4UI9J

Atomic structure of the human anaphase-promoting complex
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVNGLEKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
total genus 179
structure length 504
sequence length 532
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ui9J00
1E96B 2L6JA 3S7FA 4BT8A 4APOA 3RKVA 4GCNA 2VGYA 3QWWA 4KYOB 2FBNA 2VYIA 4WNEA 2UWJG 3CV0A 1NA0A 3R9AB 3QKYA 3UQ3A 3PE3A 4J8EA 4AY6A 3Q4AB 4YVQC 3UPVA 2UY1A 4O6FA 2C0LA 3ASDA 4CGWA 4BT9A 2OOEA 3ESKA 4GZ3A 1PC2A 4I2ZA 4HOSA 2VGXB 3CEQA 3CKBA 4N3CA 4U04A 4UI9C 5LCWC 4ABNA 5KJLA 3PDNA 3Q5MA 5LCWJ 4A1SA 4N5CA 4YNDA 4G25A 2VGXA 3TG4A 4CGVA 5FTPA 3U4TA 1KT1A 4AM9A 2Q7FA 3URZA 3LY8A 2KCKA 3CKCA 3S7BA 5BT1A 5EX3A 3TG5A 4J8DA 4F3VA 2XCBA 3IEGA 4EQFA 3JYSA 3FP3A 2NC9A 3CVLA 2XCCA 2QFCA 2XGOA 3ZHEA 4JL0A 4N39A 1NZNA 3SZ7A 4BTBA 4AIFA 2Y4UA 4HOQA 3MA5A 4XIFA 5ARFA 5HI7A 3RIBA 2IF4A 4XI0A 5KJKA 1KT0A 2LSVA 2HYZA 3KS2A 4HOUA 5JJ7A 4G23A 3O48A 5CHEE 2XGMA 2WPVA 4GYOA 5D0OD 4U0UA 1A17A 3ASFA 4U0ZA 1XNFA 5FT9A 5G05J 2KATA 3RJVA 5FJYA 1IHGA 5A6CA 4WUYA 1KLXA 3MV2B 3LKUA 3VTXA 3QWPA 3E4BA 3QOUA 4I2WA 2PZIA 3Q49B 4GYWA 4GA0A 4ME2A 4GPKA 5D0QD 3S7DA 3FFLA 1OUVA 4CDRA 4JHRA 3OXGA 5KJMA 5BNWA 4G2VA 1WM5A 2UY1B 3CVPA 5M72A 2WQHA 1B89A 5A7DB 2BUGA 2YQ8A 2XPIA 3AS4A 4RG6A 3GYZA 5FZSA 3CVNA 3HYMB 4N3AA 4U07A 4UI9J 4NRHB 2XGSA 4J8FA 4UI9K 5JJTA 5G04J 4HORA 3U3WA 2E2EA 4I9CA 1YA0A 2AVPA 1W3BA 2JLBA 3ZGQA 2KC7A 3MEKA 3RU0A 3K9IA 2MHKA 4WNFA 4G24A 3S7JA 5C1DA 2I6HA 2P58C 3Q15A 3OXLA 4GA1A 4J0UA 4N3BA 4UQZA 5EKQD 4I9EA 4GYYA 5G05C 2Y4TA 5EX0A 4B94A 4N2QA 4GCOA 2FEZA 2PL2A 4BTAA 2YHCA 5HQ8A 4H7XA 4GZ6A 3GW4A 5AYWD 3VTYA 3CK9A 3WXXA 4BWRA 5CCMA 3LY9A 3CVQA 2VQ2A 4G26A 4NQ0A 3NF1A 2PQRA 1P5QA 5DBKA 4YVOA 5CCLA 4JA9A 4IN3B 1NA3A 2V5FA 4LEUA 2PQNA 2HR2A 2XEVA 3QDNA 2VSNA 4XI9A 3CK7A 2J9QA 2FF4A 4JA7A 4KBQA 2LSUA 2R5SA 1ELRA 3KD7A 3GZ2A 5FZQA 2KCVA 2DBAA 3LPZA 4Y6WA 3ZPJA 1TJCA 5FZRA 4AY5A 3EDTB 4GA2A 4UQXA 1HH8A 1FCHA 3BEEA 2C0MA 2C2LA 3ASGA 1QQEA 3FWVA 4UQYA 3LCAA 4WNGA 3RO3A 3ZHEB 2HO1A 1ELWA 3KAEA 3AS8A 5KJNA 3CK8A 4Y6CA 5ARGA 5DIZA 4N2SA 2KCLA 3RO2A 3MKRA 3PE4A 1WAO1 1ZU2A 3QWVA 1ZBPA 4I1AA 3N71A 5G04C 3TAXA 1Y8MA 4RG9A 1IYGA 3Q47B 1HXIA 2FO7A 4H7YA 2FI7A 3UUXA 4I17A 2VSYA 2GW1A 3LY7A 3LYAA 3OXFA 3ASHA 1HZ4A 4G1TA 2ONDA 4GZ5A 4W9RA 4U0SA 4HOTA 3AS5A 5JJ6A 1QZ2A 3MV3B 2IFUA 4KXKB 5BW8C 3SF4A 3ULQA 3ZFWA 3ZN3A 3GZ1A 3TGOA 4WNDA 2LNIA
chains in the Genus database with same CATH superfamily
1E96B 4K03A 2L6JA 3RKVA 4LRZA 2VGYA 1TNUA 1HE8A 2UWJG 3CV0A 2OVBA 2GRQB 3DSWA 4U96D 3PS6A 1OT8A 3APDA 4MRUA 2P9IG 3EIQC 3E37A 4ANVA 4J7WA 1OWLA 2VGEA 3URZA 3DSVA 3VLDA 1NZNA 4HI9A 3CIAA 5T3RA 4GPMA 4EBAA 4XKBA 4GYOA 1XNFA 4DPRA 2XRYA 2YNQA 3ASOE 2DYSE 3ISMC 1WM5A 4DI4A 3E30A 3J5QB 4I1MA 3ZXSA 2CFZA 1Z3XA 3CQGB 3FHEA 2ZGGA 3K9IA 4ZFHA 1N95A 5C1DA 1SVXA 2DVWA 3E33A 1JCSA 4GTQA 5CERB 2ETAA 1FVFA 4JA7A 3CSTA 3TWTA 4HVBA 1FCHA 5FQ8A 5AQ9A 4N2SA 2WB2A 4L23A 3ZRHA 3C5RA 3PE4A 3VLEA 1H2TC 4H7YA 1TYQG 4HOTA 3AS5A 3C72A 2LO6A 2LUHA 4D10C 3EHNA 3FH8A 4YVQC 3FH5A 3ESKA 3TL5A 3RRMB 4CEMA 2EINE 1BPOA 3ESLA 3TG4A 4GAAA 1UG3A 5AIJA 4Z68A 3IEGA 1TN7A 1MQSA 3V2OA 2HE0A 3DPDA 4U0ZA 4DJAA 3VTXA 4C9BB 1DVPA 1MX4A 4LUNU 3IXEA 5D0QD 3U66A 4DX1A 3SY2A 2VJ8A 3B7SA 5BPPA 4URKA 2F8YA 5ENRD 2CHWA 1E7VA 1SA4A 4WNFA 5EKQD 2VSXE 3FUKA 5AN8A 4HQDA 3CVQA 4BSXA 1EYHA 2Y0BG 3DXKG 3FEXA 3PEVB 2GRMA 2FF4A 2R5SA 2DBAA 3LJ3A 2IOSA 1N9AA 3ZU7B 2J07A 3ASGA 4R7LA 3Q47B 1HXIA 2FO7A 3UUXA 4K5BA 2XZDG 1QZ2A 3EIJA 3LVQE 5FQ6A 5IY5E 4GMLA 3FTSA 3W9FA 4FA6A 1RZ4A 2R2LA 1KZOA 4GZ3A 3U64A 5LCWC 3LS8A 1IHBA 3HXBA 2H6FA 3QK0A 3BQOA 4ACLA 5EX3A 3TG5A 1BLXB 3JYSA 3TWRA 3PZDA 2F8XK 2QFCA 1UJKA 3FUIA 2GROB 1L5JA 3O48A 5FJYA 1KLXA 4ACKA 2XHEA 4GPKA 3OXGA 4UWFA 4UWGA 2EIKE 2H6HA 3HIZA 2ILRA 2XGSA 4UI9K 1BI7B 5G2NA 2E2EA 4EZKA 4I9CA 4BFRA 3CVWA 2KM4A 1MYOA 4DLQA 4GA1A 3PVLA 4UQZA 5CRUA 3DEOA 3MKQA 2BEDA 4NQ0A 4YVOA 3KEZA 2E0IA 2RKKA 3LXUX 4RSYA 2KCVA 4Y6WA 5LFAA 3ZVVA 1TJCA 4FP7A 4FADA 3RO3A 3L08A 4A3TA 3JUEA 4B89A 1EF1C 1Z6TA 4K5AB 1TNZA 4G11A 2GRNB 1OCCE 2R03A 2B6CA 5BW8C 3MV3B 4NIKA 4GTPA 1SZ9A 4GCNA 3GZSA 4CT0A 1WY6A 4UUCA 3Q4AB 3HDXA 4EECA 1LD8A 1IQUA 5B3SE 1S63A 4MLPA 3QC1A 4FC8A 1E8WA 2BF0X 3V79K 1H19A 3CKCA 4HB5A 4CYMD 3EUVA 2CG3A 3UM1A 4U8YD 2Y4UA 2A5EA 2L6BA 4GZDA 3ZKJA 4JPSA 5HI7A 5LP0A 3HVEB 3JQ0A 3Q7FA 1PY1A 1K1BA 3QJZA 2BUGA 1HG2A 3B13A 4U07A 3R7QA 1W3BA 3IBEA 1NI1A 3FUHA 4X8QA 1H2VC 4GCOA 5AYWD 5CEAA 4KVMA 4JXTA 5JHBA 1N52A 1P5QA 5FWQA 4JA9A 2QY7A 2HR2A 3UKRG 2P9PG 4C0EA 2H6IA 4EZLA 3ASNE 2DWZA 3V31A 4AY6A 1QQEA 3LCAA 3ZHEB 5DIZA 3BU8A 2I9CA 3QWVA 5G04C 1TNOA 4GTOA 5B1AE 4PUCA 2ONDA 3MX3A 1IKND 1OY3D 3CHSA 1ZB1A 2LNIA 3DSXA 3BG0B 3RRNB 3SNXA 1H6PA 4BESA 4WNEA 5ENNA 3Q7AA 3VLFA 4HOSA 2VGXB 4U8VD 2GRLA 2XPYA 3HXFA 3PDNA 4U7EB 3FTUA 3TXNA 1QYMA 4F3VA 2XCBA 2IONA 2NC9A 3G2TA 4J8SA 2LSVA 2A5UA 4HOUA 5JJ7A 2XS1A 5CBOA 5A6CA 2KATA 3RJVA 3ZNGA 3QOUA 4I2WA 2UY1B 5JMND 1N54A 2P2CP 5KCMA 1O1SA 4JD2G 4CRWA 3ONLA 3G2VA 4YDWA 4LG6A 2X6IA 1JWFA 2YHCA 4JEUA 3ZIMA 3VTYA 3WXXA 4K0RA 3UXGA 4Q69A 4JB8P 4EZJA 1S64A 2J9QA 4U63A 2VTBA 1UW4B 1X5BA 5LX8A 1YYHA 3D9OA 2WQ7A 3CK8A 4Y6CA 2X6FA 3RK6A 2KXPC 4V3IA 3FU3A 2WXMA 4IRUA 1ZBPA 3CGHA 5CRVA 1O1RA 5E76A 2J08A 3ZFWA 1E8ZA 3PNLB 3FY4A 3JXIA 3D9IA 4PS8A 4PS3A 3NQPA 4BT9A 2OOEA 4JVSA 4N3CA 4RQIA 5LCWJ 3Q5MA 1ELKA 5LOZA 4G25A 3S2AA 3UTMA 2L9BA 4HRLA 5A23A 4Q96A 4JL0A 2EIME 1WG0A 2AXVA 3KS2A 3FUJA 3LDZA 4FHJA 3E4BA 4GA0A 4TRQA 3CHPA 3DEPA 1MHQA 3FEYA 4RLYA 1HU3A 1V55E 4CCAA 2OCCE 2DZOA 3JXJA 3IHYA 4XEIG 4N2QA 5HQ8A 3QNKA 1TNBA 3LY9A 4WWNA 1UN9A 2X6JA 4TXPA 3G2SA 4C0MA 4GU5A 5FZQA 4JHJA 3LPZA 1VDYA 2EIJE 3NZUA 4FJZA 4UQYA 2ZU6B 1E8XA 3HRAA 2CHZA 1AWCB 4B8CB 2RG8A 2GW1A 3CVVA 5JJ6A 2IO3C 3FUFA 5CMYA 4BT8A 4I6GA 5ENOD 4PS7A 3O4ZA 2WQ6A 4AEZC 4I6EA 2P9KG 3FU5A 2WXRA 1QNFA 2J49A 3OTNA 2WXJA 1KT1A 3AU4A 3S7BA 4DX5D 2QC9A 4ANUA 4EPZA 3T5VA 3CHOA 2WPVA 3LEWA 3ASFA 1YCSB 3EHQA 3MV2B 3LKUA 1NFIE 3ZUVB 3S7DA 4DUIA 4CZ2D 5KBAA 4RG6A 2V4HC 2KC7A 2MHKA 3S7JA 2I6HA 2JABA 2B0OE 3SBTB 3AG3E 4O60A 4BETA 1GW6A 5DBKA 2V5FA 1E7UA 2VSNA 4GB9A 3ZPJA 4BX9A 2WVIA 3UM0A 1OWNA 2YINA 1IXVA 1FT1A 5ARGA 3AG2E 4AJWA 2R17C 4AOFA 4HI8A 3L9TA 1HZ4A 2XRZA 3DXMG 3L13A 5B1BE 2MYOA 4QFVA 2WXKA 1E90A 4CGWA 3FULA 1JCRA 1INZA 1EDUA 4DX2A 4A1SA 1RW2A 4YNDA 1H2UA 3EJNA 5D2MC 5FTPA 3KEAA 3AU5A 1UN8A 2Y69E 2I1KA 1OCZE 4EQFA 1OWMA 4YDYA 1H6KA 1LTXA 3HG0D 1KPSB 2IJGX 2PZIA 3Q49B 3DSSA 3FFLA 4GMJA 3CVPA 3SO8A 3ZXPA 2WXQA 3GYZA 3G2WA 3UKUG 5JJTA 1YA0A 3ABKE 1N4QA 2P58C 3I4RB 2V0PA 4GYYA 5EDSA 4B94A 2FEZA 4GMRA 1EPUA 3CK9A 4A1GA 2J4BA 4HNAD 4KZ0A 3CK7A 4FJYA 1ELRA 2RFAA 3GZ2A 1QBQA 5FZRA 4QQIA 5HS0A 2HO1A 2AW6A 5T4YA 1Z5SC 4YDOA 3C98A 4G8KA 3KSLA 4TXQA 4L2YA 3HHMA 3ONKA 3CLJA 4FLHA 3TWQA 2IFUA 2ZGDA 3FH7A 1U3CA 3FDHA 3B95A 3UX4A 3R9MA 3UQ3A 4B0ZA 4O6FA 2C0LA 3RRUA 1PC2A 4I2ZA 3CQCB 4N5CA 3UT4A 2VGXA 4CDNA 4J8DA 4NURA 2XGOA 4N39A 2V8SE 5D0OD 2VTBB 3FTWA 4AV7A 5ENSD 4ME2A 4YDEA 2CHXA 1BD8A 3D9NA 2XPIA 3HYMB 5JA4D 2MRIA 4ILGA 4F1PA 4B93B 4HLLA 2Y4TA 3NAWA 1D8DA 1S70B 2QYUA 2DYRE 3UM3A 4HS2A 2WXFA 1HF8A 3CHQA 3SFXA 2BKKB 3PH0C 2FO1E 2KCLA 4XZ4A 5AJLA 4EBAG 3N71A 4LERA 5T8IA 1N4PA 3LYAA 4OAVB 4MS6A 3CR3A 3TGOA 3UIPC 3IV0A 2FBNA 3UPVA 1BU9A 2IEJA 3JCKC 4TV3A 1FT2A 3V30A 3AAAC 4ABNA 2WXOA 4P29A 2LXLA 1DC2A 4HLEA 3PUJA 2RD0A 2XEHA 2Q7FA 4F1SA 4NACA 3L17A 5ITZF 1IQRA 2Y1LE 3HXDA 4BSZB 2XEEA 5ARFA 2CG2A 2IF4A 2HYZA 2RFMA 1NL4A 5CBNA 3LJNA 5FT9A 4WUYA 3QWPA 4A55A 1OUVA 3QB2A 4UWKA 1B89A 5AARA 3ML9A 2EQXA 2CFUA 2WXHA 4HORA 4APFA 5FINA 2LAIA 4CDMA 3RU0A 2XPZA 4LNUD 1OWOA 3OXLA 4N3BA 3ZYQA 3QAQA 3DBSA 2P9SG 2AWIA 5KNHD 3R7RA 3TWWA 1DCEA 2WMOA 4OVUA 4UWHA 2KZTA 4XI9A 2LSUA 3OAWA 5CMWA 3Q75A 3KAEA 5ANRA 5J08A 3UINC 1MJ0A 4GTRA 1Y8MA 1TN8A 3CHRA 3D9KA 3Q73A 2FI7A 4K5CA 3HXCA 4GZ5A 4W9RA 2YHEA 4U0SA 3GZ1A 3T8KA 4AXHA 3ASDA 4L7TA 4ILIA 3CEQA 3RAUA 1TR4A 5EYPF 3APFA 3MJWA 3UIOC 3ULEG 4CGVA 3PNTB 4BX8A 3CVXA 1JPLA 3DSUA 4ILHB 4LSZE 3DSTA 3CHMA 4BTBA 3CVUA 5JHAA 3MA5A 4XIFA 4XI0A 5AAOA 4CT4A 2IQCA 3SHFA 2OV8A 1S0PA 1X81A 4LNGA 2LAHA 3MZLB 4G2VA 4J6IA 3FU0A 4N3AA 4NRHB 1U3DA 2JLBA 4O1OA 4IYPA 3NB2A 4BTAA 1O1TA 4LNBA 4Q94A 5C2YA 2P9NG 2WXNA 3P1UA 4M7CA 4GZCA 3BUAA 3HXEA 2F37A 3TWXA 2XENA 4AY5A 2AJAA 4AVXA 2C0MA 2C2LA 3SQVA 5ANLA 3D9JA 4XKCA 4I1AA 4MKTA 5EN5D 1UOHA 1Q2ZA 2BTDA 3SF4A 3JQ1A 3FUDA 4KYOB 4HXIA 1NA0A 3R9AB 3QKYA 3B7UX 2UY1A 5EIBE 3DPYA 2PM6A 4UI9C 4JEHA 4DX7D 2I1JA 4GTTA 1D9SA 2VSOE 4M3OA 3ZHEA 3CVLA 2XCCA 3MCXA 3SZ7A 2AXUA 3RIBA 2X38A 1KT0A 3J5PA 1A17A 1SA5A 5G05J 4IULA 3Q9UC 3UT7A 1K3ZD 5BNWA 2MOWA 2A4ZA 3BG1B 3Q79A 4PH4B 4UI9J 1KZPA 5BV0A 4JW1A 4HFGA 2AVPA 4I43A 1Z3YA 3MEKA 2LXMA 3SFYA 1SW6A 5FQ7A 4J0UA 3Q15A 3CVYA 3D9MA 3C3QA 2IO2C 4ATZD 2VQ2A 4G26A 3NF1A 1MZCA 3HVEA 2J09A 3AG1E 4BERA 2BKGA 3KD7A 3UI2A 5AQAA 3E34A 1ELWA 4LCTA 3ML8A 1OCOE 3RO2A 1XGWA 3L22A 4TUUA 3SBSA 3D9LA 1ZU2A 2X6HA 1FPPA 3TAXA 2DCPA 2VSYA 3LY7A 4G1TA 1D8EA 3T5XA 4HRMB 3S7FA 2WXPA 4PDXA 3NZSA 3PE3A 4J8EA 3SGHA 1BI8B 3U9WA 3TWUA 2KZTB 5BXOA 1OCRE 5BV1A 3PUKA 5ENQD 3APCA 3LY8A 4ZHBA 3LVRE 3D9PA 2EILE 5ENTD 2R02A 5J90A 2ZXWE 4HOQA 3RSEG 1WDYA 2X6KA 4G23A 5CHEE 1OXJA 3C3OA 4WWOA 4B8AA 3Q78A 3PZ1A 2PNNA 5FZSA 4J8FA 3U3WA 3L82A 3EHMA 2ETCA 4N5QA 1LD7A 2ZIRA 4FULA 4TXRA 3GW4A 5D66A 2NSZA 3F6QA 2PQNA 3QDNA 3ZYMA 3EDTB 3NOCD 3P2BA 1K8KG 2XQ0A 5AJDA 1N0RA 1O5MA 5KNGA 4I6JA 2I2OA 1DCQA 1WAO1 2GRPB 2OEVA 3SFZA 4RG9A 1IYGA 1N4SA 2M63A 3AG4E 3L54A 3TXMA 5ENPD 3ZN3A 2L0IA 4KT6B 4APOA 2L0TB 1LF8A 3I4GA 2NXPA 5BUZA 2OVFA 3MGBA 5EILA 3ZEFA 3CKBA 4U8HA 3B7RL 3U4TA 5H7PA 4I1OB 3G2UA 5BT1A 4E6HA 5E75A 4L1BA 1SQMA 2X3MA 1PAQA 3T9KA 5KJKA 2WXGA 5EYLA 3D3MA 1MX6A 1JUQA 5EIDA 4RVBA 1HFAA 4JZYA 5M72A 4DK5A 4FLBA 4BY6A 2H6GA 3ENEA 1TEZA 4JC8A 5HRYA 4ANXA 4I9EA 2PL2A 2V4LA 4H7XA 1G3NB 5CECB 4BWRA 5CCMA 2PQRA 5HKPA 3ZYLA 2GGFA 1U2VG 5FQ4A 3Q9NC 4WNGA 1HG5A 3W9GA 3MYVA 3DRAA 4OAUC 4L2LA 4OYSA 3NBNB 4DX6D 3TWVA 4KVOA 1N94A 2AXZA 3QWWA 4KZCA 3ABLE 1N11A 4A63B 1FVHA 3FTYA 3FU6A 3FUEA 3PZ2A 5CEDB 4U04A 3FUNA 1N0QA 5KJLA 3B7TA 3PZ4A 4FHKA 4TUMA 4XE0A 4EHMA 2WM9A 4BEPA 1MX2A 1UJJA 4JHKA 4O1PA 1HX8A 3KSQA 2FULA 2NYJA 4AIFA 2DIWA 2F0YA 3JUIA 4J8YA 2XGMA 2WXLA 3EU9A 4U0UA 1IHGA 2GRRB 2IOLA 3I5PA 3FTZA 2YQ8A 3AS4A 3SD5A 1DNPA 3I3NA 3CVNA 2WMNA 5G04J 2R59A 1V54E 3ZGQA 3EU5A 3L16A 3QARA 1TJFA 4OVVA 2V5QC 5AQBA 1K1AA 4ANWA 5CCLA 1SZAA 1NA3A 2PM7A 2P9LG 3DWLG 4LEUA 2DZNA 5KWDA 4E85A 2OEWA 4UQXA 3WG7E 1HH8A 4F6RD 3FWVA 3FUMA 5KJMA 3AS8A 1Y6IA 3UT8A 1OWPA 5G55A 2KBXA 3MKQB 1H6OA 2QYJA 1H0AA 4KMOA 2QZAA 4I17A 3ABME 4DI3A 3UM2A 3FTVA 2HM8A 3L6AA 4WNDA 1HS6A 3CSFA 2ETBA 1E8YA 2VYIA 4ATGA 4GTMA 1A5EA 2ZISA 2Y3AA 3PEUB 4GTSA 4A3VA 3SI5A 3TJPA 1JCQA 4MBGA 4WAFA 2J4DA 3E32A 4AM9A 3PREA 2KCKA 4L9PA 3PRZA 3FP3A 4U95D 3FTXA 2P9UG 3C3RA 3IHVA 2WXIA 3V2XA 4GYWA 4GTVA 4DRXE 1TNYA 4CDRA 4JHRA 1HO8A 5FIOA 3B7BA 4DLOA 2JEKA 2WQHA 5A7DB 3EHRA 3D9HA 2J8SD 4AP2A 4UWLA 2XS8A 4F7AA 1N4RA 3X2QE 2IU1A 1NP7A 4G24A 5AENA 4HRNA 3IKOB 4FU3A 4G8LA 5G05C 5EX0A 3AJIA 4GZ6A 4WWPA 3PZ3A 1AP7A 4IN3B 1YMPA 5AQ7A 3ULYA 2XEVA 3TWSA 3T8MA 4KBQA 1TN6A 4XX5A 3NOGD 4GA2A 3ZYKA 3BEEA 2IY0C 2XZTG 5KJNA 1JWGA 3MKRA 4HBDA 2R05A 4F53A 3ZW3A 5BXUA 4C48B 3UMVA 3OXFA 3ASHA 4KXKB 3ULQA
chains in the Genus database with same CATH topology
1E96B 3BG0B 3RRNB 3FH7A 2L6JA 1U3CA 4K03A 3FDHA 3S7FA 3SNXA 2WXPA 4LRZA 2VGYA 4PDXA 3RKVA 3NZSA 4WNEA 1HE8A 2UWJG 3CV0A 2OVBA 3UQ3A 3UX4A 3PE3A 4J8EA 4B0ZA 3SGHA 4O6FA 2C0LA 5ENNA 3PS6A 3RRUA 3U9WA 1PC2A 4I2ZA 3APDA 3VLFA 2VGXB 4MRUA 4HOSA 2GRLA 3EIQC 2XPYA 2KZTB 3PDNA 3CQCB 5BV1A 4N5CA 3FTUA 4ANVA 3UT4A 2VGXA 3PUKA 1OWLA 3URZA 3APCA 3LY8A 4CDNA 3LVRE 3TXNA 4J8DA 4F3VA 2XCBA 3VLDA 3D9PA 2IONA 4NURA 2NC9A 2XGOA 5J90A 4N39A 1NZNA 3G2TA 4HOQA 4J8SA 3CIAA 2LSVA 5T3RA 2A5UA 4HOUA 2V8SE 2X6KA 4EBAA 4G23A 4XKBA 5CHEE 5JJ7A 5D0OD 2VTBB 4GYOA 3FTWA 5A6CA 1XNFA 4DPRA 2KATA 3RJVA 4AV7A 2XRYA 3QOUA 4I2WA 2YNQA 4WWOA 4ME2A 2CHXA 4B8AA 1WM5A 2UY1B 1N54A 3D9NA 2XPIA 4DI4A 5FZSA 5KCMA 3HYMB 4I1MA 2MRIA 4CRWA 3ONLA 4J8FA 2CFZA 3ZXSA 1Z3XA 4ILGA 3CQGB 3U3WA 3G2VA 3FHEA 3EHMA 3K9IA 5C1DA 2Y4TA 2X6IA 1JWFA 4FULA 2YHCA 4JEUA 3ZIMA 3VTYA 3GW4A 3WXXA 4K0RA 4Q69A 4EZJA 2NSZA 2PQNA 1FVFA 3QDNA 4HS2A 2WXFA 2J9QA 4JA7A 4U63A 3ZYMA 1HF8A 2VTBA 3CHQA 3CSTA 4HVBA 1UW4B 1X5BA 5LX8A 3EDTB 3P2BA 1FCHA 3D9OA 3PH0C 2WQ7A 5FQ8A 4N2SA 3CK8A 4Y6CA 2WB2A 4L23A 2KCLA 2XQ0A 5AJDA 2X6FA 3RK6A 4V3IA 3ZRHA 3FU3A 4I6JA 4XZ4A 3PE4A 2I2OA 1WAO1 3VLEA 2WXMA 4IRUA 5AJLA 1ZBPA 1H2TC 4EBAG 3N71A 3SFZA 4LERA 4RG9A 5T8IA 1IYGA 3CGHA 2M63A 4H7YA 3LYAA 3L54A 5E76A 2J08A 3TXMA 4HOTA 3AS5A 4MS6A 3CR3A 3ZFWA 3ZN3A 3TGOA 2L0IA 3IV0A 2LO6A 4KT6B 4D10C 1E8ZA 3PNLB 4APOA 2L0TB 1LF8A 3I4GA 2NXPA 3FY4A 2FBNA 3D9IA 4PS8A 5BUZA 3EHNA 4PS3A 3FH8A 4YVQC 3UPVA 2OVFA 3MGBA 3FH5A 3NQPA 3ZEFA 4BT9A 2OOEA 3ESKA 3JCKC 4TV3A 4JVSA 3TL5A 3RRMB 4CEMA 3CKBA 1BPOA 3ESLA 4N3CA 4U8HA 4ABNA 5LCWJ 2WXOA 3Q5MA 1ELKA 4P29A 5LOZA 4HLEA 4G25A 3B7RL 3PUJA 3S2AA 3TG4A 4GAAA 3U4TA 2RD0A 2Q7FA 4F1SA 2L9BA 1UG3A 5A23A 5AIJA 4I1OB 3G2UA 5BT1A 4E6HA 4Q96A 4NACA 3IEGA 5E75A 4L1BA 1SQMA 3L17A 2X3MA 1IQRA 4JL0A 1PAQA 1MQSA 5KJKA 5ARFA 2CG2A 2WXGA 2IF4A 2AXVA 2HYZA 3KS2A 3D3MA 3DPDA 4U0ZA 3FUJA 5FT9A 3LDZA 4FHJA 4DJAA 1JUQA 4WUYA 3VTXA 3QWPA 3E4BA 4C9BB 4RVBA 1DVPA 4LUNU 1HFAA 4GA0A 4TRQA 5D0QD 4A55A 3CHPA 1OUVA 1MHQA 3FEYA 3QB2A 3U66A 4JZYA 4UWKA 2VJ8A 3B7SA 4DK5A 1B89A 5BPPA 5M72A 4URKA 1HU3A 3ML9A 4FLBA 4BY6A 2EQXA 2CFUA 3ENEA 2WXHA 4CCAA 4HORA 4APFA 2LAIA 2CHWA 4CDMA 1E7VA 3RU0A 1TEZA 4WNFA 2XPZA 4JC8A 1OWOA 5EKQD 3OXLA 4N3BA 4ANXA 3IHYA 3ZYQA 4I9EA 2VSXE 3FUKA 4N2QA 2PL2A 2V4LA 3QAQA 5HQ8A 4H7XA 3DBSA 3QNKA 4BWRA 5CCMA 2AWIA 3CVQA 3LY9A 4WWNA 3R7RA 1UN9A 2PQRA 2WMOA 4OVUA 2X6JA 4BSXA 3ZYLA 1EYHA 2GGFA 3G2SA 4UWHA 4C0MA 2KZTA 3FEXA 3PEVB 4XI9A 2GRMA 2FF4A 4GU5A 2LSUA 2R5SA 3OAWA 4JHJA 5FZQA 2DBAA 3LPZA 5FQ4A 1VDYA 5CMWA 3LJ3A 2IOSA 2J07A 3NZUA 3ASGA 4FJZA 4UQYA 2ZU6B 4WNGA 1E8XA 3KAEA 5ANRA 1HG5A 4R7LA 2CHZA 5J08A 3MYVA 4B8CB 1Y8MA 4L2LA 4OYSA 3Q47B 2RG8A 1HXIA 3CHRA 3D9KA 2FO7A 2FI7A 3UUXA 2GW1A 4W9RA 4GZ5A 3CVVA 2YHEA 4U0SA 5JJ6A 1QZ2A 3EIJA 3GZ1A 3LVQE 5FQ6A 3FUFA 5CMYA 4GMLA 4KVOA 4BT8A 2AXZA 3QWWA 4KZCA 4I6GA 3FTSA 4PS7A 4AXHA 3O4ZA 2WQ6A 4AEZC 4FA6A 3ASDA 4I6EA 4GZ3A 4L7TA 1FVHA 3FTYA 4ILIA 3FU5A 3FU6A 3CEQA 3FUEA 4U04A 3U64A 3FUNA 5LCWC 3LS8A 3B7TA 5KJLA 4FHKA 3APFA 2WXRA 1QNFA 2J49A 3MJWA 4CGVA 3OTNA 2WXJA 1KT1A 4XE0A 3QK0A 3PNTB 4BX8A 2WM9A 3AU4A 3S7BA 4ACLA 3CVXA 5EX3A 3TG5A 1JPLA 1UJJA 4JHKA 3JYSA 3PZDA 4ANUA 1HX8A 4EPZA 2QFCA 1UJKA 2FULA 4ILHB 3T5VA 3CHMA 4BTBA 3CVUA 4AIFA 2DIWA 5JHAA 3MA5A 3FUIA 4XIFA 3JUIA 4XI0A 4CT4A 1L5JA 3CHOA 3O48A 2XGMA 2WPVA 2WXLA 3LEWA 4U0UA 3ASFA 2IQCA 5FJYA 1IHGA 3SHFA 1KLXA 3MV2B 3LKUA 4ACKA 2XHEA 2OV8A 1S0PA 4GPKA 2LAHA 3S7DA 3OXGA 2IOLA 3MZLB 4G2VA 4UWFA 4UWGA 4J6IA 3I5PA 3FTZA 3HIZA 2YQ8A 3AS4A 3SD5A 1DNPA 2ILRA 4RG6A 3I3NA 3FU0A 3CVNA 4N3AA 2WMNA 4NRHB 2XGSA 4UI9K 5G2NA 1U3DA 5G04J 2R59A 2E2EA 4EZKA 4I9CA 4BFRA 3CVWA 2JLBA 2KM4A 3ZGQA 2KC7A 4DLQA 2MHKA 3S7JA 2I6HA 3L16A 3QARA 4GA1A 1TJFA 3PVLA 4IYPA 4OVVA 4UQZA 3SBTB 4BTAA 4Q94A 3MKQA 5C2YA 1GW6A 2WXNA 3P1UA 4NQ0A 4GZCA 5DBKA 4ANWA 4YVOA 5CCLA 1SZAA 1NA3A 2V5FA 2PM7A 1E7UA 3KEZA 4LEUA 2VSNA 2E0IA 3LXUX 4RSYA 2KCVA 4Y6WA 5LFAA 4GB9A 3ZPJA 1TJCA 4FP7A 3ZVVA 4AY5A 4E85A 4FADA 4BX9A 4UQXA 4AVXA 1HH8A 2WVIA 1OWNA 2C0MA 2C2LA 3FWVA 3FUMA 2YINA 3RO3A 5KJMA 3L08A 3AS8A 5ARGA 4A3TA 1Y6IA 4AJWA 4B89A 2R17C 5ANLA 3UT8A 1EF1C 1OWPA 1Z6TA 4AOFA 5G55A 3D9JA 3MKQB 4XKCA 4I1AA 1H0AA 4KMOA 4MKTA 4G11A 4I17A 4DI3A 1HZ4A 5BW8C 2BTDA 3MV3B 2XRZA 3FTVA 2HM8A 3JQ1A 3L6AA 3SF4A 4WNDA 1HS6A 3L13A 3CSFA 1SZ9A 3FUDA 3GZSA 4GCNA 1E8YA 4KYOB 1WY6A 2VYIA 4HXIA 4ATGA 1NA0A 3R9AB 3QKYA 4QFVA 3Q4AB 2WXKA 3B7UX 2UY1A 1E90A 3HDXA 4EECA 3FULA 4CGWA 2Y3AA 3PEUB 1IQUA 4A3VA 3SI5A 2PM6A 4MLPA 3QC1A 4UI9C 4FC8A 3TJPA 1INZA 1EDUA 1E8WA 4A1SA 4YNDA 1H2UA 2BF0X 4WAFA 4JEHA 2J4DA 3EJNA 5FTPA 4AM9A 3PREA 3AU5A 2I1JA 1H19A 1UN8A 2KCKA 3CKCA 2I1KA 4EQFA 3PRZA 2VSOE 4M3OA 3FP3A 1OWMA 2CG3A 2XCCA 3CVLA 3ZHEA 1H6KA 3MCXA 3SZ7A 2Y4UA 2AXUA 3RIBA 2X38A 1KT0A 3FTXA 4GZDA 4JPSA 5HI7A 3IHVA 2WXIA 1A17A 5G05J 5LP0A 3HVEB 3JQ0A 4IULA 2IJGX 2PZIA 3Q49B 4GYWA 3UT7A 3FFLA 4CDRA 4GMJA 1HO8A 4JHRA 4DLOA 2JEKA 5BNWA 3CVPA 1PY1A 2WQHA 5A7DB 2MOWA 2A4ZA 3QJZA 2BUGA 3BG1B 4AP2A 4PH4B 1HG2A 2WXQA 3B13A 3GYZA 4UWLA 4U07A 4F7AA 3G2WA 4UI9J 3R7QA 5JJTA 5BV0A 4HFGA 1YA0A 2AVPA 4JW1A 1W3BA 4I43A 1Z3YA 3IBEA 3MEKA 2IU1A 3FUHA 1NP7A 4G24A 5AENA 5FQ7A 1H2VC 3IKOB 2P58C 3I4RB 3Q15A 4FU3A 2V0PA 4J0UA 3CVYA 4GYYA 5G05C 4B94A 5EX0A 5EDSA 4GCOA 3D9MA 2FEZA 4GZ6A 5AYWD 4WWPA 1EPUA 3CK9A 4KVMA 4JXTA 5JHBA 2VQ2A 4G26A 3NF1A 1N52A 1P5QA 3HVEA 4JA9A 4IN3B 5FWQA 4A1GA 2QY7A 2J4BA 2XEVA 2HR2A 2J09A 4KZ0A 3CK7A 4FJYA 4KBQA 3T8MA 3KD7A 1ELRA 4XX5A 3GZ2A 4CT0A 4C0EA 4EZLA 5FZRA 4GA2A 3ZYKA 3BEEA 4AY6A 1QQEA 3LCAA 3ZHEB 2HO1A 1ELWA 4LCTA 5KJNA 3ML8A 5DIZA 2AW6A 1JWGA 5T4YA 2I9CA 3RO2A 3MKRA 1XGWA 3L22A 4TUUA 3C98A 3D9LA 3SBSA 1ZU2A 3QWVA 2X6HA 4F53A 3TAXA 4L2YA 5G04C 3HHMA 3ZW3A 3ONKA 2DCPA 2VSYA 3LY7A 3OXFA 3UMVA 4G1TA 3ASHA 4PUCA 3CLJA 2ONDA 4FLHA 3MX3A 2IFUA 4KXKB 3ULQA 3CHSA 2LNIA 3T5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E96 B;  2L6J A;  3S7F A;  4BT8 A;  4APO A;  3RKV A;  4GCN A;  2VGY A;  3QWW A;  4KYO B;  2FBN A;  2VYI A;  4WNE A;  2UWJ G;  3CV0 A;  1NA0 A;  3R9A B;  3QKY A;  3UQ3 A;  3PE3 A;  4J8E A;  4AY6 A;  3Q4A B;  4YVQ C;  3UPV A;  2UY1 A;  4O6F A;  2C0L A;  3ASD A;  4CGW A;  4BT9 A;  2OOE A;  3ESK A;  4GZ3 A;  1PC2 A;  4I2Z A;  4HOS A;  2VGX B;  3CEQ A;  3CKB A;  4N3C A;  4U04 A;  4UI9 C;  5LCW C;  4ABN A;  5KJL A;  3PDN A;  3Q5M A;  5LCW J;  4A1S A;  4N5C A;  4YND A;  4G25 A;  2VGX A;  3TG4 A;  4CGV A;  5FTP A;  3U4T A;  1KT1 A;  4AM9 A;  2Q7F A;  3URZ A;  3LY8 A;  2KCK A;  3CKC A;  3S7B A;  5BT1 A;  5EX3 A;  3TG5 A;  4J8D A;  4F3V A;  2XCB A;  3IEG A;  4EQF A;  3JYS A;  3FP3 A;  2NC9 A;  3CVL A;  2XCC A;  2QFC A;  2XGO A;  3ZHE A;  4JL0 A;  4N39 A;  1NZN A;  3SZ7 A;  4BTB A;  4AIF A;  2Y4U A;  4HOQ A;  3MA5 A;  4XIF A;  5ARF A;  5HI7 A;  3RIB A;  2IF4 A;  4XI0 A;  5KJK A;  1KT0 A;  2LSV A;  2HYZ A;  3KS2 A;  4HOU A;  5JJ7 A;  4G23 A;  3O48 A;  5CHE E;  2XGM A;  2WPV A;  4GYO A;  5D0O D;  4U0U A;  1A17 A;  3ASF A;  4U0Z A;  1XNF A;  5FT9 A;  5G05 J;  2KAT A;  3RJV A;  5FJY A;  1IHG A;  5A6C A;  4WUY A;  1KLX A;  3MV2 B;  3LKU A;  3VTX A;  3QWP A;  3E4B A;  3QOU A;  4I2W A;  2PZI A;  3Q49 B;  4GYW A;  4GA0 A;  4ME2 A;  4GPK A;  5D0Q D;  3S7D A;  3FFL A;  1OUV A;  4CDR A;  4JHR A;  3OXG A;  5KJM A;  5BNW A;  4G2V A;  1WM5 A;  2UY1 B;  3CVP A;  5M72 A;  2WQH A;  1B89 A;  5A7D B;  2BUG A;  2YQ8 A;  2XPI A;  3AS4 A;  4RG6 A;  3GYZ A;  5FZS A;  3CVN A;  3HYM B;  4N3A A;  4U07 A;  4UI9 J;  4NRH B;  2XGS A;  4J8F A;  4UI9 K;  5JJT A;  5G04 J;  4HOR A;  3U3W A;  2E2E A;  4I9C A;  1YA0 A;  2AVP A;  1W3B A;  2JLB A;  3ZGQ A;  2KC7 A;  3MEK A;  3RU0 A;  3K9I A;  2MHK A;  4WNF A;  4G24 A;  3S7J A;  5C1D A;  2I6H A;  2P58 C;  3Q15 A;  3OXL A;  4GA1 A;  4J0U A;  4N3B A;  4UQZ A;  5EKQ D;  4I9E A;  4GYY A;  5G05 C;  2Y4T A;  5EX0 A;  4B94 A;  4N2Q A;  4GCO A;  2FEZ A;  2PL2 A;  4BTA A;  2YHC A;  5HQ8 A;  4H7X A;  4GZ6 A;  3GW4 A;  5AYW D;  3VTY A;  3CK9 A;  3WXX A;  4BWR A;  5CCM A;  3LY9 A;  3CVQ A;  2VQ2 A;  4G26 A;  4NQ0 A;  3NF1 A;  2PQR A;  1P5Q A;  5DBK A;  4YVO A;  5CCL A;  4JA9 A;  4IN3 B;  1NA3 A;  2V5F A;  4LEU A;  2PQN A;  2HR2 A;  2XEV A;  3QDN A;  2VSN A;  4XI9 A;  3CK7 A;  2J9Q A;  2FF4 A;  4JA7 A;  4KBQ A;  2LSU A;  2R5S A;  1ELR A;  3KD7 A;  3GZ2 A;  5FZQ A;  2KCV A;  2DBA A;  3LPZ A;  4Y6W A;  3ZPJ A;  1TJC A;  5FZR A;  4AY5 A;  3EDT B;  4GA2 A;  4UQX A;  1HH8 A;  1FCH A;  3BEE A;  2C0M A;  2C2L A;  3ASG A;  1QQE A;  3FWV A;  4UQY A;  3LCA A;  4WNG A;  3RO3 A;  3ZHE B;  2HO1 A;  1ELW A;  3KAE A;  3AS8 A;  5KJN A;  3CK8 A;  4Y6C A;  5ARG A;  5DIZ A;  4N2S A;  2KCL A;  3RO2 A;  3MKR A;  3PE4 A;  1WAO 1;  1ZU2 A;  3QWV A;  1ZBP A;  4I1A A;  3N71 A;  5G04 C;  3TAX A;  1Y8M A;  4RG9 A;  1IYG A;  3Q47 B;  1HXI A;  2FO7 A;  4H7Y A;  2FI7 A;  3UUX A;  4I17 A;  2VSY A;  2GW1 A;  3LY7 A;  3LYA A;  3OXF A;  3ASH A;  1HZ4 A;  4G1T A;  2OND A;  4GZ5 A;  4W9R A;  4U0S A;  4HOT A;  3AS5 A;  5JJ6 A;  1QZ2 A;  3MV3 B;  2IFU A;  4KXK B;  5BW8 C;  3SF4 A;  3ULQ A;  3ZFW A;  3ZN3 A;  3GZ1 A;  3TGO A;  4WND A;  2LNI A; 
#chains in the Genus database with same CATH topology
 1E96 B;  4K03 A;  2L6J A;  3RKV A;  4LRZ A;  2VGY A;  1TNU A;  1HE8 A;  2UWJ G;  3CV0 A;  2OVB A;  2GRQ B;  3DSW A;  4U96 D;  3PS6 A;  1OT8 A;  3APD A;  4MRU A;  2P9I G;  3EIQ C;  3E37 A;  4ANV A;  4J7W A;  1OWL A;  2VGE A;  3URZ A;  3DSV A;  3VLD A;  1NZN A;  4HI9 A;  3CIA A;  5T3R A;  4GPM A;  4EBA A;  4XKB A;  4GYO A;  1XNF A;  4DPR A;  2XRY A;  2YNQ A;  3ASO E;  2DYS E;  3ISM C;  1WM5 A;  4DI4 A;  3E30 A;  3J5Q B;  4I1M A;  3ZXS A;  2CFZ A;  1Z3X A;  3CQG B;  3FHE A;  2ZGG A;  3K9I A;  4ZFH A;  1N95 A;  5C1D A;  1SVX A;  2DVW A;  3E33 A;  1JCS A;  4GTQ A;  5CER B;  2ETA A;  1FVF A;  4JA7 A;  3CST A;  3TWT A;  4HVB A;  1FCH A;  5FQ8 A;  5AQ9 A;  4N2S A;  2WB2 A;  4L23 A;  3ZRH A;  3C5R A;  3PE4 A;  3VLE A;  1H2T C;  4H7Y A;  1TYQ G;  4HOT A;  3AS5 A;  3C72 A;  2LO6 A;  2LUH A;  4D10 C;  3EHN A;  3FH8 A;  4YVQ C;  3FH5 A;  3ESK A;  3TL5 A;  3RRM B;  4CEM A;  2EIN E;  1BPO A;  3ESL A;  3TG4 A;  4GAA A;  1UG3 A;  5AIJ A;  4Z68 A;  3IEG A;  1TN7 A;  1MQS A;  3V2O A;  2HE0 A;  3DPD A;  4U0Z A;  4DJA A;  3VTX A;  4C9B B;  1DVP A;  1MX4 A;  4LUN U;  3IXE A;  5D0Q D;  3U66 A;  4DX1 A;  3SY2 A;  2VJ8 A;  3B7S A;  5BPP A;  4URK A;  2F8Y A;  5ENR D;  2CHW A;  1E7V A;  1SA4 A;  4WNF A;  5EKQ D;  2VSX E;  3FUK A;  5AN8 A;  4HQD A;  3CVQ A;  4BSX A;  1EYH A;  2Y0B G;  3DXK G;  3FEX A;  3PEV B;  2GRM A;  2FF4 A;  2R5S A;  2DBA A;  3LJ3 A;  2IOS A;  1N9A A;  3ZU7 B;  2J07 A;  3ASG A;  4R7L A;  3Q47 B;  1HXI A;  2FO7 A;  3UUX A;  4K5B A;  2XZD G;  1QZ2 A;  3EIJ A;  3LVQ E;  5FQ6 A;  5IY5 E;  4GML A;  3FTS A;  3W9F A;  4FA6 A;  1RZ4 A;  2R2L A;  1KZO A;  4GZ3 A;  3U64 A;  5LCW C;  3LS8 A;  1IHB A;  3HXB A;  2H6F A;  3QK0 A;  3BQO A;  4ACL A;  5EX3 A;  3TG5 A;  1BLX B;  3JYS A;  3TWR A;  3PZD A;  2F8X K;  2QFC A;  1UJK A;  3FUI A;  2GRO B;  1L5J A;  3O48 A;  5FJY A;  1KLX A;  4ACK A;  2XHE A;  4GPK A;  3OXG A;  4UWF A;  4UWG A;  2EIK E;  2H6H A;  3HIZ A;  2ILR A;  2XGS A;  4UI9 K;  1BI7 B;  5G2N A;  2E2E A;  4EZK A;  4I9C A;  4BFR A;  3CVW A;  2KM4 A;  1MYO A;  4DLQ A;  4GA1 A;  3PVL A;  4UQZ A;  5CRU A;  3DEO A;  3MKQ A;  2BED A;  4NQ0 A;  4YVO A;  3KEZ A;  2E0I A;  2RKK A;  3LXU X;  4RSY A;  2KCV A;  4Y6W A;  5LFA A;  3ZVV A;  1TJC A;  4FP7 A;  4FAD A;  3RO3 A;  3L08 A;  4A3T A;  3JUE A;  4B89 A;  1EF1 C;  1Z6T A;  4K5A B;  1TNZ A;  4G11 A;  2GRN B;  1OCC E;  2R03 A;  2B6C A;  5BW8 C;  3MV3 B;  4NIK A;  4GTP A;  1SZ9 A;  4GCN A;  3GZS A;  4CT0 A;  1WY6 A;  4UUC A;  3Q4A B;  3HDX A;  4EEC A;  1LD8 A;  1IQU A;  5B3S E;  1S63 A;  4MLP A;  3QC1 A;  4FC8 A;  1E8W A;  2BF0 X;  3V79 K;  1H19 A;  3CKC A;  4HB5 A;  4CYM D;  3EUV A;  2CG3 A;  3UM1 A;  4U8Y D;  2Y4U A;  2A5E A;  2L6B A;  4GZD A;  3ZKJ A;  4JPS A;  5HI7 A;  5LP0 A;  3HVE B;  3JQ0 A;  3Q7F A;  1PY1 A;  1K1B A;  3QJZ A;  2BUG A;  1HG2 A;  3B13 A;  4U07 A;  3R7Q A;  1W3B A;  3IBE A;  1NI1 A;  3FUH A;  4X8Q A;  1H2V C;  4GCO A;  5AYW D;  5CEA A;  4KVM A;  4JXT A;  5JHB A;  1N52 A;  1P5Q A;  5FWQ A;  4JA9 A;  2QY7 A;  2HR2 A;  3UKR G;  2P9P G;  4C0E A;  2H6I A;  4EZL A;  3ASN E;  2DWZ A;  3V31 A;  4AY6 A;  1QQE A;  3LCA A;  3ZHE B;  5DIZ A;  3BU8 A;  2I9C A;  3QWV A;  5G04 C;  1TNO A;  4GTO A;  5B1A E;  4PUC A;  2OND A;  3MX3 A;  1IKN D;  1OY3 D;  3CHS A;  1ZB1 A;  2LNI A;  3DSX A;  3BG0 B;  3RRN B;  3SNX A;  1H6P A;  4BES A;  4WNE A;  5ENN A;  3Q7A A;  3VLF A;  4HOS A;  2VGX B;  4U8V D;  2GRL A;  2XPY A;  3HXF A;  3PDN A;  4U7E B;  3FTU A;  3TXN A;  1QYM A;  4F3V A;  2XCB A;  2ION A;  2NC9 A;  3G2T A;  4J8S A;  2LSV A;  2A5U A;  4HOU A;  5JJ7 A;  2XS1 A;  5CBO A;  5A6C A;  2KAT A;  3RJV A;  3ZNG A;  3QOU A;  4I2W A;  2UY1 B;  5JMN D;  1N54 A;  2P2C P;  5KCM A;  1O1S A;  4JD2 G;  4CRW A;  3ONL A;  3G2V A;  4YDW A;  4LG6 A;  2X6I A;  1JWF A;  2YHC A;  4JEU A;  3ZIM A;  3VTY A;  3WXX A;  4K0R A;  3UXG A;  4Q69 A;  4JB8 P;  4EZJ A;  1S64 A;  2J9Q A;  4U63 A;  2VTB A;  1UW4 B;  1X5B A;  5LX8 A;  1YYH A;  3D9O A;  2WQ7 A;  3CK8 A;  4Y6C A;  2X6F A;  3RK6 A;  2KXP C;  4V3I A;  3FU3 A;  2WXM A;  4IRU A;  1ZBP A;  3CGH A;  5CRV A;  1O1R A;  5E76 A;  2J08 A;  3ZFW A;  1E8Z A;  3PNL B;  3FY4 A;  3JXI A;  3D9I A;  4PS8 A;  4PS3 A;  3NQP A;  4BT9 A;  2OOE A;  4JVS A;  4N3C A;  4RQI A;  5LCW J;  3Q5M A;  1ELK A;  5LOZ A;  4G25 A;  3S2A A;  3UTM A;  2L9B A;  4HRL A;  5A23 A;  4Q96 A;  4JL0 A;  2EIM E;  1WG0 A;  2AXV A;  3KS2 A;  3FUJ A;  3LDZ A;  4FHJ A;  3E4B A;  4GA0 A;  4TRQ A;  3CHP A;  3DEP A;  1MHQ A;  3FEY A;  4RLY A;  1HU3 A;  1V55 E;  4CCA A;  2OCC E;  2DZO A;  3JXJ A;  3IHY A;  4XEI G;  4N2Q A;  5HQ8 A;  3QNK A;  1TNB A;  3LY9 A;  4WWN A;  1UN9 A;  2X6J A;  4TXP A;  3G2S A;  4C0M A;  4GU5 A;  5FZQ A;  4JHJ A;  3LPZ A;  1VDY A;  2EIJ E;  3NZU A;  4FJZ A;  4UQY A;  2ZU6 B;  1E8X A;  3HRA A;  2CHZ A;  1AWC B;  4B8C B;  2RG8 A;  2GW1 A;  3CVV A;  5JJ6 A;  2IO3 C;  3FUF A;  5CMY A;  4BT8 A;  4I6G A;  5ENO D;  4PS7 A;  3O4Z A;  2WQ6 A;  4AEZ C;  4I6E A;  2P9K G;  3FU5 A;  2WXR A;  1QNF A;  2J49 A;  3OTN A;  2WXJ A;  1KT1 A;  3AU4 A;  3S7B A;  4DX5 D;  2QC9 A;  4ANU A;  4EPZ A;  3T5V A;  3CHO A;  2WPV A;  3LEW A;  3ASF A;  1YCS B;  3EHQ A;  3MV2 B;  3LKU A;  1NFI E;  3ZUV B;  3S7D A;  4DUI A;  4CZ2 D;  5KBA A;  4RG6 A;  2V4H C;  2KC7 A;  2MHK A;  3S7J A;  2I6H A;  2JAB A;  2B0O E;  3SBT B;  3AG3 E;  4O60 A;  4BET A;  1GW6 A;  5DBK A;  2V5F A;  1E7U A;  2VSN A;  4GB9 A;  3ZPJ A;  4BX9 A;  2WVI A;  3UM0 A;  1OWN A;  2YIN A;  1IXV A;  1FT1 A;  5ARG A;  3AG2 E;  4AJW A;  2R17 C;  4AOF A;  4HI8 A;  3L9T A;  1HZ4 A;  2XRZ A;  3DXM G;  3L13 A;  5B1B E;  2MYO A;  4QFV A;  2WXK A;  1E90 A;  4CGW A;  3FUL A;  1JCR A;  1INZ A;  1EDU A;  4DX2 A;  4A1S A;  1RW2 A;  4YND A;  1H2U A;  3EJN A;  5D2M C;  5FTP A;  3KEA A;  3AU5 A;  1UN8 A;  2Y69 E;  2I1K A;  1OCZ E;  4EQF A;  1OWM A;  4YDY A;  1H6K A;  1LTX A;  3HG0 D;  1KPS B;  2IJG X;  2PZI A;  3Q49 B;  3DSS A;  3FFL A;  4GMJ A;  3CVP A;  3SO8 A;  3ZXP A;  2WXQ A;  3GYZ A;  3G2W A;  3UKU G;  5JJT A;  1YA0 A;  3ABK E;  1N4Q A;  2P58 C;  3I4R B;  2V0P A;  4GYY A;  5EDS A;  4B94 A;  2FEZ A;  4GMR A;  1EPU A;  3CK9 A;  4A1G A;  2J4B A;  4HNA D;  4KZ0 A;  3CK7 A;  4FJY A;  1ELR A;  2RFA A;  3GZ2 A;  1QBQ A;  5FZR A;  4QQI A;  5HS0 A;  2HO1 A;  2AW6 A;  5T4Y A;  1Z5S C;  4YDO A;  3C98 A;  4G8K A;  3KSL A;  4TXQ A;  4L2Y A;  3HHM A;  3ONK A;  3CLJ A;  4FLH A;  3TWQ A;  2IFU A;  2ZGD A;  3FH7 A;  1U3C A;  3FDH A;  3B95 A;  3UX4 A;  3R9M A;  3UQ3 A;  4B0Z A;  4O6F A;  2C0L A;  3RRU A;  1PC2 A;  4I2Z A;  3CQC B;  4N5C A;  3UT4 A;  2VGX A;  4CDN A;  4J8D A;  4NUR A;  2XGO A;  4N39 A;  2V8S E;  5D0O D;  2VTB B;  3FTW A;  4AV7 A;  5ENS D;  4ME2 A;  4YDE A;  2CHX A;  1BD8 A;  3D9N A;  2XPI A;  3HYM B;  5JA4 D;  2MRI A;  4ILG A;  4F1P A;  4B93 B;  4HLL A;  2Y4T A;  3NAW A;  1D8D A;  1S70 B;  2QYU A;  2DYR E;  3UM3 A;  4HS2 A;  2WXF A;  1HF8 A;  3CHQ A;  3SFX A;  2BKK B;  3PH0 C;  2FO1 E;  2KCL A;  4XZ4 A;  5AJL A;  4EBA G;  3N71 A;  4LER A;  5T8I A;  1N4P A;  3LYA A;  4OAV B;  4MS6 A;  3CR3 A;  3TGO A;  3UIP C;  3IV0 A;  2FBN A;  3UPV A;  1BU9 A;  2IEJ A;  3JCK C;  4TV3 A;  1FT2 A;  3V30 A;  3AAA C;  4ABN A;  2WXO A;  4P29 A;  2LXL A;  1DC2 A;  4HLE A;  3PUJ A;  2RD0 A;  2XEH A;  2Q7F A;  4F1S A;  4NAC A;  3L17 A;  5ITZ F;  1IQR A;  2Y1L E;  3HXD A;  4BSZ B;  2XEE A;  5ARF A;  2CG2 A;  2IF4 A;  2HYZ A;  2RFM A;  1NL4 A;  5CBN A;  3LJN A;  5FT9 A;  4WUY A;  3QWP A;  4A55 A;  1OUV A;  3QB2 A;  4UWK A;  1B89 A;  5AAR A;  3ML9 A;  2EQX A;  2CFU A;  2WXH A;  4HOR A;  4APF A;  5FIN A;  2LAI A;  4CDM A;  3RU0 A;  2XPZ A;  4LNU D;  1OWO A;  3OXL A;  4N3B A;  3ZYQ A;  3QAQ A;  3DBS A;  2P9S G;  2AWI A;  5KNH D;  3R7R A;  3TWW A;  1DCE A;  2WMO A;  4OVU A;  4UWH A;  2KZT A;  4XI9 A;  2LSU A;  3OAW A;  5CMW A;  3Q75 A;  3KAE A;  5ANR A;  5J08 A;  3UIN C;  1MJ0 A;  4GTR A;  1Y8M A;  1TN8 A;  3CHR A;  3D9K A;  3Q73 A;  2FI7 A;  4K5C A;  3HXC A;  4GZ5 A;  4W9R A;  2YHE A;  4U0S A;  3GZ1 A;  3T8K A;  4AXH A;  3ASD A;  4L7T A;  4ILI A;  3CEQ A;  3RAU A;  1TR4 A;  5EYP F;  3APF A;  3MJW A;  3UIO C;  3ULE G;  4CGV A;  3PNT B;  4BX8 A;  3CVX A;  1JPL A;  3DSU A;  4ILH B;  4LSZ E;  3DST A;  3CHM A;  4BTB A;  3CVU A;  5JHA A;  3MA5 A;  4XIF A;  4XI0 A;  5AAO A;  4CT4 A;  2IQC A;  3SHF A;  2OV8 A;  1S0P A;  1X81 A;  4LNG A;  2LAH A;  3MZL B;  4G2V A;  4J6I A;  3FU0 A;  4N3A A;  4NRH B;  1U3D A;  2JLB A;  4O1O A;  4IYP A;  3NB2 A;  4BTA A;  1O1T A;  4LNB A;  4Q94 A;  5C2Y A;  2P9N G;  2WXN A;  3P1U A;  4M7C A;  4GZC A;  3BUA A;  3HXE A;  2F37 A;  3TWX A;  2XEN A;  4AY5 A;  2AJA A;  4AVX A;  2C0M A;  2C2L A;  3SQV A;  5ANL A;  3D9J A;  4XKC A;  4I1A A;  4MKT A;  5EN5 D;  1UOH A;  1Q2Z A;  2BTD A;  3SF4 A;  3JQ1 A;  3FUD A;  4KYO B;  4HXI A;  1NA0 A;  3R9A B;  3QKY A;  3B7U X;  2UY1 A;  5EIB E;  3DPY A;  2PM6 A;  4UI9 C;  4JEH A;  4DX7 D;  2I1J A;  4GTT A;  1D9S A;  2VSO E;  4M3O A;  3ZHE A;  3CVL A;  2XCC A;  3MCX A;  3SZ7 A;  2AXU A;  3RIB A;  2X38 A;  1KT0 A;  3J5P A;  1A17 A;  1SA5 A;  5G05 J;  4IUL A;  3Q9U C;  3UT7 A;  1K3Z D;  5BNW A;  2MOW A;  2A4Z A;  3BG1 B;  3Q79 A;  4PH4 B;  4UI9 J;  1KZP A;  5BV0 A;  4JW1 A;  4HFG A;  2AVP A;  4I43 A;  1Z3Y A;  3MEK A;  2LXM A;  3SFY A;  1SW6 A;  5FQ7 A;  4J0U A;  3Q15 A;  3CVY A;  3D9M A;  3C3Q A;  2IO2 C;  4ATZ D;  2VQ2 A;  4G26 A;  3NF1 A;  1MZC A;  3HVE A;  2J09 A;  3AG1 E;  4BER A;  2BKG A;  3KD7 A;  3UI2 A;  5AQA A;  3E34 A;  1ELW A;  4LCT A;  3ML8 A;  1OCO E;  3RO2 A;  1XGW A;  3L22 A;  4TUU A;  3SBS A;  3D9L A;  1ZU2 A;  2X6H A;  1FPP A;  3TAX A;  2DCP A;  2VSY A;  3LY7 A;  4G1T A;  1D8E A;  3T5X A;  4HRM B;  3S7F A;  2WXP A;  4PDX A;  3NZS A;  3PE3 A;  4J8E A;  3SGH A;  1BI8 B;  3U9W A;  3TWU A;  2KZT B;  5BXO A;  1OCR E;  5BV1 A;  3PUK A;  5ENQ D;  3APC A;  3LY8 A;  4ZHB A;  3LVR E;  3D9P A;  2EIL E;  5ENT D;  2R02 A;  5J90 A;  2ZXW E;  4HOQ A;  3RSE G;  1WDY A;  2X6K A;  4G23 A;  5CHE E;  1OXJ A;  3C3O A;  4WWO A;  4B8A A;  3Q78 A;  3PZ1 A;  2PNN A;  5FZS A;  4J8F A;  3U3W A;  3L82 A;  3EHM A;  2ETC A;  4N5Q A;  1LD7 A;  2ZIR A;  4FUL A;  4TXR A;  3GW4 A;  5D66 A;  2NSZ A;  3F6Q A;  2PQN A;  3QDN A;  3ZYM A;  3EDT B;  3NOC D;  3P2B A;  1K8K G;  2XQ0 A;  5AJD A;  1N0R A;  1O5M A;  5KNG A;  4I6J A;  2I2O A;  1DCQ A;  1WAO 1;  2GRP B;  2OEV A;  3SFZ A;  4RG9 A;  1IYG A;  1N4S A;  2M63 A;  3AG4 E;  3L54 A;  3TXM A;  5ENP D;  3ZN3 A;  2L0I A;  4KT6 B;  4APO A;  2L0T B;  1LF8 A;  3I4G A;  2NXP A;  5BUZ A;  2OVF A;  3MGB A;  5EIL A;  3ZEF A;  3CKB A;  4U8H A;  3B7R L;  3U4T A;  5H7P A;  4I1O B;  3G2U A;  5BT1 A;  4E6H A;  5E75 A;  4L1B A;  1SQM A;  2X3M A;  1PAQ A;  3T9K A;  5KJK A;  2WXG A;  5EYL A;  3D3M A;  1MX6 A;  1JUQ A;  5EID A;  4RVB A;  1HFA A;  4JZY A;  5M72 A;  4DK5 A;  4FLB A;  4BY6 A;  2H6G A;  3ENE A;  1TEZ A;  4JC8 A;  5HRY A;  4ANX A;  4I9E A;  2PL2 A;  2V4L A;  4H7X A;  1G3N B;  5CEC B;  4BWR A;  5CCM A;  2PQR A;  5HKP A;  3ZYL A;  2GGF A;  1U2V G;  5FQ4 A;  3Q9N C;  4WNG A;  1HG5 A;  3W9G A;  3MYV A;  3DRA A;  4OAU C;  4L2L A;  4OYS A;  3NBN B;  4DX6 D;  3TWV A;  4KVO A;  1N94 A;  2AXZ A;  3QWW A;  4KZC A;  3ABL E;  1N11 A;  4A63 B;  1FVH A;  3FTY A;  3FU6 A;  3FUE A;  3PZ2 A;  5CED B;  4U04 A;  3FUN A;  1N0Q A;  5KJL A;  3B7T A;  3PZ4 A;  4FHK A;  4TUM A;  4XE0 A;  4EHM A;  2WM9 A;  4BEP A;  1MX2 A;  1UJJ A;  4JHK A;  4O1P A;  1HX8 A;  3KSQ A;  2FUL A;  2NYJ A;  4AIF A;  2DIW A;  2F0Y A;  3JUI A;  4J8Y A;  2XGM A;  2WXL A;  3EU9 A;  4U0U A;  1IHG A;  2GRR B;  2IOL A;  3I5P A;  3FTZ A;  2YQ8 A;  3AS4 A;  3SD5 A;  1DNP A;  3I3N A;  3CVN A;  2WMN A;  5G04 J;  2R59 A;  1V54 E;  3ZGQ A;  3EU5 A;  3L16 A;  3QAR A;  1TJF A;  4OVV A;  2V5Q C;  5AQB A;  1K1A A;  4ANW A;  5CCL A;  1SZA A;  1NA3 A;  2PM7 A;  2P9L G;  3DWL G;  4LEU A;  2DZN A;  5KWD A;  4E85 A;  2OEW A;  4UQX A;  3WG7 E;  1HH8 A;  4F6R D;  3FWV A;  3FUM A;  5KJM A;  3AS8 A;  1Y6I A;  3UT8 A;  1OWP A;  5G55 A;  2KBX A;  3MKQ B;  1H6O A;  2QYJ A;  1H0A A;  4KMO A;  2QZA A;  4I17 A;  3ABM E;  4DI3 A;  3UM2 A;  3FTV A;  2HM8 A;  3L6A A;  4WND A;  1HS6 A;  3CSF A;  2ETB A;  1E8Y A;  2VYI A;  4ATG A;  4GTM A;  1A5E A;  2ZIS A;  2Y3A A;  3PEU B;  4GTS A;  4A3V A;  3SI5 A;  3TJP A;  1JCQ A;  4MBG A;  4WAF A;  2J4D A;  3E32 A;  4AM9 A;  3PRE A;  2KCK A;  4L9P A;  3PRZ A;  3FP3 A;  4U95 D;  3FTX A;  2P9U G;  3C3R A;  3IHV A;  2WXI A;  3V2X A;  4GYW A;  4GTV A;  4DRX E;  1TNY A;  4CDR A;  4JHR A;  1HO8 A;  5FIO A;  3B7B A;  4DLO A;  2JEK A;  2WQH A;  5A7D B;  3EHR A;  3D9H A;  2J8S D;  4AP2 A;  4UWL A;  2XS8 A;  4F7A A;  1N4R A;  3X2Q E;  2IU1 A;  1NP7 A;  4G24 A;  5AEN A;  4HRN A;  3IKO B;  4FU3 A;  4G8L A;  5G05 C;  5EX0 A;  3AJI A;  4GZ6 A;  4WWP A;  3PZ3 A;  1AP7 A;  4IN3 B;  1YMP A;  5AQ7 A;  3ULY A;  2XEV A;  3TWS A;  3T8M A;  4KBQ A;  1TN6 A;  4XX5 A;  3NOG D;  4GA2 A;  3ZYK A;  3BEE A;  2IY0 C;  2XZT G;  5KJN A;  1JWG A;  3MKR A;  4HBD A;  2R05 A;  4F53 A;  3ZW3 A;  5BXU A;  4C48 B;  3UMV A;  3OXF A;  3ASH A;  4KXK B;  3ULQ A; 
#chains in the Genus database with same CATH homology
 1E96 B;  3BG0 B;  3RRN B;  3FH7 A;  2L6J A;  1U3C A;  4K03 A;  3FDH A;  3S7F A;  3SNX A;  2WXP A;  4LRZ A;  2VGY A;  4PDX A;  3RKV A;  3NZS A;  4WNE A;  1HE8 A;  2UWJ G;  3CV0 A;  2OVB A;  3UQ3 A;  3UX4 A;  3PE3 A;  4J8E A;  4B0Z A;  3SGH A;  4O6F A;  2C0L A;  5ENN A;  3PS6 A;  3RRU A;  3U9W A;  1PC2 A;  4I2Z A;  3APD A;  3VLF A;  2VGX B;  4MRU A;  4HOS A;  2GRL A;  3EIQ C;  2XPY A;  2KZT B;  3PDN A;  3CQC B;  5BV1 A;  4N5C A;  3FTU A;  4ANV A;  3UT4 A;  2VGX A;  3PUK A;  1OWL A;  3URZ A;  3APC A;  3LY8 A;  4CDN A;  3LVR E;  3TXN A;  4J8D A;  4F3V A;  2XCB A;  3VLD A;  3D9P A;  2ION A;  4NUR A;  2NC9 A;  2XGO A;  5J90 A;  4N39 A;  1NZN A;  3G2T A;  4HOQ A;  4J8S A;  3CIA A;  2LSV A;  5T3R A;  2A5U A;  4HOU A;  2V8S E;  2X6K A;  4EBA A;  4G23 A;  4XKB A;  5CHE E;  5JJ7 A;  5D0O D;  2VTB B;  4GYO A;  3FTW A;  5A6C A;  1XNF A;  4DPR A;  2KAT A;  3RJV A;  4AV7 A;  2XRY A;  3QOU A;  4I2W A;  2YNQ A;  4WWO A;  4ME2 A;  2CHX A;  4B8A A;  1WM5 A;  2UY1 B;  1N54 A;  3D9N A;  2XPI A;  4DI4 A;  5FZS A;  5KCM A;  3HYM B;  4I1M A;  2MRI A;  4CRW A;  3ONL A;  4J8F A;  2CFZ A;  3ZXS A;  1Z3X A;  4ILG A;  3CQG B;  3U3W A;  3G2V A;  3FHE A;  3EHM A;  3K9I A;  5C1D A;  2Y4T A;  2X6I A;  1JWF A;  4FUL A;  2YHC A;  4JEU A;  3ZIM A;  3VTY A;  3GW4 A;  3WXX A;  4K0R A;  4Q69 A;  4EZJ A;  2NSZ A;  2PQN A;  1FVF A;  3QDN A;  4HS2 A;  2WXF A;  2J9Q A;  4JA7 A;  4U63 A;  3ZYM A;  1HF8 A;  2VTB A;  3CHQ A;  3CST A;  4HVB A;  1UW4 B;  1X5B A;  5LX8 A;  3EDT B;  3P2B A;  1FCH A;  3D9O A;  3PH0 C;  2WQ7 A;  5FQ8 A;  4N2S A;  3CK8 A;  4Y6C A;  2WB2 A;  4L23 A;  2KCL A;  2XQ0 A;  5AJD A;  2X6F A;  3RK6 A;  4V3I A;  3ZRH A;  3FU3 A;  4I6J A;  4XZ4 A;  3PE4 A;  2I2O A;  1WAO 1;  3VLE A;  2WXM A;  4IRU A;  5AJL A;  1ZBP A;  1H2T C;  4EBA G;  3N71 A;  3SFZ A;  4LER A;  4RG9 A;  5T8I A;  1IYG A;  3CGH A;  2M63 A;  4H7Y A;  3LYA A;  3L54 A;  5E76 A;  2J08 A;  3TXM A;  4HOT A;  3AS5 A;  4MS6 A;  3CR3 A;  3ZFW A;  3ZN3 A;  3TGO A;  2L0I A;  3IV0 A;  2LO6 A;  4KT6 B;  4D10 C;  1E8Z A;  3PNL B;  4APO A;  2L0T B;  1LF8 A;  3I4G A;  2NXP A;  3FY4 A;  2FBN A;  3D9I A;  4PS8 A;  5BUZ A;  3EHN A;  4PS3 A;  3FH8 A;  4YVQ C;  3UPV A;  2OVF A;  3MGB A;  3FH5 A;  3NQP A;  3ZEF A;  4BT9 A;  2OOE A;  3ESK A;  3JCK C;  4TV3 A;  4JVS A;  3TL5 A;  3RRM B;  4CEM A;  3CKB A;  1BPO A;  3ESL A;  4N3C A;  4U8H A;  4ABN A;  5LCW J;  2WXO A;  3Q5M A;  1ELK A;  4P29 A;  5LOZ A;  4HLE A;  4G25 A;  3B7R L;  3PUJ A;  3S2A A;  3TG4 A;  4GAA A;  3U4T A;  2RD0 A;  2Q7F A;  4F1S A;  2L9B A;  1UG3 A;  5A23 A;  5AIJ A;  4I1O B;  3G2U A;  5BT1 A;  4E6H A;  4Q96 A;  4NAC A;  3IEG A;  5E75 A;  4L1B A;  1SQM A;  3L17 A;  2X3M A;  1IQR A;  4JL0 A;  1PAQ A;  1MQS A;  5KJK A;  5ARF A;  2CG2 A;  2WXG A;  2IF4 A;  2AXV A;  2HYZ A;  3KS2 A;  3D3M A;  3DPD A;  4U0Z A;  3FUJ A;  5FT9 A;  3LDZ A;  4FHJ A;  4DJA A;  1JUQ A;  4WUY A;  3VTX A;  3QWP A;  3E4B A;  4C9B B;  4RVB A;  1DVP A;  4LUN U;  1HFA A;  4GA0 A;  4TRQ A;  5D0Q D;  4A55 A;  3CHP A;  1OUV A;  1MHQ A;  3FEY A;  3QB2 A;  3U66 A;  4JZY A;  4UWK A;  2VJ8 A;  3B7S A;  4DK5 A;  1B89 A;  5BPP A;  5M72 A;  4URK A;  1HU3 A;  3ML9 A;  4FLB A;  4BY6 A;  2EQX A;  2CFU A;  3ENE A;  2WXH A;  4CCA A;  4HOR A;  4APF A;  2LAI A;  2CHW A;  4CDM A;  1E7V A;  3RU0 A;  1TEZ A;  4WNF A;  2XPZ A;  4JC8 A;  1OWO A;  5EKQ D;  3OXL A;  4N3B A;  4ANX A;  3IHY A;  3ZYQ A;  4I9E A;  2VSX E;  3FUK A;  4N2Q A;  2PL2 A;  2V4L A;  3QAQ A;  5HQ8 A;  4H7X A;  3DBS A;  3QNK A;  4BWR A;  5CCM A;  2AWI A;  3CVQ A;  3LY9 A;  4WWN A;  3R7R A;  1UN9 A;  2PQR A;  2WMO A;  4OVU A;  2X6J A;  4BSX A;  3ZYL A;  1EYH A;  2GGF A;  3G2S A;  4UWH A;  4C0M A;  2KZT A;  3FEX A;  3PEV B;  4XI9 A;  2GRM A;  2FF4 A;  4GU5 A;  2LSU A;  2R5S A;  3OAW A;  4JHJ A;  5FZQ A;  2DBA A;  3LPZ A;  5FQ4 A;  1VDY A;  5CMW A;  3LJ3 A;  2IOS A;  2J07 A;  3NZU A;  3ASG A;  4FJZ A;  4UQY A;  2ZU6 B;  4WNG A;  1E8X A;  3KAE A;  5ANR A;  1HG5 A;  4R7L A;  2CHZ A;  5J08 A;  3MYV A;  4B8C B;  1Y8M A;  4L2L A;  4OYS A;  3Q47 B;  2RG8 A;  1HXI A;  3CHR A;  3D9K A;  2FO7 A;  2FI7 A;  3UUX A;  2GW1 A;  4W9R A;  4GZ5 A;  3CVV A;  2YHE A;  4U0S A;  5JJ6 A;  1QZ2 A;  3EIJ A;  3GZ1 A;  3LVQ E;  5FQ6 A;  3FUF A;  5CMY A;  4GML A;  4KVO A;  4BT8 A;  2AXZ A;  3QWW A;  4KZC A;  4I6G A;  3FTS A;  4PS7 A;  4AXH A;  3O4Z A;  2WQ6 A;  4AEZ C;  4FA6 A;  3ASD A;  4I6E A;  4GZ3 A;  4L7T A;  1FVH A;  3FTY A;  4ILI A;  3FU5 A;  3FU6 A;  3CEQ A;  3FUE A;  4U04 A;  3U64 A;  3FUN A;  5LCW C;  3LS8 A;  3B7T A;  5KJL A;  4FHK A;  3APF A;  2WXR A;  1QNF A;  2J49 A;  3MJW A;  4CGV A;  3OTN A;  2WXJ A;  1KT1 A;  4XE0 A;  3QK0 A;  3PNT B;  4BX8 A;  2WM9 A;  3AU4 A;  3S7B A;  4ACL A;  3CVX A;  5EX3 A;  3TG5 A;  1JPL A;  1UJJ A;  4JHK A;  3JYS A;  3PZD A;  4ANU A;  1HX8 A;  4EPZ A;  2QFC A;  1UJK A;  2FUL A;  4ILH B;  3T5V A;  3CHM A;  4BTB A;  3CVU A;  4AIF A;  2DIW A;  5JHA A;  3MA5 A;  3FUI A;  4XIF A;  3JUI A;  4XI0 A;  4CT4 A;  1L5J A;  3CHO A;  3O48 A;  2XGM A;  2WPV A;  2WXL A;  3LEW A;  4U0U A;  3ASF A;  2IQC A;  5FJY A;  1IHG A;  3SHF A;  1KLX A;  3MV2 B;  3LKU A;  4ACK A;  2XHE A;  2OV8 A;  1S0P A;  4GPK A;  2LAH A;  3S7D A;  3OXG A;  2IOL A;  3MZL B;  4G2V A;  4UWF A;  4UWG A;  4J6I A;  3I5P A;  3FTZ A;  3HIZ A;  2YQ8 A;  3AS4 A;  3SD5 A;  1DNP A;  2ILR A;  4RG6 A;  3I3N A;  3FU0 A;  3CVN A;  4N3A A;  2WMN A;  4NRH B;  2XGS A;  4UI9 K;  5G2N A;  1U3D A;  5G04 J;  2R59 A;  2E2E A;  4EZK A;  4I9C A;  4BFR A;  3CVW A;  2JLB A;  2KM4 A;  3ZGQ A;  2KC7 A;  4DLQ A;  2MHK A;  3S7J A;  2I6H A;  3L16 A;  3QAR A;  4GA1 A;  1TJF A;  3PVL A;  4IYP A;  4OVV A;  4UQZ A;  3SBT B;  4BTA A;  4Q94 A;  3MKQ A;  5C2Y A;  1GW6 A;  2WXN A;  3P1U A;  4NQ0 A;  4GZC A;  5DBK A;  4ANW A;  4YVO A;  5CCL A;  1SZA A;  1NA3 A;  2V5F A;  2PM7 A;  1E7U A;  3KEZ A;  4LEU A;  2VSN A;  2E0I A;  3LXU X;  4RSY A;  2KCV A;  4Y6W A;  5LFA A;  4GB9 A;  3ZPJ A;  1TJC A;  4FP7 A;  3ZVV A;  4AY5 A;  4E85 A;  4FAD A;  4BX9 A;  4UQX A;  4AVX A;  1HH8 A;  2WVI A;  1OWN A;  2C0M A;  2C2L A;  3FWV A;  3FUM A;  2YIN A;  3RO3 A;  5KJM A;  3L08 A;  3AS8 A;  5ARG A;  4A3T A;  1Y6I A;  4AJW A;  4B89 A;  2R17 C;  5ANL A;  3UT8 A;  1EF1 C;  1OWP A;  1Z6T A;  4AOF A;  5G55 A;  3D9J A;  3MKQ B;  4XKC A;  4I1A A;  1H0A A;  4KMO A;  4MKT A;  4G11 A;  4I17 A;  4DI3 A;  1HZ4 A;  5BW8 C;  2BTD A;  3MV3 B;  2XRZ A;  3FTV A;  2HM8 A;  3JQ1 A;  3L6A A;  3SF4 A;  4WND A;  1HS6 A;  3L13 A;  3CSF A;  1SZ9 A;  3FUD A;  3GZS A;  4GCN A;  1E8Y A;  4KYO B;  1WY6 A;  2VYI A;  4HXI A;  4ATG A;  1NA0 A;  3R9A B;  3QKY A;  4QFV A;  3Q4A B;  2WXK A;  3B7U X;  2UY1 A;  1E90 A;  3HDX A;  4EEC A;  3FUL A;  4CGW A;  2Y3A A;  3PEU B;  1IQU A;  4A3V A;  3SI5 A;  2PM6 A;  4MLP A;  3QC1 A;  4UI9 C;  4FC8 A;  3TJP A;  1INZ A;  1EDU A;  1E8W A;  4A1S A;  4YND A;  1H2U A;  2BF0 X;  4WAF A;  4JEH A;  2J4D A;  3EJN A;  5FTP A;  4AM9 A;  3PRE A;  3AU5 A;  2I1J A;  1H19 A;  1UN8 A;  2KCK A;  3CKC A;  2I1K A;  4EQF A;  3PRZ A;  2VSO E;  4M3O A;  3FP3 A;  1OWM A;  2CG3 A;  2XCC A;  3CVL A;  3ZHE A;  1H6K A;  3MCX A;  3SZ7 A;  2Y4U A;  2AXU A;  3RIB A;  2X38 A;  1KT0 A;  3FTX A;  4GZD A;  4JPS A;  5HI7 A;  3IHV A;  2WXI A;  1A17 A;  5G05 J;  5LP0 A;  3HVE B;  3JQ0 A;  4IUL A;  2IJG X;  2PZI A;  3Q49 B;  4GYW A;  3UT7 A;  3FFL A;  4CDR A;  4GMJ A;  1HO8 A;  4JHR A;  4DLO A;  2JEK A;  5BNW A;  3CVP A;  1PY1 A;  2WQH A;  5A7D B;  2MOW A;  2A4Z A;  3QJZ A;  2BUG A;  3BG1 B;  4AP2 A;  4PH4 B;  1HG2 A;  2WXQ A;  3B13 A;  3GYZ A;  4UWL A;  4U07 A;  4F7A A;  3G2W A;  4UI9 J;  3R7Q A;  5JJT A;  5BV0 A;  4HFG A;  1YA0 A;  2AVP A;  4JW1 A;  1W3B A;  4I43 A;  1Z3Y A;  3IBE A;  3MEK A;  2IU1 A;  3FUH A;  1NP7 A;  4G24 A;  5AEN A;  5FQ7 A;  1H2V C;  3IKO B;  2P58 C;  3I4R B;  3Q15 A;  4FU3 A;  2V0P A;  4J0U A;  3CVY A;  4GYY A;  5G05 C;  4B94 A;  5EX0 A;  5EDS A;  4GCO A;  3D9M A;  2FEZ A;  4GZ6 A;  5AYW D;  4WWP A;  1EPU A;  3CK9 A;  4KVM A;  4JXT A;  5JHB A;  2VQ2 A;  4G26 A;  3NF1 A;  1N52 A;  1P5Q A;  3HVE A;  4JA9 A;  4IN3 B;  5FWQ A;  4A1G A;  2QY7 A;  2J4B A;  2XEV A;  2HR2 A;  2J09 A;  4KZ0 A;  3CK7 A;  4FJY A;  4KBQ A;  3T8M A;  3KD7 A;  1ELR A;  4XX5 A;  3GZ2 A;  4CT0 A;  4C0E A;  4EZL A;  5FZR A;  4GA2 A;  3ZYK A;  3BEE A;  4AY6 A;  1QQE A;  3LCA A;  3ZHE B;  2HO1 A;  1ELW A;  4LCT A;  5KJN A;  3ML8 A;  5DIZ A;  2AW6 A;  1JWG A;  5T4Y A;  2I9C A;  3RO2 A;  3MKR A;  1XGW A;  3L22 A;  4TUU A;  3C98 A;  3D9L A;  3SBS A;  1ZU2 A;  3QWV A;  2X6H A;  4F53 A;  3TAX A;  4L2Y A;  5G04 C;  3HHM A;  3ZW3 A;  3ONK A;  2DCP A;  2VSY A;  3LY7 A;  3OXF A;  3UMV A;  4G1T A;  3ASH A;  4PUC A;  3CLJ A;  2OND A;  4FLH A;  3MX3 A;  2IFU A;  4KXK B;  3ULQ A;  3CHS A;  2LNI A;  3T5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...