1VDYA

Nmr structure of the hypothetical enth-vhs domain at3g16270 from arabidopsis thaliana
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
140
structure length
140
Chain Sequence
GSSGSSGESYWRSRMIDAVTSDEDKVAPVYKLEEICDLLRSSHVSIVKEFSEFILKRLDNKSPIVKQKALRLIKYAVGKSGSEFRREMQRNSVAVRNLFHYKGHPDPLKGDALNKAVRETAHETISAIFSEENGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein (RAFL09-17-B18)
publication title Solution structure of the hypothetical ENTH-VHS domain AT3G16270 from arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
total genus 40
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2004-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1vdyA00
2DIWA 4GZCA 1HG5A 1HF8A 1JWFA 3D9IA 1XGWA 3ZYMA 4JXTA 1UJJA 1X5BA 3G2VA 4FU3A 4HFGA 5LOZA 4GZDA 1EDUA 3D9MA 1HX8A 5CMYA 1EYHA 3G2UA 3G2SA 1SZ9A 1JPLA 4AVXA 1UJKA 2QY7A 3D9OA 2L0IA 5LP0A 3ZYLA 3G2WA 3G2TA 3D9LA 2BF0X 2LO6A 5CMWA 2DCPA 1MHQA 1HG2A 2V8SE 4FLBA 1DVPA 3D9KA 2L0TB 4Q96A 1JWGA 1INZA 3ONKA 1VDYA 3RRUA 2KM4A 3D9JA 3D9NA 1JUQA 3D9PA 1HFAA 4NACA 3ONLA 3ZYQA 3ZYKA 1SZAA 1PY1A 3CLJA 4Q94A 5J08A 1LF8A 2MOWA 1H0AA 3LDZA 1ELKA
chains in the Genus database with same CATH superfamily
4YNDA 4A3TA 1E8YA 3ASGA 4GTVA 3KSQA 2P58C 4J8YA 4GMJA 5ITZF 1N0QA 2OEVA 4V3IA 4GU5A 3CKCA 5EYLA 4JHRA 3LVRE 4K5BA 2WMOA 5J08A 4DX6D 1H6OA 3C3QA 3AG2E 3CK9A 5KJKA 1K1BA 1V55E 4HQDA 1WM5A 3L16A 3HVEB 4B8CB 3X2QE 4BSXA 3KSLA 2JABA 3TL5A 3SQVA 2F0YA 3S7FA 2I1JA 4DI3A 1E8XA 4I9EA 4HOTA 1OXJA 1SA5A 3QOUA 4GPKA 1Z5SC 3WXXA 1D8DA 3PE4A 4RVBA 2WM9A 2BEDA 3AU5A 4KMOA 4YDYA 4QQIA 3ABKE 3D9NA 4O60A 4JC8A 4XI9A 4HRLA 3C98A 5ENNA 3AS5A 2Y0BG 5EILA 2C0LA 3FUMA 4CDNA 1JPLA 2NXPA 2VGXB 3TWRA 1HH8A 3BG0B 1DVPA 3CHQA 5BPPA 1N94A 2WXRA 4XEIG 1OWOA 4M7CA 4K5CA 3SGHA 3FEXA 4G11A 4J0UA 3P2BA 4U04A 2P9SG 1NA0A 4KVOA 4RQIA 3LKUA 3OXGA 4HLEA 3JCKC 4JXTA 2WVIA 5BNWA 3GZ1A 2P2CP 4EHMA 3RO2A 3E34A 1K8KG 4GB9A 5B1AE 5EX0A 3E32A 3DPDA 3SY2A 5T8IA 2J08A 4WNGA 2WXLA 2IY0C 2KATA 3QC1A 3CEQA 1ELKA 2IOSA 3ZPJA 3FH5A 1KT0A 1SVXA 2A5EA 1FPPA 3TG5A 1BU9A 5G04C 1OWNA 1LD7A 2JEKA 4KVMA 3QWPA 2XPYA 3B7UX 3KS2A 2XS1A 2I6HA 4U0UA 3CHSA 4DX1A 3J5QB 1H0AA 3GW4A 3UI2A 4CGWA 3E30A 5CBOA 3SFYA 2ETAA 5BUZA 3FUDA 3LXUX 4FA6A 5AQBA 4BEPA 1FVFA 4DRXE 4LG6A 4I9CA 2V5FA 4Q96A 3FU3A 5KBAA 1LF8A 4WNFA 2X6JA 4BESA 4DX5D 3FUHA 4GPMA 5A23A 1TN6A 4HS2A 3UT8A 3ABME 4FLHA 2Y69E 3SHFA 3MGBA 2XENA 3ASFA 1P5QA 3DSUA 3UXGA 1TNBA 2JLBA 2FO1E 1QZ2A 3AS4A 1OCZE 3UKRG 2QFCA 4WWPA 2OCCE 2ZU6B 4F3VA 2PM7A 4ILHB 2VJ8A 3CKBA 3LJ3A 1L5JA 3R9AB 4LRZA 4HORA 3PNTB 4DUIA 4I1MA 3IHYA 3EU9A 1IQRA 1OWMA 2H6FA 4HXIA 5FQ6A 2OVBA 4MBGA 4ANVA 2PZIA 2X6FA 4GMRA 2HYZA 2H6HA 2IU1A 3F6QA 5FZSA 4XZ4A 4G2VA 3APFA 2DVWA 3HXFA 3ZNGA 5CERB 3TWXA 2KXPC 4URKA 3L22A 5T3RA 5ENRD 2VSOE 5AAOA 4GCNA 3LJNA 2XCCA 1IYGA 2UWJG 3QB2A 3UIPC 3LVQE 4L1BA 5LFAA 4U8YD 2GGFA 3D9IA 3QWWA 4HFGA 3JXIA 3TWTA 2XGMA 1SZ9A 2EILE 1QYMA 4A55A 3PS6A 3KAEA 2V8SE 2WQ6A 1TYQG 4ANWA 4UWLA 5EX3A 4Y6CA 4G25A 5KNHD 3SNXA 2IOLA 3AS8A 1UJJA 3AJIA 3FU5A 4NURA 3D9MA 3FTZA 1H6KA 3EUVA 3MJWA 3B7RL 4N5CA 1IXVA 4BX8A 2J4DA 3CLJA 5BXOA 3CSTA 2GW1A 4RG9A 3VLFA 1YMPA 1N0RA 3DPYA 4GYOA 4J8FA 1G3NB 2GRMA 5G55A 5T4YA 3ZKJA 2R02A 4UI9K 3BEEA 1ELRA 1O1RA 3ZN3A 3NOGD 4LSZE 4C0MA 4J7WA 3FTUA 2GRNB 2WXQA 2Q7FA 4FHJA 3IEGA 4I1AA 1PC2A 1O1TA 3EIJA 2R05A 1U3CA 4KYOB 4L2LA 3AAAC 4EZJA 3SI5A 4AM9A 4G8LA 1O1SA 3LDZA 1DNPA 3TJPA 3VTYA 3V30A 3AG4E 1N9AA 2WXMA 2QY7A 2WXPA 3ZXSA 3EHNA 4A1SA 2WMNA 1BLXB 1ZB1A 3U3WA 3S7BA 1DCEA 3FTYA 4LNGA 2J8SD 4J8EA 2ZISA 5JHAA 3DEOA 4AP2A 3BG1B 1OT8A 4UQXA 3L82A 4GTOA 1H2VC 2ZXWE 3K9IA 3UQ3A 3CVWA 3RRUA 3RK6A 5FINA 3TXNA 2ETCA 4NQ0A 1OY3D 3LY9A 3CVNA 4HRNA 3T5XA 4DX2A 2IEJA 4AOFA 3OXLA 2V4HC 2AJAA 4UQZA 1FT1A 5ENPD 2VQ2A 3FY4A 4JA7A 4BY6A 1U2VG 1HG2A 4EBAA 5ENQD 3I4GA 3OAWA 4UWHA 5JJ7A 4F53A 4U8HA 5AARA 4I6EA 1BPOA 3ZEFA 3S7DA 3ASHA 3UMVA 3LYAA 3ZYMA 3MKQA 4D10C 2CHXA 4L2YA 3MYVA 4EECA 3EIQC 3ULQA 2BUGA 1MJ0A 4CGVA 3IHVA 4GTPA 3VLEA 4YVOA 3WG7E 3W9FA 2IO3C 3T8MA 1SQMA 1E7UA 3UM1A 5KWDA 1HU3A 1E7VA 1OWPA 3LPZA 4CZ2D 4BTAA 3FUJA 5EIDA 4XKCA 4K0RA 2QC9A 1YCSB 4ZFHA 4FJZA 3I4RB 1SZAA 1TNUA 3HXEA 4BERA 4PH4B 4C0EA 2X6HA 2M63A 5LCWJ 2KCLA 4EPZA 2WQ7A 2KZTA 2EIJE 3SBTB 1JCSA 3OTNA 2RFMA 1W3BA 5FWQA 3HXCA 1UG3A 3UINC 4YDWA 4ZHBA 2WXGA 5FZRA 3Q79A 4U0SA 2WXNA 2ZIRA 3TWQA 2XRZA 3NBNB 5AQ7A 1NL4A 4P29A 3UM0A 2RFAA 2YQ8A 3MV3B 3HXDA 4L7TA 4FC8A 1KLXA 5C1DA 4HI8A 4BT9A 3O48A 4M3OA 3Q75A 3KEZA 2HO1A 2C2LA 1MX6A 3C72A 1UW4B 4CDRA 2LNIA 2YHEA 4QFVA 4WNEA 4CEMA 2PM6A 4AEZC 5DIZA 3TWSA 5HRYA 1MX2A 3MX3A 3ZIMA 2KC7A 5JJ6A 3FTVA 1NA3A 5LP0A 4CRWA 5KCMA 2V4LA 4OAVB 3C3RA 1MQSA 2IF4A 3ONKA 2EINE 3QJZA 3Q47B 3VTXA 5EYPF 2AW6A 3PDNA 3NZSA 3FEYA 2X6IA 1EDUA 2X38A 4FJYA 1SW6A 2DWZA 4BWRA 4F6RD 2MRIA 4GTTA 3CVPA 3I5PA 5ANLA 1VDYA 2J09A 4Y6WA 3MKQB 5CEDB 4GZ6A 3FTXA 3AU4A 3TWVA 4GZCA 3W9GA 3ZXPA 4WWNA 4B8AA 5LOZA 3LCAA 3IBEA 2LAHA 3B13A 3EU5A 3FUFA 3MEKA 4J8DA 3RIBA 3D9JA 4HB5A 4OAUC 4PS7A 2P9PG 5CCMA 3T9KA 2DIWA 1N4SA 1WY6A 1LD8A 3QAQA 3RRNB 4IULA 2E2EA 4GA1A 1JCRA 3ISMC 2ZGGA 3ZYLA 3UM2A 1HE8A 4G1TA 4BETA 3ASDA 4PDXA 2KZTB 2XQ0A 2RG8A 3ESLA 4I1OB 4MRUA 3ZW3A 4TRQA 4WNDA 4ATZD 1Z6TA 4NRHB 3BUAA 3C3OA 4TXPA 3B95A 4A1GA 5BXUA 3PVLA 2V0PA 4JZYA 2LSUA 3TXMA 2EIME 2HE0A 1WAO1 3DXMG 3PH0C 4O6FA 1BD8A 2XPIA 4I43A 2AXUA 3SFZA 3ZVVA 1O5MA 2OVFA 1HZ4A 3PZ2A 4MS6A 4GTMA 3PREA 4GTRA 4LEUA 3TWUA 5LCWC 2ONDA 1RW2A 3ML8A 5FQ8A 2L6BA 1OCRE 3PZDA 2BTDA 1QQEA 3DRAA 1TNZA 3TG4A 3B7TA 4Q69A 2HM8A 4DPRA 3QK0A 2CHZA 5M72A 4EBAG 1QBQA 3MA5A 2PQRA 3NAWA 5EDSA 4CCAA 2VGEA 4N39A 4JEHA 1DC2A 3I3NA 5AYWD 4F1PA 3KEAA 4OVVA 5J90A 5ENOD 1E90A 4X8QA 2DYSE 5AJDA 3SZ7A 3LEWA 3FH7A 2VSNA 3O4ZA 3Q49B 2OOEA 2KBXA 3ASNE 3KD7A 5ENSD 1D8EA 1Z3YA 3VLDA 2WXOA 3ULEG 2Y1LE 1TN8A 4U0ZA 4TV3A 1EYHA 3MCXA 4AIFA 1AWCB 1EPUA 5AIJA 4ANXA 5E75A 4XIFA 5E76A 4EZLA 2R2LA 3B7SA 3PEUB 1N4PA 1OUVA 2PQNA 4UI9J 2BKGA 5FIOA 4JA9A 5ARFA 4ACLA 4ANUA 2IJGX 3CV0A 4H7XA 2J07A 1E8WA 3FUIA 4JHKA 4GTQA 3Q73A 2WXIA 2L0IA 4TUUA 2XS8A 3FDHA 3HYMB 1SA4A 4WWOA 3APCA 1BI8B 2AVPA 1U3DA 4HBDA 1TN7A 4GCOA 3V2OA 1HG5A 4I6JA 2GRQB 1XGWA 3CSFA 2LXMA 4YDEA 1N54A 4YVQC 3CK8A 1RZ4A 1INZA 2A4ZA 4I2WA 4NACA 3CHPA 2AXVA 4L23A 4Q94A 4B94A 2WXJA 1YYHA 4DJAA 1H19A 1KZOA 3D9HA 4FULA 1N4RA 2WXKA 4IYPA 5D0OD 5KNGA 3JUIA 4J8SA 3RRMB 2F8XK 3V2XA 3ENEA 1WDYA 2F8YA 2FEZA 3ZU7B 4ILIA 4OYSA 5AQ9A 4G8KA 4B0ZA 5CMYA 3G2SA 3PE3A 4XI0A 3JUEA 4GYYA 3S7JA 3P1UA 3HXBA 3CVQA 3URZA 2B0OE 1JWGA 4BFRA 2YHCA 2OEWA 5FZQA 3PUKA 5D0QD 3UM3A 4GYWA 3HRAA 5CECB 3ZHEA 2XGSA 2CFZA 3C5RA 4UUCA 3UIOC 1TJCA 1KZPA 2RD0A 1Y6IA 1TR4A 2IO2C 4KXKB 5EN5D 1BI7B 4KZ0A 2LAIA 3RO3A 5KJNA 1KPSB 3J5PA 2F37A 3ULYA 2X3MA 4WUYA 3R7RA 4I17A 3SO8A 3ZUVB 2DZNA 1HF8A 3U4TA 4CT0A 1MYOA 3Q9UC 4GMLA 4O1PA 3PZ1A 3RKVA 3FWVA 2ZGDA 1A17A 5AN8A 4J6IA 4I2ZA 1DCQA 4LCTA 5CHEE 3ML9A 4F7AA 5KJLA 3HG0D 1H2TC 2XZDG 2WB2A 4ATGA 3MKRA 4GZDA 3HDXA 3Q4AB 4U63A 5D2MC 4AVXA 2R17C 5A7DB 1PAQA 4K5AB 3GZSA 3Q5MA 3Q7FA 3ZYQA 3GZ2A 1NFIE 4UWFA 1NP7A 2CHWA 3SBSA 3JXJA 3UT4A 3UX4A 1OCOE 1OWLA 3SD5A 4DLOA 4N5QA 1X81A 5CEAA 4HOSA 1PY1A 3DSVA 3RJVA 5CRUA 1HS6A 5LX8A 5JA4D 2QYJA 2WXFA 2CG3A 5JHBA 3FHEA 3OXFA 5HKPA 3LY7A 2ILRA 4APFA 2VGYA 4U96D 3QKYA 3G2TA 2LXLA 5B1BE 4EQFA 5G04J 4OVUA 3D9PA 1TNYA 4XKBA 3L13A 3MV2B 2PNNA 3CR3A 3L9TA 4RSYA 3ZHEB 4G26A 3D9KA 2V5QC 1S70B 2PL2A 2UY1A 3PZ4A 4GZ3A 1Y8MA 2KCVA 3PNLB 1X5BA 2MHKA 5G05J 4TXRA 5D66A 1E96B 3U9WA 3FUNA 4I6GA 3S2AA 1A5EA 4U8VD 1B89A 4JPSA 4APOA 3FUKA 1UN8A 2J49A 3CVUA 4G24A 2VSXE 1AP7A 5B3SE 5HI7A 4HOQA 1N4QA 1NI1A 4AJWA 4HI9A 4JB8P 3SFXA 2NC9A 3FH8A 2RKKA 3Q15A 1HXIA 3RSEG 1KT1A 4UWGA 2GROB 1WG0A 3ASOE 1LTXA 4N3AA 1S0PA 4MKTA 5AENA 1FT2A 1IHGA 2B6CA 4JD2G 1E8ZA 4U95D 1OCCE 1Z3XA 3HHMA 3NQPA 3CGHA 3AG3E 2OV8A 4BX9A 3EDTB 4AY5A 2E0IA 2XHEA 5FTPA 2XRYA 5A6CA 4IN3B 2WQHA 4GTSA 2WXHA 2BKKB 3DSTA 5FT9A 4DLQA 4N3CA 1K3ZD 3G2WA 3TWWA 3NF1A 3IV0A 2KM4A 3EHRA 4TXQA 2DBAA 3Q78A 4FP7A 3CHMA 3LY8A 3MZLB 1YA0A 4DX7D 3CVXA 4E85A 2UY1B 1S63A 4NIKA 3NOCD 4GA0A 2L0TB 2KCKA 1EF1C 1QNFA 2XEEA 3FUEA 3V79K 4GZ5A 4L9PA 2FI7A 4LNBA 1ELWA 3DSWA 3CVYA 2P9NG 4GAAA 4N2QA 2EIKE 4KBQA 3CHOA 4IRUA 2GRPB 5CRVA 3LS8A 1IHBA 5ENTD 3N71A 3CVVA 3RU0A 3QDNA 4UQYA 3CQGB 4LNUD 2XGOA 4TUMA 1JUQA 3FFLA 4GA2A 4ILGA 3U64A 1H2UA 5JMND 3IKOB 4FHKA 3ZRHA 2MYOA 3EHMA 2J9QA 4AXHA 1FVHA 2XEVA 3B7BA 2LO6A 2I2OA 1TNOA 2Y4UA 3JQ0A 5KJMA 3GYZA 2XPZA 4LUNU 5G05C 1TEZA 2GRRB 3L08A 2J4BA 3U66A 4E6HA 4RLYA 3RAUA 3BU8A 2R03A 3R9MA 3CIAA 4N2SA 4MLPA 4AY6A 3QNKA 4R7LA 2CG2A 1Q2ZA 5C2YA 1V54E 5FQ7A 2H6GA 2AXZA 4K03A 4DI4A 3DSXA 2NSZA 3UT7A 5ARGA 1IQUA 2Y4TA 5BV1A 2P9IG 1HFAA 5EKQD 4A3VA 1UJKA 2EQXA 2DYRE 3IXEA 3Q9NC 3DEPA 4UWKA 4RG6A 2ETBA 1D9SA 3TGOA 3D9LA 3PZ3A 2P9UG 4XE0A 2L9BA 3DXKG 2FBNA 4CYMD 3TAXA 4H7YA 2IQCA 1TJFA 3UPVA 4EZKA 3QARA 4WAFA 2I9CA 2HR2A 4KT6B 1NZNA 3T5VA 3DWLG 5AQAA 3FTSA 4HLLA 4B93B 1N95A 1K1AA 1ZBPA 4PUCA 5CMWA 2DCPA 4FLBA 3CVLA 2WPVA 2R59A 4JEUA 3T8KA 4JL0A 3APDA 3UTMA 3DSSA 3PEVB 2VTBA 3HIZA 3G2VA 3DBSA 4N3BA 5IY5E 3FU0A 4Z68A 3G2UA 3NZUA 2R5SA 5CBNA 2I1KA 3E37A 5H7PA 2C0MA 4PS8A 2CFUA 3Q7AA 2MOWA 3PRZA 4BTBA 2H6IA 1JWFA 2L6JA 4FADA 4U7EB 1HX8A 3UUXA 1MX4A 3FU6A 3QWVA 2GRLA 4KZCA 4DK5A 3JYSA 1IKND 3ZGQA 2P9KG 5CCLA 5FJYA 3FP3A 4BSZB 2AWIA 2XEHA 2DZOA 3L54A 3V31A 4C9BB 4CDMA 4A63B 2QYUA 3ESKA 1S64A 2XCBA 3AG1E 2YINA 3PUJA 2LSVA 4JHJA 5BW8C 2X6KA 4O1OA 1UOHA 1UN9A 2VYIA 3HVEA 1HO8A 1N52A 5HQ8A 3CK7A 1FCHA 4HNAD 3L6AA 2IFUA 4BT8A 4C48B 2YNQA 4ACKA 2P9LG 4U07A 2LUHA 2FF4A 4YDOA 5DBKA 4G23A 4UI9C 1JCQA 4JW1A 2A5UA 3R7QA 3L17A 3BQOA 1ZU2A 5G2NA 4CT4A 3D9OA 4HRMB 4HVBA 5ANRA 1XNFA 2VSYA 2FULA 3E33A 2VTBB 3CHRA 3EHQA 2VGXA 3FULA 4AV7A 4B89A 5AJLA 2FO7A 4ME2A 4FU3A 5FQ4A 4ABNA 2XZTG 5BT1A 3D3MA 1MZCA 3UKUG 5JJTA 3ABLE 4LERA 1GW6A 2QZAA 3FTWA 3ZYKA 5HS0A 3E4BA 4PS3A 3SF4A 3JQ1A 1H6PA 2NYJA 3NB2A 5BV0A 5EIBE 3EJNA 4JVSA 4HOUA 4W9RA 2BF0X 3CQCB 1MHQA 2IONA 2Y3AA 3ZFWA 3ONLA 4F1SA 1N11A 4XX5A
chains in the Genus database with same CATH topology
4YNDA 3TJPA 4A3TA 1E8YA 3ASGA 4FP7A 3VTYA 1OUVA 3CHMA 2PQNA 3LY8A 4UI9J 3MZLB 1YA0A 2P58C 4GMJA 3CVXA 4E85A 2UY1B 2WXMA 2QY7A 4JA9A 2WXPA 4V3IA 5ARFA 4ACLA 3ZXSA 3EHNA 4GU5A 2IJGX 4A1SA 4ANUA 2WMNA 3CKCA 3CV0A 4GA0A 2L0TB 3U3WA 4JHRA 2KCKA 1EF1C 3LVRE 1QNFA 4H7XA 3FUEA 3S7BA 2J07A 1E8WA 4GZ5A 3FUIA 3FTYA 2FI7A 2WMOA 4JHKA 5J08A 1ELWA 3CVYA 4J8EA 5JHAA 4GAAA 3CK9A 4AP2A 4N2QA 3BG1B 5KJKA 4KBQA 3CHOA 4IRUA 2WXIA 3LS8A 2L0IA 4TUUA 4UQXA 3FDHA 3HYMB 3N71A 3CVVA 3RU0A 4WWOA 1H2VC 3APCA 3QDNA 4UQYA 3CQGB 3K9IA 1WM5A 3L16A 3HVEB 3UQ3A 3RRUA 2AVPA 2XGOA 3RK6A 1JUQA 3TXNA 4B8CB 4BSXA 3CVWA 1U3DA 4NQ0A 3FFLA 3TL5A 3LY9A 4GCOA 3CVNA 3S7FA 3T5XA 4GA2A 2I1JA 4DI3A 1E8XA 4ILGA 1HG5A 4I6JA 4AOFA 4I9EA 1XGWA 1H2UA 3CSFA 3OXLA 3U64A 4HOTA 3QOUA 4GPKA 3IKOB 4FHKA 3ZRHA 3WXXA 1N54A 3PE4A 4UQZA 4YVQC 2VQ2A 4RVBA 3EHMA 2J9QA 3FY4A 4AXHA 4JA7A 1FVHA 2WM9A 2XEVA 3AU5A 2LO6A 4BY6A 1HG2A 4KMOA 2I2OA 3CK8A 2Y4UA 3JQ0A 1INZA 2A4ZA 5KJMA 4I2WA 3GYZA 3D9NA 4NACA 2XPZA 4EBAA 3CHPA 2AXVA 3I4GA 3OAWA 4JC8A 2WXJA 4LUNU 4L23A 4Q94A 4UWHA 5G05C 4U8HA 4XI9A 4F53A 5JJ7A 1TEZA 3L08A 4I6EA 4DJAA 1BPOA 3S7DA 3ZEFA 3ASHA 3UMVA 1H19A 2J4BA 3C98A 3LYAA 3MKQA 2CHXA 3AS5A 5ENNA 4D10C 3U66A 2C0LA 4L2YA 3FUMA 4FULA 4CDNA 4E6HA 1JPLA 3MYVA 2WXKA 4IYPA 2NXPA 5D0OD 2VGXB 3JUIA 1HH8A 4J8SA 3EIQC 3RRMB 3BG0B 4EECA 3ULQA 1DVPA 3CHQA 3CIAA 2BUGA 3ENEA 4N2SA 4MLPA 5BPPA 2FEZA 4AY6A 3QNKA 4R7LA 4CGVA 3IHVA 2CG2A 2WXRA 3VLEA 1OWOA 4ILIA 5C2YA 4OYSA 4YVOA 5FQ7A 4B0ZA 2AXZA 3T8MA 4K03A 4DI4A 3SGHA 1SQMA 3FEXA 1E7UA 5CMYA 4G11A 3G2SA 3PE3A 2NSZA 4XI0A 4GYYA 4J0UA 3P2BA 4U04A 3UT7A 1HU3A 1E7VA 3S7JA 1OWPA 3LPZA 3P1UA 5ARGA 1IQUA 1NA0A 4BTAA 3FUJA 3CVQA 4KVOA 2Y4TA 4XKCA 4K0RA 3URZA 5BV1A 1JWGA 4BFRA 2YHCA 3LKUA 1HFAA 5FZQA 4FJZA 3PUKA 3I4RB 5D0QD 3OXGA 1SZAA 4GYWA 4HLEA 4PH4B 3ZHEA 5EKQD 4A3VA 2XGSA 2CFZA 3JCKC 1UJKA 1TJCA 2EQXA 2RD0A 4C0EA 1Y6IA 2X6HA 4JXTA 2M63A 2WVIA 4KXKB 5BNWA 5LCWJ 2KCLA 4EPZA 4UWKA 3GZ1A 2KZTA 4KZ0A 4RG6A 3SBTB 2WQ7A 3TGOA 3OTNA 3RO2A 2LAIA 1W3BA 3RO3A 5KJNA 4GB9A 5EX0A 5FWQA 3D9LA 3DPDA 1UG3A 4XE0A 5T8IA 2J08A 2L9BA 2WXLA 4WNGA 2WXGA 5FZRA 2KATA 2X3MA 3QC1A 4U0SA 4WUYA 3R7RA 2WXNA 2FBNA 4I17A 2XRZA 3CEQA 3TAXA 1ELKA 4P29A 1HF8A 2IOSA 4H7YA 3U4TA 2IQCA 3ZPJA 4CT0A 1TJFA 3UPVA 4EZKA 3FH5A 4GMLA 3QARA 2YQ8A 3MV3B 4WAFA 2I9CA 4L7TA 1KT0A 3RKVA 4FC8A 1KLXA 2HR2A 3FWVA 3TG5A 5C1DA 5G04C 4KT6B 1A17A 1NZNA 1OWNA 4BT9A 3O48A 2JEKA 4M3OA 4KVMA 3QWPA 3T5VA 3KEZA 2XPYA 3B7UX 2HO1A 3KS2A 4J6IA 4I2ZA 4U0UA 2I6HA 4LCTA 2C2LA 3CHSA 5CHEE 3ML9A 4F7AA 1UW4B 1H0AA 4CDRA 5KJLA 2LNIA 3GW4A 1H2TC 4CGWA 2YHEA 4QFVA 2WB2A 4ATGA 4WNEA 3MKRA 4CEMA 2PM6A 4GZDA 3FTSA 3HDXA 3Q4AB 4U63A 5DIZA 4AEZC 3MX3A 5BUZA 3FUDA 2KC7A 5JJ6A 3FTVA 3LXUX 4AVXA 2R17C 3ZIMA 1NA3A 5A7DB 1ZBPA 4FA6A 1PAQA 4CRWA 5LP0A 4PUCA 1FVFA 5CMWA 5KCMA 2DCPA 2V4LA 4I9CA 4FLBA 2V5FA 3GZSA 1MQSA 3Q5MA 3CVLA 4Q96A 2IF4A 2WPVA 3ONKA 2R59A 4JEUA 3QJZA 3FU3A 3ZYQA 3Q47B 4JL0A 3GZ2A 3APDA 3PEVB 1LF8A 3VTXA 4WNFA 2VTBA 2AW6A 3PDNA 3HIZA 3NZSA 4UWFA 3FEYA 3G2VA 1NP7A 2CHWA 2X6IA 2X6JA 3DBSA 4N3BA 3SBSA 1EDUA 3FUHA 2X38A 4FJYA 3UT4A 3FU0A 3UX4A 3G2UA 1OWLA 3NZUA 5A23A 4BWRA 2MRIA 2R5SA 4HS2A 3SD5A 4DLOA 3UT8A 3CVPA 3I5PA 4FLHA 5ANLA 1VDYA 3SHFA 2I1KA 2J09A 3MGBA 2C0MA 4PS8A 3ASFA 4Y6WA 1P5QA 3MKQB 4HOSA 4GZ6A 1PY1A 3FTXA 3RJVA 2CFUA 1HS6A 2MOWA 3AU4A 3PRZA 5LX8A 2WXFA 4BTBA 2CG3A 4GZCA 1JWFA 5JHBA 2JLBA 2L6JA 3FHEA 3OXFA 4WWNA 4B8AA 5LOZA 4FADA 3LCAA 1QZ2A 3LY7A 1HX8A 3AS4A 2ILRA 4APFA 2QFCA 2VGYA 3UUXA 3QKYA 3IBEA 2LAHA 4WWPA 3B13A 2ZU6B 3FUFA 3G2TA 3MEKA 4F3VA 4J8DA 2PM7A 3RIBA 3FU6A 4EQFA 5G04J 4OVUA 4ILHB 3D9JA 3D9PA 2VJ8A 3QWVA 2GRLA 3CKBA 3LJ3A 1L5JA 3R9AB 4KZCA 4PS7A 4DK5A 3JYSA 4LRZA 4HORA 5CCMA 3PNTB 2DIWA 3ZGQA 4XKBA 4I1MA 1WY6A 3L13A 3MV2B 3QAQA 3RRNB 4IULA 5CCLA 2E2EA 3IHYA 1IQRA 1OWMA 4HXIA 5FJYA 4GA1A 5FQ6A 2OVBA 3CR3A 3FP3A 4ANVA 2PZIA 2AWIA 4RSYA 3ZYLA 2X6FA 2HYZA 3ZHEB 2IU1A 4G26A 3D9KA 1HE8A 3L54A 2PL2A 2UY1A 4G1TA 4GZ3A 1Y8MA 4C9BB 5FZSA 4XZ4A 3ASDA 4G2VA 2KCVA 3APFA 4PDXA 4CDMA 2KZTB 2XQ0A 2RG8A 3ESLA 3ESKA 4I1OB 4MRUA 3PNLB 1X5BA 2MHKA 2XCBA 5G05J 3ZW3A 1E96B 4URKA 3L22A 3U9WA 4TRQA 3FUNA 5T3RA 4I6GA 2YINA 1Z6TA 4WNDA 4NRHB 3S2AA 2VSOE 3PUJA 4GCNA 1B89A 2LSVA 4JPSA 2XCCA 4JHJA 4APOA 1IYGA 2UWJG 4A1GA 5BW8C 2X6KA 3FUKA 3PVLA 1UN9A 3QB2A 2V0PA 1UN8A 2J49A 3LVQE 4JZYA 3CVUA 4L1BA 2LSUA 3TXMA 5LFAA 2VYIA 2GGFA 4G24A 3HVEA 1HO8A 3D9IA 1WAO1 3QWWA 4HFGA 1N52A 2VSXE 5HQ8A 3CK7A 1FCHA 3PH0C 4O6FA 2XGMA 2XPIA 1SZ9A 4I43A 2AXUA 3SFZA 5HI7A 4HOQA 4A55A 3PS6A 3ZVVA 3KAEA 2V8SE 3L6AA 4AJWA 2IFUA 4BT8A 2OVFA 1HZ4A 2YNQA 2WQ6A 4ACKA 4MS6A 4U07A 4ANWA 4UWLA 3PREA 2FF4A 5EX3A 4LEUA 5LCWC 4Y6CA 5DBKA 4G25A 4G23A 2NC9A 3FH8A 2ONDA 4UI9C 2IOLA 3SNXA 3AS8A 1UJJA 3FU5A 3ML8A 4JW1A 4NURA 5FQ8A 2A5UA 1HXIA 3Q15A 3D9MA 3FTZA 1H6KA 3R7QA 3L17A 1KT1A 4UWGA 3MJWA 1ZU2A 3PZDA 2BTDA 3B7RL 5G2NA 1QQEA 3D9OA 4CT4A 4HVBA 5ANRA 1XNFA 3TG4A 4N3AA 2VSYA 4N5CA 1S0PA 4MKTA 2FULA 2VTBB 3CHRA 3B7TA 4BX8A 4Q69A 2HM8A 4DPRA 3QK0A 5AENA 2J4DA 2VGXA 2CHZA 5M72A 3FULA 1IHGA 4AV7A 3CLJA 3MA5A 4B89A 4EBAG 2PQRA 1E8ZA 5EDSA 4CCAA 5AJLA 3CSTA 2FO7A 4JEHA 2GW1A 4ME2A 4N39A 3ZYMA 1Z3XA 3HHMA 4FU3A 3I3NA 4RG9A 5FQ4A 5AYWD 3VLFA 4ABNA 5BT1A 5J90A 4OVVA 4GYOA 1E90A 3D3MA 3NQPA 5AJDA 3SZ7A 4J8FA 3CGHA 3LEWA 2GRMA 3FH7A 2VSNA 5G55A 5T4YA 4UI9K 5JJTA 3BEEA 2OV8A 1ELRA 3O4ZA 2OOEA 3Q49B 4BX9A 3EDTB 4LERA 3ZN3A 1GW6A 3FTWA 4AY5A 3ZYKA 2E0IA 2XHEA 3KD7A 5FTPA 2XRYA 3E4BA 5A6CA 1Z3YA 4PS3A 4C0MA 3VLDA 4IN3B 3SF4A 2WXOA 2WQHA 3JQ1A 3FTUA 2WXHA 2WXQA 2Q7FA 5FT9A 4U0ZA 4FHJA 4TV3A 4DLQA 3IEGA 1EYHA 3MCXA 1PC2A 4I1AA 4AIFA 5BV0A 3EIJA 4N3CA 1U3CA 4B94A 3EJNA 3G2WA 4HOUA 4JVSA 2BF0X 3CQCB 4W9RA 1EPUA 1MHQA 2IONA 3IV0A 3NF1A 5AIJA 4ANXA 4KYOB 2Y3AA 4XIFA 5E75A 4L2LA 2KM4A 5E76A 3ZFWA 3ONLA 4F1SA 4EZJA 3SI5A 4EZLA 4AM9A 3B7SA 3PEUB 2DBAA 3LDZA 4XX5A 1DNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIW A;  4GZC A;  1HG5 A;  1HF8 A;  1JWF A;  3D9I A;  1XGW A;  3ZYM A;  4JXT A;  1UJJ A;  1X5B A;  3G2V A;  4FU3 A;  4HFG A;  5LOZ A;  4GZD A;  1EDU A;  3D9M A;  1HX8 A;  5CMY A;  1EYH A;  3G2U A;  3G2S A;  1SZ9 A;  1JPL A;  4AVX A;  1UJK A;  2QY7 A;  3D9O A;  2L0I A;  5LP0 A;  3ZYL A;  3G2W A;  3G2T A;  3D9L A;  2BF0 X;  2LO6 A;  5CMW A;  2DCP A;  1MHQ A;  1HG2 A;  2V8S E;  4FLB A;  1DVP A;  3D9K A;  2L0T B;  4Q96 A;  1JWG A;  1INZ A;  3ONK A;  1VDY A;  3RRU A;  2KM4 A;  3D9J A;  3D9N A;  1JUQ A;  3D9P A;  1HFA A;  4NAC A;  3ONL A;  3ZYQ A;  3ZYK A;  1SZA A;  1PY1 A;  3CLJ A;  4Q94 A;  5J08 A;  1LF8 A;  2MOW A;  1H0A A;  3LDZ A;  1ELK A; 
#chains in the Genus database with same CATH topology
 4YND A;  4A3T A;  1E8Y A;  3ASG A;  4GTV A;  3KSQ A;  2P58 C;  4J8Y A;  4GMJ A;  5ITZ F;  1N0Q A;  2OEV A;  4V3I A;  4GU5 A;  3CKC A;  5EYL A;  4JHR A;  3LVR E;  4K5B A;  2WMO A;  5J08 A;  4DX6 D;  1H6O A;  3C3Q A;  3AG2 E;  3CK9 A;  5KJK A;  1K1B A;  1V55 E;  4HQD A;  1WM5 A;  3L16 A;  3HVE B;  4B8C B;  3X2Q E;  4BSX A;  3KSL A;  2JAB A;  3TL5 A;  3SQV A;  2F0Y A;  3S7F A;  2I1J A;  4DI3 A;  1E8X A;  4I9E A;  4HOT A;  1OXJ A;  1SA5 A;  3QOU A;  4GPK A;  1Z5S C;  3WXX A;  1D8D A;  3PE4 A;  4RVB A;  2WM9 A;  2BED A;  3AU5 A;  4KMO A;  4YDY A;  4QQI A;  3ABK E;  3D9N A;  4O60 A;  4JC8 A;  4XI9 A;  4HRL A;  3C98 A;  5ENN A;  3AS5 A;  2Y0B G;  5EIL A;  2C0L A;  3FUM A;  4CDN A;  1JPL A;  2NXP A;  2VGX B;  3TWR A;  1HH8 A;  3BG0 B;  1DVP A;  3CHQ A;  5BPP A;  1N94 A;  2WXR A;  4XEI G;  1OWO A;  4M7C A;  4K5C A;  3SGH A;  3FEX A;  4G11 A;  4J0U A;  3P2B A;  4U04 A;  2P9S G;  1NA0 A;  4KVO A;  4RQI A;  3LKU A;  3OXG A;  4HLE A;  3JCK C;  4JXT A;  2WVI A;  5BNW A;  3GZ1 A;  2P2C P;  4EHM A;  3RO2 A;  3E34 A;  1K8K G;  4GB9 A;  5B1A E;  5EX0 A;  3E32 A;  3DPD A;  3SY2 A;  5T8I A;  2J08 A;  4WNG A;  2WXL A;  2IY0 C;  2KAT A;  3QC1 A;  3CEQ A;  1ELK A;  2IOS A;  3ZPJ A;  3FH5 A;  1KT0 A;  1SVX A;  2A5E A;  1FPP A;  3TG5 A;  1BU9 A;  5G04 C;  1OWN A;  1LD7 A;  2JEK A;  4KVM A;  3QWP A;  2XPY A;  3B7U X;  3KS2 A;  2XS1 A;  2I6H A;  4U0U A;  3CHS A;  4DX1 A;  3J5Q B;  1H0A A;  3GW4 A;  3UI2 A;  4CGW A;  3E30 A;  5CBO A;  3SFY A;  2ETA A;  5BUZ A;  3FUD A;  3LXU X;  4FA6 A;  5AQB A;  4BEP A;  1FVF A;  4DRX E;  4LG6 A;  4I9C A;  2V5F A;  4Q96 A;  3FU3 A;  5KBA A;  1LF8 A;  4WNF A;  2X6J A;  4BES A;  4DX5 D;  3FUH A;  4GPM A;  5A23 A;  1TN6 A;  4HS2 A;  3UT8 A;  3ABM E;  4FLH A;  2Y69 E;  3SHF A;  3MGB A;  2XEN A;  3ASF A;  1P5Q A;  3DSU A;  3UXG A;  1TNB A;  2JLB A;  2FO1 E;  1QZ2 A;  3AS4 A;  1OCZ E;  3UKR G;  2QFC A;  4WWP A;  2OCC E;  2ZU6 B;  4F3V A;  2PM7 A;  4ILH B;  2VJ8 A;  3CKB A;  3LJ3 A;  1L5J A;  3R9A B;  4LRZ A;  4HOR A;  3PNT B;  4DUI A;  4I1M A;  3IHY A;  3EU9 A;  1IQR A;  1OWM A;  2H6F A;  4HXI A;  5FQ6 A;  2OVB A;  4MBG A;  4ANV A;  2PZI A;  2X6F A;  4GMR A;  2HYZ A;  2H6H A;  2IU1 A;  3F6Q A;  5FZS A;  4XZ4 A;  4G2V A;  3APF A;  2DVW A;  3HXF A;  3ZNG A;  5CER B;  3TWX A;  2KXP C;  4URK A;  3L22 A;  5T3R A;  5ENR D;  2VSO E;  5AAO A;  4GCN A;  3LJN A;  2XCC A;  1IYG A;  2UWJ G;  3QB2 A;  3UIP C;  3LVQ E;  4L1B A;  5LFA A;  4U8Y D;  2GGF A;  3D9I A;  3QWW A;  4HFG A;  3JXI A;  3TWT A;  2XGM A;  1SZ9 A;  2EIL E;  1QYM A;  4A55 A;  3PS6 A;  3KAE A;  2V8S E;  2WQ6 A;  1TYQ G;  4ANW A;  4UWL A;  5EX3 A;  4Y6C A;  4G25 A;  5KNH D;  3SNX A;  2IOL A;  3AS8 A;  1UJJ A;  3AJI A;  3FU5 A;  4NUR A;  3D9M A;  3FTZ A;  1H6K A;  3EUV A;  3MJW A;  3B7R L;  4N5C A;  1IXV A;  4BX8 A;  2J4D A;  3CLJ A;  5BXO A;  3CST A;  2GW1 A;  4RG9 A;  3VLF A;  1YMP A;  1N0R A;  3DPY A;  4GYO A;  4J8F A;  1G3N B;  2GRM A;  5G55 A;  5T4Y A;  3ZKJ A;  2R02 A;  4UI9 K;  3BEE A;  1ELR A;  1O1R A;  3ZN3 A;  3NOG D;  4LSZ E;  4C0M A;  4J7W A;  3FTU A;  2GRN B;  2WXQ A;  2Q7F A;  4FHJ A;  3IEG A;  4I1A A;  1PC2 A;  1O1T A;  3EIJ A;  2R05 A;  1U3C A;  4KYO B;  4L2L A;  3AAA C;  4EZJ A;  3SI5 A;  4AM9 A;  4G8L A;  1O1S A;  3LDZ A;  1DNP A;  3TJP A;  3VTY A;  3V30 A;  3AG4 E;  1N9A A;  2WXM A;  2QY7 A;  2WXP A;  3ZXS A;  3EHN A;  4A1S A;  2WMN A;  1BLX B;  1ZB1 A;  3U3W A;  3S7B A;  1DCE A;  3FTY A;  4LNG A;  2J8S D;  4J8E A;  2ZIS A;  5JHA A;  3DEO A;  4AP2 A;  3BG1 B;  1OT8 A;  4UQX A;  3L82 A;  4GTO A;  1H2V C;  2ZXW E;  3K9I A;  3UQ3 A;  3CVW A;  3RRU A;  3RK6 A;  5FIN A;  3TXN A;  2ETC A;  4NQ0 A;  1OY3 D;  3LY9 A;  3CVN A;  4HRN A;  3T5X A;  4DX2 A;  2IEJ A;  4AOF A;  3OXL A;  2V4H C;  2AJA A;  4UQZ A;  1FT1 A;  5ENP D;  2VQ2 A;  3FY4 A;  4JA7 A;  4BY6 A;  1U2V G;  1HG2 A;  4EBA A;  5ENQ D;  3I4G A;  3OAW A;  4UWH A;  5JJ7 A;  4F53 A;  4U8H A;  5AAR A;  4I6E A;  1BPO A;  3ZEF A;  3S7D A;  3ASH A;  3UMV A;  3LYA A;  3ZYM A;  3MKQ A;  4D10 C;  2CHX A;  4L2Y A;  3MYV A;  4EEC A;  3EIQ C;  3ULQ A;  2BUG A;  1MJ0 A;  4CGV A;  3IHV A;  4GTP A;  3VLE A;  4YVO A;  3WG7 E;  3W9F A;  2IO3 C;  3T8M A;  1SQM A;  1E7U A;  3UM1 A;  5KWD A;  1HU3 A;  1E7V A;  1OWP A;  3LPZ A;  4CZ2 D;  4BTA A;  3FUJ A;  5EID A;  4XKC A;  4K0R A;  2QC9 A;  1YCS B;  4ZFH A;  4FJZ A;  3I4R B;  1SZA A;  1TNU A;  3HXE A;  4BER A;  4PH4 B;  4C0E A;  2X6H A;  2M63 A;  5LCW J;  2KCL A;  4EPZ A;  2WQ7 A;  2KZT A;  2EIJ E;  3SBT B;  1JCS A;  3OTN A;  2RFM A;  1W3B A;  5FWQ A;  3HXC A;  1UG3 A;  3UIN C;  4YDW A;  4ZHB A;  2WXG A;  5FZR A;  3Q79 A;  4U0S A;  2WXN A;  2ZIR A;  3TWQ A;  2XRZ A;  3NBN B;  5AQ7 A;  1NL4 A;  4P29 A;  3UM0 A;  2RFA A;  2YQ8 A;  3MV3 B;  3HXD A;  4L7T A;  4FC8 A;  1KLX A;  5C1D A;  4HI8 A;  4BT9 A;  3O48 A;  4M3O A;  3Q75 A;  3KEZ A;  2HO1 A;  2C2L A;  1MX6 A;  3C72 A;  1UW4 B;  4CDR A;  2LNI A;  2YHE A;  4QFV A;  4WNE A;  4CEM A;  2PM6 A;  4AEZ C;  5DIZ A;  3TWS A;  5HRY A;  1MX2 A;  3MX3 A;  3ZIM A;  2KC7 A;  5JJ6 A;  3FTV A;  1NA3 A;  5LP0 A;  4CRW A;  5KCM A;  2V4L A;  4OAV B;  3C3R A;  1MQS A;  2IF4 A;  3ONK A;  2EIN E;  3QJZ A;  3Q47 B;  3VTX A;  5EYP F;  2AW6 A;  3PDN A;  3NZS A;  3FEY A;  2X6I A;  1EDU A;  2X38 A;  4FJY A;  1SW6 A;  2DWZ A;  4BWR A;  4F6R D;  2MRI A;  4GTT A;  3CVP A;  3I5P A;  5ANL A;  1VDY A;  2J09 A;  4Y6W A;  3MKQ B;  5CED B;  4GZ6 A;  3FTX A;  3AU4 A;  3TWV A;  4GZC A;  3W9G A;  3ZXP A;  4WWN A;  4B8A A;  5LOZ A;  3LCA A;  3IBE A;  2LAH A;  3B13 A;  3EU5 A;  3FUF A;  3MEK A;  4J8D A;  3RIB A;  3D9J A;  4HB5 A;  4OAU C;  4PS7 A;  2P9P G;  5CCM A;  3T9K A;  2DIW A;  1N4S A;  1WY6 A;  1LD8 A;  3QAQ A;  3RRN B;  4IUL A;  2E2E A;  4GA1 A;  1JCR A;  3ISM C;  2ZGG A;  3ZYL A;  3UM2 A;  1HE8 A;  4G1T A;  4BET A;  3ASD A;  4PDX A;  2KZT B;  2XQ0 A;  2RG8 A;  3ESL A;  4I1O B;  4MRU A;  3ZW3 A;  4TRQ A;  4WND A;  4ATZ D;  1Z6T A;  4NRH B;  3BUA A;  3C3O A;  4TXP A;  3B95 A;  4A1G A;  5BXU A;  3PVL A;  2V0P A;  4JZY A;  2LSU A;  3TXM A;  2EIM E;  2HE0 A;  1WAO 1;  3DXM G;  3PH0 C;  4O6F A;  1BD8 A;  2XPI A;  4I43 A;  2AXU A;  3SFZ A;  3ZVV A;  1O5M A;  2OVF A;  1HZ4 A;  3PZ2 A;  4MS6 A;  4GTM A;  3PRE A;  4GTR A;  4LEU A;  3TWU A;  5LCW C;  2OND A;  1RW2 A;  3ML8 A;  5FQ8 A;  2L6B A;  1OCR E;  3PZD A;  2BTD A;  1QQE A;  3DRA A;  1TNZ A;  3TG4 A;  3B7T A;  4Q69 A;  2HM8 A;  4DPR A;  3QK0 A;  2CHZ A;  5M72 A;  4EBA G;  1QBQ A;  3MA5 A;  2PQR A;  3NAW A;  5EDS A;  4CCA A;  2VGE A;  4N39 A;  4JEH A;  1DC2 A;  3I3N A;  5AYW D;  4F1P A;  3KEA A;  4OVV A;  5J90 A;  5ENO D;  1E90 A;  4X8Q A;  2DYS E;  5AJD A;  3SZ7 A;  3LEW A;  3FH7 A;  2VSN A;  3O4Z A;  3Q49 B;  2OOE A;  2KBX A;  3ASN E;  3KD7 A;  5ENS D;  1D8E A;  1Z3Y A;  3VLD A;  2WXO A;  3ULE G;  2Y1L E;  1TN8 A;  4U0Z A;  4TV3 A;  1EYH A;  3MCX A;  4AIF A;  1AWC B;  1EPU A;  5AIJ A;  4ANX A;  5E75 A;  4XIF A;  5E76 A;  4EZL A;  2R2L A;  3B7S A;  3PEU B;  1N4P A;  1OUV A;  2PQN A;  4UI9 J;  2BKG A;  5FIO A;  4JA9 A;  5ARF A;  4ACL A;  4ANU A;  2IJG X;  3CV0 A;  4H7X A;  2J07 A;  1E8W A;  3FUI A;  4JHK A;  4GTQ A;  3Q73 A;  2WXI A;  2L0I A;  4TUU A;  2XS8 A;  3FDH A;  3HYM B;  1SA4 A;  4WWO A;  3APC A;  1BI8 B;  2AVP A;  1U3D A;  4HBD A;  1TN7 A;  4GCO A;  3V2O A;  1HG5 A;  4I6J A;  2GRQ B;  1XGW A;  3CSF A;  2LXM A;  4YDE A;  1N54 A;  4YVQ C;  3CK8 A;  1RZ4 A;  1INZ A;  2A4Z A;  4I2W A;  4NAC A;  3CHP A;  2AXV A;  4L23 A;  4Q94 A;  4B94 A;  2WXJ A;  1YYH A;  4DJA A;  1H19 A;  1KZO A;  3D9H A;  4FUL A;  1N4R A;  2WXK A;  4IYP A;  5D0O D;  5KNG A;  3JUI A;  4J8S A;  3RRM B;  2F8X K;  3V2X A;  3ENE A;  1WDY A;  2F8Y A;  2FEZ A;  3ZU7 B;  4ILI A;  4OYS A;  5AQ9 A;  4G8K A;  4B0Z A;  5CMY A;  3G2S A;  3PE3 A;  4XI0 A;  3JUE A;  4GYY A;  3S7J A;  3P1U A;  3HXB A;  3CVQ A;  3URZ A;  2B0O E;  1JWG A;  4BFR A;  2YHC A;  2OEW A;  5FZQ A;  3PUK A;  5D0Q D;  3UM3 A;  4GYW A;  3HRA A;  5CEC B;  3ZHE A;  2XGS A;  2CFZ A;  3C5R A;  4UUC A;  3UIO C;  1TJC A;  1KZP A;  2RD0 A;  1Y6I A;  1TR4 A;  2IO2 C;  4KXK B;  5EN5 D;  1BI7 B;  4KZ0 A;  2LAI A;  3RO3 A;  5KJN A;  1KPS B;  3J5P A;  2F37 A;  3ULY A;  2X3M A;  4WUY A;  3R7R A;  4I17 A;  3SO8 A;  3ZUV B;  2DZN A;  1HF8 A;  3U4T A;  4CT0 A;  1MYO A;  3Q9U C;  4GML A;  4O1P A;  3PZ1 A;  3RKV A;  3FWV A;  2ZGD A;  1A17 A;  5AN8 A;  4J6I A;  4I2Z A;  1DCQ A;  4LCT A;  5CHE E;  3ML9 A;  4F7A A;  5KJL A;  3HG0 D;  1H2T C;  2XZD G;  2WB2 A;  4ATG A;  3MKR A;  4GZD A;  3HDX A;  3Q4A B;  4U63 A;  5D2M C;  4AVX A;  2R17 C;  5A7D B;  1PAQ A;  4K5A B;  3GZS A;  3Q5M A;  3Q7F A;  3ZYQ A;  3GZ2 A;  1NFI E;  4UWF A;  1NP7 A;  2CHW A;  3SBS A;  3JXJ A;  3UT4 A;  3UX4 A;  1OCO E;  1OWL A;  3SD5 A;  4DLO A;  4N5Q A;  1X81 A;  5CEA A;  4HOS A;  1PY1 A;  3DSV A;  3RJV A;  5CRU A;  1HS6 A;  5LX8 A;  5JA4 D;  2QYJ A;  2WXF A;  2CG3 A;  5JHB A;  3FHE A;  3OXF A;  5HKP A;  3LY7 A;  2ILR A;  4APF A;  2VGY A;  4U96 D;  3QKY A;  3G2T A;  2LXL A;  5B1B E;  4EQF A;  5G04 J;  4OVU A;  3D9P A;  1TNY A;  4XKB A;  3L13 A;  3MV2 B;  2PNN A;  3CR3 A;  3L9T A;  4RSY A;  3ZHE B;  4G26 A;  3D9K A;  2V5Q C;  1S70 B;  2PL2 A;  2UY1 A;  3PZ4 A;  4GZ3 A;  1Y8M A;  2KCV A;  3PNL B;  1X5B A;  2MHK A;  5G05 J;  4TXR A;  5D66 A;  1E96 B;  3U9W A;  3FUN A;  4I6G A;  3S2A A;  1A5E A;  4U8V D;  1B89 A;  4JPS A;  4APO A;  3FUK A;  1UN8 A;  2J49 A;  3CVU A;  4G24 A;  2VSX E;  1AP7 A;  5B3S E;  5HI7 A;  4HOQ A;  1N4Q A;  1NI1 A;  4AJW A;  4HI9 A;  4JB8 P;  3SFX A;  2NC9 A;  3FH8 A;  2RKK A;  3Q15 A;  1HXI A;  3RSE G;  1KT1 A;  4UWG A;  2GRO B;  1WG0 A;  3ASO E;  1LTX A;  4N3A A;  1S0P A;  4MKT A;  5AEN A;  1FT2 A;  1IHG A;  2B6C A;  4JD2 G;  1E8Z A;  4U95 D;  1OCC E;  1Z3X A;  3HHM A;  3NQP A;  3CGH A;  3AG3 E;  2OV8 A;  4BX9 A;  3EDT B;  4AY5 A;  2E0I A;  2XHE A;  5FTP A;  2XRY A;  5A6C A;  4IN3 B;  2WQH A;  4GTS A;  2WXH A;  2BKK B;  3DST A;  5FT9 A;  4DLQ A;  4N3C A;  1K3Z D;  3G2W A;  3TWW A;  3NF1 A;  3IV0 A;  2KM4 A;  3EHR A;  4TXQ A;  2DBA A;  3Q78 A;  4FP7 A;  3CHM A;  3LY8 A;  3MZL B;  1YA0 A;  4DX7 D;  3CVX A;  4E85 A;  2UY1 B;  1S63 A;  4NIK A;  3NOC D;  4GA0 A;  2L0T B;  2KCK A;  1EF1 C;  1QNF A;  2XEE A;  3FUE A;  3V79 K;  4GZ5 A;  4L9P A;  2FI7 A;  4LNB A;  1ELW A;  3DSW A;  3CVY A;  2P9N G;  4GAA A;  4N2Q A;  2EIK E;  4KBQ A;  3CHO A;  4IRU A;  2GRP B;  5CRV A;  3LS8 A;  1IHB A;  5ENT D;  3N71 A;  3CVV A;  3RU0 A;  3QDN A;  4UQY A;  3CQG B;  4LNU D;  2XGO A;  4TUM A;  1JUQ A;  3FFL A;  4GA2 A;  4ILG A;  3U64 A;  1H2U A;  5JMN D;  3IKO B;  4FHK A;  3ZRH A;  2MYO A;  3EHM A;  2J9Q A;  4AXH A;  1FVH A;  2XEV A;  3B7B A;  2LO6 A;  2I2O A;  1TNO A;  2Y4U A;  3JQ0 A;  5KJM A;  3GYZ A;  2XPZ A;  4LUN U;  5G05 C;  1TEZ A;  2GRR B;  3L08 A;  2J4B A;  3U66 A;  4E6H A;  4RLY A;  3RAU A;  3BU8 A;  2R03 A;  3R9M A;  3CIA A;  4N2S A;  4MLP A;  4AY6 A;  3QNK A;  4R7L A;  2CG2 A;  1Q2Z A;  5C2Y A;  1V54 E;  5FQ7 A;  2H6G A;  2AXZ A;  4K03 A;  4DI4 A;  3DSX A;  2NSZ A;  3UT7 A;  5ARG A;  1IQU A;  2Y4T A;  5BV1 A;  2P9I G;  1HFA A;  5EKQ D;  4A3V A;  1UJK A;  2EQX A;  2DYR E;  3IXE A;  3Q9N C;  3DEP A;  4UWK A;  4RG6 A;  2ETB A;  1D9S A;  3TGO A;  3D9L A;  3PZ3 A;  2P9U G;  4XE0 A;  2L9B A;  3DXK G;  2FBN A;  4CYM D;  3TAX A;  4H7Y A;  2IQC A;  1TJF A;  3UPV A;  4EZK A;  3QAR A;  4WAF A;  2I9C A;  2HR2 A;  4KT6 B;  1NZN A;  3T5V A;  3DWL G;  5AQA A;  3FTS A;  4HLL A;  4B93 B;  1N95 A;  1K1A A;  1ZBP A;  4PUC A;  5CMW A;  2DCP A;  4FLB A;  3CVL A;  2WPV A;  2R59 A;  4JEU A;  3T8K A;  4JL0 A;  3APD A;  3UTM A;  3DSS A;  3PEV B;  2VTB A;  3HIZ A;  3G2V A;  3DBS A;  4N3B A;  5IY5 E;  3FU0 A;  4Z68 A;  3G2U A;  3NZU A;  2R5S A;  5CBN A;  2I1K A;  3E37 A;  5H7P A;  2C0M A;  4PS8 A;  2CFU A;  3Q7A A;  2MOW A;  3PRZ A;  4BTB A;  2H6I A;  1JWF A;  2L6J A;  4FAD A;  4U7E B;  1HX8 A;  3UUX A;  1MX4 A;  3FU6 A;  3QWV A;  2GRL A;  4KZC A;  4DK5 A;  3JYS A;  1IKN D;  3ZGQ A;  2P9K G;  5CCL A;  5FJY A;  3FP3 A;  4BSZ B;  2AWI A;  2XEH A;  2DZO A;  3L54 A;  3V31 A;  4C9B B;  4CDM A;  4A63 B;  2QYU A;  3ESK A;  1S64 A;  2XCB A;  3AG1 E;  2YIN A;  3PUJ A;  2LSV A;  4JHJ A;  5BW8 C;  2X6K A;  4O1O A;  1UOH A;  1UN9 A;  2VYI A;  3HVE A;  1HO8 A;  1N52 A;  5HQ8 A;  3CK7 A;  1FCH A;  4HNA D;  3L6A A;  2IFU A;  4BT8 A;  4C48 B;  2YNQ A;  4ACK A;  2P9L G;  4U07 A;  2LUH A;  2FF4 A;  4YDO A;  5DBK A;  4G23 A;  4UI9 C;  1JCQ A;  4JW1 A;  2A5U A;  3R7Q A;  3L17 A;  3BQO A;  1ZU2 A;  5G2N A;  4CT4 A;  3D9O A;  4HRM B;  4HVB A;  5ANR A;  1XNF A;  2VSY A;  2FUL A;  3E33 A;  2VTB B;  3CHR A;  3EHQ A;  2VGX A;  3FUL A;  4AV7 A;  4B89 A;  5AJL A;  2FO7 A;  4ME2 A;  4FU3 A;  5FQ4 A;  4ABN A;  2XZT G;  5BT1 A;  3D3M A;  1MZC A;  3UKU G;  5JJT A;  3ABL E;  4LER A;  1GW6 A;  2QZA A;  3FTW A;  3ZYK A;  5HS0 A;  3E4B A;  4PS3 A;  3SF4 A;  3JQ1 A;  1H6P A;  2NYJ A;  3NB2 A;  5BV0 A;  5EIB E;  3EJN A;  4JVS A;  4HOU A;  4W9R A;  2BF0 X;  3CQC B;  1MHQ A;  2ION A;  2Y3A A;  3ZFW A;  3ONL A;  4F1S A;  1N11 A;  4XX5 A; 
#chains in the Genus database with same CATH homology
 4YND A;  3TJP A;  4A3T A;  1E8Y A;  3ASG A;  4FP7 A;  3VTY A;  1OUV A;  3CHM A;  2PQN A;  3LY8 A;  4UI9 J;  3MZL B;  1YA0 A;  2P58 C;  4GMJ A;  3CVX A;  4E85 A;  2UY1 B;  2WXM A;  2QY7 A;  4JA9 A;  2WXP A;  4V3I A;  5ARF A;  4ACL A;  3ZXS A;  3EHN A;  4GU5 A;  2IJG X;  4A1S A;  4ANU A;  2WMN A;  3CKC A;  3CV0 A;  4GA0 A;  2L0T B;  3U3W A;  4JHR A;  2KCK A;  1EF1 C;  3LVR E;  1QNF A;  4H7X A;  3FUE A;  3S7B A;  2J07 A;  1E8W A;  4GZ5 A;  3FUI A;  3FTY A;  2FI7 A;  2WMO A;  4JHK A;  5J08 A;  1ELW A;  3CVY A;  4J8E A;  5JHA A;  4GAA A;  3CK9 A;  4AP2 A;  4N2Q A;  3BG1 B;  5KJK A;  4KBQ A;  3CHO A;  4IRU A;  2WXI A;  3LS8 A;  2L0I A;  4TUU A;  4UQX A;  3FDH A;  3HYM B;  3N71 A;  3CVV A;  3RU0 A;  4WWO A;  1H2V C;  3APC A;  3QDN A;  4UQY A;  3CQG B;  3K9I A;  1WM5 A;  3L16 A;  3HVE B;  3UQ3 A;  3RRU A;  2AVP A;  2XGO A;  3RK6 A;  1JUQ A;  3TXN A;  4B8C B;  4BSX A;  3CVW A;  1U3D A;  4NQ0 A;  3FFL A;  3TL5 A;  3LY9 A;  4GCO A;  3CVN A;  3S7F A;  3T5X A;  4GA2 A;  2I1J A;  4DI3 A;  1E8X A;  4ILG A;  1HG5 A;  4I6J A;  4AOF A;  4I9E A;  1XGW A;  1H2U A;  3CSF A;  3OXL A;  3U64 A;  4HOT A;  3QOU A;  4GPK A;  3IKO B;  4FHK A;  3ZRH A;  3WXX A;  1N54 A;  3PE4 A;  4UQZ A;  4YVQ C;  2VQ2 A;  4RVB A;  3EHM A;  2J9Q A;  3FY4 A;  4AXH A;  4JA7 A;  1FVH A;  2WM9 A;  2XEV A;  3AU5 A;  2LO6 A;  4BY6 A;  1HG2 A;  4KMO A;  2I2O A;  3CK8 A;  2Y4U A;  3JQ0 A;  1INZ A;  2A4Z A;  5KJM A;  4I2W A;  3GYZ A;  3D9N A;  4NAC A;  2XPZ A;  4EBA A;  3CHP A;  2AXV A;  3I4G A;  3OAW A;  4JC8 A;  2WXJ A;  4LUN U;  4L23 A;  4Q94 A;  4UWH A;  5G05 C;  4U8H A;  4XI9 A;  4F53 A;  5JJ7 A;  1TEZ A;  3L08 A;  4I6E A;  4DJA A;  1BPO A;  3S7D A;  3ZEF A;  3ASH A;  3UMV A;  1H19 A;  2J4B A;  3C98 A;  3LYA A;  3MKQ A;  2CHX A;  3AS5 A;  5ENN A;  4D10 C;  3U66 A;  2C0L A;  4L2Y A;  3FUM A;  4FUL A;  4CDN A;  4E6H A;  1JPL A;  3MYV A;  2WXK A;  4IYP A;  2NXP A;  5D0O D;  2VGX B;  3JUI A;  1HH8 A;  4J8S A;  3EIQ C;  3RRM B;  3BG0 B;  4EEC A;  3ULQ A;  1DVP A;  3CHQ A;  3CIA A;  2BUG A;  3ENE A;  4N2S A;  4MLP A;  5BPP A;  2FEZ A;  4AY6 A;  3QNK A;  4R7L A;  4CGV A;  3IHV A;  2CG2 A;  2WXR A;  3VLE A;  1OWO A;  4ILI A;  5C2Y A;  4OYS A;  4YVO A;  5FQ7 A;  4B0Z A;  2AXZ A;  3T8M A;  4K03 A;  4DI4 A;  3SGH A;  1SQM A;  3FEX A;  1E7U A;  5CMY A;  4G11 A;  3G2S A;  3PE3 A;  2NSZ A;  4XI0 A;  4GYY A;  4J0U A;  3P2B A;  4U04 A;  3UT7 A;  1HU3 A;  1E7V A;  3S7J A;  1OWP A;  3LPZ A;  3P1U A;  5ARG A;  1IQU A;  1NA0 A;  4BTA A;  3FUJ A;  3CVQ A;  4KVO A;  2Y4T A;  4XKC A;  4K0R A;  3URZ A;  5BV1 A;  1JWG A;  4BFR A;  2YHC A;  3LKU A;  1HFA A;  5FZQ A;  4FJZ A;  3PUK A;  3I4R B;  5D0Q D;  3OXG A;  1SZA A;  4GYW A;  4HLE A;  4PH4 B;  3ZHE A;  5EKQ D;  4A3V A;  2XGS A;  2CFZ A;  3JCK C;  1UJK A;  1TJC A;  2EQX A;  2RD0 A;  4C0E A;  1Y6I A;  2X6H A;  4JXT A;  2M63 A;  2WVI A;  4KXK B;  5BNW A;  5LCW J;  2KCL A;  4EPZ A;  4UWK A;  3GZ1 A;  2KZT A;  4KZ0 A;  4RG6 A;  3SBT B;  2WQ7 A;  3TGO A;  3OTN A;  3RO2 A;  2LAI A;  1W3B A;  3RO3 A;  5KJN A;  4GB9 A;  5EX0 A;  5FWQ A;  3D9L A;  3DPD A;  1UG3 A;  4XE0 A;  5T8I A;  2J08 A;  2L9B A;  2WXL A;  4WNG A;  2WXG A;  5FZR A;  2KAT A;  2X3M A;  3QC1 A;  4U0S A;  4WUY A;  3R7R A;  2WXN A;  2FBN A;  4I17 A;  2XRZ A;  3CEQ A;  3TAX A;  1ELK A;  4P29 A;  1HF8 A;  2IOS A;  4H7Y A;  3U4T A;  2IQC A;  3ZPJ A;  4CT0 A;  1TJF A;  3UPV A;  4EZK A;  3FH5 A;  4GML A;  3QAR A;  2YQ8 A;  3MV3 B;  4WAF A;  2I9C A;  4L7T A;  1KT0 A;  3RKV A;  4FC8 A;  1KLX A;  2HR2 A;  3FWV A;  3TG5 A;  5C1D A;  5G04 C;  4KT6 B;  1A17 A;  1NZN A;  1OWN A;  4BT9 A;  3O48 A;  2JEK A;  4M3O A;  4KVM A;  3QWP A;  3T5V A;  3KEZ A;  2XPY A;  3B7U X;  2HO1 A;  3KS2 A;  4J6I A;  4I2Z A;  4U0U A;  2I6H A;  4LCT A;  2C2L A;  3CHS A;  5CHE E;  3ML9 A;  4F7A A;  1UW4 B;  1H0A A;  4CDR A;  5KJL A;  2LNI A;  3GW4 A;  1H2T C;  4CGW A;  2YHE A;  4QFV A;  2WB2 A;  4ATG A;  4WNE A;  3MKR A;  4CEM A;  2PM6 A;  4GZD A;  3FTS A;  3HDX A;  3Q4A B;  4U63 A;  5DIZ A;  4AEZ C;  3MX3 A;  5BUZ A;  3FUD A;  2KC7 A;  5JJ6 A;  3FTV A;  3LXU X;  4AVX A;  2R17 C;  3ZIM A;  1NA3 A;  5A7D B;  1ZBP A;  4FA6 A;  1PAQ A;  4CRW A;  5LP0 A;  4PUC A;  1FVF A;  5CMW A;  5KCM A;  2DCP A;  2V4L A;  4I9C A;  4FLB A;  2V5F A;  3GZS A;  1MQS A;  3Q5M A;  3CVL A;  4Q96 A;  2IF4 A;  2WPV A;  3ONK A;  2R59 A;  4JEU A;  3QJZ A;  3FU3 A;  3ZYQ A;  3Q47 B;  4JL0 A;  3GZ2 A;  3APD A;  3PEV B;  1LF8 A;  3VTX A;  4WNF A;  2VTB A;  2AW6 A;  3PDN A;  3HIZ A;  3NZS A;  4UWF A;  3FEY A;  3G2V A;  1NP7 A;  2CHW A;  2X6I A;  2X6J A;  3DBS A;  4N3B A;  3SBS A;  1EDU A;  3FUH A;  2X38 A;  4FJY A;  3UT4 A;  3FU0 A;  3UX4 A;  3G2U A;  1OWL A;  3NZU A;  5A23 A;  4BWR A;  2MRI A;  2R5S A;  4HS2 A;  3SD5 A;  4DLO A;  3UT8 A;  3CVP A;  3I5P A;  4FLH A;  5ANL A;  1VDY A;  3SHF A;  2I1K A;  2J09 A;  3MGB A;  2C0M A;  4PS8 A;  3ASF A;  4Y6W A;  1P5Q A;  3MKQ B;  4HOS A;  4GZ6 A;  1PY1 A;  3FTX A;  3RJV A;  2CFU A;  1HS6 A;  2MOW A;  3AU4 A;  3PRZ A;  5LX8 A;  2WXF A;  4BTB A;  2CG3 A;  4GZC A;  1JWF A;  5JHB A;  2JLB A;  2L6J A;  3FHE A;  3OXF A;  4WWN A;  4B8A A;  5LOZ A;  4FAD A;  3LCA A;  1QZ2 A;  3LY7 A;  1HX8 A;  3AS4 A;  2ILR A;  4APF A;  2QFC A;  2VGY A;  3UUX A;  3QKY A;  3IBE A;  2LAH A;  4WWP A;  3B13 A;  2ZU6 B;  3FUF A;  3G2T A;  3MEK A;  4F3V A;  4J8D A;  2PM7 A;  3RIB A;  3FU6 A;  4EQF A;  5G04 J;  4OVU A;  4ILH B;  3D9J A;  3D9P A;  2VJ8 A;  3QWV A;  2GRL A;  3CKB A;  3LJ3 A;  1L5J A;  3R9A B;  4KZC A;  4PS7 A;  4DK5 A;  3JYS A;  4LRZ A;  4HOR A;  5CCM A;  3PNT B;  2DIW A;  3ZGQ A;  4XKB A;  4I1M A;  1WY6 A;  3L13 A;  3MV2 B;  3QAQ A;  3RRN B;  4IUL A;  5CCL A;  2E2E A;  3IHY A;  1IQR A;  1OWM A;  4HXI A;  5FJY A;  4GA1 A;  5FQ6 A;  2OVB A;  3CR3 A;  3FP3 A;  4ANV A;  2PZI A;  2AWI A;  4RSY A;  3ZYL A;  2X6F A;  2HYZ A;  3ZHE B;  2IU1 A;  4G26 A;  3D9K A;  1HE8 A;  3L54 A;  2PL2 A;  2UY1 A;  4G1T A;  4GZ3 A;  1Y8M A;  4C9B B;  5FZS A;  4XZ4 A;  3ASD A;  4G2V A;  2KCV A;  3APF A;  4PDX A;  4CDM A;  2KZT B;  2XQ0 A;  2RG8 A;  3ESL A;  3ESK A;  4I1O B;  4MRU A;  3PNL B;  1X5B A;  2MHK A;  2XCB A;  5G05 J;  3ZW3 A;  1E96 B;  4URK A;  3L22 A;  3U9W A;  4TRQ A;  3FUN A;  5T3R A;  4I6G A;  2YIN A;  1Z6T A;  4WND A;  4NRH B;  3S2A A;  2VSO E;  3PUJ A;  4GCN A;  1B89 A;  2LSV A;  4JPS A;  2XCC A;  4JHJ A;  4APO A;  1IYG A;  2UWJ G;  4A1G A;  5BW8 C;  2X6K A;  3FUK A;  3PVL A;  1UN9 A;  3QB2 A;  2V0P A;  1UN8 A;  2J49 A;  3LVQ E;  4JZY A;  3CVU A;  4L1B A;  2LSU A;  3TXM A;  5LFA A;  2VYI A;  2GGF A;  4G24 A;  3HVE A;  1HO8 A;  3D9I A;  1WAO 1;  3QWW A;  4HFG A;  1N52 A;  2VSX E;  5HQ8 A;  3CK7 A;  1FCH A;  3PH0 C;  4O6F A;  2XGM A;  2XPI A;  1SZ9 A;  4I43 A;  2AXU A;  3SFZ A;  5HI7 A;  4HOQ A;  4A55 A;  3PS6 A;  3ZVV A;  3KAE A;  2V8S E;  3L6A A;  4AJW A;  2IFU A;  4BT8 A;  2OVF A;  1HZ4 A;  2YNQ A;  2WQ6 A;  4ACK A;  4MS6 A;  4U07 A;  4ANW A;  4UWL A;  3PRE A;  2FF4 A;  5EX3 A;  4LEU A;  5LCW C;  4Y6C A;  5DBK A;  4G25 A;  4G23 A;  2NC9 A;  3FH8 A;  2OND A;  4UI9 C;  2IOL A;  3SNX A;  3AS8 A;  1UJJ A;  3FU5 A;  3ML8 A;  4JW1 A;  4NUR A;  5FQ8 A;  2A5U A;  1HXI A;  3Q15 A;  3D9M A;  3FTZ A;  1H6K A;  3R7Q A;  3L17 A;  1KT1 A;  4UWG A;  3MJW A;  1ZU2 A;  3PZD A;  2BTD A;  3B7R L;  5G2N A;  1QQE A;  3D9O A;  4CT4 A;  4HVB A;  5ANR A;  1XNF A;  3TG4 A;  4N3A A;  2VSY A;  4N5C A;  1S0P A;  4MKT A;  2FUL A;  2VTB B;  3CHR A;  3B7T A;  4BX8 A;  4Q69 A;  2HM8 A;  4DPR A;  3QK0 A;  5AEN A;  2J4D A;  2VGX A;  2CHZ A;  5M72 A;  3FUL A;  1IHG A;  4AV7 A;  3CLJ A;  3MA5 A;  4B89 A;  4EBA G;  2PQR A;  1E8Z A;  5EDS A;  4CCA A;  5AJL A;  3CST A;  2FO7 A;  4JEH A;  2GW1 A;  4ME2 A;  4N39 A;  3ZYM A;  1Z3X A;  3HHM A;  4FU3 A;  3I3N A;  4RG9 A;  5FQ4 A;  5AYW D;  3VLF A;  4ABN A;  5BT1 A;  5J90 A;  4OVV A;  4GYO A;  1E90 A;  3D3M A;  3NQP A;  5AJD A;  3SZ7 A;  4J8F A;  3CGH A;  3LEW A;  2GRM A;  3FH7 A;  2VSN A;  5G55 A;  5T4Y A;  4UI9 K;  5JJT A;  3BEE A;  2OV8 A;  1ELR A;  3O4Z A;  2OOE A;  3Q49 B;  4BX9 A;  3EDT B;  4LER A;  3ZN3 A;  1GW6 A;  3FTW A;  4AY5 A;  3ZYK A;  2E0I A;  2XHE A;  3KD7 A;  5FTP A;  2XRY A;  3E4B A;  5A6C A;  1Z3Y A;  4PS3 A;  4C0M A;  3VLD A;  4IN3 B;  3SF4 A;  2WXO A;  2WQH A;  3JQ1 A;  3FTU A;  2WXH A;  2WXQ A;  2Q7F A;  5FT9 A;  4U0Z A;  4FHJ A;  4TV3 A;  4DLQ A;  3IEG A;  1EYH A;  3MCX A;  1PC2 A;  4I1A A;  4AIF A;  5BV0 A;  3EIJ A;  4N3C A;  1U3C A;  4B94 A;  3EJN A;  3G2W A;  4HOU A;  4JVS A;  2BF0 X;  3CQC B;  4W9R A;  1EPU A;  1MHQ A;  2ION A;  3IV0 A;  3NF1 A;  5AIJ A;  4ANX A;  4KYO B;  2Y3A A;  4XIF A;  5E75 A;  4L2L A;  2KM4 A;  5E76 A;  3ZFW A;  3ONL A;  4F1S A;  4EZJ A;  3SI5 A;  4EZL A;  4AM9 A;  3B7S A;  3PEU B;  2DBA A;  3LDZ A;  4XX5 A;  1DNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...