1VDYA

Nmr structure of the hypothetical enth-vhs domain at3g16270 from arabidopsis thaliana
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
140
structure length
140
Chain Sequence
GSSGSSGESYWRSRMIDAVTSDEDKVAPVYKLEEICDLLRSSHVSIVKEFSEFILKRLDNKSPIVKQKALRLIKYAVGKSGSEFRREMQRNSVAVRNLFHYKGHPDPLKGDALNKAVRETAHETISAIFSEENGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein (RAFL09-17-B18)
publication title Solution structure of the hypothetical ENTH-VHS domain AT3G16270 from arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 40
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2004-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1vdyA00
1ELKA 1LF8A 1PY1A 1EYHA 1UJKA 3G2TA 3ONKA 4JXTA 3RRUA 3ZYKA 4Q94A 2DCPA 5CMWA 3LDZA 1JPLA 3ZYLA 1HF8A 4Q96A 1HG2A 3D9KA 4AVXA 1HFAA 2V8SE 3G2UA 1H0AA 1JWFA 1MHQA 2QY7A 4GZDA 2KM4A 3CLJA 3G2VA 3D9OA 4FU3A 2L0IA 5CMYA 2BF0X 3D9NA 5LOZA 3D9PA 3G2WA 3D9MA 2DIWA 3D9JA 1JUQA 1UJJA 1X5BA 4HFGA 1DVPA 4NACA 3ONLA 1SZAA 2MOWA 3ZYQA 1VDYA 1INZA 1HG5A 1XGWA 2LO6A 5J08A 5LP0A 3ZYMA 3G2SA 1HX8A 2L0TB 3D9LA 1SZ9A 3D9IA 1EDUA 1JWGA 4FLBA 4GZCA
chains in the Genus database with same CATH superfamily
4WNEA 5CRVA 3FUMA 4DI4A 1NA0A 3P2BA 4N39A 3FH5A 3QWWA 4DX1A 3G2UA 4IYPA 4FLHA 3ULYA 4PUCA 3TWTA 3SFZA 3CHSA 3QNKA 2Q7FA 4KVOA 4YDOA 3FTSA 2IQCA 2NC9A 3UI2A 4BT8A 4M3OA 4JA7A 3AS4A 4AXHA 4I43A 1E96B 4I6EA 2KM4A 3TJPA 3EHQA 3Q15A 4GZ3A 3HXEA 2OEWA 4TXPA 3FFLA 3HVEA 4BERA 1A17A 2ZIRA 1U3CA 3MKQB 4PS8A 2XPZA 4I9EA 4K03A 1KZOA 5KJKA 3T5XA 4U8YD 3C3QA 1YCSB 1SQMA 1U3DA 1HU3A 1K3ZD 1LD7A 1ELWA 3ZN3A 3DSUA 2Y0BG 4X8QA 3PNTB 2WB2A 2H6HA 3GW4A 2XS1A 3JYSA 4GTMA 1Q2ZA 3LDZA 2IO3C 4GZ6A 5AQ9A 2XENA 4FU3A 2BKKB 3U9WA 2BUGA 4AM9A 4DI3A 3ESLA 3FDHA 1UJJA 3IKOB 4GA2A 5E76A 4M7CA 3ZRHA 1O1TA 3ZIMA 5EX3A 3QDNA 4JHRA 5C2YA 3T5VA 1GW6A 2I1KA 3BU8A 3FTVA 2WXJA 1IKND 1PAQA 2RD0A 1N4QA 1H2UA 3UT7A 3I4GA 3S7BA 1HXIA 4N3BA 1N94A 4G8KA 3JXIA 3MX3A 2DYRE 5A23A 4W9RA 3SD5A 4KT6B 3ML8A 4AVXA 5LX8A 4UWGA 5AQ7A 2ONDA 2ETBA 1PY1A 1D8DA 4WWOA 4CZ2D 1SA4A 5G04J 2HO1A 1RZ4A 4U0UA 4JA9A 2IU1A 2EINE 4YDYA 2WQHA 3DXMG 1OCRE 4L2YA 4FLBA 3FU6A 4EQFA 4WWPA 4JVSA 3TAXA 3DEOA 5FZSA 3DEPA 5KJMA 4XKBA 4AJWA 5KBAA 2XGSA 4OVVA 2OEVA 3CKCA 1YA0A 2R2LA 3ASGA 1Z3XA 1HZ4A 4HNAD 5FIOA 3R9MA 3B13A 3B7SA 5T3RA 3CVPA 2XS8A 4RLYA 3CVLA 4ANUA 3FEYA 3QARA 2DIWA 4ZFHA 3KEZA 3U64A 2OCCE 3FULA 3S7DA 2A4ZA 5AJDA 3TWQA 2R59A 2XRZA 3NBNB 2F8XK 2XPIA 3CK7A 4BSZB 3ZKJA 3E4BA 3VLDA 4LSZE 3MKRA 4F1PA 3CIAA 3ASHA 3IV0A 4FP7A 2WM9A 3CVNA 3AG1E 5KNHD 3HYMB 4CEMA 2X6JA 3IHVA 4KZ0A 1LD8A 4XIFA 4D10C 1XGWA 2AVPA 4UQXA 5FJYA 3ZNGA 3QOUA 3UT8A 5AN8A 3GYZA 4N5CA 5H7PA 1TNZA 4GYYA 3N71A 3TXMA 2EIJE 2P9NG 2F37A 1NZNA 5FZQA 3BEEA 4YVOA 2P9LG 4ZHBA 3ZUVB 3CVWA 4J8SA 1FCHA 2GRMA 2AXZA 3EU5A 5J90A 5T8IA 1UJKA 3DWLG 3OXLA 3BG0B 2ILRA 4RG6A 1OCCE 1SZAA 3BUAA 3QAQA 4JEHA 3RKVA 4GTVA 4I6GA 5AQBA 3GZ2A 4JL0A 3SQVA 3FUHA 4B8CB 4J0UA 3HIZA 3I3NA 1ZBPA 3NZSA 4ME2A 1MX2A 4G24A 2QYUA 4HRLA 2KC7A 3FU3A 4U04A 2VTBB 1HX8A 2L0TB 3LPZA 5G55A 3FUKA 5FQ4A 4DLOA 3WXXA 1HF8A 3J5QB 4N3CA 2ZXWE 2H6IA 5E75A 4JZYA 3TWSA 1TNYA 1QNFA 3EIJA 5FT9A 4ATGA 3ZEFA 1LF8A 1KLXA 4ACLA 3NAWA 1BU9A 3NQPA 2AW6A 2J08A 1E8ZA 4AY5A 4C0MA 2IY0C 5D0OD 5ANLA 3Q49B 4GMJA 2ETAA 4V3IA 4YDEA 4FJYA 4GZCA 3UM2A 4Q94A 4H7XA 4HOQA 3EIQC 3NF1A 4BSXA 4EZJA 2IJGX 3KD7A 1E7UA 1WM5A 1TNBA 3UUXA 5BV1A 1G3NB 4GTQA 1X5BA 3ZYKA 3ABME 1SA5A 4G2VA 4DX2A 3PEVB 4A1SA 1MX4A 4ANVA 3PZ4A 3G2TA 3CQCB 1MJ0A 4G25A 4K5CA 1OWLA 2BEDA 5D0QD 5LOZA 2GGFA 3T9KA 2NXPA 2KCKA 3HXBA 1L5JA 5KJLA 2HM8A 2P9IG 5ARGA 2V4HC 3E30A 3O4ZA 2J8SD 2FEZA 3JUIA 5CMWA 2IONA 2C0LA 3UKUG 2KATA 2PM6A 3KEAA 4FHJA 2PQRA 4DX5D 3EU9A 5KWDA 1DVPA 4LNGA 3PUJA 5LP0A 2WXKA 1IYGA 2J4BA 3ISMC 4FULA 3CHMA 3V79K 2CFUA 3IBEA 2VGEA 3EHNA 3MGBA 4K5BA 4ABNA 3CVXA 1Y8MA 3TG4A 2PZIA 4BESA 3RK6A 2XGMA 4APOA 2P58C 2R03A 3MA5A 3RRUA 1UN8A 4U95D 1EF1C 2WXNA 4A3VA 4HVBA 4GTSA 3LYAA 4HXIA 4HI8A 3MV3B 5IY5E 3AG3E 4CDNA 3ULEG 1KT1A 2P9UG 2YQ8A 3V30A 2I6HA 2YNQA 1U2VG 4BETA 1JPLA 1V54E 3IHYA 4JC8A 1UN9A 4OVUA 1OCOE 3I5PA 3CVUA 4F1SA 3JQ0A 5ENPD 5EIBE 1N54A 3DSXA 3B7UX 2KCLA 3QWVA 4LNBA 1YYHA 2B6CA 3FUDA 4BY6A 2GRLA 2XPYA 5KNGA 2CHWA 2WXIA 4HFGA 3JXJA 3MYVA 3S7JA 2WMNA 1FT2A 1N4SA 2GRPB 5CEDB 2E0IA 5FQ7A 1TJFA 4AIFA 2WXFA 2PQNA 1WDYA 3ASOE 5AARA 3ZW3A 4CGVA 3AJIA 3Q9NC 2KZTB 5G05C 2GRQB 4N5QA 3Q7FA 2B0OE 3JCKC 4OYSA 3RU0A 2X38A 3HDXA 3L6AA 4CT0A 2LUHA 1K1AA 3CGHA 5C1DA 4G8LA 4LUNU 3V31A 4Y6CA 2JLBA 1WAO1 4FC8A 3GZSA 1ELRA 4A55A 1X81A 5JJ6A 1TR4A 4NRHB 3ESKA 5BXOA 3PZ1A 5CHEE 2L9BA 4GZ5A 5JJ7A 4E6HA 1AWCB 4AOFA 3T8KA 5AJLA 5BUZA 1HH8A 4XI9A 3ZU7B 2CG2A 3DBSA 2VGYA 4PS3A 1OCZE 4HOUA 3S7FA 2V5FA 4H7YA 2FF4A 1OXJA 4QFVA 3DSTA 2QC9A 4TUMA 4PDXA 4U8HA 2LSVA 4CGWA 1N95A 3LJ3A 4ILHB 4TUUA 3E37A 3WG7E 3ONKA 3FEXA 3KAEA 5EDSA 5CEAA 4U0ZA 3FUNA 1E90A 4I1AA 5BW8C 4OAUC 1NL4A 3Q7AA 3ZYQA 1WG0A 1H2TC 1Y6IA 5EKQD 3PH0C 3Q47B 3JQ1A 3QK0A 2X6IA 4I2ZA 2X6HA 2WQ6A 1YMPA 3MV2B 4HB5A 1SW6A 1Z3YA 2EQXA 3SO8A 3UIPC 2WPVA 4B0ZA 3CV0A 1MZCA 4O1OA 4F7AA 5ENOD 4EBAG 5J08A 3Q5MA 4N2SA 2R05A 2DZNA 2PM7A 3D9LA 1IHBA 2XZDG 3Q4AB 3FWVA 3LXUX 3LCAA 4ACKA 4GA0A 4JXTA 2DWZA 2X3MA 3URZA 4Q96A 3CHRA 3UM3A 4GMRA 4L7TA 4U07A 4HI9A 3D9PA 1N4PA 2PL2A 3QWPA 1H6OA 2CFZA 4K0RA 5BNWA 2WVIA 1OWMA 2EIME 4GYWA 3SY2A 3O48A 1QBQA 4TRQA 4TXQA 1N9AA 2GRRB 2IEJA 5EN5D 2Y3AA 2L6JA 3PS6A 2CHZA 1IXVA 2ETCA 2J9QA 2X6FA 3DXKG 5G2NA 3MJWA 1NI1A 3R7QA 1TJCA 1LTXA 5BV0A 3C72A 3CKBA 4FA6A 3L22A 3SF4A 4I9CA 5BPPA 4GMLA 2KXPC 3L17A 3MKQA 3EHMA 4NIKA 1QQEA 4L2LA 2H6FA 3UINC 3HG0D 4B89A 4JD2G 4HLEA 1O5MA 4HRMB 1E8WA 2GW1A 2RG8A 4WAFA 1S70B 2EIKE 4J8DA 1JCRA 3LVRE 3FP3A 3FTXA 3L82A 2FULA 3ZHEA 4JB8P 5HS0A 3FHEA 4EECA 1NA3A 3LY9A 2V4LA 4ILIA 5AQAA 3EJNA 2MOWA 3AG2E 1IHGA 1O1SA 2IF4A 1Z5SC 4C9BB 4F6RD 1P5QA 1HO8A 3IXEA 4GTTA 3ZYLA 4HOSA 4LNUD 5JMND 3CK8A 4BX9A 2C2LA 4G11A 4IRUA 4KBQA 3G2SA 2J07A 2BTDA 2GROB 3R9AB 2UY1A 3KSQA 3UKRG 1OWPA 2RKKA 5FWQA 3UIOC 4GCNA 3FH7A 3UMVA 4BFRA 3UXGA 3LY7A 2AXUA 3UT4A 4LG6A 4L23A 3E32A 2LXLA 3HVEB 3CVQA 4AEZC 1V55E 4LRZA 4EBAA 4PS7A 1N4RA 3D9KA 2HYZA 2BKGA 2IOSA 5KJNA 1NFIE 4ILGA 2QYJA 3BG1B 4BT9A 4FHKA 4KVMA 5T4YA 1FT1A 1HG5A 4GTPA 4XEIG 3L08A 2DYSE 4A3TA 2LSUA 4GU5A 5FTPA 5AENA 4UI9K 4GTRA 4GPMA 3ABLE 4BX8A 2L6BA 2WXLA 3CHQA 2KCVA 5FQ6A 3FUEA 1TEZA 2OVFA 2IFUA 5FQ8A 2R02A 3TWVA 2R17C 4DJAA 3SBSA 4WNDA 4URKA 2M63A 3RO2A 4Y6WA 3RRMB 2NYJA 5DIZA 2XEHA 4J8EA 3FH8A 3KS2A 4NURA 5CRUA 1IQRA 1K8KG 4U0SA 2AJAA 4JHKA 2LXMA 5HKPA 4IULA 3PZ3A 1MHQA 5LCWC 5G05J 5D2MC 4F53A 5A6CA 3B7TA 3S2AA 5HI7A 5ENSD 4U7EB 5HRYA 4I2WA 2IOLA 4N3AA 3ASNE 3SZ7A 4DRXE 4CRWA 5FINA 2UWJG 4GA1A 4Q69A 2L0IA 3V2XA 3HXDA 3SGHA 3FY4A 2Y4TA 4UI9C 4QQIA 3TGOA 3W9GA 4E85A 1HG2A 1W3BA 2VSXE 1H0AA 1KZPA 3DSVA 1WY6A 1FVHA 4MS6A 4R7LA 3DRAA 5ENQD 3RO3A 3SI5A 3J5PA 4RSYA 1JWGA 2J09A 3LVQE 2VGXA 4HS2A 3HHMA 1BI7B 3R7RA 1H6KA 3D9OA 3CK9A 2ZISA 3LJNA 1IQUA 1OY3D 4KXKB 5JJTA 2VSYA 1RW2A 1SZ9A 4G1TA 2XEVA 3ZVVA 1KPSB 3LKUA 3UQ3A 3TWWA 2QY7A 4GZDA 2LAIA 2VTBA 3K9IA 4MKTA 2FBNA 3APFA 2ZU6B 1FVFA 3PDNA 4L9PA 2P9PG 3AS8A 4I17A 3UTMA 5M72A 2A5UA 3ZXSA 2V8SE 3CVYA 5EYLA 3CQGB 4GAAA 4DLQA 5JHBA 4J6IA 4UQZA 3SNXA 3G2WA 3TG5A 5JHAA 1DNPA 5BT1A 2LO6A 5A7DB 3ZYMA 3UM1A 3QC1A 5AAOA 2R5SA 1NP7A 5HQ8A 4EHMA 4CT4A 1JWFA 2MRIA 3TXNA 5EIDA 2OOEA 1SVXA 4B8AA 2WXGA 4L1BA 1JCSA 2DZOA 4LERA 1FPPA 4J8YA 1S64A 1EDUA 3HXFA 2HR2A 4J8FA 2Y1LE 2LNIA 5B1BE 4XE0A 2OVBA 3ZHEB 3EHRA 3AAAC 4UWHA 1TYQG 1HFAA 4CDRA 4HBDA 3DPDA 2X6KA 2PNNA 2WXOA 2I2OA 3EDTB 4RVBA 2AXVA 5BXUA 1UW4B 2YHCA 3DSWA 3B7RL 4UWLA 2HE0A 3SFXA 3APCA 2XZTG 3L16A 4XZ4A 3NZUA 2DCPA 3CHOA 1QZ2A 4ANXA 4U63A 2VJ8A 2DBAA 3V2OA 3C3RA 1D8EA 1N52A 2NSZA 4WWNA 2V5QC 1BLXB 2UY1B 3L54A 2WXPA 2XRYA 3GZ1A 3UX4A 3PE3A 1OWOA 2WXMA 1UOHA 2VSNA 3MZLB 4HORA 1S63A 4I1MA 2QFCA 2I1JA 4DX6D 3FTWA 1N11A 3CEQA 1TN7A 1TNOA 2BF0X 4YNDA 4UWKA 5ANRA 3UM0A 4YVQC 1PC2A 2E2EA 4APFA 2XCCA 4U96D 3FTZA 3ENEA 4JW1A 4LCTA 3NOGD 3VLFA 4XKCA 3G2VA 4GCOA 1BPOA 1BI8B 2A5EA 1O1RA 2YINA 4GB9A 1VDYA 1OUVA 2RFMA 4B93B 1MQSA 1UG3A 1MX6A 3NB2A 3U3WA 2J4DA 4JEUA 3AU5A 2GRNB 2H6GA 3D3MA 4IN3B 3PUKA 4MBGA 5DBKA 4WNGA 3D9JA 1B89A 2DVWA 3E34A 3PREA 5CECB 5AIJA 4OAVB 1E8YA 1OWNA 3ABKE 3FUIA 3L9TA 3PVLA 4UUCA 5CERB 3OAWA 3VLEA 4B94A 2KBXA 2JABA 5EILA 4LEUA 3APDA 1TN8A 3D9MA 5CBNA 4WUYA 5CCMA 3AG4E 2FI7A 3ZPJA 1XNFA 5B3SE 1BD8A 4AP2A 4BTAA 3RIBA 3LS8A 4J7WA 1TNUA 3QJZA 4HOTA 2MHKA 4MLPA 2KZTA 2WXQA 5EYPF 2VYIA 3Q78A 3FU5A 3PZDA 4EZLA 2EILE 3CVVA 3I4RB 3HRAA 3ML9A 4N2QA 3PEUB 3DPYA 4UWFA 5G04C 1A5EA 2P2CP 3SBTB 2RFAA 3Q75A 3ULQA 2JEKA 4P29A 1JUQA 3MCXA 4FADA 2VSOE 4ATZD 4AV7A 5EX0A 3ASFA 5CBOA 1EYHA 1KT0A 4GPKA 3ZFWA 3LEWA 1DC2A 2VGXB 3AU4A 4K5AB 2WXRA 3SHFA 5LCWJ 1N0QA 3C98A 2CHXA 3T8MA 3OXGA 2WQ7A 1K1BA 4KZCA 5ARFA 1MYOA 4GYOA 2P9KG 2XCBA 2CG3A 3PE4A 4EPZA 3F6QA 2XGOA 2XQ0A 3CLJA 3PNLB 1TN6A 5KCMA 3QB2A 3ZXPA 4NACA 3NOCD 3U4TA 1ZB1A 4UI9J 3U66A 3CSTA 2QZAA 1JCQA 4PH4B 5ENTD 3TL5A 2XEEA 4A63B 4G26A 2AWIA 4HQDA 3Q79A 2J49A 2C0MA 3EUVA 2P9SG 4C48B 3B7BA 4TXRA 2V0PA 4BTBA 3RRNB 3AS5A 3PZ2A 3FUJA 4UQYA 2VQ2A 1E7VA 3C5RA 4AY6A 3E33A 4MRUA 5B1AE 4HRNA 4I6JA 5LFAA 3OTNA 3FU0A 4O60A 4HLLA 2F8YA 3RJVA 3CSFA 4DUIA 4TV3A 2LAHA 5ENRD 4BEPA 3ASDA 4WNFA 3VTXA 5CCLA 3ONLA 1INZA 4KMOA 3SFYA 3LY8A 3KSLA 4CCAA 2Y4UA 3FUFA 1HS6A 2XHEA 3PRZA 4C0EA 3CR3A 2YHEA 1D9SA 1HE8A 1ZU2A 3BQOA 4DX7D 3B95A 5CMYA 4RQIA 4O1PA 2WXHA 2FO7A 5D66A 4XX5A 4DK5A 3TWUA 3ZGQA 4G23A 1S0PA 3D9IA 5FZRA 1QYMA 1H6PA 1EPUA 1DCEA 3TWXA 2ZGGA 3X2QE 3FTYA 4CYMD 1E8XA 3Q73A 1OT8A 4DPRA 3QKYA 4I1OB 2ZGDA 3D9HA 4FJZA 1AP7A 4ANWA 4KYOB 4XI0A 5ENNA 1Z6TA 1ELKA 3FTUA 3JUEA 3P1UA 3C3OA 5JA4D 4GTOA 4A1GA 2OV8A 4O6FA 3VTYA 4Z68A 2FO1E 3DSSA 3IEGA 4F3VA 5ITZF 4RG9A 3OXFA 1DCQA 2WMOA 2IO2C 2F0YA 3RSEG 3CHPA 4YDWA 3TWRA 4NQ0A 4JHJA 2I9CA 2MYOA 3HXCA 4BWRA 1H19A 2Y69E 4U8VD 4CDMA 5AYWD 3MEKA 3D9NA 1N0RA 3UPVA 3Q9UC 3W9FA 4EZKA 3L13A 1H2VC 3RAUA 4JPSA
chains in the Genus database with same CATH topology
2WXPA 4WNEA 3FUMA 4Q94A 4L2LA 2XRYA 4DI4A 1NA0A 4H7XA 3P2BA 3GZ1A 4HOQA 4N39A 3EIQC 3FH5A 3NF1A 3UX4A 4BSXA 3PE3A 4EZJA 3QWWA 3G2UA 4IYPA 1OWOA 2WXMA 4FLHA 2IJGX 3KD7A 1E7UA 4PUCA 1WM5A 3UUXA 4B89A 5BV1A 4HLEA 3SFZA 1X5BA 3ZYKA 3CHSA 2VSNA 1E8WA 2GW1A 3QNKA 2Q7FA 4G2VA 2RG8A 3PEVB 4KVOA 4WAFA 3FTSA 4A1SA 2IQCA 2NC9A 3MZLB 4ANVA 4BT8A 4HORA 3G2TA 4I1MA 4J8DA 3CQCB 4M3OA 4JA7A 3LVRE 3FP3A 3FTXA 2QFCA 2FULA 3AS4A 2I1JA 3ZHEA 4AXHA 4G25A 4I43A 1E96B 3FTWA 1OWLA 3FHEA 3CEQA 4I6EA 2KM4A 5D0QD 3TJPA 4EECA 3Q15A 4GZ3A 2BF0X 4YNDA 1NA3A 4UWKA 5LOZA 2GGFA 3LY9A 2NXPA 2V4LA 5ANRA 2KCKA 4ILIA 3EJNA 2MOWA 1L5JA 4YVQC 5KJLA 1IHGA 2HM8A 1PC2A 3FFLA 3HVEA 2E2EA 4APFA 5ARGA 2XCCA 1A17A 1U3CA 3O4ZA 3MKQB 4PS8A 2IF4A 2XPZA 4I9EA 4K03A 2FEZA 3JUIA 5KJKA 3FTZA 3T5XA 3ENEA 4C9BB 5CMWA 1P5QA 4JW1A 1HO8A 2IONA 1SQMA 2C0LA 1U3DA 1HU3A 4LCTA 3ZYLA 4HOSA 2KATA 3VLFA 2PM6A 4FHJA 1ELWA 4XKCA 3ZN3A 3CK8A 2PQRA 3G2VA 1BPOA 4GCOA 4BX9A 2C2LA 2YINA 1DVPA 4GB9A 1VDYA 1OUVA 4G11A 3PNTB 3PUJA 5LP0A 4IRUA 2WXKA 4KBQA 3G2SA 2J07A 2BTDA 2WB2A 3R9AB 1IYGA 2UY1A 1MQSA 3GW4A 2J4BA 1UG3A 4FULA 3JYSA 3CHMA 1OWPA 3U3WA 2J4DA 3LDZA 4JEUA 5FWQA 3AU5A 2CFUA 3D3MA 3IBEA 4IN3B 4GCNA 3FH7A 3EHNA 3UMVA 4GZ6A 4BFRA 3MGBA 3LY7A 4FU3A 2AXUA 4ABNA 3PUKA 3CVXA 3U9WA 4AM9A 2BUGA 1Y8MA 5DBKA 3ESLA 3UT4A 4DI3A 3TG4A 4WNGA 3D9JA 3FDHA 1B89A 1UJJA 3IKOB 2PZIA 3PREA 4GA2A 4L23A 5E76A 3RK6A 5AIJA 1E8YA 1OWNA 2XGMA 3FUIA 3HVEB 3CVQA 3PVLA 4AEZC 3ZRHA 4APOA 2P58C 3OAWA 3VLEA 4B94A 3ZIMA 4LRZA 5EX3A 4EBAA 3QDNA 3MA5A 3RRUA 4LEUA 4PS7A 1UN8A 3APDA 4JHRA 1EF1C 2WXNA 5C2YA 4A3VA 3T5VA 1GW6A 3D9KA 4HVBA 2HYZA 2I1KA 3FTVA 2IOSA 3LYAA 5KJNA 2WXJA 4HXIA 3MV3B 4ILGA 3BG1B 4BT9A 3D9MA 4WUYA 4FHKA 4CDNA 5CCMA 1PAQA 1KT1A 4KVMA 5T4YA 1HG5A 2FI7A 2RD0A 3ZPJA 1H2UA 3L08A 1XNFA 2YQ8A 3UT7A 3I4GA 4A3TA 3S7BA 2LSUA 4AP2A 4GU5A 5FTPA 2I6HA 5AENA 4UI9K 4BTAA 1HXIA 2YNQA 3RIBA 4N3BA 3LS8A 3MX3A 1JPLA 3QJZA 4BX8A 4HOTA 2MHKA 4MLPA 2WXLA 3IHYA 5A23A 3CHQA 2KZTA 4JC8A 1UN9A 2WXQA 2KCVA 4W9RA 2VYIA 4OVUA 5FQ6A 3I5PA 3CVUA 3SD5A 3FUEA 1TEZA 4KT6B 2OVFA 3ML8A 4AVXA 4F1SA 3FU5A 2IFUA 5FQ8A 3PZDA 2R17C 5LX8A 3JQ0A 4UWGA 4DJAA 2ONDA 3SBSA 4EZLA 4WNDA 3CVVA 4URKA 1N54A 2M63A 1PY1A 4Y6WA 3RO2A 3B7UX 3I4RB 4WWOA 3RRMB 3ML9A 2KCLA 4N2QA 3PEUB 3QWVA 5DIZA 4UWFA 5G04C 3FUDA 5G04J 4BY6A 2HO1A 4J8EA 4U0UA 3FH8A 2GRLA 2XPYA 3KS2A 4NURA 3SBTB 4JA9A 3ULQA 2IU1A 2JEKA 1IQRA 2CHWA 2WXIA 4P29A 1JUQA 4HFGA 3MYVA 3S7JA 2WQHA 3MCXA 4FADA 2VSOE 4U0SA 4AV7A 5EX0A 2WMNA 4L2YA 3ASFA 4FLBA 4JHKA 3FU6A 1EYHA 4EQFA 2E0IA 5FQ7A 1TJFA 4WWPA 1KT0A 4GPKA 3ZFWA 4AIFA 4JVSA 3LEWA 4IULA 2VGXB 5FZSA 3TAXA 3AU4A 2WXFA 2PQNA 4CGVA 3ZW3A 5KJMA 2WXRA 3SHFA 1MHQA 4XKBA 4AJWA 2KZTB 5LCWC 5G05C 5LCWJ 5G05J 2XGSA 4OVVA 4OYSA 3C98A 2CHXA 3JCKC 4F53A 3RU0A 3CKCA 5A6CA 3T8MA 2X38A 3B7TA 3OXGA 2WQ7A 3HDXA 3L6AA 4CT0A 3S2AA 5HI7A 1YA0A 4KZCA 3ASGA 3CGHA 5ARFA 5C1DA 1Z3XA 4GYOA 4LUNU 1HZ4A 2IOLA 4I2WA 4N3AA 2XCBA 2CG3A 3B13A 3SZ7A 3PE4A 4Y6CA 2JLBA 3B7SA 5T3RA 3CVPA 4EPZA 1WAO1 4FC8A 4CRWA 3GZSA 2XGOA 2UWJG 1ELRA 4GA1A 2XQ0A 4Q69A 3CLJA 3CVLA 2L0IA 3PNLB 4ANUA 5KCMA 3FEYA 3SGHA 3QB2A 3FY4A 3QARA 2DIWA 4A55A 4NACA 2Y4TA 3U4TA 5JJ6A 4UI9C 4UI9J 3KEZA 4NRHB 3U64A 3FULA 3ESKA 3S7DA 2A4ZA 3U66A 3CSTA 5AJDA 2R59A 3TGOA 2XRZA 4PH4B 3TL5A 4E85A 5CHEE 2L9BA 2XPIA 3CK7A 1HG2A 1W3BA 4GZ5A 2VSXE 1H0AA 5JJ7A 1WY6A 1FVHA 4E6HA 3E4BA 4AOFA 4G26A 4MS6A 4R7LA 5AJLA 5BUZA 2AWIA 3RO3A 1HH8A 3SI5A 3VLDA 2J49A 2C0MA 3MKRA 4XI9A 4RSYA 2CG2A 3DBSA 1JWGA 2VGYA 4PS3A 4HOUA 3CIAA 3S7FA 3ASHA 2J09A 3IV0A 2V5FA 4FP7A 4H7YA 2V0PA 2FF4A 2WM9A 3LVQE 3RRNB 4BTBA 3CVNA 2VGXA 4HS2A 4QFVA 3AS5A 3HYMB 4CEMA 2X6JA 3IHVA 3HHMA 3FUJA 4KZ0A 4UQYA 3R7RA 1H6KA 2VQ2A 3D9OA 4PDXA 3CK9A 4U8HA 2LSVA 1E7VA 4XIFA 4D10C 4AY6A 4CGWA 1IQUA 4KXKB 4MRUA 5JJTA 2VSYA 1XGWA 2AVPA 3LJ3A 4UQXA 5FJYA 4ILHB 4TUUA 3QOUA 3UT8A 1SZ9A 4G1TA 3GYZA 4N5CA 2XEVA 4I6JA 3ONKA 3ZVVA 5LFAA 3FEXA 3KAEA 3OTNA 3FU0A 4GYYA 5EDSA 3LKUA 3UQ3A 3N71A 4U0ZA 3TXMA 3RJVA 3CSFA 3FUNA 1E90A 2QY7A 4I1AA 5BW8C 4GZDA 2LAHA 4TV3A 1NZNA 5FZQA 3BEEA 4YVOA 3ASDA 4WNFA 3VTXA 2LAIA 5CCLA 3ONLA 1INZA 4KMOA 3ZYQA 2VTBA 3CVWA 3K9IA 4MKTA 1H2TC 1Y6IA 4J8SA 1FCHA 2GRMA 2FBNA 2AXZA 5EKQD 3LY8A 3APFA 2ZU6B 3PH0C 3Q47B 3JQ1A 3QK0A 1FVFA 2X6IA 3PDNA 1UJKA 4I2ZA 5T8IA 4CCAA 5J90A 2Y4UA 3FUFA 1HS6A 2X6HA 2WQ6A 2XHEA 3AS8A 3MV2B 3OXLA 3PRZA 4I17A 4C0EA 3CR3A 1Z3YA 2EQXA 5M72A 2YHEA 2A5UA 3BG0B 3ZXSA 1HE8A 1ZU2A 2V8SE 3CVYA 2WPVA 3CQGB 4GAAA 4B0ZA 2ILRA 5CMYA 4DLQA 5JHBA 3CV0A 4J6IA 4UQZA 3SNXA 4RG6A 3G2WA 2WXHA 2FO7A 3TG5A 5JHAA 1DNPA 4XX5A 4F7AA 4DK5A 1SZAA 4EBAG 5BT1A 2LO6A 3QAQA 5J08A 5A7DB 3ZYMA 3Q5MA 4N2SA 4JEHA 2PM7A 3D9LA 4G23A 3Q4AB 3ZGQA 1S0PA 3D9IA 3FWVA 5FZRA 3RKVA 3QC1A 4I6GA 3LXUX 3LCAA 4ACKA 3GZ2A 4JL0A 4GA0A 1EPUA 4JXTA 2R5SA 3FUHA 4B8CB 4J0UA 1NP7A 5HQ8A 2X3MA 3HIZA 3URZA 4CT4A 3I3NA 4Q96A 3CHRA 1ZBPA 3NZSA 4ME2A 3FTYA 1JWFA 4G24A 2MRIA 3TXNA 1E8XA 4L7TA 4U07A 2OOEA 4DPRA 3D9PA 4B8AA 2WXGA 4L1BA 3QKYA 2PL2A 3QWPA 4I1OB 2KC7A 3FU3A 4FJZA 4U04A 2CFZA 4K0RA 2VTBB 4LERA 1HX8A 2L0TB 5BNWA 4ANWA 3LPZA 4KYOB 1EDUA 2WVIA 5G55A 4XI0A 5ENNA 1Z6TA 3FUKA 1ELKA 1OWMA 2HR2A 4J8FA 3FTUA 3P1UA 2LNIA 4XE0A 4GYWA 2OV8A 2OVBA 3O48A 4TRQA 5FQ4A 3WXXA 3ZHEB 4A1GA 1HF8A 4UWHA 4DLOA 1HFAA 4N3CA 4O6FA 4CDRA 3VTYA 3DPDA 2X6KA 2Y3AA 2WXOA 2I2OA 2L6JA 5E75A 3PS6A 4JZYA 3EDTB 4RVBA 2CHZA 2AXVA 2J9QA 3IEGA 1QNFA 1UW4B 2X6FA 2YHCA 3EIJA 5FT9A 3B7RL 4ATGA 4RG9A 3OXFA 3ZEFA 4F3VA 2WMOA 4UWLA 5G2NA 3APCA 3MJWA 1LF8A 1KLXA 3L16A 3CHPA 4XZ4A 3R7QA 1TJCA 3NZUA 2DCPA 4ACLA 3CHOA 4NQ0A 4JHJA 1QZ2A 3NQPA 2I9CA 4ANXA 2AW6A 4BWRA 5BV0A 2J08A 4U63A 1H19A 3CKBA 4FA6A 4CDMA 2VJ8A 2DBAA 5AYWD 3MEKA 1E8ZA 3D9NA 3L22A 3SF4A 4AY5A 4I9CA 4C0MA 5BPPA 5D0OD 3UPVA 4GMLA 5ANLA 3Q49B 3L17A 4EZKA 1N52A 3L13A 2NSZA 1H2VC 4WWNA 3MKQA 4GMJA 2UY1B 4V3IA 3L54A 4JPSA 3EHMA 1QQEA 4FJYA 4GZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELK A;  1LF8 A;  1PY1 A;  1EYH A;  1UJK A;  3G2T A;  3ONK A;  4JXT A;  3RRU A;  3ZYK A;  4Q94 A;  2DCP A;  5CMW A;  3LDZ A;  1JPL A;  3ZYL A;  1HF8 A;  4Q96 A;  1HG2 A;  3D9K A;  4AVX A;  1HFA A;  2V8S E;  3G2U A;  1H0A A;  1JWF A;  1MHQ A;  2QY7 A;  4GZD A;  2KM4 A;  3CLJ A;  3G2V A;  3D9O A;  4FU3 A;  2L0I A;  5CMY A;  2BF0 X;  3D9N A;  5LOZ A;  3D9P A;  3G2W A;  3D9M A;  2DIW A;  3D9J A;  1JUQ A;  1UJJ A;  1X5B A;  4HFG A;  1DVP A;  4NAC A;  3ONL A;  1SZA A;  2MOW A;  3ZYQ A;  1VDY A;  1INZ A;  1HG5 A;  1XGW A;  2LO6 A;  5J08 A;  5LP0 A;  3ZYM A;  3G2S A;  1HX8 A;  2L0T B;  3D9L A;  1SZ9 A;  3D9I A;  1EDU A;  1JWG A;  4FLB A;  4GZC A; 
#chains in the Genus database with same CATH topology
 4WNE A;  5CRV A;  3FUM A;  4DI4 A;  1NA0 A;  3P2B A;  4N39 A;  3FH5 A;  3QWW A;  4DX1 A;  3G2U A;  4IYP A;  4FLH A;  3ULY A;  4PUC A;  3TWT A;  3SFZ A;  3CHS A;  3QNK A;  2Q7F A;  4KVO A;  4YDO A;  3FTS A;  2IQC A;  2NC9 A;  3UI2 A;  4BT8 A;  4M3O A;  4JA7 A;  3AS4 A;  4AXH A;  4I43 A;  1E96 B;  4I6E A;  2KM4 A;  3TJP A;  3EHQ A;  3Q15 A;  4GZ3 A;  3HXE A;  2OEW A;  4TXP A;  3FFL A;  3HVE A;  4BER A;  1A17 A;  2ZIR A;  1U3C A;  3MKQ B;  4PS8 A;  2XPZ A;  4I9E A;  4K03 A;  1KZO A;  5KJK A;  3T5X A;  4U8Y D;  3C3Q A;  1YCS B;  1SQM A;  1U3D A;  1HU3 A;  1K3Z D;  1LD7 A;  1ELW A;  3ZN3 A;  3DSU A;  2Y0B G;  4X8Q A;  3PNT B;  2WB2 A;  2H6H A;  3GW4 A;  2XS1 A;  3JYS A;  4GTM A;  1Q2Z A;  3LDZ A;  2IO3 C;  4GZ6 A;  5AQ9 A;  2XEN A;  4FU3 A;  2BKK B;  3U9W A;  2BUG A;  4AM9 A;  4DI3 A;  3ESL A;  3FDH A;  1UJJ A;  3IKO B;  4GA2 A;  5E76 A;  4M7C A;  3ZRH A;  1O1T A;  3ZIM A;  5EX3 A;  3QDN A;  4JHR A;  5C2Y A;  3T5V A;  1GW6 A;  2I1K A;  3BU8 A;  3FTV A;  2WXJ A;  1IKN D;  1PAQ A;  2RD0 A;  1N4Q A;  1H2U A;  3UT7 A;  3I4G A;  3S7B A;  1HXI A;  4N3B A;  1N94 A;  4G8K A;  3JXI A;  3MX3 A;  2DYR E;  5A23 A;  4W9R A;  3SD5 A;  4KT6 B;  3ML8 A;  4AVX A;  5LX8 A;  4UWG A;  5AQ7 A;  2OND A;  2ETB A;  1PY1 A;  1D8D A;  4WWO A;  4CZ2 D;  1SA4 A;  5G04 J;  2HO1 A;  1RZ4 A;  4U0U A;  4JA9 A;  2IU1 A;  2EIN E;  4YDY A;  2WQH A;  3DXM G;  1OCR E;  4L2Y A;  4FLB A;  3FU6 A;  4EQF A;  4WWP A;  4JVS A;  3TAX A;  3DEO A;  5FZS A;  3DEP A;  5KJM A;  4XKB A;  4AJW A;  5KBA A;  2XGS A;  4OVV A;  2OEV A;  3CKC A;  1YA0 A;  2R2L A;  3ASG A;  1Z3X A;  1HZ4 A;  4HNA D;  5FIO A;  3R9M A;  3B13 A;  3B7S A;  5T3R A;  3CVP A;  2XS8 A;  4RLY A;  3CVL A;  4ANU A;  3FEY A;  3QAR A;  2DIW A;  4ZFH A;  3KEZ A;  3U64 A;  2OCC E;  3FUL A;  3S7D A;  2A4Z A;  5AJD A;  3TWQ A;  2R59 A;  2XRZ A;  3NBN B;  2F8X K;  2XPI A;  3CK7 A;  4BSZ B;  3ZKJ A;  3E4B A;  3VLD A;  4LSZ E;  3MKR A;  4F1P A;  3CIA A;  3ASH A;  3IV0 A;  4FP7 A;  2WM9 A;  3CVN A;  3AG1 E;  5KNH D;  3HYM B;  4CEM A;  2X6J A;  3IHV A;  4KZ0 A;  1LD8 A;  4XIF A;  4D10 C;  1XGW A;  2AVP A;  4UQX A;  5FJY A;  3ZNG A;  3QOU A;  3UT8 A;  5AN8 A;  3GYZ A;  4N5C A;  5H7P A;  1TNZ A;  4GYY A;  3N71 A;  3TXM A;  2EIJ E;  2P9N G;  2F37 A;  1NZN A;  5FZQ A;  3BEE A;  4YVO A;  2P9L G;  4ZHB A;  3ZUV B;  3CVW A;  4J8S A;  1FCH A;  2GRM A;  2AXZ A;  3EU5 A;  5J90 A;  5T8I A;  1UJK A;  3DWL G;  3OXL A;  3BG0 B;  2ILR A;  4RG6 A;  1OCC E;  1SZA A;  3BUA A;  3QAQ A;  4JEH A;  3RKV A;  4GTV A;  4I6G A;  5AQB A;  3GZ2 A;  4JL0 A;  3SQV A;  3FUH A;  4B8C B;  4J0U A;  3HIZ A;  3I3N A;  1ZBP A;  3NZS A;  4ME2 A;  1MX2 A;  4G24 A;  2QYU A;  4HRL A;  2KC7 A;  3FU3 A;  4U04 A;  2VTB B;  1HX8 A;  2L0T B;  3LPZ A;  5G55 A;  3FUK A;  5FQ4 A;  4DLO A;  3WXX A;  1HF8 A;  3J5Q B;  4N3C A;  2ZXW E;  2H6I A;  5E75 A;  4JZY A;  3TWS A;  1TNY A;  1QNF A;  3EIJ A;  5FT9 A;  4ATG A;  3ZEF A;  1LF8 A;  1KLX A;  4ACL A;  3NAW A;  1BU9 A;  3NQP A;  2AW6 A;  2J08 A;  1E8Z A;  4AY5 A;  4C0M A;  2IY0 C;  5D0O D;  5ANL A;  3Q49 B;  4GMJ A;  2ETA A;  4V3I A;  4YDE A;  4FJY A;  4GZC A;  3UM2 A;  4Q94 A;  4H7X A;  4HOQ A;  3EIQ C;  3NF1 A;  4BSX A;  4EZJ A;  2IJG X;  3KD7 A;  1E7U A;  1WM5 A;  1TNB A;  3UUX A;  5BV1 A;  1G3N B;  4GTQ A;  1X5B A;  3ZYK A;  3ABM E;  1SA5 A;  4G2V A;  4DX2 A;  3PEV B;  4A1S A;  1MX4 A;  4ANV A;  3PZ4 A;  3G2T A;  3CQC B;  1MJ0 A;  4G25 A;  4K5C A;  1OWL A;  2BED A;  5D0Q D;  5LOZ A;  2GGF A;  3T9K A;  2NXP A;  2KCK A;  3HXB A;  1L5J A;  5KJL A;  2HM8 A;  2P9I G;  5ARG A;  2V4H C;  3E30 A;  3O4Z A;  2J8S D;  2FEZ A;  3JUI A;  5CMW A;  2ION A;  2C0L A;  3UKU G;  2KAT A;  2PM6 A;  3KEA A;  4FHJ A;  2PQR A;  4DX5 D;  3EU9 A;  5KWD A;  1DVP A;  4LNG A;  3PUJ A;  5LP0 A;  2WXK A;  1IYG A;  2J4B A;  3ISM C;  4FUL A;  3CHM A;  3V79 K;  2CFU A;  3IBE A;  2VGE A;  3EHN A;  3MGB A;  4K5B A;  4ABN A;  3CVX A;  1Y8M A;  3TG4 A;  2PZI A;  4BES A;  3RK6 A;  2XGM A;  4APO A;  2P58 C;  2R03 A;  3MA5 A;  3RRU A;  1UN8 A;  4U95 D;  1EF1 C;  2WXN A;  4A3V A;  4HVB A;  4GTS A;  3LYA A;  4HXI A;  4HI8 A;  3MV3 B;  5IY5 E;  3AG3 E;  4CDN A;  3ULE G;  1KT1 A;  2P9U G;  2YQ8 A;  3V30 A;  2I6H A;  2YNQ A;  1U2V G;  4BET A;  1JPL A;  1V54 E;  3IHY A;  4JC8 A;  1UN9 A;  4OVU A;  1OCO E;  3I5P A;  3CVU A;  4F1S A;  3JQ0 A;  5ENP D;  5EIB E;  1N54 A;  3DSX A;  3B7U X;  2KCL A;  3QWV A;  4LNB A;  1YYH A;  2B6C A;  3FUD A;  4BY6 A;  2GRL A;  2XPY A;  5KNG A;  2CHW A;  2WXI A;  4HFG A;  3JXJ A;  3MYV A;  3S7J A;  2WMN A;  1FT2 A;  1N4S A;  2GRP B;  5CED B;  2E0I A;  5FQ7 A;  1TJF A;  4AIF A;  2WXF A;  2PQN A;  1WDY A;  3ASO E;  5AAR A;  3ZW3 A;  4CGV A;  3AJI A;  3Q9N C;  2KZT B;  5G05 C;  2GRQ B;  4N5Q A;  3Q7F A;  2B0O E;  3JCK C;  4OYS A;  3RU0 A;  2X38 A;  3HDX A;  3L6A A;  4CT0 A;  2LUH A;  1K1A A;  3CGH A;  5C1D A;  4G8L A;  4LUN U;  3V31 A;  4Y6C A;  2JLB A;  1WAO 1;  4FC8 A;  3GZS A;  1ELR A;  4A55 A;  1X81 A;  5JJ6 A;  1TR4 A;  4NRH B;  3ESK A;  5BXO A;  3PZ1 A;  5CHE E;  2L9B A;  4GZ5 A;  5JJ7 A;  4E6H A;  1AWC B;  4AOF A;  3T8K A;  5AJL A;  5BUZ A;  1HH8 A;  4XI9 A;  3ZU7 B;  2CG2 A;  3DBS A;  2VGY A;  4PS3 A;  1OCZ E;  4HOU A;  3S7F A;  2V5F A;  4H7Y A;  2FF4 A;  1OXJ A;  4QFV A;  3DST A;  2QC9 A;  4TUM A;  4PDX A;  4U8H A;  2LSV A;  4CGW A;  1N95 A;  3LJ3 A;  4ILH B;  4TUU A;  3E37 A;  3WG7 E;  3ONK A;  3FEX A;  3KAE A;  5EDS A;  5CEA A;  4U0Z A;  3FUN A;  1E90 A;  4I1A A;  5BW8 C;  4OAU C;  1NL4 A;  3Q7A A;  3ZYQ A;  1WG0 A;  1H2T C;  1Y6I A;  5EKQ D;  3PH0 C;  3Q47 B;  3JQ1 A;  3QK0 A;  2X6I A;  4I2Z A;  2X6H A;  2WQ6 A;  1YMP A;  3MV2 B;  4HB5 A;  1SW6 A;  1Z3Y A;  2EQX A;  3SO8 A;  3UIP C;  2WPV A;  4B0Z A;  3CV0 A;  1MZC A;  4O1O A;  4F7A A;  5ENO D;  4EBA G;  5J08 A;  3Q5M A;  4N2S A;  2R05 A;  2DZN A;  2PM7 A;  3D9L A;  1IHB A;  2XZD G;  3Q4A B;  3FWV A;  3LXU X;  3LCA A;  4ACK A;  4GA0 A;  4JXT A;  2DWZ A;  2X3M A;  3URZ A;  4Q96 A;  3CHR A;  3UM3 A;  4GMR A;  4L7T A;  4U07 A;  4HI9 A;  3D9P A;  1N4P A;  2PL2 A;  3QWP A;  1H6O A;  2CFZ A;  4K0R A;  5BNW A;  2WVI A;  1OWM A;  2EIM E;  4GYW A;  3SY2 A;  3O48 A;  1QBQ A;  4TRQ A;  4TXQ A;  1N9A A;  2GRR B;  2IEJ A;  5EN5 D;  2Y3A A;  2L6J A;  3PS6 A;  2CHZ A;  1IXV A;  2ETC A;  2J9Q A;  2X6F A;  3DXK G;  5G2N A;  3MJW A;  1NI1 A;  3R7Q A;  1TJC A;  1LTX A;  5BV0 A;  3C72 A;  3CKB A;  4FA6 A;  3L22 A;  3SF4 A;  4I9C A;  5BPP A;  4GML A;  2KXP C;  3L17 A;  3MKQ A;  3EHM A;  4NIK A;  1QQE A;  4L2L A;  2H6F A;  3UIN C;  3HG0 D;  4B89 A;  4JD2 G;  4HLE A;  1O5M A;  4HRM B;  1E8W A;  2GW1 A;  2RG8 A;  4WAF A;  1S70 B;  2EIK E;  4J8D A;  1JCR A;  3LVR E;  3FP3 A;  3FTX A;  3L82 A;  2FUL A;  3ZHE A;  4JB8 P;  5HS0 A;  3FHE A;  4EEC A;  1NA3 A;  3LY9 A;  2V4L A;  4ILI A;  5AQA A;  3EJN A;  2MOW A;  3AG2 E;  1IHG A;  1O1S A;  2IF4 A;  1Z5S C;  4C9B B;  4F6R D;  1P5Q A;  1HO8 A;  3IXE A;  4GTT A;  3ZYL A;  4HOS A;  4LNU D;  5JMN D;  3CK8 A;  4BX9 A;  2C2L A;  4G11 A;  4IRU A;  4KBQ A;  3G2S A;  2J07 A;  2BTD A;  2GRO B;  3R9A B;  2UY1 A;  3KSQ A;  3UKR G;  1OWP A;  2RKK A;  5FWQ A;  3UIO C;  4GCN A;  3FH7 A;  3UMV A;  4BFR A;  3UXG A;  3LY7 A;  2AXU A;  3UT4 A;  4LG6 A;  4L23 A;  3E32 A;  2LXL A;  3HVE B;  3CVQ A;  4AEZ C;  1V55 E;  4LRZ A;  4EBA A;  4PS7 A;  1N4R A;  3D9K A;  2HYZ A;  2BKG A;  2IOS A;  5KJN A;  1NFI E;  4ILG A;  2QYJ A;  3BG1 B;  4BT9 A;  4FHK A;  4KVM A;  5T4Y A;  1FT1 A;  1HG5 A;  4GTP A;  4XEI G;  3L08 A;  2DYS E;  4A3T A;  2LSU A;  4GU5 A;  5FTP A;  5AEN A;  4UI9 K;  4GTR A;  4GPM A;  3ABL E;  4BX8 A;  2L6B A;  2WXL A;  3CHQ A;  2KCV A;  5FQ6 A;  3FUE A;  1TEZ A;  2OVF A;  2IFU A;  5FQ8 A;  2R02 A;  3TWV A;  2R17 C;  4DJA A;  3SBS A;  4WND A;  4URK A;  2M63 A;  3RO2 A;  4Y6W A;  3RRM B;  2NYJ A;  5DIZ A;  2XEH A;  4J8E A;  3FH8 A;  3KS2 A;  4NUR A;  5CRU A;  1IQR A;  1K8K G;  4U0S A;  2AJA A;  4JHK A;  2LXM A;  5HKP A;  4IUL A;  3PZ3 A;  1MHQ A;  5LCW C;  5G05 J;  5D2M C;  4F53 A;  5A6C A;  3B7T A;  3S2A A;  5HI7 A;  5ENS D;  4U7E B;  5HRY A;  4I2W A;  2IOL A;  4N3A A;  3ASN E;  3SZ7 A;  4DRX E;  4CRW A;  5FIN A;  2UWJ G;  4GA1 A;  4Q69 A;  2L0I A;  3V2X A;  3HXD A;  3SGH A;  3FY4 A;  2Y4T A;  4UI9 C;  4QQI A;  3TGO A;  3W9G A;  4E85 A;  1HG2 A;  1W3B A;  2VSX E;  1H0A A;  1KZP A;  3DSV A;  1WY6 A;  1FVH A;  4MS6 A;  4R7L A;  3DRA A;  5ENQ D;  3RO3 A;  3SI5 A;  3J5P A;  4RSY A;  1JWG A;  2J09 A;  3LVQ E;  2VGX A;  4HS2 A;  3HHM A;  1BI7 B;  3R7R A;  1H6K A;  3D9O A;  3CK9 A;  2ZIS A;  3LJN A;  1IQU A;  1OY3 D;  4KXK B;  5JJT A;  2VSY A;  1RW2 A;  1SZ9 A;  4G1T A;  2XEV A;  3ZVV A;  1KPS B;  3LKU A;  3UQ3 A;  3TWW A;  2QY7 A;  4GZD A;  2LAI A;  2VTB A;  3K9I A;  4MKT A;  2FBN A;  3APF A;  2ZU6 B;  1FVF A;  3PDN A;  4L9P A;  2P9P G;  3AS8 A;  4I17 A;  3UTM A;  5M72 A;  2A5U A;  3ZXS A;  2V8S E;  3CVY A;  5EYL A;  3CQG B;  4GAA A;  4DLQ A;  5JHB A;  4J6I A;  4UQZ A;  3SNX A;  3G2W A;  3TG5 A;  5JHA A;  1DNP A;  5BT1 A;  2LO6 A;  5A7D B;  3ZYM A;  3UM1 A;  3QC1 A;  5AAO A;  2R5S A;  1NP7 A;  5HQ8 A;  4EHM A;  4CT4 A;  1JWF A;  2MRI A;  3TXN A;  5EID A;  2OOE A;  1SVX A;  4B8A A;  2WXG A;  4L1B A;  1JCS A;  2DZO A;  4LER A;  1FPP A;  4J8Y A;  1S64 A;  1EDU A;  3HXF A;  2HR2 A;  4J8F A;  2Y1L E;  2LNI A;  5B1B E;  4XE0 A;  2OVB A;  3ZHE B;  3EHR A;  3AAA C;  4UWH A;  1TYQ G;  1HFA A;  4CDR A;  4HBD A;  3DPD A;  2X6K A;  2PNN A;  2WXO A;  2I2O A;  3EDT B;  4RVB A;  2AXV A;  5BXU A;  1UW4 B;  2YHC A;  3DSW A;  3B7R L;  4UWL A;  2HE0 A;  3SFX A;  3APC A;  2XZT G;  3L16 A;  4XZ4 A;  3NZU A;  2DCP A;  3CHO A;  1QZ2 A;  4ANX A;  4U63 A;  2VJ8 A;  2DBA A;  3V2O A;  3C3R A;  1D8E A;  1N52 A;  2NSZ A;  4WWN A;  2V5Q C;  1BLX B;  2UY1 B;  3L54 A;  2WXP A;  2XRY A;  3GZ1 A;  3UX4 A;  3PE3 A;  1OWO A;  2WXM A;  1UOH A;  2VSN A;  3MZL B;  4HOR A;  1S63 A;  4I1M A;  2QFC A;  2I1J A;  4DX6 D;  3FTW A;  1N11 A;  3CEQ A;  1TN7 A;  1TNO A;  2BF0 X;  4YND A;  4UWK A;  5ANR A;  3UM0 A;  4YVQ C;  1PC2 A;  2E2E A;  4APF A;  2XCC A;  4U96 D;  3FTZ A;  3ENE A;  4JW1 A;  4LCT A;  3NOG D;  3VLF A;  4XKC A;  3G2V A;  4GCO A;  1BPO A;  1BI8 B;  2A5E A;  1O1R A;  2YIN A;  4GB9 A;  1VDY A;  1OUV A;  2RFM A;  4B93 B;  1MQS A;  1UG3 A;  1MX6 A;  3NB2 A;  3U3W A;  2J4D A;  4JEU A;  3AU5 A;  2GRN B;  2H6G A;  3D3M A;  4IN3 B;  3PUK A;  4MBG A;  5DBK A;  4WNG A;  3D9J A;  1B89 A;  2DVW A;  3E34 A;  3PRE A;  5CEC B;  5AIJ A;  4OAV B;  1E8Y A;  1OWN A;  3ABK E;  3FUI A;  3L9T A;  3PVL A;  4UUC A;  5CER B;  3OAW A;  3VLE A;  4B94 A;  2KBX A;  2JAB A;  5EIL A;  4LEU A;  3APD A;  1TN8 A;  3D9M A;  5CBN A;  4WUY A;  5CCM A;  3AG4 E;  2FI7 A;  3ZPJ A;  1XNF A;  5B3S E;  1BD8 A;  4AP2 A;  4BTA A;  3RIB A;  3LS8 A;  4J7W A;  1TNU A;  3QJZ A;  4HOT A;  2MHK A;  4MLP A;  2KZT A;  2WXQ A;  5EYP F;  2VYI A;  3Q78 A;  3FU5 A;  3PZD A;  4EZL A;  2EIL E;  3CVV A;  3I4R B;  3HRA A;  3ML9 A;  4N2Q A;  3PEU B;  3DPY A;  4UWF A;  5G04 C;  1A5E A;  2P2C P;  3SBT B;  2RFA A;  3Q75 A;  3ULQ A;  2JEK A;  4P29 A;  1JUQ A;  3MCX A;  4FAD A;  2VSO E;  4ATZ D;  4AV7 A;  5EX0 A;  3ASF A;  5CBO A;  1EYH A;  1KT0 A;  4GPK A;  3ZFW A;  3LEW A;  1DC2 A;  2VGX B;  3AU4 A;  4K5A B;  2WXR A;  3SHF A;  5LCW J;  1N0Q A;  3C98 A;  2CHX A;  3T8M A;  3OXG A;  2WQ7 A;  1K1B A;  4KZC A;  5ARF A;  1MYO A;  4GYO A;  2P9K G;  2XCB A;  2CG3 A;  3PE4 A;  4EPZ A;  3F6Q A;  2XGO A;  2XQ0 A;  3CLJ A;  3PNL B;  1TN6 A;  5KCM A;  3QB2 A;  3ZXP A;  4NAC A;  3NOC D;  3U4T A;  1ZB1 A;  4UI9 J;  3U66 A;  3CST A;  2QZA A;  1JCQ A;  4PH4 B;  5ENT D;  3TL5 A;  2XEE A;  4A63 B;  4G26 A;  2AWI A;  4HQD A;  3Q79 A;  2J49 A;  2C0M A;  3EUV A;  2P9S G;  4C48 B;  3B7B A;  4TXR A;  2V0P A;  4BTB A;  3RRN B;  3AS5 A;  3PZ2 A;  3FUJ A;  4UQY A;  2VQ2 A;  1E7V A;  3C5R A;  4AY6 A;  3E33 A;  4MRU A;  5B1A E;  4HRN A;  4I6J A;  5LFA A;  3OTN A;  3FU0 A;  4O60 A;  4HLL A;  2F8Y A;  3RJV A;  3CSF A;  4DUI A;  4TV3 A;  2LAH A;  5ENR D;  4BEP A;  3ASD A;  4WNF A;  3VTX A;  5CCL A;  3ONL A;  1INZ A;  4KMO A;  3SFY A;  3LY8 A;  3KSL A;  4CCA A;  2Y4U A;  3FUF A;  1HS6 A;  2XHE A;  3PRZ A;  4C0E A;  3CR3 A;  2YHE A;  1D9S A;  1HE8 A;  1ZU2 A;  3BQO A;  4DX7 D;  3B95 A;  5CMY A;  4RQI A;  4O1P A;  2WXH A;  2FO7 A;  5D66 A;  4XX5 A;  4DK5 A;  3TWU A;  3ZGQ A;  4G23 A;  1S0P A;  3D9I A;  5FZR A;  1QYM A;  1H6P A;  1EPU A;  1DCE A;  3TWX A;  2ZGG A;  3X2Q E;  3FTY A;  4CYM D;  1E8X A;  3Q73 A;  1OT8 A;  4DPR A;  3QKY A;  4I1O B;  2ZGD A;  3D9H A;  4FJZ A;  1AP7 A;  4ANW A;  4KYO B;  4XI0 A;  5ENN A;  1Z6T A;  1ELK A;  3FTU A;  3JUE A;  3P1U A;  3C3O A;  5JA4 D;  4GTO A;  4A1G A;  2OV8 A;  4O6F A;  3VTY A;  4Z68 A;  2FO1 E;  3DSS A;  3IEG A;  4F3V A;  5ITZ F;  4RG9 A;  3OXF A;  1DCQ A;  2WMO A;  2IO2 C;  2F0Y A;  3RSE G;  3CHP A;  4YDW A;  3TWR A;  4NQ0 A;  4JHJ A;  2I9C A;  2MYO A;  3HXC A;  4BWR A;  1H19 A;  2Y69 E;  4U8V D;  4CDM A;  5AYW D;  3MEK A;  3D9N A;  1N0R A;  3UPV A;  3Q9U C;  3W9F A;  4EZK A;  3L13 A;  1H2V C;  3RAU A;  4JPS A; 
#chains in the Genus database with same CATH homology
 2WXP A;  4WNE A;  3FUM A;  4Q94 A;  4L2L A;  2XRY A;  4DI4 A;  1NA0 A;  4H7X A;  3P2B A;  3GZ1 A;  4HOQ A;  4N39 A;  3EIQ C;  3FH5 A;  3NF1 A;  3UX4 A;  4BSX A;  3PE3 A;  4EZJ A;  3QWW A;  3G2U A;  4IYP A;  1OWO A;  2WXM A;  4FLH A;  2IJG X;  3KD7 A;  1E7U A;  4PUC A;  1WM5 A;  3UUX A;  4B89 A;  5BV1 A;  4HLE A;  3SFZ A;  1X5B A;  3ZYK A;  3CHS A;  2VSN A;  1E8W A;  2GW1 A;  3QNK A;  2Q7F A;  4G2V A;  2RG8 A;  3PEV B;  4KVO A;  4WAF A;  3FTS A;  4A1S A;  2IQC A;  2NC9 A;  3MZL B;  4ANV A;  4BT8 A;  4HOR A;  3G2T A;  4I1M A;  4J8D A;  3CQC B;  4M3O A;  4JA7 A;  3LVR E;  3FP3 A;  3FTX A;  2QFC A;  2FUL A;  3AS4 A;  2I1J A;  3ZHE A;  4AXH A;  4G25 A;  4I43 A;  1E96 B;  3FTW A;  1OWL A;  3FHE A;  3CEQ A;  4I6E A;  2KM4 A;  5D0Q D;  3TJP A;  4EEC A;  3Q15 A;  4GZ3 A;  2BF0 X;  4YND A;  1NA3 A;  4UWK A;  5LOZ A;  2GGF A;  3LY9 A;  2NXP A;  2V4L A;  5ANR A;  2KCK A;  4ILI A;  3EJN A;  2MOW A;  1L5J A;  4YVQ C;  5KJL A;  1IHG A;  2HM8 A;  1PC2 A;  3FFL A;  3HVE A;  2E2E A;  4APF A;  5ARG A;  2XCC A;  1A17 A;  1U3C A;  3O4Z A;  3MKQ B;  4PS8 A;  2IF4 A;  2XPZ A;  4I9E A;  4K03 A;  2FEZ A;  3JUI A;  5KJK A;  3FTZ A;  3T5X A;  3ENE A;  4C9B B;  5CMW A;  1P5Q A;  4JW1 A;  1HO8 A;  2ION A;  1SQM A;  2C0L A;  1U3D A;  1HU3 A;  4LCT A;  3ZYL A;  4HOS A;  2KAT A;  3VLF A;  2PM6 A;  4FHJ A;  1ELW A;  4XKC A;  3ZN3 A;  3CK8 A;  2PQR A;  3G2V A;  1BPO A;  4GCO A;  4BX9 A;  2C2L A;  2YIN A;  1DVP A;  4GB9 A;  1VDY A;  1OUV A;  4G11 A;  3PNT B;  3PUJ A;  5LP0 A;  4IRU A;  2WXK A;  4KBQ A;  3G2S A;  2J07 A;  2BTD A;  2WB2 A;  3R9A B;  1IYG A;  2UY1 A;  1MQS A;  3GW4 A;  2J4B A;  1UG3 A;  4FUL A;  3JYS A;  3CHM A;  1OWP A;  3U3W A;  2J4D A;  3LDZ A;  4JEU A;  5FWQ A;  3AU5 A;  2CFU A;  3D3M A;  3IBE A;  4IN3 B;  4GCN A;  3FH7 A;  3EHN A;  3UMV A;  4GZ6 A;  4BFR A;  3MGB A;  3LY7 A;  4FU3 A;  2AXU A;  4ABN A;  3PUK A;  3CVX A;  3U9W A;  4AM9 A;  2BUG A;  1Y8M A;  5DBK A;  3ESL A;  3UT4 A;  4DI3 A;  3TG4 A;  4WNG A;  3D9J A;  3FDH A;  1B89 A;  1UJJ A;  3IKO B;  2PZI A;  3PRE A;  4GA2 A;  4L23 A;  5E76 A;  3RK6 A;  5AIJ A;  1E8Y A;  1OWN A;  2XGM A;  3FUI A;  3HVE B;  3CVQ A;  3PVL A;  4AEZ C;  3ZRH A;  4APO A;  2P58 C;  3OAW A;  3VLE A;  4B94 A;  3ZIM A;  4LRZ A;  5EX3 A;  4EBA A;  3QDN A;  3MA5 A;  3RRU A;  4LEU A;  4PS7 A;  1UN8 A;  3APD A;  4JHR A;  1EF1 C;  2WXN A;  5C2Y A;  4A3V A;  3T5V A;  1GW6 A;  3D9K A;  4HVB A;  2HYZ A;  2I1K A;  3FTV A;  2IOS A;  3LYA A;  5KJN A;  2WXJ A;  4HXI A;  3MV3 B;  4ILG A;  3BG1 B;  4BT9 A;  3D9M A;  4WUY A;  4FHK A;  4CDN A;  5CCM A;  1PAQ A;  1KT1 A;  4KVM A;  5T4Y A;  1HG5 A;  2FI7 A;  2RD0 A;  3ZPJ A;  1H2U A;  3L08 A;  1XNF A;  2YQ8 A;  3UT7 A;  3I4G A;  4A3T A;  3S7B A;  2LSU A;  4AP2 A;  4GU5 A;  5FTP A;  2I6H A;  5AEN A;  4UI9 K;  4BTA A;  1HXI A;  2YNQ A;  3RIB A;  4N3B A;  3LS8 A;  3MX3 A;  1JPL A;  3QJZ A;  4BX8 A;  4HOT A;  2MHK A;  4MLP A;  2WXL A;  3IHY A;  5A23 A;  3CHQ A;  2KZT A;  4JC8 A;  1UN9 A;  2WXQ A;  2KCV A;  4W9R A;  2VYI A;  4OVU A;  5FQ6 A;  3I5P A;  3CVU A;  3SD5 A;  3FUE A;  1TEZ A;  4KT6 B;  2OVF A;  3ML8 A;  4AVX A;  4F1S A;  3FU5 A;  2IFU A;  5FQ8 A;  3PZD A;  2R17 C;  5LX8 A;  3JQ0 A;  4UWG A;  4DJA A;  2OND A;  3SBS A;  4EZL A;  4WND A;  3CVV A;  4URK A;  1N54 A;  2M63 A;  1PY1 A;  4Y6W A;  3RO2 A;  3B7U X;  3I4R B;  4WWO A;  3RRM B;  3ML9 A;  2KCL A;  4N2Q A;  3PEU B;  3QWV A;  5DIZ A;  4UWF A;  5G04 C;  3FUD A;  5G04 J;  4BY6 A;  2HO1 A;  4J8E A;  4U0U A;  3FH8 A;  2GRL A;  2XPY A;  3KS2 A;  4NUR A;  3SBT B;  4JA9 A;  3ULQ A;  2IU1 A;  2JEK A;  1IQR A;  2CHW A;  2WXI A;  4P29 A;  1JUQ A;  4HFG A;  3MYV A;  3S7J A;  2WQH A;  3MCX A;  4FAD A;  2VSO E;  4U0S A;  4AV7 A;  5EX0 A;  2WMN A;  4L2Y A;  3ASF A;  4FLB A;  4JHK A;  3FU6 A;  1EYH A;  4EQF A;  2E0I A;  5FQ7 A;  1TJF A;  4WWP A;  1KT0 A;  4GPK A;  3ZFW A;  4AIF A;  4JVS A;  3LEW A;  4IUL A;  2VGX B;  5FZS A;  3TAX A;  3AU4 A;  2WXF A;  2PQN A;  4CGV A;  3ZW3 A;  5KJM A;  2WXR A;  3SHF A;  1MHQ A;  4XKB A;  4AJW A;  2KZT B;  5LCW C;  5G05 C;  5LCW J;  5G05 J;  2XGS A;  4OVV A;  4OYS A;  3C98 A;  2CHX A;  3JCK C;  4F53 A;  3RU0 A;  3CKC A;  5A6C A;  3T8M A;  2X38 A;  3B7T A;  3OXG A;  2WQ7 A;  3HDX A;  3L6A A;  4CT0 A;  3S2A A;  5HI7 A;  1YA0 A;  4KZC A;  3ASG A;  3CGH A;  5ARF A;  5C1D A;  1Z3X A;  4GYO A;  4LUN U;  1HZ4 A;  2IOL A;  4I2W A;  4N3A A;  2XCB A;  2CG3 A;  3B13 A;  3SZ7 A;  3PE4 A;  4Y6C A;  2JLB A;  3B7S A;  5T3R A;  3CVP A;  4EPZ A;  1WAO 1;  4FC8 A;  4CRW A;  3GZS A;  2XGO A;  2UWJ G;  1ELR A;  4GA1 A;  2XQ0 A;  4Q69 A;  3CLJ A;  3CVL A;  2L0I A;  3PNL B;  4ANU A;  5KCM A;  3FEY A;  3SGH A;  3QB2 A;  3FY4 A;  3QAR A;  2DIW A;  4A55 A;  4NAC A;  2Y4T A;  3U4T A;  5JJ6 A;  4UI9 C;  4UI9 J;  3KEZ A;  4NRH B;  3U64 A;  3FUL A;  3ESK A;  3S7D A;  2A4Z A;  3U66 A;  3CST A;  5AJD A;  2R59 A;  3TGO A;  2XRZ A;  4PH4 B;  3TL5 A;  4E85 A;  5CHE E;  2L9B A;  2XPI A;  3CK7 A;  1HG2 A;  1W3B A;  4GZ5 A;  2VSX E;  1H0A A;  5JJ7 A;  1WY6 A;  1FVH A;  4E6H A;  3E4B A;  4AOF A;  4G26 A;  4MS6 A;  4R7L A;  5AJL A;  5BUZ A;  2AWI A;  3RO3 A;  1HH8 A;  3SI5 A;  3VLD A;  2J49 A;  2C0M A;  3MKR A;  4XI9 A;  4RSY A;  2CG2 A;  3DBS A;  1JWG A;  2VGY A;  4PS3 A;  4HOU A;  3CIA A;  3S7F A;  3ASH A;  2J09 A;  3IV0 A;  2V5F A;  4FP7 A;  4H7Y A;  2V0P A;  2FF4 A;  2WM9 A;  3LVQ E;  3RRN B;  4BTB A;  3CVN A;  2VGX A;  4HS2 A;  4QFV A;  3AS5 A;  3HYM B;  4CEM A;  2X6J A;  3IHV A;  3HHM A;  3FUJ A;  4KZ0 A;  4UQY A;  3R7R A;  1H6K A;  2VQ2 A;  3D9O A;  4PDX A;  3CK9 A;  4U8H A;  2LSV A;  1E7V A;  4XIF A;  4D10 C;  4AY6 A;  4CGW A;  1IQU A;  4KXK B;  4MRU A;  5JJT A;  2VSY A;  1XGW A;  2AVP A;  3LJ3 A;  4UQX A;  5FJY A;  4ILH B;  4TUU A;  3QOU A;  3UT8 A;  1SZ9 A;  4G1T A;  3GYZ A;  4N5C A;  2XEV A;  4I6J A;  3ONK A;  3ZVV A;  5LFA A;  3FEX A;  3KAE A;  3OTN A;  3FU0 A;  4GYY A;  5EDS A;  3LKU A;  3UQ3 A;  3N71 A;  4U0Z A;  3TXM A;  3RJV A;  3CSF A;  3FUN A;  1E90 A;  2QY7 A;  4I1A A;  5BW8 C;  4GZD A;  2LAH A;  4TV3 A;  1NZN A;  5FZQ A;  3BEE A;  4YVO A;  3ASD A;  4WNF A;  3VTX A;  2LAI A;  5CCL A;  3ONL A;  1INZ A;  4KMO A;  3ZYQ A;  2VTB A;  3CVW A;  3K9I A;  4MKT A;  1H2T C;  1Y6I A;  4J8S A;  1FCH A;  2GRM A;  2FBN A;  2AXZ A;  5EKQ D;  3LY8 A;  3APF A;  2ZU6 B;  3PH0 C;  3Q47 B;  3JQ1 A;  3QK0 A;  1FVF A;  2X6I A;  3PDN A;  1UJK A;  4I2Z A;  5T8I A;  4CCA A;  5J90 A;  2Y4U A;  3FUF A;  1HS6 A;  2X6H A;  2WQ6 A;  2XHE A;  3AS8 A;  3MV2 B;  3OXL A;  3PRZ A;  4I17 A;  4C0E A;  3CR3 A;  1Z3Y A;  2EQX A;  5M72 A;  2YHE A;  2A5U A;  3BG0 B;  3ZXS A;  1HE8 A;  1ZU2 A;  2V8S E;  3CVY A;  2WPV A;  3CQG B;  4GAA A;  4B0Z A;  2ILR A;  5CMY A;  4DLQ A;  5JHB A;  3CV0 A;  4J6I A;  4UQZ A;  3SNX A;  4RG6 A;  3G2W A;  2WXH A;  2FO7 A;  3TG5 A;  5JHA A;  1DNP A;  4XX5 A;  4F7A A;  4DK5 A;  1SZA A;  4EBA G;  5BT1 A;  2LO6 A;  3QAQ A;  5J08 A;  5A7D B;  3ZYM A;  3Q5M A;  4N2S A;  4JEH A;  2PM7 A;  3D9L A;  4G23 A;  3Q4A B;  3ZGQ A;  1S0P A;  3D9I A;  3FWV A;  5FZR A;  3RKV A;  3QC1 A;  4I6G A;  3LXU X;  3LCA A;  4ACK A;  3GZ2 A;  4JL0 A;  4GA0 A;  1EPU A;  4JXT A;  2R5S A;  3FUH A;  4B8C B;  4J0U A;  1NP7 A;  5HQ8 A;  2X3M A;  3HIZ A;  3URZ A;  4CT4 A;  3I3N A;  4Q96 A;  3CHR A;  1ZBP A;  3NZS A;  4ME2 A;  3FTY A;  1JWF A;  4G24 A;  2MRI A;  3TXN A;  1E8X A;  4L7T A;  4U07 A;  2OOE A;  4DPR A;  3D9P A;  4B8A A;  2WXG A;  4L1B A;  3QKY A;  2PL2 A;  3QWP A;  4I1O B;  2KC7 A;  3FU3 A;  4FJZ A;  4U04 A;  2CFZ A;  4K0R A;  2VTB B;  4LER A;  1HX8 A;  2L0T B;  5BNW A;  4ANW A;  3LPZ A;  4KYO B;  1EDU A;  2WVI A;  5G55 A;  4XI0 A;  5ENN A;  1Z6T A;  3FUK A;  1ELK A;  1OWM A;  2HR2 A;  4J8F A;  3FTU A;  3P1U A;  2LNI A;  4XE0 A;  4GYW A;  2OV8 A;  2OVB A;  3O48 A;  4TRQ A;  5FQ4 A;  3WXX A;  3ZHE B;  4A1G A;  1HF8 A;  4UWH A;  4DLO A;  1HFA A;  4N3C A;  4O6F A;  4CDR A;  3VTY A;  3DPD A;  2X6K A;  2Y3A A;  2WXO A;  2I2O A;  2L6J A;  5E75 A;  3PS6 A;  4JZY A;  3EDT B;  4RVB A;  2CHZ A;  2AXV A;  2J9Q A;  3IEG A;  1QNF A;  1UW4 B;  2X6F A;  2YHC A;  3EIJ A;  5FT9 A;  3B7R L;  4ATG A;  4RG9 A;  3OXF A;  3ZEF A;  4F3V A;  2WMO A;  4UWL A;  5G2N A;  3APC A;  3MJW A;  1LF8 A;  1KLX A;  3L16 A;  3CHP A;  4XZ4 A;  3R7Q A;  1TJC A;  3NZU A;  2DCP A;  4ACL A;  3CHO A;  4NQ0 A;  4JHJ A;  1QZ2 A;  3NQP A;  2I9C A;  4ANX A;  2AW6 A;  4BWR A;  5BV0 A;  2J08 A;  4U63 A;  1H19 A;  3CKB A;  4FA6 A;  4CDM A;  2VJ8 A;  2DBA A;  5AYW D;  3MEK A;  1E8Z A;  3D9N A;  3L22 A;  3SF4 A;  4AY5 A;  4I9C A;  4C0M A;  5BPP A;  5D0O D;  3UPV A;  4GML A;  5ANL A;  3Q49 B;  3L17 A;  4EZK A;  1N52 A;  3L13 A;  2NSZ A;  1H2V C;  4WWN A;  3MKQ A;  4GMJ A;  2UY1 B;  4V3I A;  3L54 A;  4JPS A;  3EHM A;  1QQE A;  4FJY A;  4GZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...