A;  3BG1 B;  2WMN A;  2WXI A;  1SQM A;  2A5U A;  3QAQ A;  3FUJ A;  2ILR A;  3AS8 A;  3TAX A;  4AOF A;  4CRW A;  3U66 A;  5T8I A;  4I1O B;  2XPY A;  4A55 A;  4GB9 A;  4Q96 A;  2V0P A;  3LDZ A;  3L16 A;  4GMJ A;  4K0R A;  4NUR A;  3JQ0 A;  3ZGQ A;  5J08 A;  3ZW3 A;  3HIZ A;  2Y3A A;  2X3M A;  2Q7F A;  4FHJ A;  4AEZ C;  4I1A A;  4MS6 A;  2UY1 A;  4KVM A;  4KBQ A;  2PQN A;  2YHE A;  4FLH A;  4GCN A;  3PVL A;  3TXM A;  1E90 A;  2J4D A;  5D0Q D;  3HVE B;  4K03 A;  4IUL A;  5E75 A;  1HX8 A;  1BPO A;  1H2V C;  2PQR A;  1DNP A;  4J8F A;  4O6F A;  4MLP A;  4DI3 A;  2DIW A;  3CHR A;  1JUQ A;  4U04 A;  2VGX A;  5AIJ A;  3EHN A;  4JHR A;  2KM4 A;  3CVQ A;  1GW6 A;  1P5Q A;  5BW8 C;  1OUV A;  2GW1 A;  3OAW A;  5AJL A;  2KCV A;  2XRZ A;  3CVN A;  1IQR A;  3RJV A;  2WB2 A;  1HH8 A;  3MGB A;  5FQ7 A;  3PEV B;  3KD7 A;  2IFU A;  3ESL A;  4I6J A;  4XKB A;  5G05 J;  3S7D A;  3I5P A;  4C0M A;  4NAC A;  3S2A A;  4FAD A;  2YIN A;  4GAA A;  2OVF A;  2VQ2 A;  5KJK A;  4EBA G;  2DCP A;  3BG0 B;  1UN8 A;  2XRY A;  3CKB A;  3FTZ A;  1WY6 A;  4XI0 A;  3ESK A;  4U0U A;  1NP7 A;  4UWL A;  5JJ6 A;  3LY7 A;  3LY8 A;  3EJN A;  2R59 A;  3SFZ A;  1EYH A;  2LSU A;  4BWR A;  1UJJ A;  5JJT A;  3ZN3 A;  4N3A A;  3FU0 A;  5CMW A;  3CK9 A;  2DBA A;  3K9I A;  3UT8 A;  1IQU A;  4EQF A;  5FJY A;  3MYV A;  2WXF A;  4J0U A;  4D10 C;  3EIQ C;  5J90 A;  2V5F A;  3G2S A;  3PZD A;  4BT9 A;  4MKT A;  3FH7 A;  4ME2 A;  4G25 A;  5ENN A;  4Q94 A;  5ARG A;  3FWV A;  3R7Q A;  5G55 A;  3ZHE A;  3QK0 A;  4URK A;  5KJN A;  3D9M A;  4UWH A;  2BF0 X;  2IOS A;  1HO8 A;  4G24 A;  4RSY A;  2LAH A;  4C0E A;  3O4Z A;  2XQ0 A;  3LY9 A;  2NXP A;  1OWP A;  2CG2 A;  3MKQ A;  3QWP A;  3SZ7 A;  4PS8 A;  1W3B A;  1WAO 1;  2XGM A;  4U07 A;  3B7S A;  1E96 B;  4OYS A;  2J09 A;  3G2T A;  3L08 A;  3PH0 C;  4GU5 A;  3FU3 A;  4WNG A;  4B94 A;  2WQ6 A;  1L5J A;  3FUI A;  4FUL A;  3FUK A;  3NZU A;  4EBA A;  4E85 A;  1KLX A;  5LP0 A;  4HLE A;  4DLO A;  4GA0 A;  2V8S E;  2KC7 A;  3FH8 A;  3P1U A;  3TXN A;  3FTV A;  2NSZ A;  3U3W A;  2IQC A;  3IV0 A;  4GZD A;  3APC A;  2E2E A;  3AS4 A;  2XGS A;  3D9P A;  4KVO A;  4JA9 A;  2QFC A;  2Y4U A;  1E8X A;  3OXG A;  1U3D A;  4IRU A;  4CDR A;  1FCH A;  4V3I A;  4EZJ A;  1VDY A;  3HDX A;  2AXZ A;  4QFV A;  3ZEF A;  2WPV A;  3FY4 A;  5G04 C;  3RIB A;  4I9E A;  2X6H A;  3UMV A;  3EHM A;  3QWV A;  1FVH A;  4J6I A;  5ANL A;  1EPU A;  4G26 A;  3IHY A;  1XNF A;  4RG9 A;  2ION A;  2FBN A;  4CDM A;  2IU1 A;  2MHK A;  4RG6 A;  4WND A;  2I9C A;  3HVE A;  3PEU B;  3PS6 A;  3S7F A;  1ELK A;  3U9W A;  2WQ7 A;  3GYZ A;  3PUJ A;  2VTB B;  2XPI A;  2J4B A;  3ENE A;  5KJL A;  3CIA A;  3LVR E;  4APF A;  2CG3 A;  3GW4 A;  4KZC A;  3SGH A;  5KJM A;  3QAR A;  4AV7 A;  4L1B A;  3D9K A;  2PM7 A;  5BV1 A;  4L23 A;  3AS5 A;  1E7V A;  4XKC A;  2YHC A;  3LVQ E;  4EZL A;  1JPL A;  1B89 A;  3RO3 A;  4BY6 A;  3B13 A;  3JCK C;  4G11 A;  5CMY A;  1TJF A;  3APD A;  5D0O D;  4A1G A;  5LFA A;  4F53 A;  4E6H A;  3Q47 B;  3KS2 A;  3CST A;  4OVV A;  4AY5 A;  2JEK A;  1TEZ A;  5FQ8 A;  3PE3 A;  3RU0 A;  1SZA A;  4PDX A;  1H2T C;  1ZBP A;  1N54 A;  2IOL A;  5CHE E;  3ZIM A;  3CEQ A;  3AU5 A;  4CDN A;  2FEZ A;  3TGO A;  3VLF A;  2UWJ G;  3APF A;  5FT9 A;  3CHP A;  3LCA A;  3GZS A;  1DVP A;  4GYY A;  2OOE A;  3FTS A;  3T8M A;  2J08 A;  3MA5 A;  4ACL A;  4I9C A;  3SD5 A;  5FQ6 A;  2VSN A;  3MKR A;  4ATG A;  4DI4 A;  3ZFW A;  2AVP A;  3MV2 B;  3LEW A;  2VJ8 A;  3L6A A;  2RD0 A;  4ANX A;  2CHX A;  1A17 A;  4UI9 K;  5ANR A;  4FA6 A;  4CGV A;  4BT8 A;  5JHB A;  3RK6 A;  3UX4 A;  2XEV A;  1JWG A;  2IJG X;  3CHM A;  4GA1 A;  4NRH B;  4UWK A;  3UT7 A;  4W9R A;  2L6J A;  3TG5 A;  1UG3 A;  3L13 A;  4ACK A;  4BX9 A;  3FEX A;  1JWF A;  2LNI A;  1PAQ A;  2M63 A;  5FTP A;  2C2L A;  4F3V A;  1TJC A;  3I4G A;  3JUI A;  3CQC B;  3JYS A;  1UN9 A;  3ASG A;  4J8D A;  2WM9 A;  4N3B A;  1FVF A;  2AWI A;  3OTN A;  3FU5 A;  4LUN U;  1LF8 A;  4FP7 A;  4AJW A;  4AM9 A;  3ASF A;  2MRI A;  3NQP A;  3LYA A;  2KCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...