4UI9J

Atomic structure of the human anaphase-promoting complex
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
b'NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVNGLEKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
total genus 179
structure length 504
sequence length 532
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ui9J00
2FI7A 5G04C 1XNFA 4I1AA 3EDTB 4BT8A 3WXXA 5G04J 1YA0A 3QWPA 5CCLA 3RO2A 2JLBA 2KCLA 2KCVA 4NRHB 1TJCA 3QKYA 1ZU2A 3JYSA 2MHKA 3QWVA 5D0QD 4XI0A 3N71A 5CCMA 3Q4AB 4GZ5A 4N3BA 3LY9A 4G24A 3OXFA 2HO1A 4CGWA 3AS8A 1IHGA 2LNIA 3RKVA 4JL0A 4U0UA 4WUYA 2WQHA 2HR2A 3UUXA 1IYGA 4GYYA 2VYIA 1WM5A 5ARGA 4YNDA 1A17A 2HYZA 1NZNA 3CVLA 2PQRA 4APOA 3MKRA 2XPIA 3CVQA 4EQFA 3IEGA 2XGSA 4N3AA 4B94A 1ZBPA 2XEVA 3HYMB 3ASGA 2J9QA 3GYZA 5CHEE 3URZA 1NA0A 1P5QA 4HORA 4N2QA 4U0SA 4CGVA 4KYOB 4NQ0A 3PE4A 2C0LA 3U3WA 2KCKA 4G23A 2XGMA 4WNEA 5ARFA 4YVOA 1HXIA 4G2VA 3CK8A 2QFCA 3KD7A 3CVPA 4W9RA 3FWVA 4HOQA 5HI7A 2Y4UA 2NC9A 4BTBA 3ZHEB 4GA2A 3QWWA 2AVPA 3FFLA 5EX3A 3ZFWA 2VSYA 4WNDA 2BUGA 3LY8A 3VTXA 5KJNA 5KJMA 3KAEA 3ASDA 3SF4A 2LSVA 1QQEA 3MV3B 3OXLA 5AYWD 5EX0A 4JA7A 4UI9C 3GZ2A 3ZPJA 4XIFA 4AY6A 2P58C 4GYWA 4GZ3A 2UY1A 2VGXA 5FT9A 3ZN3A 4Y6CA 3TGOA 5FZQA 4RG6A 4H7XA 4UQYA 4GPKA 2DBAA 5M72A 1KT1A 4U07A 2VSNA 4G25A 3AS5A 1KT0A 2FEZA 4UQXA 2FO7A 3ASFA 4IN3B 3S7DA 4GZ6A 3R9AB 3LPZA 2XCCA 5JJ7A 3RU0A 2KATA 2OOEA 3CVNA 4N5CA 1ELRA 3MEKA 4O6FA 5KJKA 2UWJG 4J0UA 4J8FA 5A7DB 4N3CA 3RJVA 5FZSA 4I17A 3AS4A 3QDNA 4U04A 3GW4A 3RO3A 4A1SA 3GZ1A 1HZ4A 1E96B 4KBQA 3ZGQA 2Y4TA 3CKCA 2VQ2A 4AY5A 3O48A 2Q7FA 2PZIA 3Q5MA 3TG5A 4ME2A 4Y6WA 2VGYA 4I2WA 5G05C 4HOTA 4I9EA 1NA3A 5FJYA 4WNGA 2E2EA 1HH8A 3RIBA 4RG9A 4J8EA 5DBKA 3Q49B 4AM9A 3LY7A 3LKUA 1B89A 5A6CA 2R5SA 3CK7A 1OUVA 5KJLA 5JJ6A 4JA9A 5BT1A 5BW8C 4UI9J 4AIFA 2ONDA 1W3BA 2L6JA 4N2SA 3PE3A 2YHCA 4GCNA 4F3VA 3Q47B 4LEUA 2FF4A 5EKQD 5BNWA 5JJTA 3ZHEA 3TG4A 4KXKB 3K9IA 5LCWC 4I2ZA 4WNFA 2C2LA 5LCWJ 3BEEA 3MV2B 3CK9A 1Y8MA 2XGOA 1FCHA 1WAO1 3CKBA 2C0MA 3FP3A 4GYOA 3KS2A 3CEQA 4G1TA 3S7JA 4J8DA 2YQ8A 5C1DA 1ELWA 3LCAA 3UQ3A 5FZRA 3MA5A 3E4BA 1QZ2A 2LSUA 5FTPA 3ASHA 3ULQA 4HOSA 2I6HA 2GW1A 3SZ7A 3S7BA 3CV0A 4XI9A 2V5FA 3TAXA 3VTYA 3PDNA 4YVQC 2PL2A 4BT9A 4N39A 4GA1A 2PQNA 4GA0A 4BWRA 2UY1B 2VGXB 2IF4A 2FBNA 2WPVA 3LYAA 4JHRA 5G05J 2XCBA 2KC7A 1KLXA 4G26A 5D0OD 3NF1A 3U4TA 4ABNA 3Q15A 4I9CA 4U0ZA 3OXGA 4CDRA 1PC2A 5DIZA 3S7FA 4UQZA 3UPVA 4BTAA 4GCOA 4UI9K 4HOUA 2IFUA 3QOUA 4H7YA 3ESKA 5HQ8A
chains in the Genus database with same CATH superfamily
1E8WA 2XENA 4JHKA 2JABA 2WQ6A 5G04C 3V79K 4BT8A 3NOGD 1Z5SC 3WXXA 1BI7B 2R2LA 3RO2A 2JLBA 4PUCA 1OWOA 1HFAA 1OXJA 4XX5A 1TJCA 4HRMB 3JYSA 1E8XA 4XI0A 1IXVA 3N71A 3CVYA 2KM4A 3D9JA 4G24A 3OXFA 3KSQA 3FTXA 4JL0A 1OCOE 2WQHA 1RW2A 2HR2A 4KZ0A 3CR3A 4EBAA 2AW6A 2VYIA 1SW6A 4BESA 2WQ7A 4YNDA 3FU3A 2WM9A 1GW6A 1N4PA 3D3MA 1MX4A 3UI2A 4EQFA 4CT4A 3W9FA 4N3AA 3FUEA 4J7WA 1ZBPA 2XEVA 1OWMA 2J9QA 5CHEE 5LOZA 5LP0A 4FLHA 1JWFA 4CGVA 4AEZC 4KYOB 4OVVA 2V0PA 2C0LA 5ENRD 5CERB 2V4HC 4J8YA 1N9AA 1HXIA 5C2YA 2A5EA 2XEEA 3CK8A 3KEZA 3CVXA 2ZISA 3KD7A 4DX7D 3CHOA 2VTBB 2DZNA 4IYPA 2HM8A 5FQ6A 2Y4UA 2NC9A 2WMOA 3QB2A 1LD7A 5AQ9A 5CEAA 3QWWA 2AVPA 3FFLA 2J08A 5EX3A 2X38A 3ZFWA 5JMND 4FHKA 2BUGA 2R03A 4GB9A 4LUNU 4LNUD 3PEUB 1OWPA 2CFZA 2RD0A 4U96D 1JCSA 2EIME 1HX8A 3DSVA 4JA7A 3PZ4A 4GMJA 1BD8A 2RKKA 3ZKJA 3L82A 4U7EB 3PNTB 1PAQA 2UY1A 4GTVA 4F1PA 3L16A 4L23A 4WWPA 2GRNB 3HHMA 4RG6A 1N52A 1Z3XA 4UUCA 4XKBA 2GRPB 1UOHA 2PM7A 1QNFA 2DBAA 2XZDG 4O1PA 5EYLA 2WXKA 4GZCA 3JXJA 1NFIE 4ACKA 1FVHA 1MQSA 4TXRA 5ITZF 4LCTA 2H6HA 3ZEFA 2J07A 3EUVA 3C5RA 4IN3B 2WMNA 3R9AB 3LPZA 5B3SE 3Q79A 1H6KA 3SGHA 3JCKC 5JA4D 1K1AA 3DWLG 2UWJG 3UM2A 4J8FA 4MS6A 5A7DB 3TWWA 3AS4A 3V31A 4PH4B 3RO3A 4A1SA 1TN8A 1HZ4A 3ZGQA 4RLYA 5J08A 2EILE 4AY5A 3O48A 4JEHA 3TG5A 4BX9A 1YMPA 3CVVA 5G05C 4I9EA 3ZYLA 4ZHBA 2CHWA 3ASNE 4L2LA 3RIBA 3AG2E 2ZU6B 5DBKA 4M7CA 3Q49B 3LY7A 5T4YA 3AAAC 3MX3A 4FC8A 3B13A 1E8ZA 3CK7A 1JCRA 2P9NG 3V2OA 3PS6A 4APFA 4O1OA 2V4LA 2WXMA 2ZIRA 4JA9A 5BT1A 3G2SA 4GU5A 2WXJA 3TWVA 4J8SA 3DPYA 5B1BE 3UM3A 4LNGA 2YHCA 4F3VA 4B0ZA 3E37A 2VTBA 2AXZA 2XHEA 5EKQD 1UJKA 3VLDA 2L9BA 3AG1E 1KZOA 4K5AB 2BKKB 4WNFA 4K03A 4DJAA 4GTOA 3ESLA 2WVIA 2F0YA 2X6KA 2LUHA 5HRYA 1WAO1 4AP2A 2C0MA 3FP3A 4WAFA 1Z6TA 3PUJA 4JPSA 3UT7A 1SA4A 2J4BA 4Q94A 5CBNA 4CDMA 3CEQA 4CRWA 4G1TA 3ZXSA 5C1DA 1UN9A 4WWOA 3UQ3A 5HS0A 1N4QA 3UM1A 1WY6A 5LFAA 2BTDA 3SZ7A 1HO8A 2V5FA 2PL2A 3LJ3A 3QARA 1OWLA 1AWCB 3ABLE 4N39A 1MX2A 5BV1A 3CHMA 1E7UA 2CFUA 5FQ8A 1D8EA 3LYAA 5G05J 2XCBA 5H7PA 2Y0BG 3QK0A 4B8CB 4HRNA 4EZJA 4GAAA 3ZXPA 5D0OD 3FH7A 3NF1A 3HVEB 1D9SA 1FT1A 4I9CA 4ABNA 1WG0A 4U0ZA 3OXGA 1PC2A 1UN8A 2XS1A 3DXKG 3CSFA 4FULA 3S7FA 4F7AA 2IOLA 5D66A 2IFUA 1NP7A 1UG3A 4JC8A 5IY5E 3MKQB 3T9KA 1XNFA 4BX8A 3CVWA 4F53A 4BETA 2AXVA 2P9LG 3UT4A 1O1SA 4HLLA 2KCLA 3HXFA 5G2NA 3ZU7B 2KCVA 1JUQA 2R59A 3O4ZA 1EYHA 5CRUA 1TYQG 3FTWA 2MHKA 2QY7A 4OYSA 2VSOE 2RFMA 2M63A 4L7TA 3Q4AB 4Q69A 4N3BA 3LY9A 1YCSB 4AXHA 3ML8A 4CGWA 3FDHA 1NI1A 3APDA 3CHRA 2LNIA 3Q7FA 3RKVA 2EINE 4WUYA 3TWSA 2J09A 3LVQE 4TRQA 3EHMA 3R9MA 1WM5A 3PZ3A 2I9CA 5KNHD 2HYZA 3CVLA 2XPZA 4I1OB 2XPIA 3CVQA 4ILIA 2XGSA 4NACA 1Z3YA 5AENA 3ASGA 4QQIA 3FU6A 3CVUA 1TNOA 1INZA 4AV7A 4HORA 4U0SA 4ACLA 5BXUA 4NQ0A 3TWTA 3HG0D 2PNNA 1YYHA 4C48B 1QBQA 3ZYMA 1BI8B 4WNEA 5AIJA 2WB2A 4JVSA 1ELKA 2WXPA 2QFCA 4HI9A 4W9RA 3FWVA 5HI7A 4BTBA 5AQ7A 3ZHEB 4GA2A 5KWDA 2A5UA 3HXBA 4G11A 3LVRE 5CECB 5LX8A 1X81A 2VSYA 3ULEG 3PRZA 3D9PA 5EDSA 3VTXA 4ANWA 1SZAA 4UWFA 1TNUA 2AWIA 2LSVA 3SHFA 1LTXA 4HFGA 4QFVA 5ENSD 4UI9C 5FWQA 4E6HA 3ZPJA 1DNPA 4C9BB 4AY6A 2P58C 4GYWA 4GZ3A 4M3OA 5FT9A 4Y6CA 5EN5D 5FZQA 4XE0A 2R17C 4EPZA 2WXFA 5T3RA 3UXGA 3JUEA 1DC2A 1Y6IA 1KT1A 2P9KG 3UMVA 2RG8A 3ZNGA 2DWZA 3HVEA 3JQ0A 4U07A 2VSNA 1H6OA 2F8YA 1HG5A 5G55A 1RZ4A 3FHEA 2F8XK 3ZW3A 3PUKA 1TNBA 3MKQA 4AVXA 2GRLA 2WXGA 3CVNA 2YHEA 1ELRA 3MEKA 4GTTA 4CT0A 2DYRE 2JEKA 3RJVA 3DRAA 5FZSA 5EYPF 4U04A 3GW4A 4P29A 4GTQA 4CEMA 1E96B 1BU9A 2Y4TA 2VGEA 3FUDA 4PS8A 2KXPC 3ZYKA 2AXUA 5AQAA 4C0MA 3D9IA 2P9SG 2PZIA 3FEYA 4ANVA 2IY0C 2CHZA 4I2WA 4UWGA 2DVWA 4HOTA 3AU5A 4GMRA 2XZTG 5D2MC 4RSYA 3NAWA 1TJFA 1BPOA 3RK6A 2XQ0A 1K3ZD 2GROB 1B89A 5A6CA 2R5SA 1E7VA 2P2CP 3B7BA 5EILA 3RSEG 3HRAA 4UI9J 2ONDA 4HBDA 4HNAD 1N94A 5HKPA 4B93B 5ENPD 3PE3A 5CRVA 1EDUA 2FF4A 4GPMA 3SO8A 3ZHEA 2IU1A 1ZB1A 2KZTB 2C2LA 4CYMD 4A3VA 5LCWJ 3MV2B 3C72A 4EECA 4JD2G 3E34A 3CQCB 1Y8MA 3T5VA 1DCEA 3L17A 4BY6A 1FCHA 3SI5A 4GTSA 5A23A 4L1BA 2X6JA 3ISMC 4U95D 3KS2A 3EHQA 4LSZE 4J8DA 2YQ8A 4A3TA 1ELWA 3LCAA 4ILGA 5FZRA 2L6BA 3MA5A 3B7SA 3B7TA 4OAUC 2LSUA 3ZUVB 2IEJA 4I43A 3ULQA 3FTSA 2GW1A 3TL5A 1FT2A 3S7BA 4XI9A 5BXOA 4UWLA 3D9LA 3SBTB 3PDNA 3L13A 3L6AA 2L0IA 5EIBE 2PQNA 4BWRA 4U8VD 4JXTA 2VGXB 4DLOA 2FBNA 4HXIA 3AG4E 3LDZA 1MZCA 1EPUA 4U8HA 3NZSA 4TXPA 2ETAA 4G26A 3UINC 3U4TA 3Q15A 4EZKA 5KCMA 1UW4B 5AJDA 1O1TA 4BSZB 3UPVA 1SQMA 2WXOA 4UI9K 1U3DA 3AG3E 4Z68A 2EQXA 3ESKA 1S64A 1N54A 1HU3A 1A5EA 1TR4A 2ZGDA 4L2YA 3UX4A 3APFA 4C0EA 1MHQA 3LS8A 1YA0A 3QWPA 5CCLA 1TNZA 4AOFA 3U9WA 4NRHB 3QKYA 4ATZD 4ANUA 1ZU2A 2ILRA 3QWVA 5CBOA 2HO1A 3L08A 4GTMA 3SBSA 1FPPA 1N4RA 2X6IA 1IKND 2WXLA 4EBAG 3PVLA 3CHPA 2QYUA 3QC1A 3DSXA 4E85A 4F6RD 1HG2A 2GGFA 2QC9A 2XEHA 5ARGA 1U3CA 1A17A 2H6GA 4FHJA 3DBSA 3AJIA 3IEGA 3T8MA 3T5XA 3HYMB 3GYZA 3IBEA 4GMLA 3URZA 3Q9NC 3ZRHA 5KBAA 4FP7A 2KZTA 4D10C 3D9OA 2ZXWE 3PE4A 1UJJA 3UKRG 2KBXA 3KEAA 4NURA 3EIQC 3FTYA 5ARFA 2BF0X 4G2VA 2FULA 3CVPA 4HOQA 1H6PA 1N4SA 3EJNA 3U66A 5J90A 2J8SD 3C3RA 3V2XA 4WNDA 5E76A 3D9NA 4NIKA 3FUJA 5KJNA 5KJMA 3KAEA 4DK5A 3SF4A 1OY3D 1QQEA 2EIKE 3OXLA 5AYWD 5EX0A 2Y69E 2H6FA 3ULYA 3GZ2A 5ENOD 3PNLB 4ZFHA 2VGXA 3ZN3A 2AJAA 2NSZA 3TGOA 2QYJA 3FTZA 4K5BA 3C3QA 3IHVA 4YDWA 4HI8A 1H2TC 5M72A 3PZ2A 3ZIMA 1N95A 2X3MA 1E8YA 3RRNB 1SA5A 3FEXA 3E33A 2FEZA 4UQXA 5FQ4A 2FO7A 3FH5A 3L22A 3S7DA 4GZ6A 4KZCA 3G2VA 3IXEA 5JJ7A 3RU0A 2X6FA 3APCA 2L0TB 1TN7A 4JW1A 2ETCA 3SFZA 4O6FA 1Q2ZA 3ENEA 4J6IA 4X8QA 2WXNA 3EIJA 2OVFA 3IV0A 3KSLA 3QDNA 3GZ1A 4BFRA 4KBQA 3CKCA 1S63A 3ONLA 4A1GA 3JXIA 1XGWA 3MZLB 3EU9A 2QZAA 3Q5MA 2GRMA 5CMYA 1AP7A 4V3IA 4Y6WA 3LJNA 4CZ2D 3NZUA 2VGYA 1V54E 4WNGA 3Q75A 1QYMA 1HH8A 3J5QB 2IO2C 4IRUA 2BEDA 1JWGA 4HQDA 4RG9A 3DEOA 2OV8A 2YINA 4J8EA 4I6JA 4KMOA 4DPRA 2DCPA 4UWKA 4AM9A 3LKUA 3U64A 4YDEA 3L54A 3BG0B 1N0RA 2GRRB 4XEIG 3LEWA 4I6EA 3DEPA 5JJ6A 2H6IA 3FU0A 5BUZA 5BW8C 3TJPA 4PS3A 1S70B 1NL4A 1VDYA 4N2SA 1L5JA 5ENTD 3PH0C 2XRYA 4FU3A 4GCNA 4TV3A 4UWHA 4G8KA 1U2VG 5JJTA 3PZDA 3TG4A 3C98A 4OAVB 3K9IA 5LCWC 3FY4A 4I2ZA 4OVUA 2P9UG 2MRIA 3FTUA 1WDYA 5FIOA 2LO6A 2XGOA 1LF8A 3DSTA 1FVFA 2DIWA 4GYOA 1TEZA 2ZGGA 2LAIA 5AAOA 2Y3AA 1LD8A 3ASOE 3BQOA 2R05A 4KT6B 3TWQA 3E4BA 5EIDA 2OVBA 5B1AE 1N0QA 3GZSA 5FTPA 3RRMB 3ASHA 3EHRA 4HOSA 4O60A 3OAWA 2IQCA 2OCCE 4RQIA 3R7RA 3CV0A 3TAXA 4JZYA 4BT9A 3Q73A 1PY1A 3S2AA 2X6HA 4TUUA 1IQRA 4GZDA 1D8DA 5ANRA 2IF4A 3FUFA 4JHRA 3DSUA 4U8YD 2BKGA 1KZPA 1KLXA 4FJYA 3NQPA 1DVPA 3EU5A 1IQUA 4TUMA 4CDRA 2Y1LE 5DIZA 4FLBA 4RVBA 4UQZA 3CIAA 3TWUA 4BTAA 3EHNA 3QOUA 4BSXA 3FU5A 3CHSA 5HQ8A 2R02A 2FI7A 4LNBA 3HIZA 3EDTB 4FJZA 4I1AA 3BU8A 2MOWA 5G04J 1HE8A 1OCRE 3C3OA 3W9GA 1H2UA 4KVMA 3SQVA 3FUNA 4MKTA 3Q9UC 5D0QD 3TWRA 4Q96A 1TN6A 5CCMA 2RFAA 4GZ5A 5FQ7A 2J49A 3P1UA 3VLEA 4IULA 2IJGX 3AS8A 4DI4A 1IHGA 4JEUA 1H19A 4U0UA 3FTVA 2I1JA 2LXMA 3UUXA 4AJWA 2B6CA 1IYGA 4GYYA 2ETBA 4XKCA 2IOSA 3FULA 5AARA 3HXEA 3E32A 2VSXE 4PDXA 1NZNA 4DRXE 4APOA 2PQRA 3CSTA 3MKRA 3UT8A 4B94A 5BPPA 2DYSE 1SZ9A 4HS2A 2V8SE 5JHAA 1NA0A 1P5QA 3NOCD 4N2QA 4K0RA 1MJ0A 1TNYA 3B7UX 1O1RA 2OEWA 4A55A 4YDYA 4LRZA 3X2QE 3U3WA 2KCKA 3QNKA 1HS6A 4G23A 5KNGA 3ML9A 2XGMA 1JCQA 3ABKE 2E0IA 4YVOA 2CHXA 2CG3A 4B8AA 3P2BA 5FINA 2FO1E 5JHBA 3BG1B 4WWNA 4G8LA 2XS8A 4HRLA 4F1SA 4GTPA 4BEPA 3LY8A 3WG7E 3DSSA 3ASDA 3SD5A 3RAUA 3D9KA 3MV3B 5AJLA 3UM0A 3JUIA 4XIFA 3NBNB 1N11A 2A4ZA 1OCCE 4DX5D 4H7XA 3CLJA 2HE0A 4UQYA 3D9HA 3ABME 3SY2A 4GPKA 4EZLA 4BERA 3NB2A 3J5PA 3LXUX 3JQ1A 4XZ4A 1K1BA 4MRUA 3Q78A 4DX1A 3VLFA 3G2UA 3IKOB 4R7LA 4G25A 3AS5A 1KT0A 4K5CA 2P9PG 3MJWA 3AU4A 1H0AA 3FUMA 3ASFA 4LERA 2WXQA 1SVXA 1E90A 2LXLA 3PREA 4GTRA 2F37A 3MGBA 4JB8P 2XCCA 2KATA 4FADA 2OOEA 3UTMA 4DX6D 3SNXA 4N5CA 1DCQA 3FH8A 5KJKA 4J0UA 3I4RB 4I1MA 4DLQA 4KVOA 4N3CA 3DSWA 5ENNA 5ANLA 4I17A 4DX2A 4ANXA 2GRQB 3B95A 2WXHA 1MYOA 4I6GA 5E75A 4EHMA 2YNQA 2LAHA 2VQ2A 2CG2A 2Q7FA 2P9IG 3TXNA 3F6QA 2J4DA 5BV0A 4DI3A 4JHJA 4ME2A 3RRUA 4L9PA 1NA3A 5FJYA 2E2EA 1OT8A 3B7RL 2PM6A 1HF8A 3DPDA 3TXMA 3ONKA 3QJZA 2IONA 2WXIA 1BLXB 5ENQD 5CEDB 3FUKA 2DZOA 3I5PA 1OUVA 5KJLA 3V30A 1OWNA 2OEVA 3HXCA 3DXMG 4URKA 4AIFA 4ATGA 1W3BA 3UKUG 1K8KG 2L6JA 3UIPC 3E30A 2I1KA 2IO3C 3Q7AA 3Q47B 4LEUA 4TXQA 3I3NA 4PS7A 4YDOA 5T8IA 3R7QA 5BNWA 1V55E 3QAQA 3BUAA 2B0OE 2XPYA 4KXKB 1KPSB 2NYJA 1JPLA 3BEEA 4MLPA 3IHYA 3CK9A 3HDXA 3FUHA 3PEVB 4ILHB 2I2OA 3CKBA 5AQBA 3S7JA 2MYOA 3MCXA 3TWXA 4CDNA 3SFYA 1QZ2A 1S0PA 3SFXA 3HXDA 1IHBA 3G2WA 1H2VC 2XRZA 2I6HA 2V5QC 4U63A 4MBGA 4HB5A 3UIOC 1X5BA 1O5MA 3VTYA 3I4GA 4YVQC 3MYVA 1G3NB 4LG6A 4GA1A 4GA0A 3OTNA 2UY1B 4B89A 2VJ8A 1MX6A 3FUIA 5CMWA 2WPVA 4A63B 3T8KA 3L9TA 1OCZE 3CHQA 2KC7A 2EIJE 4N5QA 3CGHA 3G2TA 5AN8A 4CCAA 2NXPA 3ZYQA 1EF1C 3CQGB 3D9MA 4FA6A 4HLEA 4HVBA 4GCOA 4HOUA 3ZVVA 3PZ1A 4H7YA 2WXRA 4DUIA
chains in the Genus database with same CATH topology
1N54A 4JC8A 1E8WA 4JHKA 2FI7A 3MKQB 2WQ6A 1HU3A 5G04C 1XNFA 4L2YA 3HIZA 3EDTB 4FJZA 4I1AA 3UX4A 3APFA 4BT8A 4BX8A 3CVWA 4C0EA 1MHQA 3WXXA 3LS8A 4F53A 2MOWA 5G04J 1YA0A 1HE8A 3QWPA 5CCLA 2AXVA 3RO2A 3UT4A 4AOFA 2JLBA 2KCLA 4PUCA 3U9WA 1OWOA 1H2UA 1HFAA 5G2NA 4KVMA 2KCVA 1JUQA 2R59A 3FUNA 4XX5A 3O4ZA 4NRHB 1EYHA 1TJCA 3QKYA 4MKTA 4ANUA 1ZU2A 3JYSA 3FU5A 3FTWA 2MHKA 1E8XA 2ILRA 2QY7A 3QWVA 4OYSA 2VSOE 5D0QD 4XI0A 4Q96A 3N71A 2M63A 3CVYA 4L7TA 5CCMA 3Q4AB 4GZ5A 4N3BA 3LY9A 5FQ7A 4Q69A 2KM4A 3D9JA 4G24A 3OXFA 2J49A 4AXHA 3P1UA 3VLEA 3ML8A 2HO1A 3L08A 3FTXA 4IULA 2IJGX 3AS8A 4CGWA 4DI4A 1IHGA 3FDHA 4JEUA 3SBSA 3APDA 2X6IA 2LNIA 3CHRA 3RKVA 4JL0A 1H19A 4U0UA 2WXLA 4EBAG 3PVLA 3FTVA 4WUYA 2WQHA 2I1JA 2J09A 3LVQE 3CHPA 2HR2A 4KZ0A 3CR3A 3QC1A 3UUXA 4AJWA 1IYGA 4GYYA 4TRQA 4XKCA 4E85A 3EHMA 4EBAA 2AW6A 2VYIA 1HG2A 2IOSA 2WQ7A 3FULA 1WM5A 2GGFA 5ARGA 1U3CA 2I9CA 3FU3A 4YNDA 2WM9A 1GW6A 2VSXE 4PDXA 1A17A 2HYZA 1NZNA 3D3MA 3CVLA 2PQRA 3CSTA 3MKRA 4APOA 2XPZA 4I1OB 4FHJA 2XPIA 3CVQA 3DBSA 4EQFA 4CT4A 3IEGA 4ILIA 2XGSA 3T8MA 3UT8A 4N3AA 3T5XA 4B94A 3FUEA 1Z3YA 4NACA 5AENA 1ZBPA 2XEVA 3HYMB 1OWMA 3ASGA 5BPPA 2J9QA 1SZ9A 3FU6A 3GYZA 2V8SE 3IBEA 4HS2A 4GMLA 3CVUA 5CHEE 5LOZA 5LP0A 3URZA 4FLHA 3ZRHA 1INZA 5JHAA 1NA0A 1P5QA 4AV7A 1JWFA 4HORA 4N2QA 4U0SA 4CGVA 4FP7A 4ACLA 4AEZC 2KZTA 4K0RA 4D10C 4KYOB 3D9OA 4OVVA 4NQ0A 2V0PA 3B7UX 3PE4A 1UJJA 2C0LA 4A55A 4LRZA 3U3WA 2KCKA 3QNKA 1HS6A 4G23A 4NURA 3ZYMA 3ML9A 2XGMA 4WNEA 5AIJA 3EIQC 2WB2A 3FTYA 5ARFA 2E0IA 4YVOA 2CHXA 1HXIA 2BF0X 4G2VA 4JVSA 1ELKA 5C2YA 2CG3A 2FULA 4B8AA 3CVXA 2WXPA 2QFCA 3CK8A 3KEZA 3KD7A 3P2BA 3CHOA 2VTBB 3CVPA 4W9RA 3FWVA 4HOQA 4IYPA 2HM8A 5HI7A 5FQ6A 2Y4UA 5JHBA 2NC9A 2WMOA 3BG1B 3QB2A 4BTBA 3EJNA 4WWNA 3U66A 3ZHEB 4GA2A 5J90A 2A5UA 3QWWA 2AVPA 3FFLA 4G11A 3LVRE 2J08A 5EX3A 2X38A 5LX8A 3ZFWA 2VSYA 4WNDA 5E76A 4F1SA 3PRZA 3D9NA 3D9PA 4FHKA 2BUGA 4GB9A 4LUNU 3LY8A 3FUJA 5EDSA 3VTXA 3PEUB 5KJNA 1OWPA 2CFZA 5KJMA 2RD0A 3KAEA 4ANWA 3ASDA 1SZAA 4UWFA 4DK5A 2AWIA 3SD5A 3SF4A 2LSVA 1QQEA 3SHFA 3D9KA 4HFGA 3MV3B 4QFVA 3OXLA 5AYWD 5EX0A 1HX8A 5AJLA 4JA7A 4UI9C 3GZ2A 5FWQA 4E6HA 3ZPJA 4GMJA 1DNPA 3JUIA 4XIFA 4C9BB 4AY6A 2P58C 3PNLB 4GYWA 4GZ3A 3PNTB 1PAQA 2UY1A 4M3OA 2VGXA 3L16A 5FT9A 4L23A 4WWPA 3ZN3A 4Y6CA 2A4ZA 2NSZA 3TGOA 5FZQA 3HHMA 4RG6A 4H7XA 1N52A 4XE0A 3CLJA 1Z3XA 4UQYA 2R17C 4EPZA 4GPKA 4EZLA 4XKBA 3FTZA 2WXFA 3IHVA 5T3RA 3LXUX 3JQ1A 4XZ4A 2PM7A 1QNFA 2DBAA 4MRUA 1H2TC 5M72A 1Y6IA 1KT1A 3UMVA 2WXKA 4GZCA 4ACKA 1FVHA 2RG8A 3VLFA 3ZIMA 3HVEA 2X3MA 1E8YA 1MQSA 3RRNB 3JQ0A 3G2UA 4U07A 2VSNA 3IKOB 4R7LA 4G25A 3AS5A 3FEXA 1KT0A 3MJWA 1HG5A 4LCTA 2FEZA 5G55A 3ZEFA 3FHEA 2J07A 3AU4A 1H0AA 4UQXA 5FQ4A 3FUMA 2FO7A 3ASFA 3ZW3A 4LERA 3PUKA 3FH5A 4IN3B 3L22A 2WXQA 3S7DA 1E90A 4GZ6A 2WMNA 3PREA 4KZCA 3LPZA 3R9AB 3G2VA 3MKQA 3MGBA 4AVXA 2XCCA 5JJ7A 2GRLA 2WXGA 2KATA 3RU0A 2X6FA 3APCA 4FADA 1H6KA 2L0TB 3SGHA 2OOEA 3CVNA 3SNXA 4N5CA 4JW1A 3JCKC 2YHEA 3SFZA 1ELRA 3FH8A 3MEKA 4O6FA 4CT0A 2UWJG 3I4RB 4J0UA 5KJKA 4I1MA 4J8FA 4MS6A 5A7DB 4DLQA 3ENEA 4KVOA 4N3CA 2JEKA 4J6IA 3RJVA 5FZSA 5ENNA 5ANLA 4I17A 3AS4A 2WXNA 3EIJA 2OVFA 3IV0A 3QDNA 4U04A 3GW4A 4P29A 4PH4B 3RO3A 4A1SA 4ANXA 4CEMA 3GZ1A 4BFRA 1HZ4A 1E96B 2WXHA 4KBQA 3ZGQA 2Y4TA 3CKCA 4I6GA 5E75A 3ONLA 2YNQA 5J08A 2LAHA 3FUDA 4PS8A 3ZYKA 4A1GA 2VQ2A 2CG2A 4AY5A 3O48A 2AXUA 1XGWA 2Q7FA 3MZLB 4C0MA 3D9IA 2PZIA 3FEYA 3Q5MA 2J4DA 2GRMA 4JEHA 3TG5A 3TXNA 4BX9A 4ANVA 5BV0A 5CMYA 2CHZA 4V3IA 4DI3A 4JHJA 4ME2A 4Y6WA 3NZUA 2VGYA 4I2WA 3RRUA 4UWGA 3CVVA 5G05C 4HOTA 4I9EA 1NA3A 5FJYA 4WNGA 2E2EA 3ZYLA 3AU5A 2CHWA 1HH8A 3B7RL 2PM6A 4IRUA 1HF8A 4L2LA 3RIBA 1JWGA 3DPDA 3TXMA 3ONKA 4RG9A 4RSYA 2ZU6B 2OV8A 2YINA 4J8EA 3QJZA 4I6JA 5DBKA 2IONA 4KMOA 3Q49B 4DPRA 1TJFA 1BPOA 2DCPA 3RK6A 2WXIA 2XQ0A 4UWKA 3LY7A 5T4YA 3LKUA 3U64A 4AM9A 1B89A 3L54A 3MX3A 3BG0B 4FC8A 2R5SA 5A6CA 1E7VA 3FUKA 3B13A 1E8ZA 3CK7A 3I5PA 3LEWA 4I6EA 1OUVA 3PS6A 5KJLA 5JJ6A 4APFA 3FU0A 1OWNA 2V4LA 2WXMA 4JA9A 5BT1A 3G2SA 5BW8C 4UI9J 4GU5A 3TJPA 5BUZA 4PS3A 2WXJA 4URKA 4AIFA 2ONDA 4J8SA 4ATGA 1W3BA 2L6JA 1VDYA 4N2SA 1L5JA 3PH0C 3PE3A 2XRYA 2YHCA 4FU3A 1EDUA 4GCNA 4F3VA 4B0ZA 2I1KA 4TV3A 3Q47B 2VTBA 4LEUA 2AXZA 2FF4A 2XHEA 4UWHA 5EKQD 1UJKA 3I3NA 4PS7A 5T8IA 3R7QA 5BNWA 3QAQA 3VLDA 2L9BA 5JJTA 3PZDA 3ZHEA 3TG4A 3C98A 2XPYA 2IU1A 4KXKB 3K9IA 5LCWC 3FY4A 4I2ZA 4WNFA 2KZTB 4K03A 4DJAA 4OVUA 1JPLA 2C2LA 2MRIA 4A3VA 3FTUA 3BEEA 3MV2B 4MLPA 3IHYA 5LCWJ 2LO6A 3ESLA 4EECA 2WVIA 3CK9A 3HDXA 3FUHA 3CQCB 1Y8MA 3PEVB 2XGOA 2X6KA 1LF8A 3T5VA 1FVFA 4ILHB 2I2OA 3L17A 4BY6A 1FCHA 1WAO1 4AP2A 3CKBA 2C0MA 3FP3A 2DIWA 4WAFA 1Z6TA 4GYOA 3SI5A 5A23A 1TEZA 4L1BA 3PUJA 4JPSA 2X6JA 2LAIA 3UT7A 2J4BA 4Q94A 2Y3AA 3KS2A 4CDMA 3CEQA 4CRWA 4G1TA 3S7JA 3ZXSA 4J8DA 2YQ8A 4A3TA 5C1DA 3MCXA 1UN9A 1ELWA 4WWOA 3LCAA 4KT6B 4ILGA 5FZRA 3UQ3A 4CDNA 3MA5A 3E4BA 3B7SA 2OVBA 3B7TA 1QZ2A 1S0PA 2LSUA 3GZSA 5FTPA 3RRMB 3ASHA 4I43A 3G2WA 1H2VC 1WY6A 3ULQA 2XRZA 3FTSA 4HOSA 5LFAA 3OAWA 2I6HA 2IQCA 2BTDA 3R7RA 2GW1A 3TL5A 4U63A 3SZ7A 3S7BA 3CV0A 4XI9A 1X5BA 1HO8A 2V5FA 4UWLA 3TAXA 3D9LA 3VTYA 3I4GA 3SBTB 3PDNA 3MYVA 4YVQC 2PL2A 3LJ3A 3QARA 4JZYA 1OWLA 3L13A 4BT9A 4N39A 3L6AA 2L0IA 1PY1A 4GA1A 5BV1A 2PQNA 3S2AA 4GA0A 4BWRA 3CHMA 2X6HA 3OTNA 4TUUA 2UY1B 4JXTA 1IQRA 2VGXB 4GZDA 4B89A 5ANRA 2VJ8A 4DLOA 2IF4A 1E7UA 2FBNA 4HXIA 3FUIA 5CMWA 2WPVA 2CFUA 3LDZA 5FQ8A 3LYAA 3FUFA 4JHRA 5G05J 1EPUA 3CHQA 2XCBA 4U8HA 3NZSA 2KC7A 3QK0A 4B8CB 1KLXA 4FJYA 3CGHA 4G26A 4GAAA 4EZJA 3G2TA 1DVPA 3FH7A 3NF1A 3NQPA 5D0OD 3HVEB 3U4TA 4ABNA 3Q15A 4I9CA 1IQUA 5HQ8A 4CCAA 4U0ZA 3OXGA 2NXPA 4CDRA 4EZKA 5KCMA 1PC2A 1UN8A 3CSFA 4FULA 3ZYQA 1EF1C 5DIZA 4FLBA 1UW4B 4RVBA 5AJDA 3CQGB 4UQZA 3D9MA 3S7FA 3CIAA 4FA6A 3UPVA 4F7AA 4BTAA 1SQMA 4HLEA 4HVBA 4GCOA 2IOLA 2WXOA 4UI9K 1U3DA 4HOUA 3ZVVA 3EHNA 2IFUA 2EQXA 3QOUA 2WXRA 1NP7A 4H7YA 4BSXA 3ESKA 3CHSA 1UG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FI7 A;  5G04 C;  1XNF A;  4I1A A;  3EDT B;  4BT8 A;  3WXX A;  5G04 J;  1YA0 A;  3QWP A;  5CCL A;  3RO2 A;  2JLB A;  2KCL A;  2KCV A;  4NRH B;  1TJC A;  3QKY A;  1ZU2 A;  3JYS A;  2MHK A;  3QWV A;  5D0Q D;  4XI0 A;  3N71 A;  5CCM A;  3Q4A B;  4GZ5 A;  4N3B A;  3LY9 A;  4G24 A;  3OXF A;  2HO1 A;  4CGW A;  3AS8 A;  1IHG A;  2LNI A;  3RKV A;  4JL0 A;  4U0U A;  4WUY A;  2WQH A;  2HR2 A;  3UUX A;  1IYG A;  4GYY A;  2VYI A;  1WM5 A;  5ARG A;  4YND A;  1A17 A;  2HYZ A;  1NZN A;  3CVL A;  2PQR A;  4APO A;  3MKR A;  2XPI A;  3CVQ A;  4EQF A;  3IEG A;  2XGS A;  4N3A A;  4B94 A;  1ZBP A;  2XEV A;  3HYM B;  3ASG A;  2J9Q A;  3GYZ A;  5CHE E;  3URZ A;  1NA0 A;  1P5Q A;  4HOR A;  4N2Q A;  4U0S A;  4CGV A;  4KYO B;  4NQ0 A;  3PE4 A;  2C0L A;  3U3W A;  2KCK A;  4G23 A;  2XGM A;  4WNE A;  5ARF A;  4YVO A;  1HXI A;  4G2V A;  3CK8 A;  2QFC A;  3KD7 A;  3CVP A;  4W9R A;  3FWV A;  4HOQ A;  5HI7 A;  2Y4U A;  2NC9 A;  4BTB A;  3ZHE B;  4GA2 A;  3QWW A;  2AVP A;  3FFL A;  5EX3 A;  3ZFW A;  2VSY A;  4WND A;  2BUG A;  3LY8 A;  3VTX A;  5KJN A;  5KJM A;  3KAE A;  3ASD A;  3SF4 A;  2LSV A;  1QQE A;  3MV3 B;  3OXL A;  5AYW D;  5EX0 A;  4JA7 A;  4UI9 C;  3GZ2 A;  3ZPJ A;  4XIF A;  4AY6 A;  2P58 C;  4GYW A;  4GZ3 A;  2UY1 A;  2VGX A;  5FT9 A;  3ZN3 A;  4Y6C A;  3TGO A;  5FZQ A;  4RG6 A;  4H7X A;  4UQY A;  4GPK A;  2DBA A;  5M72 A;  1KT1 A;  4U07 A;  2VSN A;  4G25 A;  3AS5 A;  1KT0 A;  2FEZ A;  4UQX A;  2FO7 A;  3ASF A;  4IN3 B;  3S7D A;  4GZ6 A;  3R9A B;  3LPZ A;  2XCC A;  5JJ7 A;  3RU0 A;  2KAT A;  2OOE A;  3CVN A;  4N5C A;  1ELR A;  3MEK A;  4O6F A;  5KJK A;  2UWJ G;  4J0U A;  4J8F A;  5A7D B;  4N3C A;  3RJV A;  5FZS A;  4I17 A;  3AS4 A;  3QDN A;  4U04 A;  3GW4 A;  3RO3 A;  4A1S A;  3GZ1 A;  1HZ4 A;  1E96 B;  4KBQ A;  3ZGQ A;  2Y4T A;  3CKC A;  2VQ2 A;  4AY5 A;  3O48 A;  2Q7F A;  2PZI A;  3Q5M A;  3TG5 A;  4ME2 A;  4Y6W A;  2VGY A;  4I2W A;  5G05 C;  4HOT A;  4I9E A;  1NA3 A;  5FJY A;  4WNG A;  2E2E A;  1HH8 A;  3RIB A;  4RG9 A;  4J8E A;  5DBK A;  3Q49 B;  4AM9 A;  3LY7 A;  3LKU A;  1B89 A;  5A6C A;  2R5S A;  3CK7 A;  1OUV A;  5KJL A;  5JJ6 A;  4JA9 A;  5BT1 A;  5BW8 C;  4UI9 J;  4AIF A;  2OND A;  1W3B A;  2L6J A;  4N2S A;  3PE3 A;  2YHC A;  4GCN A;  4F3V A;  3Q47 B;  4LEU A;  2FF4 A;  5EKQ D;  5BNW A;  5JJT A;  3ZHE A;  3TG4 A;  4KXK B;  3K9I A;  5LCW C;  4I2Z A;  4WNF A;  2C2L A;  5LCW J;  3BEE A;  3MV2 B;  3CK9 A;  1Y8M A;  2XGO A;  1FCH A;  1WAO 1;  3CKB A;  2C0M A;  3FP3 A;  4GYO A;  3KS2 A;  3CEQ A;  4G1T A;  3S7J A;  4J8D A;  2YQ8 A;  5C1D A;  1ELW A;  3LCA A;  3UQ3 A;  5FZR A;  3MA5 A;  3E4B A;  1QZ2 A;  2LSU A;  5FTP A;  3ASH A;  3ULQ A;  4HOS A;  2I6H A;  2GW1 A;  3SZ7 A;  3S7B A;  3CV0 A;  4XI9 A;  2V5F A;  3TAX A;  3VTY A;  3PDN A;  4YVQ C;  2PL2 A;  4BT9 A;  4N39 A;  4GA1 A;  2PQN A;  4GA0 A;  4BWR A;  2UY1 B;  2VGX B;  2IF4 A;  2FBN A;  2WPV A;  3LYA A;  4JHR A;  5G05 J;  2XCB A;  2KC7 A;  1KLX A;  4G26 A;  5D0O D;  3NF1 A;  3U4T A;  4ABN A;  3Q15 A;  4I9C A;  4U0Z A;  3OXG A;  4CDR A;  1PC2 A;  5DIZ A;  3S7F A;  4UQZ A;  3UPV A;  4BTA A;  4GCO A;  4UI9 K;  4HOU A;  2IFU A;  3QOU A;  4H7Y A;  3ESK A;  5HQ8 A; 
#chains in the Genus database with same CATH topology
 1E8W A;  2XEN A;  4JHK A;  2JAB A;  2WQ6 A;  5G04 C;  3V79 K;  4BT8 A;  3NOG D;  1Z5S C;  3WXX A;  1BI7 B;  2R2L A;  3RO2 A;  2JLB A;  4PUC A;  1OWO A;  1HFA A;  1OXJ A;  4XX5 A;  1TJC A;  4HRM B;  3JYS A;  1E8X A;  4XI0 A;  1IXV A;  3N71 A;  3CVY A;  2KM4 A;  3D9J A;  4G24 A;  3OXF A;  3KSQ A;  3FTX A;  4JL0 A;  1OCO E;  2WQH A;  1RW2 A;  2HR2 A;  4KZ0 A;  3CR3 A;  4EBA A;  2AW6 A;  2VYI A;  1SW6 A;  4BES A;  2WQ7 A;  4YND A;  3FU3 A;  2WM9 A;  1GW6 A;  1N4P A;  3D3M A;  1MX4 A;  3UI2 A;  4EQF A;  4CT4 A;  3W9F A;  4N3A A;  3FUE A;  4J7W A;  1ZBP A;  2XEV A;  1OWM A;  2J9Q A;  5CHE E;  5LOZ A;  5LP0 A;  4FLH A;  1JWF A;  4CGV A;  4AEZ C;  4KYO B;  4OVV A;  2V0P A;  2C0L A;  5ENR D;  5CER B;  2V4H C;  4J8Y A;  1N9A A;  1HXI A;  5C2Y A;  2A5E A;  2XEE A;  3CK8 A;  3KEZ A;  3CVX A;  2ZIS A;  3KD7 A;  4DX7 D;  3CHO A;  2VTB B;  2DZN A;  4IYP A;  2HM8 A;  5FQ6 A;  2Y4U A;  2NC9 A;  2WMO A;  3QB2 A;  1LD7 A;  5AQ9 A;  5CEA A;  3QWW A;  2AVP A;  3FFL A;  2J08 A;  5EX3 A;  2X38 A;  3ZFW A;  5JMN D;  4FHK A;  2BUG A;  2R03 A;  4GB9 A;  4LUN U;  4LNU D;  3PEU B;  1OWP A;  2CFZ A;  2RD0 A;  4U96 D;  1JCS A;  2EIM E;  1HX8 A;  3DSV A;  4JA7 A;  3PZ4 A;  4GMJ A;  1BD8 A;  2RKK A;  3ZKJ A;  3L82 A;  4U7E B;  3PNT B;  1PAQ A;  2UY1 A;  4GTV A;  4F1P A;  3L16 A;  4L23 A;  4WWP A;  2GRN B;  3HHM A;  4RG6 A;  1N52 A;  1Z3X A;  4UUC A;  4XKB A;  2GRP B;  1UOH A;  2PM7 A;  1QNF A;  2DBA A;  2XZD G;  4O1P A;  5EYL A;  2WXK A;  4GZC A;  3JXJ A;  1NFI E;  4ACK A;  1FVH A;  1MQS A;  4TXR A;  5ITZ F;  4LCT A;  2H6H A;  3ZEF A;  2J07 A;  3EUV A;  3C5R A;  4IN3 B;  2WMN A;  3R9A B;  3LPZ A;  5B3S E;  3Q79 A;  1H6K A;  3SGH A;  3JCK C;  5JA4 D;  1K1A A;  3DWL G;  2UWJ G;  3UM2 A;  4J8F A;  4MS6 A;  5A7D B;  3TWW A;  3AS4 A;  3V31 A;  4PH4 B;  3RO3 A;  4A1S A;  1TN8 A;  1HZ4 A;  3ZGQ A;  4RLY A;  5J08 A;  2EIL E;  4AY5 A;  3O48 A;  4JEH A;  3TG5 A;  4BX9 A;  1YMP A;  3CVV A;  5G05 C;  4I9E A;  3ZYL A;  4ZHB A;  2CHW A;  3ASN E;  4L2L A;  3RIB A;  3AG2 E;  2ZU6 B;  5DBK A;  4M7C A;  3Q49 B;  3LY7 A;  5T4Y A;  3AAA C;  3MX3 A;  4FC8 A;  3B13 A;  1E8Z A;  3CK7 A;  1JCR A;  2P9N G;  3V2O A;  3PS6 A;  4APF A;  4O1O A;  2V4L A;  2WXM A;  2ZIR A;  4JA9 A;  5BT1 A;  3G2S A;  4GU5 A;  2WXJ A;  3TWV A;  4J8S A;  3DPY A;  5B1B E;  3UM3 A;  4LNG A;  2YHC A;  4F3V A;  4B0Z A;  3E37 A;  2VTB A;  2AXZ A;  2XHE A;  5EKQ D;  1UJK A;  3VLD A;  2L9B A;  3AG1 E;  1KZO A;  4K5A B;  2BKK B;  4WNF A;  4K03 A;  4DJA A;  4GTO A;  3ESL A;  2WVI A;  2F0Y A;  2X6K A;  2LUH A;  5HRY A;  1WAO 1;  4AP2 A;  2C0M A;  3FP3 A;  4WAF A;  1Z6T A;  3PUJ A;  4JPS A;  3UT7 A;  1SA4 A;  2J4B A;  4Q94 A;  5CBN A;  4CDM A;  3CEQ A;  4CRW A;  4G1T A;  3ZXS A;  5C1D A;  1UN9 A;  4WWO A;  3UQ3 A;  5HS0 A;  1N4Q A;  3UM1 A;  1WY6 A;  5LFA A;  2BTD A;  3SZ7 A;  1HO8 A;  2V5F A;  2PL2 A;  3LJ3 A;  3QAR A;  1OWL A;  1AWC B;  3ABL E;  4N39 A;  1MX2 A;  5BV1 A;  3CHM A;  1E7U A;  2CFU A;  5FQ8 A;  1D8E A;  3LYA A;  5G05 J;  2XCB A;  5H7P A;  2Y0B G;  3QK0 A;  4B8C B;  4HRN A;  4EZJ A;  4GAA A;  3ZXP A;  5D0O D;  3FH7 A;  3NF1 A;  3HVE B;  1D9S A;  1FT1 A;  4I9C A;  4ABN A;  1WG0 A;  4U0Z A;  3OXG A;  1PC2 A;  1UN8 A;  2XS1 A;  3DXK G;  3CSF A;  4FUL A;  3S7F A;  4F7A A;  2IOL A;  5D66 A;  2IFU A;  1NP7 A;  1UG3 A;  4JC8 A;  5IY5 E;  3MKQ B;  3T9K A;  1XNF A;  4BX8 A;  3CVW A;  4F53 A;  4BET A;  2AXV A;  2P9L G;  3UT4 A;  1O1S A;  4HLL A;  2KCL A;  3HXF A;  5G2N A;  3ZU7 B;  2KCV A;  1JUQ A;  2R59 A;  3O4Z A;  1EYH A;  5CRU A;  1TYQ G;  3FTW A;  2MHK A;  2QY7 A;  4OYS A;  2VSO E;  2RFM A;  2M63 A;  4L7T A;  3Q4A B;  4Q69 A;  4N3B A;  3LY9 A;  1YCS B;  4AXH A;  3ML8 A;  4CGW A;  3FDH A;  1NI1 A;  3APD A;  3CHR A;  2LNI A;  3Q7F A;  3RKV A;  2EIN E;  4WUY A;  3TWS A;  2J09 A;  3LVQ E;  4TRQ A;  3EHM A;  3R9M A;  1WM5 A;  3PZ3 A;  2I9C A;  5KNH D;  2HYZ A;  3CVL A;  2XPZ A;  4I1O B;  2XPI A;  3CVQ A;  4ILI A;  2XGS A;  4NAC A;  1Z3Y A;  5AEN A;  3ASG A;  4QQI A;  3FU6 A;  3CVU A;  1TNO A;  1INZ A;  4AV7 A;  4HOR A;  4U0S A;  4ACL A;  5BXU A;  4NQ0 A;  3TWT A;  3HG0 D;  2PNN A;  1YYH A;  4C48 B;  1QBQ A;  3ZYM A;  1BI8 B;  4WNE A;  5AIJ A;  2WB2 A;  4JVS A;  1ELK A;  2WXP A;  2QFC A;  4HI9 A;  4W9R A;  3FWV A;  5HI7 A;  4BTB A;  5AQ7 A;  3ZHE B;  4GA2 A;  5KWD A;  2A5U A;  3HXB A;  4G11 A;  3LVR E;  5CEC B;  5LX8 A;  1X81 A;  2VSY A;  3ULE G;  3PRZ A;  3D9P A;  5EDS A;  3VTX A;  4ANW A;  1SZA A;  4UWF A;  1TNU A;  2AWI A;  2LSV A;  3SHF A;  1LTX A;  4HFG A;  4QFV A;  5ENS D;  4UI9 C;  5FWQ A;  4E6H A;  3ZPJ A;  1DNP A;  4C9B B;  4AY6 A;  2P58 C;  4GYW A;  4GZ3 A;  4M3O A;  5FT9 A;  4Y6C A;  5EN5 D;  5FZQ A;  4XE0 A;  2R17 C;  4EPZ A;  2WXF A;  5T3R A;  3UXG A;  3JUE A;  1DC2 A;  1Y6I A;  1KT1 A;  2P9K G;  3UMV A;  2RG8 A;  3ZNG A;  2DWZ A;  3HVE A;  3JQ0 A;  4U07 A;  2VSN A;  1H6O A;  2F8Y A;  1HG5 A;  5G55 A;  1RZ4 A;  3FHE A;  2F8X K;  3ZW3 A;  3PUK A;  1TNB A;  3MKQ A;  4AVX A;  2GRL A;  2WXG A;  3CVN A;  2YHE A;  1ELR A;  3MEK A;  4GTT A;  4CT0 A;  2DYR E;  2JEK A;  3RJV A;  3DRA A;  5FZS A;  5EYP F;  4U04 A;  3GW4 A;  4P29 A;  4GTQ A;  4CEM A;  1E96 B;  1BU9 A;  2Y4T A;  2VGE A;  3FUD A;  4PS8 A;  2KXP C;  3ZYK A;  2AXU A;  5AQA A;  4C0M A;  3D9I A;  2P9S G;  2PZI A;  3FEY A;  4ANV A;  2IY0 C;  2CHZ A;  4I2W A;  4UWG A;  2DVW A;  4HOT A;  3AU5 A;  4GMR A;  2XZT G;  5D2M C;  4RSY A;  3NAW A;  1TJF A;  1BPO A;  3RK6 A;  2XQ0 A;  1K3Z D;  2GRO B;  1B89 A;  5A6C A;  2R5S A;  1E7V A;  2P2C P;  3B7B A;  5EIL A;  3RSE G;  3HRA A;  4UI9 J;  2OND A;  4HBD A;  4HNA D;  1N94 A;  5HKP A;  4B93 B;  5ENP D;  3PE3 A;  5CRV A;  1EDU A;  2FF4 A;  4GPM A;  3SO8 A;  3ZHE A;  2IU1 A;  1ZB1 A;  2KZT B;  2C2L A;  4CYM D;  4A3V A;  5LCW J;  3MV2 B;  3C72 A;  4EEC A;  4JD2 G;  3E34 A;  3CQC B;  1Y8M A;  3T5V A;  1DCE A;  3L17 A;  4BY6 A;  1FCH A;  3SI5 A;  4GTS A;  5A23 A;  4L1B A;  2X6J A;  3ISM C;  4U95 D;  3KS2 A;  3EHQ A;  4LSZ E;  4J8D A;  2YQ8 A;  4A3T A;  1ELW A;  3LCA A;  4ILG A;  5FZR A;  2L6B A;  3MA5 A;  3B7S A;  3B7T A;  4OAU C;  2LSU A;  3ZUV B;  2IEJ A;  4I43 A;  3ULQ A;  3FTS A;  2GW1 A;  3TL5 A;  1FT2 A;  3S7B A;  4XI9 A;  5BXO A;  4UWL A;  3D9L A;  3SBT B;  3PDN A;  3L13 A;  3L6A A;  2L0I A;  5EIB E;  2PQN A;  4BWR A;  4U8V D;  4JXT A;  2VGX B;  4DLO A;  2FBN A;  4HXI A;  3AG4 E;  3LDZ A;  1MZC A;  1EPU A;  4U8H A;  3NZS A;  4TXP A;  2ETA A;  4G26 A;  3UIN C;  3U4T A;  3Q15 A;  4EZK A;  5KCM A;  1UW4 B;  5AJD A;  1O1T A;  4BSZ B;  3UPV A;  1SQM A;  2WXO A;  4UI9 K;  1U3D A;  3AG3 E;  4Z68 A;  2EQX A;  3ESK A;  1S64 A;  1N54 A;  1HU3 A;  1A5E A;  1TR4 A;  2ZGD A;  4L2Y A;  3UX4 A;  3APF A;  4C0E A;  1MHQ A;  3LS8 A;  1YA0 A;  3QWP A;  5CCL A;  1TNZ A;  4AOF A;  3U9W A;  4NRH B;  3QKY A;  4ATZ D;  4ANU A;  1ZU2 A;  2ILR A;  3QWV A;  5CBO A;  2HO1 A;  3L08 A;  4GTM A;  3SBS A;  1FPP A;  1N4R A;  2X6I A;  1IKN D;  2WXL A;  4EBA G;  3PVL A;  3CHP A;  2QYU A;  3QC1 A;  3DSX A;  4E85 A;  4F6R D;  1HG2 A;  2GGF A;  2QC9 A;  2XEH A;  5ARG A;  1U3C A;  1A17 A;  2H6G A;  4FHJ A;  3DBS A;  3AJI A;  3IEG A;  3T8M A;  3T5X A;  3HYM B;  3GYZ A;  3IBE A;  4GML A;  3URZ A;  3Q9N C;  3ZRH A;  5KBA A;  4FP7 A;  2KZT A;  4D10 C;  3D9O A;  2ZXW E;  3PE4 A;  1UJJ A;  3UKR G;  2KBX A;  3KEA A;  4NUR A;  3EIQ C;  3FTY A;  5ARF A;  2BF0 X;  4G2V A;  2FUL A;  3CVP A;  4HOQ A;  1H6P A;  1N4S A;  3EJN A;  3U66 A;  5J90 A;  2J8S D;  3C3R A;  3V2X A;  4WND A;  5E76 A;  3D9N A;  4NIK A;  3FUJ A;  5KJN A;  5KJM A;  3KAE A;  4DK5 A;  3SF4 A;  1OY3 D;  1QQE A;  2EIK E;  3OXL A;  5AYW D;  5EX0 A;  2Y69 E;  2H6F A;  3ULY A;  3GZ2 A;  5ENO D;  3PNL B;  4ZFH A;  2VGX A;  3ZN3 A;  2AJA A;  2NSZ A;  3TGO A;  2QYJ A;  3FTZ A;  4K5B A;  3C3Q A;  3IHV A;  4YDW A;  4HI8 A;  1H2T C;  5M72 A;  3PZ2 A;  3ZIM A;  1N95 A;  2X3M A;  1E8Y A;  3RRN B;  1SA5 A;  3FEX A;  3E33 A;  2FEZ A;  4UQX A;  5FQ4 A;  2FO7 A;  3FH5 A;  3L22 A;  3S7D A;  4GZ6 A;  4KZC A;  3G2V A;  3IXE A;  5JJ7 A;  3RU0 A;  2X6F A;  3APC A;  2L0T B;  1TN7 A;  4JW1 A;  2ETC A;  3SFZ A;  4O6F A;  1Q2Z A;  3ENE A;  4J6I A;  4X8Q A;  2WXN A;  3EIJ A;  2OVF A;  3IV0 A;  3KSL A;  3QDN A;  3GZ1 A;  4BFR A;  4KBQ A;  3CKC A;  1S63 A;  3ONL A;  4A1G A;  3JXI A;  1XGW A;  3MZL B;  3EU9 A;  2QZA A;  3Q5M A;  2GRM A;  5CMY A;  1AP7 A;  4V3I A;  4Y6W A;  3LJN A;  4CZ2 D;  3NZU A;  2VGY A;  1V54 E;  4WNG A;  3Q75 A;  1QYM A;  1HH8 A;  3J5Q B;  2IO2 C;  4IRU A;  2BED A;  1JWG A;  4HQD A;  4RG9 A;  3DEO A;  2OV8 A;  2YIN A;  4J8E A;  4I6J A;  4KMO A;  4DPR A;  2DCP A;  4UWK A;  4AM9 A;  3LKU A;  3U64 A;  4YDE A;  3L54 A;  3BG0 B;  1N0R A;  2GRR B;  4XEI G;  3LEW A;  4I6E A;  3DEP A;  5JJ6 A;  2H6I A;  3FU0 A;  5BUZ A;  5BW8 C;  3TJP A;  4PS3 A;  1S70 B;  1NL4 A;  1VDY A;  4N2S A;  1L5J A;  5ENT D;  3PH0 C;  2XRY A;  4FU3 A;  4GCN A;  4TV3 A;  4UWH A;  4G8K A;  1U2V G;  5JJT A;  3PZD A;  3TG4 A;  3C98 A;  4OAV B;  3K9I A;  5LCW C;  3FY4 A;  4I2Z A;  4OVU A;  2P9U G;  2MRI A;  3FTU A;  1WDY A;  5FIO A;  2LO6 A;  2XGO A;  1LF8 A;  3DST A;  1FVF A;  2DIW A;  4GYO A;  1TEZ A;  2ZGG A;  2LAI A;  5AAO A;  2Y3A A;  1LD8 A;  3ASO E;  3BQO A;  2R05 A;  4KT6 B;  3TWQ A;  3E4B A;  5EID A;  2OVB A;  5B1A E;  1N0Q A;  3GZS A;  5FTP A;  3RRM B;  3ASH A;  3EHR A;  4HOS A;  4O60 A;  3OAW A;  2IQC A;  2OCC E;  4RQI A;  3R7R A;  3CV0 A;  3TAX A;  4JZY A;  4BT9 A;  3Q73 A;  1PY1 A;  3S2A A;  2X6H A;  4TUU A;  1IQR A;  4GZD A;  1D8D A;  5ANR A;  2IF4 A;  3FUF A;  4JHR A;  3DSU A;  4U8Y D;  2BKG A;  1KZP A;  1KLX A;  4FJY A;  3NQP A;  1DVP A;  3EU5 A;  1IQU A;  4TUM A;  4CDR A;  2Y1L E;  5DIZ A;  4FLB A;  4RVB A;  4UQZ A;  3CIA A;  3TWU A;  4BTA A;  3EHN A;  3QOU A;  4BSX A;  3FU5 A;  3CHS A;  5HQ8 A;  2R02 A;  2FI7 A;  4LNB A;  3HIZ A;  3EDT B;  4FJZ A;  4I1A A;  3BU8 A;  2MOW A;  5G04 J;  1HE8 A;  1OCR E;  3C3O A;  3W9G A;  1H2U A;  4KVM A;  3SQV A;  3FUN A;  4MKT A;  3Q9U C;  5D0Q D;  3TWR A;  4Q96 A;  1TN6 A;  5CCM A;  2RFA A;  4GZ5 A;  5FQ7 A;  2J49 A;  3P1U A;  3VLE A;  4IUL A;  2IJG X;  3AS8 A;  4DI4 A;  1IHG A;  4JEU A;  1H19 A;  4U0U A;  3FTV A;  2I1J A;  2LXM A;  3UUX A;  4AJW A;  2B6C A;  1IYG A;  4GYY A;  2ETB A;  4XKC A;  2IOS A;  3FUL A;  5AAR A;  3HXE A;  3E32 A;  2VSX E;  4PDX A;  1NZN A;  4DRX E;  4APO A;  2PQR A;  3CST A;  3MKR A;  3UT8 A;  4B94 A;  5BPP A;  2DYS E;  1SZ9 A;  4HS2 A;  2V8S E;  5JHA A;  1NA0 A;  1P5Q A;  3NOC D;  4N2Q A;  4K0R A;  1MJ0 A;  1TNY A;  3B7U X;  1O1R A;  2OEW A;  4A55 A;  4YDY A;  4LRZ A;  3X2Q E;  3U3W A;  2KCK A;  3QNK A;  1HS6 A;  4G23 A;  5KNG A;  3ML9 A;  2XGM A;  1JCQ A;  3ABK E;  2E0I A;  4YVO A;  2CHX A;  2CG3 A;  4B8A A;  3P2B A;  5FIN A;  2FO1 E;  5JHB A;  3BG1 B;  4WWN A;  4G8L A;  2XS8 A;  4HRL A;  4F1S A;  4GTP A;  4BEP A;  3LY8 A;  3WG7 E;  3DSS A;  3ASD A;  3SD5 A;  3RAU A;  3D9K A;  3MV3 B;  5AJL A;  3UM0 A;  3JUI A;  4XIF A;  3NBN B;  1N11 A;  2A4Z A;  1OCC E;  4DX5 D;  4H7X A;  3CLJ A;  2HE0 A;  4UQY A;  3D9H A;  3ABM E;  3SY2 A;  4GPK A;  4EZL A;  4BER A;  3NB2 A;  3J5P A;  3LXU X;  3JQ1 A;  4XZ4 A;  1K1B A;  4MRU A;  3Q78 A;  4DX1 A;  3VLF A;  3G2U A;  3IKO B;  4R7L A;  4G25 A;  3AS5 A;  1KT0 A;  4K5C A;  2P9P G;  3MJW A;  3AU4 A;  1H0A A;  3FUM A;  3ASF A;  4LER A;  2WXQ A;  1SVX A;  1E90 A;  2LXL A;  3PRE A;  4GTR A;  2F37 A;  3MGB A;  4JB8 P;  2XCC A;  2KAT A;  4FAD A;  2OOE A;  3UTM A;  4DX6 D;  3SNX A;  4N5C A;  1DCQ A;  3FH8 A;  5KJK A;  4J0U A;  3I4R B;  4I1M A;  4DLQ A;  4KVO A;  4N3C A;  3DSW A;  5ENN A;  5ANL A;  4I17 A;  4DX2 A;  4ANX A;  2GRQ B;  3B95 A;  2WXH A;  1MYO A;  4I6G A;  5E75 A;  4EHM A;  2YNQ A;  2LAH A;  2VQ2 A;  2CG2 A;  2Q7F A;  2P9I G;  3TXN A;  3F6Q A;  2J4D A;  5BV0 A;  4DI3 A;  4JHJ A;  4ME2 A;  3RRU A;  4L9P A;  1NA3 A;  5FJY A;  2E2E A;  1OT8 A;  3B7R L;  2PM6 A;  1HF8 A;  3DPD A;  3TXM A;  3ONK A;  3QJZ A;  2ION A;  2WXI A;  1BLX B;  5ENQ D;  5CED B;  3FUK A;  2DZO A;  3I5P A;  1OUV A;  5KJL A;  3V30 A;  1OWN A;  2OEV A;  3HXC A;  3DXM G;  4URK A;  4AIF A;  4ATG A;  1W3B A;  3UKU G;  1K8K G;  2L6J A;  3UIP C;  3E30 A;  2I1K A;  2IO3 C;  3Q7A A;  3Q47 B;  4LEU A;  4TXQ A;  3I3N A;  4PS7 A;  4YDO A;  5T8I A;  3R7Q A;  5BNW A;  1V55 E;  3QAQ A;  3BUA A;  2B0O E;  2XPY A;  4KXK B;  1KPS B;  2NYJ A;  1JPL A;  3BEE A;  4MLP A;  3IHY A;  3CK9 A;  3HDX A;  3FUH A;  3PEV B;  4ILH B;  2I2O A;  3CKB A;  5AQB A;  3S7J A;  2MYO A;  3MCX A;  3TWX A;  4CDN A;  3SFY A;  1QZ2 A;  1S0P A;  3SFX A;  3HXD A;  1IHB A;  3G2W A;  1H2V C;  2XRZ A;  2I6H A;  2V5Q C;  4U63 A;  4MBG A;  4HB5 A;  3UIO C;  1X5B A;  1O5M A;  3VTY A;  3I4G A;  4YVQ C;  3MYV A;  1G3N B;  4LG6 A;  4GA1 A;  4GA0 A;  3OTN A;  2UY1 B;  4B89 A;  2VJ8 A;  1MX6 A;  3FUI A;  5CMW A;  2WPV A;  4A63 B;  3T8K A;  3L9T A;  1OCZ E;  3CHQ A;  2KC7 A;  2EIJ E;  4N5Q A;  3CGH A;  3G2T A;  5AN8 A;  4CCA A;  2NXP A;  3ZYQ A;  1EF1 C;  3CQG B;  3D9M A;  4FA6 A;  4HLE A;  4HVB A;  4GCO A;  4HOU A;  3ZVV A;  3PZ1 A;  4H7Y A;  2WXR A;  4DUI A; 
#chains in the Genus database with same CATH homology
 1N54 A;  4JC8 A;  1E8W A;  4JHK A;  2FI7 A;  3MKQ B;  2WQ6 A;  1HU3 A;  5G04 C;  1XNF A;  4L2Y A;  3HIZ A;  3EDT B;  4FJZ A;  4I1A A;  3UX4 A;  3APF A;  4BT8 A;  4BX8 A;  3CVW A;  4C0E A;  1MHQ A;  3WXX A;  3LS8 A;  4F53 A;  2MOW A;  5G04 J;  1YA0 A;  1HE8 A;  3QWP A;  5CCL A;  2AXV A;  3RO2 A;  3UT4 A;  4AOF A;  2JLB A;  2KCL A;  4PUC A;  3U9W A;  1OWO A;  1H2U A;  1HFA A;  5G2N A;  4KVM A;  2KCV A;  1JUQ A;  2R59 A;  3FUN A;  4XX5 A;  3O4Z A;  4NRH B;  1EYH A;  1TJC A;  3QKY A;  4MKT A;  4ANU A;  1ZU2 A;  3JYS A;  3FU5 A;  3FTW A;  2MHK A;  1E8X A;  2ILR A;  2QY7 A;  3QWV A;  4OYS A;  2VSO E;  5D0Q D;  4XI0 A;  4Q96 A;  3N71 A;  2M63 A;  3CVY A;  4L7T A;  5CCM A;  3Q4A B;  4GZ5 A;  4N3B A;  3LY9 A;  5FQ7 A;  4Q69 A;  2KM4 A;  3D9J A;  4G24 A;  3OXF A;  2J49 A;  4AXH A;  3P1U A;  3VLE A;  3ML8 A;  2HO1 A;  3L08 A;  3FTX A;  4IUL A;  2IJG X;  3AS8 A;  4CGW A;  4DI4 A;  1IHG A;  3FDH A;  4JEU A;  3SBS A;  3APD A;  2X6I A;  2LNI A;  3CHR A;  3RKV A;  4JL0 A;  1H19 A;  4U0U A;  2WXL A;  4EBA G;  3PVL A;  3FTV A;  4WUY A;  2WQH A;  2I1J A;  2J09 A;  3LVQ E;  3CHP A;  2HR2 A;  4KZ0 A;  3CR3 A;  3QC1 A;  3UUX A;  4AJW A;  1IYG A;  4GYY A;  4TRQ A;  4XKC A;  4E85 A;  3EHM A;  4EBA A;  2AW6 A;  2VYI A;  1HG2 A;  2IOS A;  2WQ7 A;  3FUL A;  1WM5 A;  2GGF A;  5ARG A;  1U3C A;  2I9C A;  3FU3 A;  4YND A;  2WM9 A;  1GW6 A;  2VSX E;  4PDX A;  1A17 A;  2HYZ A;  1NZN A;  3D3M A;  3CVL A;  2PQR A;  3CST A;  3MKR A;  4APO A;  2XPZ A;  4I1O B;  4FHJ A;  2XPI A;  3CVQ A;  3DBS A;  4EQF A;  4CT4 A;  3IEG A;  4ILI A;  2XGS A;  3T8M A;  3UT8 A;  4N3A A;  3T5X A;  4B94 A;  3FUE A;  1Z3Y A;  4NAC A;  5AEN A;  1ZBP A;  2XEV A;  3HYM B;  1OWM A;  3ASG A;  5BPP A;  2J9Q A;  1SZ9 A;  3FU6 A;  3GYZ A;  2V8S E;  3IBE A;  4HS2 A;  4GML A;  3CVU A;  5CHE E;  5LOZ A;  5LP0 A;  3URZ A;  4FLH A;  3ZRH A;  1INZ A;  5JHA A;  1NA0 A;  1P5Q A;  4AV7 A;  1JWF A;  4HOR A;  4N2Q A;  4U0S A;  4CGV A;  4FP7 A;  4ACL A;  4AEZ C;  2KZT A;  4K0R A;  4D10 C;  4KYO B;  3D9O A;  4OVV A;  4NQ0 A;  2V0P A;  3B7U X;  3PE4 A;  1UJJ A;  2C0L A;  4A55 A;  4LRZ A;  3U3W A;  2KCK A;  3QNK A;  1HS6 A;  4G23 A;  4NUR A;  3ZYM A;  3ML9 A;  2XGM A;  4WNE A;  5AIJ A;  3EIQ C;  2WB2 A;  3FTY A;  5ARF A;  2E0I A;  4YVO A;  2CHX A;  1HXI A;  2BF0 X;  4G2V A;  4JVS A;  1ELK A;  5C2Y A;  2CG3 A;  2FUL A;  4B8A A;  3CVX A;  2WXP A;  2QFC A;  3CK8 A;  3KEZ A;  3KD7 A;  3P2B A;  3CHO A;  2VTB B;  3CVP A;  4W9R A;  3FWV A;  4HOQ A;  4IYP A;  2HM8 A;  5HI7 A;  5FQ6 A;  2Y4U A;  5JHB A;  2NC9 A;  2WMO A;  3BG1 B;  3QB2 A;  4BTB A;  3EJN A;  4WWN A;  3U66 A;  3ZHE B;  4GA2 A;  5J90 A;  2A5U A;  3QWW A;  2AVP A;  3FFL A;  4G11 A;  3LVR E;  2J08 A;  5EX3 A;  2X38 A;  5LX8 A;  3ZFW A;  2VSY A;  4WND A;  5E76 A;  4F1S A;  3PRZ A;  3D9N A;  3D9P A;  4FHK A;  2BUG A;  4GB9 A;  4LUN U;  3LY8 A;  3FUJ A;  5EDS A;  3VTX A;  3PEU B;  5KJN A;  1OWP A;  2CFZ A;  5KJM A;  2RD0 A;  3KAE A;  4ANW A;  3ASD A;  1SZA A;  4UWF A;  4DK5 A;  2AWI A;  3SD5 A;  3SF4 A;  2LSV A;  1QQE A;  3SHF A;  3D9K A;  4HFG A;  3MV3 B;  4QFV A;  3OXL A;  5AYW D;  5EX0 A;  1HX8 A;  5AJL A;  4JA7 A;  4UI9 C;  3GZ2 A;  5FWQ A;  4E6H A;  3ZPJ A;  4GMJ A;  1DNP A;  3JUI A;  4XIF A;  4C9B B;  4AY6 A;  2P58 C;  3PNL B;  4GYW A;  4GZ3 A;  3PNT B;  1PAQ A;  2UY1 A;  4M3O A;  2VGX A;  3L16 A;  5FT9 A;  4L23 A;  4WWP A;  3ZN3 A;  4Y6C A;  2A4Z A;  2NSZ A;  3TGO A;  5FZQ A;  3HHM A;  4RG6 A;  4H7X A;  1N52 A;  4XE0 A;  3CLJ A;  1Z3X A;  4UQY A;  2R17 C;  4EPZ A;  4GPK A;  4EZL A;  4XKB A;  3FTZ A;  2WXF A;  3IHV A;  5T3R A;  3LXU X;  3JQ1 A;  4XZ4 A;  2PM7 A;  1QNF A;  2DBA A;  4MRU A;  1H2T C;  5M72 A;  1Y6I A;  1KT1 A;  3UMV A;  2WXK A;  4GZC A;  4ACK A;  1FVH A;  2RG8 A;  3VLF A;  3ZIM A;  3HVE A;  2X3M A;  1E8Y A;  1MQS A;  3RRN B;  3JQ0 A;  3G2U A;  4U07 A;  2VSN A;  3IKO B;  4R7L A;  4G25 A;  3AS5 A;  3FEX A;  1KT0 A;  3MJW A;  1HG5 A;  4LCT A;  2FEZ A;  5G55 A;  3ZEF A;  3FHE A;  2J07 A;  3AU4 A;  1H0A A;  4UQX A;  5FQ4 A;  3FUM A;  2FO7 A;  3ASF A;  3ZW3 A;  4LER A;  3PUK A;  3FH5 A;  4IN3 B;  3L22 A;  2WXQ A;  3S7D A;  1E90 A;  4GZ6 A;  2WMN A;  3PRE A;  4KZC A;  3LPZ A;  3R9A B;  3G2V A;  3MKQ A;  3MGB A;  4AVX A;  2XCC A;  5JJ7 A;  2GRL A;  2WXG A;  2KAT A;  3RU0 A;  2X6F A;  3APC A;  4FAD A;  1H6K A;  2L0T B;  3SGH A;  2OOE A;  3CVN A;  3SNX A;  4N5C A;  4JW1 A;  3JCK C;  2YHE A;  3SFZ A;  1ELR A;  3FH8 A;  3MEK A;  4O6F A;  4CT0 A;  2UWJ G;  3I4R B;  4J0U A;  5KJK A;  4I1M A;  4J8F A;  4MS6 A;  5A7D B;  4DLQ A;  3ENE A;  4KVO A;  4N3C A;  2JEK A;  4J6I A;  3RJV A;  5FZS A;  5ENN A;  5ANL A;  4I17 A;  3AS4 A;  2WXN A;  3EIJ A;  2OVF A;  3IV0 A;  3QDN A;  4U04 A;  3GW4 A;  4P29 A;  4PH4 B;  3RO3 A;  4A1S A;  4ANX A;  4CEM A;  3GZ1 A;  4BFR A;  1HZ4 A;  1E96 B;  2WXH A;  4KBQ A;  3ZGQ A;  2Y4T A;  3CKC A;  4I6G A;  5E75 A;  3ONL A;  2YNQ A;  5J08 A;  2LAH A;  3FUD A;  4PS8 A;  3ZYK A;  4A1G A;  2VQ2 A;  2CG2 A;  4AY5 A;  3O48 A;  2AXU A;  1XGW A;  2Q7F A;  3MZL B;  4C0M A;  3D9I A;  2PZI A;  3FEY A;  3Q5M A;  2J4D A;  2GRM A;  4JEH A;  3TG5 A;  3TXN A;  4BX9 A;  4ANV A;  5BV0 A;  5CMY A;  2CHZ A;  4V3I A;  4DI3 A;  4JHJ A;  4ME2 A;  4Y6W A;  3NZU A;  2VGY A;  4I2W A;  3RRU A;  4UWG A;  3CVV A;  5G05 C;  4HOT A;  4I9E A;  1NA3 A;  5FJY A;  4WNG A;  2E2E A;  3ZYL A;  3AU5 A;  2CHW A;  1HH8 A;  3B7R L;  2PM6 A;  4IRU A;  1HF8 A;  4L2L A;  3RIB A;  1JWG A;  3DPD A;  3TXM A;  3ONK A;  4RG9 A;  4RSY A;  2ZU6 B;  2OV8 A;  2YIN A;  4J8E A;  3QJZ A;  4I6J A;  5DBK A;  2ION A;  4KMO A;  3Q49 B;  4DPR A;  1TJF A;  1BPO A;  2DCP A;  3RK6 A;  2WXI A;  2XQ0 A;  4UWK A;  3LY7 A;  5T4Y A;  3LKU A;  3U64 A;  4AM9 A;  1B89 A;  3L54 A;  3MX3 A;  3BG0 B;  4FC8 A;  2R5S A;  5A6C A;  1E7V A;  3FUK A;  3B13 A;  1E8Z A;  3CK7 A;  3I5P A;  3LEW A;  4I6E A;  1OUV A;  3PS6 A;  5KJL A;  5JJ6 A;  4APF A;  3FU0 A;  1OWN A;  2V4L A;  2WXM A;  4JA9 A;  5BT1 A;  3G2S A;  5BW8 C;  4UI9 J;  4GU5 A;  3TJP A;  5BUZ A;  4PS3 A;  2WXJ A;  4URK A;  4AIF A;  2OND A;  4J8S A;  4ATG A;  1W3B A;  2L6J A;  1VDY A;  4N2S A;  1L5J A;  3PH0 C;  3PE3 A;  2XRY A;  2YHC A;  4FU3 A;  1EDU A;  4GCN A;  4F3V A;  4B0Z A;  2I1K A;  4TV3 A;  3Q47 B;  2VTB A;  4LEU A;  2AXZ A;  2FF4 A;  2XHE A;  4UWH A;  5EKQ D;  1UJK A;  3I3N A;  4PS7 A;  5T8I A;  3R7Q A;  5BNW A;  3QAQ A;  3VLD A;  2L9B A;  5JJT A;  3PZD A;  3ZHE A;  3TG4 A;  3C98 A;  2XPY A;  2IU1 A;  4KXK B;  3K9I A;  5LCW C;  3FY4 A;  4I2Z A;  4WNF A;  2KZT B;  4K03 A;  4DJA A;  4OVU A;  1JPL A;  2C2L A;  2MRI A;  4A3V A;  3FTU A;  3BEE A;  3MV2 B;  4MLP A;  3IHY A;  5LCW J;  2LO6 A;  3ESL A;  4EEC A;  2WVI A;  3CK9 A;  3HDX A;  3FUH A;  3CQC B;  1Y8M A;  3PEV B;  2XGO A;  2X6K A;  1LF8 A;  3T5V A;  1FVF A;  4ILH B;  2I2O A;  3L17 A;  4BY6 A;  1FCH A;  1WAO 1;  4AP2 A;  3CKB A;  2C0M A;  3FP3 A;  2DIW A;  4WAF A;  1Z6T A;  4GYO A;  3SI5 A;  5A23 A;  1TEZ A;  4L1B A;  3PUJ A;  4JPS A;  2X6J A;  2LAI A;  3UT7 A;  2J4B A;  4Q94 A;  2Y3A A;  3KS2 A;  4CDM A;  3CEQ A;  4CRW A;  4G1T A;  3S7J A;  3ZXS A;  4J8D A;  2YQ8 A;  4A3T A;  5C1D A;  3MCX A;  1UN9 A;  1ELW A;  4WWO A;  3LCA A;  4KT6 B;  4ILG A;  5FZR A;  3UQ3 A;  4CDN A;  3MA5 A;  3E4B A;  3B7S A;  2OVB A;  3B7T A;  1QZ2 A;  1S0P A;  2LSU A;  3GZS A;  5FTP A;  3RRM B;  3ASH A;  4I43 A;  3G2W A;  1H2V C;  1WY6 A;  3ULQ A;  2XRZ A;  3FTS A;  4HOS A;  5LFA A;  3OAW A;  2I6H A;  2IQC A;  2BTD A;  3R7R A;  2GW1 A;  3TL5 A;  4U63 A;  3SZ7 A;  3S7B A;  3CV0 A;  4XI9 A;  1X5B A;  1HO8 A;  2V5F A;  4UWL A;  3TAX A;  3D9L A;  3VTY A;  3I4G A;  3SBT B;  3PDN A;  3MYV A;  4YVQ C;  2PL2 A;  3LJ3 A;  3QAR A;  4JZY A;  1OWL A;  3L13 A;  4BT9 A;  4N39 A;  3L6A A;  2L0I A;  1PY1 A;  4GA1 A;  5BV1 A;  2PQN A;  3S2A A;  4GA0 A;  4BWR A;  3CHM A;  2X6H A;  3OTN A;  4TUU A;  2UY1 B;  4JXT A;  1IQR A;  2VGX B;  4GZD A;  4B89 A;  5ANR A;  2VJ8 A;  4DLO A;  2IF4 A;  1E7U A;  2FBN A;  4HXI A;  3FUI A;  5CMW A;  2WPV A;  2CFU A;  3LDZ A;  5FQ8 A;  3LYA A;  3FUF A;  4JHR A;  5G05 J;  1EPU A;  3CHQ A;  2XCB A;  4U8H A;  3NZS A;  2KC7 A;  3QK0 A;  4B8C B;  1KLX A;  4FJY A;  3CGH A;  4G26 A;  4GAA A;  4EZJ A;  3G2T A;  1DVP A;  3FH7 A;  3NF1 A;  3NQP A;  5D0O D;  3HVE B;  3U4T A;  4ABN A;  3Q15 A;  4I9C A;  1IQU A;  5HQ8 A;  4CCA A;  4U0Z A;  3OXG A;  2NXP A;  4CDR A;  4EZK A;  5KCM A;  1PC2 A;  1UN8 A;  3CSF A;  4FUL A;  3ZYQ A;  1EF1 C;  5DIZ A;  4FLB A;  1UW4 B;  4RVB A;  5AJD A;  3CQG B;  4UQZ A;  3D9M A;  3S7F A;  3CIA A;  4FA6 A;  3UPV A;  4F7A A;  4BTA A;  1SQM A;  4HLE A;  4HVB A;  4GCO A;  2IOL A;  2WXO A;  4UI9 K;  1U3D A;  4HOU A;  3ZVV A;  3EHN A;  2IFU A;  2EQX A;  3QOU A;  2WXR A;  1NP7 A;  4H7Y A;  4BSX A;  3ESK A;  3CHS A;  1UG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...