3AS4A

Mama amb-1 c2221
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
170
structure length
170
Chain Sequence
DIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
total genus 69
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3as4A01
1XNFA 3QOUA 3UQ3A 4JL0A 4I17A 4AM9A 1ZU2A 3RU0A 2P58C 3LKUA 1WAO1 4BT8A 3TG4A 3CV0A 4GCNA 5EKQD 4XIFA 2WQHA 3PDNA 4U04A 3GYZA 2XCCA 5G05J 3UUXA 3URZA 1QZ2A 4UI9K 5FZQA 3Q49B 1HH8A 2VQ2A 3AS8A 2KCLA 3Q15A 2J9QA 2PL2A 3BEEA 4Y6CA 3ASHA 4J8FA 4BTAA 2Y4TA 3MV3B 3U4TA 2ONDA 3CKCA 2UY1B 4KBQA 2VYIA 4JA9A 5HQ8A 1KLXA 4GZ6A 3VTXA 3ESKA 2XPIA 2FBNA 4N5CA 2XCBA 4GA2A 4BT9A 3RO3A 2KATA 3S7JA 2GW1A 5KJMA 3N71A 3ASFA 2KCVA 5M72A 3ASDA 4H7YA 2PQRA 3LYAA 2PQNA 4AY5A 3ZFWA 1KT1A 4F3VA 4N39A 4XI0A 5JJTA 4WNDA 4WNGA 4B94A 1ELWA 1B89A 2LSVA 4I9CA 4A1SA 3FP3A 4UQXA 3Q4AB 2C0LA 5DIZA 4APOA 4AIFA 3MV2B 3MEKA 2QFCA 4HOTA 2VSNA 3CK9A 1OUVA 3LCAA 3MKRA 4J8DA 1NZNA 2L6JA 1ZBPA 5CHEE 4JA7A 2AVPA 4U0UA 3TAXA 4GZ3A 1YA0A 2FF4A 5AYWD 3RJVA 3EDTB 3RIBA 3KAEA 4I9EA 4BTBA 3O48A 4EQFA 3PE3A 3LY8A 5G05C 4WUYA 2XGOA 5D0QD 3ZHEA 2OOEA 5A7DB 5A6CA 4Y6WA 5ARFA 1TJCA 3LY9A 4HOSA 4CGWA 3JYSA 5KJNA 4U0SA 4G1TA 4W9RA 4ABNA 4WNFA 5CCLA 5JJ6A 3CVQA 3OXFA 3NF1A 2E2EA 3QKYA 2XGMA 5G04C 3CVNA 3KD7A 4G23A 3OXLA 3LY7A 4JHRA 5FZSA 5G04J 3GW4A 5HI7A 3IEGA 2WPVA 4G25A 2I6HA 4U07A 1IHGA 3Q5MA 3VTYA 2VGXB 3Q47B 4XI9A 1NA0A 3TGOA 4ME2A 2DBAA 1E96B 4G26A 2UY1A 5BW8C 2LNIA 1Y8MA 3UPVA 4GYOA 3CVPA 4YVQC 4HOUA 4UI9J 3FFLA 4UQYA 4IN3B 1P5QA 2NC9A 2FO7A 3CEQA 3LPZA 4YNDA 4N3CA 4HORA 5EX3A 3S7BA 4GA1A 1IYGA 3QWWA 4GCOA 3ZPJA 3GZ2A 3QDNA 3RKVA 3ULQA 3GZ1A 4N2SA 1FCHA 2VSYA 5EX0A 1KT0A 4KXKB 5BT1A 3AS4A 3RO2A 3S7DA 2UWJG 3MA5A 3U3WA 2VGYA 3CVLA 5LCWC 5JJ7A 4GPKA 5FTPA 4UQZA 1PC2A 4NRHB 4N3BA 3QWVA 5LCWJ 3S7FA 5D0OD 3QWPA 2BUGA 2HO1A 4WNEA 2PZIA 4I2ZA 4I1AA 3CKBA 2KC7A 4KYOB 4GYYA 3HYMB 2FI7A 2IFUA 3CK7A 2LSUA 5BNWA 4YVOA 2JLBA 3PE4A 1WM5A 4BWRA 2FEZA 2Q7FA 2C0MA 4CGVA 2YQ8A 4GZ5A 3AS5A 4GA0A 4RG6A 4J0UA 4G24A 1W3BA 3E4BA 4U0ZA 3CK8A 4HOQA 5KJLA 4I2WA 4CDRA 4UI9C 3K9IA 5ARGA 2Y4UA 2KCKA 4AY6A 3ZN3A 5FJYA 1ELRA 2YHCA 4H7XA 3KS2A 4GYWA 2MHKA 3FWVA 3SZ7A 4J8EA 3ASGA 2VGXA 5DBKA 1NA3A 1HXIA 1QQEA 2IF4A 2XGSA 4NQ0A 2HR2A 4O6FA 2R5SA 5CCMA 4N3AA 2XEVA 3R9AB 2C2LA 3ZHEB 1HZ4A 3OXGA 1A17A 3ZGQA 5FZRA 5C1DA 4LEUA 2HYZA 4RG9A 3TG5A 3SF4A 3WXXA 4N2QA 4G2VA 5KJKA 2V5FA 5FT9A
chains in the Genus database with same CATH superfamily
1JUQA 3ONLA 4JL0A 5ENTD 3UT4A 1PAQA 5H7PA 3ISMC 4BT8A 3AG1E 5ANLA 3Q79A 2WQHA 5G2NA 3GYZA 1N0QA 3UUXA 3BG0B 2CHXA 3NOGD 5AQ9A 2L9BA 3VLDA 1OWMA 2RFAA 1HH8A 4WWPA 5KBAA 3Q15A 1H6PA 2AXZA 3UM2A 2VSXE 3MV3B 4OAVB 3TJPA 3JQ1A 3FU0A 4ZHBA 1K3ZD 1SVXA 5HQ8A 3ESKA 1NFIE 4RLYA 5ANRA 5JMND 3S7JA 2ZGGA 4M7CA 4TXRA 3ASFA 5B1AE 5M72A 3FUNA 3KSLA 4A55A 4FU3A 4GMLA 3NZUA 4LNUD 1QYMA 3CVXA 4WWOA 3ZFWA 4FULA 4GZDA 4F3VA 3QARA 4E85A 3Q7AA 2ZIRA 3CVWA 5ENRD 4UWLA 1N4QA 1TNYA 2WXRA 5AAOA 5LX8A 1TN8A 4I9CA 4A1SA 1SZAA 5AENA 2X38A 3SBSA 2F37A 4APOA 4JZYA 1JWGA 2VSNA 3CK9A 1OUVA 4YDOA 3LCAA 4K5AB 4N5QA 2L6JA 3LJNA 3HVEB 4U0UA 1YA0A 3JXIA 3RJVA 4OYSA 1SW6A 5AJLA 3D9MA 3EDTB 4JXTA 1Z3YA 1NP7A 2LAHA 1ZB1A 3SHFA 4A63B 1IQRA 3CQCB 5BXUA 5EIBE 3E30A 4BERA 1MJ0A 4CT4A 2LUHA 1MHQA 3FHEA 3TWWA 2PM6A 3PREA 4J6IA 4LUNU 3D3MA 2V0PA 3D9PA 4HNAD 4GZCA 2WMOA 3ABME 2E2EA 1DC2A 4YDWA 2P9IG 3UTMA 3QKYA 3SBTB 3KD7A 3SD5A 3DPDA 3FTYA 3R7RA 5BPPA 2I2OA 3ZUVB 1TYQG 5HI7A 4LRZA 5G55A 4B8AA 3DSXA 3IEGA 2WPVA 2DYRE 4FP7A 4DPRA 4U07A 3PZ1A 1IHGA 3LVRE 3Q5MA 1NL4A 4JPSA 4OVVA 2WQ7A 3HXEA 4V3IA 4C0EA 1E96B 3L82A 5BW8C 3MCXA 4KT6B 1Y8MA 1OCOE 1OWNA 2VTBA 2L6BA 2I1KA 2DYSE 2BF0X 3I4GA 3LPZA 4HORA 4TXPA 2XEHA 5EX3A 1IYGA 2R05A 3QWWA 3IKOB 3ZPJA 3OTNA 1DCEA 3PNTB 3FUKA 1BI7B 4N2SA 1N95A 3CLJA 3CGHA 3MZLB 5BT1A 3AS4A 4JB8P 2UWJG 4CZ2D 2B6CA 3U3WA 2VGYA 3CVLA 5LCWC 4GPKA 5FTPA 2ZXWE 2V4LA 3LVQE 2EQXA 3QWPA 4CCAA 2F8XK 4WNEA 4TUUA 4TRQA 5A23A 5CECB 4I2ZA 4XKBA 2GRNB 3ZU7B 3HYMB 4GU5A 2BTDA 3V2OA 1D9SA 2FI7A 1UJJA 1S0PA 3CSTA 1IXVA 3EHNA 1OCCE 2NSZA 3B13A 2WXMA 3FUIA 4ANUA 4CEMA 2Q7FA 1FPPA 3L08A 1N11A 3C3RA 2I1JA 3JCKC 5BXOA 3EU5A 3RRNB 4GA0A 4L7TA 4HFGA 4LSZE 2M63A 1WDYA 3UI2A 3CK8A 2R2LA 2A5EA 1EF1C 1U3CA 1H6OA 4A3TA 3QB2A 3QC1A 2DZOA 4H7XA 4MS6A 3EUVA 3L9TA 3KS2A 5JA4D 4EHMA 3V30A 3T8MA 1JWFA 2P9KG 4NACA 5ENNA 4UWKA 3AJIA 1TNOA 4F53A 2IF4A 2HR2A 4DLQA 5CCMA 4N3AA 2QY7A 5FQ4A 3ONKA 5C2YA 4ILIA 2AJAA 1A17A 3TWUA 2XS1A 2MOWA 4G2VA 1O1RA 5KJKA 1HS6A 2J4DA 5FWQA 3UQ3A 4DK5A 4AM9A 3RU0A 2IONA 4BETA 1N94A 1WAO1 1PY1A 4APFA 4GCNA 3SO8A 3IHVA 3D9IA 2A5UA 4XIFA 3DSUA 5G05J 3FULA 1QZ2A 1V54E 4UI9K 1JPLA 5FZQA 3J5PA 3ABLE 2MYOA 3FTZA 1U2VG 2J9QA 3D9HA 2OVFA 2PL2A 2P9SG 3L17A 3FU3A 3ASHA 2JEKA 2DWZA 4J8FA 2Y4TA 3CKCA 4KBQA 5FQ8A 3CVYA 2HE0A 4JA9A 2VJ8A 2H6GA 2GROB 4GZ6A 4C0MA 2ZISA 3APCA 1UG3A 2XPIA 2YNQA 2H6FA 1HG2A 2E0IA 2VTBB 4N5CA 4GA2A 1S64A 1WG0A 2RKKA 3FUMA 2KCVA 3ASDA 4BSZB 4H7YA 4LCTA 4EZKA 3PH0C 3FH8A 2GRQB 3PNLB 1HFAA 4XI0A 3G2WA 4WNGA 4B93B 3DWLG 3DEOA 2XRYA 4DRXE 3Q4AB 3FUEA 3IHYA 3PZDA 5DIZA 5JHAA 4ATZD 4ANWA 2OCCE 1EDUA 3DXMG 1V55E 4HLEA 2QFCA 2J8SD 4HOTA 1N4RA 2XENA 3CQGB 5LFAA 1NI1A 5CHEE 2RFMA 4JA7A 2AVPA 4BESA 5ENQD 1FT2A 3QK0A 2XRZA 2FF4A 2ETAA 2ZGDA 3FUHA 1BU9A 1KPSB 1JCSA 2CG3A 4ACKA 4WAFA 2CHZA 2RG8A 4I9EA 3O48A 3IXEA 1MYOA 4EQFA 2OEWA 2XZDG 3PUKA 3FEXA 3DBSA 5JHBA 4HB5A 4WUYA 5D0QD 3IV0A 3ZHEA 5A7DB 5A6CA 1HX8A 3B95A 3P2BA 1TN6A 5AN8A 3CHOA 4CGWA 3HXDA 4U95D 1SA5A 3DSTA 5CCLA 5JJ6A 3CVQA 3OXFA 4FA6A 3C72A 4Z68A 2FULA 2XGMA 4BEPA 2H6HA 2R03A 4CDNA 4J8YA 4G23A 2A4ZA 5J90A 4RVBA 2YHEA 3LY7A 4JHRA 4CRWA 1IKND 3L13A 2DCPA 3G2UA 3RSEG 3GW4A 3UM3A 4O1PA 1UW4B 3WG7E 3Q47B 1NA0A 3TGOA 1OXJA 4L9PA 3G2SA 1FT1A 1KZOA 5HKPA 4G11A 4IYPA 3E37A 4G26A 2UY1A 3TWQA 3UIOC 2LAIA 1A5EA 3SFZA 4KVOA 2WM9A 3D9KA 2QYJA 4GYOA 3UINC 3CVPA 4YVQC 4HOUA 3EIQC 4U96D 4L2YA 1AWCB 3T9KA 3SI5A 4FHKA 3ZYKA 2WB2A 4CT0A 4YNDA 4N3CA 3DSSA 3JQ0A 3HXFA 4Q69A 3ZEFA 3UKRG 1QNFA 5T4YA 4ZFHA 2I9CA 4XZ4A 1OY3D 2OVBA 2R59A 1MX4A 3ZKJA 4U7EB 1FCHA 3ENEA 5EX0A 1KT0A 3RO2A 3L16A 4UWGA 4CDMA 4XE0A 2BKKB 4OVUA 3B7UX 4UQZA 2WXLA 3P1UA 4G8LA 2CG2A 4FADA 3HIZA 4RSYA 5D0OD 4AXHA 2BUGA 3ML8A 1N9AA 2J07A 3G2TA 5CRUA 4GB9A 3SQVA 3PEVB 3F6QA 3SNXA 3FTVA 4J8SA 4AJWA 3PRZA 4UWFA 2LSUA 4YVOA 2R17C 3KSQA 1HF8A 2JLBA 2XPZA 3OAWA 3I5PA 5EDSA 4JEUA 2H6IA 4I6EA 3FUDA 3CSFA 5HS0A 2XEEA 4BX8A 3TWXA 2AXVA 3CVUA 3E4BA 4HOQA 2IOSA 2CFUA 3IBEA 4UI9C 5ARGA 2KCKA 1Z6TA 3ZN3A 5FJYA 4JEHA 3FUFA 2YHCA 5EYPF 3FH7A 1DNPA 2MHKA 1H0AA 3S2AA 2OV8A 2XHEA 5ENOD 1WY6A 1QQEA 4O1OA 4HLLA 3DSWA 4NQ0A 4EZLA 4F7AA 1N0RA 2XEVA 5AJDA 3R7QA 3ZHEB 2C2LA 4DUIA 5AQBA 3UKUG 2HYZA 3FY4A 3SF4A 2IJGX 2Y3AA 5HRYA 3CHRA 1EYHA 4I17A 3E33A 2KZTA 3TWVA 1RW2A 1E8ZA 3CV0A 3E32A 1IHBA 3T5XA 2X6HA 3AG4E 4GTOA 5BUZA 3LEWA 3CHQA 2EIKE 3EU9A 3MKQA 1EPUA 2J08A 5KNGA 1N4PA 4U63A 4K5CA 3FTWA 3Q49B 3AS8A 2CHWA 5ENPD 3ZNGA 3EHRA 4WWNA 2P9UG 1Q2ZA 1HE8A 2EILE 3BEEA 4Y6CA 1O5MA 4K0RA 2V8SE 2IOLA 4BTAA 2ONDA 2UY1B 2VYIA 3Q73A 1KLXA 3VTXA 3EHQA 1MX6A 2J49A 3TWSA 4HRMB 4L23A 2XCBA 5AQ7A 4BT9A 3RO3A 2GRRB 2KATA 5KJMA 3V2XA 3N71A 3I3NA 3LYAA 5EN5D 4FHJA 4GMJA 2WXQA 3G2VA 4PDXA 1S70B 1VDYA 4N39A 4NURA 5JJTA 1U3DA 2WXIA 4B94A 1ELWA 4JC8A 1B89A 2HM8A 3W9GA 2LSVA 3ZVVA 3FP3A 4UQXA 3AG3E 1FVFA 3FEYA 3Q9NC 3RAUA 3ZYMA 2IU1A 1MQSA 4AIFA 3SY2A 5CEDB 1YYHA 3MGBA 3D9JA 1NZNA 3FUJA 4EECA 1QBQA 1N52A 1TNUA 4TXQA 2IY0C 1H2UA 3TAXA 4GZ3A 5KCMA 5BV1A 3KEAA 5AYWD 3RIBA 3O4ZA 4BTBA 3L54A 3JXJA 3TL5A 3PE3A 3LY8A 2WXGA 1E8XA 3D9NA 1TNBA 3RRUA 2XGOA 2AW6A 2OOEA 3DRAA 1TJCA 3AAAC 5D66A 4DX5D 5ITZF 2LXLA 3QAQA 4U0SA 3ZW3A 4G1TA 4MLPA 3HXBA 1TJFA 1HU3A 1D8EA 4ABNA 4HRLA 4WNFA 1S63A 3KEZA 1GW6A 2X6JA 3UT7A 3ZXSA 1K8KG 4A1GA 5FQ7A 3Q7FA 1E7VA 3CVNA 3OXLA 4JVSA 5CRVA 3ULEG 4FLHA 3PUJA 4M3OA 5G04J 3DPYA 3FDHA 2DIWA 5T3RA 4EZJA 2I6HA 3ASOE 4F1SA 3UX4A 2AWIA 4XI9A 1X5BA 2J4BA 1O1SA 1LF8A 5B1BE 1O1TA 2OEVA 2RD0A 4B8CB 2WXKA 3PZ2A 1LTXA 3B7BA 2ETCA 3VLFA 1SQMA 3FFLA 3JUEA 2DZNA 1P5QA 3CIAA 2NC9A 2FO7A 3QJZA 3DEPA 1KZPA 2KZTB 3D9OA 3S7BA 3T8KA 4GCOA 1L5JA 3NB2A 3MJWA 3GZ2A 3ABKE 3PZ4A 3RKVA 4UWHA 4GAAA 2CFZA 3ULQA 1Z5SC 4GTSA 2X6IA 4HS2A 3MKQB 3RRMB 1N4SA 4BFRA 1JCQA 4ILGA 5D2MC 4JHKA 1DCQA 3R9MA 5JJ7A 4HBDA 2V5QC 1H2VC 1PC2A 4NRHB 4I1OB 4N3BA 3QWVA 4CYMD 4XKCA 3S7FA 4EPZA 4DI3A 3AG2E 4EBAG 3CHPA 2PZIA 4L2LA 2P9LG 4KYOB 4GYYA 5CBNA 3ESLA 2IFUA 3FH5A 3BUAA 2GGFA 3B7TA 3PE4A 2FEZA 3L22A 2WXJA 1SZ9A 2C0MA 2YQ8A 1OT8A 4GZ5A 3AS5A 4DX2A 4HVBA 3CHMA 4RG6A 5ENSD 4J0UA 4XEIG 1UN9A 3PVLA 3SGHA 2LO6A 1IQUA 3Q75A 4KZ0A 5EIDA 5AARA 3HDXA 4I2WA 3DXKG 3U64A 2LXMA 2QZAA 4D10C 4AY6A 4GMRA 4AOFA 2WXHA 4IRUA 3L6AA 4MKTA 3AU4A 1Y6IA 4GYWA 2B0OE 4U8HA 4FJZA 3LXUX 1D8DA 3FWVA 1OCZE 2WQ6A 4AEZC 4GTTA 3APDA 4DJAA 4QQIA 2VGXA 5DBKA 4HI9A 2XQ0A 1E90A 3SFYA 3LS8A 4NIKA 1UJKA 4O6FA 2WXPA 2DVWA 3R9AB 2GRMA 4HXIA 5E76A 4ILHB 4DI4A 3JUIA 3PS6A 3TXMA 1XGWA 3E34A 5FZRA 5C1DA 5LOZA 4LEUA 3UM0A 3CHSA 3VLEA 4O60A 2QC9A 3PZ3A 3ASNE 2V5FA 5FT9A 2PNNA 1XNFA 3QOUA 3C5RA 3UIPC 1ZU2A 3CR3A 2P58C 3LKUA 4TUMA 3TG4A 3EJNA 4U8YD 3APFA 5EKQD 1H19A 3UM1A 3D9LA 4DX7D 3PDNA 4U04A 2XCCA 3URZA 2KXPC 3GZSA 3MX3A 3W9FA 4ANVA 4PUCA 2VQ2A 2KCLA 2WXOA 1YCSB 1TNZA 2EINE 4YDYA 1YMPA 3FU5A 4K5BA 3U4TA 1TR4A 3HXCA 1OWLA 3NAWA 1E7UA 4IULA 3BG1B 1BD8A 2FBNA 4LERA 3NOCD 3B7SA 2XS8A 2JABA 1LD7A 3EIJA 2GW1A 2EIJE 3V79K 5AIJA 2Y0BG 2PQRA 2PQNA 3BU8A 4ACLA 3UXGA 4AY5A 1Z3XA 3I4RB 5CBOA 1KT1A 1BLXB 4WNDA 4FLBA 4I6GA 4EBAA 1DVPA 2X3MA 3FTXA 4DX6D 2C0LA 4I6JA 4Q96A 1UOHA 3MV2B 4X8QA 3MEKA 2WVIA 4XX5A 4DX1A 3PEUB 5CERB 3MKRA 4J8DA 2NXPA 1ZBPA 3J5QB 3U66A 5FQ6A 3MYVA 4KMOA 3U9WA 4BX9A 2AXUA 4HI8A 2F0YA 1H6KA 4A3VA 3KAEA 2ZU6B 2MRIA 5G05C 2GRPB 3C3QA 2F8YA 1G3NB 2NYJA 2J09A 3NQPA 3DSVA 4B0ZA 1H2TC 4Y6WA 2P9PG 2QYUA 5ARFA 4LNGA 3LY9A 1X81A 4HOSA 3JYSA 5KJNA 1K1BA 2P9NG 4U8VD 3UT8A 5BV0A 2BEDA 4W9RA 3HRAA 2R02A 1HO8A 4URKA 4LG6A 4QFVA 3FU6A 3ZYLA 3NF1A 4PH4B 3ULYA 4MBGA 1E8WA 4AV7A 2EIME 4RQIA 3CVVA 5KNHD 5G04C 4MRUA 5AQAA 2YINA 4L1BA 5FZSA 1MZCA 5B3SE 4G25A 1MX2A 3VTYA 2IEJA 1ELKA 2VGXB 5KWDA 3NZSA 3X2QE 4E6HA 1UN8A 4ME2A 2DBAA 4FJYA 4JW1A 3BQOA 4BSXA 2KM4A 1AP7A 2LNIA 4KZCA 3LJ3A 3UPVA 4GTQA 3SFXA 4F1PA 3TWTA 4UI9J 2Y1LE 3EHMA 4UQYA 4I43A 1OCRE 4IN3B 3B7RL 3QNKA 3ZYQA 2WXNA 1INZA 4R7LA 3CEQA 2PM7A 4GTVA 4HRNA 2IO3C 1FVHA 4TV3A 2IO2C 4GA1A 3C98A 3LDZA 3HG0D 5FINA 1TEZA 5CMYA 3QDNA 4PS7A 4JD2G 2KBXA 1K1AA 3GZ1A 3C3OA 2VSYA 3RK6A 1HG5A 4KXKB 4B89A 5FIOA 4G8KA 3S7DA 3MA5A 1RZ4A 1JCRA 4C48B 4Q94A 5IY5E 4FC8A 4AVXA 4LNBA 3HVEA 5LCWJ 3ZXPA 2XZTG 1TN7A 5EYLA 4F6RD 2L0IA 4GTPA 2HO1A 4AP2A 2P2CP 4GPMA 4I1AA 5EILA 3CKBA 2KC7A 4K03A 4GTRA 2L0TB 2WMNA 3UMVA 3CK7A 3FTUA 5BNWA 4P29A 2GRLA 4DLOA 4PS8A 1WM5A 3Q9UC 4BWRA 2BKGA 4CGVA 3TWRA 4ANXA 4UUCA 3FTSA 4JHJA 3HHMA 1N54A 4G24A 5J08A 1W3BA 1OWPA 2XPYA 4U0ZA 3V31A 1OWOA 2Y69E 5CEAA 5KJLA 4J7WA 3TXNA 4CDRA 3K9IA 2Y4UA 1BPOA 2ILRA 1ELRA 3T5VA 4C9BB 4ATGA 3NBNB 1LD8A 3SZ7A 3Q78A 4J8EA 3ASGA 1NA3A 1HXIA 2ETBA 4I1MA 4OAUC 1BI8B 2XGSA 2X6FA 1E8YA 2V4HC 2R5SA 4GTMA 3ZIMA 3ML9A 5T8IA 1HZ4A 3OXGA 2VGEA 3ZRHA 3ZGQA 4YDEA 1SA4A 5LP0A 3AU5A 4RG9A 4KVMA 3TG5A 2FO1E 2VSOE 2IQCA 3WXXA 5CMWA 4N2QA 4BY6A 4PS3A 5E75A 2WXFA 4HQDA 2X6KA
chains in the Genus database with same CATH topology
1XNFA 1EYHA 1JUQA 3CHRA 3QOUA 3ONLA 3UQ3A 4JL0A 4I17A 4AM9A 4DK5A 1ZU2A 3CR3A 2KZTA 2P58C 3RU0A 3UT4A 1PAQA 2IONA 3LKUA 1WAO1 4BT8A 1PY1A 3TG4A 3EJNA 1E8ZA 4APFA 3CV0A 4GCNA 5ANLA 3APFA 5EKQD 3IHVA 1H19A 3D9IA 2A5UA 3T5XA 4XIFA 2X6HA 5BUZA 3LEWA 2WQHA 3CHQA 3D9LA 3PDNA 4U04A 5G2NA 3GYZA 2XCCA 5G05J 3UUXA 3BG0B 2CHXA 3FULA 3URZA 3GZSA 1QZ2A 3MKQA 1EPUA 4UI9K 2L9BA 2J08A 1JPLA 5FZQA 3VLDA 3MX3A 4U63A 4ANVA 4PUCA 1OWMA 3FTWA 1HH8A 3Q49B 2VQ2A 3AS8A 2CHWA 2KCLA 4WWPA 2WXOA 4WWNA 3FTZA 3Q15A 2J9QA 1HE8A 2OVFA 2PL2A 3L17A 3BEEA 3FU3A 4Y6CA 3ASHA 2JEKA 2AXZA 4K0RA 2V8SE 3FU5A 2IOLA 2VSXE 4J8FA 4BTAA 2Y4TA 3MV3B 3U4TA 2ONDA 3CKCA 2UY1B 4KBQA 3TJPA 3JQ1A 5FQ8A 2VYIA 3FU0A 3CVYA 1OWLA 4JA9A 5HQ8A 2VJ8A 1E7UA 1KLXA 4GZ6A 4C0MA 3VTXA 3ESKA 4IULA 3APCA 1UG3A 2XPIA 3BG1B 2FBNA 2YNQA 1HG2A 4LERA 2J49A 2E0IA 4L23A 2VTBB 3B7SA 4N5CA 2XCBA 4GA2A 4BT9A 3RO3A 5ANRA 2KATA 3EIJA 3S7JA 2GW1A 5KJMA 3FUMA 3N71A 3ASFA 2KCVA 5AIJA 5M72A 3FUNA 3ASDA 3I3NA 2PQRA 4H7YA 3LYAA 4LCTA 4A55A 4FHJA 4EZKA 2PQNA 3PH0C 4FU3A 4GMLA 3FH8A 3PNLB 3NZUA 4ACLA 3CVXA 4GMJA 4WWOA 4AY5A 2WXQA 3G2VA 1Z3XA 1HFAA 4FULA 3ZFWA 3I4RB 4GZDA 4PDXA 1VDYA 1KT1A 4F3VA 3QARA 4N39A 4NURA 4XI0A 4E85A 5JJTA 1U3DA 3G2WA 4WNDA 3R9AB 4FLBA 3CVWA 2WXIA 4WNGA 4I6GA 4B94A 1ELWA 4JC8A 4EBAA 4UWLA 1B89A 2HM8A 2WXRA 1DVPA 2X3MA 5LX8A 2LSVA 3ZVVA 4I9CA 2XRYA 4A1SA 3FP3A 1SZAA 4UQXA 3Q4AB 3FTXA 3FUEA 1FVFA 5AENA 2C0LA 2X38A 3IHYA 3PZDA 4I6JA 4Q96A 5DIZA 3SBSA 5JHAA 3FEYA 3ZYMA 2IU1A 1MQSA 4APOA 4AIFA 3MV2B 4JZYA 4ANWA 3MGBA 1EDUA 3MEKA 4HLEA 1JWGA 2QFCA 4HOTA 2VSNA 2WVIA 3CK9A 1OUVA 4XX5A 3PEUB 3D9JA 3LCAA 3MKRA 4J8DA 3CQGB 5LFAA 1NZNA 3FUJA 2L6JA 2NXPA 4EECA 1N52A 1ZBPA 5CHEE 3HVEB 4JA7A 2AVPA 4U0UA 1H2UA 5FQ6A 3TAXA 3U66A 4GZ3A 3QK0A 2XRZA 5KCMA 1YA0A 2FF4A 3MYVA 5AYWD 3ZHEB 3FUHA 4KMOA 3U9WA 4BX9A 2AXUA 3RJVA 4OYSA 5AJLA 3D9MA 1H6KA 2CG3A 3EDTB 3RIBA 4ACKA 4A3VA 4JXTA 4WAFA 2CHZA 3KAEA 3O4ZA 2RG8A 4I9EA 3O48A 4BTBA 4EQFA 3L54A 2ZU6B 3PUKA 3TL5A 3PE3A 1Z3YA 3LY8A 2MRIA 1NP7A 3FEXA 2WXGA 3DBSA 2LAHA 1E8XA 5G05C 5JHBA 3SHFA 1IQRA 3D9NA 3CQCB 3RRUA 4WUYA 2XGOA 2AW6A 2J09A 3NQPA 5D0QD 3IV0A 2OOEA 3ZHEA 5A7DB 5A6CA 4B0ZA 1H2TC 1HX8A 4Y6WA 5ARFA 3P2BA 1TJCA 3LY9A 3CHOA 4HOSA 4CGWA 3JYSA 4CT4A 3QAQA 5KJNA 4U0SA 1MHQA 3FHEA 3ZW3A 4G1TA 4MLPA 1TJFA 2PM6A 3PREA 3UT8A 4J6IA 5BV0A 1HU3A 4W9RA 4ABNA 4LUNU 1HO8A 4URKA 4WNFA 5CCLA 3KEZA 1GW6A 4QFVA 5JJ6A 3D3MA 2X6JA 3FU6A 3ZYLA 2V0PA 3D9PA 3CVQA 3OXFA 4GZCA 2WMOA 3NF1A 4FA6A 4PH4B 3UT7A 1E8WA 2E2EA 3ZXSA 4AV7A 4A1GA 5FQ7A 3CVVA 3QKYA 2FULA 2XGMA 5G04C 4MRUA 3SBTB 4CDNA 1E7VA 3CVNA 3KD7A 2A4ZA 4G23A 5J90A 3OXLA 2YINA 3DPDA 4JVSA 4RVBA 3SD5A 4L1BA 2YHEA 3LY7A 3FTYA 4JHRA 5FZSA 4CRWA 3R7RA 5BPPA 2I2OA 4FLHA 3PUJA 4M3OA 5G04J 3L13A 2DCPA 3FDHA 3G2UA 2DIWA 5T3RA 3GW4A 4EZJA 5HI7A 4LRZA 5G55A 4B8AA 3IEGA 2WPVA 4FP7A 2I6HA 4G25A 4DPRA 1UW4B 4F1SA 3UX4A 4U07A 1IHGA 2AWIA 3LVRE 3Q5MA 3VTYA 1ELKA 2VGXB 3Q47B 4XI9A 1NA0A 3TGOA 3NZSA 1X5BA 3G2SA 4JPSA 4OVVA 2WQ7A 4E6HA 1UN8A 2J4BA 4ME2A 4V3IA 4G11A 4C0EA 2DBAA 4IYPA 1E96B 4G26A 2UY1A 2LAIA 5BW8C 4FJYA 1LF8A 4JW1A 3SFZA 4KVOA 3MCXA 4BSXA 2KM4A 4KT6B 2WM9A 2RD0A 2LNIA 1Y8MA 3D9KA 4KZCA 3LJ3A 4B8CB 3UPVA 2WXKA 4GYOA 1OWNA 2VTBA 3CVPA 4YVQC 4HOUA 3EIQC 4UI9J 3VLFA 1SQMA 3EHMA 3FFLA 4L2YA 4UQYA 2I1KA 4I43A 4IN3B 3B7RL 3QNKA 3SI5A 3ZYQA 1P5QA 3CIAA 2WXNA 1INZA 4R7LA 2NC9A 2FO7A 3CEQA 4FHKA 2PM7A 2BF0X 3I4GA 3QJZA 3ZYKA 4CT0A 2WB2A 3LPZA 4YNDA 4N3CA 4HORA 2KZTB 1FVHA 5EX3A 3D9OA 4TV3A 3S7BA 3JQ0A 4GA1A 4Q69A 1IYGA 3ZEFA 3QWWA 1L5JA 3IKOB 4GCOA 3C98A 3MJWA 3ZPJA 3LDZA 3GZ2A 1QNFA 5T4YA 3OTNA 1TEZA 5CMYA 3PNTB 3QDNA 4PS7A 3RKVA 2I9CA 4UWHA 4XZ4A 4GAAA 2CFZA 3ULQA 3FUKA 2OVBA 5FWQA 2X6IA 3GZ1A 2R59A 4N2SA 4HS2A 3CLJA 3MKQB 3CGHA 1FCHA 2VSYA 3ENEA 3RRMB 3RK6A 5EX0A 1HG5A 1KT0A 4KXKB 3MZLB 5BT1A 4BFRA 4B89A 3AS4A 3RO2A 3S7DA 2UWJG 3L16A 3MA5A 4UWGA 4CDMA 4ILGA 3U3WA 4JHKA 2VGYA 4XE0A 3CVLA 5LCWC 5JJ7A 4OVUA 4GPKA 5FTPA 4Q94A 3B7UX 4UQZA 4FC8A 1H2VC 2V4LA 1PC2A 2WXLA 4NRHB 4AVXA 3LVQE 4I1OB 3P1UA 4N3BA 2CG2A 3HVEA 3QWVA 5LCWJ 4FADA 3HIZA 2EQXA 4XKCA 4RSYA 3S7FA 5D0OD 3QWPA 4AXHA 2BUGA 3ML8A 4CCAA 2J07A 2L0IA 3G2TA 4DI3A 4EPZA 4EBAG 2HO1A 4WNEA 4AP2A 3CHPA 4TUUA 4TRQA 4GB9A 2PZIA 5A23A 4I2ZA 3PEVB 4I1AA 3CKBA 4L2LA 2KC7A 4XKBA 3SNXA 4KYOB 3FTVA 4GYYA 4K03A 3HYMB 4GU5A 2BTDA 3ESLA 4J8SA 4AJWA 2FI7A 3PRZA 2IFUA 2L0TB 1UJJA 3FH5A 1S0PA 2WMNA 3CSTA 2GGFA 3UMVA 3EHNA 4UWFA 3CK7A 2LSUA 3FTUA 4YVOA 5BNWA 2R17C 2NSZA 3B13A 4P29A 2WXMA 3B7TA 2GRLA 3FUIA 1HF8A 2JLBA 2XPZA 4DLOA 4ANUA 3PE4A 3OAWA 3I5PA 4PS8A 1WM5A 5EDSA 4CEMA 4BWRA 2FEZA 2Q7FA 3L22A 4JEUA 2WXJA 3L08A 1SZ9A 2C0MA 4CGVA 4I6EA 2I1JA 3FUDA 2YQ8A 3CSFA 3JCKC 3RRNB 4GZ5A 3AS5A 4ANXA 4GA0A 4L7TA 4HVBA 3FTSA 3CHMA 4RG6A 4JHJA 4J0UA 4HFGA 3HHMA 4BX8A 1N54A 4G24A 5J08A 1W3BA 2AXVA 2M63A 1OWPA 3CVUA 1UN9A 3PVLA 3E4BA 2XPYA 4U0ZA 3SGHA 2LO6A 3CK8A 4HOQA 1IQUA 1OWOA 2CFUA 2IOSA 3IBEA 4KZ0A 3HDXA 5KJLA 4I2WA 3TXNA 4CDRA 4UI9C 3K9IA 5ARGA 3U64A 2Y4UA 4D10C 2KCKA 1Z6TA 4AY6A 3ZN3A 1EF1C 1U3CA 5FJYA 1BPOA 4JEHA 4A3TA 4AOFA 3QB2A 2ILRA 2WXHA 1ELRA 3T5VA 3FUFA 4IRUA 2YHCA 4C9BB 3QC1A 4H7XA 3FH7A 3L6AA 4ATGA 4MS6A 4MKTA 3KS2A 3AU4A 1Y6IA 1DNPA 4GYWA 2MHKA 4U8HA 4FJZA 1H0AA 3LXUX 3FWVA 2OV8A 3S2AA 2WQ6A 3SZ7A 3T8MA 4AEZC 2XHEA 4J8EA 1JWFA 3ASGA 3APDA 4DJAA 2VGXA 4NACA 5DBKA 1NA3A 1HXIA 2XQ0A 1E90A 1WY6A 5ENNA 4I1MA 4UWKA 4F53A 3LS8A 1QQEA 2IF4A 2X6FA 2XGSA 4NQ0A 2HR2A 4EZLA 4DLQA 1E8YA 1UJKA 4O6FA 4F7AA 2R5SA 5CCMA 4N3AA 3ZIMA 2WXPA 2XEVA 5AJDA 3R7QA 2QY7A 5FQ4A 3ML9A 2GRMA 2C2LA 3ONKA 1HZ4A 4HXIA 5E76A 4ILIA 5C2YA 5T8IA 3OXGA 4ILHB 1A17A 3ZRHA 3JUIA 4DI4A 3PS6A 3TXMA 1XGWA 3ZGQA 5BV1A 5FZRA 5LP0A 5C1DA 3AU5A 5LOZA 4LEUA 3CHSA 2HYZA 4RG9A 3VLEA 4KVMA 2MOWA 3TG5A 3FY4A 3SF4A 2VSOE 2IQCA 3WXXA 5CMWA 4N2QA 4BY6A 2IJGX 4G2VA 4PS3A 2Y3AA 5KJKA 1HS6A 2J4DA 2V5FA 2WXFA 5E75A 5FT9A 2X6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNF A;  3QOU A;  3UQ3 A;  4JL0 A;  4I17 A;  4AM9 A;  1ZU2 A;  3RU0 A;  2P58 C;  3LKU A;  1WAO 1;  4BT8 A;  3TG4 A;  3CV0 A;  4GCN A;  5EKQ D;  4XIF A;  2WQH A;  3PDN A;  4U04 A;  3GYZ A;  2XCC A;  5G05 J;  3UUX A;  3URZ A;  1QZ2 A;  4UI9 K;  5FZQ A;  3Q49 B;  1HH8 A;  2VQ2 A;  3AS8 A;  2KCL A;  3Q15 A;  2J9Q A;  2PL2 A;  3BEE A;  4Y6C A;  3ASH A;  4J8F A;  4BTA A;  2Y4T A;  3MV3 B;  3U4T A;  2OND A;  3CKC A;  2UY1 B;  4KBQ A;  2VYI A;  4JA9 A;  5HQ8 A;  1KLX A;  4GZ6 A;  3VTX A;  3ESK A;  2XPI A;  2FBN A;  4N5C A;  2XCB A;  4GA2 A;  4BT9 A;  3RO3 A;  2KAT A;  3S7J A;  2GW1 A;  5KJM A;  3N71 A;  3ASF A;  2KCV A;  5M72 A;  3ASD A;  4H7Y A;  2PQR A;  3LYA A;  2PQN A;  4AY5 A;  3ZFW A;  1KT1 A;  4F3V A;  4N39 A;  4XI0 A;  5JJT A;  4WND A;  4WNG A;  4B94 A;  1ELW A;  1B89 A;  2LSV A;  4I9C A;  4A1S A;  3FP3 A;  4UQX A;  3Q4A B;  2C0L A;  5DIZ A;  4APO A;  4AIF A;  3MV2 B;  3MEK A;  2QFC A;  4HOT A;  2VSN A;  3CK9 A;  1OUV A;  3LCA A;  3MKR A;  4J8D A;  1NZN A;  2L6J A;  1ZBP A;  5CHE E;  4JA7 A;  2AVP A;  4U0U A;  3TAX A;  4GZ3 A;  1YA0 A;  2FF4 A;  5AYW D;  3RJV A;  3EDT B;  3RIB A;  3KAE A;  4I9E A;  4BTB A;  3O48 A;  4EQF A;  3PE3 A;  3LY8 A;  5G05 C;  4WUY A;  2XGO A;  5D0Q D;  3ZHE A;  2OOE A;  5A7D B;  5A6C A;  4Y6W A;  5ARF A;  1TJC A;  3LY9 A;  4HOS A;  4CGW A;  3JYS A;  5KJN A;  4U0S A;  4G1T A;  4W9R A;  4ABN A;  4WNF A;  5CCL A;  5JJ6 A;  3CVQ A;  3OXF A;  3NF1 A;  2E2E A;  3QKY A;  2XGM A;  5G04 C;  3CVN A;  3KD7 A;  4G23 A;  3OXL A;  3LY7 A;  4JHR A;  5FZS A;  5G04 J;  3GW4 A;  5HI7 A;  3IEG A;  2WPV A;  4G25 A;  2I6H A;  4U07 A;  1IHG A;  3Q5M A;  3VTY A;  2VGX B;  3Q47 B;  4XI9 A;  1NA0 A;  3TGO A;  4ME2 A;  2DBA A;  1E96 B;  4G26 A;  2UY1 A;  5BW8 C;  2LNI A;  1Y8M A;  3UPV A;  4GYO A;  3CVP A;  4YVQ C;  4HOU A;  4UI9 J;  3FFL A;  4UQY A;  4IN3 B;  1P5Q A;  2NC9 A;  2FO7 A;  3CEQ A;  3LPZ A;  4YND A;  4N3C A;  4HOR A;  5EX3 A;  3S7B A;  4GA1 A;  1IYG A;  3QWW A;  4GCO A;  3ZPJ A;  3GZ2 A;  3QDN A;  3RKV A;  3ULQ A;  3GZ1 A;  4N2S A;  1FCH A;  2VSY A;  5EX0 A;  1KT0 A;  4KXK B;  5BT1 A;  3AS4 A;  3RO2 A;  3S7D A;  2UWJ G;  3MA5 A;  3U3W A;  2VGY A;  3CVL A;  5LCW C;  5JJ7 A;  4GPK A;  5FTP A;  4UQZ A;  1PC2 A;  4NRH B;  4N3B A;  3QWV A;  5LCW J;  3S7F A;  5D0O D;  3QWP A;  2BUG A;  2HO1 A;  4WNE A;  2PZI A;  4I2Z A;  4I1A A;  3CKB A;  2KC7 A;  4KYO B;  4GYY A;  3HYM B;  2FI7 A;  2IFU A;  3CK7 A;  2LSU A;  5BNW A;  4YVO A;  2JLB A;  3PE4 A;  1WM5 A;  4BWR A;  2FEZ A;  2Q7F A;  2C0M A;  4CGV A;  2YQ8 A;  4GZ5 A;  3AS5 A;  4GA0 A;  4RG6 A;  4J0U A;  4G24 A;  1W3B A;  3E4B A;  4U0Z A;  3CK8 A;  4HOQ A;  5KJL A;  4I2W A;  4CDR A;  4UI9 C;  3K9I A;  5ARG A;  2Y4U A;  2KCK A;  4AY6 A;  3ZN3 A;  5FJY A;  1ELR A;  2YHC A;  4H7X A;  3KS2 A;  4GYW A;  2MHK A;  3FWV A;  3SZ7 A;  4J8E A;  3ASG A;  2VGX A;  5DBK A;  1NA3 A;  1HXI A;  1QQE A;  2IF4 A;  2XGS A;  4NQ0 A;  2HR2 A;  4O6F A;  2R5S A;  5CCM A;  4N3A A;  2XEV A;  3R9A B;  2C2L A;  3ZHE B;  1HZ4 A;  3OXG A;  1A17 A;  3ZGQ A;  5FZR A;  5C1D A;  4LEU A;  2HYZ A;  4RG9 A;  3TG5 A;  3SF4 A;  3WXX A;  4N2Q A;  4G2V A;  5KJK A;  2V5F A;  5FT9 A; 
#chains in the Genus database with same CATH topology
 1JUQ A;  3ONL A;  4JL0 A;  5ENT D;  3UT4 A;  1PAQ A;  5H7P A;  3ISM C;  4BT8 A;  3AG1 E;  5ANL A;  3Q79 A;  2WQH A;  5G2N A;  3GYZ A;  1N0Q A;  3UUX A;  3BG0 B;  2CHX A;  3NOG D;  5AQ9 A;  2L9B A;  3VLD A;  1OWM A;  2RFA A;  1HH8 A;  4WWP A;  5KBA A;  3Q15 A;  1H6P A;  2AXZ A;  3UM2 A;  2VSX E;  3MV3 B;  4OAV B;  3TJP A;  3JQ1 A;  3FU0 A;  4ZHB A;  1K3Z D;  1SVX A;  5HQ8 A;  3ESK A;  1NFI E;  4RLY A;  5ANR A;  5JMN D;  3S7J A;  2ZGG A;  4M7C A;  4TXR A;  3ASF A;  5B1A E;  5M72 A;  3FUN A;  3KSL A;  4A55 A;  4FU3 A;  4GML A;  3NZU A;  4LNU D;  1QYM A;  3CVX A;  4WWO A;  3ZFW A;  4FUL A;  4GZD A;  4F3V A;  3QAR A;  4E85 A;  3Q7A A;  2ZIR A;  3CVW A;  5ENR D;  4UWL A;  1N4Q A;  1TNY A;  2WXR A;  5AAO A;  5LX8 A;  1TN8 A;  4I9C A;  4A1S A;  1SZA A;  5AEN A;  2X38 A;  3SBS A;  2F37 A;  4APO A;  4JZY A;  1JWG A;  2VSN A;  3CK9 A;  1OUV A;  4YDO A;  3LCA A;  4K5A B;  4N5Q A;  2L6J A;  3LJN A;  3HVE B;  4U0U A;  1YA0 A;  3JXI A;  3RJV A;  4OYS A;  1SW6 A;  5AJL A;  3D9M A;  3EDT B;  4JXT A;  1Z3Y A;  1NP7 A;  2LAH A;  1ZB1 A;  3SHF A;  4A63 B;  1IQR A;  3CQC B;  5BXU A;  5EIB E;  3E30 A;  4BER A;  1MJ0 A;  4CT4 A;  2LUH A;  1MHQ A;  3FHE A;  3TWW A;  2PM6 A;  3PRE A;  4J6I A;  4LUN U;  3D3M A;  2V0P A;  3D9P A;  4HNA D;  4GZC A;  2WMO A;  3ABM E;  2E2E A;  1DC2 A;  4YDW A;  2P9I G;  3UTM A;  3QKY A;  3SBT B;  3KD7 A;  3SD5 A;  3DPD A;  3FTY A;  3R7R A;  5BPP A;  2I2O A;  3ZUV B;  1TYQ G;  5HI7 A;  4LRZ A;  5G55 A;  4B8A A;  3DSX A;  3IEG A;  2WPV A;  2DYR E;  4FP7 A;  4DPR A;  4U07 A;  3PZ1 A;  1IHG A;  3LVR E;  3Q5M A;  1NL4 A;  4JPS A;  4OVV A;  2WQ7 A;  3HXE A;  4V3I A;  4C0E A;  1E96 B;  3L82 A;  5BW8 C;  3MCX A;  4KT6 B;  1Y8M A;  1OCO E;  1OWN A;  2VTB A;  2L6B A;  2I1K A;  2DYS E;  2BF0 X;  3I4G A;  3LPZ A;  4HOR A;  4TXP A;  2XEH A;  5EX3 A;  1IYG A;  2R05 A;  3QWW A;  3IKO B;  3ZPJ A;  3OTN A;  1DCE A;  3PNT B;  3FUK A;  1BI7 B;  4N2S A;  1N95 A;  3CLJ A;  3CGH A;  3MZL B;  5BT1 A;  3AS4 A;  4JB8 P;  2UWJ G;  4CZ2 D;  2B6C A;  3U3W A;  2VGY A;  3CVL A;  5LCW C;  4GPK A;  5FTP A;  2ZXW E;  2V4L A;  3LVQ E;  2EQX A;  3QWP A;  4CCA A;  2F8X K;  4WNE A;  4TUU A;  4TRQ A;  5A23 A;  5CEC B;  4I2Z A;  4XKB A;  2GRN B;  3ZU7 B;  3HYM B;  4GU5 A;  2BTD A;  3V2O A;  1D9S A;  2FI7 A;  1UJJ A;  1S0P A;  3CST A;  1IXV A;  3EHN A;  1OCC E;  2NSZ A;  3B13 A;  2WXM A;  3FUI A;  4ANU A;  4CEM A;  2Q7F A;  1FPP A;  3L08 A;  1N11 A;  3C3R A;  2I1J A;  3JCK C;  5BXO A;  3EU5 A;  3RRN B;  4GA0 A;  4L7T A;  4HFG A;  4LSZ E;  2M63 A;  1WDY A;  3UI2 A;  3CK8 A;  2R2L A;  2A5E A;  1EF1 C;  1U3C A;  1H6O A;  4A3T A;  3QB2 A;  3QC1 A;  2DZO A;  4H7X A;  4MS6 A;  3EUV A;  3L9T A;  3KS2 A;  5JA4 D;  4EHM A;  3V30 A;  3T8M A;  1JWF A;  2P9K G;  4NAC A;  5ENN A;  4UWK A;  3AJI A;  1TNO A;  4F53 A;  2IF4 A;  2HR2 A;  4DLQ A;  5CCM A;  4N3A A;  2QY7 A;  5FQ4 A;  3ONK A;  5C2Y A;  4ILI A;  2AJA A;  1A17 A;  3TWU A;  2XS1 A;  2MOW A;  4G2V A;  1O1R A;  5KJK A;  1HS6 A;  2J4D A;  5FWQ A;  3UQ3 A;  4DK5 A;  4AM9 A;  3RU0 A;  2ION A;  4BET A;  1N94 A;  1WAO 1;  1PY1 A;  4APF A;  4GCN A;  3SO8 A;  3IHV A;  3D9I A;  2A5U A;  4XIF A;  3DSU A;  5G05 J;  3FUL A;  1QZ2 A;  1V54 E;  4UI9 K;  1JPL A;  5FZQ A;  3J5P A;  3ABL E;  2MYO A;  3FTZ A;  1U2V G;  2J9Q A;  3D9H A;  2OVF A;  2PL2 A;  2P9S G;  3L17 A;  3FU3 A;  3ASH A;  2JEK A;  2DWZ A;  4J8F A;  2Y4T A;  3CKC A;  4KBQ A;  5FQ8 A;  3CVY A;  2HE0 A;  4JA9 A;  2VJ8 A;  2H6G A;  2GRO B;  4GZ6 A;  4C0M A;  2ZIS A;  3APC A;  1UG3 A;  2XPI A;  2YNQ A;  2H6F A;  1HG2 A;  2E0I A;  2VTB B;  4N5C A;  4GA2 A;  1S64 A;  1WG0 A;  2RKK A;  3FUM A;  2KCV A;  3ASD A;  4BSZ B;  4H7Y A;  4LCT A;  4EZK A;  3PH0 C;  3FH8 A;  2GRQ B;  3PNL B;  1HFA A;  4XI0 A;  3G2W A;  4WNG A;  4B93 B;  3DWL G;  3DEO A;  2XRY A;  4DRX E;  3Q4A B;  3FUE A;  3IHY A;  3PZD A;  5DIZ A;  5JHA A;  4ATZ D;  4ANW A;  2OCC E;  1EDU A;  3DXM G;  1V55 E;  4HLE A;  2QFC A;  2J8S D;  4HOT A;  1N4R A;  2XEN A;  3CQG B;  5LFA A;  1NI1 A;  5CHE E;  2RFM A;  4JA7 A;  2AVP A;  4BES A;  5ENQ D;  1FT2 A;  3QK0 A;  2XRZ A;  2FF4 A;  2ETA A;  2ZGD A;  3FUH A;  1BU9 A;  1KPS B;  1JCS A;  2CG3 A;  4ACK A;  4WAF A;  2CHZ A;  2RG8 A;  4I9E A;  3O48 A;  3IXE A;  1MYO A;  4EQF A;  2OEW A;  2XZD G;  3PUK A;  3FEX A;  3DBS A;  5JHB A;  4HB5 A;  4WUY A;  5D0Q D;  3IV0 A;  3ZHE A;  5A7D B;  5A6C A;  1HX8 A;  3B95 A;  3P2B A;  1TN6 A;  5AN8 A;  3CHO A;  4CGW A;  3HXD A;  4U95 D;  1SA5 A;  3DST A;  5CCL A;  5JJ6 A;  3CVQ A;  3OXF A;  4FA6 A;  3C72 A;  4Z68 A;  2FUL A;  2XGM A;  4BEP A;  2H6H A;  2R03 A;  4CDN A;  4J8Y A;  4G23 A;  2A4Z A;  5J90 A;  4RVB A;  2YHE A;  3LY7 A;  4JHR A;  4CRW A;  1IKN D;  3L13 A;  2DCP A;  3G2U A;  3RSE G;  3GW4 A;  3UM3 A;  4O1P A;  1UW4 B;  3WG7 E;  3Q47 B;  1NA0 A;  3TGO A;  1OXJ A;  4L9P A;  3G2S A;  1FT1 A;  1KZO A;  5HKP A;  4G11 A;  4IYP A;  3E37 A;  4G26 A;  2UY1 A;  3TWQ A;  3UIO C;  2LAI A;  1A5E A;  3SFZ A;  4KVO A;  2WM9 A;  3D9K A;  2QYJ A;  4GYO A;  3UIN C;  3CVP A;  4YVQ C;  4HOU A;  3EIQ C;  4U96 D;  4L2Y A;  1AWC B;  3T9K A;  3SI5 A;  4FHK A;  3ZYK A;  2WB2 A;  4CT0 A;  4YND A;  4N3C A;  3DSS A;  3JQ0 A;  3HXF A;  4Q69 A;  3ZEF A;  3UKR G;  1QNF A;  5T4Y A;  4ZFH A;  2I9C A;  4XZ4 A;  1OY3 D;  2OVB A;  2R59 A;  1MX4 A;  3ZKJ A;  4U7E B;  1FCH A;  3ENE A;  5EX0 A;  1KT0 A;  3RO2 A;  3L16 A;  4UWG A;  4CDM A;  4XE0 A;  2BKK B;  4OVU A;  3B7U X;  4UQZ A;  2WXL A;  3P1U A;  4G8L A;  2CG2 A;  4FAD A;  3HIZ A;  4RSY A;  5D0O D;  4AXH A;  2BUG A;  3ML8 A;  1N9A A;  2J07 A;  3G2T A;  5CRU A;  4GB9 A;  3SQV A;  3PEV B;  3F6Q A;  3SNX A;  3FTV A;  4J8S A;  4AJW A;  3PRZ A;  4UWF A;  2LSU A;  4YVO A;  2R17 C;  3KSQ A;  1HF8 A;  2JLB A;  2XPZ A;  3OAW A;  3I5P A;  5EDS A;  4JEU A;  2H6I A;  4I6E A;  3FUD A;  3CSF A;  5HS0 A;  2XEE A;  4BX8 A;  3TWX A;  2AXV A;  3CVU A;  3E4B A;  4HOQ A;  2IOS A;  2CFU A;  3IBE A;  4UI9 C;  5ARG A;  2KCK A;  1Z6T A;  3ZN3 A;  5FJY A;  4JEH A;  3FUF A;  2YHC A;  5EYP F;  3FH7 A;  1DNP A;  2MHK A;  1H0A A;  3S2A A;  2OV8 A;  2XHE A;  5ENO D;  1WY6 A;  1QQE A;  4O1O A;  4HLL A;  3DSW A;  4NQ0 A;  4EZL A;  4F7A A;  1N0R A;  2XEV A;  5AJD A;  3R7Q A;  3ZHE B;  2C2L A;  4DUI A;  5AQB A;  3UKU G;  2HYZ A;  3FY4 A;  3SF4 A;  2IJG X;  2Y3A A;  5HRY A;  3CHR A;  1EYH A;  4I17 A;  3E33 A;  2KZT A;  3TWV A;  1RW2 A;  1E8Z A;  3CV0 A;  3E32 A;  1IHB A;  3T5X A;  2X6H A;  3AG4 E;  4GTO A;  5BUZ A;  3LEW A;  3CHQ A;  2EIK E;  3EU9 A;  3MKQ A;  1EPU A;  2J08 A;  5KNG A;  1N4P A;  4U63 A;  4K5C A;  3FTW A;  3Q49 B;  3AS8 A;  2CHW A;  5ENP D;  3ZNG A;  3EHR A;  4WWN A;  2P9U G;  1Q2Z A;  1HE8 A;  2EIL E;  3BEE A;  4Y6C A;  1O5M A;  4K0R A;  2V8S E;  2IOL A;  4BTA A;  2OND A;  2UY1 B;  2VYI A;  3Q73 A;  1KLX A;  3VTX A;  3EHQ A;  1MX6 A;  2J49 A;  3TWS A;  4HRM B;  4L23 A;  2XCB A;  5AQ7 A;  4BT9 A;  3RO3 A;  2GRR B;  2KAT A;  5KJM A;  3V2X A;  3N71 A;  3I3N A;  3LYA A;  5EN5 D;  4FHJ A;  4GMJ A;  2WXQ A;  3G2V A;  4PDX A;  1S70 B;  1VDY A;  4N39 A;  4NUR A;  5JJT A;  1U3D A;  2WXI A;  4B94 A;  1ELW A;  4JC8 A;  1B89 A;  2HM8 A;  3W9G A;  2LSV A;  3ZVV A;  3FP3 A;  4UQX A;  3AG3 E;  1FVF A;  3FEY A;  3Q9N C;  3RAU A;  3ZYM A;  2IU1 A;  1MQS A;  4AIF A;  3SY2 A;  5CED B;  1YYH A;  3MGB A;  3D9J A;  1NZN A;  3FUJ A;  4EEC A;  1QBQ A;  1N52 A;  1TNU A;  4TXQ A;  2IY0 C;  1H2U A;  3TAX A;  4GZ3 A;  5KCM A;  5BV1 A;  3KEA A;  5AYW D;  3RIB A;  3O4Z A;  4BTB A;  3L54 A;  3JXJ A;  3TL5 A;  3PE3 A;  3LY8 A;  2WXG A;  1E8X A;  3D9N A;  1TNB A;  3RRU A;  2XGO A;  2AW6 A;  2OOE A;  3DRA A;  1TJC A;  3AAA C;  5D66 A;  4DX5 D;  5ITZ F;  2LXL A;  3QAQ A;  4U0S A;  3ZW3 A;  4G1T A;  4MLP A;  3HXB A;  1TJF A;  1HU3 A;  1D8E A;  4ABN A;  4HRL A;  4WNF A;  1S63 A;  3KEZ A;  1GW6 A;  2X6J A;  3UT7 A;  3ZXS A;  1K8K G;  4A1G A;  5FQ7 A;  3Q7F A;  1E7V A;  3CVN A;  3OXL A;  4JVS A;  5CRV A;  3ULE G;  4FLH A;  3PUJ A;  4M3O A;  5G04 J;  3DPY A;  3FDH A;  2DIW A;  5T3R A;  4EZJ A;  2I6H A;  3ASO E;  4F1S A;  3UX4 A;  2AWI A;  4XI9 A;  1X5B A;  2J4B A;  1O1S A;  1LF8 A;  5B1B E;  1O1T A;  2OEV A;  2RD0 A;  4B8C B;  2WXK A;  3PZ2 A;  1LTX A;  3B7B A;  2ETC A;  3VLF A;  1SQM A;  3FFL A;  3JUE A;  2DZN A;  1P5Q A;  3CIA A;  2NC9 A;  2FO7 A;  3QJZ A;  3DEP A;  1KZP A;  2KZT B;  3D9O A;  3S7B A;  3T8K A;  4GCO A;  1L5J A;  3NB2 A;  3MJW A;  3GZ2 A;  3ABK E;  3PZ4 A;  3RKV A;  4UWH A;  4GAA A;  2CFZ A;  3ULQ A;  1Z5S C;  4GTS A;  2X6I A;  4HS2 A;  3MKQ B;  3RRM B;  1N4S A;  4BFR A;  1JCQ A;  4ILG A;  5D2M C;  4JHK A;  1DCQ A;  3R9M A;  5JJ7 A;  4HBD A;  2V5Q C;  1H2V C;  1PC2 A;  4NRH B;  4I1O B;  4N3B A;  3QWV A;  4CYM D;  4XKC A;  3S7F A;  4EPZ A;  4DI3 A;  3AG2 E;  4EBA G;  3CHP A;  2PZI A;  4L2L A;  2P9L G;  4KYO B;  4GYY A;  5CBN A;  3ESL A;  2IFU A;  3FH5 A;  3BUA A;  2GGF A;  3B7T A;  3PE4 A;  2FEZ A;  3L22 A;  2WXJ A;  1SZ9 A;  2C0M A;  2YQ8 A;  1OT8 A;  4GZ5 A;  3AS5 A;  4DX2 A;  4HVB A;  3CHM A;  4RG6 A;  5ENS D;  4J0U A;  4XEI G;  1UN9 A;  3PVL A;  3SGH A;  2LO6 A;  1IQU A;  3Q75 A;  4KZ0 A;  5EID A;  5AAR A;  3HDX A;  4I2W A;  3DXK G;  3U64 A;  2LXM A;  2QZA A;  4D10 C;  4AY6 A;  4GMR A;  4AOF A;  2WXH A;  4IRU A;  3L6A A;  4MKT A;  3AU4 A;  1Y6I A;  4GYW A;  2B0O E;  4U8H A;  4FJZ A;  3LXU X;  1D8D A;  3FWV A;  1OCZ E;  2WQ6 A;  4AEZ C;  4GTT A;  3APD A;  4DJA A;  4QQI A;  2VGX A;  5DBK A;  4HI9 A;  2XQ0 A;  1E90 A;  3SFY A;  3LS8 A;  4NIK A;  1UJK A;  4O6F A;  2WXP A;  2DVW A;  3R9A B;  2GRM A;  4HXI A;  5E76 A;  4ILH B;  4DI4 A;  3JUI A;  3PS6 A;  3TXM A;  1XGW A;  3E34 A;  5FZR A;  5C1D A;  5LOZ A;  4LEU A;  3UM0 A;  3CHS A;  3VLE A;  4O60 A;  2QC9 A;  3PZ3 A;  3ASN E;  2V5F A;  5FT9 A;  2PNN A;  1XNF A;  3QOU A;  3C5R A;  3UIP C;  1ZU2 A;  3CR3 A;  2P58 C;  3LKU A;  4TUM A;  3TG4 A;  3EJN A;  4U8Y D;  3APF A;  5EKQ D;  1H19 A;  3UM1 A;  3D9L A;  4DX7 D;  3PDN A;  4U04 A;  2XCC A;  3URZ A;  2KXP C;  3GZS A;  3MX3 A;  3W9F A;  4ANV A;  4PUC A;  2VQ2 A;  2KCL A;  2WXO A;  1YCS B;  1TNZ A;  2EIN E;  4YDY A;  1YMP A;  3FU5 A;  4K5B A;  3U4T A;  1TR4 A;  3HXC A;  1OWL A;  3NAW A;  1E7U A;  4IUL A;  3BG1 B;  1BD8 A;  2FBN A;  4LER A;  3NOC D;  3B7S A;  2XS8 A;  2JAB A;  1LD7 A;  3EIJ A;  2GW1 A;  2EIJ E;  3V79 K;  5AIJ A;  2Y0B G;  2PQR A;  2PQN A;  3BU8 A;  4ACL A;  3UXG A;  4AY5 A;  1Z3X A;  3I4R B;  5CBO A;  1KT1 A;  1BLX B;  4WND A;  4FLB A;  4I6G A;  4EBA A;  1DVP A;  2X3M A;  3FTX A;  4DX6 D;  2C0L A;  4I6J A;  4Q96 A;  1UOH A;  3MV2 B;  4X8Q A;  3MEK A;  2WVI A;  4XX5 A;  4DX1 A;  3PEU B;  5CER B;  3MKR A;  4J8D A;  2NXP A;  1ZBP A;  3J5Q B;  3U66 A;  5FQ6 A;  3MYV A;  4KMO A;  3U9W A;  4BX9 A;  2AXU A;  4HI8 A;  2F0Y A;  1H6K A;  4A3V A;  3KAE A;  2ZU6 B;  2MRI A;  5G05 C;  2GRP B;  3C3Q A;  2F8Y A;  1G3N B;  2NYJ A;  2J09 A;  3NQP A;  3DSV A;  4B0Z A;  1H2T C;  4Y6W A;  2P9P G;  2QYU A;  5ARF A;  4LNG A;  3LY9 A;  1X81 A;  4HOS A;  3JYS A;  5KJN A;  1K1B A;  2P9N G;  4U8V D;  3UT8 A;  5BV0 A;  2BED A;  4W9R A;  3HRA A;  2R02 A;  1HO8 A;  4URK A;  4LG6 A;  4QFV A;  3FU6 A;  3ZYL A;  3NF1 A;  4PH4 B;  3ULY A;  4MBG A;  1E8W A;  4AV7 A;  2EIM E;  4RQI A;  3CVV A;  5KNH D;  5G04 C;  4MRU A;  5AQA A;  2YIN A;  4L1B A;  5FZS A;  1MZC A;  5B3S E;  4G25 A;  1MX2 A;  3VTY A;  2IEJ A;  1ELK A;  2VGX B;  5KWD A;  3NZS A;  3X2Q E;  4E6H A;  1UN8 A;  4ME2 A;  2DBA A;  4FJY A;  4JW1 A;  3BQO A;  4BSX A;  2KM4 A;  1AP7 A;  2LNI A;  4KZC A;  3LJ3 A;  3UPV A;  4GTQ A;  3SFX A;  4F1P A;  3TWT A;  4UI9 J;  2Y1L E;  3EHM A;  4UQY A;  4I43 A;  1OCR E;  4IN3 B;  3B7R L;  3QNK A;  3ZYQ A;  2WXN A;  1INZ A;  4R7L A;  3CEQ A;  2PM7 A;  4GTV A;  4HRN A;  2IO3 C;  1FVH A;  4TV3 A;  2IO2 C;  4GA1 A;  3C98 A;  3LDZ A;  3HG0 D;  5FIN A;  1TEZ A;  5CMY A;  3QDN A;  4PS7 A;  4JD2 G;  2KBX A;  1K1A A;  3GZ1 A;  3C3O A;  2VSY A;  3RK6 A;  1HG5 A;  4KXK B;  4B89 A;  5FIO A;  4G8K A;  3S7D A;  3MA5 A;  1RZ4 A;  1JCR A;  4C48 B;  4Q94 A;  5IY5 E;  4FC8 A;  4AVX A;  4LNB A;  3HVE A;  5LCW J;  3ZXP A;  2XZT G;  1TN7 A;  5EYL A;  4F6R D;  2L0I A;  4GTP A;  2HO1 A;  4AP2 A;  2P2C P;  4GPM A;  4I1A A;  5EIL A;  3CKB A;  2KC7 A;  4K03 A;  4GTR A;  2L0T B;  2WMN A;  3UMV A;  3CK7 A;  3FTU A;  5BNW A;  4P29 A;  2GRL A;  4DLO A;  4PS8 A;  1WM5 A;  3Q9U C;  4BWR A;  2BKG A;  4CGV A;  3TWR A;  4ANX A;  4UUC A;  3FTS A;  4JHJ A;  3HHM A;  1N54 A;  4G24 A;  5J08 A;  1W3B A;  1OWP A;  2XPY A;  4U0Z A;  3V31 A;  1OWO A;  2Y69 E;  5CEA A;  5KJL A;  4J7W A;  3TXN A;  4CDR A;  3K9I A;  2Y4U A;  1BPO A;  2ILR A;  1ELR A;  3T5V A;  4C9B B;  4ATG A;  3NBN B;  1LD8 A;  3SZ7 A;  3Q78 A;  4J8E A;  3ASG A;  1NA3 A;  1HXI A;  2ETB A;  4I1M A;  4OAU C;  1BI8 B;  2XGS A;  2X6F A;  1E8Y A;  2V4H C;  2R5S A;  4GTM A;  3ZIM A;  3ML9 A;  5T8I A;  1HZ4 A;  3OXG A;  2VGE A;  3ZRH A;  3ZGQ A;  4YDE A;  1SA4 A;  5LP0 A;  3AU5 A;  4RG9 A;  4KVM A;  3TG5 A;  2FO1 E;  2VSO E;  2IQC A;  3WXX A;  5CMW A;  4N2Q A;  4BY6 A;  4PS3 A;  5E75 A;  2WXF A;  4HQD A;  2X6K A; 
#chains in the Genus database with same CATH homology
 1XNF A;  1EYH A;  1JUQ A;  3CHR A;  3QOU A;  3ONL A;  3UQ3 A;  4JL0 A;  4I17 A;  4AM9 A;  4DK5 A;  1ZU2 A;  3CR3 A;  2KZT A;  2P58 C;  3RU0 A;  3UT4 A;  1PAQ A;  2ION A;  3LKU A;  1WAO 1;  4BT8 A;  1PY1 A;  3TG4 A;  3EJN A;  1E8Z A;  4APF A;  3CV0 A;  4GCN A;  5ANL A;  3APF A;  5EKQ D;  3IHV A;  1H19 A;  3D9I A;  2A5U A;  3T5X A;  4XIF A;  2X6H A;  5BUZ A;  3LEW A;  2WQH A;  3CHQ A;  3D9L A;  3PDN A;  4U04 A;  5G2N A;  3GYZ A;  2XCC A;  5G05 J;  3UUX A;  3BG0 B;  2CHX A;  3FUL A;  3URZ A;  3GZS A;  1QZ2 A;  3MKQ A;  1EPU A;  4UI9 K;  2L9B A;  2J08 A;  1JPL A;  5FZQ A;  3VLD A;  3MX3 A;  4U63 A;  4ANV A;  4PUC A;  1OWM A;  3FTW A;  1HH8 A;  3Q49 B;  2VQ2 A;  3AS8 A;  2CHW A;  2KCL A;  4WWP A;  2WXO A;  4WWN A;  3FTZ A;  3Q15 A;  2J9Q A;  1HE8 A;  2OVF A;  2PL2 A;  3L17 A;  3BEE A;  3FU3 A;  4Y6C A;  3ASH A;  2JEK A;  2AXZ A;  4K0R A;  2V8S E;  3FU5 A;  2IOL A;  2VSX E;  4J8F A;  4BTA A;  2Y4T A;  3MV3 B;  3U4T A;  2OND A;  3CKC A;  2UY1 B;  4KBQ A;  3TJP A;  3JQ1 A;  5FQ8 A;  2VYI A;  3FU0 A;  3CVY A;  1OWL A;  4JA9 A;  5HQ8 A;  2VJ8 A;  1E7U A;  1KLX A;  4GZ6 A;  4C0M A;  3VTX A;  3ESK A;  4IUL A;  3APC A;  1UG3 A;  2XPI A;  3BG1 B;  2FBN A;  2YNQ A;  1HG2 A;  4LER A;  2J49 A;  2E0I A;  4L23 A;  2VTB B;  3B7S A;  4N5C A;  2XCB A;  4GA2 A;  4BT9 A;  3RO3 A;  5ANR A;  2KAT A;  3EIJ A;  3S7J A;  2GW1 A;  5KJM A;  3FUM A;  3N71 A;  3ASF A;  2KCV A;  5AIJ A;  5M72 A;  3FUN A;  3ASD A;  3I3N A;  2PQR A;  4H7Y A;  3LYA A;  4LCT A;  4A55 A;  4FHJ A;  4EZK A;  2PQN A;  3PH0 C;  4FU3 A;  4GML A;  3FH8 A;  3PNL B;  3NZU A;  4ACL A;  3CVX A;  4GMJ A;  4WWO A;  4AY5 A;  2WXQ A;  3G2V A;  1Z3X A;  1HFA A;  4FUL A;  3ZFW A;  3I4R B;  4GZD A;  4PDX A;  1VDY A;  1KT1 A;  4F3V A;  3QAR A;  4N39 A;  4NUR A;  4XI0 A;  4E85 A;  5JJT A;  1U3D A;  3G2W A;  4WND A;  3R9A B;  4FLB A;  3CVW A;  2WXI A;  4WNG A;  4I6G A;  4B94 A;  1ELW A;  4JC8 A;  4EBA A;  4UWL A;  1B89 A;  2HM8 A;  2WXR A;  1DVP A;  2X3M A;  5LX8 A;  2LSV A;  3ZVV A;  4I9C A;  2XRY A;  4A1S A;  3FP3 A;  1SZA A;  4UQX A;  3Q4A B;  3FTX A;  3FUE A;  1FVF A;  5AEN A;  2C0L A;  2X38 A;  3IHY A;  3PZD A;  4I6J A;  4Q96 A;  5DIZ A;  3SBS A;  5JHA A;  3FEY A;  3ZYM A;  2IU1 A;  1MQS A;  4APO A;  4AIF A;  3MV2 B;  4JZY A;  4ANW A;  3MGB A;  1EDU A;  3MEK A;  4HLE A;  1JWG A;  2QFC A;  4HOT A;  2VSN A;  2WVI A;  3CK9 A;  1OUV A;  4XX5 A;  3PEU B;  3D9J A;  3LCA A;  3MKR A;  4J8D A;  3CQG B;  5LFA A;  1NZN A;  3FUJ A;  2L6J A;  2NXP A;  4EEC A;  1N52 A;  1ZBP A;  5CHE E;  3HVE B;  4JA7 A;  2AVP A;  4U0U A;  1H2U A;  5FQ6 A;  3TAX A;  3U66 A;  4GZ3 A;  3QK0 A;  2XRZ A;  5KCM A;  1YA0 A;  2FF4 A;  3MYV A;  5AYW D;  3ZHE B;  3FUH A;  4KMO A;  3U9W A;  4BX9 A;  2AXU A;  3RJV A;  4OYS A;  5AJL A;  3D9M A;  1H6K A;  2CG3 A;  3EDT B;  3RIB A;  4ACK A;  4A3V A;  4JXT A;  4WAF A;  2CHZ A;  3KAE A;  3O4Z A;  2RG8 A;  4I9E A;  3O48 A;  4BTB A;  4EQF A;  3L54 A;  2ZU6 B;  3PUK A;  3TL5 A;  3PE3 A;  1Z3Y A;  3LY8 A;  2MRI A;  1NP7 A;  3FEX A;  2WXG A;  3DBS A;  2LAH A;  1E8X A;  5G05 C;  5JHB A;  3SHF A;  1IQR A;  3D9N A;  3CQC B;  3RRU A;  4WUY A;  2XGO A;  2AW6 A;  2J09 A;  3NQP A;  5D0Q D;  3IV0 A;  2OOE A;  3ZHE A;  5A7D B;  5A6C A;  4B0Z A;  1H2T C;  1HX8 A;  4Y6W A;  5ARF A;  3P2B A;  1TJC A;  3LY9 A;  3CHO A;  4HOS A;  4CGW A;  3JYS A;  4CT4 A;  3QAQ A;  5KJN A;  4U0S A;  1MHQ A;  3FHE A;  3ZW3 A;  4G1T A;  4MLP A;  1TJF A;  2PM6 A;  3PRE A;  3UT8 A;  4J6I A;  5BV0 A;  1HU3 A;  4W9R A;  4ABN A;  4LUN U;  1HO8 A;  4URK A;  4WNF A;  5CCL A;  3KEZ A;  1GW6 A;  4QFV A;  5JJ6 A;  3D3M A;  2X6J A;  3FU6 A;  3ZYL A;  2V0P A;  3D9P A;  3CVQ A;  3OXF A;  4GZC A;  2WMO A;  3NF1 A;  4FA6 A;  4PH4 B;  3UT7 A;  1E8W A;  2E2E A;  3ZXS A;  4AV7 A;  4A1G A;  5FQ7 A;  3CVV A;  3QKY A;  2FUL A;  2XGM A;  5G04 C;  4MRU A;  3SBT B;  4CDN A;  1E7V A;  3CVN A;  3KD7 A;  2A4Z A;  4G23 A;  5J90 A;  3OXL A;  2YIN A;  3DPD A;  4JVS A;  4RVB A;  3SD5 A;  4L1B A;  2YHE A;  3LY7 A;  3FTY A;  4JHR A;  5FZS A;  4CRW A;  3R7R A;  5BPP A;  2I2O A;  4FLH A;  3PUJ A;  4M3O A;  5G04 J;  3L13 A;  2DCP A;  3FDH A;  3G2U A;  2DIW A;  5T3R A;  3GW4 A;  4EZJ A;  5HI7 A;  4LRZ A;  5G55 A;  4B8A A;  3IEG A;  2WPV A;  4FP7 A;  2I6H A;  4G25 A;  4DPR A;  1UW4 B;  4F1S A;  3UX4 A;  4U07 A;  1IHG A;  2AWI A;  3LVR E;  3Q5M A;  3VTY A;  1ELK A;  2VGX B;  3Q47 B;  4XI9 A;  1NA0 A;  3TGO A;  3NZS A;  1X5B A;  3G2S A;  4JPS A;  4OVV A;  2WQ7 A;  4E6H A;  1UN8 A;  2J4B A;  4ME2 A;  4V3I A;  4G11 A;  4C0E A;  2DBA A;  4IYP A;  1E96 B;  4G26 A;  2UY1 A;  2LAI A;  5BW8 C;  4FJY A;  1LF8 A;  4JW1 A;  3SFZ A;  4KVO A;  3MCX A;  4BSX A;  2KM4 A;  4KT6 B;  2WM9 A;  2RD0 A;  2LNI A;  1Y8M A;  3D9K A;  4KZC A;  3LJ3 A;  4B8C B;  3UPV A;  2WXK A;  4GYO A;  1OWN A;  2VTB A;  3CVP A;  4YVQ C;  4HOU A;  3EIQ C;  4UI9 J;  3VLF A;  1SQM A;  3EHM A;  3FFL A;  4L2Y A;  4UQY A;  2I1K A;  4I43 A;  4IN3 B;  3B7R L;  3QNK A;  3SI5 A;  3ZYQ A;  1P5Q A;  3CIA A;  2WXN A;  1INZ A;  4R7L A;  2NC9 A;  2FO7 A;  3CEQ A;  4FHK A;  2PM7 A;  2BF0 X;  3I4G A;  3QJZ A;  3ZYK A;  4CT0 A;  2WB2 A;  3LPZ A;  4YND A;  4N3C A;  4HOR A;  2KZT B;  1FVH A;  5EX3 A;  3D9O A;  4TV3 A;  3S7B A;  3JQ0 A;  4GA1 A;  4Q69 A;  1IYG A;  3ZEF A;  3QWW A;  1L5J A;  3IKO B;  4GCO A;  3C98 A;  3MJW A;  3ZPJ A;  3LDZ A;  3GZ2 A;  1QNF A;  5T4Y A;  3OTN A;  1TEZ A;  5CMY A;  3PNT B;  3QDN A;  4PS7 A;  3RKV A;  2I9C A;  4UWH A;  4XZ4 A;  4GAA A;  2CFZ A;  3ULQ A;  3FUK A;  2OVB A;  5FWQ A;  2X6I A;  3GZ1 A;  2R59 A;  4N2S A;  4HS2 A;  3CLJ A;  3MKQ B;  3CGH A;  1FCH A;  2VSY A;  3ENE A;  3RRM B;  3RK6 A;  5EX0 A;  1HG5 A;  1KT0 A;  4KXK B;  3MZL B;  5BT1 A;  4BFR A;  4B89 A;  3AS4 A;  3RO2 A;  3S7D A;  2UWJ G;  3L16 A;  3MA5 A;  4UWG A;  4CDM A;  4ILG A;  3U3W A;  4JHK A;  2VGY A;  4XE0 A;  3CVL A;  5LCW C;  5JJ7 A;  4OVU A;  4GPK A;  5FTP A;  4Q94 A;  3B7U X;  4UQZ A;  4FC8 A;  1H2V C;  2V4L A;  1PC2 A;  2WXL A;  4NRH B;  4AVX A;  3LVQ E;  4I1O B;  3P1U A;  4N3B A;  2CG2 A;  3HVE A;  3QWV A;  5LCW J;  4FAD A;  3HIZ A;  2EQX A;  4XKC A;  4RSY A;  3S7F A;  5D0O D;  3QWP A;  4AXH A;  2BUG A;  3ML8 A;  4CCA A;  2J07 A;  2L0I A;  3G2T A;  4DI3 A;  4EPZ A;  4EBA G;  2HO1 A;  4WNE A;  4AP2 A;  3CHP A;  4TUU A;  4TRQ A;  4GB9 A;  2PZI A;  5A23 A;  4I2Z A;  3PEV B;  4I1A A;  3CKB A;  4L2L A;  2KC7 A;  4XKB A;  3SNX A;  4KYO B;  3FTV A;  4GYY A;  4K03 A;  3HYM B;  4GU5 A;  2BTD A;  3ESL A;  4J8S A;  4AJW A;  2FI7 A;  3PRZ A;  2IFU A;  2L0T B;  1UJJ A;  3FH5 A;  1S0P A;  2WMN A;  3CST A;  2GGF A;  3UMV A;  3EHN A;  4UWF A;  3CK7 A;  2LSU A;  3FTU A;  4YVO A;  5BNW A;  2R17 C;  2NSZ A;  3B13 A;  4P29 A;  2WXM A;  3B7T A;  2GRL A;  3FUI A;  1HF8 A;  2JLB A;  2XPZ A;  4DLO A;  4ANU A;  3PE4 A;  3OAW A;  3I5P A;  4PS8 A;  1WM5 A;  5EDS A;  4CEM A;  4BWR A;  2FEZ A;  2Q7F A;  3L22 A;  4JEU A;  2WXJ A;  3L08 A;  1SZ9 A;  2C0M A;  4CGV A;  4I6E A;  2I1J A;  3FUD A;  2YQ8 A;  3CSF A;  3JCK C;  3RRN B;  4GZ5 A;  3AS5 A;  4ANX A;  4GA0 A;  4L7T A;  4HVB A;  3FTS A;  3CHM A;  4RG6 A;  4JHJ A;  4J0U A;  4HFG A;  3HHM A;  4BX8 A;  1N54 A;  4G24 A;  5J08 A;  1W3B A;  2AXV A;  2M63 A;  1OWP A;  3CVU A;  1UN9 A;  3PVL A;  3E4B A;  2XPY A;  4U0Z A;  3SGH A;  2LO6 A;  3CK8 A;  4HOQ A;  1IQU A;  1OWO A;  2CFU A;  2IOS A;  3IBE A;  4KZ0 A;  3HDX A;  5KJL A;  4I2W A;  3TXN A;  4CDR A;  4UI9 C;  3K9I A;  5ARG A;  3U64 A;  2Y4U A;  4D10 C;  2KCK A;  1Z6T A;  4AY6 A;  3ZN3 A;  1EF1 C;  1U3C A;  5FJY A;  1BPO A;  4JEH A;  4A3T A;  4AOF A;  3QB2 A;  2ILR A;  2WXH A;  1ELR A;  3T5V A;  3FUF A;  4IRU A;  2YHC A;  4C9B B;  3QC1 A;  4H7X A;  3FH7 A;  3L6A A;  4ATG A;  4MS6 A;  4MKT A;  3KS2 A;  3AU4 A;  1Y6I A;  1DNP A;  4GYW A;  2MHK A;  4U8H A;  4FJZ A;  1H0A A;  3LXU X;  3FWV A;  2OV8 A;  3S2A A;  2WQ6 A;  3SZ7 A;  3T8M A;  4AEZ C;  2XHE A;  4J8E A;  1JWF A;  3ASG A;  3APD A;  4DJA A;  2VGX A;  4NAC A;  5DBK A;  1NA3 A;  1HXI A;  2XQ0 A;  1E90 A;  1WY6 A;  5ENN A;  4I1M A;  4UWK A;  4F53 A;  3LS8 A;  1QQE A;  2IF4 A;  2X6F A;  2XGS A;  4NQ0 A;  2HR2 A;  4EZL A;  4DLQ A;  1E8Y A;  1UJK A;  4O6F A;  4F7A A;  2R5S A;  5CCM A;  4N3A A;  3ZIM A;  2WXP A;  2XEV A;  5AJD A;  3R7Q A;  2QY7 A;  5FQ4 A;  3ML9 A;  2GRM A;  2C2L A;  3ONK A;  1HZ4 A;  4HXI A;  5E76 A;  4ILI A;  5C2Y A;  5T8I A;  3OXG A;  4ILH B;  1A17 A;  3ZRH A;  3JUI A;  4DI4 A;  3PS6 A;  3TXM A;  1XGW A;  3ZGQ A;  5BV1 A;  5FZR A;  5LP0 A;  5C1D A;  3AU5 A;  5LOZ A;  4LEU A;  3CHS A;  2HYZ A;  4RG9 A;  3VLE A;  4KVM A;  2MOW A;  3TG5 A;  3FY4 A;  3SF4 A;  2VSO E;  2IQC A;  3WXX A;  5CMW A;  4N2Q A;  4BY6 A;  2IJG X;  4G2V A;  4PS3 A;  2Y3A A;  5KJK A;  1HS6 A;  2J4D A;  2V5F A;  2WXF A;  5E75 A;  5FT9 A;  2X6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...