3AS4A

Mama amb-1 c2221
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
170
structure length
170
Chain Sequence
DIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
total genus 69
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3as4A01
2C0LA 5FZQA 2IFUA 3LKUA 3Q49B 2I6HA 2VSYA 4APOA 4GCOA 4GPKA 4G23A 4BT9A 4RG9A 3MEKA 1HXIA 5D0OD 2KATA 3Q4AB 5A6CA 3CK9A 4UQZA 5G04J 5BNWA 5G05J 2XPIA 2LSUA 2QFCA 2IF4A 2MHKA 4ME2A 4I17A 4I2WA 3MKRA 3ASFA 1ELWA 4GZ5A 5DIZA 5HI7A 4G1TA 5AYWD 4UI9K 2Q7FA 3RO3A 3VTYA 4GA1A 3K9IA 2XGMA 3CVQA 2UY1A 3MV3B 5KJNA 4J8FA 2VSNA 1W3BA 4BWRA 3OXGA 2XGOA 2HR2A 1IHGA 4IN3B 1Y8MA 2FO7A 4XIFA 3BEEA 4KXKB 3OXFA 3CK7A 2BUGA 5LCWJ 5EKQD 2KCKA 2L6JA 3PE4A 4GYOA 3LY7A 5FZRA 2FBNA 2P58C 4WNFA 3S7DA 3S7FA 3QWPA 3CEQA 2XEVA 4BTBA 4WNEA 3VTXA 4WNGA 3RKVA 4CGVA 3QWVA 5JJ6A 3LCAA 3RIBA 5JJTA 4I9EA 3EDTB 4BT8A 2PZIA 3UUXA 3GW4A 4I2ZA 5BW8C 1WAO1 4UQYA 3JYSA 1ELRA 5HQ8A 1E96B 3QOUA 4N2SA 3CK8A 1P5QA 4H7XA 2C2LA 4G2VA 4JA9A 3CVLA 3UPVA 4U0SA 4WNDA 2ONDA 5ARGA 2PL2A 4J0UA 4U0ZA 4O6FA 3LY8A 4NQ0A 3E4BA 4ABNA 5G05C 5FT9A 3ZFWA 5ARFA 2AVPA 3KS2A 4F3VA 2WQHA 2FEZA 3QDNA 2V5FA 4HOUA 1KLXA 4YVOA 3ASHA 4N5CA 3SZ7A 5CHEE 4U0UA 4AM9A 3MV2B 1A17A 3KD7A 3LY9A 3HYMB 2VGXB 2C0MA 4U04A 3MA5A 4N3CA 4I1AA 3FFLA 1B89A 3GZ2A 2HYZA 2XCCA 3RU0A 5LCWC 4UI9J 1OUVA 2HO1A 4G24A 4Y6WA 3WXXA 3IEGA 1HH8A 1PC2A 5FZSA 2FF4A 3URZA 3GZ1A 4CGWA 4HORA 3Q15A 3FP3A 4N3BA 4N2QA 4AY6A 4H7YA 1NA3A 3AS5A 2VGYA 1IYGA 3ULQA 4XI9A 4YVQC 5DBKA 3GYZA 4Y6CA 4UQXA 5EX0A 1QQEA 3U4TA 1KT0A 2UWJG 2KCLA 3CKBA 3Q5MA 2YHCA 3TG5A 4JL0A 1KT1A 5FTPA 3TAXA 2GW1A 4N39A 3FWVA 3ZHEA 5FJYA 2FI7A 3QKYA 4I9CA 4B94A 2Y4TA 3ASDA 4GA0A 4HOQA 2JLBA 3PDNA 5G04C 4CDRA 3CKCA 5CCLA 5C1DA 4JHRA 4GYWA 3LYAA 3LPZA 2XGSA 3Q47B 4XI0A 3ZGQA 1FCHA 3UQ3A 3RO2A 1NA0A 2Y4UA 5KJLA 4N3AA 4GZ3A 1HZ4A 2VGXA 3AS4A 1WM5A 5M72A 3TGOA 3KAEA 4G25A 4BTAA 4GCNA 4U07A 2WPVA 4UI9C 3S7JA 2E2EA 3N71A 4RG6A 4WUYA 2J9QA 3ESKA 4NRHB 2VQ2A 2DBAA 4J8DA 2UY1B 4LEUA 1ZU2A 3CV0A 5BT1A 4JA7A 4G26A 5EX3A 3SF4A 2KCVA 3ASGA 2VYIA 3ZN3A 3S7BA 4W9RA 1NZNA 3U3WA 3AS8A 5KJMA 4EQFA 2R5SA 4J8EA 5CCMA 3QWWA 4AIFA 4KYOB 2YQ8A 4YNDA 2XCBA 3RJVA 5JJ7A 2OOEA 4AY5A 3OXLA 5D0QD 2KC7A 2NC9A 4HOSA 3CVPA 4GA2A 4HOTA 2LNIA 4GZ6A 1YA0A 3CVNA 4A1SA 3R9AB 5KJKA 3O48A 3TG4A 1ZBPA 3ZPJA 1QZ2A 2LSVA 2PQRA 3PE3A 1XNFA 1TJCA 4KBQA 5A7DB 3NF1A 2PQNA 4GYYA 3ZHEB
chains in the Genus database with same CATH superfamily
5JHAA 1HS6A 2C0LA 3HDXA 4MLPA 2IFUA 3UT4A 1NL4A 3LKUA 5FQ8A 3IHVA 2DCPA 4GCOA 3BUAA 2X6JA 3HG0D 4WAFA 4G23A 4I6JA 5ANRA 2I9CA 1IHBA 4LNUD 1E8ZA 2WXHA 1K8KG 3SNXA 4UQZA 3LS8A 1V55E 4J8SA 4UUCA 3FUMA 1TNOA 4ME2A 2IF4A 4FLBA 4I2WA 2VTBA 3ENEA 5DIZA 5HI7A 1E8YA 4G1TA 3FUFA 3VTYA 4GTTA 4XZ4A 3HRAA 4L2YA 2XGMA 3S2AA 3ULEG 3PUJA 1S70B 3NB2A 1N54A 1EDUA 1VDYA 1N0QA 2FULA 1OY3D 3Q7AA 4KXKB 5BV1A 3OXFA 4GPMA 2KCKA 1H19A 3PE4A 2WXRA 4L2LA 5FZRA 3DEPA 2X6IA 3LVRE 2ZGGA 3Q78A 3VTXA 5EILA 1OWLA 4EZJA 3QWVA 3SFZA 4B8CB 3LCAA 3CHOA 4I9EA 2XEEA 2J09A 5T3RA 2A5EA 3GW4A 2X6KA 2IQCA 1WAO1 4GU5A 3T5VA 4TUUA 1K3ZD 2NYJA 4KZ0A 4UQYA 5IY5E 3JQ1A 4GMRA 1JCQA 1OWMA 3QOUA 5D2MC 3CK8A 4DX2A 3CHSA 2LAHA 2GRLA 2XZDG 4JA9A 2QC9A 2RG8A 3CVLA 1WY6A 3D9PA 3R9MA 2ETAA 4JC8A 2ONDA 1S64A 2V4HC 2A5UA 2A4ZA 3SI5A 3E4BA 5A23A 1H2TC 5ARFA 1JCRA 3TWVA 4GMLA 3X2QE 3V2XA 2IY0C 1H6PA 4BESA 2NSZA 4XX5A 3EHQA 3W9GA 5BXOA 3UM1A 1TNBA 4NIKA 3SZ7A 3ASHA 2KM4A 4N5CA 5CHEE 4U0UA 3SFYA 3SGHA 4AM9A 3TJPA 1HX8A 3B7TA 5KWDA 3U9WA 4AXHA 2RFMA 4BSZB 3LY9A 4U04A 4RVBA 3B95A 4N3CA 4I1AA 4EBAA 2CHZA 3FFLA 1UN9A 5KBAA 3SD5A 3CVXA 3VLFA 3FUNA 3EUVA 1LD8A 1SA4A 1BPOA 4E85A 3LVQE 4G24A 1FVHA 5ENOD 3IEGA 3U66A 1Y6IA 1UJKA 5JMND 3URZA 5EN5D 4GAAA 1IXVA 1JCSA 4HORA 2ETBA 2P9NG 4N2QA 3Q75A 1OWOA 1H6KA 3ULQA 4XI9A 4U63A 3APDA 2ZGDA 5EX0A 3ML8A 1MJ0A 2R02A 2ZXWE 1H6OA 5E75A 3MYVA 1OWNA 4I1OB 2XENA 3SBSA 3FUKA 3NZSA 3QKYA 1UJJA 3D9HA 5AIJA 3Q9NC 4I9CA 4WWPA 3E34A 4GA0A 5B1BE 2JLBA 4U8YD 1DNPA 1KZPA 3DSWA 3SO8A 1FT2A 4KVOA 1N52A 3JXJA 3DXMG 3PZ2A 2DZOA 2X3MA 3P1UA 2V8SE 5CRVA 1HE8A 4C0EA 1O1TA 1LF8A 2PM7A 3UXGA 4N3AA 1WM5A 5M72A 1N11A 2L0IA 4DK5A 3EIQC 3TWQA 4BTAA 2P9KG 3UT7A 3PZDA 4QFVA 4UI9C 3S7JA 3Q7FA 5FQ4A 2J9QA 3EJNA 3ESKA 2VQ2A 3NOCD 2LXLA 4A63B 4D10C 2P9UG 3B7UX 3D9MA 4LEUA 2GRRB 3RRMB 3T8KA 2CHWA 4BY6A 2CHXA 3FUJA 4DPRA 3ASGA 3Q73A 2VYIA 3S7BA 5AN8A 1NZNA 3LDZA 4I6GA 1HU3A 1FPPA 2L9BA 3UT8A 3PZ3A 4Z68A 3AS8A 4PH4B 3PREA 3ZVVA 2QYUA 1IQUA 2VSOE 3ABLE 4M7CA 2V0PA 5CCMA 2DIWA 2DYSE 2WXKA 4CDNA 1TR4A 2KC7A 4WWOA 3UM3A 4GA2A 4NURA 3IXEA 4HOTA 2LNIA 1Z6TA 4A1SA 1H2VC 3O4ZA 3R9AB 1S0PA 3O48A 1BI7B 3TG4A 4RLYA 3FTYA 2WXQA 3HXEA 5T8IA 5ANLA 2GRNB 5FQ7A 3AAAC 2OV8A 2GGFA 2EINE 3ZHEB 4B94A 2VGEA 5B3SE 3G2UA 3CHMA 5FZQA 1TNZA 2I6HA 4HFGA 2VSYA 4ANUA 2RFAA 2NXPA 4BT9A 3BG1B 4U96D 1YYHA 3B13A 1TJFA 3FY4A 4G11A 4DRXE 2BEDA 2KATA 3CK9A 5BNWA 5G05J 4CEMA 1DCQA 2XPIA 4U8HA 3APFA 3MKRA 4U7EB 4HVBA 1INZA 1NI1A 2M63A 4WWNA 3DSUA 2Q7FA 2EQXA 3DRAA 1K1BA 4GA1A 2UY1A 3MV3B 5J08A 3L22A 4APFA 5CERB 5KJNA 2XRZA 4A3TA 2VSNA 2EIME 3OXGA 2XGOA 3CLJA 1FT1A 2P2CP 3QAQA 3ZEFA 1WDYA 4ANWA 3GZSA 4NACA 4RQIA 3T5XA 4OVVA 2FO7A 3L08A 3BEEA 2I1KA 3PVLA 5CECB 2OEVA 4IULA 3CK7A 5D66A 2DZNA 1L5JA 2HE0A 5ENPD 4GYOA 3LY7A 2FBNA 4GTMA 3S7DA 5KNGA 3CEQA 4KZCA 5HS0A 1QBQA 4UWFA 4WNEA 1EF1C 3FTUA 3CHQA 4YDOA 2F8XK 4JPSA 3FTZA 5JJTA 5FINA 2EIJE 3AU5A 3UUXA 4I2ZA 3ZIMA 4FADA 3JYSA 4ATGA 3IKOB 5HQ8A 1E96B 4TV3A 3Q79A 4PS7A 2XEHA 4LUNU 2BKKB 4U0SA 4EZKA 4BSXA 4AJWA 2FO1E 3ZYKA 4NQ0A 4ABNA 2RKKA 2P9LG 5FT9A 3ZFWA 5AQ9A 1OCRE 1Z3XA 3PH0C 3JQ0A 3DPYA 3BG0B 2WQHA 2FEZA 3QDNA 2V5FA 4CRWA 1KLXA 1OWPA 4GTPA 3I4RB 3KD7A 2AXVA 4GB9A 3LJ3A 3FTVA 4TXPA 1BLXB 3MA5A 4JW1A 3FTXA 2VTBB 1B89A 3IBEA 3GZ2A 4O1OA 1FVFA 2HYZA 4ZFHA 3FUEA 1WG0A 2PNNA 3FUIA 1N4QA 3RU0A 4OAVB 5LCWC 1OUVA 2HO1A 4ILIA 4Y6WA 3WXXA 5E76A 4C48B 4BX8A 3ZRHA 1SQMA 4YDYA 4CGWA 3CHRA 4A55A 4FC8A 2ZIRA 4I43A 1D8EA 5CRUA 5AENA 3EIJA 3RRNB 2P9PG 1U3DA 3CQCB 2WXNA 3NBNB 3DSSA 1IYGA 1TNUA 4YVQC 3UMVA 3GYZA 3ESLA 4HLEA 1BI8B 3I4GA 4ZHBA 4FU3A 2BTDA 3CVYA 1KT0A 3TWSA 5ENTD 1AWCB 4GZDA 4JEHA 3LEWA 3CKBA 5FIOA 3ZNGA 3E33A 3PZ1A 1SA5A 3TG5A 1AP7A 4JL0A 5FTPA 3CSFA 4BERA 3RAUA 3TXNA 5KNHD 2GW1A 1OXJA 4N5QA 2QY7A 4HS2A 4JVSA 2FI7A 4AP2A 2WQ7A 3L9TA 2IOLA 5EIDA 3DSTA 5HRYA 2R17C 3G2VA 3KSQA 3PDNA 4CDRA 4L23A 3Q9UC 3JUIA 3NOGD 3ZYQA 3LYAA 4HBDA 3Q47B 2WXPA 2IJGX 4G8KA 3ZGQA 4GZCA 4KT6B 2J4BA 1NFIE 4B93B 4GZ3A 1HZ4A 3AS4A 3ZYMA 3TGOA 4EPZA 2KZTB 2LXMA 3AG2E 4JD2G 3N71A 3CVWA 4RG6A 4FP7A 4ACLA 1SVXA 3TWTA 4BFRA 1BD8A 4NRHB 2DBAA 3V79K 2H6HA 2DYRE 2GRPB 4K03A 1U2VG 4J8DA 4PDXA 1ZU2A 3CV0A 1E7VA 2PM6A 3ZN3A 4FHKA 3ULYA 2Y1LE 2WVIA 4EHMA 1N95A 3MCXA 3I5PA 5AARA 3L54A 4J8YA 1Z5SC 2BF0X 3LXUX 5AJLA 5LX8A 1D8DA 4AIFA 5BXUA 2YQ8A 4YNDA 4BEPA 3RJVA 1N0RA 2OOEA 4ANXA 4HOSA 3OTNA 3CVPA 1O1RA 3B7SA 2P9SG 2R59A 4XKBA 5AJDA 3IV0A 5KCMA 4FHJA 5KJKA 3UKUG 3FUHA 4UWGA 1O5MA 3ZPJA 3FU6A 3HXFA 5JA4D 1UOHA 4KBQA 5AQ7A 3CIAA 3UKRG 3MGBA 5HKPA 2PQNA 3DXKG 3C3QA 3KEAA 3Q49B 1YMPA 3HVEB 3W9FA 4C0MA 4RG9A 4OYSA 1HXIA 5D0OD 3PNLB 3UI2A 1KPSB 5G55A 3PZ4A 4O60A 3QARA 1UG3A 4I17A 2XPZA 3ASFA 4B0ZA 2RD0A 4UI9K 2J49A 3RO3A 3FEXA 1Q2ZA 3K9IA 3CVQA 2Y0BG 5J90A 3G2WA 2IEJA 4URKA 1TN7A 1V54E 4K5CA 2BKGA 2WXFA 4BWRA 4F6RD 1E7UA 2HR2A 3EU9A 1IHGA 2IU1A 1A5EA 1TN6A 4EZLA 3SHFA 4X8QA 5AQBA 2Y3AA 1N4PA 1X81A 1EPUA 2DVWA 4EBAG 3J5QB 5EKQD 4LNGA 2YINA 4CCAA 3SQVA 5BPPA 4FULA 4WNFA 3PEUB 3BU8A 3S7FA 3QWPA 3EHNA 2QZAA 4CGVA 3CQGB 5BUZA 4MKTA 5JJ6A 3RIBA 2WMNA 4Q94A 3FTWA 3D9LA 3FUDA 3EDTB 4BT8A 2PZIA 4HB5A 2GRQB 1ELRA 4L7TA 4P29A 4B8AA 4N2SA 4H7XA 3TWXA 4AVXA 4G2VA 3D9IA 3JCKC 4U95D 2MOWA 2PL2A 4J0UA 1IKND 4O6FA 3LY8A 3EHMA 5LP0A 1H0AA 1JWFA 3L16A 2P9IG 4YVOA 4DX5D 3QNKA 3SY2A 2IOSA 1ZB1A 3VLDA 4CYMD 3C72A 5LOZA 2XHEA 2VGXB 2C0MA 1E8XA 2WXOA 4I1MA 4DLQA 4DLOA 3CHPA 4PS8A 2OVBA 1X5BA 4UI9J 5CBNA 2B6CA 3DEOA 4FA6A 1HH8A 4U8VD 3FH8A 1MX4A 1PC2A 3FH5A 5AQAA 2FF4A 4FJYA 4GTQA 4ILHB 3GZ1A 3FP3A 4N3BA 3QK0A 1NA3A 3NZUA 1Z3YA 2VGYA 2IONA 4LERA 3OAWA 3I3NA 2I2OA 2WQ6A 2VJ8A 1LD7A 2ZU6B 3C3OA 3DBSA 2HM8A 4UQXA 2XQ0A 3QC1A 2UWJG 2KCLA 1BU9A 3E32A 3ZUVB 4B89A 2GROB 5ENSD 3QB2A 3FU0A 2WXMA 3MKQA 4M3OA 4LRZA 2X6HA 4K5AB 4PS3A 4OAUC 3HXDA 3ASDA 4HOQA 2KXPC 1PY1A 1S63A 5G04C 4ANVA 3B7RL 1ELKA 3JUEA 1TYQG 3TWUA 3FTSA 3CKCA 5CCLA 5C1DA 3D9OA 1SW6A 3AG3E 3EHRA 2OCCE 5CEAA 3V2OA 2WMOA 4PUCA 2I1JA 1UW4B 4QQIA 4XI0A 1FCHA 2OVFA 3C98A 3UQ3A 3RO2A 1NA0A 4IRUA 1UN8A 3VLEA 4DX6D 3KAEA 4G25A 3HXBA 1JWGA 1O1SA 4G8LA 4HRMB 4TXRA 2WPVA 3FU5A 2E2EA 1G3NB 3RK6A 4LCTA 4Q69A 3PEVB 5BT1A 3FH7A 4F1PA 5EX3A 3SF4A 2KCVA 2WXJA 1XGWA 4GMJA 4W9RA 3E37A 2CFUA 5FQ6A 2XRYA 3U3WA 3ZXSA 3F6QA 1MQSA 2V4LA 1D9SA 3DWLG 5B1AE 4DX7D 4V3IA 1TNYA 3D9NA 1LTXA 1SZ9A 2XCBA 4FJZA 5JJ7A 3DSVA 4AY5A 3OXLA 2NC9A 4I6EA 4KMOA 3E30A 4A3VA 4GZ6A 1YA0A 4CT0A 1ZBPA 1MHQA 3UIOC 4GTRA 1E90A 3AG4E 2LSVA 3R7RA 1XNFA 1TJCA 4UWHA 4DUIA 2X38A 3L17A 3FULA 3NF1A 3C5RA 3JXIA 4GYYA 3ZU7B 3FHEA 1RZ4A 4MRUA 4XEIG 2MYOA 4APOA 4GPKA 3CVUA 2H6FA 4TUMA 3G2TA 2XS8A 3MEKA 2WM9A 2Y69E 4JB8P 3ZXPA 2R03A 3APCA 3Q4AB 5A6CA 2KBXA 5G04J 4C9BB 1MYOA 2LSUA 2QFCA 2MHKA 2KZTA 5ENQD 1ELWA 4GZ5A 4RSYA 3T8MA 4IYPA 5AYWD 4HQDA 3D9JA 2IO2C 3TL5A 1RW2A 3RSEG 1HF8A 2J4DA 3P2BA 2WXGA 4J8FA 1W3BA 1MX6A 1HG2A 4IN3B 3BQOA 1K1AA 2H6GA 4CZ2D 1Y8MA 3PS6A 4XIFA 1YCSB 2ETCA 3RRUA 4L1BA 4HRNA 2BUGA 1OCOE 5LCWJ 2CG2A 1IQRA 3UIPC 2L0TB 3L82A 2L6JA 3AG1E 3C3RA 2P58C 5ENNA 2AJAA 5EIBE 3CR3A 4BTBA 2XEVA 3ASNE 3UM0A 4WNGA 2XS1A 1MX2A 3RKVA 1KZOA 4OVUA 3J5PA 3SBTB 3HHMA 5AAOA 4HRLA 3MZLB 3SFXA 3NAWA 3ZW3A 4JXTA 2JABA 3ABME 5BW8C 3ONLA 3R7QA 3NQPA 5LFAA 1DVPA 1P5QA 2C2LA 2F8YA 4J7WA 4ATZD 3UPVA 4WNDA 5ARGA 4XKCA 3G2SA 3UTMA 3HVEA 3V31A 5ITZF 4U0ZA 4TXQA 3HXCA 4EECA 5G05C 1PAQA 4YDWA 2AVPA 3KS2A 2AXZA 4XE0A 3WG7E 4F3VA 3LJNA 4AOFA 4HOUA 2XZTG 1GW6A 1HO8A 4KVMA 3MV2B 4DX1A 1A17A 4Q96A 2J07A 1N94A 2JEKA 3UM2A 3HYMB 4F1SA 4CT4A 4LG6A 2J08A 3T9KA 2DWZA 3D3MA 2XCCA 1QYMA 3MX3A 3ONKA 4F53A 2E0IA 5CMWA 1HG5A 1DC2A 2L6BA 5FZSA 2AW6A 4BETA 3TWWA 3Q15A 4DJAA 2R05A 4HNAD 4AY6A 4H7YA 1OCCE 3AS5A 2H6IA 3CGHA 4JHKA 2B0OE 5DBKA 4Y6CA 4J6IA 4GTOA 3ML9A 5CEDB 1QQEA 3U4TA 2CG3A 4GTVA 2VSXE 1JUQA 3Q5MA 4ACKA 4BX9A 3QJZA 1MZCA 2YHCA 3UX4A 1KT1A 3TAXA 1OCZE 3FDHA 4N39A 2ZISA 1N4RA 3FWVA 3ZHEA 1E8WA 5FJYA 5T4YA 3DSXA 2F0YA 5CBOA 4MS6A 1JPLA 2YHEA 4JEUA 2LUHA 2Y4TA 3ASOE 4O1PA 2AWIA 2AXUA 4LNBA 4JHRA 3KSLA 4GYWA 2ILRA 3UINC 3LPZA 3ZYLA 2XGSA 1U3CA 4YDEA 3PRZA 1DCEA 4LSZE 1QNFA 3EU5A 4K5BA 5JHBA 2Y4UA 2OEWA 5G2NA 1OT8A 5ENRD 4UWLA 4JHJA 2XPYA 5KJLA 4HI9A 3B7BA 2VGXA 5FWQA 4AEZC 4GCNA 3CSTA 4U07A 2GRMA 4HXIA 3CVVA 1EYHA 3PUKA 4L9PA 4R7LA 2MRIA 5EYPF 4WUYA 4ILGA 4UWKA 1N4SA 3AJIA 4JZYA 1N9AA 4F7AA 3ZKJA 3FEYA 4K0RA 5CMYA 2UY1B 3TXMA 3FU3A 3AU4A 2IO3C 4A1GA 4JA7A 4G26A 2J8SD 2X6FA 2EILE 3ISMC 4DI4A 3IHYA 3TWRA 5H7PA 1SZAA 5C2YA 4E6HA 4CDMA 3D9KA 5KJMA 4EQFA 2R5SA 1TEZA 2CFZA 4J8EA 3PNTB 3DPDA 3MJWA 2R2LA 3QWWA 5EDSA 4KYOB 1TN8A 3V30A 4AV7A 2WXIA 5EYLA 3L6AA 2EIKE 5D0QD 4MBGA 4HLLA 2LAIA 3U64A 2F37A 3KEZA 3CVNA 5BV0A 2V5QC 2QYJA 1HFAA 2WXLA 1NP7A 4FLHA 1QZ2A 2LO6A 2PQRA 3ABKE 3PE3A 4GTSA 5A7DB 3L13A 1H2UA 3HIZA 4DI3A 4HI8A 4TRQA 2YNQA 2WB2A 3MKQB
chains in the Genus database with same CATH topology
5JHAA 3FHEA 1HS6A 2C0LA 3G2UA 3CHMA 3HDXA 4MLPA 4MRUA 5FZQA 2IFUA 3UT4A 3LKUA 3Q49B 2I6HA 4HFGA 5FQ8A 3IHVA 2DCPA 2VSYA 4APOA 4GCOA 4GPKA 4ANUA 3HVEB 3CVUA 2X6JA 4WAFA 2NXPA 4G23A 4BT9A 4I6JA 5ANRA 3G2TA 3BG1B 4C0MA 2I9CA 3MEKA 4RG9A 2WM9A 3B13A 4OYSA 1TJFA 3FY4A 1HXIA 2VTBA 4G11A 5D0OD 3APCA 3PNLB 1E8ZA 2WXHA 2KATA 3Q4AB 5G55A 5A6CA 3CK9A 3SNXA 4UQZA 3LS8A 5G04J 5BNWA 4C9BB 5G05J 4J8SA 3QARA 4CEMA 3FUMA 2XPIA 2LSUA 4U8HA 2QFCA 2IF4A 1UG3A 2KZTA 2MHKA 3APFA 4FLBA 4I17A 4I2WA 4ME2A 2XPZA 3ASFA 3MKRA 1ELWA 4B0ZA 2RD0A 4HVBA 1INZA 3ENEA 4GZ5A 5DIZA 4RSYA 3T8MA 4IYPA 5HI7A 1E8YA 2M63A 4G1TA 4WWNA 5AYWD 4UI9K 2Q7FA 2J49A 3RO3A 2EQXA 3FUFA 3FEXA 3VTYA 3D9JA 4XZ4A 4GA1A 3K9IA 3TL5A 4L2YA 2XGMA 3CVQA 2UY1A 1HF8A 3MV3B 2J4DA 3L22A 5J08A 5J90A 3P2BA 4APFA 2WXGA 5KJNA 3G2WA 3S2AA 4URKA 2XRZA 4J8FA 4A3TA 2VSNA 1W3BA 3PUJA 1N54A 1EDUA 1VDYA 2WXFA 4BWRA 1HG2A 3OXGA 1E7UA 2XGOA 3CLJA 2HR2A 1IHGA 4IN3B 3QAQA 2IU1A 2FULA 3ZEFA 4ANWA 3GZSA 4NACA 1Y8MA 3T5XA 4OVVA 2FO7A 3L08A 3PS6A 4EZLA 3SHFA 4XIFA 3BEEA 2I1KA 2Y3AA 3PVLA 3RRUA 1EPUA 4IULA 4KXKB 3OXFA 3CK7A 4L1BA 5BV1A 2BUGA 4EBAG 5LCWJ 2CG2A 1IQRA 5EKQD 2L0TB 1L5JA 2YINA 2KCKA 1H19A 2L6JA 3PE4A 4CCAA 4GYOA 2WXRA 3LY7A 5BPPA 4L2LA 5FZRA 2FBNA 2P58C 4FULA 4WNFA 3PEUB 5ENNA 3S7DA 3CR3A 2X6IA 3LVRE 3S7FA 3QWPA 3CEQA 2XEVA 4BTBA 4KZCA 3EHNA 4UWFA 4WNEA 3VTXA 1EF1C 3FTUA 1OWLA 4WNGA 3CHQA 3RKVA 3CQGB 4EZJA 5BUZA 3QWVA 4CGVA 4MKTA 3SFZA 5JJ6A 4B8CB 3LCAA 4JPSA 3RIBA 2WMNA 4Q94A 4OVUA 3FTZA 5JJTA 3FTWA 3D9LA 3CHOA 3SBTB 3FUDA 4I9EA 3HHMA 3EDTB 3MZLB 2J09A 3AU5A 4BT8A 2PZIA 5T3RA 3UUXA 3GW4A 2X6KA 2IQCA 4I2ZA 3ZW3A 4JXTA 3ZHEB 5BW8C 1WAO1 4GU5A 3T5VA 4TUUA 3ZIMA 4KZ0A 4UQYA 3JYSA 4FADA 4ATGA 3IKOB 1ELRA 5HQ8A 3ONLA 3JQ1A 4L7TA 1E96B 4P29A 3R7QA 4B8AA 1OWMA 3QOUA 4TV3A 4N2SA 3NQPA 3CK8A 5LFAA 3CHSA 4PS7A 1DVPA 1P5QA 2LAHA 4H7XA 2C2LA 2GRLA 4AVXA 4G2VA 4JA9A 2RG8A 3CVLA 1WY6A 3D9PA 4LUNU 3UPVA 3D9IA 4JC8A 4U0SA 4WNDA 2ONDA 4EZKA 3JCKC 5ARGA 4BSXA 4XKCA 3G2SA 4AJWA 2MOWA 2PL2A 4J0UA 3HVEA 4U0ZA 4O6FA 2A5UA 3ZYKA 2A4ZA 3SI5A 3LY8A 4EECA 4NQ0A 3E4BA 4ABNA 5A23A 5G05C 1PAQA 1H2TC 3EHMA 5LP0A 1H0AA 5FT9A 4EPZA 3ZFWA 5ARFA 2AVPA 3KS2A 2AXZA 4GMLA 1Z3XA 3PH0C 3JQ0A 4XE0A 4F3VA 3BG0B 1JWFA 2WQHA 3L16A 4AOFA 2FEZA 2NSZA 3QDNA 4XX5A 2V5FA 4HOUA 4CRWA 1KLXA 1OWPA 4YVOA 3ASHA 2KM4A 4N5CA 5CHEE 3SZ7A 1GW6A 4U0UA 3QNKA 1HO8A 3SGHA 4AM9A 4KVMA 2IOSA 3TJPA 3I4RB 3MV2B 1A17A 4Q96A 3VLDA 1HX8A 2J07A 3B7TA 2AXVA 3KD7A 2JEKA 3U9WA 4AXHA 5LOZA 4GB9A 3LJ3A 2XHEA 3FTVA 3LY9A 3HYMB 2VGXB 2C0MA 4U04A 4RVBA 1E8XA 3MA5A 4N3CA 4JW1A 4I1AA 4F1SA 4CT4A 2WXOA 3FTXA 4EBAA 4I1MA 2CHZA 4DLQA 4DLOA 3FFLA 2VTBB 1UN9A 3CHPA 1B89A 3IBEA 2J08A 3SD5A 3GZ2A 3CVXA 3VLFA 1FVFA 2HYZA 3FUNA 3D3MA 3FUEA 1BPOA 4PS8A 2OVBA 3FUIA 2XCCA 1X5BA 3MX3A 3RU0A 5LCWC 3ONKA 4UI9J 1OUVA 2HO1A 3LVQE 4G24A 4ILIA 4Y6WA 3WXXA 5E76A 2E0IA 4E85A 1FVHA 5CMWA 3IEGA 4FA6A 1HH8A 1HG5A 4BX8A 3U66A 3FH8A 3ZRHA 1SQMA 1Y6IA 1UJKA 1PC2A 3FH5A 5FZSA 2FF4A 3URZA 4FJYA 4ILHB 3GZ1A 4GAAA 2AW6A 4CGWA 3CHRA 4A55A 4HORA 4F53A 3Q15A 4DJAA 3FP3A 4N3BA 4FC8A 3QK0A 4N2QA 4AY6A 4H7YA 4I43A 5AENA 1NA3A 3NZUA 3EIJA 3AS5A 3RRNB 1Z3YA 3CGHA 4JHKA 2VGYA 1OWOA 2IONA 4LERA 1H6KA 1U3DA 3CQCB 3OAWA 3I3NA 2WXNA 2I2OA 1IYGA 3ULQA 2WQ6A 4XI9A 4U63A 4YVQC 5DBKA 2VJ8A 3APDA 3UMVA 2ZU6B 3GYZA 4Y6CA 3ESLA 4J6IA 4HLEA 3DBSA 3I4GA 3ML9A 2HM8A 4FU3A 4UQXA 5EX0A 1QQEA 3ML8A 3U4TA 2BTDA 3CVYA 2XQ0A 2CG3A 1KT0A 3QC1A 2UWJG 2VSXE 2KCLA 4GZDA 4JEHA 1JUQA 3LEWA 3CKBA 3Q5MA 4ACKA 4BX9A 3QJZA 2YHCA 5E75A 3TG5A 3MYVA 4JL0A 1OWNA 3UX4A 1KT1A 5FTPA 3CSFA 3TAXA 3TXNA 4B89A 4I1OB 2GW1A 3FUKA 3QB2A 3FDHA 3NZSA 4N39A 3FU0A 3SBSA 3FWVA 2QY7A 2WXMA 4HS2A 3MKQA 4JVSA 3ZHEA 1E8WA 4M3OA 5FJYA 4LRZA 2X6HA 2FI7A 5T4YA 3QKYA 1UJJA 4AP2A 5AIJA 4WWPA 4I9CA 4PS3A 4MS6A 1JPLA 2YHEA 4B94A 2WQ7A 4JEUA 2Y4TA 2IOLA 2R17C 3ASDA 3G2VA 4GA0A 4HOQA 1PY1A 2JLBA 3PDNA 1DNPA 5G04C 2AWIA 4CDRA 4ANVA 3B7RL 1ELKA 2AXUA 3FTSA 4L23A 4AEZC 3CKCA 3JUIA 5CCLA 5C1DA 3D9OA 4KVOA 4JHRA 3ZYQA 1N52A 4GYWA 2ILRA 2X3MA 3P1UA 2V8SE 3LYAA 3LPZA 3ZYLA 2XGSA 1U3CA 2WMOA 4PUCA 2I1JA 3Q47B 1UW4B 2WXPA 2IJGX 3PRZA 1QNFA 4XI0A 3ZGQA 4GZCA 1FCHA 2OVFA 3C98A 3UQ3A 5JHBA 1HE8A 4C0EA 3RO2A 1NA0A 1LF8A 2Y4UA 4KT6B 5G2NA 4IRUA 2J4BA 2PM7A 4UWLA 4JHJA 1UN8A 2XPYA 5KJLA 4N3AA 3VLEA 4GZ3A 1HZ4A 2VGXA 3AS4A 1WM5A 5M72A 3ZYMA 5FWQA 3TGOA 2L0IA 3KAEA 4G25A 4DK5A 3EIQC 1JWGA 4BTAA 4GCNA 3CSTA 3PZDA 4QFVA 2GRMA 4U07A 2KZTB 4HXIA 3UT7A 1EYHA 2WPVA 3PUKA 3CVVA 3FU5A 4UI9C 2E2EA 3S7JA 3N71A 3CVWA 4RG6A 4R7LA 2MRIA 5FQ4A 4WUYA 4FP7A 4ACLA 2J9QA 4ILGA 3EJNA 3RK6A 3ESKA 4LCTA 4UWKA 4BFRA 4Q69A 4NRHB 2VQ2A 2DBAA 4D10C 4JZYA 4F7AA 4K03A 3PEVB 4J8DA 3FEYA 4K0RA 3B7UX 3D9MA 5CMYA 2UY1B 4PDXA 4LEUA 1ZU2A 3CV0A 3TXMA 3FU3A 5BT1A 3AU4A 3RRMB 4A1GA 4JA7A 4G26A 2CHWA 1E7VA 4BY6A 2PM6A 3FH7A 5EX3A 3SF4A 2CHXA 2KCVA 2WXJA 3FUJA 4DPRA 3ASGA 1XGWA 2VYIA 2X6FA 3ZN3A 3S7BA 4GMJA 4W9RA 1NZNA 3LDZA 4FHKA 2CFUA 4I6GA 4DI4A 3IHYA 1HU3A 1SZAA 5FQ6A 5C2YA 2XRYA 3U3WA 3ZXSA 2L9BA 3UT8A 4E6HA 3AS8A 4PH4B 4CDMA 3D9KA 1MQSA 2V4LA 2WVIA 3PREA 3MCXA 3I5PA 3ZVVA 5KJMA 3L54A 4EQFA 2R5SA 2BF0X 3LXUX 1IQUA 1TEZA 2VSOE 5AJLA 5LX8A 2CFZA 4J8EA 4V3IA 3PNTB 3DPDA 3MJWA 3D9NA 2V0PA 5CCMA 2DIWA 3QWWA 4AIFA 5EDSA 4KYOB 1SZ9A 2YQ8A 4YNDA 2XCBA 4AV7A 4FJZA 2WXKA 2WXIA 3RJVA 5JJ7A 2OOEA 3L6AA 4CDNA 4AY5A 3OXLA 4WWOA 2KC7A 2NC9A 5D0QD 4ANXA 4HOSA 3OTNA 4I6EA 3CVPA 4GA2A 2LAIA 3U64A 3B7SA 4KMOA 4NURA 4HOTA 2LNIA 1Z6TA 4A3VA 3KEZA 4GZ6A 1YA0A 2R59A 3CVNA 1H2VC 3O4ZA 4XKBA 5AJDA 4A1SA 5BV0A 3IV0A 5KCMA 4FHJA 3R9AB 5KJKA 4CT0A 1S0PA 3FUHA 3O48A 4UWGA 3TG4A 1HFAA 1ZBPA 1MHQA 2WXLA 1NP7A 3FTYA 3ZPJA 1E90A 3FU6A 4FLHA 1QZ2A 2LO6A 2LSVA 2WXQA 3R7RA 2PQRA 3PE3A 1XNFA 1TJCA 5T8IA 4KBQA 5ANLA 4UWHA 5FQ7A 3CIAA 5A7DB 3L13A 2X38A 2OV8A 3MGBA 2GGFA 3L17A 3FULA 1H2UA 3NF1A 2PQNA 3HIZA 4DI3A 4TRQA 4GYYA 2YNQA 2WB2A 3MKQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0L A;  5FZQ A;  2IFU A;  3LKU A;  3Q49 B;  2I6H A;  2VSY A;  4APO A;  4GCO A;  4GPK A;  4G23 A;  4BT9 A;  4RG9 A;  3MEK A;  1HXI A;  5D0O D;  2KAT A;  3Q4A B;  5A6C A;  3CK9 A;  4UQZ A;  5G04 J;  5BNW A;  5G05 J;  2XPI A;  2LSU A;  2QFC A;  2IF4 A;  2MHK A;  4ME2 A;  4I17 A;  4I2W A;  3MKR A;  3ASF A;  1ELW A;  4GZ5 A;  5DIZ A;  5HI7 A;  4G1T A;  5AYW D;  4UI9 K;  2Q7F A;  3RO3 A;  3VTY A;  4GA1 A;  3K9I A;  2XGM A;  3CVQ A;  2UY1 A;  3MV3 B;  5KJN A;  4J8F A;  2VSN A;  1W3B A;  4BWR A;  3OXG A;  2XGO A;  2HR2 A;  1IHG A;  4IN3 B;  1Y8M A;  2FO7 A;  4XIF A;  3BEE A;  4KXK B;  3OXF A;  3CK7 A;  2BUG A;  5LCW J;  5EKQ D;  2KCK A;  2L6J A;  3PE4 A;  4GYO A;  3LY7 A;  5FZR A;  2FBN A;  2P58 C;  4WNF A;  3S7D A;  3S7F A;  3QWP A;  3CEQ A;  2XEV A;  4BTB A;  4WNE A;  3VTX A;  4WNG A;  3RKV A;  4CGV A;  3QWV A;  5JJ6 A;  3LCA A;  3RIB A;  5JJT A;  4I9E A;  3EDT B;  4BT8 A;  2PZI A;  3UUX A;  3GW4 A;  4I2Z A;  5BW8 C;  1WAO 1;  4UQY A;  3JYS A;  1ELR A;  5HQ8 A;  1E96 B;  3QOU A;  4N2S A;  3CK8 A;  1P5Q A;  4H7X A;  2C2L A;  4G2V A;  4JA9 A;  3CVL A;  3UPV A;  4U0S A;  4WND A;  2OND A;  5ARG A;  2PL2 A;  4J0U A;  4U0Z A;  4O6F A;  3LY8 A;  4NQ0 A;  3E4B A;  4ABN A;  5G05 C;  5FT9 A;  3ZFW A;  5ARF A;  2AVP A;  3KS2 A;  4F3V A;  2WQH A;  2FEZ A;  3QDN A;  2V5F A;  4HOU A;  1KLX A;  4YVO A;  3ASH A;  4N5C A;  3SZ7 A;  5CHE E;  4U0U A;  4AM9 A;  3MV2 B;  1A17 A;  3KD7 A;  3LY9 A;  3HYM B;  2VGX B;  2C0M A;  4U04 A;  3MA5 A;  4N3C A;  4I1A A;  3FFL A;  1B89 A;  3GZ2 A;  2HYZ A;  2XCC A;  3RU0 A;  5LCW C;  4UI9 J;  1OUV A;  2HO1 A;  4G24 A;  4Y6W A;  3WXX A;  3IEG A;  1HH8 A;  1PC2 A;  5FZS A;  2FF4 A;  3URZ A;  3GZ1 A;  4CGW A;  4HOR A;  3Q15 A;  3FP3 A;  4N3B A;  4N2Q A;  4AY6 A;  4H7Y A;  1NA3 A;  3AS5 A;  2VGY A;  1IYG A;  3ULQ A;  4XI9 A;  4YVQ C;  5DBK A;  3GYZ A;  4Y6C A;  4UQX A;  5EX0 A;  1QQE A;  3U4T A;  1KT0 A;  2UWJ G;  2KCL A;  3CKB A;  3Q5M A;  2YHC A;  3TG5 A;  4JL0 A;  1KT1 A;  5FTP A;  3TAX A;  2GW1 A;  4N39 A;  3FWV A;  3ZHE A;  5FJY A;  2FI7 A;  3QKY A;  4I9C A;  4B94 A;  2Y4T A;  3ASD A;  4GA0 A;  4HOQ A;  2JLB A;  3PDN A;  5G04 C;  4CDR A;  3CKC A;  5CCL A;  5C1D A;  4JHR A;  4GYW A;  3LYA A;  3LPZ A;  2XGS A;  3Q47 B;  4XI0 A;  3ZGQ A;  1FCH A;  3UQ3 A;  3RO2 A;  1NA0 A;  2Y4U A;  5KJL A;  4N3A A;  4GZ3 A;  1HZ4 A;  2VGX A;  3AS4 A;  1WM5 A;  5M72 A;  3TGO A;  3KAE A;  4G25 A;  4BTA A;  4GCN A;  4U07 A;  2WPV A;  4UI9 C;  3S7J A;  2E2E A;  3N71 A;  4RG6 A;  4WUY A;  2J9Q A;  3ESK A;  4NRH B;  2VQ2 A;  2DBA A;  4J8D A;  2UY1 B;  4LEU A;  1ZU2 A;  3CV0 A;  5BT1 A;  4JA7 A;  4G26 A;  5EX3 A;  3SF4 A;  2KCV A;  3ASG A;  2VYI A;  3ZN3 A;  3S7B A;  4W9R A;  1NZN A;  3U3W A;  3AS8 A;  5KJM A;  4EQF A;  2R5S A;  4J8E A;  5CCM A;  3QWW A;  4AIF A;  4KYO B;  2YQ8 A;  4YND A;  2XCB A;  3RJV A;  5JJ7 A;  2OOE A;  4AY5 A;  3OXL A;  5D0Q D;  2KC7 A;  2NC9 A;  4HOS A;  3CVP A;  4GA2 A;  4HOT A;  2LNI A;  4GZ6 A;  1YA0 A;  3CVN A;  4A1S A;  3R9A B;  5KJK A;  3O48 A;  3TG4 A;  1ZBP A;  3ZPJ A;  1QZ2 A;  2LSV A;  2PQR A;  3PE3 A;  1XNF A;  1TJC A;  4KBQ A;  5A7D B;  3NF1 A;  2PQN A;  4GYY A;  3ZHE B; 
#chains in the Genus database with same CATH topology
 5JHA A;  1HS6 A;  2C0L A;  3HDX A;  4MLP A;  2IFU A;  3UT4 A;  1NL4 A;  3LKU A;  5FQ8 A;  3IHV A;  2DCP A;  4GCO A;  3BUA A;  2X6J A;  3HG0 D;  4WAF A;  4G23 A;  4I6J A;  5ANR A;  2I9C A;  1IHB A;  4LNU D;  1E8Z A;  2WXH A;  1K8K G;  3SNX A;  4UQZ A;  3LS8 A;  1V55 E;  4J8S A;  4UUC A;  3FUM A;  1TNO A;  4ME2 A;  2IF4 A;  4FLB A;  4I2W A;  2VTB A;  3ENE A;  5DIZ A;  5HI7 A;  1E8Y A;  4G1T A;  3FUF A;  3VTY A;  4GTT A;  4XZ4 A;  3HRA A;  4L2Y A;  2XGM A;  3S2A A;  3ULE G;  3PUJ A;  1S70 B;  3NB2 A;  1N54 A;  1EDU A;  1VDY A;  1N0Q A;  2FUL A;  1OY3 D;  3Q7A A;  4KXK B;  5BV1 A;  3OXF A;  4GPM A;  2KCK A;  1H19 A;  3PE4 A;  2WXR A;  4L2L A;  5FZR A;  3DEP A;  2X6I A;  3LVR E;  2ZGG A;  3Q78 A;  3VTX A;  5EIL A;  1OWL A;  4EZJ A;  3QWV A;  3SFZ A;  4B8C B;  3LCA A;  3CHO A;  4I9E A;  2XEE A;  2J09 A;  5T3R A;  2A5E A;  3GW4 A;  2X6K A;  2IQC A;  1WAO 1;  4GU5 A;  3T5V A;  4TUU A;  1K3Z D;  2NYJ A;  4KZ0 A;  4UQY A;  5IY5 E;  3JQ1 A;  4GMR A;  1JCQ A;  1OWM A;  3QOU A;  5D2M C;  3CK8 A;  4DX2 A;  3CHS A;  2LAH A;  2GRL A;  2XZD G;  4JA9 A;  2QC9 A;  2RG8 A;  3CVL A;  1WY6 A;  3D9P A;  3R9M A;  2ETA A;  4JC8 A;  2OND A;  1S64 A;  2V4H C;  2A5U A;  2A4Z A;  3SI5 A;  3E4B A;  5A23 A;  1H2T C;  5ARF A;  1JCR A;  3TWV A;  4GML A;  3X2Q E;  3V2X A;  2IY0 C;  1H6P A;  4BES A;  2NSZ A;  4XX5 A;  3EHQ A;  3W9G A;  5BXO A;  3UM1 A;  1TNB A;  4NIK A;  3SZ7 A;  3ASH A;  2KM4 A;  4N5C A;  5CHE E;  4U0U A;  3SFY A;  3SGH A;  4AM9 A;  3TJP A;  1HX8 A;  3B7T A;  5KWD A;  3U9W A;  4AXH A;  2RFM A;  4BSZ B;  3LY9 A;  4U04 A;  4RVB A;  3B95 A;  4N3C A;  4I1A A;  4EBA A;  2CHZ A;  3FFL A;  1UN9 A;  5KBA A;  3SD5 A;  3CVX A;  3VLF A;  3FUN A;  3EUV A;  1LD8 A;  1SA4 A;  1BPO A;  4E85 A;  3LVQ E;  4G24 A;  1FVH A;  5ENO D;  3IEG A;  3U66 A;  1Y6I A;  1UJK A;  5JMN D;  3URZ A;  5EN5 D;  4GAA A;  1IXV A;  1JCS A;  4HOR A;  2ETB A;  2P9N G;  4N2Q A;  3Q75 A;  1OWO A;  1H6K A;  3ULQ A;  4XI9 A;  4U63 A;  3APD A;  2ZGD A;  5EX0 A;  3ML8 A;  1MJ0 A;  2R02 A;  2ZXW E;  1H6O A;  5E75 A;  3MYV A;  1OWN A;  4I1O B;  2XEN A;  3SBS A;  3FUK A;  3NZS A;  3QKY A;  1UJJ A;  3D9H A;  5AIJ A;  3Q9N C;  4I9C A;  4WWP A;  3E34 A;  4GA0 A;  5B1B E;  2JLB A;  4U8Y D;  1DNP A;  1KZP A;  3DSW A;  3SO8 A;  1FT2 A;  4KVO A;  1N52 A;  3JXJ A;  3DXM G;  3PZ2 A;  2DZO A;  2X3M A;  3P1U A;  2V8S E;  5CRV A;  1HE8 A;  4C0E A;  1O1T A;  1LF8 A;  2PM7 A;  3UXG A;  4N3A A;  1WM5 A;  5M72 A;  1N11 A;  2L0I A;  4DK5 A;  3EIQ C;  3TWQ A;  4BTA A;  2P9K G;  3UT7 A;  3PZD A;  4QFV A;  4UI9 C;  3S7J A;  3Q7F A;  5FQ4 A;  2J9Q A;  3EJN A;  3ESK A;  2VQ2 A;  3NOC D;  2LXL A;  4A63 B;  4D10 C;  2P9U G;  3B7U X;  3D9M A;  4LEU A;  2GRR B;  3RRM B;  3T8K A;  2CHW A;  4BY6 A;  2CHX A;  3FUJ A;  4DPR A;  3ASG A;  3Q73 A;  2VYI A;  3S7B A;  5AN8 A;  1NZN A;  3LDZ A;  4I6G A;  1HU3 A;  1FPP A;  2L9B A;  3UT8 A;  3PZ3 A;  4Z68 A;  3AS8 A;  4PH4 B;  3PRE A;  3ZVV A;  2QYU A;  1IQU A;  2VSO E;  3ABL E;  4M7C A;  2V0P A;  5CCM A;  2DIW A;  2DYS E;  2WXK A;  4CDN A;  1TR4 A;  2KC7 A;  4WWO A;  3UM3 A;  4GA2 A;  4NUR A;  3IXE A;  4HOT A;  2LNI A;  1Z6T A;  4A1S A;  1H2V C;  3O4Z A;  3R9A B;  1S0P A;  3O48 A;  1BI7 B;  3TG4 A;  4RLY A;  3FTY A;  2WXQ A;  3HXE A;  5T8I A;  5ANL A;  2GRN B;  5FQ7 A;  3AAA C;  2OV8 A;  2GGF A;  2EIN E;  3ZHE B;  4B94 A;  2VGE A;  5B3S E;  3G2U A;  3CHM A;  5FZQ A;  1TNZ A;  2I6H A;  4HFG A;  2VSY A;  4ANU A;  2RFA A;  2NXP A;  4BT9 A;  3BG1 B;  4U96 D;  1YYH A;  3B13 A;  1TJF A;  3FY4 A;  4G11 A;  4DRX E;  2BED A;  2KAT A;  3CK9 A;  5BNW A;  5G05 J;  4CEM A;  1DCQ A;  2XPI A;  4U8H A;  3APF A;  3MKR A;  4U7E B;  4HVB A;  1INZ A;  1NI1 A;  2M63 A;  4WWN A;  3DSU A;  2Q7F A;  2EQX A;  3DRA A;  1K1B A;  4GA1 A;  2UY1 A;  3MV3 B;  5J08 A;  3L22 A;  4APF A;  5CER B;  5KJN A;  2XRZ A;  4A3T A;  2VSN A;  2EIM E;  3OXG A;  2XGO A;  3CLJ A;  1FT1 A;  2P2C P;  3QAQ A;  3ZEF A;  1WDY A;  4ANW A;  3GZS A;  4NAC A;  4RQI A;  3T5X A;  4OVV A;  2FO7 A;  3L08 A;  3BEE A;  2I1K A;  3PVL A;  5CEC B;  2OEV A;  4IUL A;  3CK7 A;  5D66 A;  2DZN A;  1L5J A;  2HE0 A;  5ENP D;  4GYO A;  3LY7 A;  2FBN A;  4GTM A;  3S7D A;  5KNG A;  3CEQ A;  4KZC A;  5HS0 A;  1QBQ A;  4UWF A;  4WNE A;  1EF1 C;  3FTU A;  3CHQ A;  4YDO A;  2F8X K;  4JPS A;  3FTZ A;  5JJT A;  5FIN A;  2EIJ E;  3AU5 A;  3UUX A;  4I2Z A;  3ZIM A;  4FAD A;  3JYS A;  4ATG A;  3IKO B;  5HQ8 A;  1E96 B;  4TV3 A;  3Q79 A;  4PS7 A;  2XEH A;  4LUN U;  2BKK B;  4U0S A;  4EZK A;  4BSX A;  4AJW A;  2FO1 E;  3ZYK A;  4NQ0 A;  4ABN A;  2RKK A;  2P9L G;  5FT9 A;  3ZFW A;  5AQ9 A;  1OCR E;  1Z3X A;  3PH0 C;  3JQ0 A;  3DPY A;  3BG0 B;  2WQH A;  2FEZ A;  3QDN A;  2V5F A;  4CRW A;  1KLX A;  1OWP A;  4GTP A;  3I4R B;  3KD7 A;  2AXV A;  4GB9 A;  3LJ3 A;  3FTV A;  4TXP A;  1BLX B;  3MA5 A;  4JW1 A;  3FTX A;  2VTB B;  1B89 A;  3IBE A;  3GZ2 A;  4O1O A;  1FVF A;  2HYZ A;  4ZFH A;  3FUE A;  1WG0 A;  2PNN A;  3FUI A;  1N4Q A;  3RU0 A;  4OAV B;  5LCW C;  1OUV A;  2HO1 A;  4ILI A;  4Y6W A;  3WXX A;  5E76 A;  4C48 B;  4BX8 A;  3ZRH A;  1SQM A;  4YDY A;  4CGW A;  3CHR A;  4A55 A;  4FC8 A;  2ZIR A;  4I43 A;  1D8E A;  5CRU A;  5AEN A;  3EIJ A;  3RRN B;  2P9P G;  1U3D A;  3CQC B;  2WXN A;  3NBN B;  3DSS A;  1IYG A;  1TNU A;  4YVQ C;  3UMV A;  3GYZ A;  3ESL A;  4HLE A;  1BI8 B;  3I4G A;  4ZHB A;  4FU3 A;  2BTD A;  3CVY A;  1KT0 A;  3TWS A;  5ENT D;  1AWC B;  4GZD A;  4JEH A;  3LEW A;  3CKB A;  5FIO A;  3ZNG A;  3E33 A;  3PZ1 A;  1SA5 A;  3TG5 A;  1AP7 A;  4JL0 A;  5FTP A;  3CSF A;  4BER A;  3RAU A;  3TXN A;  5KNH D;  2GW1 A;  1OXJ A;  4N5Q A;  2QY7 A;  4HS2 A;  4JVS A;  2FI7 A;  4AP2 A;  2WQ7 A;  3L9T A;  2IOL A;  5EID A;  3DST A;  5HRY A;  2R17 C;  3G2V A;  3KSQ A;  3PDN A;  4CDR A;  4L23 A;  3Q9U C;  3JUI A;  3NOG D;  3ZYQ A;  3LYA A;  4HBD A;  3Q47 B;  2WXP A;  2IJG X;  4G8K A;  3ZGQ A;  4GZC A;  4KT6 B;  2J4B A;  1NFI E;  4B93 B;  4GZ3 A;  1HZ4 A;  3AS4 A;  3ZYM A;  3TGO A;  4EPZ A;  2KZT B;  2LXM A;  3AG2 E;  4JD2 G;  3N71 A;  3CVW A;  4RG6 A;  4FP7 A;  4ACL A;  1SVX A;  3TWT A;  4BFR A;  1BD8 A;  4NRH B;  2DBA A;  3V79 K;  2H6H A;  2DYR E;  2GRP B;  4K03 A;  1U2V G;  4J8D A;  4PDX A;  1ZU2 A;  3CV0 A;  1E7V A;  2PM6 A;  3ZN3 A;  4FHK A;  3ULY A;  2Y1L E;  2WVI A;  4EHM A;  1N95 A;  3MCX A;  3I5P A;  5AAR A;  3L54 A;  4J8Y A;  1Z5S C;  2BF0 X;  3LXU X;  5AJL A;  5LX8 A;  1D8D A;  4AIF A;  5BXU A;  2YQ8 A;  4YND A;  4BEP A;  3RJV A;  1N0R A;  2OOE A;  4ANX A;  4HOS A;  3OTN A;  3CVP A;  1O1R A;  3B7S A;  2P9S G;  2R59 A;  4XKB A;  5AJD A;  3IV0 A;  5KCM A;  4FHJ A;  5KJK A;  3UKU G;  3FUH A;  4UWG A;  1O5M A;  3ZPJ A;  3FU6 A;  3HXF A;  5JA4 D;  1UOH A;  4KBQ A;  5AQ7 A;  3CIA A;  3UKR G;  3MGB A;  5HKP A;  2PQN A;  3DXK G;  3C3Q A;  3KEA A;  3Q49 B;  1YMP A;  3HVE B;  3W9F A;  4C0M A;  4RG9 A;  4OYS A;  1HXI A;  5D0O D;  3PNL B;  3UI2 A;  1KPS B;  5G55 A;  3PZ4 A;  4O60 A;  3QAR A;  1UG3 A;  4I17 A;  2XPZ A;  3ASF A;  4B0Z A;  2RD0 A;  4UI9 K;  2J49 A;  3RO3 A;  3FEX A;  1Q2Z A;  3K9I A;  3CVQ A;  2Y0B G;  5J90 A;  3G2W A;  2IEJ A;  4URK A;  1TN7 A;  1V54 E;  4K5C A;  2BKG A;  2WXF A;  4BWR A;  4F6R D;  1E7U A;  2HR2 A;  3EU9 A;  1IHG A;  2IU1 A;  1A5E A;  1TN6 A;  4EZL A;  3SHF A;  4X8Q A;  5AQB A;  2Y3A A;  1N4P A;  1X81 A;  1EPU A;  2DVW A;  4EBA G;  3J5Q B;  5EKQ D;  4LNG A;  2YIN A;  4CCA A;  3SQV A;  5BPP A;  4FUL A;  4WNF A;  3PEU B;  3BU8 A;  3S7F A;  3QWP A;  3EHN A;  2QZA A;  4CGV A;  3CQG B;  5BUZ A;  4MKT A;  5JJ6 A;  3RIB A;  2WMN A;  4Q94 A;  3FTW A;  3D9L A;  3FUD A;  3EDT B;  4BT8 A;  2PZI A;  4HB5 A;  2GRQ B;  1ELR A;  4L7T A;  4P29 A;  4B8A A;  4N2S A;  4H7X A;  3TWX A;  4AVX A;  4G2V A;  3D9I A;  3JCK C;  4U95 D;  2MOW A;  2PL2 A;  4J0U A;  1IKN D;  4O6F A;  3LY8 A;  3EHM A;  5LP0 A;  1H0A A;  1JWF A;  3L16 A;  2P9I G;  4YVO A;  4DX5 D;  3QNK A;  3SY2 A;  2IOS A;  1ZB1 A;  3VLD A;  4CYM D;  3C72 A;  5LOZ A;  2XHE A;  2VGX B;  2C0M A;  1E8X A;  2WXO A;  4I1M A;  4DLQ A;  4DLO A;  3CHP A;  4PS8 A;  2OVB A;  1X5B A;  4UI9 J;  5CBN A;  2B6C A;  3DEO A;  4FA6 A;  1HH8 A;  4U8V D;  3FH8 A;  1MX4 A;  1PC2 A;  3FH5 A;  5AQA A;  2FF4 A;  4FJY A;  4GTQ A;  4ILH B;  3GZ1 A;  3FP3 A;  4N3B A;  3QK0 A;  1NA3 A;  3NZU A;  1Z3Y A;  2VGY A;  2ION A;  4LER A;  3OAW A;  3I3N A;  2I2O A;  2WQ6 A;  2VJ8 A;  1LD7 A;  2ZU6 B;  3C3O A;  3DBS A;  2HM8 A;  4UQX A;  2XQ0 A;  3QC1 A;  2UWJ G;  2KCL A;  1BU9 A;  3E32 A;  3ZUV B;  4B89 A;  2GRO B;  5ENS D;  3QB2 A;  3FU0 A;  2WXM A;  3MKQ A;  4M3O A;  4LRZ A;  2X6H A;  4K5A B;  4PS3 A;  4OAU C;  3HXD A;  3ASD A;  4HOQ A;  2KXP C;  1PY1 A;  1S63 A;  5G04 C;  4ANV A;  3B7R L;  1ELK A;  3JUE A;  1TYQ G;  3TWU A;  3FTS A;  3CKC A;  5CCL A;  5C1D A;  3D9O A;  1SW6 A;  3AG3 E;  3EHR A;  2OCC E;  5CEA A;  3V2O A;  2WMO A;  4PUC A;  2I1J A;  1UW4 B;  4QQI A;  4XI0 A;  1FCH A;  2OVF A;  3C98 A;  3UQ3 A;  3RO2 A;  1NA0 A;  4IRU A;  1UN8 A;  3VLE A;  4DX6 D;  3KAE A;  4G25 A;  3HXB A;  1JWG A;  1O1S A;  4G8L A;  4HRM B;  4TXR A;  2WPV A;  3FU5 A;  2E2E A;  1G3N B;  3RK6 A;  4LCT A;  4Q69 A;  3PEV B;  5BT1 A;  3FH7 A;  4F1P A;  5EX3 A;  3SF4 A;  2KCV A;  2WXJ A;  1XGW A;  4GMJ A;  4W9R A;  3E37 A;  2CFU A;  5FQ6 A;  2XRY A;  3U3W A;  3ZXS A;  3F6Q A;  1MQS A;  2V4L A;  1D9S A;  3DWL G;  5B1A E;  4DX7 D;  4V3I A;  1TNY A;  3D9N A;  1LTX A;  1SZ9 A;  2XCB A;  4FJZ A;  5JJ7 A;  3DSV A;  4AY5 A;  3OXL A;  2NC9 A;  4I6E A;  4KMO A;  3E30 A;  4A3V A;  4GZ6 A;  1YA0 A;  4CT0 A;  1ZBP A;  1MHQ A;  3UIO C;  4GTR A;  1E90 A;  3AG4 E;  2LSV A;  3R7R A;  1XNF A;  1TJC A;  4UWH A;  4DUI A;  2X38 A;  3L17 A;  3FUL A;  3NF1 A;  3C5R A;  3JXI A;  4GYY A;  3ZU7 B;  3FHE A;  1RZ4 A;  4MRU A;  4XEI G;  2MYO A;  4APO A;  4GPK A;  3CVU A;  2H6F A;  4TUM A;  3G2T A;  2XS8 A;  3MEK A;  2WM9 A;  2Y69 E;  4JB8 P;  3ZXP A;  2R03 A;  3APC A;  3Q4A B;  5A6C A;  2KBX A;  5G04 J;  4C9B B;  1MYO A;  2LSU A;  2QFC A;  2MHK A;  2KZT A;  5ENQ D;  1ELW A;  4GZ5 A;  4RSY A;  3T8M A;  4IYP A;  5AYW D;  4HQD A;  3D9J A;  2IO2 C;  3TL5 A;  1RW2 A;  3RSE G;  1HF8 A;  2J4D A;  3P2B A;  2WXG A;  4J8F A;  1W3B A;  1MX6 A;  1HG2 A;  4IN3 B;  3BQO A;  1K1A A;  2H6G A;  4CZ2 D;  1Y8M A;  3PS6 A;  4XIF A;  1YCS B;  2ETC A;  3RRU A;  4L1B A;  4HRN A;  2BUG A;  1OCO E;  5LCW J;  2CG2 A;  1IQR A;  3UIP C;  2L0T B;  3L82 A;  2L6J A;  3AG1 E;  3C3R A;  2P58 C;  5ENN A;  2AJA A;  5EIB E;  3CR3 A;  4BTB A;  2XEV A;  3ASN E;  3UM0 A;  4WNG A;  2XS1 A;  1MX2 A;  3RKV A;  1KZO A;  4OVU A;  3J5P A;  3SBT B;  3HHM A;  5AAO A;  4HRL A;  3MZL B;  3SFX A;  3NAW A;  3ZW3 A;  4JXT A;  2JAB A;  3ABM E;  5BW8 C;  3ONL A;  3R7Q A;  3NQP A;  5LFA A;  1DVP A;  1P5Q A;  2C2L A;  2F8Y A;  4J7W A;  4ATZ D;  3UPV A;  4WND A;  5ARG A;  4XKC A;  3G2S A;  3UTM A;  3HVE A;  3V31 A;  5ITZ F;  4U0Z A;  4TXQ A;  3HXC A;  4EEC A;  5G05 C;  1PAQ A;  4YDW A;  2AVP A;  3KS2 A;  2AXZ A;  4XE0 A;  3WG7 E;  4F3V A;  3LJN A;  4AOF A;  4HOU A;  2XZT G;  1GW6 A;  1HO8 A;  4KVM A;  3MV2 B;  4DX1 A;  1A17 A;  4Q96 A;  2J07 A;  1N94 A;  2JEK A;  3UM2 A;  3HYM B;  4F1S A;  4CT4 A;  4LG6 A;  2J08 A;  3T9K A;  2DWZ A;  3D3M A;  2XCC A;  1QYM A;  3MX3 A;  3ONK A;  4F53 A;  2E0I A;  5CMW A;  1HG5 A;  1DC2 A;  2L6B A;  5FZS A;  2AW6 A;  4BET A;  3TWW A;  3Q15 A;  4DJA A;  2R05 A;  4HNA D;  4AY6 A;  4H7Y A;  1OCC E;  3AS5 A;  2H6I A;  3CGH A;  4JHK A;  2B0O E;  5DBK A;  4Y6C A;  4J6I A;  4GTO A;  3ML9 A;  5CED B;  1QQE A;  3U4T A;  2CG3 A;  4GTV A;  2VSX E;  1JUQ A;  3Q5M A;  4ACK A;  4BX9 A;  3QJZ A;  1MZC A;  2YHC A;  3UX4 A;  1KT1 A;  3TAX A;  1OCZ E;  3FDH A;  4N39 A;  2ZIS A;  1N4R A;  3FWV A;  3ZHE A;  1E8W A;  5FJY A;  5T4Y A;  3DSX A;  2F0Y A;  5CBO A;  4MS6 A;  1JPL A;  2YHE A;  4JEU A;  2LUH A;  2Y4T A;  3ASO E;  4O1P A;  2AWI A;  2AXU A;  4LNB A;  4JHR A;  3KSL A;  4GYW A;  2ILR A;  3UIN C;  3LPZ A;  3ZYL A;  2XGS A;  1U3C A;  4YDE A;  3PRZ A;  1DCE A;  4LSZ E;  1QNF A;  3EU5 A;  4K5B A;  5JHB A;  2Y4U A;  2OEW A;  5G2N A;  1OT8 A;  5ENR D;  4UWL A;  4JHJ A;  2XPY A;  5KJL A;  4HI9 A;  3B7B A;  2VGX A;  5FWQ A;  4AEZ C;  4GCN A;  3CST A;  4U07 A;  2GRM A;  4HXI A;  3CVV A;  1EYH A;  3PUK A;  4L9P A;  4R7L A;  2MRI A;  5EYP F;  4WUY A;  4ILG A;  4UWK A;  1N4S A;  3AJI A;  4JZY A;  1N9A A;  4F7A A;  3ZKJ A;  3FEY A;  4K0R A;  5CMY A;  2UY1 B;  3TXM A;  3FU3 A;  3AU4 A;  2IO3 C;  4A1G A;  4JA7 A;  4G26 A;  2J8S D;  2X6F A;  2EIL E;  3ISM C;  4DI4 A;  3IHY A;  3TWR A;  5H7P A;  1SZA A;  5C2Y A;  4E6H A;  4CDM A;  3D9K A;  5KJM A;  4EQF A;  2R5S A;  1TEZ A;  2CFZ A;  4J8E A;  3PNT B;  3DPD A;  3MJW A;  2R2L A;  3QWW A;  5EDS A;  4KYO B;  1TN8 A;  3V30 A;  4AV7 A;  2WXI A;  5EYL A;  3L6A A;  2EIK E;  5D0Q D;  4MBG A;  4HLL A;  2LAI A;  3U64 A;  2F37 A;  3KEZ A;  3CVN A;  5BV0 A;  2V5Q C;  2QYJ A;  1HFA A;  2WXL A;  1NP7 A;  4FLH A;  1QZ2 A;  2LO6 A;  2PQR A;  3ABK E;  3PE3 A;  4GTS A;  5A7D B;  3L13 A;  1H2U A;  3HIZ A;  4DI3 A;  4HI8 A;  4TRQ A;  2YNQ A;  2WB2 A;  3MKQ B; 
#chains in the Genus database with same CATH homology
 5JHA A;  3FHE A;  1HS6 A;  2C0L A;  3G2U A;  3CHM A;  3HDX A;  4MLP A;  4MRU A;  5FZQ A;  2IFU A;  3UT4 A;  3LKU A;  3Q49 B;  2I6H A;  4HFG A;  5FQ8 A;  3IHV A;  2DCP A;  2VSY A;  4APO A;  4GCO A;  4GPK A;  4ANU A;  3HVE B;  3CVU A;  2X6J A;  4WAF A;  2NXP A;  4G23 A;  4BT9 A;  4I6J A;  5ANR A;  3G2T A;  3BG1 B;  4C0M A;  2I9C A;  3MEK A;  4RG9 A;  2WM9 A;  3B13 A;  4OYS A;  1TJF A;  3FY4 A;  1HXI A;  2VTB A;  4G11 A;  5D0O D;  3APC A;  3PNL B;  1E8Z A;  2WXH A;  2KAT A;  3Q4A B;  5G55 A;  5A6C A;  3CK9 A;  3SNX A;  4UQZ A;  3LS8 A;  5G04 J;  5BNW A;  4C9B B;  5G05 J;  4J8S A;  3QAR A;  4CEM A;  3FUM A;  2XPI A;  2LSU A;  4U8H A;  2QFC A;  2IF4 A;  1UG3 A;  2KZT A;  2MHK A;  3APF A;  4FLB A;  4I17 A;  4I2W A;  4ME2 A;  2XPZ A;  3ASF A;  3MKR A;  1ELW A;  4B0Z A;  2RD0 A;  4HVB A;  1INZ A;  3ENE A;  4GZ5 A;  5DIZ A;  4RSY A;  3T8M A;  4IYP A;  5HI7 A;  1E8Y A;  2M63 A;  4G1T A;  4WWN A;  5AYW D;  4UI9 K;  2Q7F A;  2J49 A;  3RO3 A;  2EQX A;  3FUF A;  3FEX A;  3VTY A;  3D9J A;  4XZ4 A;  4GA1 A;  3K9I A;  3TL5 A;  4L2Y A;  2XGM A;  3CVQ A;  2UY1 A;  1HF8 A;  3MV3 B;  2J4D A;  3L22 A;  5J08 A;  5J90 A;  3P2B A;  4APF A;  2WXG A;  5KJN A;  3G2W A;  3S2A A;  4URK A;  2XRZ A;  4J8F A;  4A3T A;  2VSN A;  1W3B A;  3PUJ A;  1N54 A;  1EDU A;  1VDY A;  2WXF A;  4BWR A;  1HG2 A;  3OXG A;  1E7U A;  2XGO A;  3CLJ A;  2HR2 A;  1IHG A;  4IN3 B;  3QAQ A;  2IU1 A;  2FUL A;  3ZEF A;  4ANW A;  3GZS A;  4NAC A;  1Y8M A;  3T5X A;  4OVV A;  2FO7 A;  3L08 A;  3PS6 A;  4EZL A;  3SHF A;  4XIF A;  3BEE A;  2I1K A;  2Y3A A;  3PVL A;  3RRU A;  1EPU A;  4IUL A;  4KXK B;  3OXF A;  3CK7 A;  4L1B A;  5BV1 A;  2BUG A;  4EBA G;  5LCW J;  2CG2 A;  1IQR A;  5EKQ D;  2L0T B;  1L5J A;  2YIN A;  2KCK A;  1H19 A;  2L6J A;  3PE4 A;  4CCA A;  4GYO A;  2WXR A;  3LY7 A;  5BPP A;  4L2L A;  5FZR A;  2FBN A;  2P58 C;  4FUL A;  4WNF A;  3PEU B;  5ENN A;  3S7D A;  3CR3 A;  2X6I A;  3LVR E;  3S7F A;  3QWP A;  3CEQ A;  2XEV A;  4BTB A;  4KZC A;  3EHN A;  4UWF A;  4WNE A;  3VTX A;  1EF1 C;  3FTU A;  1OWL A;  4WNG A;  3CHQ A;  3RKV A;  3CQG B;  4EZJ A;  5BUZ A;  3QWV A;  4CGV A;  4MKT A;  3SFZ A;  5JJ6 A;  4B8C B;  3LCA A;  4JPS A;  3RIB A;  2WMN A;  4Q94 A;  4OVU A;  3FTZ A;  5JJT A;  3FTW A;  3D9L A;  3CHO A;  3SBT B;  3FUD A;  4I9E A;  3HHM A;  3EDT B;  3MZL B;  2J09 A;  3AU5 A;  4BT8 A;  2PZI A;  5T3R A;  3UUX A;  3GW4 A;  2X6K A;  2IQC A;  4I2Z A;  3ZW3 A;  4JXT A;  3ZHE B;  5BW8 C;  1WAO 1;  4GU5 A;  3T5V A;  4TUU A;  3ZIM A;  4KZ0 A;  4UQY A;  3JYS A;  4FAD A;  4ATG A;  3IKO B;  1ELR A;  5HQ8 A;  3ONL A;  3JQ1 A;  4L7T A;  1E96 B;  4P29 A;  3R7Q A;  4B8A A;  1OWM A;  3QOU A;  4TV3 A;  4N2S A;  3NQP A;  3CK8 A;  5LFA A;  3CHS A;  4PS7 A;  1DVP A;  1P5Q A;  2LAH A;  4H7X A;  2C2L A;  2GRL A;  4AVX A;  4G2V A;  4JA9 A;  2RG8 A;  3CVL A;  1WY6 A;  3D9P A;  4LUN U;  3UPV A;  3D9I A;  4JC8 A;  4U0S A;  4WND A;  2OND A;  4EZK A;  3JCK C;  5ARG A;  4BSX A;  4XKC A;  3G2S A;  4AJW A;  2MOW A;  2PL2 A;  4J0U A;  3HVE A;  4U0Z A;  4O6F A;  2A5U A;  3ZYK A;  2A4Z A;  3SI5 A;  3LY8 A;  4EEC A;  4NQ0 A;  3E4B A;  4ABN A;  5A23 A;  5G05 C;  1PAQ A;  1H2T C;  3EHM A;  5LP0 A;  1H0A A;  5FT9 A;  4EPZ A;  3ZFW A;  5ARF A;  2AVP A;  3KS2 A;  2AXZ A;  4GML A;  1Z3X A;  3PH0 C;  3JQ0 A;  4XE0 A;  4F3V A;  3BG0 B;  1JWF A;  2WQH A;  3L16 A;  4AOF A;  2FEZ A;  2NSZ A;  3QDN A;  4XX5 A;  2V5F A;  4HOU A;  4CRW A;  1KLX A;  1OWP A;  4YVO A;  3ASH A;  2KM4 A;  4N5C A;  5CHE E;  3SZ7 A;  1GW6 A;  4U0U A;  3QNK A;  1HO8 A;  3SGH A;  4AM9 A;  4KVM A;  2IOS A;  3TJP A;  3I4R B;  3MV2 B;  1A17 A;  4Q96 A;  3VLD A;  1HX8 A;  2J07 A;  3B7T A;  2AXV A;  3KD7 A;  2JEK A;  3U9W A;  4AXH A;  5LOZ A;  4GB9 A;  3LJ3 A;  2XHE A;  3FTV A;  3LY9 A;  3HYM B;  2VGX B;  2C0M A;  4U04 A;  4RVB A;  1E8X A;  3MA5 A;  4N3C A;  4JW1 A;  4I1A A;  4F1S A;  4CT4 A;  2WXO A;  3FTX A;  4EBA A;  4I1M A;  2CHZ A;  4DLQ A;  4DLO A;  3FFL A;  2VTB B;  1UN9 A;  3CHP A;  1B89 A;  3IBE A;  2J08 A;  3SD5 A;  3GZ2 A;  3CVX A;  3VLF A;  1FVF A;  2HYZ A;  3FUN A;  3D3M A;  3FUE A;  1BPO A;  4PS8 A;  2OVB A;  3FUI A;  2XCC A;  1X5B A;  3MX3 A;  3RU0 A;  5LCW C;  3ONK A;  4UI9 J;  1OUV A;  2HO1 A;  3LVQ E;  4G24 A;  4ILI A;  4Y6W A;  3WXX A;  5E76 A;  2E0I A;  4E85 A;  1FVH A;  5CMW A;  3IEG A;  4FA6 A;  1HH8 A;  1HG5 A;  4BX8 A;  3U66 A;  3FH8 A;  3ZRH A;  1SQM A;  1Y6I A;  1UJK A;  1PC2 A;  3FH5 A;  5FZS A;  2FF4 A;  3URZ A;  4FJY A;  4ILH B;  3GZ1 A;  4GAA A;  2AW6 A;  4CGW A;  3CHR A;  4A55 A;  4HOR A;  4F53 A;  3Q15 A;  4DJA A;  3FP3 A;  4N3B A;  4FC8 A;  3QK0 A;  4N2Q A;  4AY6 A;  4H7Y A;  4I43 A;  5AEN A;  1NA3 A;  3NZU A;  3EIJ A;  3AS5 A;  3RRN B;  1Z3Y A;  3CGH A;  4JHK A;  2VGY A;  1OWO A;  2ION A;  4LER A;  1H6K A;  1U3D A;  3CQC B;  3OAW A;  3I3N A;  2WXN A;  2I2O A;  1IYG A;  3ULQ A;  2WQ6 A;  4XI9 A;  4U63 A;  4YVQ C;  5DBK A;  2VJ8 A;  3APD A;  3UMV A;  2ZU6 B;  3GYZ A;  4Y6C A;  3ESL A;  4J6I A;  4HLE A;  3DBS A;  3I4G A;  3ML9 A;  2HM8 A;  4FU3 A;  4UQX A;  5EX0 A;  1QQE A;  3ML8 A;  3U4T A;  2BTD A;  3CVY A;  2XQ0 A;  2CG3 A;  1KT0 A;  3QC1 A;  2UWJ G;  2VSX E;  2KCL A;  4GZD A;  4JEH A;  1JUQ A;  3LEW A;  3CKB A;  3Q5M A;  4ACK A;  4BX9 A;  3QJZ A;  2YHC A;  5E75 A;  3TG5 A;  3MYV A;  4JL0 A;  1OWN A;  3UX4 A;  1KT1 A;  5FTP A;  3CSF A;  3TAX A;  3TXN A;  4B89 A;  4I1O B;  2GW1 A;  3FUK A;  3QB2 A;  3FDH A;  3NZS A;  4N39 A;  3FU0 A;  3SBS A;  3FWV A;  2QY7 A;  2WXM A;  4HS2 A;  3MKQ A;  4JVS A;  3ZHE A;  1E8W A;  4M3O A;  5FJY A;  4LRZ A;  2X6H A;  2FI7 A;  5T4Y A;  3QKY A;  1UJJ A;  4AP2 A;  5AIJ A;  4WWP A;  4I9C A;  4PS3 A;  4MS6 A;  1JPL A;  2YHE A;  4B94 A;  2WQ7 A;  4JEU A;  2Y4T A;  2IOL A;  2R17 C;  3ASD A;  3G2V A;  4GA0 A;  4HOQ A;  1PY1 A;  2JLB A;  3PDN A;  1DNP A;  5G04 C;  2AWI A;  4CDR A;  4ANV A;  3B7R L;  1ELK A;  2AXU A;  3FTS A;  4L23 A;  4AEZ C;  3CKC A;  3JUI A;  5CCL A;  5C1D A;  3D9O A;  4KVO A;  4JHR A;  3ZYQ A;  1N52 A;  4GYW A;  2ILR A;  2X3M A;  3P1U A;  2V8S E;  3LYA A;  3LPZ A;  3ZYL A;  2XGS A;  1U3C A;  2WMO A;  4PUC A;  2I1J A;  3Q47 B;  1UW4 B;  2WXP A;  2IJG X;  3PRZ A;  1QNF A;  4XI0 A;  3ZGQ A;  4GZC A;  1FCH A;  2OVF A;  3C98 A;  3UQ3 A;  5JHB A;  1HE8 A;  4C0E A;  3RO2 A;  1NA0 A;  1LF8 A;  2Y4U A;  4KT6 B;  5G2N A;  4IRU A;  2J4B A;  2PM7 A;  4UWL A;  4JHJ A;  1UN8 A;  2XPY A;  5KJL A;  4N3A A;  3VLE A;  4GZ3 A;  1HZ4 A;  2VGX A;  3AS4 A;  1WM5 A;  5M72 A;  3ZYM A;  5FWQ A;  3TGO A;  2L0I A;  3KAE A;  4G25 A;  4DK5 A;  3EIQ C;  1JWG A;  4BTA A;  4GCN A;  3CST A;  3PZD A;  4QFV A;  2GRM A;  4U07 A;  2KZT B;  4HXI A;  3UT7 A;  1EYH A;  2WPV A;  3PUK A;  3CVV A;  3FU5 A;  4UI9 C;  2E2E A;  3S7J A;  3N71 A;  3CVW A;  4RG6 A;  4R7L A;  2MRI A;  5FQ4 A;  4WUY A;  4FP7 A;  4ACL A;  2J9Q A;  4ILG A;  3EJN A;  3RK6 A;  3ESK A;  4LCT A;  4UWK A;  4BFR A;  4Q69 A;  4NRH B;  2VQ2 A;  2DBA A;  4D10 C;  4JZY A;  4F7A A;  4K03 A;  3PEV B;  4J8D A;  3FEY A;  4K0R A;  3B7U X;  3D9M A;  5CMY A;  2UY1 B;  4PDX A;  4LEU A;  1ZU2 A;  3CV0 A;  3TXM A;  3FU3 A;  5BT1 A;  3AU4 A;  3RRM B;  4A1G A;  4JA7 A;  4G26 A;  2CHW A;  1E7V A;  4BY6 A;  2PM6 A;  3FH7 A;  5EX3 A;  3SF4 A;  2CHX A;  2KCV A;  2WXJ A;  3FUJ A;  4DPR A;  3ASG A;  1XGW A;  2VYI A;  2X6F A;  3ZN3 A;  3S7B A;  4GMJ A;  4W9R A;  1NZN A;  3LDZ A;  4FHK A;  2CFU A;  4I6G A;  4DI4 A;  3IHY A;  1HU3 A;  1SZA A;  5FQ6 A;  5C2Y A;  2XRY A;  3U3W A;  3ZXS A;  2L9B A;  3UT8 A;  4E6H A;  3AS8 A;  4PH4 B;  4CDM A;  3D9K A;  1MQS A;  2V4L A;  2WVI A;  3PRE A;  3MCX A;  3I5P A;  3ZVV A;  5KJM A;  3L54 A;  4EQF A;  2R5S A;  2BF0 X;  3LXU X;  1IQU A;  1TEZ A;  2VSO E;  5AJL A;  5LX8 A;  2CFZ A;  4J8E A;  4V3I A;  3PNT B;  3DPD A;  3MJW A;  3D9N A;  2V0P A;  5CCM A;  2DIW A;  3QWW A;  4AIF A;  5EDS A;  4KYO B;  1SZ9 A;  2YQ8 A;  4YND A;  2XCB A;  4AV7 A;  4FJZ A;  2WXK A;  2WXI A;  3RJV A;  5JJ7 A;  2OOE A;  3L6A A;  4CDN A;  4AY5 A;  3OXL A;  4WWO A;  2KC7 A;  2NC9 A;  5D0Q D;  4ANX A;  4HOS A;  3OTN A;  4I6E A;  3CVP A;  4GA2 A;  2LAI A;  3U64 A;  3B7S A;  4KMO A;  4NUR A;  4HOT A;  2LNI A;  1Z6T A;  4A3V A;  3KEZ A;  4GZ6 A;  1YA0 A;  2R59 A;  3CVN A;  1H2V C;  3O4Z A;  4XKB A;  5AJD A;  4A1S A;  5BV0 A;  3IV0 A;  5KCM A;  4FHJ A;  3R9A B;  5KJK A;  4CT0 A;  1S0P A;  3FUH A;  3O48 A;  4UWG A;  3TG4 A;  1HFA A;  1ZBP A;  1MHQ A;  2WXL A;  1NP7 A;  3FTY A;  3ZPJ A;  1E90 A;  3FU6 A;  4FLH A;  1QZ2 A;  2LO6 A;  2LSV A;  2WXQ A;  3R7R A;  2PQR A;  3PE3 A;  1XNF A;  1TJC A;  5T8I A;  4KBQ A;  5ANL A;  4UWH A;  5FQ7 A;  3CIA A;  5A7D B;  3L13 A;  2X38 A;  2OV8 A;  3MGB A;  2GGF A;  3L17 A;  3FUL A;  1H2U A;  3NF1 A;  2PQN A;  3HIZ A;  4DI3 A;  4TRQ A;  4GYY A;  2YNQ A;  2WB2 A;  3MKQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...