4UI9J

Atomic structure of the human anaphase-promoting complex
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
532
structure length
504
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVNGLEKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
total genus 179
structure length 504
sequence length 532
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ui9J00
3GYZA 3EDTB 4XI0A 3KD7A 4U07A 3GZ2A 5FJYA 4KBQA 5FTPA 2FBNA 2HR2A 4N39A 4J8FA 2KCKA 4U0ZA 2PQRA 4AIFA 2LNIA 4ME2A 2HO1A 3FWVA 5FZRA 4KYOB 2XGMA 3ASFA 4APOA 4H7XA 4JHRA 5G05C 5JJ6A 5BW8C 2E2EA 3ASHA 5CCMA 1QZ2A 4AY6A 3HYMB 2WQHA 4XI9A 2QFCA 4UQZA 5DIZA 2KATA 2OOEA 5HI7A 5KJKA 1ELRA 2WPVA 3OXFA 4WNDA 4O6FA 1TJCA 5AYWD 4UI9K 5M72A 3UPVA 4GCOA 2Y4UA 5CHEE 4GPKA 2YQ8A 3LY9A 5CCLA 5DBKA 3O48A 1NA0A 3URZA 3FP3A 2XGOA 1WM5A 1A17A 2L6JA 3CKBA 5EX3A 4BTBA 1Y8MA 2VGXA 5HQ8A 4HOSA 3N71A 1E96B 3PE3A 5EX0A 5A6CA 4I2WA 2FI7A 2R5SA 4YVQC 5LCWC 4A1SA 3KS2A 5FZSA 4GZ5A 4RG6A 1KT1A 1QQEA 4IN3B 4N3CA 1HZ4A 5G04C 2KCVA 4J8EA 2BUGA 5FT9A 2PZIA 2FEZA 3R9AB 3K9IA 4GA2A 4J8DA 3LCAA 4GYWA 3Q4AB 3QWVA 3VTXA 3ASDA 2XCCA 2UWJG 3CVPA 2VSNA 4UQYA 4BT9A 4JA7A 2FF4A 5A7DB 3TGOA 3LPZA 3CK8A 4G1TA 3SZ7A 2P58C 4HOTA 5ARFA 3MV3B 4HORA 4N2QA 5C1DA 2PL2A 3BEEA 2C2LA 3TG4A 1P5QA 4N3BA 2XPIA 3AS4A 3IEGA 3CVLA 3UQ3A 4BTAA 4HOUA 4AM9A 3GZ1A 4I17A 1ZU2A 4GZ3A 1ELWA 3ULQA 1KLXA 2VYIA 4GCNA 4Y6CA 4EQFA 3LY7A 4I1AA 3QOUA 3OXLA 3ASGA 3SF4A 3TAXA 3S7DA 4U0SA 2C0MA 2LSUA 3RU0A 2LSVA 3TG5A 2VSYA 4G23A 3AS5A 4AY5A 1YA0A 5BT1A 3CK9A 4BWRA 4UQXA 3ESKA 3PE4A 3GW4A 2XGSA 3WXXA 4U04A 5FZQA 2MHKA 1NZNA 2IF4A 5BNWA 4UI9J 4GYYA 3JYSA 3NF1A 4G26A 5ARGA 2GW1A 3OXGA 3U3WA 4WNEA 4YVOA 2VGXB 1NA3A 4N2SA 3ZPJA 5KJLA 3MV2B 3ZFWA 4GZ6A 1IHGA 4RG9A 3ZN3A 3KAEA 3E4BA 2FO7A 5G04J 3CEQA 4ABNA 3MEKA 4I9CA 5JJ7A 2V5FA 4GYOA 1WAO1 4GA0A 3ZHEA 4N5CA 2XCBA 1B89A 3CVQA 4CDRA 1FCHA 3QWPA 4WNGA 2I6HA 4CGWA 4LEUA 4CGVA 4WUYA 3S7BA 3U4TA 3Q47B 3VTYA 4JA9A 3FFLA 3CVNA 3ZGQA 5EKQD 4KXKB 3QKYA 4HOQA 5D0OD 1XNFA 4J0UA 1HXIA 3UUXA 4G24A 3ZHEB 2AVPA 2VQ2A 3QWWA 4B94A 4N3AA 2PQNA 3S7JA 4F3VA 1W3BA 5G05J 3LKUA 2VGYA 3CKCA 2Y4TA 4I9EA 3S7FA 2Q7FA 4YNDA 4I2ZA 4JL0A 3MA5A 1KT0A 3RIBA 3PDNA 3CK7A 3LY8A 3RO3A 3RO2A 3CV0A 3MKRA 2XEVA 5KJNA 3Q49B 4BT8A 3AS8A 2UY1A 4Y6WA 3LYAA 3QDNA 4UI9C 2KC7A 2NC9A 4NQ0A 5KJMA 3Q5MA 2C0LA 3RKVA 2DBAA 4W9RA 1HH8A 2J9QA 4GA1A 4G2VA 2IFUA 1PC2A 4XIFA 2KCLA 4G25A 3RJVA 4U0UA 4H7YA 2ONDA 2UY1B 5JJTA 4NRHB 2YHCA 4WNFA 2HYZA 1OUVA 2JLBA 3Q15A 5D0QD 5LCWJ 1ZBPA 1IYGA
chains in the Genus database with same CATH superfamily
5BXUA 3QC1A 2P9PG 3GYZA 4MBGA 1D9SA 1HFAA 1O1RA 1U2VG 1G3NB 3J5PA 3I4GA 3APDA 4U07A 4ZHBA 3D9OA 4F1PA 5FJYA 3JXIA 2BF0X 2VGEA 4BSXA 3G2WA 4CT4A 4DX1A 3TWRA 4HNAD 2RFMA 2HR2A 4N39A 2DZOA 4MLPA 4AVXA 1DNPA 2LUHA 4EBAA 2X3MA 3NB2A 2LNIA 4BESA 3FUJA 2WMNA 4WWOA 1KPSB 5EDSA 3ABLE 2LO6A 2XGMA 4LSZE 2MOWA 4JHRA 3E32A 1NI1A 2ZISA 2DYSE 3EIJA 2OV8A 2E2EA 2IJGX 5CCMA 3CHRA 5C2YA 3I3NA 4EECA 2WQHA 4U8VD 4PS8A 2QFCA 4UQZA 5DIZA 4GB9A 4I6JA 2KATA 4TXPA 5H7PA 3W9FA 1N0RA 5HI7A 4KZCA 4HRNA 2VSOE 3ASOE 1EF1C 3B7UX 4O6FA 3D9IA 2WXQA 4M3OA 4UI9K 1WG0A 1OCCE 5E76A 5M72A 3UPVA 2Y4UA 3KSLA 2CFUA 3LY9A 5DBKA 2R17C 5CEDB 2XZTG 3PRZA 5LFAA 1SZAA 4GZDA 3URZA 2QYUA 4B8AA 3APFA 3UM1A 2GRPB 1Y8MA 2VGXA 5HQ8A 2YINA 3N71A 1BI7B 3CQCB 5D2MC 3PE3A 2XRYA 1Z3XA 2R5SA 4DPRA 3Q7FA 4GTVA 5FZSA 4RG6A 2GROB 2WXPA 4IN3B 4K5AB 3UM0A 4FA6A 2HE0A 2PZIA 1N4RA 2JEKA 2X6HA 4J8DA 3U9WA 3CSTA 3CVXA 1N94A 3L22A 3FUEA 3I5PA 3ASDA 3QWVA 2XCCA 3VTXA 4DX6D 2FF4A 1DVPA 4ZFHA 5A7DB 3AG2E 4J8SA 4EPZA 3FTZA 2EILE 3MV3B 4FU3A 3DEPA 4HORA 4N2QA 5C1DA 5AENA 3RAUA 1O1SA 5AJDA 3TWXA 3D9JA 4BTAA 4HOUA 4AM9A 4I17A 4L9PA 5CMWA 2LXLA 1H19A 1N95A 1ELWA 5AQBA 3FUNA 3B7BA 2VYIA 3APCA 3LY7A 4XX5A 2R03A 3PS6A 5EN5D 3OXLA 3TWVA 2LAIA 5EYPF 1WDYA 2CG2A 3ASGA 4JHJA 3S7DA 2C0MA 3FUIA 5AARA 1JCQA 4JB8P 3TG5A 4OAVB 4AY5A 5BT1A 1WY6A 4UQXA 3ESKA 1E8ZA 2DYRE 4LNUD 5EIBE 3GW4A 5EIDA 2WQ6A 3WXXA 4GU5A 4PS3A 4CRWA 1BLXB 3DSVA 3SY2A 2CFZA 5BNWA 4U95D 2V4HC 3Q79A 4UI9J 5AN8A 4K5CA 2QZAA 4FLBA 4G26A 3E30A 3CSFA 2GW1A 2VSXE 5E75A 2WXNA 4WNEA 4YVOA 1YCSB 5D66A 3CQGB 2IEJA 5EILA 1UJKA 4ATGA 5IY5E 5ENRD 4CYMD 4PH4B 4BEPA 4F53A 4HBDA 3HG0D 3ZFWA 3DXMG 4DLQA 5CRUA 4LG6A 1Q2ZA 1RZ4A 4CCAA 1UN8A 2LXMA 3KAEA 3RRUA 1JWFA 2CHZA 3D9KA 5G04J 3EHRA 3IHYA 3MEKA 4EBAG 4I9CA 3MJWA 2V5FA 5HRYA 4CDMA 3BG0B 4BETA 3ZHEA 2GGFA 1B89A 3ZKJA 2IOLA 3W9GA 1FCHA 2I1KA 4CGWA 3PUKA 3DRAA 2RD0A 1TNOA 1EDUA 2OEWA 3ZGQA 5EKQD 3DSSA 2J4DA 3QKYA 1OXJA 1K1BA 3EIQC 4J0UA 3NOGD 3HVEA 3TWQA 3ZHEB 2P9IG 4GAAA 3ZRHA 1KZPA 3FTSA 5HS0A 3LKUA 3PEVB 4CZ2D 3SHFA 5AAOA 3FUFA 3CKCA 2Y4TA 4FP7A 1HO8A 4I2ZA 4JL0A 3MA5A 1KT0A 3RIBA 1S64A 4L2LA 3DEOA 3CK7A 2NXPA 3HVEB 1Y6IA 3Q73A 3RO2A 3CV0A 1TNUA 3MKRA 4GTSA 1FVHA 3EJNA 2BEDA 3Q49B 3B13A 5CRVA 1JPLA 4UI9C 4BFRA 4I43A 2NC9A 4P29A 3EU5A 4IRUA 1N9AA 4I1OB 5J08A 3CVVA 2J9QA 4GA1A 4EZKA 1PC2A 2F8YA 2KCLA 3P1UA 2WXIA 3AG4E 3QJZA 1TR4A 3FH5A 1X81A 4A3VA 3FTYA 5JJTA 3QAQA 3BQOA 1TN6A 3KEAA 5CECB 3FU3A 1OY3D 1TN7A 1VDYA 1SA5A 4NIKA 4YDYA 3ZVVA 3PEUB 3L9TA 3HRAA 1MYOA 4U8HA 2XPZA 5ANRA 4JXTA 4C9BB 1FT2A 3KD7A 1OCRE 4BY6A 4U96D 3CIAA 3T8KA 1MX4A 4B89A 2FBNA 2KCKA 3MYVA 4LUNU 4GZCA 1U3CA 2Y1LE 3QB2A 1N4QA 3ASFA 4APOA 4TXQA 1OWLA 4H7XA 2J09A 4TV3A 4IYPA 4ILGA 1Z3YA 3UI2A 1QZ2A 3JUIA 4HLEA 3CVUA 2J07A 4XI9A 1OWNA 1Z5SC 3R7QA 3HDXA 1ELRA 3PZ1A 3FUMA 1K8KG 1TJCA 4HB5A 3NZSA 3DPDA 4GCOA 2QY7A 1A5EA 4FADA 3CLJA 1SW6A 1NA0A 4DLOA 4Q96A 2NYJA 1FVFA 3CKBA 2DZNA 4BTBA 3CHMA 2OVBA 3ULYA 3B95A 1FPPA 5G55A 5B1BE 3HXFA 5A6CA 4I2WA 3SD5A 3MGBA 3FHEA 3L17A 1KT1A 1QQEA 3MZLB 4RQIA 3SQVA 5CBOA 2ZU6B 2KCVA 1TJFA 3L08A 4ANWA 2CG3A 3GZSA 4FHJA 3MKQA 4DK5A 1TN8A 2UWJG 4XE0A 3UKRG 1QBQA 4V3IA 2IO3C 1S70B 3LPZA 3B7TA 2EIME 3V79K 2P9NG 1JUQA 2R05A 3T9KA 2X38A 2ZGGA 4G1TA 3UIPC 3SZ7A 3PZ3A 2P58C 1L5JA 3MKQB 5ARFA 3MCXA 4J7WA 3BEEA 3C98A 1XGWA 3ABKE 3IEGA 4JVSA 5G2NA 1E8WA 4GZ3A 3ULQA 1KLXA 3X2QE 4WWNA 3HXBA 2EINE 4Y6CA 3BU8A 3G2TA 5KWDA 1BU9A 5EYLA 3ULEG 2IONA 3D9HA 4U0SA 1H6OA 1EPUA 3RU0A 1E8YA 2YNQA 3AG1E 3L16A 2V8SE 1YA0A 3CK9A 4BWRA 4ATZD 4Q94A 4ILIA 3PE4A 4HQDA 2H6IA 3ABME 2ETAA 4GTRA 3T5VA 2MHKA 2L0IA 1NZNA 4KVMA 4OAUC 2OCCE 3VLDA 3V2XA 3QNKA 4A63B 2Y69E 1MJ0A 3DBSA 2X6IA 3CVWA 1TNYA 3FU5A 2XS8A 2VGXB 4B93B 3UT8A 4N2SA 3FTVA 2OEVA 3ZPJA 2EIJE 4K5BA 1E8XA 4OVUA 1IHGA 4RG9A 2IY0C 3TWTA 3CEQA 4ABNA 1AWCB 1OT8A 4GYOA 5LX8A 3CVQA 1TEZA 1BI8B 1JCSA 4CDRA 3QWPA 4CGVA 4WUYA 2FULA 4EZJA 1QYMA 3Q9NC 5B3SE 5JHBA 4U8YD 2WXMA 3PVLA 5D0OD 4UWFA 1XNFA 1HXIA 1NL4A 2VTBA 4U7EB 4YDEA 4GMLA 4B94A 4N3AA 4F3VA 1HU3A 4O60A 4F6RD 2VGYA 3EU9A 3R7RA 3DWLG 4DX2A 1E7VA 1H2TC 2Q7FA 3UMVA 2B0OE 3PDNA 5ENSD 3PNLB 3SFXA 3LY8A 4GMRA 2VTBB 3U64A 2AJAA 4FULA 4BT8A 5ANLA 2UY1A 3UIOC 2KC7A 3SFYA 5BUZA 4I6GA 1V54E 3Q5MA 1N4SA 2C0LA 2A4ZA 3RKVA 2DBAA 1HH8A 4KVOA 4G25A 2XZDG 3UM3A 1JCRA 4U0UA 4HI8A 4JW1A 4CEMA 2UY1B 3G2UA 3VLEA 4TRQA 3TXMA 4I1MA 4BERA 5D0QD 5LCWJ 1IYGA 5AQ7A 2IQCA 4TXRA 3RSEG 5FQ7A 2DIWA 5CEAA 4XI0A 4HFGA 3UT7A 3GZ2A 4KBQA 4KT6B 3QARA 4TUMA 2RG8A 4J8FA 1IQUA 4TUUA 4Z68A 4JZYA 3ZU7B 4DJAA 5KBAA 2WXLA 2FO1E 2PQRA 4ME2A 2ETBA 2HO1A 5FZRA 3FWVA 3L54A 2AXUA 4KYOB 4K03A 2PNNA 1OWMA 3UM2A 4U63A 4IULA 4L7TA 3Q75A 5ITZF 5JJ6A 2WB2A 3ASHA 4GMJA 3T8MA 3FU0A 4FHKA 5ENTD 4I6EA 1D8EA 2H6GA 3L82A 4XEIG 3NAWA 4LCTA 1KZOA 5KJKA 3DSUA 1H6KA 3RRNB 2KZTA 2WPVA 4APFA 3TWSA 3DPYA 3PNTB 3ZXPA 3LJNA 4GPKA 2YQ8A 3O48A 4F7AA 1FT1A 3ESLA 3C5RA 1NFIE 1K3ZD 1SZ9A 3FP3A 3SGHA 4BX8A 1WM5A 4YDOA 4MRUA 2L6JA 1S63A 2KZTB 3PREA 1INZA 3F6QA 4DI4A 4LRZA 5JMND 5ENOD 4J6IA 3FTWA 4O1OA 5EX0A 3TWWA 4AP2A 2XPYA 4YVQC 5LCWC 3KS2A 3BUAA 1HX8A 4URKA 2CHWA 5G04C 3ZYMA 1N52A 4JPSA 4A1GA 1HF8A 3HHMA 3ZYLA 2WXRA 2BUGA 2FEZA 3R9AB 5AJLA 5BXOA 3MX3A 3SBSA 4FC8A 3LVQE 2DCPA 4FJYA 4DX7D 3SBTB 3CVPA 3LEWA 2IU1A 2VSNA 4UQYA 3Q78A 5AQ9A 4BT9A 1EYHA 1QNFA 4PUCA 3TXNA 4HOTA 2RKKA 3DSWA 1OCOE 1MX2A 2C2LA 1O1TA 3TG4A 3VLFA 2XPIA 3SI5A 4AEZC 2DWZA 4LERA 1NP7A 4PS7A 3C3RA 1ZU2A 4DRXE 4EQFA 3FDHA 1Z6TA 2J08A 3PZ2A 1HS6A 4AJWA 2WM9A 3QOUA 3LXUX 5KNGA 3S2AA 2WMOA 3AAAC 3SF4A 3TAXA 2IO2C 4GTMA 2ILRA 1IKND 1MQSA 3DSXA 4A55A 3TL5A 2VSYA 1TNBA 3U66A 1DCEA 4MKTA 2JABA 2P2CP 2A5EA 3UX4A 2XGSA 4U04A 5FZQA 1UOHA 1H6PA 1TNZA 3NF1A 2R59A 4DUIA 4Q69A 5JA4D 3L13A 3Q9UC 2DVWA 1E90A 4RVBA 3U3WA 1SQMA 5BV0A 3ZUVB 1N4PA 2ZIRA 3NQPA 3FY4A 3MV2B 2L0TB 4ACLA 4UWLA 3D9PA 4GZ6A 1LTXA 2F8XK 3FH7A 3FH8A 4M7CA 3E4BA 1X5BA 2FO7A 4CDNA 1U3DA 3G2VA 3PH0C 2EQXA 5CBNA 4HI9A 4XKCA 4HS2A 4EHMA 1BD8A 1H2UA 3HIZA 2XCBA 1HG2A 2WXHA 4ILHB 4L2YA 2I6HA 1SVXA 1OWOA 3P2BA 4LEUA 2WXGA 4G8LA 3ONLA 3NBNB 3HXDA 3U4TA 2V4LA 1PAQA 3Q47B 5B1AE 2EIKE 5BPPA 4JA9A 3FFLA 3V2OA 4KXKB 3HXEA 4HOQA 4C48B 3UUXA 2ZGDA 1MZCA 1ZB1A 3C3QA 4E6HA 1AP7A 5J90A 2AVPA 1HG5A 2PQNA 3S7JA 4FJZA 1H0AA 2XS1A 3C3OA 4L1BA 5G05J 1K1AA 3RK6A 4I9EA 3RRMB 3S7FA 4EZLA 1UG3A 5FQ8A 4LNBA 2GRNB 3RO3A 1OWPA 5FQ4A 4UWGA 3L6AA 2XEVA 1HE8A 4YDWA 5KJNA 3AS8A 1N11A 4Y6WA 2P9LG 3LYAA 3QDNA 3IXEA 4NQ0A 5CERB 1DC2A 2AWIA 2QC9A 4W9RA 2H6HA 4G2VA 3SO8A 3EHMA 5LP0A 4JC8A 4X8QA 3E33A 1LF8A 2E0IA 2KM4A 4H7YA 4NRHB 2B6CA 5T8IA 4WNFA 3EUVA 2HYZA 3JCKC 4F1SA 3J5QB 4UUCA 1OUVA 2NSZA 3FUKA 3DSTA 3KEZA 4ANXA 3ISMC 5JHAA 1UN9A 3UT4A 2M63A 1ZBPA 4OVVA 4ACKA 2J49A 1UW4B 3JUEA 4WAFA 2GRLA 3LJ3A 3ZNGA 4WWPA 3EDTB 2P9KG 1LD8A 4JD2G 3FUHA 2AXZA 3G2SA 3D3MA 3V31A 3QK0A 4QFVA 4C0EA 4HXIA 5FTPA 3UINC 3TWUA 3ML8A 4NURA 4U0ZA 5A23A 4AIFA 2AW6A 2PM6A 3LS8A 4NACA 2BTDA 2XEEA 5ENNA 3UTMA 3FEXA 5FWQA 5G05C 3AU5A 2WXJA 4AXHA 5BW8C 1V55E 3IV0A 3R9MA 2Y3AA 3ENEA 4AY6A 2VJ8A 3HYMB 2MRIA 4KMOA 2WXOA 2OOEA 1H2VC 4L23A 1TYQG 4R7LA 1YYHA 4JEHA 3OXFA 3B7SA 2BKGA 4WNDA 5AYWD 5HKPA 5CHEE 5CCLA 4QQIA 3UXGA 2R02A 1O5MA 2XRZA 2WVIA 3ASNE 4UWHA 2XEHA 2XGOA 3E34A 4GTOA 4G8KA 1A17A 2P9UG 3AJIA 3ZXSA 5EX3A 3CR3A 3CVYA 4HVBA 4HOSA 4A3TA 3TJPA 1BPOA 1E96B 2FI7A 4GTPA 1RW2A 4A1SA 4GZ5A 3FTUA 2RFAA 4N3CA 4BSZB 1HZ4A 1MX6A 3LVRE 1N0QA 4AOFA 3V30A 4D10C 3C72A 3OTNA 5ENPD 2A5UA 4J8EA 5FT9A 3K9IA 4GA2A 3LCAA 3Q7AA 3ML9A 4GYWA 1IQRA 5T3RA 3Q4AB 3FTXA 2P9SG 2X6FA 4RSYA 4HRMB 4JA7A 4JHKA 3CGHA 5ENQD 3EHQA 3FUDA 3TGOA 2J8SD 3LDZA 3CK8A 4MS6A 2OVFA 1SA4A 2F37A 1DCQA 5LOZA 3CHPA 1N54A 3D9MA 2PL2A 3BG1B 4ANVA 1P5QA 3DXKG 4N3BA 3D9NA 2WXFA 3AS4A 3JQ0A 3UKUG 3CVLA 3UQ3A 3IBEA 4HRLA 3GZ1A 2H6FA 2L6BA 4GTQA 4GCNA 2L9BA 4I1AA 4RLYA 3PUJA 4N5QA 4ANUA 1GW6A 5KCMA 1ELKA 2LSUA 3PZ4A 2XENA 2LSVA 2R2LA 3OAWA 4G23A 3AS5A 2GRRB 1IHBA 2F0YA 4JEUA 2GRMA 4DI3A 1S0PA 3ZYQA 2IF4A 2KXPC 2GRQB 1E7UA 5FINA 4GYYA 3JYSA 5ARGA 2I9CA 3PZDA 2X6KA 4B8CB 3OXGA 2WQ7A 4AV7A 4LNGA 3SFZA 2I2OA 1NA3A 3EHNA 3IKOB 2CHXA 4FLHA 5KJLA 3JXJA 3FEYA 3O4ZA 4BX9A 3ZN3A 2BKKB 1D8DA 5CMYA 1MHQA 4E85A 3CHQA 1UJJA 5JJ7A 5FQ6A 2WXKA 4K0RA 2V5QC 1WAO1 3AG3E 4GA0A 4DX5D 2KBXA 4N5CA 4UWKA 2J4BA 3SNXA 2LAHA 3E37A 4OYSA 2HM8A 4J8YA 3D9LA 4WNGA 3KSQA 4GTTA 5BV1A 2PM7A 4PDXA 3S7BA 3NOCD 2XQ0A 2ETCA 3VTYA 3ZIMA 3ZEFA 5AQAA 3CVNA 3HXCA 3FU6A 3JQ1A 3CHSA 4G24A 3AU4A 3ONKA 2VQ2A 3NZUA 3QWWA 2IOSA 1W3BA 3ZW3A 3IHVA 1LD7A 4CT0A 4B0ZA 3FULA 3I4RB 4YNDA 5KNHD 5FIOA 5AIJA 2ZXWE 2V0PA 2MYOA 4XZ4A 1JWGA 2I1JA 4C0MA 3B7RL 5KJMA 3T5XA 2X6JA 1IXVA 2YHEA 2AXVA 3CHOA 2IFUA 4XIFA 4O1PA 2Y0BG 4KZ0A 3RJVA 4XKBA 5T4YA 1OCZE 2ONDA 4GPMA 1YMPA 2YHCA 4G11A 2QYJA 4HLLA 3WG7E 2JLBA 2XHEA 1PY1A 3Q15A 3ZYKA
chains in the Genus database with same CATH topology
4ACKA 2IQCA 3QC1A 3GYZA 2J49A 1UW4B 4WAFA 1HFAA 2GRLA 3LJ3A 5FQ7A 4U8HA 2XPZA 5ANRA 4WWPA 2DIWA 3EDTB 4JXTA 4C9BB 4XI0A 4HFGA 3I4GA 3APDA 3KD7A 3FUHA 2AXZA 3UT7A 4U07A 3D9OA 3GZ2A 3G2SA 3D3MA 4BY6A 3QK0A 4QFVA 4C0EA 3CIAA 5FJYA 4KBQA 4KT6B 4HXIA 2BF0X 5FTPA 4BSXA 4B89A 3G2WA 4CT4A 3QARA 2FBNA 3ML8A 2HR2A 2RG8A 4J8FA 4N39A 1IQUA 2KCKA 4MLPA 3MYVA 4NURA 4U0ZA 4AVXA 4LUNU 1DNPA 4TUUA 4JZYA 4GZCA 4DJAA 5A23A 1U3CA 4EBAA 2X3MA 2WXLA 2PQRA 4AIFA 2LNIA 2AW6A 2HO1A 2PM6A 3FWVA 3QB2A 3FUJA 3L54A 4ME2A 2WMNA 4WWOA 5FZRA 2AXUA 5EDSA 3LS8A 2LO6A 4K03A 4KYOB 4NACA 2XGMA 1OWMA 3ASFA 2BTDA 5ENNA 4APOA 4U63A 3FEXA 4IULA 2MOWA 4L7TA 1OWLA 4H7XA 4JHRA 2J09A 5FWQA 5G05C 5JJ6A 3AU5A 4TV3A 2WXJA 4AXHA 3EIJA 4IYPA 5BW8C 2OV8A 2E2EA 3ASHA 2IJGX 3IV0A 4GMJA 3CHRA 1Z3YA 2Y3AA 3FU0A 4FHKA 4ILGA 5C2YA 3T8MA 1QZ2A 3ENEA 3JUIA 4HLEA 3CVUA 3I3NA 2J07A 4AY6A 2VJ8A 3HYMB 4EECA 2WQHA 2MRIA 4PS8A 4XI9A 1OWNA 2QFCA 4UQZA 4KMOA 5DIZA 4I6EA 4GB9A 2WXOA 4I6JA 2KATA 2OOEA 1H2VC 4L23A 4R7LA 4LCTA 5HI7A 5KJKA 4KZCA 3R7QA 1H6KA 3HDXA 3RRNB 2KZTA 4JEHA 1ELRA 2VSOE 2WPVA 4APFA 3OXFA 3B7SA 1EF1C 3FUMA 3B7UX 3PNTB 4WNDA 4O6FA 3D9IA 1TJCA 5AYWD 3NZSA 2WXQA 4M3OA 4UI9K 5M72A 3UPVA 5E76A 3DPDA 4GCOA 2Y4UA 5CHEE 2CFUA 2YQ8A 2QY7A 3LY9A 5DBKA 5CCLA 4GPKA 4FADA 2R17C 3O48A 3CLJA 4F7AA 2WB2A 3ESLA 3PRZA 5LFAA 1SZAA 1SZ9A 2XRZA 2WVIA 4GZDA 1NA0A 3URZA 3FP3A 3SGHA 4BX8A 4UWHA 4DLOA 2XGOA 1WM5A 4Q96A 1A17A 1FVFA 4MRUA 2L6JA 3ZXSA 3CKBA 2KZTB 3PREA 4B8AA 1INZA 3APFA 5EX3A 3CR3A 4BTBA 3CHMA 3CVYA 4DI4A 1Y8MA 2OVBA 4LRZA 2VGXA 4HVBA 5HQ8A 2YINA 4HOSA 4A3TA 3TJPA 3N71A 3CQCB 5G55A 4J6IA 3FTWA 1BPOA 1E96B 3PE3A 5EX0A 5A6CA 4I2WA 2XRYA 2FI7A 1Z3XA 3SD5A 4AP2A 2XPYA 2R5SA 4DPRA 4YVQC 5LCWC 3MGBA 4A1SA 3KS2A 5FZSA 4GZ5A 3FTUA 3FHEA 4RG6A 1HX8A 3L17A 4URKA 2WXPA 1KT1A 1QQEA 3MZLB 4IN3B 4N3CA 1IYGA 1HZ4A 2CHWA 5G04C 3ZYMA 3LVRE 4AOFA 4D10C 2ZU6B 1N52A 4JPSA 4A1GA 2KCVA 1TJFA 4FA6A 1HF8A 3L08A 3HHMA 3OTNA 3ZYLA 2WXRA 2A5UA 2CG3A 4ANWA 4J8EA 2BUGA 5FT9A 2PZIA 2FEZA 3R9AB 5AJLA 2JEKA 3GZSA 2X6HA 3K9IA 3MX3A 4FHJA 4GA2A 4FC8A 4J8DA 3LVQE 3LCAA 3SBSA 3MKQA 3ML9A 4GYWA 2DCPA 4FJYA 1IQRA 5T3RA 3U9WA 3CSTA 3Q4AB 3CVXA 3L22A 3FTXA 3FUEA 3ASDA 3I5PA 2XCCA 3QWVA 3VTXA 4DK5A 2UWJG 3SBTB 2X6FA 3CVPA 4RSYA 3LEWA 2IU1A 2VSNA 4UQYA 4BT9A 4JA7A 4JHKA 2FF4A 3CGHA 4XE0A 1DVPA 3FUDA 1EYHA 4V3IA 5A7DB 3TGOA 3LPZA 1QNFA 3B7TA 3LDZA 3CK8A 1JUQA 4MS6A 2OVFA 2X38A 4G1TA 3SZ7A 2P58C 4J8SA 1L5JA 4PUCA 3TXNA 4HOTA 3MKQB 5LOZA 4EPZA 3FTZA 5ARFA 3MV3B 3MCXA 4FU3A 3CHPA 4HORA 4N2QA 5C1DA 1N54A 3D9MA 2PL2A 5AENA 3BEEA 3BG1B 4ANVA 2C2LA 3C98A 3TG4A 1XGWA 1P5QA 4N3BA 3D9NA 3VLFA 2WXFA 2XPIA 3AS4A 3IEGA 3SI5A 4JVSA 3JQ0A 5AJDA 3CVLA 4AEZC 4LERA 1NP7A 3D9JA 3UQ3A 4BTAA 3IBEA 4PS7A 4HOUA 5G2NA 4AM9A 1E8WA 3GZ1A 4I17A 1ZU2A 4GZ3A 5CMWA 1H19A 1ELWA 3ULQA 3FUNA 1KLXA 2VYIA 4WWNA 4GCNA 4Y6CA 4EQFA 2L9BA 3FDHA 1Z6TA 2J08A 3G2TA 1HS6A 3APCA 3LY7A 4AJWA 4I1AA 4XX5A 2WM9A 3QOUA 3PS6A 3LXUX 3OXLA 2LAIA 3PUJA 4CGWA 2CG2A 3S2AA 2WMOA 3ASGA 4ANUA 1GW6A 2IONA 3SF4A 5KCMA 3TAXA 4JHJA 2ILRA 3S7DA 4U0SA 1MQSA 2C0MA 3FUIA 4A55A 1ELKA 2LSUA 1EPUA 3RU0A 3TL5A 2LSVA 3TG5A 2VSYA 1E8YA 2YNQA 3U66A 3L16A 3OAWA 4G23A 4MKTA 3AS5A 4AY5A 2V8SE 1YA0A 5BT1A 3CK9A 1WY6A 4JEUA 4Q94A 3ESKA 4UQXA 4ILIA 3PE4A 4BWRA 1E8ZA 2GRMA 3GW4A 3UX4A 4DI3A 2WQ6A 2XGSA 3WXXA 4U04A 5FZQA 4GU5A 3T5VA 1S0PA 2MHKA 4PS3A 3ZYQA 2L0IA 4CRWA 1NZNA 2IF4A 2CFZA 4KVMA 5BNWA 1E7UA 4UI9J 4GYYA 3JYSA 3VLDA 3QNKA 4FLBA 3NF1A 4G26A 2R59A 5ARGA 4Q69A 3L13A 3CSFA 2GW1A 2VSXE 5E75A 3DBSA 2I9CA 3PZDA 2X6KA 4B8CB 3OXGA 2WQ7A 1E90A 2X6IA 4RVBA 2WXNA 3CVWA 3U3WA 1SQMA 4WNEA 4YVOA 4AV7A 5BV0A 3FU5A 3CQGB 2VGXB 3SFZA 2I2OA 3UT8A 1NA3A 3EHNA 3IKOB 2CHXA 1UJKA 4FLHA 4ATGA 4N2SA 3FTVA 3NQPA 3ZPJA 5KJLA 4PH4B 1E8XA 3FY4A 3MV2B 2L0TB 3FEYA 4F53A 4ACLA 3ZFWA 4UWLA 3O4ZA 3D9PA 4GZ6A 4OVUA 4DLQA 1IHGA 4RG9A 4BX9A 3ZN3A 3FH7A 4CCAA 3FH8A 1UN8A 3KAEA 3E4BA 5CMYA 3RRUA 1MHQA 1JWFA 4E85A 2CHZA 3D9KA 1X5BA 2FO7A 3CHQA 5G04J 4CDNA 1U3DA 3CEQA 4ABNA 3IHYA 3MEKA 3G2VA 1UJJA 4EBAG 4I9CA 3PH0C 3MJWA 5JJ7A 2EQXA 2V5FA 5FQ6A 4XKCA 2WXKA 4GYOA 4K0RA 4HS2A 5LX8A 1WAO1 4CDMA 3BG0B 4GA0A 3ZHEA 1H2UA 3HIZA 2GGFA 4N5CA 2XCBA 1HG2A 4UWKA 1B89A 2WXHA 3CVQA 2J4BA 1TEZA 4ILHB 3SNXA 2LAHA 2IOLA 4OYSA 4CDRA 2HM8A 4L2YA 1FCHA 2I1KA 3D9LA 2I6HA 3QWPA 4WNGA 5BV1A 1OWOA 3P2BA 4LEUA 2PM7A 4WUYA 2FULA 4PDXA 2WXGA 4EZJA 4CGVA 3PUKA 3ONLA 3S7BA 3U4TA 5JHBA 2V4LA 2XQ0A 1PAQA 3Q47B 2RD0A 2WXMA 3VTYA 3ZIMA 5BPPA 1EDUA 4JA9A 3ZEFA 3FFLA 3CVNA 3ZGQA 5EKQD 3PVLA 2J4DA 4KXKB 3QKYA 4HOQA 3EIQC 4UWFA 5D0OD 3FU6A 1XNFA 3JQ1A 1HXIA 4J0UA 3UUXA 3HVEA 3CHSA 4G24A 4E6HA 3ZHEB 2VTBA 3AU4A 4GAAA 5J90A 2AVPA 3ONKA 2VQ2A 4GMLA 3NZUA 3QWWA 4B94A 1HG5A 4N3AA 2PQNA 3S7JA 2IOSA 4FJZA 1H0AA 4F3VA 3ZRHA 4L1BA 1W3BA 3FTSA 5G05J 3RK6A 3ZW3A 3IHVA 3LKUA 3PEVB 1HU3A 2VGYA 4CT0A 3R7RA 3SHFA 4B0ZA 3FUFA 3CKCA 2Y4TA 3FULA 1HO8A 3I4RB 4FP7A 1E7VA 4I9EA 1H2TC 3RRMB 3S7FA 2Q7FA 4YNDA 4I2ZA 4EZLA 1UG3A 3UMVA 4JL0A 3MA5A 5FQ8A 1KT0A 3RIBA 3PDNA 5AIJA 4L2LA 3CK7A 3PNLB 2NXPA 3LY8A 3HVEB 2V0PA 1Y6IA 3RO3A 2VTBB 1OWPA 3RO2A 3CV0A 5FQ4A 4UWGA 3L6AA 3MKRA 2XEVA 1HE8A 3U64A 1FVHA 3EJNA 4FULA 5KJNA 3Q49B 5ANLA 3AS8A 3B13A 4XZ4A 4BT8A 2UY1A 4Y6WA 1JWGA 1JPLA 3LYAA 3QDNA 2I1JA 4UI9C 4BFRA 2KC7A 5BUZA 4I43A 4C0MA 2NC9A 4I6GA 3B7RL 4NQ0A 5CCMA 5KJMA 4P29A 3T5XA 2X6JA 4IRUA 2AWIA 3Q5MA 4I1OB 2C0LA 2YHEA 5J08A 3CVVA 2A4ZA 2AXVA 3CHOA 3RKVA 2DBAA 4W9RA 1HH8A 2J9QA 4GA1A 4KVOA 4EZKA 4G2VA 3EHMA 1PC2A 2IFUA 5LP0A 4XIFA 4JC8A 2KCLA 3P1UA 2WXIA 4G25A 3QJZA 3FH5A 4KZ0A 1LF8A 3RJVA 4XKBA 2E0IA 5T4YA 2KM4A 4U0UA 4JW1A 4A3VA 4CEMA 4H7YA 3FTYA 2ONDA 2UY1B 5JJTA 3QAQA 4NRHB 3G2UA 3VLEA 5T8IA 2YHCA 4G11A 4WNFA 2HYZA 3JCKC 4F1SA 4TRQA 1OUVA 2NSZA 3FUKA 2JLBA 3FU3A 3TXMA 1VDYA 2XHEA 4I1MA 3KEZA 1PY1A 3Q15A 4ANXA 5D0QD 5JHAA 3ZVVA 1UN9A 3UT4A 5LCWJ 2M63A 3PEUB 1ZBPA 3ZYKA 4OVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYZ A;  3EDT B;  4XI0 A;  3KD7 A;  4U07 A;  3GZ2 A;  5FJY A;  4KBQ A;  5FTP A;  2FBN A;  2HR2 A;  4N39 A;  4J8F A;  2KCK A;  4U0Z A;  2PQR A;  4AIF A;  2LNI A;  4ME2 A;  2HO1 A;  3FWV A;  5FZR A;  4KYO B;  2XGM A;  3ASF A;  4APO A;  4H7X A;  4JHR A;  5G05 C;  5JJ6 A;  5BW8 C;  2E2E A;  3ASH A;  5CCM A;  1QZ2 A;  4AY6 A;  3HYM B;  2WQH A;  4XI9 A;  2QFC A;  4UQZ A;  5DIZ A;  2KAT A;  2OOE A;  5HI7 A;  5KJK A;  1ELR A;  2WPV A;  3OXF A;  4WND A;  4O6F A;  1TJC A;  5AYW D;  4UI9 K;  5M72 A;  3UPV A;  4GCO A;  2Y4U A;  5CHE E;  4GPK A;  2YQ8 A;  3LY9 A;  5CCL A;  5DBK A;  3O48 A;  1NA0 A;  3URZ A;  3FP3 A;  2XGO A;  1WM5 A;  1A17 A;  2L6J A;  3CKB A;  5EX3 A;  4BTB A;  1Y8M A;  2VGX A;  5HQ8 A;  4HOS A;  3N71 A;  1E96 B;  3PE3 A;  5EX0 A;  5A6C A;  4I2W A;  2FI7 A;  2R5S A;  4YVQ C;  5LCW C;  4A1S A;  3KS2 A;  5FZS A;  4GZ5 A;  4RG6 A;  1KT1 A;  1QQE A;  4IN3 B;  4N3C A;  1HZ4 A;  5G04 C;  2KCV A;  4J8E A;  2BUG A;  5FT9 A;  2PZI A;  2FEZ A;  3R9A B;  3K9I A;  4GA2 A;  4J8D A;  3LCA A;  4GYW A;  3Q4A B;  3QWV A;  3VTX A;  3ASD A;  2XCC A;  2UWJ G;  3CVP A;  2VSN A;  4UQY A;  4BT9 A;  4JA7 A;  2FF4 A;  5A7D B;  3TGO A;  3LPZ A;  3CK8 A;  4G1T A;  3SZ7 A;  2P58 C;  4HOT A;  5ARF A;  3MV3 B;  4HOR A;  4N2Q A;  5C1D A;  2PL2 A;  3BEE A;  2C2L A;  3TG4 A;  1P5Q A;  4N3B A;  2XPI A;  3AS4 A;  3IEG A;  3CVL A;  3UQ3 A;  4BTA A;  4HOU A;  4AM9 A;  3GZ1 A;  4I17 A;  1ZU2 A;  4GZ3 A;  1ELW A;  3ULQ A;  1KLX A;  2VYI A;  4GCN A;  4Y6C A;  4EQF A;  3LY7 A;  4I1A A;  3QOU A;  3OXL A;  3ASG A;  3SF4 A;  3TAX A;  3S7D A;  4U0S A;  2C0M A;  2LSU A;  3RU0 A;  2LSV A;  3TG5 A;  2VSY A;  4G23 A;  3AS5 A;  4AY5 A;  1YA0 A;  5BT1 A;  3CK9 A;  4BWR A;  4UQX A;  3ESK A;  3PE4 A;  3GW4 A;  2XGS A;  3WXX A;  4U04 A;  5FZQ A;  2MHK A;  1NZN A;  2IF4 A;  5BNW A;  4UI9 J;  4GYY A;  3JYS A;  3NF1 A;  4G26 A;  5ARG A;  2GW1 A;  3OXG A;  3U3W A;  4WNE A;  4YVO A;  2VGX B;  1NA3 A;  4N2S A;  3ZPJ A;  5KJL A;  3MV2 B;  3ZFW A;  4GZ6 A;  1IHG A;  4RG9 A;  3ZN3 A;  3KAE A;  3E4B A;  2FO7 A;  5G04 J;  3CEQ A;  4ABN A;  3MEK A;  4I9C A;  5JJ7 A;  2V5F A;  4GYO A;  1WAO 1;  4GA0 A;  3ZHE A;  4N5C A;  2XCB A;  1B89 A;  3CVQ A;  4CDR A;  1FCH A;  3QWP A;  4WNG A;  2I6H A;  4CGW A;  4LEU A;  4CGV A;  4WUY A;  3S7B A;  3U4T A;  3Q47 B;  3VTY A;  4JA9 A;  3FFL A;  3CVN A;  3ZGQ A;  5EKQ D;  4KXK B;  3QKY A;  4HOQ A;  5D0O D;  1XNF A;  4J0U A;  1HXI A;  3UUX A;  4G24 A;  3ZHE B;  2AVP A;  2VQ2 A;  3QWW A;  4B94 A;  4N3A A;  2PQN A;  3S7J A;  4F3V A;  1W3B A;  5G05 J;  3LKU A;  2VGY A;  3CKC A;  2Y4T A;  4I9E A;  3S7F A;  2Q7F A;  4YND A;  4I2Z A;  4JL0 A;  3MA5 A;  1KT0 A;  3RIB A;  3PDN A;  3CK7 A;  3LY8 A;  3RO3 A;  3RO2 A;  3CV0 A;  3MKR A;  2XEV A;  5KJN A;  3Q49 B;  4BT8 A;  3AS8 A;  2UY1 A;  4Y6W A;  3LYA A;  3QDN A;  4UI9 C;  2KC7 A;  2NC9 A;  4NQ0 A;  5KJM A;  3Q5M A;  2C0L A;  3RKV A;  2DBA A;  4W9R A;  1HH8 A;  2J9Q A;  4GA1 A;  4G2V A;  2IFU A;  1PC2 A;  4XIF A;  2KCL A;  4G25 A;  3RJV A;  4U0U A;  4H7Y A;  2OND A;  2UY1 B;  5JJT A;  4NRH B;  2YHC A;  4WNF A;  2HYZ A;  1OUV A;  2JLB A;  3Q15 A;  5D0Q D;  5LCW J;  1ZBP A;  1IYG A; 
#chains in the Genus database with same CATH topology
 5BXU A;  3QC1 A;  2P9P G;  3GYZ A;  4MBG A;  1D9S A;  1HFA A;  1O1R A;  1U2V G;  1G3N B;  3J5P A;  3I4G A;  3APD A;  4U07 A;  4ZHB A;  3D9O A;  4F1P A;  5FJY A;  3JXI A;  2BF0 X;  2VGE A;  4BSX A;  3G2W A;  4CT4 A;  4DX1 A;  3TWR A;  4HNA D;  2RFM A;  2HR2 A;  4N39 A;  2DZO A;  4MLP A;  4AVX A;  1DNP A;  2LUH A;  4EBA A;  2X3M A;  3NB2 A;  2LNI A;  4BES A;  3FUJ A;  2WMN A;  4WWO A;  1KPS B;  5EDS A;  3ABL E;  2LO6 A;  2XGM A;  4LSZ E;  2MOW A;  4JHR A;  3E32 A;  1NI1 A;  2ZIS A;  2DYS E;  3EIJ A;  2OV8 A;  2E2E A;  2IJG X;  5CCM A;  3CHR A;  5C2Y A;  3I3N A;  4EEC A;  2WQH A;  4U8V D;  4PS8 A;  2QFC A;  4UQZ A;  5DIZ A;  4GB9 A;  4I6J A;  2KAT A;  4TXP A;  5H7P A;  3W9F A;  1N0R A;  5HI7 A;  4KZC A;  4HRN A;  2VSO E;  3ASO E;  1EF1 C;  3B7U X;  4O6F A;  3D9I A;  2WXQ A;  4M3O A;  4UI9 K;  1WG0 A;  1OCC E;  5E76 A;  5M72 A;  3UPV A;  2Y4U A;  3KSL A;  2CFU A;  3LY9 A;  5DBK A;  2R17 C;  5CED B;  2XZT G;  3PRZ A;  5LFA A;  1SZA A;  4GZD A;  3URZ A;  2QYU A;  4B8A A;  3APF A;  3UM1 A;  2GRP B;  1Y8M A;  2VGX A;  5HQ8 A;  2YIN A;  3N71 A;  1BI7 B;  3CQC B;  5D2M C;  3PE3 A;  2XRY A;  1Z3X A;  2R5S A;  4DPR A;  3Q7F A;  4GTV A;  5FZS A;  4RG6 A;  2GRO B;  2WXP A;  4IN3 B;  4K5A B;  3UM0 A;  4FA6 A;  2HE0 A;  2PZI A;  1N4R A;  2JEK A;  2X6H A;  4J8D A;  3U9W A;  3CST A;  3CVX A;  1N94 A;  3L22 A;  3FUE A;  3I5P A;  3ASD A;  3QWV A;  2XCC A;  3VTX A;  4DX6 D;  2FF4 A;  1DVP A;  4ZFH A;  5A7D B;  3AG2 E;  4J8S A;  4EPZ A;  3FTZ A;  2EIL E;  3MV3 B;  4FU3 A;  3DEP A;  4HOR A;  4N2Q A;  5C1D A;  5AEN A;  3RAU A;  1O1S A;  5AJD A;  3TWX A;  3D9J A;  4BTA A;  4HOU A;  4AM9 A;  4I17 A;  4L9P A;  5CMW A;  2LXL A;  1H19 A;  1N95 A;  1ELW A;  5AQB A;  3FUN A;  3B7B A;  2VYI A;  3APC A;  3LY7 A;  4XX5 A;  2R03 A;  3PS6 A;  5EN5 D;  3OXL A;  3TWV A;  2LAI A;  5EYP F;  1WDY A;  2CG2 A;  3ASG A;  4JHJ A;  3S7D A;  2C0M A;  3FUI A;  5AAR A;  1JCQ A;  4JB8 P;  3TG5 A;  4OAV B;  4AY5 A;  5BT1 A;  1WY6 A;  4UQX A;  3ESK A;  1E8Z A;  2DYR E;  4LNU D;  5EIB E;  3GW4 A;  5EID A;  2WQ6 A;  3WXX A;  4GU5 A;  4PS3 A;  4CRW A;  1BLX B;  3DSV A;  3SY2 A;  2CFZ A;  5BNW A;  4U95 D;  2V4H C;  3Q79 A;  4UI9 J;  5AN8 A;  4K5C A;  2QZA A;  4FLB A;  4G26 A;  3E30 A;  3CSF A;  2GW1 A;  2VSX E;  5E75 A;  2WXN A;  4WNE A;  4YVO A;  1YCS B;  5D66 A;  3CQG B;  2IEJ A;  5EIL A;  1UJK A;  4ATG A;  5IY5 E;  5ENR D;  4CYM D;  4PH4 B;  4BEP A;  4F53 A;  4HBD A;  3HG0 D;  3ZFW A;  3DXM G;  4DLQ A;  5CRU A;  4LG6 A;  1Q2Z A;  1RZ4 A;  4CCA A;  1UN8 A;  2LXM A;  3KAE A;  3RRU A;  1JWF A;  2CHZ A;  3D9K A;  5G04 J;  3EHR A;  3IHY A;  3MEK A;  4EBA G;  4I9C A;  3MJW A;  2V5F A;  5HRY A;  4CDM A;  3BG0 B;  4BET A;  3ZHE A;  2GGF A;  1B89 A;  3ZKJ A;  2IOL A;  3W9G A;  1FCH A;  2I1K A;  4CGW A;  3PUK A;  3DRA A;  2RD0 A;  1TNO A;  1EDU A;  2OEW A;  3ZGQ A;  5EKQ D;  3DSS A;  2J4D A;  3QKY A;  1OXJ A;  1K1B A;  3EIQ C;  4J0U A;  3NOG D;  3HVE A;  3TWQ A;  3ZHE B;  2P9I G;  4GAA A;  3ZRH A;  1KZP A;  3FTS A;  5HS0 A;  3LKU A;  3PEV B;  4CZ2 D;  3SHF A;  5AAO A;  3FUF A;  3CKC A;  2Y4T A;  4FP7 A;  1HO8 A;  4I2Z A;  4JL0 A;  3MA5 A;  1KT0 A;  3RIB A;  1S64 A;  4L2L A;  3DEO A;  3CK7 A;  2NXP A;  3HVE B;  1Y6I A;  3Q73 A;  3RO2 A;  3CV0 A;  1TNU A;  3MKR A;  4GTS A;  1FVH A;  3EJN A;  2BED A;  3Q49 B;  3B13 A;  5CRV A;  1JPL A;  4UI9 C;  4BFR A;  4I43 A;  2NC9 A;  4P29 A;  3EU5 A;  4IRU A;  1N9A A;  4I1O B;  5J08 A;  3CVV A;  2J9Q A;  4GA1 A;  4EZK A;  1PC2 A;  2F8Y A;  2KCL A;  3P1U A;  2WXI A;  3AG4 E;  3QJZ A;  1TR4 A;  3FH5 A;  1X81 A;  4A3V A;  3FTY A;  5JJT A;  3QAQ A;  3BQO A;  1TN6 A;  3KEA A;  5CEC B;  3FU3 A;  1OY3 D;  1TN7 A;  1VDY A;  1SA5 A;  4NIK A;  4YDY A;  3ZVV A;  3PEU B;  3L9T A;  3HRA A;  1MYO A;  4U8H A;  2XPZ A;  5ANR A;  4JXT A;  4C9B B;  1FT2 A;  3KD7 A;  1OCR E;  4BY6 A;  4U96 D;  3CIA A;  3T8K A;  1MX4 A;  4B89 A;  2FBN A;  2KCK A;  3MYV A;  4LUN U;  4GZC A;  1U3C A;  2Y1L E;  3QB2 A;  1N4Q A;  3ASF A;  4APO A;  4TXQ A;  1OWL A;  4H7X A;  2J09 A;  4TV3 A;  4IYP A;  4ILG A;  1Z3Y A;  3UI2 A;  1QZ2 A;  3JUI A;  4HLE A;  3CVU A;  2J07 A;  4XI9 A;  1OWN A;  1Z5S C;  3R7Q A;  3HDX A;  1ELR A;  3PZ1 A;  3FUM A;  1K8K G;  1TJC A;  4HB5 A;  3NZS A;  3DPD A;  4GCO A;  2QY7 A;  1A5E A;  4FAD A;  3CLJ A;  1SW6 A;  1NA0 A;  4DLO A;  4Q96 A;  2NYJ A;  1FVF A;  3CKB A;  2DZN A;  4BTB A;  3CHM A;  2OVB A;  3ULY A;  3B95 A;  1FPP A;  5G55 A;  5B1B E;  3HXF A;  5A6C A;  4I2W A;  3SD5 A;  3MGB A;  3FHE A;  3L17 A;  1KT1 A;  1QQE A;  3MZL B;  4RQI A;  3SQV A;  5CBO A;  2ZU6 B;  2KCV A;  1TJF A;  3L08 A;  4ANW A;  2CG3 A;  3GZS A;  4FHJ A;  3MKQ A;  4DK5 A;  1TN8 A;  2UWJ G;  4XE0 A;  3UKR G;  1QBQ A;  4V3I A;  2IO3 C;  1S70 B;  3LPZ A;  3B7T A;  2EIM E;  3V79 K;  2P9N G;  1JUQ A;  2R05 A;  3T9K A;  2X38 A;  2ZGG A;  4G1T A;  3UIP C;  3SZ7 A;  3PZ3 A;  2P58 C;  1L5J A;  3MKQ B;  5ARF A;  3MCX A;  4J7W A;  3BEE A;  3C98 A;  1XGW A;  3ABK E;  3IEG A;  4JVS A;  5G2N A;  1E8W A;  4GZ3 A;  3ULQ A;  1KLX A;  3X2Q E;  4WWN A;  3HXB A;  2EIN E;  4Y6C A;  3BU8 A;  3G2T A;  5KWD A;  1BU9 A;  5EYL A;  3ULE G;  2ION A;  3D9H A;  4U0S A;  1H6O A;  1EPU A;  3RU0 A;  1E8Y A;  2YNQ A;  3AG1 E;  3L16 A;  2V8S E;  1YA0 A;  3CK9 A;  4BWR A;  4ATZ D;  4Q94 A;  4ILI A;  3PE4 A;  4HQD A;  2H6I A;  3ABM E;  2ETA A;  4GTR A;  3T5V A;  2MHK A;  2L0I A;  1NZN A;  4KVM A;  4OAU C;  2OCC E;  3VLD A;  3V2X A;  3QNK A;  4A63 B;  2Y69 E;  1MJ0 A;  3DBS A;  2X6I A;  3CVW A;  1TNY A;  3FU5 A;  2XS8 A;  2VGX B;  4B93 B;  3UT8 A;  4N2S A;  3FTV A;  2OEV A;  3ZPJ A;  2EIJ E;  4K5B A;  1E8X A;  4OVU A;  1IHG A;  4RG9 A;  2IY0 C;  3TWT A;  3CEQ A;  4ABN A;  1AWC B;  1OT8 A;  4GYO A;  5LX8 A;  3CVQ A;  1TEZ A;  1BI8 B;  1JCS A;  4CDR A;  3QWP A;  4CGV A;  4WUY A;  2FUL A;  4EZJ A;  1QYM A;  3Q9N C;  5B3S E;  5JHB A;  4U8Y D;  2WXM A;  3PVL A;  5D0O D;  4UWF A;  1XNF A;  1HXI A;  1NL4 A;  2VTB A;  4U7E B;  4YDE A;  4GML A;  4B94 A;  4N3A A;  4F3V A;  1HU3 A;  4O60 A;  4F6R D;  2VGY A;  3EU9 A;  3R7R A;  3DWL G;  4DX2 A;  1E7V A;  1H2T C;  2Q7F A;  3UMV A;  2B0O E;  3PDN A;  5ENS D;  3PNL B;  3SFX A;  3LY8 A;  4GMR A;  2VTB B;  3U64 A;  2AJA A;  4FUL A;  4BT8 A;  5ANL A;  2UY1 A;  3UIO C;  2KC7 A;  3SFY A;  5BUZ A;  4I6G A;  1V54 E;  3Q5M A;  1N4S A;  2C0L A;  2A4Z A;  3RKV A;  2DBA A;  1HH8 A;  4KVO A;  4G25 A;  2XZD G;  3UM3 A;  1JCR A;  4U0U A;  4HI8 A;  4JW1 A;  4CEM A;  2UY1 B;  3G2U A;  3VLE A;  4TRQ A;  3TXM A;  4I1M A;  4BER A;  5D0Q D;  5LCW J;  1IYG A;  5AQ7 A;  2IQC A;  4TXR A;  3RSE G;  5FQ7 A;  2DIW A;  5CEA A;  4XI0 A;  4HFG A;  3UT7 A;  3GZ2 A;  4KBQ A;  4KT6 B;  3QAR A;  4TUM A;  2RG8 A;  4J8F A;  1IQU A;  4TUU A;  4Z68 A;  4JZY A;  3ZU7 B;  4DJA A;  5KBA A;  2WXL A;  2FO1 E;  2PQR A;  4ME2 A;  2ETB A;  2HO1 A;  5FZR A;  3FWV A;  3L54 A;  2AXU A;  4KYO B;  4K03 A;  2PNN A;  1OWM A;  3UM2 A;  4U63 A;  4IUL A;  4L7T A;  3Q75 A;  5ITZ F;  5JJ6 A;  2WB2 A;  3ASH A;  4GMJ A;  3T8M A;  3FU0 A;  4FHK A;  5ENT D;  4I6E A;  1D8E A;  2H6G A;  3L82 A;  4XEI G;  3NAW A;  4LCT A;  1KZO A;  5KJK A;  3DSU A;  1H6K A;  3RRN B;  2KZT A;  2WPV A;  4APF A;  3TWS A;  3DPY A;  3PNT B;  3ZXP A;  3LJN A;  4GPK A;  2YQ8 A;  3O48 A;  4F7A A;  1FT1 A;  3ESL A;  3C5R A;  1NFI E;  1K3Z D;  1SZ9 A;  3FP3 A;  3SGH A;  4BX8 A;  1WM5 A;  4YDO A;  4MRU A;  2L6J A;  1S63 A;  2KZT B;  3PRE A;  1INZ A;  3F6Q A;  4DI4 A;  4LRZ A;  5JMN D;  5ENO D;  4J6I A;  3FTW A;  4O1O A;  5EX0 A;  3TWW A;  4AP2 A;  2XPY A;  4YVQ C;  5LCW C;  3KS2 A;  3BUA A;  1HX8 A;  4URK A;  2CHW A;  5G04 C;  3ZYM A;  1N52 A;  4JPS A;  4A1G A;  1HF8 A;  3HHM A;  3ZYL A;  2WXR A;  2BUG A;  2FEZ A;  3R9A B;  5AJL A;  5BXO A;  3MX3 A;  3SBS A;  4FC8 A;  3LVQ E;  2DCP A;  4FJY A;  4DX7 D;  3SBT B;  3CVP A;  3LEW A;  2IU1 A;  2VSN A;  4UQY A;  3Q78 A;  5AQ9 A;  4BT9 A;  1EYH A;  1QNF A;  4PUC A;  3TXN A;  4HOT A;  2RKK A;  3DSW A;  1OCO E;  1MX2 A;  2C2L A;  1O1T A;  3TG4 A;  3VLF A;  2XPI A;  3SI5 A;  4AEZ C;  2DWZ A;  4LER A;  1NP7 A;  4PS7 A;  3C3R A;  1ZU2 A;  4DRX E;  4EQF A;  3FDH A;  1Z6T A;  2J08 A;  3PZ2 A;  1HS6 A;  4AJW A;  2WM9 A;  3QOU A;  3LXU X;  5KNG A;  3S2A A;  2WMO A;  3AAA C;  3SF4 A;  3TAX A;  2IO2 C;  4GTM A;  2ILR A;  1IKN D;  1MQS A;  3DSX A;  4A55 A;  3TL5 A;  2VSY A;  1TNB A;  3U66 A;  1DCE A;  4MKT A;  2JAB A;  2P2C P;  2A5E A;  3UX4 A;  2XGS A;  4U04 A;  5FZQ A;  1UOH A;  1H6P A;  1TNZ A;  3NF1 A;  2R59 A;  4DUI A;  4Q69 A;  5JA4 D;  3L13 A;  3Q9U C;  2DVW A;  1E90 A;  4RVB A;  3U3W A;  1SQM A;  5BV0 A;  3ZUV B;  1N4P A;  2ZIR A;  3NQP A;  3FY4 A;  3MV2 B;  2L0T B;  4ACL A;  4UWL A;  3D9P A;  4GZ6 A;  1LTX A;  2F8X K;  3FH7 A;  3FH8 A;  4M7C A;  3E4B A;  1X5B A;  2FO7 A;  4CDN A;  1U3D A;  3G2V A;  3PH0 C;  2EQX A;  5CBN A;  4HI9 A;  4XKC A;  4HS2 A;  4EHM A;  1BD8 A;  1H2U A;  3HIZ A;  2XCB A;  1HG2 A;  2WXH A;  4ILH B;  4L2Y A;  2I6H A;  1SVX A;  1OWO A;  3P2B A;  4LEU A;  2WXG A;  4G8L A;  3ONL A;  3NBN B;  3HXD A;  3U4T A;  2V4L A;  1PAQ A;  3Q47 B;  5B1A E;  2EIK E;  5BPP A;  4JA9 A;  3FFL A;  3V2O A;  4KXK B;  3HXE A;  4HOQ A;  4C48 B;  3UUX A;  2ZGD A;  1MZC A;  1ZB1 A;  3C3Q A;  4E6H A;  1AP7 A;  5J90 A;  2AVP A;  1HG5 A;  2PQN A;  3S7J A;  4FJZ A;  1H0A A;  2XS1 A;  3C3O A;  4L1B A;  5G05 J;  1K1A A;  3RK6 A;  4I9E A;  3RRM B;  3S7F A;  4EZL A;  1UG3 A;  5FQ8 A;  4LNB A;  2GRN B;  3RO3 A;  1OWP A;  5FQ4 A;  4UWG A;  3L6A A;  2XEV A;  1HE8 A;  4YDW A;  5KJN A;  3AS8 A;  1N11 A;  4Y6W A;  2P9L G;  3LYA A;  3QDN A;  3IXE A;  4NQ0 A;  5CER B;  1DC2 A;  2AWI A;  2QC9 A;  4W9R A;  2H6H A;  4G2V A;  3SO8 A;  3EHM A;  5LP0 A;  4JC8 A;  4X8Q A;  3E33 A;  1LF8 A;  2E0I A;  2KM4 A;  4H7Y A;  4NRH B;  2B6C A;  5T8I A;  4WNF A;  3EUV A;  2HYZ A;  3JCK C;  4F1S A;  3J5Q B;  4UUC A;  1OUV A;  2NSZ A;  3FUK A;  3DST A;  3KEZ A;  4ANX A;  3ISM C;  5JHA A;  1UN9 A;  3UT4 A;  2M63 A;  1ZBP A;  4OVV A;  4ACK A;  2J49 A;  1UW4 B;  3JUE A;  4WAF A;  2GRL A;  3LJ3 A;  3ZNG A;  4WWP A;  3EDT B;  2P9K G;  1LD8 A;  4JD2 G;  3FUH A;  2AXZ A;  3G2S A;  3D3M A;  3V31 A;  3QK0 A;  4QFV A;  4C0E A;  4HXI A;  5FTP A;  3UIN C;  3TWU A;  3ML8 A;  4NUR A;  4U0Z A;  5A23 A;  4AIF A;  2AW6 A;  2PM6 A;  3LS8 A;  4NAC A;  2BTD A;  2XEE A;  5ENN A;  3UTM A;  3FEX A;  5FWQ A;  5G05 C;  3AU5 A;  2WXJ A;  4AXH A;  5BW8 C;  1V55 E;  3IV0 A;  3R9M A;  2Y3A A;  3ENE A;  4AY6 A;  2VJ8 A;  3HYM B;  2MRI A;  4KMO A;  2WXO A;  2OOE A;  1H2V C;  4L23 A;  1TYQ G;  4R7L A;  1YYH A;  4JEH A;  3OXF A;  3B7S A;  2BKG A;  4WND A;  5AYW D;  5HKP A;  5CHE E;  5CCL A;  4QQI A;  3UXG A;  2R02 A;  1O5M A;  2XRZ A;  2WVI A;  3ASN E;  4UWH A;  2XEH A;  2XGO A;  3E34 A;  4GTO A;  4G8K A;  1A17 A;  2P9U G;  3AJI A;  3ZXS A;  5EX3 A;  3CR3 A;  3CVY A;  4HVB A;  4HOS A;  4A3T A;  3TJP A;  1BPO A;  1E96 B;  2FI7 A;  4GTP A;  1RW2 A;  4A1S A;  4GZ5 A;  3FTU A;  2RFA A;  4N3C A;  4BSZ B;  1HZ4 A;  1MX6 A;  3LVR E;  1N0Q A;  4AOF A;  3V30 A;  4D10 C;  3C72 A;  3OTN A;  5ENP D;  2A5U A;  4J8E A;  5FT9 A;  3K9I A;  4GA2 A;  3LCA A;  3Q7A A;  3ML9 A;  4GYW A;  1IQR A;  5T3R A;  3Q4A B;  3FTX A;  2P9S G;  2X6F A;  4RSY A;  4HRM B;  4JA7 A;  4JHK A;  3CGH A;  5ENQ D;  3EHQ A;  3FUD A;  3TGO A;  2J8S D;  3LDZ A;  3CK8 A;  4MS6 A;  2OVF A;  1SA4 A;  2F37 A;  1DCQ A;  5LOZ A;  3CHP A;  1N54 A;  3D9M A;  2PL2 A;  3BG1 B;  4ANV A;  1P5Q A;  3DXK G;  4N3B A;  3D9N A;  2WXF A;  3AS4 A;  3JQ0 A;  3UKU G;  3CVL A;  3UQ3 A;  3IBE A;  4HRL A;  3GZ1 A;  2H6F A;  2L6B A;  4GTQ A;  4GCN A;  2L9B A;  4I1A A;  4RLY A;  3PUJ A;  4N5Q A;  4ANU A;  1GW6 A;  5KCM A;  1ELK A;  2LSU A;  3PZ4 A;  2XEN A;  2LSV A;  2R2L A;  3OAW A;  4G23 A;  3AS5 A;  2GRR B;  1IHB A;  2F0Y A;  4JEU A;  2GRM A;  4DI3 A;  1S0P A;  3ZYQ A;  2IF4 A;  2KXP C;  2GRQ B;  1E7U A;  5FIN A;  4GYY A;  3JYS A;  5ARG A;  2I9C A;  3PZD A;  2X6K A;  4B8C B;  3OXG A;  2WQ7 A;  4AV7 A;  4LNG A;  3SFZ A;  2I2O A;  1NA3 A;  3EHN A;  3IKO B;  2CHX A;  4FLH A;  5KJL A;  3JXJ A;  3FEY A;  3O4Z A;  4BX9 A;  3ZN3 A;  2BKK B;  1D8D A;  5CMY A;  1MHQ A;  4E85 A;  3CHQ A;  1UJJ A;  5JJ7 A;  5FQ6 A;  2WXK A;  4K0R A;  2V5Q C;  1WAO 1;  3AG3 E;  4GA0 A;  4DX5 D;  2KBX A;  4N5C A;  4UWK A;  2J4B A;  3SNX A;  2LAH A;  3E37 A;  4OYS A;  2HM8 A;  4J8Y A;  3D9L A;  4WNG A;  3KSQ A;  4GTT A;  5BV1 A;  2PM7 A;  4PDX A;  3S7B A;  3NOC D;  2XQ0 A;  2ETC A;  3VTY A;  3ZIM A;  3ZEF A;  5AQA A;  3CVN A;  3HXC A;  3FU6 A;  3JQ1 A;  3CHS A;  4G24 A;  3AU4 A;  3ONK A;  2VQ2 A;  3NZU A;  3QWW A;  2IOS A;  1W3B A;  3ZW3 A;  3IHV A;  1LD7 A;  4CT0 A;  4B0Z A;  3FUL A;  3I4R B;  4YND A;  5KNH D;  5FIO A;  5AIJ A;  2ZXW E;  2V0P A;  2MYO A;  4XZ4 A;  1JWG A;  2I1J A;  4C0M A;  3B7R L;  5KJM A;  3T5X A;  2X6J A;  1IXV A;  2YHE A;  2AXV A;  3CHO A;  2IFU A;  4XIF A;  4O1P A;  2Y0B G;  4KZ0 A;  3RJV A;  4XKB A;  5T4Y A;  1OCZ E;  2OND A;  4GPM A;  1YMP A;  2YHC A;  4G11 A;  2QYJ A;  4HLL A;  3WG7 E;  2JLB A;  2XHE A;  1PY1 A;  3Q15 A;  3ZYK A; 
#chains in the Genus database with same CATH homology
 4ACK A;  2IQC A;  3QC1 A;  3GYZ A;  2J49 A;  1UW4 B;  4WAF A;  1HFA A;  2GRL A;  3LJ3 A;  5FQ7 A;  4U8H A;  2XPZ A;  5ANR A;  4WWP A;  2DIW A;  3EDT B;  4JXT A;  4C9B B;  4XI0 A;  4HFG A;  3I4G A;  3APD A;  3KD7 A;  3FUH A;  2AXZ A;  3UT7 A;  4U07 A;  3D9O A;  3GZ2 A;  3G2S A;  3D3M A;  4BY6 A;  3QK0 A;  4QFV A;  4C0E A;  3CIA A;  5FJY A;  4KBQ A;  4KT6 B;  4HXI A;  2BF0 X;  5FTP A;  4BSX A;  4B89 A;  3G2W A;  4CT4 A;  3QAR A;  2FBN A;  3ML8 A;  2HR2 A;  2RG8 A;  4J8F A;  4N39 A;  1IQU A;  2KCK A;  4MLP A;  3MYV A;  4NUR A;  4U0Z A;  4AVX A;  4LUN U;  1DNP A;  4TUU A;  4JZY A;  4GZC A;  4DJA A;  5A23 A;  1U3C A;  4EBA A;  2X3M A;  2WXL A;  2PQR A;  4AIF A;  2LNI A;  2AW6 A;  2HO1 A;  2PM6 A;  3FWV A;  3QB2 A;  3FUJ A;  3L54 A;  4ME2 A;  2WMN A;  4WWO A;  5FZR A;  2AXU A;  5EDS A;  3LS8 A;  2LO6 A;  4K03 A;  4KYO B;  4NAC A;  2XGM A;  1OWM A;  3ASF A;  2BTD A;  5ENN A;  4APO A;  4U63 A;  3FEX A;  4IUL A;  2MOW A;  4L7T A;  1OWL A;  4H7X A;  4JHR A;  2J09 A;  5FWQ A;  5G05 C;  5JJ6 A;  3AU5 A;  4TV3 A;  2WXJ A;  4AXH A;  3EIJ A;  4IYP A;  5BW8 C;  2OV8 A;  2E2E A;  3ASH A;  2IJG X;  3IV0 A;  4GMJ A;  3CHR A;  1Z3Y A;  2Y3A A;  3FU0 A;  4FHK A;  4ILG A;  5C2Y A;  3T8M A;  1QZ2 A;  3ENE A;  3JUI A;  4HLE A;  3CVU A;  3I3N A;  2J07 A;  4AY6 A;  2VJ8 A;  3HYM B;  4EEC A;  2WQH A;  2MRI A;  4PS8 A;  4XI9 A;  1OWN A;  2QFC A;  4UQZ A;  4KMO A;  5DIZ A;  4I6E A;  4GB9 A;  2WXO A;  4I6J A;  2KAT A;  2OOE A;  1H2V C;  4L23 A;  4R7L A;  4LCT A;  5HI7 A;  5KJK A;  4KZC A;  3R7Q A;  1H6K A;  3HDX A;  3RRN B;  2KZT A;  4JEH A;  1ELR A;  2VSO E;  2WPV A;  4APF A;  3OXF A;  3B7S A;  1EF1 C;  3FUM A;  3B7U X;  3PNT B;  4WND A;  4O6F A;  3D9I A;  1TJC A;  5AYW D;  3NZS A;  2WXQ A;  4M3O A;  4UI9 K;  5M72 A;  3UPV A;  5E76 A;  3DPD A;  4GCO A;  2Y4U A;  5CHE E;  2CFU A;  2YQ8 A;  2QY7 A;  3LY9 A;  5DBK A;  5CCL A;  4GPK A;  4FAD A;  2R17 C;  3O48 A;  3CLJ A;  4F7A A;  2WB2 A;  3ESL A;  3PRZ A;  5LFA A;  1SZA A;  1SZ9 A;  2XRZ A;  2WVI A;  4GZD A;  1NA0 A;  3URZ A;  3FP3 A;  3SGH A;  4BX8 A;  4UWH A;  4DLO A;  2XGO A;  1WM5 A;  4Q96 A;  1A17 A;  1FVF A;  4MRU A;  2L6J A;  3ZXS A;  3CKB A;  2KZT B;  3PRE A;  4B8A A;  1INZ A;  3APF A;  5EX3 A;  3CR3 A;  4BTB A;  3CHM A;  3CVY A;  4DI4 A;  1Y8M A;  2OVB A;  4LRZ A;  2VGX A;  4HVB A;  5HQ8 A;  2YIN A;  4HOS A;  4A3T A;  3TJP A;  3N71 A;  3CQC B;  5G55 A;  4J6I A;  3FTW A;  1BPO A;  1E96 B;  3PE3 A;  5EX0 A;  5A6C A;  4I2W A;  2XRY A;  2FI7 A;  1Z3X A;  3SD5 A;  4AP2 A;  2XPY A;  2R5S A;  4DPR A;  4YVQ C;  5LCW C;  3MGB A;  4A1S A;  3KS2 A;  5FZS A;  4GZ5 A;  3FTU A;  3FHE A;  4RG6 A;  1HX8 A;  3L17 A;  4URK A;  2WXP A;  1KT1 A;  1QQE A;  3MZL B;  4IN3 B;  4N3C A;  1IYG A;  1HZ4 A;  2CHW A;  5G04 C;  3ZYM A;  3LVR E;  4AOF A;  4D10 C;  2ZU6 B;  1N52 A;  4JPS A;  4A1G A;  2KCV A;  1TJF A;  4FA6 A;  1HF8 A;  3L08 A;  3HHM A;  3OTN A;  3ZYL A;  2WXR A;  2A5U A;  2CG3 A;  4ANW A;  4J8E A;  2BUG A;  5FT9 A;  2PZI A;  2FEZ A;  3R9A B;  5AJL A;  2JEK A;  3GZS A;  2X6H A;  3K9I A;  3MX3 A;  4FHJ A;  4GA2 A;  4FC8 A;  4J8D A;  3LVQ E;  3LCA A;  3SBS A;  3MKQ A;  3ML9 A;  4GYW A;  2DCP A;  4FJY A;  1IQR A;  5T3R A;  3U9W A;  3CST A;  3Q4A B;  3CVX A;  3L22 A;  3FTX A;  3FUE A;  3ASD A;  3I5P A;  2XCC A;  3QWV A;  3VTX A;  4DK5 A;  2UWJ G;  3SBT B;  2X6F A;  3CVP A;  4RSY A;  3LEW A;  2IU1 A;  2VSN A;  4UQY A;  4BT9 A;  4JA7 A;  4JHK A;  2FF4 A;  3CGH A;  4XE0 A;  1DVP A;  3FUD A;  1EYH A;  4V3I A;  5A7D B;  3TGO A;  3LPZ A;  1QNF A;  3B7T A;  3LDZ A;  3CK8 A;  1JUQ A;  4MS6 A;  2OVF A;  2X38 A;  4G1T A;  3SZ7 A;  2P58 C;  4J8S A;  1L5J A;  4PUC A;  3TXN A;  4HOT A;  3MKQ B;  5LOZ A;  4EPZ A;  3FTZ A;  5ARF A;  3MV3 B;  3MCX A;  4FU3 A;  3CHP A;  4HOR A;  4N2Q A;  5C1D A;  1N54 A;  3D9M A;  2PL2 A;  5AEN A;  3BEE A;  3BG1 B;  4ANV A;  2C2L A;  3C98 A;  3TG4 A;  1XGW A;  1P5Q A;  4N3B A;  3D9N A;  3VLF A;  2WXF A;  2XPI A;  3AS4 A;  3IEG A;  3SI5 A;  4JVS A;  3JQ0 A;  5AJD A;  3CVL A;  4AEZ C;  4LER A;  1NP7 A;  3D9J A;  3UQ3 A;  4BTA A;  3IBE A;  4PS7 A;  4HOU A;  5G2N A;  4AM9 A;  1E8W A;  3GZ1 A;  4I17 A;  1ZU2 A;  4GZ3 A;  5CMW A;  1H19 A;  1ELW A;  3ULQ A;  3FUN A;  1KLX A;  2VYI A;  4WWN A;  4GCN A;  4Y6C A;  4EQF A;  2L9B A;  3FDH A;  1Z6T A;  2J08 A;  3G2T A;  1HS6 A;  3APC A;  3LY7 A;  4AJW A;  4I1A A;  4XX5 A;  2WM9 A;  3QOU A;  3PS6 A;  3LXU X;  3OXL A;  2LAI A;  3PUJ A;  4CGW A;  2CG2 A;  3S2A A;  2WMO A;  3ASG A;  4ANU A;  1GW6 A;  2ION A;  3SF4 A;  5KCM A;  3TAX A;  4JHJ A;  2ILR A;  3S7D A;  4U0S A;  1MQS A;  2C0M A;  3FUI A;  4A55 A;  1ELK A;  2LSU A;  1EPU A;  3RU0 A;  3TL5 A;  2LSV A;  3TG5 A;  2VSY A;  1E8Y A;  2YNQ A;  3U66 A;  3L16 A;  3OAW A;  4G23 A;  4MKT A;  3AS5 A;  4AY5 A;  2V8S E;  1YA0 A;  5BT1 A;  3CK9 A;  1WY6 A;  4JEU A;  4Q94 A;  3ESK A;  4UQX A;  4ILI A;  3PE4 A;  4BWR A;  1E8Z A;  2GRM A;  3GW4 A;  3UX4 A;  4DI3 A;  2WQ6 A;  2XGS A;  3WXX A;  4U04 A;  5FZQ A;  4GU5 A;  3T5V A;  1S0P A;  2MHK A;  4PS3 A;  3ZYQ A;  2L0I A;  4CRW A;  1NZN A;  2IF4 A;  2CFZ A;  4KVM A;  5BNW A;  1E7U A;  4UI9 J;  4GYY A;  3JYS A;  3VLD A;  3QNK A;  4FLB A;  3NF1 A;  4G26 A;  2R59 A;  5ARG A;  4Q69 A;  3L13 A;  3CSF A;  2GW1 A;  2VSX E;  5E75 A;  3DBS A;  2I9C A;  3PZD A;  2X6K A;  4B8C B;  3OXG A;  2WQ7 A;  1E90 A;  2X6I A;  4RVB A;  2WXN A;  3CVW A;  3U3W A;  1SQM A;  4WNE A;  4YVO A;  4AV7 A;  5BV0 A;  3FU5 A;  3CQG B;  2VGX B;  3SFZ A;  2I2O A;  3UT8 A;  1NA3 A;  3EHN A;  3IKO B;  2CHX A;  1UJK A;  4FLH A;  4ATG A;  4N2S A;  3FTV A;  3NQP A;  3ZPJ A;  5KJL A;  4PH4 B;  1E8X A;  3FY4 A;  3MV2 B;  2L0T B;  3FEY A;  4F53 A;  4ACL A;  3ZFW A;  4UWL A;  3O4Z A;  3D9P A;  4GZ6 A;  4OVU A;  4DLQ A;  1IHG A;  4RG9 A;  4BX9 A;  3ZN3 A;  3FH7 A;  4CCA A;  3FH8 A;  1UN8 A;  3KAE A;  3E4B A;  5CMY A;  3RRU A;  1MHQ A;  1JWF A;  4E85 A;  2CHZ A;  3D9K A;  1X5B A;  2FO7 A;  3CHQ A;  5G04 J;  4CDN A;  1U3D A;  3CEQ A;  4ABN A;  3IHY A;  3MEK A;  3G2V A;  1UJJ A;  4EBA G;  4I9C A;  3PH0 C;  3MJW A;  5JJ7 A;  2EQX A;  2V5F A;  5FQ6 A;  4XKC A;  2WXK A;  4GYO A;  4K0R A;  4HS2 A;  5LX8 A;  1WAO 1;  4CDM A;  3BG0 B;  4GA0 A;  3ZHE A;  1H2U A;  3HIZ A;  2GGF A;  4N5C A;  2XCB A;  1HG2 A;  4UWK A;  1B89 A;  2WXH A;  3CVQ A;  2J4B A;  1TEZ A;  4ILH B;  3SNX A;  2LAH A;  2IOL A;  4OYS A;  4CDR A;  2HM8 A;  4L2Y A;  1FCH A;  2I1K A;  3D9L A;  2I6H A;  3QWP A;  4WNG A;  5BV1 A;  1OWO A;  3P2B A;  4LEU A;  2PM7 A;  4WUY A;  2FUL A;  4PDX A;  2WXG A;  4EZJ A;  4CGV A;  3PUK A;  3ONL A;  3S7B A;  3U4T A;  5JHB A;  2V4L A;  2XQ0 A;  1PAQ A;  3Q47 B;  2RD0 A;  2WXM A;  3VTY A;  3ZIM A;  5BPP A;  1EDU A;  4JA9 A;  3ZEF A;  3FFL A;  3CVN A;  3ZGQ A;  5EKQ D;  3PVL A;  2J4D A;  4KXK B;  3QKY A;  4HOQ A;  3EIQ C;  4UWF A;  5D0O D;  3FU6 A;  1XNF A;  3JQ1 A;  1HXI A;  4J0U A;  3UUX A;  3HVE A;  3CHS A;  4G24 A;  4E6H A;  3ZHE B;  2VTB A;  3AU4 A;  4GAA A;  5J90 A;  2AVP A;  3ONK A;  2VQ2 A;  4GML A;  3NZU A;  3QWW A;  4B94 A;  1HG5 A;  4N3A A;  2PQN A;  3S7J A;  2IOS A;  4FJZ A;  1H0A A;  4F3V A;  3ZRH A;  4L1B A;  1W3B A;  3FTS A;  5G05 J;  3RK6 A;  3ZW3 A;  3IHV A;  3LKU A;  3PEV B;  1HU3 A;  2VGY A;  4CT0 A;  3R7R A;  3SHF A;  4B0Z A;  3FUF A;  3CKC A;  2Y4T A;  3FUL A;  1HO8 A;  3I4R B;  4FP7 A;  1E7V A;  4I9E A;  1H2T C;  3RRM B;  3S7F A;  2Q7F A;  4YND A;  4I2Z A;  4EZL A;  1UG3 A;  3UMV A;  4JL0 A;  3MA5 A;  5FQ8 A;  1KT0 A;  3RIB A;  3PDN A;  5AIJ A;  4L2L A;  3CK7 A;  3PNL B;  2NXP A;  3LY8 A;  3HVE B;  2V0P A;  1Y6I A;  3RO3 A;  2VTB B;  1OWP A;  3RO2 A;  3CV0 A;  5FQ4 A;  4UWG A;  3L6A A;  3MKR A;  2XEV A;  1HE8 A;  3U64 A;  1FVH A;  3EJN A;  4FUL A;  5KJN A;  3Q49 B;  5ANL A;  3AS8 A;  3B13 A;  4XZ4 A;  4BT8 A;  2UY1 A;  4Y6W A;  1JWG A;  1JPL A;  3LYA A;  3QDN A;  2I1J A;  4UI9 C;  4BFR A;  2KC7 A;  5BUZ A;  4I43 A;  4C0M A;  2NC9 A;  4I6G A;  3B7R L;  4NQ0 A;  5CCM A;  5KJM A;  4P29 A;  3T5X A;  2X6J A;  4IRU A;  2AWI A;  3Q5M A;  4I1O B;  2C0L A;  2YHE A;  5J08 A;  3CVV A;  2A4Z A;  2AXV A;  3CHO A;  3RKV A;  2DBA A;  4W9R A;  1HH8 A;  2J9Q A;  4GA1 A;  4KVO A;  4EZK A;  4G2V A;  3EHM A;  1PC2 A;  2IFU A;  5LP0 A;  4XIF A;  4JC8 A;  2KCL A;  3P1U A;  2WXI A;  4G25 A;  3QJZ A;  3FH5 A;  4KZ0 A;  1LF8 A;  3RJV A;  4XKB A;  2E0I A;  5T4Y A;  2KM4 A;  4U0U A;  4JW1 A;  4A3V A;  4CEM A;  4H7Y A;  3FTY A;  2OND A;  2UY1 B;  5JJT A;  3QAQ A;  4NRH B;  3G2U A;  3VLE A;  5T8I A;  2YHC A;  4G11 A;  4WNF A;  2HYZ A;  3JCK C;  4F1S A;  4TRQ A;  1OUV A;  2NSZ A;  3FUK A;  2JLB A;  3FU3 A;  3TXM A;  1VDY A;  2XHE A;  4I1M A;  3KEZ A;  1PY1 A;  3Q15 A;  4ANX A;  5D0Q D;  5JHA A;  3ZVV A;  1UN9 A;  3UT4 A;  5LCW J;  2M63 A;  3PEU B;  1ZBP A;  3ZYK A;  4OVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...