4UI9J

Atomic structure of the human anaphase-promoting complex
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVNGLEKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
total genus 179
structure length 504
sequence length 532
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ui9J00
2KCVA 4N3BA 4WUYA 5FZRA 3S7FA 1HH8A 3FWVA 1Y8MA 3E4BA 4KXKB 2XGMA 3QWWA 3LPZA 3ULQA 4I17A 5G05J 2VSYA 3SF4A 4IN3B 3SZ7A 3KD7A 3ZFWA 5FZQA 2XGOA 3KAEA 3RO2A 3ASGA 3S7JA 2Y4TA 4H7XA 4KYOB 4N2QA 2J9QA 4GYYA 4JA9A 4B94A 3RO3A 4APOA 3ASDA 3ZHEA 1PC2A 4UQZA 4I1AA 3Q4AB 4YNDA 3S7BA 2VGXA 3TGOA 5KJLA 3NF1A 5G04C 2FI7A 3TG5A 1QQEA 4JHRA 3IEGA 2VGXB 4RG6A 2ONDA 4UQYA 3AS8A 2XPIA 3Q49B 3JYSA 4G24A 1FCHA 2Q7FA 4JA7A 1ELRA 1ZU2A 1P5QA 4U0ZA 1WAO1 3MKRA 2PQNA 2UY1A 4XIFA 4BT8A 1A17A 5EX0A 2KCKA 2I6HA 2Y4UA 3GW4A 3QKYA 3EDTB 4U04A 2LSVA 4UI9C 3UPVA 4NRHB 5KJMA 5ARFA 4I9CA 3RIBA 1WM5A 2LNIA 2UY1B 4O6FA 4HOTA 1E96B 2PZIA 3LY8A 3HYMB 3CVLA 2FEZA 3QOUA 4HOUA 3LCAA 3CVPA 4WNGA 4G26A 4Y6CA 3VTXA 3TG4A 4F3VA 3CK7A 1ELWA 2R5SA 3LY9A 1HXIA 3OXLA 1OUVA 4GCOA 2OOEA 4H7YA 4GZ3A 3RU0A 3ZN3A 5JJ6A 4G23A 4N5CA 5KJKA 5CCLA 3CV0A 3MA5A 2V5FA 3ZHEB 4A1SA 4BT9A 3Q15A 5JJ7A 4HORA 2PL2A 2VQ2A 2VYIA 4XI0A 3VTYA 1KT0A 2MHKA 4AIFA 2AVPA 4I2ZA 3S7DA 3LYAA 1NZNA 3ESKA 2IFUA 4I9EA 4LEUA 2KC7A 5LCWJ 3WXXA 1IYGA 2IF4A 4N3AA 2HR2A 5C1DA 4GYWA 4GCNA 2FF4A 4WNFA 3AS5A 4GYOA 3GYZA 4ME2A 2QFCA 4WNEA 2BUGA 4Y6WA 5FTPA 5BNWA 4HOQA 2P58C 2XCBA 3FP3A 3GZ2A 2XEVA 5EKQD 5HQ8A 2FO7A 2KATA 4G2VA 4EQFA 1IHGA 1KLXA 5DIZA 4U07A 4GZ5A 2C2LA 4G1TA 3UUXA 5CCMA 3TAXA 1TJCA 4J8EA 3ASFA 3LY7A 2YHCA 4UI9K 2HYZA 3BEEA 4BWRA 2WQHA 3CK9A 4AY5A 4U0SA 3LKUA 3PE3A 5FZSA 3OXGA 1KT1A 3CVQA 1W3BA 2HO1A 3OXFA 5CHEE 5G04J 4BTBA 5JJTA 1NA0A 5DBKA 4UI9J 5KJNA 4G25A 2C0MA 3CKBA 3MV2B 4U0UA 5A7DB 3Q5MA 5ARGA 5FT9A 2JLBA 4JL0A 3U3WA 4GZ6A 4NQ0A 2L6JA 4J8DA 3R9AB 4N2SA 3QWPA 2WPVA 1HZ4A 2FBNA 3U4TA 3ZPJA 2VSNA 4RG9A 3CKCA 4W9RA 1QZ2A 4GA2A 4CGWA 3PE4A 1ZBPA 3O48A 4GA0A 4KBQA 5FJYA 3K9IA 5HI7A 4UQXA 5M72A 2NC9A 3URZA 3CEQA 3QWVA 4YVOA 1XNFA 2XCCA 4ABNA 3MEKA 4HOSA 2LSUA 1B89A 2KCLA 4BTAA 4CGVA 2VGYA 2YQ8A 5LCWC 3RJVA 2XGSA 3CK8A 4XI9A 4WNDA 4CDRA 5A6CA 3UQ3A 4J0UA 2E2EA 3N71A 3Q47B 5D0OD 4YVQC 4GPKA 3KS2A 4I2WA 5G05C 4AY6A 3QDNA 3CVNA 3GZ1A 5BW8C 2UWJG 4J8FA 3ASHA 5D0QD 2C0LA 5AYWD 5BT1A 3FFLA 1NA3A 3PDNA 3ZGQA 4N39A 5EX3A 4AM9A 2PQRA 3MV3B 4N3CA 3RKVA 2DBAA 1YA0A 4GA1A 2GW1A 3AS4A
chains in the Genus database with same CATH superfamily
2RG8A 3S7FA 3E37A 4KXKB 1SZ9A 3G2SA 2J9QA 5CBOA 3Q79A 4WWPA 4XKBA 2Q7FA 3OAWA 4L23A 1JPLA 4FC8A 2I6HA 2LSVA 4UWGA 4WNGA 4F3VA 1E7UA 3CK7A 3B7UX 5JJ6A 4L7TA 4A1SA 5JJ7A 2WMNA 4HORA 2WVIA 4AIFA 2Y0BG 2PM7A 3KSQA 4RLYA 2JABA 4LEUA 1VDYA 2FF4A 3FH7A 3PNLB 1OCCE 3HXEA 2C2LA 3RRUA 1AWCB 3LKUA 3IXEA 3T5VA 3OXFA 3NZUA 4AEZC 1OCOE 3ML8A 4O60A 4NQ0A 4EBAG 3TWSA 3UM1A 1HZ4A 3DPYA 3ZPJA 3D3MA 2GRMA 4FHKA 3UIPC 4A55A 1TN7A 3CHRA 2ETBA 1V55E 3QWVA 4IRUA 4ABNA 5AQ7A 4BTAA 2P9SG 2E2EA 5ENTD 3SI5A 4D10C 5FIOA 3AS4A 3DSXA 5BNWA 4TUMA 1Y8MA 4I17A 4G8LA 4EZLA 2XGOA 4CT4A 3TWRA 4OYSA 5JHBA 4I1AA 3Q4AB 5ENRD 4GTVA 4UQYA 4FA6A 4G24A 2B6CA 4OVUA 1D8EA 3FU3A 3GW4A 2CHXA 4GTQA 5ARFA 4APFA 3LY8A 3UM0A 3E32A 5A23A 4EZJA 3LY9A 3FTSA 1X5BA 1EDUA 5AJDA 3B7RL 1V54E 5ANLA 1A5EA 2WXPA 3LYAA 2KC7A 2QYJA 3ZNGA 4GYOA 3DPDA 4I6JA 4M3OA 3SFYA 3UUXA 3HDXA 3SNXA 3ASFA 2RFAA 4Q69A 1O1RA 4ANXA 4TUUA 5T3RA 4HB5A 1UW4B 3U9WA 4RG9A 1H0AA 4B93B 3PE4A 3Q78A 1TNOA 3FEXA 5B1BE 3Q9NC 3CR3A 5ENQD 1JWGA 3CLJA 3CK8A 3QNKA 1E8ZA 2WQ6A 5D0QD 1U3DA 3APFA 3NOCD 3V2OA 4A3TA 1HH8A 5J08A 1Z6TA 3APDA 2XENA 2M63A 2ETCA 4B89A 1E8XA 4EECA 3G2UA 2YHEA 3JUEA 4PDXA 2OCCE 1Z3YA 4K5CA 1P5QA 1D9SA 1LF8A 4RVBA 1NFIE 4UI9C 4JC8A 4J8YA 4I43A 2AXZA 5B3SE 2P2CP 4HOUA 4GCOA 1IHBA 4YDYA 2V5FA 3Q15A 2XEHA 1KT0A 1HFAA 4I2ZA 4XZ4A 3AG3E 3ZKJA 2VTBB 2IF4A 4N3AA 3QK0A 2HR2A 4ME2A 3EJNA 3DRAA 4F53A 3EHRA 3TWUA 2LAHA 3NOGD 4K03A 3CVQA 2MRIA 5G04J 3T8MA 3O4ZA 2LAIA 4B8CB 3LXUX 3RSEG 3QWPA 2EQXA 2X6HA 4KBQA 4NACA 2P9PG 4GTTA 4N5QA 3D9HA 2IJGX 4CDRA 1DVPA 5BW8C 5LOZA 5LFAA 1WG0A 3MZLB 2X6IA 4GMJA 4LSZE 1D8DA 3E4BA 3L82A 3QWWA 3T8KA 3MX3A 4DUIA 4GYYA 3SHFA 5G55A 4B94A 3RO3A 2DVWA 4LNGA 4UQZA 3FUEA 4KZ0A 4YNDA 1SA4A 3TL5A 1SQMA 2IO3C 2WXMA 4GPMA 3UINC 4A1GA 4JEUA 2XZDG 4NRHB 3FUIA 3CHPA 1O1SA 5EYPF 5CBNA 3EU5A 1HU3A 3DXKG 2VSXE 5LCWJ 3S2AA 3B7TA 3WG7E 4BSZB 3E30A 4WNEA 4BFRA 2WXFA 3MCXA 1TN8A 5EKQD 4GAAA 3TWVA 1OCZE 4Z68A 4EQFA 4UI9K 5HRYA 3IHVA 1UN8A 3U3WA 3L22A 2YNQA 2WPVA 3FUKA 3EHQA 3K9IA 3KEZA 2EIJE 4L1BA 4LERA 2I2OA 2ZISA 3UQ3A 3MGBA 4TRQA 4GTPA 3HG0D 3TJPA 1G3NB 3ISMC 3AG4E 3FUNA 4GA1A 3ASOE 1NP7A 3C3OA 4GTSA 4ZHBA 4FJZA 3FWVA 4WWOA 3ZFWA 4HOSA 5KBAA 5T8IA 5EIBE 5G04C 2IO2C 2AJAA 3UKUG 2CG3A 3ULEG 3Q49B 1ZU2A 1UOHA 3CQCB 3SD5A 3W9GA 3IV0A 2NXPA 1RZ4A 3G2WA 3CVLA 3I4RB 4GZCA 1BLXB 2OOEA 4TXRA 1JWFA 3FUFA 3S7DA 1NI1A 2OVFA 1MJ0A 1JCQA 1IYGA 4XEIG 4FU3A 1U2VG 3CSTA 3SBSA 3ZEFA 5HQ8A 3EHNA 3HRAA 5DIZA 4M7CA 4BWRA 3PRZA 5CERB 4AY5A 4PS3A 1KZPA 2PNNA 4HBDA 5AAOA 5D2MC 3L17A 3SY2A 3DWLG 1OXJA 5FJYA 2NC9A 2Y3AA 3LVQE 1MX6A 4UWLA 2CFZA 5T4YA 3CSFA 1Q2ZA 5KNHD 1S64A 2Y1LE 3PDNA 3FUDA 2GRPB 2EINE 2KXPC 2E0IA 3SZ7A 3UT4A 3ZXPA 4DX5D 2QZAA 4KMOA 3PZDA 2P9LG 3AJIA 3ZIMA 1HX8A 5FQ8A 3TG5A 2L9BA 3L08A 3RK6A 3FTWA 1HO8A 2VGXB 2V5QC 4HRMB 4ATZD 4PS7A 4MS6A 3V31A 3JCKC 3L6AA 1O1TA 3CVPA 4Q96A 4BESA 2QYUA 5CCLA 3ZRHA 4LNUD 2VQ2A 3C3RA 3VTYA 3ASNE 4I9EA 3W9FA 4IULA 3HVEB 3AS5A 2P58C 1QNFA 2KZTB 4ANVA 4FJYA 4GZ5A 4GZDA 2YHCA 4U0SA 3NB2A 4AOFA 5CHEE 1Z5SC 1NA0A 5CECB 5KJNA 1OT8A 2C0MA 4U0UA 3TWTA 4KZCA 4HLEA 4J8DA 4URKA 4GA2A 2AXUA 1ZBPA 4UQXA 3TWXA 3CHOA 4L2YA 3F6QA 3AG1E 1AP7A 2ZGDA 3Q47B 3FUJA 3R7QA 3UMVA 3D9LA 1OY3D 5AYWD 4FLBA 4LRZA 2GGFA 4N3CA 3TWQA 3RKVA 2GW1A 4BERA 1JCRA 2J8SD 5FWQA 4AJWA 4IN3B 3KD7A 1TJFA 1OWPA 3LJNA 2ZIRA 4AVXA 4HI9A 2ZXWE 2CHWA 4FULA 3FEYA 3ZVVA 2CFUA 3NAWA 4JA7A 1WAO1 1S0PA 2BTDA 1A17A 5EX0A 4FLHA 2Y4UA 2QC9A 3UIOC 1N52A 1OWNA 3RIBA 3PZ3A 3VLFA 2F37A 2NYJA 3CGHA 2DZOA 5EX3A 5E76A 4H7YA 3RU0A 3FU5A 4HQDA 1N94A 2J07A 2IY0C 5AN8A 3SFZA 2F8XK 5C1DA 4GYWA 4UWKA 5FTPA 2R03A 4GMRA 3EIJA 1YCSB 2FULA 2WXHA 3D9NA 1KT1A 4R7LA 4E85A 4HRLA 3NQPA 1BPOA 1H19A 1N4QA 3O48A 2VGEA 3ZU7B 3SGHA 3CIAA 5AQBA 2XCCA 4HVBA 2EILE 1DCEA 4DI4A 4YDWA 5D0OD 4CYMD 3GZ1A 3VLEA 4J8FA 4KT6B 3RRNB 1TNZA 2R2LA 1FT1A 1U3CA 1K8KG 2ILRA 1IXVA 2JEKA 1BI7B 4JB8P 3ASGA 3PZ2A 4I1OB 3Q75A 4ILGA 4APOA 3ZHEA 3UT7A 4QFVA 4U63A 3P2BA 4ACKA 4I9CA 2BEDA 4BEPA 5EYLA 3VTXA 3ZXSA 3UPVA 2WXNA 4O1OA 1NZNA 3ESKA 2IFUA 3FH5A 3WXXA 4FP7A 1H2VC 3LVRE 3BU8A 3V30A 5CEDB 1YMPA 1DC2A 3UI2A 3FHEA 2A5EA 4NIKA 5CCMA 2WXOA 1FT2A 2WQHA 1IQRA 4J7WA 4O1PA 1FPPA 4F1PA 4G25A 3GZSA 4DLQA 3FULA 3R7RA 2RKKA 4B0ZA 1E7VA 2ZU6B 5EIDA 1N11A 1HG2A 3E34A 4WNDA 3CVNA 4U8YD 1WY6A 3ZGQA 3ABME 2DBAA 5EN5D 3EIQC 4ILHB 3DEPA 1IKND 2XGMA 3LPZA 1OWOA 3U66A 3KAEA 3RO2A 3S7JA 3I3NA 2Y4TA 2LO6A 4B8AA 2L0TB 3ASDA 1SA5A 3CVWA 2AWIA 1MX2A 1OCRE 2F8YA 3APCA 1QQEA 4E6HA 4U8HA 1ELRA 2R59A 3QAQA 3D9PA 3MKQB 4MLPA 3HXCA 4CT0A 3ONKA 2FO1E 2HE0A 4AY6A 3LCAA 4CZ2D 1MZCA 4JZYA 3ZYKA 3FTXA 4GTRA 3JQ1A 5JMND 5EDSA 2V0PA 1DCQA 2A5UA 2I1KA 4F1SA 2LXMA 3Q9UC 1IHGA 3C5RA 4X8QA 3AU4A 5E75A 3EUVA 3CK9A 4I6EA 3OXGA 4BTBA 3PUKA 4HXIA 1PAQA 2J4DA 5B1AE 5AJLA 5DBKA 3T9KA 5AENA 2V8SE 5KNGA 5A7DB 2IEJA 2DYSE 3UM2A 1N4SA 3R9AB 3L54A 3DSWA 2X3MA 5KCMA 5M72A 1UG3A 3CEQA 4CDMA 3LS8A 1B89A 3HXDA 5BV1A 4GTMA 4XI9A 4J0UA 2OV8A 5FQ7A 3MV3B 3J5QB 4F6RD 3TXNA 2VSYA 2L0IA 2V4LA 4KYOB 2BKGA 3DSTA 3SFXA 3BUAA 2XQ0A 4JHRA 1IQUA 3TG4A 3IBEA 2WQ7A 4C9BB 4XIFA 3KEAA 1KPSB 2KCKA 3EDTB 2P9NG 4GU5A 4O6FA 2GRRB 3HYMB 5ENNA 1QBQA 3ENEA 3HXFA 1LD7A 4N5CA 3AAAC 4U95D 2F0YA 2P9UG 5H7PA 3FU6A 4XI0A 4UWHA 3MYVA 3T5XA 1TYQG 2XCBA 3FUMA 2BKKB 3QJZA 4RQIA 2KATA 1BU9A 3TAXA 1OWLA 4U8VD 2DYRE 4HFGA 1W3BA 2X38A 4PS8A 2B0OE 5FQ6A 3AU5A 1H6PA 5FT9A 2Y69E 2XZTG 2GRNB 4LCTA 4CGWA 3MKQA 4JW1A 2LSUA 2EIME 2VGYA 5AARA 4ANWA 4YVQC 4LNBA 5G05C 4AP2A 3DSUA 1NA3A 4XE0A 1K1AA 4N3BA 5FZRA 1E8YA 4LG6A 5LP0A 3SF4A 5FZQA 3JXJA 2LUHA 1N54A 1BD8A 1H2UA 3FTZA 1DNPA 3SBTB 3S7BA 2VGXA 4P29A 2X6JA 4U0ZA 5BXUA 2PQNA 4DX1A 3PNTB 4U04A 3DXMG 3PVLA 1WM5A 1E96B 2VTBA 4G23A 2RFMA 3ZHEB 5CMYA 2VYIA 2XPZA 3BG1B 1GW6A 4CEMA 1TNBA 3ESLA 1INZA 2QFCA 2BUGA 4HOQA 4JVSA 3FU0A 1TJCA 1BI8B 4J8SA 4UI9J 3CKBA 1YYHA 3JXIA 1MHQA 4GZ6A 3J5PA 2XEEA 3CKCA 2OEVA 1N0RA 2QY7A 2WXGA 3UX4A 4YDOA 3Q73A 3MEKA 3B7BA 3ABKE 3N71A 1HF8A 4C48B 4DK5A 2DCPA 2V4HC 3IKOB 1YA0A 2GRLA 3HVEA 3CVVA 4JA9A 1KZOA 1L5JA 1PC2A 3V79K 3Q7AA 2ZGGA 3NF1A 5CMWA 3CVYA 1N4PA 2ONDA 1S63A 1LTXA 1H6OA 2WXJA 1S70B 3PZ4A 1ZB1A 2XS1A 3OXLA 2WM9A 1H2TC 2CG2A 4U7EB 5ENSD 5CRUA 2HM8A 2AVPA 2WXIA 3D9IA 5BV0A 2LXLA 1EF1C 2R02A 4DX7D 1UJJA 4KVMA 4L9PA 4MBGA 4CDNA 4G2VA 2I1JA 4G1TA 3TXMA 1QYMA 2IOLA 4L2LA 5JJTA 3C98A 4ATGA 5FINA 1HS6A 1Y6IA 4ILIA 4N2SA 3U4TA 1TEZA 4MKTA 3FTUA 3SQVA 4MRUA 5HI7A 4DX2A 5BPPA 3D9MA 1E90A 1EPUA 2X6FA 4V3IA 4CGVA 1WDYA 3PS6A 4GPKA 2J09A 3P1UA 4NURA 3I4GA 2H6GA 3ZYMA 4YDEA 4N39A 4JHJA 4UUCA 4TXQA 5JA4D 2CHZA 4HI8A 4G8KA 4ANUA 2VSOE 5G05J 4EZKA 2IOSA 4WAFA 2PM6A 4KVOA 4AV7A 4OAVB 3VLDA 4XKCA 4XX5A 3TGOA 2FI7A 3EU9A 2RD0A 4EBAA 4BX8A 1ELKA 5KJMA 2UY1B 2XPYA 3C3QA 2XRZA 1UJKA 2FEZA 4G26A 5CEAA 3OTNA 2R5SA 4GZ3A 3G2VA 2MOWA 4FHJA 3EHMA 4K5AB 3C72A 3UXGA 3PREA 4JD2G 1H6KA 4WNFA 5KJKA 3GYZA 3SO8A 4I1MA 2IQCA 4DX6D 3GZ2A 1KLXA 2R05A 4HNAD 4J8EA 3LY7A 3QC1A 5IY5E 4N2QA 2HO1A 3G2TA 2JLBA 4JL0A 3HHMA 2L6JA 3BG0B 4W9RA 3LDZA 3UTMA 2WB2A 2R17C 3V2XA 2OVBA 2XGSA 1N95A 5A6CA 5BXOA 2H6IA 4U96D 3CVUA 2A4ZA 2OEWA 3CHQA 2AXVA 2PQRA 1RW2A 1FVHA 1N9AA 4HS2A 4I2WA 2KCVA 3ULQA 1TN6A 2IONA 4H7XA 2WXLA 4RSYA 3FY4A 4BX9A 2KBXA 3B7SA 1MYOA 3IEGA 2GRQB 3DBSA 4DJAA 4EPZA 4RG6A 3LJ3A 3B13A 1FCHA 3PEUB 3PZ1A 2XS8A 3MKRA 2UY1A 3CVXA 3D9JA 4K0RA 4HOTA 4PUCA 3PUJA 3B95A 3L16A 5KJLA 2IU1A 3ULYA 4EHMA 3LEWA 1K1BA 3CV0A 2H6FA 3MA5A 4BETA 4ZFHA 5ENOD 1UN9A 3R9MA 3U64A 5AIJA 3FTVA 4DLOA 4GCNA 3RRMB 1N4RA 3FDHA 5AQ9A 3FP3A 3ZYLA 2XEVA 5G2NA 2P9KG 3QARA 4DI3A 4U07A 1MX4A 2WXQA 3BEEA 1FVFA 3PE3A 2GROB 4JXTA 3PH0C 3DSSA 2FBNA 1JUQA 3L9TA 2J49A 5D66A 4WWNA 4YVOA 1XNFA 2YQ8A 3RJVA 4CRWA 1K3ZD 3HXBA 4ACLA 1N0QA 3QB2A 1E8WA 4DPRA 5ENPD 4LUNU 4J6IA 4IYPA 1PY1A 2MYOA 2YINA 1Z3XA 3D9KA 4GB9A 2VJ8A 3JYSA 4BT8A 3BQOA 2H6HA 5HKPA 5BUZA 3QKYA 5ANRA 5JHAA 2LNIA 3PEVB 3QOUA 3D9OA 4BSXA 3Q7FA 2WMOA 1HXIA 1OUVA 2AW6A 4BT9A 1HE8A 2MHKA 4GTOA 1TNUA 2EIKE 1SVXA 2HYZA 3FH8A 4A3VA 1O5MA 5FZSA 1XGWA 4HRNA 3ABLE 4OAUC 3Q5MA 2L6BA 1EYHA 4JPSA 4G11A 2VSNA 2WXKA 1QZ2A 3DEOA 1TR4A 3URZA 4TXPA 3RAUA 4A63B 2DIWA 5LCWC 3I5PA 3KS2A 1X81A 3ASHA 3ML9A 2C0LA 5FQ4A 5AQAA 3JQ0A 2X6KA 4WUYA 2BF0X 3KSLA 5J90A 3E33A 3ZUVB 1MQSA 1OWMA 3JUIA 4JEHA 4FADA 3CQGB 2XHEA 3AS8A 2XPIA 4I6GA 3ZYQA 3DSVA 4C0EA 4K5BA 3CHSA 3NBNB 1NL4A 2PZIA 4Y6CA 5EILA 1ELWA 4GMLA 3ZN3A 3AG2E 4F7AA 2PL2A 2DWZA 2KM4A 3HIZA 2I9CA 1JCSA 4Y6WA 3NZSA 3FUHA 4CCAA 2DZNA 2P9IG 2FO7A 5C2YA 3ONLA 3X2QE 4PH4B 3TWWA 4UWFA 5KWDA 4OVVA 5ITZF 2J4BA 4C0MA 1LD8A 2WXRA 3L13A 4BY6A 3MV2B 4AXHA 3CHMA 5ARGA 2NSZA 3FTYA 4Q94A 2XRYA 4JHKA 5LX8A 1SZAA 4GA0A 1SW6A 4QQIA 1TNYA 5CRVA 5HS0A 2KCLA 4TV3A 3MJWA 4HLLA 3UKRG 2ETAA 2J08A 1HG5A 3QDNA 2UWJG 3UM3A 3ZW3A 5BT1A 3FFLA 4AM9A 3IHYA 4DRXE 2KZTA 3UT8A
chains in the Genus database with same CATH topology
2RG8A 3S7FA 4FJZA 3EIQC 4ILHB 3FWVA 4ANUA 4KXKB 1SZ9A 2XGMA 3LPZA 2VSOE 1OWOA 4WWOA 5G05J 3ZFWA 4EZKA 3G2SA 4HOSA 3U66A 3KAEA 3RO2A 2IOSA 3S7JA 3I3NA 2Y4TA 4WAFA 2PM6A 2LO6A 4KVOA 2J9QA 4AV7A 4B8AA 2L0TB 3ASDA 3CVWA 3VLDA 4XKCA 2AWIA 4XX5A 5T8IA 3TGOA 5G04C 2FI7A 4WWPA 3APCA 1QQEA 4XKBA 2CG3A 4E6HA 4U8HA 3Q49B 2Q7FA 3OAWA 1ELRA 1ZU2A 4L23A 1JPLA 2RD0A 3CQCB 3SD5A 2R59A 3QAQA 2I6HA 4FC8A 3D9PA 3IV0A 3MKQB 4BX8A 1ELKA 4EBAA 2LSVA 2NXPA 4MLPA 5KJMA 3G2WA 2UY1B 2XPYA 4CT0A 3ONKA 4UWGA 2XRZA 1UJKA 3CVLA 2FEZA 4WNGA 4AY6A 3I4RB 3LCAA 4GZCA 4G26A 4F3VA 1E7UA 3CK7A 3OTNA 2R5SA 4GZ3A 2OOEA 3B7UX 5JJ6A 3G2VA 2MOWA 4JZYA 4L7TA 3ZYKA 4A1SA 5JJ7A 1JWFA 2WMNA 4FHJA 4HORA 3EHMA 2WVIA 3FUFA 4AIFA 3S7DA 3FTXA 3JQ1A 2PM7A 3PREA 5EDSA 2OVFA 4LEUA 1IYGA 4FU3A 2V0PA 1H6KA 1VDYA 2FF4A 4WNFA 3FH7A 5KJKA 3GYZA 2A5UA 3PNLB 2I1KA 4I1MA 2IQCA 3CSTA 3SBSA 4F1SA 3GZ2A 3ZEFA 5HQ8A 3EHNA 1IHGA 1KLXA 5DIZA 3AU4A 5E75A 2C2LA 3RRUA 4J8EA 3LY7A 4BWRA 3PRZA 3QC1A 3CK9A 4AY5A 3LKUA 4PS3A 4I6EA 3OXGA 4BTBA 3PUKA 4HXIA 2HO1A 1PAQA 3OXFA 2J4DA 4N2QA 3NZUA 5AJLA 5DBKA 3G2TA 4AEZC 5AENA 2V8SE 5A7DB 3ML8A 2JLBA 4JL0A 3HHMA 4NQ0A 4EBAG 2L6JA 3R9AB 1HZ4A 3BG0B 3ZPJA 3D3MA 2GRMA 3L17A 3L54A 4FHKA 4W9RA 3LDZA 4A55A 3CHRA 5FJYA 2X3MA 5KCMA 5M72A 2NC9A 2WB2A 2Y3AA 1UG3A 3CEQA 3QWVA 4CDMA 3LS8A 4IRUA 3LVQE 4ABNA 2R17C 1B89A 4UWLA 2CFZA 4BTAA 2OVBA 5T4YA 5BV1A 3CSFA 2XGSA 4XI9A 5A6CA 4J0UA 2E2EA 2OV8A 3SI5A 5FQ7A 3CVUA 3PDNA 2A4ZA 3FUDA 3CHQA 2AXVA 2PQRA 3MV3B 1FVHA 4D10C 4HS2A 3TXNA 3AS4A 4I2WA 2KCVA 5BNWA 1Y8MA 2E0IA 3ULQA 4I17A 2VSYA 4EZLA 3SZ7A 3UT4A 2XGOA 2L0IA 4CT4A 2IONA 2V4LA 4H7XA 4KYOB 4OYSA 2WXLA 4RSYA 4KMOA 5JHBA 3PZDA 4I1AA 3Q4AB 3FY4A 3ZIMA 4BX9A 1HX8A 3B7SA 5FQ8A 3TG5A 2L9BA 2XQ0A 3L08A 4JHRA 3IEGA 3DBSA 3FTWA 1HO8A 3RK6A 2VGXB 4RG6A 4DJAA 4UQYA 4EPZA 3LJ3A 3B13A 1FCHA 1IQUA 3PEUB 4G24A 3IBEA 3TG4A 4FA6A 4C9BB 3MKRA 4XIFA 2UY1A 4PS7A 4MS6A 2WQ7A 3CVXA 3D9JA 4OVUA 2KCKA 3FU3A 3GW4A 3EDTB 4GU5A 2CHXA 4K0RA 5ARFA 4APFA 4O6FA 4HOTA 4PUCA 3PUJA 3LY8A 3HYMB 3JCKC 3L6AA 3L16A 3CVPA 5ENNA 5A23A 4EZJA 5KJLA 3ENEA 2IU1A 3LY9A 4Q96A 3FTSA 1X5BA 3LEWA 1EDUA 4N5CA 5AJDA 3B7RL 5CCLA 3CV0A 3MA5A 3ZRHA 3FU6A 2VQ2A 4XI0A 5ANLA 3VTYA 2WXPA 4UWHA 1UN9A 3LYAA 3U64A 5AIJA 3FTVA 4I9EA 2KC7A 3MYVA 3T5XA 3UT8A 4IULA 3HVEB 4DLOA 4GCNA 3RRMB 3AS5A 4GYOA 3FDHA 2P58C 1QNFA 2KZTB 2XCBA 3FP3A 3DPDA 2XEVA 3FUMA 3QJZA 2KATA 4I6JA 5G2NA 3QARA 3ZYLA 4M3OA 4FJYA 4DI3A 4U07A 4GZ5A 3UUXA 3HDXA 3SNXA 3TAXA 2WXQA 4GZDA 3ASFA 2YHCA 1OWLA 3BEEA 4U0SA 4Q69A 1FVFA 3PE3A 4HFGA 1W3BA 2X38A 4PS8A 5CHEE 4AOFA 1NA0A 4JXTA 5KJNA 5FQ6A 3AU5A 3T5VA 2C0MA 4ANXA 4TUUA 4U0UA 5T3RA 5FT9A 1UW4B 4KZCA 3PH0C 4HLEA 4J8DA 3U9WA 4URKA 2FBNA 4RG9A 1JUQA 4LCTA 1H0AA 4GA2A 2AXUA 2J49A 3PE4A 4CGWA 1ZBPA 3MKQA 4WWNA 4UQXA 3FEXA 4YVOA 1XNFA 3CHOA 4L2YA 4JW1A 2LSUA 3CR3A 1JWGA 3CLJA 2VGYA 2YQ8A 3RJVA 3CK8A 4ANWA 4CRWA 3Q47B 4YVQC 4ACLA 3FUJA 3QNKA 1E8ZA 5G05C 3R7QA 3UMVA 3D9LA 2WQ6A 3QB2A 4AP2A 5D0QD 5AYWD 4FLBA 1E8WA 1NA3A 4LRZA 1U3DA 2GGFA 3APFA 4A3TA 4N3CA 4XE0A 3RKVA 4DPRA 2GW1A 4LUNU 4J6IA 4N3BA 4IYPA 5FZRA 1HH8A 5J08A 1E8YA 5FWQA 1Z6TA 5LP0A 3SF4A 4AJWA 4IN3B 3APDA 3KD7A 1TJFA 2M63A 5FZQA 4B89A 1OWPA 1N54A 1H2UA 1E8XA 3FTZA 1DNPA 4EECA 3SBTB 1PY1A 3G2UA 4AVXA 2YINA 1Z3XA 2YHEA 3S7BA 2VGXA 4PDXA 2CHWA 4P29A 4FULA 3FEYA 3ZVVA 3D9KA 1Z3YA 2CFUA 4GB9A 2VJ8A 2X6JA 3JYSA 4JA7A 4U0ZA 4BT8A 1P5QA 1WAO1 1S0PA 2PQNA 2BTDA 1A17A 5EX0A 1LF8A 4FLHA 2Y4UA 4RVBA 5BUZA 3QKYA 1N52A 1OWNA 3PNTB 4JC8A 4U04A 4UI9C 5ANRA 5JHAA 3PVLA 3RIBA 4I43A 1WM5A 2AXZA 2LNIA 3VLFA 1E96B 3PEVB 3CGHA 4HOUA 3QOUA 3D9OA 4BSXA 5EX3A 2WMOA 5E76A 1HXIA 1OUVA 4GCOA 4H7YA 3RU0A 2VTBA 2AW6A 4G23A 3FU5A 4BT9A 2V5FA 3ZHEB 3Q15A 1HE8A 5CMYA 2VYIA 2XPZA 1KT0A 2MHKA 1HFAA 3BG1B 4I2ZA 4XZ4A 2J07A 1GW6A 2IF4A 4N3AA 3SFZA 3QK0A 2HR2A 5C1DA 4GYWA 2VTBB 4CEMA 4UWKA 3ESLA 1INZA 5FTPA 4ME2A 2QFCA 2BUGA 3EJNA 4HOQA 4F53A 3EIJA 4JVSA 3FU0A 2FULA 2LAHA 1TJCA 2WXHA 2HYZA 3FH8A 4A3VA 3D9NA 4K03A 5FZSA 1KT1A 1XGWA 3CVQA 4J8SA 2MRIA 5G04J 3T8MA 4UI9J 3O4ZA 3CKBA 2LAIA 3Q5MA 4R7LA 4B8CB 4E85A 1EYHA 1MHQA 3LXUX 4JPSA 4GZ6A 4G11A 3NQPA 3QWPA 2EQXA 1BPOA 2VSNA 2WXKA 3CKCA 1QZ2A 2X6HA 1H19A 2QY7A 3O48A 4KBQA 4NACA 3SGHA 2WXGA 3URZA 3UX4A 3CIAA 2XCCA 4HVBA 3MEKA 2DIWA 5LCWC 2IJGX 3I5PA 4CDRA 4DI4A 3N71A 5D0OD 1HF8A 3KS2A 4DK5A 3GZ1A 3VLEA 1DVPA 2DCPA 4J8FA 3ASHA 3ML9A 2C0LA 4KT6B 5BW8C 5FQ4A 3RRNB 3IKOB 1U3CA 5LOZA 5LFAA 1YA0A 2ILRA 3JQ0A 3MZLB 2X6KA 2X6IA 2JEKA 4WUYA 2BF0X 5J90A 4GMJA 2GRLA 3E4BA 3HVEA 3QWWA 1MQSA 3ASGA 3MX3A 1OWMA 3JUIA 4I1OB 4JEHA 4GYYA 4JA9A 3SHFA 5G55A 4B94A 3CVVA 3RO3A 4ILGA 4APOA 1L5JA 1PC2A 3UT7A 4UQZA 4QFVA 4U63A 3FUEA 3CQGB 3ZHEA 4KZ0A 4YNDA 4FADA 2XHEA 3P2BA 3NF1A 5CMWA 3TL5A 1SQMA 3CVYA 2ONDA 2WXMA 2XPIA 3AS8A 4A1GA 4I6GA 4JEUA 4ACKA 2WXJA 3ZYQA 4C0EA 4NRHB 4I9CA 3CHSA 3FUIA 3CHPA 2PZIA 4Y6CA 4ANVA 3VTXA 1ELWA 4GMLA 3ZN3A 3OXLA 3ZXSA 3UPVA 2WXNA 2WM9A 1H2TC 2CG2A 4F7AA 1HU3A 2PL2A 2HM8A 2AVPA 2VSXE 2WXIA 1NZNA 3ESKA 2KM4A 3D9IA 2IFUA 3HIZA 3FH5A 5LCWJ 2I9CA 3WXXA 5BV0A 3S2AA 3B7TA 1EF1C 4FP7A 1H2VC 3LVRE 4Y6WA 3NZSA 3FUHA 4WNEA 4CCAA 1UJJA 2WXFA 4KVMA 3MCXA 4BFRA 5EKQD 4GAAA 4CDNA 2FO7A 4G2VA 4EQFA 3FHEA 2I1JA 4G1TA 5C2YA 3ONLA 2WXOA 3TXMA 5CCMA 4UI9K 4PH4B 4UWFA 2WQHA 1IQRA 4OVVA 2J4BA 4C0MA 3IHVA 2IOLA 4L2LA 5JJTA 2WXRA 3L13A 4BY6A 4G25A 3C98A 3MV2B 4AXHA 3CHMA 3GZSA 5ARGA 2NSZA 1UN8A 4ATGA 1HS6A 1Y6IA 3FTYA 4Q94A 4DLQA 3U3WA 3L22A 4ILIA 2XRYA 2YNQA 4N2SA 2WPVA 3U4TA 1TEZA 3FULA 4JHKA 3FUKA 3FTUA 4MKTA 3R7RA 5LX8A 1SZAA 4GA0A 4MRUA 5HI7A 4B0ZA 3K9IA 3KEZA 1E7VA 5BPPA 3D9MA 2ZU6B 1E90A 4L1BA 4LERA 1EPUA 2X6FA 2I2OA 1HG2A 2KCLA 4V3IA 4TV3A 4CGVA 3MJWA 3PS6A 4WNDA 4GPKA 3UQ3A 2J09A 3MGBA 3P1UA 4NURA 3I4GA 4TRQA 2J08A 1HG5A 3CVNA 3QDNA 3TJPA 2UWJG 3ZYMA 3ZW3A 1WY6A 5BT1A 3FFLA 3ZGQA 4N39A 4AM9A 3IHYA 3FUNA 2DBAA 4JHJA 4GA1A 2KZTA 1NP7A 2CHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCV A;  4N3B A;  4WUY A;  5FZR A;  3S7F A;  1HH8 A;  3FWV A;  1Y8M A;  3E4B A;  4KXK B;  2XGM A;  3QWW A;  3LPZ A;  3ULQ A;  4I17 A;  5G05 J;  2VSY A;  3SF4 A;  4IN3 B;  3SZ7 A;  3KD7 A;  3ZFW A;  5FZQ A;  2XGO A;  3KAE A;  3RO2 A;  3ASG A;  3S7J A;  2Y4T A;  4H7X A;  4KYO B;  4N2Q A;  2J9Q A;  4GYY A;  4JA9 A;  4B94 A;  3RO3 A;  4APO A;  3ASD A;  3ZHE A;  1PC2 A;  4UQZ A;  4I1A A;  3Q4A B;  4YND A;  3S7B A;  2VGX A;  3TGO A;  5KJL A;  3NF1 A;  5G04 C;  2FI7 A;  3TG5 A;  1QQE A;  4JHR A;  3IEG A;  2VGX B;  4RG6 A;  2OND A;  4UQY A;  3AS8 A;  2XPI A;  3Q49 B;  3JYS A;  4G24 A;  1FCH A;  2Q7F A;  4JA7 A;  1ELR A;  1ZU2 A;  1P5Q A;  4U0Z A;  1WAO 1;  3MKR A;  2PQN A;  2UY1 A;  4XIF A;  4BT8 A;  1A17 A;  5EX0 A;  2KCK A;  2I6H A;  2Y4U A;  3GW4 A;  3QKY A;  3EDT B;  4U04 A;  2LSV A;  4UI9 C;  3UPV A;  4NRH B;  5KJM A;  5ARF A;  4I9C A;  3RIB A;  1WM5 A;  2LNI A;  2UY1 B;  4O6F A;  4HOT A;  1E96 B;  2PZI A;  3LY8 A;  3HYM B;  3CVL A;  2FEZ A;  3QOU A;  4HOU A;  3LCA A;  3CVP A;  4WNG A;  4G26 A;  4Y6C A;  3VTX A;  3TG4 A;  4F3V A;  3CK7 A;  1ELW A;  2R5S A;  3LY9 A;  1HXI A;  3OXL A;  1OUV A;  4GCO A;  2OOE A;  4H7Y A;  4GZ3 A;  3RU0 A;  3ZN3 A;  5JJ6 A;  4G23 A;  4N5C A;  5KJK A;  5CCL A;  3CV0 A;  3MA5 A;  2V5F A;  3ZHE B;  4A1S A;  4BT9 A;  3Q15 A;  5JJ7 A;  4HOR A;  2PL2 A;  2VQ2 A;  2VYI A;  4XI0 A;  3VTY A;  1KT0 A;  2MHK A;  4AIF A;  2AVP A;  4I2Z A;  3S7D A;  3LYA A;  1NZN A;  3ESK A;  2IFU A;  4I9E A;  4LEU A;  2KC7 A;  5LCW J;  3WXX A;  1IYG A;  2IF4 A;  4N3A A;  2HR2 A;  5C1D A;  4GYW A;  4GCN A;  2FF4 A;  4WNF A;  3AS5 A;  4GYO A;  3GYZ A;  4ME2 A;  2QFC A;  4WNE A;  2BUG A;  4Y6W A;  5FTP A;  5BNW A;  4HOQ A;  2P58 C;  2XCB A;  3FP3 A;  3GZ2 A;  2XEV A;  5EKQ D;  5HQ8 A;  2FO7 A;  2KAT A;  4G2V A;  4EQF A;  1IHG A;  1KLX A;  5DIZ A;  4U07 A;  4GZ5 A;  2C2L A;  4G1T A;  3UUX A;  5CCM A;  3TAX A;  1TJC A;  4J8E A;  3ASF A;  3LY7 A;  2YHC A;  4UI9 K;  2HYZ A;  3BEE A;  4BWR A;  2WQH A;  3CK9 A;  4AY5 A;  4U0S A;  3LKU A;  3PE3 A;  5FZS A;  3OXG A;  1KT1 A;  3CVQ A;  1W3B A;  2HO1 A;  3OXF A;  5CHE E;  5G04 J;  4BTB A;  5JJT A;  1NA0 A;  5DBK A;  4UI9 J;  5KJN A;  4G25 A;  2C0M A;  3CKB A;  3MV2 B;  4U0U A;  5A7D B;  3Q5M A;  5ARG A;  5FT9 A;  2JLB A;  4JL0 A;  3U3W A;  4GZ6 A;  4NQ0 A;  2L6J A;  4J8D A;  3R9A B;  4N2S A;  3QWP A;  2WPV A;  1HZ4 A;  2FBN A;  3U4T A;  3ZPJ A;  2VSN A;  4RG9 A;  3CKC A;  4W9R A;  1QZ2 A;  4GA2 A;  4CGW A;  3PE4 A;  1ZBP A;  3O48 A;  4GA0 A;  4KBQ A;  5FJY A;  3K9I A;  5HI7 A;  4UQX A;  5M72 A;  2NC9 A;  3URZ A;  3CEQ A;  3QWV A;  4YVO A;  1XNF A;  2XCC A;  4ABN A;  3MEK A;  4HOS A;  2LSU A;  1B89 A;  2KCL A;  4BTA A;  4CGV A;  2VGY A;  2YQ8 A;  5LCW C;  3RJV A;  2XGS A;  3CK8 A;  4XI9 A;  4WND A;  4CDR A;  5A6C A;  3UQ3 A;  4J0U A;  2E2E A;  3N71 A;  3Q47 B;  5D0O D;  4YVQ C;  4GPK A;  3KS2 A;  4I2W A;  5G05 C;  4AY6 A;  3QDN A;  3CVN A;  3GZ1 A;  5BW8 C;  2UWJ G;  4J8F A;  3ASH A;  5D0Q D;  2C0L A;  5AYW D;  5BT1 A;  3FFL A;  1NA3 A;  3PDN A;  3ZGQ A;  4N39 A;  5EX3 A;  4AM9 A;  2PQR A;  3MV3 B;  4N3C A;  3RKV A;  2DBA A;  1YA0 A;  4GA1 A;  2GW1 A;  3AS4 A; 
#chains in the Genus database with same CATH topology
 2RG8 A;  3S7F A;  3E37 A;  4KXK B;  1SZ9 A;  3G2S A;  2J9Q A;  5CBO A;  3Q79 A;  4WWP A;  4XKB A;  2Q7F A;  3OAW A;  4L23 A;  1JPL A;  4FC8 A;  2I6H A;  2LSV A;  4UWG A;  4WNG A;  4F3V A;  1E7U A;  3CK7 A;  3B7U X;  5JJ6 A;  4L7T A;  4A1S A;  5JJ7 A;  2WMN A;  4HOR A;  2WVI A;  4AIF A;  2Y0B G;  2PM7 A;  3KSQ A;  4RLY A;  2JAB A;  4LEU A;  1VDY A;  2FF4 A;  3FH7 A;  3PNL B;  1OCC E;  3HXE A;  2C2L A;  3RRU A;  1AWC B;  3LKU A;  3IXE A;  3T5V A;  3OXF A;  3NZU A;  4AEZ C;  1OCO E;  3ML8 A;  4O60 A;  4NQ0 A;  4EBA G;  3TWS A;  3UM1 A;  1HZ4 A;  3DPY A;  3ZPJ A;  3D3M A;  2GRM A;  4FHK A;  3UIP C;  4A55 A;  1TN7 A;  3CHR A;  2ETB A;  1V55 E;  3QWV A;  4IRU A;  4ABN A;  5AQ7 A;  4BTA A;  2P9S G;  2E2E A;  5ENT D;  3SI5 A;  4D10 C;  5FIO A;  3AS4 A;  3DSX A;  5BNW A;  4TUM A;  1Y8M A;  4I17 A;  4G8L A;  4EZL A;  2XGO A;  4CT4 A;  3TWR A;  4OYS A;  5JHB A;  4I1A A;  3Q4A B;  5ENR D;  4GTV A;  4UQY A;  4FA6 A;  4G24 A;  2B6C A;  4OVU A;  1D8E A;  3FU3 A;  3GW4 A;  2CHX A;  4GTQ A;  5ARF A;  4APF A;  3LY8 A;  3UM0 A;  3E32 A;  5A23 A;  4EZJ A;  3LY9 A;  3FTS A;  1X5B A;  1EDU A;  5AJD A;  3B7R L;  1V54 E;  5ANL A;  1A5E A;  2WXP A;  3LYA A;  2KC7 A;  2QYJ A;  3ZNG A;  4GYO A;  3DPD A;  4I6J A;  4M3O A;  3SFY A;  3UUX A;  3HDX A;  3SNX A;  3ASF A;  2RFA A;  4Q69 A;  1O1R A;  4ANX A;  4TUU A;  5T3R A;  4HB5 A;  1UW4 B;  3U9W A;  4RG9 A;  1H0A A;  4B93 B;  3PE4 A;  3Q78 A;  1TNO A;  3FEX A;  5B1B E;  3Q9N C;  3CR3 A;  5ENQ D;  1JWG A;  3CLJ A;  3CK8 A;  3QNK A;  1E8Z A;  2WQ6 A;  5D0Q D;  1U3D A;  3APF A;  3NOC D;  3V2O A;  4A3T A;  1HH8 A;  5J08 A;  1Z6T A;  3APD A;  2XEN A;  2M63 A;  2ETC A;  4B89 A;  1E8X A;  4EEC A;  3G2U A;  2YHE A;  3JUE A;  4PDX A;  2OCC E;  1Z3Y A;  4K5C A;  1P5Q A;  1D9S A;  1LF8 A;  4RVB A;  1NFI E;  4UI9 C;  4JC8 A;  4J8Y A;  4I43 A;  2AXZ A;  5B3S E;  2P2C P;  4HOU A;  4GCO A;  1IHB A;  4YDY A;  2V5F A;  3Q15 A;  2XEH A;  1KT0 A;  1HFA A;  4I2Z A;  4XZ4 A;  3AG3 E;  3ZKJ A;  2VTB B;  2IF4 A;  4N3A A;  3QK0 A;  2HR2 A;  4ME2 A;  3EJN A;  3DRA A;  4F53 A;  3EHR A;  3TWU A;  2LAH A;  3NOG D;  4K03 A;  3CVQ A;  2MRI A;  5G04 J;  3T8M A;  3O4Z A;  2LAI A;  4B8C B;  3LXU X;  3RSE G;  3QWP A;  2EQX A;  2X6H A;  4KBQ A;  4NAC A;  2P9P G;  4GTT A;  4N5Q A;  3D9H A;  2IJG X;  4CDR A;  1DVP A;  5BW8 C;  5LOZ A;  5LFA A;  1WG0 A;  3MZL B;  2X6I A;  4GMJ A;  4LSZ E;  1D8D A;  3E4B A;  3L82 A;  3QWW A;  3T8K A;  3MX3 A;  4DUI A;  4GYY A;  3SHF A;  5G55 A;  4B94 A;  3RO3 A;  2DVW A;  4LNG A;  4UQZ A;  3FUE A;  4KZ0 A;  4YND A;  1SA4 A;  3TL5 A;  1SQM A;  2IO3 C;  2WXM A;  4GPM A;  3UIN C;  4A1G A;  4JEU A;  2XZD G;  4NRH B;  3FUI A;  3CHP A;  1O1S A;  5EYP F;  5CBN A;  3EU5 A;  1HU3 A;  3DXK G;  2VSX E;  5LCW J;  3S2A A;  3B7T A;  3WG7 E;  4BSZ B;  3E30 A;  4WNE A;  4BFR A;  2WXF A;  3MCX A;  1TN8 A;  5EKQ D;  4GAA A;  3TWV A;  1OCZ E;  4Z68 A;  4EQF A;  4UI9 K;  5HRY A;  3IHV A;  1UN8 A;  3U3W A;  3L22 A;  2YNQ A;  2WPV A;  3FUK A;  3EHQ A;  3K9I A;  3KEZ A;  2EIJ E;  4L1B A;  4LER A;  2I2O A;  2ZIS A;  3UQ3 A;  3MGB A;  4TRQ A;  4GTP A;  3HG0 D;  3TJP A;  1G3N B;  3ISM C;  3AG4 E;  3FUN A;  4GA1 A;  3ASO E;  1NP7 A;  3C3O A;  4GTS A;  4ZHB A;  4FJZ A;  3FWV A;  4WWO A;  3ZFW A;  4HOS A;  5KBA A;  5T8I A;  5EIB E;  5G04 C;  2IO2 C;  2AJA A;  3UKU G;  2CG3 A;  3ULE G;  3Q49 B;  1ZU2 A;  1UOH A;  3CQC B;  3SD5 A;  3W9G A;  3IV0 A;  2NXP A;  1RZ4 A;  3G2W A;  3CVL A;  3I4R B;  4GZC A;  1BLX B;  2OOE A;  4TXR A;  1JWF A;  3FUF A;  3S7D A;  1NI1 A;  2OVF A;  1MJ0 A;  1JCQ A;  1IYG A;  4XEI G;  4FU3 A;  1U2V G;  3CST A;  3SBS A;  3ZEF A;  5HQ8 A;  3EHN A;  3HRA A;  5DIZ A;  4M7C A;  4BWR A;  3PRZ A;  5CER B;  4AY5 A;  4PS3 A;  1KZP A;  2PNN A;  4HBD A;  5AAO A;  5D2M C;  3L17 A;  3SY2 A;  3DWL G;  1OXJ A;  5FJY A;  2NC9 A;  2Y3A A;  3LVQ E;  1MX6 A;  4UWL A;  2CFZ A;  5T4Y A;  3CSF A;  1Q2Z A;  5KNH D;  1S64 A;  2Y1L E;  3PDN A;  3FUD A;  2GRP B;  2EIN E;  2KXP C;  2E0I A;  3SZ7 A;  3UT4 A;  3ZXP A;  4DX5 D;  2QZA A;  4KMO A;  3PZD A;  2P9L G;  3AJI A;  3ZIM A;  1HX8 A;  5FQ8 A;  3TG5 A;  2L9B A;  3L08 A;  3RK6 A;  3FTW A;  1HO8 A;  2VGX B;  2V5Q C;  4HRM B;  4ATZ D;  4PS7 A;  4MS6 A;  3V31 A;  3JCK C;  3L6A A;  1O1T A;  3CVP A;  4Q96 A;  4BES A;  2QYU A;  5CCL A;  3ZRH A;  4LNU D;  2VQ2 A;  3C3R A;  3VTY A;  3ASN E;  4I9E A;  3W9F A;  4IUL A;  3HVE B;  3AS5 A;  2P58 C;  1QNF A;  2KZT B;  4ANV A;  4FJY A;  4GZ5 A;  4GZD A;  2YHC A;  4U0S A;  3NB2 A;  4AOF A;  5CHE E;  1Z5S C;  1NA0 A;  5CEC B;  5KJN A;  1OT8 A;  2C0M A;  4U0U A;  3TWT A;  4KZC A;  4HLE A;  4J8D A;  4URK A;  4GA2 A;  2AXU A;  1ZBP A;  4UQX A;  3TWX A;  3CHO A;  4L2Y A;  3F6Q A;  3AG1 E;  1AP7 A;  2ZGD A;  3Q47 B;  3FUJ A;  3R7Q A;  3UMV A;  3D9L A;  1OY3 D;  5AYW D;  4FLB A;  4LRZ A;  2GGF A;  4N3C A;  3TWQ A;  3RKV A;  2GW1 A;  4BER A;  1JCR A;  2J8S D;  5FWQ A;  4AJW A;  4IN3 B;  3KD7 A;  1TJF A;  1OWP A;  3LJN A;  2ZIR A;  4AVX A;  4HI9 A;  2ZXW E;  2CHW A;  4FUL A;  3FEY A;  3ZVV A;  2CFU A;  3NAW A;  4JA7 A;  1WAO 1;  1S0P A;  2BTD A;  1A17 A;  5EX0 A;  4FLH A;  2Y4U A;  2QC9 A;  3UIO C;  1N52 A;  1OWN A;  3RIB A;  3PZ3 A;  3VLF A;  2F37 A;  2NYJ A;  3CGH A;  2DZO A;  5EX3 A;  5E76 A;  4H7Y A;  3RU0 A;  3FU5 A;  4HQD A;  1N94 A;  2J07 A;  2IY0 C;  5AN8 A;  3SFZ A;  2F8X K;  5C1D A;  4GYW A;  4UWK A;  5FTP A;  2R03 A;  4GMR A;  3EIJ A;  1YCS B;  2FUL A;  2WXH A;  3D9N A;  1KT1 A;  4R7L A;  4E85 A;  4HRL A;  3NQP A;  1BPO A;  1H19 A;  1N4Q A;  3O48 A;  2VGE A;  3ZU7 B;  3SGH A;  3CIA A;  5AQB A;  2XCC A;  4HVB A;  2EIL E;  1DCE A;  4DI4 A;  4YDW A;  5D0O D;  4CYM D;  3GZ1 A;  3VLE A;  4J8F A;  4KT6 B;  3RRN B;  1TNZ A;  2R2L A;  1FT1 A;  1U3C A;  1K8K G;  2ILR A;  1IXV A;  2JEK A;  1BI7 B;  4JB8 P;  3ASG A;  3PZ2 A;  4I1O B;  3Q75 A;  4ILG A;  4APO A;  3ZHE A;  3UT7 A;  4QFV A;  4U63 A;  3P2B A;  4ACK A;  4I9C A;  2BED A;  4BEP A;  5EYL A;  3VTX A;  3ZXS A;  3UPV A;  2WXN A;  4O1O A;  1NZN A;  3ESK A;  2IFU A;  3FH5 A;  3WXX A;  4FP7 A;  1H2V C;  3LVR E;  3BU8 A;  3V30 A;  5CED B;  1YMP A;  1DC2 A;  3UI2 A;  3FHE A;  2A5E A;  4NIK A;  5CCM A;  2WXO A;  1FT2 A;  2WQH A;  1IQR A;  4J7W A;  4O1P A;  1FPP A;  4F1P A;  4G25 A;  3GZS A;  4DLQ A;  3FUL A;  3R7R A;  2RKK A;  4B0Z A;  1E7V A;  2ZU6 B;  5EID A;  1N11 A;  1HG2 A;  3E34 A;  4WND A;  3CVN A;  4U8Y D;  1WY6 A;  3ZGQ A;  3ABM E;  2DBA A;  5EN5 D;  3EIQ C;  4ILH B;  3DEP A;  1IKN D;  2XGM A;  3LPZ A;  1OWO A;  3U66 A;  3KAE A;  3RO2 A;  3S7J A;  3I3N A;  2Y4T A;  2LO6 A;  4B8A A;  2L0T B;  3ASD A;  1SA5 A;  3CVW A;  2AWI A;  1MX2 A;  1OCR E;  2F8Y A;  3APC A;  1QQE A;  4E6H A;  4U8H A;  1ELR A;  2R59 A;  3QAQ A;  3D9P A;  3MKQ B;  4MLP A;  3HXC A;  4CT0 A;  3ONK A;  2FO1 E;  2HE0 A;  4AY6 A;  3LCA A;  4CZ2 D;  1MZC A;  4JZY A;  3ZYK A;  3FTX A;  4GTR A;  3JQ1 A;  5JMN D;  5EDS A;  2V0P A;  1DCQ A;  2A5U A;  2I1K A;  4F1S A;  2LXM A;  3Q9U C;  1IHG A;  3C5R A;  4X8Q A;  3AU4 A;  5E75 A;  3EUV A;  3CK9 A;  4I6E A;  3OXG A;  4BTB A;  3PUK A;  4HXI A;  1PAQ A;  2J4D A;  5B1A E;  5AJL A;  5DBK A;  3T9K A;  5AEN A;  2V8S E;  5KNG A;  5A7D B;  2IEJ A;  2DYS E;  3UM2 A;  1N4S A;  3R9A B;  3L54 A;  3DSW A;  2X3M A;  5KCM A;  5M72 A;  1UG3 A;  3CEQ A;  4CDM A;  3LS8 A;  1B89 A;  3HXD A;  5BV1 A;  4GTM A;  4XI9 A;  4J0U A;  2OV8 A;  5FQ7 A;  3MV3 B;  3J5Q B;  4F6R D;  3TXN A;  2VSY A;  2L0I A;  2V4L A;  4KYO B;  2BKG A;  3DST A;  3SFX A;  3BUA A;  2XQ0 A;  4JHR A;  1IQU A;  3TG4 A;  3IBE A;  2WQ7 A;  4C9B B;  4XIF A;  3KEA A;  1KPS B;  2KCK A;  3EDT B;  2P9N G;  4GU5 A;  4O6F A;  2GRR B;  3HYM B;  5ENN A;  1QBQ A;  3ENE A;  3HXF A;  1LD7 A;  4N5C A;  3AAA C;  4U95 D;  2F0Y A;  2P9U G;  5H7P A;  3FU6 A;  4XI0 A;  4UWH A;  3MYV A;  3T5X A;  1TYQ G;  2XCB A;  3FUM A;  2BKK B;  3QJZ A;  4RQI A;  2KAT A;  1BU9 A;  3TAX A;  1OWL A;  4U8V D;  2DYR E;  4HFG A;  1W3B A;  2X38 A;  4PS8 A;  2B0O E;  5FQ6 A;  3AU5 A;  1H6P A;  5FT9 A;  2Y69 E;  2XZT G;  2GRN B;  4LCT A;  4CGW A;  3MKQ A;  4JW1 A;  2LSU A;  2EIM E;  2VGY A;  5AAR A;  4ANW A;  4YVQ C;  4LNB A;  5G05 C;  4AP2 A;  3DSU A;  1NA3 A;  4XE0 A;  1K1A A;  4N3B A;  5FZR A;  1E8Y A;  4LG6 A;  5LP0 A;  3SF4 A;  5FZQ A;  3JXJ A;  2LUH A;  1N54 A;  1BD8 A;  1H2U A;  3FTZ A;  1DNP A;  3SBT B;  3S7B A;  2VGX A;  4P29 A;  2X6J A;  4U0Z A;  5BXU A;  2PQN A;  4DX1 A;  3PNT B;  4U04 A;  3DXM G;  3PVL A;  1WM5 A;  1E96 B;  2VTB A;  4G23 A;  2RFM A;  3ZHE B;  5CMY A;  2VYI A;  2XPZ A;  3BG1 B;  1GW6 A;  4CEM A;  1TNB A;  3ESL A;  1INZ A;  2QFC A;  2BUG A;  4HOQ A;  4JVS A;  3FU0 A;  1TJC A;  1BI8 B;  4J8S A;  4UI9 J;  3CKB A;  1YYH A;  3JXI A;  1MHQ A;  4GZ6 A;  3J5P A;  2XEE A;  3CKC A;  2OEV A;  1N0R A;  2QY7 A;  2WXG A;  3UX4 A;  4YDO A;  3Q73 A;  3MEK A;  3B7B A;  3ABK E;  3N71 A;  1HF8 A;  4C48 B;  4DK5 A;  2DCP A;  2V4H C;  3IKO B;  1YA0 A;  2GRL A;  3HVE A;  3CVV A;  4JA9 A;  1KZO A;  1L5J A;  1PC2 A;  3V79 K;  3Q7A A;  2ZGG A;  3NF1 A;  5CMW A;  3CVY A;  1N4P A;  2OND A;  1S63 A;  1LTX A;  1H6O A;  2WXJ A;  1S70 B;  3PZ4 A;  1ZB1 A;  2XS1 A;  3OXL A;  2WM9 A;  1H2T C;  2CG2 A;  4U7E B;  5ENS D;  5CRU A;  2HM8 A;  2AVP A;  2WXI A;  3D9I A;  5BV0 A;  2LXL A;  1EF1 C;  2R02 A;  4DX7 D;  1UJJ A;  4KVM A;  4L9P A;  4MBG A;  4CDN A;  4G2V A;  2I1J A;  4G1T A;  3TXM A;  1QYM A;  2IOL A;  4L2L A;  5JJT A;  3C98 A;  4ATG A;  5FIN A;  1HS6 A;  1Y6I A;  4ILI A;  4N2S A;  3U4T A;  1TEZ A;  4MKT A;  3FTU A;  3SQV A;  4MRU A;  5HI7 A;  4DX2 A;  5BPP A;  3D9M A;  1E90 A;  1EPU A;  2X6F A;  4V3I A;  4CGV A;  1WDY A;  3PS6 A;  4GPK A;  2J09 A;  3P1U A;  4NUR A;  3I4G A;  2H6G A;  3ZYM A;  4YDE A;  4N39 A;  4JHJ A;  4UUC A;  4TXQ A;  5JA4 D;  2CHZ A;  4HI8 A;  4G8K A;  4ANU A;  2VSO E;  5G05 J;  4EZK A;  2IOS A;  4WAF A;  2PM6 A;  4KVO A;  4AV7 A;  4OAV B;  3VLD A;  4XKC A;  4XX5 A;  3TGO A;  2FI7 A;  3EU9 A;  2RD0 A;  4EBA A;  4BX8 A;  1ELK A;  5KJM A;  2UY1 B;  2XPY A;  3C3Q A;  2XRZ A;  1UJK A;  2FEZ A;  4G26 A;  5CEA A;  3OTN A;  2R5S A;  4GZ3 A;  3G2V A;  2MOW A;  4FHJ A;  3EHM A;  4K5A B;  3C72 A;  3UXG A;  3PRE A;  4JD2 G;  1H6K A;  4WNF A;  5KJK A;  3GYZ A;  3SO8 A;  4I1M A;  2IQC A;  4DX6 D;  3GZ2 A;  1KLX A;  2R05 A;  4HNA D;  4J8E A;  3LY7 A;  3QC1 A;  5IY5 E;  4N2Q A;  2HO1 A;  3G2T A;  2JLB A;  4JL0 A;  3HHM A;  2L6J A;  3BG0 B;  4W9R A;  3LDZ A;  3UTM A;  2WB2 A;  2R17 C;  3V2X A;  2OVB A;  2XGS A;  1N95 A;  5A6C A;  5BXO A;  2H6I A;  4U96 D;  3CVU A;  2A4Z A;  2OEW A;  3CHQ A;  2AXV A;  2PQR A;  1RW2 A;  1FVH A;  1N9A A;  4HS2 A;  4I2W A;  2KCV A;  3ULQ A;  1TN6 A;  2ION A;  4H7X A;  2WXL A;  4RSY A;  3FY4 A;  4BX9 A;  2KBX A;  3B7S A;  1MYO A;  3IEG A;  2GRQ B;  3DBS A;  4DJA A;  4EPZ A;  4RG6 A;  3LJ3 A;  3B13 A;  1FCH A;  3PEU B;  3PZ1 A;  2XS8 A;  3MKR A;  2UY1 A;  3CVX A;  3D9J A;  4K0R A;  4HOT A;  4PUC A;  3PUJ A;  3B95 A;  3L16 A;  5KJL A;  2IU1 A;  3ULY A;  4EHM A;  3LEW A;  1K1B A;  3CV0 A;  2H6F A;  3MA5 A;  4BET A;  4ZFH A;  5ENO D;  1UN9 A;  3R9M A;  3U64 A;  5AIJ A;  3FTV A;  4DLO A;  4GCN A;  3RRM B;  1N4R A;  3FDH A;  5AQ9 A;  3FP3 A;  3ZYL A;  2XEV A;  5G2N A;  2P9K G;  3QAR A;  4DI3 A;  4U07 A;  1MX4 A;  2WXQ A;  3BEE A;  1FVF A;  3PE3 A;  2GRO B;  4JXT A;  3PH0 C;  3DSS A;  2FBN A;  1JUQ A;  3L9T A;  2J49 A;  5D66 A;  4WWN A;  4YVO A;  1XNF A;  2YQ8 A;  3RJV A;  4CRW A;  1K3Z D;  3HXB A;  4ACL A;  1N0Q A;  3QB2 A;  1E8W A;  4DPR A;  5ENP D;  4LUN U;  4J6I A;  4IYP A;  1PY1 A;  2MYO A;  2YIN A;  1Z3X A;  3D9K A;  4GB9 A;  2VJ8 A;  3JYS A;  4BT8 A;  3BQO A;  2H6H A;  5HKP A;  5BUZ A;  3QKY A;  5ANR A;  5JHA A;  2LNI A;  3PEV B;  3QOU A;  3D9O A;  4BSX A;  3Q7F A;  2WMO A;  1HXI A;  1OUV A;  2AW6 A;  4BT9 A;  1HE8 A;  2MHK A;  4GTO A;  1TNU A;  2EIK E;  1SVX A;  2HYZ A;  3FH8 A;  4A3V A;  1O5M A;  5FZS A;  1XGW A;  4HRN A;  3ABL E;  4OAU C;  3Q5M A;  2L6B A;  1EYH A;  4JPS A;  4G11 A;  2VSN A;  2WXK A;  1QZ2 A;  3DEO A;  1TR4 A;  3URZ A;  4TXP A;  3RAU A;  4A63 B;  2DIW A;  5LCW C;  3I5P A;  3KS2 A;  1X81 A;  3ASH A;  3ML9 A;  2C0L A;  5FQ4 A;  5AQA A;  3JQ0 A;  2X6K A;  4WUY A;  2BF0 X;  3KSL A;  5J90 A;  3E33 A;  3ZUV B;  1MQS A;  1OWM A;  3JUI A;  4JEH A;  4FAD A;  3CQG B;  2XHE A;  3AS8 A;  2XPI A;  4I6G A;  3ZYQ A;  3DSV A;  4C0E A;  4K5B A;  3CHS A;  3NBN B;  1NL4 A;  2PZI A;  4Y6C A;  5EIL A;  1ELW A;  4GML A;  3ZN3 A;  3AG2 E;  4F7A A;  2PL2 A;  2DWZ A;  2KM4 A;  3HIZ A;  2I9C A;  1JCS A;  4Y6W A;  3NZS A;  3FUH A;  4CCA A;  2DZN A;  2P9I G;  2FO7 A;  5C2Y A;  3ONL A;  3X2Q E;  4PH4 B;  3TWW A;  4UWF A;  5KWD A;  4OVV A;  5ITZ F;  2J4B A;  4C0M A;  1LD8 A;  2WXR A;  3L13 A;  4BY6 A;  3MV2 B;  4AXH A;  3CHM A;  5ARG A;  2NSZ A;  3FTY A;  4Q94 A;  2XRY A;  4JHK A;  5LX8 A;  1SZA A;  4GA0 A;  1SW6 A;  4QQI A;  1TNY A;  5CRV A;  5HS0 A;  2KCL A;  4TV3 A;  3MJW A;  4HLL A;  3UKR G;  2ETA A;  2J08 A;  1HG5 A;  3QDN A;  2UWJ G;  3UM3 A;  3ZW3 A;  5BT1 A;  3FFL A;  4AM9 A;  3IHY A;  4DRX E;  2KZT A;  3UT8 A; 
#chains in the Genus database with same CATH homology
 2RG8 A;  3S7F A;  4FJZ A;  3EIQ C;  4ILH B;  3FWV A;  4ANU A;  4KXK B;  1SZ9 A;  2XGM A;  3LPZ A;  2VSO E;  1OWO A;  4WWO A;  5G05 J;  3ZFW A;  4EZK A;  3G2S A;  4HOS A;  3U66 A;  3KAE A;  3RO2 A;  2IOS A;  3S7J A;  3I3N A;  2Y4T A;  4WAF A;  2PM6 A;  2LO6 A;  4KVO A;  2J9Q A;  4AV7 A;  4B8A A;  2L0T B;  3ASD A;  3CVW A;  3VLD A;  4XKC A;  2AWI A;  4XX5 A;  5T8I A;  3TGO A;  5G04 C;  2FI7 A;  4WWP A;  3APC A;  1QQE A;  4XKB A;  2CG3 A;  4E6H A;  4U8H A;  3Q49 B;  2Q7F A;  3OAW A;  1ELR A;  1ZU2 A;  4L23 A;  1JPL A;  2RD0 A;  3CQC B;  3SD5 A;  2R59 A;  3QAQ A;  2I6H A;  4FC8 A;  3D9P A;  3IV0 A;  3MKQ B;  4BX8 A;  1ELK A;  4EBA A;  2LSV A;  2NXP A;  4MLP A;  5KJM A;  3G2W A;  2UY1 B;  2XPY A;  4CT0 A;  3ONK A;  4UWG A;  2XRZ A;  1UJK A;  3CVL A;  2FEZ A;  4WNG A;  4AY6 A;  3I4R B;  3LCA A;  4GZC A;  4G26 A;  4F3V A;  1E7U A;  3CK7 A;  3OTN A;  2R5S A;  4GZ3 A;  2OOE A;  3B7U X;  5JJ6 A;  3G2V A;  2MOW A;  4JZY A;  4L7T A;  3ZYK A;  4A1S A;  5JJ7 A;  1JWF A;  2WMN A;  4FHJ A;  4HOR A;  3EHM A;  2WVI A;  3FUF A;  4AIF A;  3S7D A;  3FTX A;  3JQ1 A;  2PM7 A;  3PRE A;  5EDS A;  2OVF A;  4LEU A;  1IYG A;  4FU3 A;  2V0P A;  1H6K A;  1VDY A;  2FF4 A;  4WNF A;  3FH7 A;  5KJK A;  3GYZ A;  2A5U A;  3PNL B;  2I1K A;  4I1M A;  2IQC A;  3CST A;  3SBS A;  4F1S A;  3GZ2 A;  3ZEF A;  5HQ8 A;  3EHN A;  1IHG A;  1KLX A;  5DIZ A;  3AU4 A;  5E75 A;  2C2L A;  3RRU A;  4J8E A;  3LY7 A;  4BWR A;  3PRZ A;  3QC1 A;  3CK9 A;  4AY5 A;  3LKU A;  4PS3 A;  4I6E A;  3OXG A;  4BTB A;  3PUK A;  4HXI A;  2HO1 A;  1PAQ A;  3OXF A;  2J4D A;  4N2Q A;  3NZU A;  5AJL A;  5DBK A;  3G2T A;  4AEZ C;  5AEN A;  2V8S E;  5A7D B;  3ML8 A;  2JLB A;  4JL0 A;  3HHM A;  4NQ0 A;  4EBA G;  2L6J A;  3R9A B;  1HZ4 A;  3BG0 B;  3ZPJ A;  3D3M A;  2GRM A;  3L17 A;  3L54 A;  4FHK A;  4W9R A;  3LDZ A;  4A55 A;  3CHR A;  5FJY A;  2X3M A;  5KCM A;  5M72 A;  2NC9 A;  2WB2 A;  2Y3A A;  1UG3 A;  3CEQ A;  3QWV A;  4CDM A;  3LS8 A;  4IRU A;  3LVQ E;  4ABN A;  2R17 C;  1B89 A;  4UWL A;  2CFZ A;  4BTA A;  2OVB A;  5T4Y A;  5BV1 A;  3CSF A;  2XGS A;  4XI9 A;  5A6C A;  4J0U A;  2E2E A;  2OV8 A;  3SI5 A;  5FQ7 A;  3CVU A;  3PDN A;  2A4Z A;  3FUD A;  3CHQ A;  2AXV A;  2PQR A;  3MV3 B;  1FVH A;  4D10 C;  4HS2 A;  3TXN A;  3AS4 A;  4I2W A;  2KCV A;  5BNW A;  1Y8M A;  2E0I A;  3ULQ A;  4I17 A;  2VSY A;  4EZL A;  3SZ7 A;  3UT4 A;  2XGO A;  2L0I A;  4CT4 A;  2ION A;  2V4L A;  4H7X A;  4KYO B;  4OYS A;  2WXL A;  4RSY A;  4KMO A;  5JHB A;  3PZD A;  4I1A A;  3Q4A B;  3FY4 A;  3ZIM A;  4BX9 A;  1HX8 A;  3B7S A;  5FQ8 A;  3TG5 A;  2L9B A;  2XQ0 A;  3L08 A;  4JHR A;  3IEG A;  3DBS A;  3FTW A;  1HO8 A;  3RK6 A;  2VGX B;  4RG6 A;  4DJA A;  4UQY A;  4EPZ A;  3LJ3 A;  3B13 A;  1FCH A;  1IQU A;  3PEU B;  4G24 A;  3IBE A;  3TG4 A;  4FA6 A;  4C9B B;  3MKR A;  4XIF A;  2UY1 A;  4PS7 A;  4MS6 A;  2WQ7 A;  3CVX A;  3D9J A;  4OVU A;  2KCK A;  3FU3 A;  3GW4 A;  3EDT B;  4GU5 A;  2CHX A;  4K0R A;  5ARF A;  4APF A;  4O6F A;  4HOT A;  4PUC A;  3PUJ A;  3LY8 A;  3HYM B;  3JCK C;  3L6A A;  3L16 A;  3CVP A;  5ENN A;  5A23 A;  4EZJ A;  5KJL A;  3ENE A;  2IU1 A;  3LY9 A;  4Q96 A;  3FTS A;  1X5B A;  3LEW A;  1EDU A;  4N5C A;  5AJD A;  3B7R L;  5CCL A;  3CV0 A;  3MA5 A;  3ZRH A;  3FU6 A;  2VQ2 A;  4XI0 A;  5ANL A;  3VTY A;  2WXP A;  4UWH A;  1UN9 A;  3LYA A;  3U64 A;  5AIJ A;  3FTV A;  4I9E A;  2KC7 A;  3MYV A;  3T5X A;  3UT8 A;  4IUL A;  3HVE B;  4DLO A;  4GCN A;  3RRM B;  3AS5 A;  4GYO A;  3FDH A;  2P58 C;  1QNF A;  2KZT B;  2XCB A;  3FP3 A;  3DPD A;  2XEV A;  3FUM A;  3QJZ A;  2KAT A;  4I6J A;  5G2N A;  3QAR A;  3ZYL A;  4M3O A;  4FJY A;  4DI3 A;  4U07 A;  4GZ5 A;  3UUX A;  3HDX A;  3SNX A;  3TAX A;  2WXQ A;  4GZD A;  3ASF A;  2YHC A;  1OWL A;  3BEE A;  4U0S A;  4Q69 A;  1FVF A;  3PE3 A;  4HFG A;  1W3B A;  2X38 A;  4PS8 A;  5CHE E;  4AOF A;  1NA0 A;  4JXT A;  5KJN A;  5FQ6 A;  3AU5 A;  3T5V A;  2C0M A;  4ANX A;  4TUU A;  4U0U A;  5T3R A;  5FT9 A;  1UW4 B;  4KZC A;  3PH0 C;  4HLE A;  4J8D A;  3U9W A;  4URK A;  2FBN A;  4RG9 A;  1JUQ A;  4LCT A;  1H0A A;  4GA2 A;  2AXU A;  2J49 A;  3PE4 A;  4CGW A;  1ZBP A;  3MKQ A;  4WWN A;  4UQX A;  3FEX A;  4YVO A;  1XNF A;  3CHO A;  4L2Y A;  4JW1 A;  2LSU A;  3CR3 A;  1JWG A;  3CLJ A;  2VGY A;  2YQ8 A;  3RJV A;  3CK8 A;  4ANW A;  4CRW A;  3Q47 B;  4YVQ C;  4ACL A;  3FUJ A;  3QNK A;  1E8Z A;  5G05 C;  3R7Q A;  3UMV A;  3D9L A;  2WQ6 A;  3QB2 A;  4AP2 A;  5D0Q D;  5AYW D;  4FLB A;  1E8W A;  1NA3 A;  4LRZ A;  1U3D A;  2GGF A;  3APF A;  4A3T A;  4N3C A;  4XE0 A;  3RKV A;  4DPR A;  2GW1 A;  4LUN U;  4J6I A;  4N3B A;  4IYP A;  5FZR A;  1HH8 A;  5J08 A;  1E8Y A;  5FWQ A;  1Z6T A;  5LP0 A;  3SF4 A;  4AJW A;  4IN3 B;  3APD A;  3KD7 A;  1TJF A;  2M63 A;  5FZQ A;  4B89 A;  1OWP A;  1N54 A;  1H2U A;  1E8X A;  3FTZ A;  1DNP A;  4EEC A;  3SBT B;  1PY1 A;  3G2U A;  4AVX A;  2YIN A;  1Z3X A;  2YHE A;  3S7B A;  2VGX A;  4PDX A;  2CHW A;  4P29 A;  4FUL A;  3FEY A;  3ZVV A;  3D9K A;  1Z3Y A;  2CFU A;  4GB9 A;  2VJ8 A;  2X6J A;  3JYS A;  4JA7 A;  4U0Z A;  4BT8 A;  1P5Q A;  1WAO 1;  1S0P A;  2PQN A;  2BTD A;  1A17 A;  5EX0 A;  1LF8 A;  4FLH A;  2Y4U A;  4RVB A;  5BUZ A;  3QKY A;  1N52 A;  1OWN A;  3PNT B;  4JC8 A;  4U04 A;  4UI9 C;  5ANR A;  5JHA A;  3PVL A;  3RIB A;  4I43 A;  1WM5 A;  2AXZ A;  2LNI A;  3VLF A;  1E96 B;  3PEV B;  3CGH A;  4HOU A;  3QOU A;  3D9O A;  4BSX A;  5EX3 A;  2WMO A;  5E76 A;  1HXI A;  1OUV A;  4GCO A;  4H7Y A;  3RU0 A;  2VTB A;  2AW6 A;  4G23 A;  3FU5 A;  4BT9 A;  2V5F A;  3ZHE B;  3Q15 A;  1HE8 A;  5CMY A;  2VYI A;  2XPZ A;  1KT0 A;  2MHK A;  1HFA A;  3BG1 B;  4I2Z A;  4XZ4 A;  2J07 A;  1GW6 A;  2IF4 A;  4N3A A;  3SFZ A;  3QK0 A;  2HR2 A;  5C1D A;  4GYW A;  2VTB B;  4CEM A;  4UWK A;  3ESL A;  1INZ A;  5FTP A;  4ME2 A;  2QFC A;  2BUG A;  3EJN A;  4HOQ A;  4F53 A;  3EIJ A;  4JVS A;  3FU0 A;  2FUL A;  2LAH A;  1TJC A;  2WXH A;  2HYZ A;  3FH8 A;  4A3V A;  3D9N A;  4K03 A;  5FZS A;  1KT1 A;  1XGW A;  3CVQ A;  4J8S A;  2MRI A;  5G04 J;  3T8M A;  4UI9 J;  3O4Z A;  3CKB A;  2LAI A;  3Q5M A;  4R7L A;  4B8C B;  4E85 A;  1EYH A;  1MHQ A;  3LXU X;  4JPS A;  4GZ6 A;  4G11 A;  3NQP A;  3QWP A;  2EQX A;  1BPO A;  2VSN A;  2WXK A;  3CKC A;  1QZ2 A;  2X6H A;  1H19 A;  2QY7 A;  3O48 A;  4KBQ A;  4NAC A;  3SGH A;  2WXG A;  3URZ A;  3UX4 A;  3CIA A;  2XCC A;  4HVB A;  3MEK A;  2DIW A;  5LCW C;  2IJG X;  3I5P A;  4CDR A;  4DI4 A;  3N71 A;  5D0O D;  1HF8 A;  3KS2 A;  4DK5 A;  3GZ1 A;  3VLE A;  1DVP A;  2DCP A;  4J8F A;  3ASH A;  3ML9 A;  2C0L A;  4KT6 B;  5BW8 C;  5FQ4 A;  3RRN B;  3IKO B;  1U3C A;  5LOZ A;  5LFA A;  1YA0 A;  2ILR A;  3JQ0 A;  3MZL B;  2X6K A;  2X6I A;  2JEK A;  4WUY A;  2BF0 X;  5J90 A;  4GMJ A;  2GRL A;  3E4B A;  3HVE A;  3QWW A;  1MQS A;  3ASG A;  3MX3 A;  1OWM A;  3JUI A;  4I1O B;  4JEH A;  4GYY A;  4JA9 A;  3SHF A;  5G55 A;  4B94 A;  3CVV A;  3RO3 A;  4ILG A;  4APO A;  1L5J A;  1PC2 A;  3UT7 A;  4UQZ A;  4QFV A;  4U63 A;  3FUE A;  3CQG B;  3ZHE A;  4KZ0 A;  4YND A;  4FAD A;  2XHE A;  3P2B A;  3NF1 A;  5CMW A;  3TL5 A;  1SQM A;  3CVY A;  2OND A;  2WXM A;  2XPI A;  3AS8 A;  4A1G A;  4I6G A;  4JEU A;  4ACK A;  2WXJ A;  3ZYQ A;  4C0E A;  4NRH B;  4I9C A;  3CHS A;  3FUI A;  3CHP A;  2PZI A;  4Y6C A;  4ANV A;  3VTX A;  1ELW A;  4GML A;  3ZN3 A;  3OXL A;  3ZXS A;  3UPV A;  2WXN A;  2WM9 A;  1H2T C;  2CG2 A;  4F7A A;  1HU3 A;  2PL2 A;  2HM8 A;  2AVP A;  2VSX E;  2WXI A;  1NZN A;  3ESK A;  2KM4 A;  3D9I A;  2IFU A;  3HIZ A;  3FH5 A;  5LCW J;  2I9C A;  3WXX A;  5BV0 A;  3S2A A;  3B7T A;  1EF1 C;  4FP7 A;  1H2V C;  3LVR E;  4Y6W A;  3NZS A;  3FUH A;  4WNE A;  4CCA A;  1UJJ A;  2WXF A;  4KVM A;  3MCX A;  4BFR A;  5EKQ D;  4GAA A;  4CDN A;  2FO7 A;  4G2V A;  4EQF A;  3FHE A;  2I1J A;  4G1T A;  5C2Y A;  3ONL A;  2WXO A;  3TXM A;  5CCM A;  4UI9 K;  4PH4 B;  4UWF A;  2WQH A;  1IQR A;  4OVV A;  2J4B A;  4C0M A;  3IHV A;  2IOL A;  4L2L A;  5JJT A;  2WXR A;  3L13 A;  4BY6 A;  4G25 A;  3C98 A;  3MV2 B;  4AXH A;  3CHM A;  3GZS A;  5ARG A;  2NSZ A;  1UN8 A;  4ATG A;  1HS6 A;  1Y6I A;  3FTY A;  4Q94 A;  4DLQ A;  3U3W A;  3L22 A;  4ILI A;  2XRY A;  2YNQ A;  4N2S A;  2WPV A;  3U4T A;  1TEZ A;  3FUL A;  4JHK A;  3FUK A;  3FTU A;  4MKT A;  3R7R A;  5LX8 A;  1SZA A;  4GA0 A;  4MRU A;  5HI7 A;  4B0Z A;  3K9I A;  3KEZ A;  1E7V A;  5BPP A;  3D9M A;  2ZU6 B;  1E90 A;  4L1B A;  4LER A;  1EPU A;  2X6F A;  2I2O A;  1HG2 A;  2KCL A;  4V3I A;  4TV3 A;  4CGV A;  3MJW A;  3PS6 A;  4WND A;  4GPK A;  3UQ3 A;  2J09 A;  3MGB A;  3P1U A;  4NUR A;  3I4G A;  4TRQ A;  2J08 A;  1HG5 A;  3CVN A;  3QDN A;  3TJP A;  2UWJ G;  3ZYM A;  3ZW3 A;  1WY6 A;  5BT1 A;  3FFL A;  3ZGQ A;  4N39 A;  4AM9 A;  3IHY A;  3FUN A;  2DBA A;  4JHJ A;  4GA1 A;  2KZT A;  1NP7 A;  2CHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...