1VDYA

Nmr structure of the hypothetical enth-vhs domain at3g16270 from arabidopsis thaliana
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
140
structure length
140
Chain Sequence
GSSGSSGESYWRSRMIDAVTSDEDKVAPVYKLEEICDLLRSSHVSIVKEFSEFILKRLDNKSPIVKQKALRLIKYAVGKSGSEFRREMQRNSVAVRNLFHYKGHPDPLKGDALNKAVRETAHETISAIFSEENGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein (RAFL09-17-B18)
publication title Solution structure of the hypothetical ENTH-VHS domain AT3G16270 from arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 40
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2004-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1vdyA00
3D9NA 4FU3A 2DCPA 2V8SE 3D9OA 3LDZA 4GZCA 3D9PA 1HG2A 1SZAA 1HFAA 5CMYA 3RRUA 4AVXA 5J08A 5LP0A 1MHQA 1PY1A 1VDYA 3D9JA 2KM4A 4GZDA 3ONLA 1JWFA 3ONKA 2QY7A 3CLJA 4NACA 1EYHA 3ZYLA 4Q96A 1H0AA 3ZYQA 3G2VA 3ZYKA 3ZYMA 2MOWA 1LF8A 4JXTA 4HFGA 1ELKA 1SZ9A 3D9IA 3G2SA 1EDUA 3G2WA 1JUQA 5LOZA 2L0IA 1HG5A 1XGWA 4FLBA 3D9LA 2LO6A 3D9MA 2BF0X 5CMWA 1INZA 1DVPA 1HX8A 1HF8A 2DIWA 4Q94A 3G2TA 1UJJA 1JPLA 1JWGA 1X5BA 3G2UA 3D9KA 1UJKA 2L0TB
chains in the Genus database with same CATH superfamily
4CZ2D 3PDNA 5FTPA 1S64A 3CKCA 2A5EA 5LCWJ 1N54A 4BWRA 4RSYA 1B89A 4P29A 4LSZE 3VTYA 4F7AA 2XCCA 2WPVA 2X6KA 2WM9A 2IO3C 1DCEA 3D9HA 2P9IG 3DSWA 3UM2A 5AQAA 4HFGA 3CHOA 5ITZF 3BQOA 2KZTB 3ABLE 1KPSB 2P9SG 3ZXPA 1JPLA 1BU9A 3UI2A 1NA3A 1LD8A 2DCPA 4L9PA 1VDYA 2GRNB 1A5EA 3PVLA 2LXLA 3LY9A 5HQ8A 2YHEA 2HYZA 5ENPD 2LNIA 3CVNA 1U3DA 2J49A 4I9EA 5BXUA 1QQEA 4WWNA 2KATA 3TGOA 4UI9K 4U7EB 3FUKA 4EZKA 3Q79A 3CHPA 4U96D 2XZTG 2ZISA 4XEIG 2J8SD 1W3BA 5CBNA 4CGWA 2B0OE 3EHQA 2ZGGA 1LF8A 4GZ6A 5E76A 5HS0A 4HS2A 3APDA 3EUVA 1IHGA 3CGHA 3ENEA 5JHBA 4PS8A 1TNUA 4JEUA 2Y4TA 4JD2G 4GB9A 1D8DA 1DNPA 2VSNA 4U95D 3RJVA 4B0ZA 3FU6A 3HVEA 2AXUA 4BT8A 3PNLB 3MV2B 4J7WA 3L16A 3TG4A 1N0QA 4OVVA 4OAVB 5BPPA 1RZ4A 3ESLA 2GW1A 3I5PA 2V4LA 2QY7A 2R03A 3SI5A 4ANVA 3Q9UC 2AVPA 1KT1A 2CFZA 2ZXWE 4GTRA 2FF4A 3CK8A 3FULA 1X81A 4GZCA 2XGOA 1H2UA 4UI9C 5B3SE 3T9KA 4A55A 3MKQA 3EHRA 4C0EA 5AENA 1TNOA 4UWFA 3EHNA 2OVFA 1HH8A 2WXQA 3FWVA 3MEKA 3QNKA 3SBSA 1ZB1A 3EDTB 5M72A 4G8LA 2XEVA 1OY3D 5FZQA 4GZ5A 2R17C 5B1AE 3J5PA 4WUYA 2PQNA 4F6RD 3LYAA 3UKUG 4FLHA 4KZCA 3NQPA 1TJFA 4A1GA 4HOUA 2XGSA 2KCVA 2KC7A 2WQHA 3HXFA 3FFLA 5BW8C 2PZIA 1UN8A 3E30A 2Y0BG 4G25A 2IU1A 2FO1E 3PEVB 4U8HA 3D9KA 4FA6A 5CCLA 3NOCD 4FADA 4HORA 3GZ1A 4V3IA 3TWSA 4JEHA 3B95A 4I17A 1TEZA 3G2WA 4M3OA 2MHKA 4XKBA 3DSUA 3AG4E 1HZ4A 1HO8A 1AP7A 4HVBA 1HU3A 1N95A 4YDYA 4LERA 1NFIE 3QAQA 4GA1A 2J08A 3KEAA 5CHEE 3CK9A 3R9MA 4GU5A 1DVPA 1MJ0A 5ENNA 4DX5D 1WAO1 3CEQA 4JHKA 5FIOA 3PZ2A 3UMVA 3JYSA 1FCHA 2V5QC 3W9GA 3GZ2A 2GROB 3Q75A 4B93B 1IQRA 3ZGQA 3TWVA 2ONDA 4CEMA 1JCRA 1TNYA 2IQCA 4G11A 2J09A 4C9BB 2RG8A 1UG3A 4GTTA 4RG9A 3UIOC 2BKGA 2F0YA 1U3CA 4J6IA 4UQXA 4L7TA 2WB2A 2OVBA 3D9JA 4GMLA 3S7DA 3L9TA 2CFUA 4B94A 5ENSD 3C3QA 1N94A 2FO7A 2H6IA 3C3RA 4B8CB 2CHWA 3UXGA 1TR4A 4GTQA 4PS3A 4G24A 2UY1B 3D9NA 4WAFA 1E8YA 1O5MA 3GYZA 2GRQB 1E8ZA 3MCXA 4JC8A 3TWUA 1SA4A 2HM8A 2IY0C 4I43A 3BUAA 5EILA 3DSVA 3RRNB 4YDOA 4OVUA 4ATZD 1FT2A 3ZVVA 2ZGDA 3DPDA 2HR2A 4DX7D 4NACA 2EIJE 4APFA 5JMND 3TWWA 1MZCA 3L08A 3RO2A 2LXMA 3CQGB 4WNGA 4FULA 3QARA 4LUNU 4K5AB 5EN5D 1D9SA 4I1OB 4PDXA 3NBNB 4AJWA 1G3NB 4XI0A 3ZYQA 1DCQA 4Y6CA 2WQ7A 3IHVA 4YVOA 4GTVA 4JA9A 1EF1C 4DLQA 2OCCE 5HRYA 3RRUA 2X6HA 2VGXB 4AY5A 3FUNA 4HRLA 3PUKA 3ZU7B 3IBEA 2LO6A 3CHMA 3UM1A 4DX6D 4TXQA 4Z68A 3AS8A 5KJLA 4NURA 5CBOA 3ZNGA 1Y6IA 1KLXA 3SZ7A 3QB2A 2ETCA 2RD0A 4DLOA 3GW4A 3IHYA 3CV0A 1BI8B 4GMJA 4BTAA 1O1TA 1HF8A 3ISMC 3ULQA 3UTMA 3DEOA 1Q2ZA 4AVXA 5B1BE 3X2QE 3CIAA 3OXLA 4TXRA 4JB8P 4DX2A 4J8YA 1OCRE 2CG3A 3SFXA 1YMPA 2KCLA 4I1MA 3G2UA 2PL2A 5EYPF 5HI7A 2LSVA 3FUEA 4R7LA 2OOEA 2JEKA 4PS7A 2IF4A 1S70B 4A3VA 3C5RA 2DYRE 1Z5SC 4DX1A 4L1BA 5FQ7A 1UN9A 4ANWA 3G2SA 3JCKC 5FT9A 2JLBA 5AQ7A 2RFMA 3ABKE 4GPKA 1N9AA 4ZFHA 1H2VC 5FJYA 3MKRA 1SQMA 3D9OA 3I4GA 5J08A 3QC1A 4MKTA 2WXOA 3G2VA 2J4DA 5ANLA 4EZJA 3B7TA 3J5QB 2HO1A 4YNDA 5CMWA 1N4PA 3CVWA 3LEWA 3KSQA 5H7PA 1KZPA 2IJGX 4K5BA 3TWRA 3RU0A 1TN7A 2EINE 3L13A 1E90A 4KVMA 3UM0A 4DJAA 4HLLA 3PH0C 3KEZA 4J8EA 4PUCA 1FT1A 2DZOA 2YHCA 1MYOA 3WG7E 1PAQA 1WM5A 1OWMA 2FULA 3QWPA 4JA7A 3FTYA 1UJKA 3LPZA 5LP0A 4QFVA 3IKOB 4U04A 1YYHA 1S63A 4C48B 1UW4B 5E75A 3TWXA 4N39A 4BT9A 3AG2E 2IOSA 2F37A 1BD8A 2Y3AA 3K9IA 5DBKA 4JHRA 3FH5A 3UT7A 1MHQA 3BG1B 2CG2A 4J8SA 1P5QA 1E7UA 4B8AA 4CDRA 3MYVA 4MLPA 4U07A 4CT4A 2GRMA 2R05A 5LX8A 4E85A 3QJZA 3B7SA 4A3TA 3E37A 5BV1A 5ENTD 1MX2A 4GCNA 3OXFA 4AP2A 4MBGA 3SO8A 4ATGA 1OWLA 1QYMA 3BEEA 3SHFA 2WXLA 3ZN3A 1N0RA 5FZRA 4I1AA 1INZA 3CVUA 4H7YA 4DI3A 3V79K 1L5JA 3DPYA 4AY6A 4FU3A 3NAWA 5EX0A 1IKND 3P2BA 3JUEA 1JWFA 3L6AA 3PZ4A 4HOSA 5T8IA 2AW6A 2M63A 5CRUA 1MQSA 3ZKJA 1V54E 2PQRA 1JCSA 3L22A 3TWQA 2X38A 1PY1A 3FUDA 3LKUA 4ANXA 5KJMA 2XS1A 1FVHA 4HB5A 4BFRA 1NA0A 5G55A 3FEXA 2R5SA 3UM3A 2H6FA 5D0QD 3FU0A 3SD5A 4FLBA 2Q7FA 4EECA 4CGVA 3CVQA 2LUHA 5ENRD 5JA4D 5KJNA 4U8VD 4MS6A 5KCMA 4CDNA 2L6JA 2R59A 4BESA 2X3MA 5ENOD 3KS2A 4WNDA 5C2YA 3UIPC 3RRMB 2WXKA 4DUIA 3SFZA 3CVPA 1ELWA 3HXEA 4EQFA 4F1SA 4WNEA 4GPMA 4I6GA 4JZYA 3PE3A 2EILE 4CCAA 1V55E 3FHEA 1HE8A 3QDNA 5KNHD 4N5QA 5BV0A 2IONA 2VSYA 4LNBA 4F1PA 5T3RA 2IO2C 2PM6A 3ONLA 3DXMG 4BTBA 3UQ3A 3CSFA 5FZSA 5A6CA 1OXJA 5JJ7A 3PUJA 2VTBB 3PREA 3PNTB 4HI8A 3CVLA 1EYHA 3AU5A 1WY6A 2ZIRA 3MJWA 5ARGA 4UI9J 3MKQB 2QYJA 3ZHEA 1OT8A 4BX9A 4L23A 4CDMA 3TXMA 4DK5A 4IN3B 5IY5E 3RIBA 3Q47B 1S0PA 4GTMA 2Y4UA 4EBAG 2DVWA 3B7BA 4GA2A 2C0MA 1XNFA 3HXBA 5D2MC 3R9AB 4C0MA 4HOQA 3FH7A 4BY6A 4FHKA 3SFYA 3V31A 2L0TB 2ZU6B 1H2TC 2KXPC 3FU5A 2GRLA 3U9WA 4APOA 3Q4AB 4RLYA 2ETAA 3VLFA 3ZFWA 4Q94A 4KZ0A 1N52A 4D10C 3G2TA 3APCA 3DEPA 4L2LA 4A63B 3T5VA 2WMOA 5ANRA 2V5FA 3CR3A 3ZEFA 4N3BA 2GGFA 1IYGA 3HDXA 1DC2A 4AOFA 4OYSA 4GAAA 3L54A 1OCOE 2Y1LE 3ML9A 4I6EA 5A7DB 3LCAA 1JWGA 3IXEA 4KT6B 1H6KA 2A5UA 3HG0D 1BI7B 4EHMA 3KD7A 4L2YA 2VGXA 4U0UA 1ZU2A 4GTOA 2PM7A 3AJIA 3BU8A 2FI7A 4AM9A 3LJ3A 3IV0A 1D8EA 4AV7A 5HKPA 1OWOA 3C98A 4OAUC 1OWNA 1TNZA 1IQUA 2VGEA 4IULA 3ASNE 3B7RL 2KBXA 3AS5A 4XKCA 1E8WA 4UWLA 4LG6A 3L17A 1H6OA 2QYUA 4TUMA 2WMNA 5JJ6A 3EU9A 3U66A 2JABA 4GZDA 4JPSA 4NRHB 2MOWA 3PS6A 3ZPJA 2DZNA 2WXNA 3CHSA 2E2EA 4KBQA 3B7UX 3DSSA 4QQIA 4EBAA 1AWCB 1OCCE 3LDZA 1TNBA 3HYMB 3O48A 2XPIA 4UQZA 2KM4A 2DWZA 3DBSA 3EU5A 3BG0B 3ZYMA 3C3OA 3CK7A 1HG5A 2V4HC 2YQ8A 4JVSA 4F3VA 2XRZA 5EKQD 3CHQA 2RKKA 4UQYA 4PH4B 3LY7A 5LCWC 3MV3B 4XIFA 3IEGA 5EX3A 5J90A 4ACKA 4BERA 5AN8A 3Q5MA 5A23A 2Y69E 3D3MA 1O1SA 1EDUA 3CVXA 5D66A 1IHBA 2MRIA 3OAWA 2F8XK 4CRWA 3PEUB 4M7CA 4K03A 4G23A 2P2CP 2V0PA 2R02A 4HQDA 1Z6TA 2X6JA 3RAUA 2EIME 2BTDA 2KZTA 3UPVA 3R7QA 1H6PA 2FBNA 5AQ9A 3FTSA 4J0UA 3QWWA 3V2XA 4NIKA 3FUIA 5CCMA 3MX3A 2AXZA 4DI4A 3Q49B 4BSXA 1PC2A 2CHXA 3LXUX 5JJTA 3PRZA 5ARFA 3E4BA 4G1TA 4WWPA 3SBTB 3APFA 2H6GA 3MA5A 5FINA 3DXKG 4JW1A 4U8YD 2P9UG 2C2LA 3U3WA 1K3ZD 2IEJA 2X6FA 2IOLA 4GYWA 4CT0A 3QK0A 4JXTA 2NYJA 2VYIA 3KSLA 3ASGA 3FUJA 3DSTA 3JQ0A 4K0RA 1ZBPA 2RFAA 4WWOA 1E8XA 3D9PA 4DPRA 2GRRB 4ILHB 1K1BA 3U4TA 1RW2A 3WXXA 1SZAA 1TYQG 5BT1A 3NOGD 4ILIA 5EIDA 3TXNA 5AJDA 5G05C 3LJNA 5BUZA 4O1PA 1A17A 3JXIA 2WXPA 3NB2A 4U63A 4LEUA 5BXOA 3FTWA 1HX8A 1N4RA 5KWDA 1Z3YA 4I6JA 4A1SA 5KNGA 5FWQA 3I4RB 3HRAA 1EPUA 3QKYA 4KVOA 2XPYA 3JUIA 3N71A 1NI1A 3AAAC 3FEYA 3CVVA 3HIZA 2B6CA 5ENQD 4ZHBA 4ME2A 3NZUA 3SY2A 3UKRG 3NF1A 4I9CA 4IRUA 3PZ1A 3EIJA 3SGHA 2VSXE 3SQVA 2I2OA 2OV8A 1FPPA 4YVQC 4HI9A 3NZSA 5BNWA 2UWJG 2AJAA 2LAHA 3S7FA 4G8KA 3FUMA 4UUCA 1ELKA 3ULYA 3HXDA 4XI9A 3PE4A 4WNFA 3JXJA 4MRUA 3TAXA 4GMRA 3KAEA 5CEAA 1Y8MA 1HS6A 3F6QA 3LVQE 1HFAA 2NC9A 1QZ2A 5FQ4A 4EPZA 2E0IA 2H6HA 5JHAA 5G05J 4EZLA 5G2NA 3DRAA 2A4ZA 3ASDA 3D9MA 2QFCA 1GW6A 3VLDA 2BEDA 3S2AA 4U0ZA 3I3NA 2NSZA 2WXIA 3O4ZA 4FJYA 4FP7A 1NZNA 3RK6A 5AIJA 2VSOE 2DYSE 2DBAA 1U2VG 4UWKA 2XCBA 3SF4A 5AAOA 4XE0A 3UX4A 3TJPA 2I9CA 3TG5A 3ZW3A 4HBDA 5G04C 4I2WA 2X6IA 2VGYA 2LAIA 3RKVA 4HRNA 3ZXSA 5FQ8A 3D9LA 4DRXE 2FEZA 2VTBA 3RO3A 5KJKA 4B89A 3L82A 2P9NG 4FC8A 4Y6WA 3JQ1A 3ESKA 4N2SA 4ABNA 1TN6A 4RVBA 4HRMB 3T8KA 2WXGA 2YNQA 2OEWA 3VLEA 3ASFA 3HVEB 3FUFA 3AU4A 4F53A 4BSZB 3TL5A 3CSTA 2PNNA 5CMYA 1WDYA 3W9FA 4XZ4A 2WVIA 3S7JA 3D9IA 3GZSA 4GTPA 4YDWA 3FP3A 4N3CA 2J07A 1OCZE 2AWIA 2XPZA 2XENA 3RSEG 1O1RA 4X8QA 3Q7FA 5T4YA 3ZUVB 4GYYA 4HNAD 4BX8A 5G04J 5LFAA 2WXFA 2XEHA 4J8FA 3U64A 2XEEA 5AQBA 4CYMD 4AEZC 1NL4A 2LSUA 3T5XA 1KT0A 1NP7A 4LNUD 4IYPA 3FUHA 2XRYA 2ETBA 4TUUA 3UT8A 4GYOA 2BKKB 4GA0A 3EIQC 5LOZA 3EJNA 4HLEA 5D0OD 4U0SA 2ILRA 5EYLA 1UJJA 2UY1A 2AXVA 2QC9A 4N3AA 3P1UA 1ELRA 3ULEG 2EIKE 3OXGA 4N2QA 3FH8A 5EIBE 3ZRHA 2I6HA 2J4BA 1HXIA 3CHRA 3B13A 4UWGA 5AYWD 3LVRE 4G2VA 4HOTA 1MX4A 1E7VA 1H0AA 3SNXA 4HXIA 2VQ2A 2WXJA 2L0IA 4ANUA 1XGWA 4NQ0A 3CQCB 3ZHEB 2YINA 1SA5A 4KYOB 2P9KG 2OEVA 2WXMA 4J8DA 3FTUA 4I2ZA 1KZOA 3ASOE 2F8YA 2L6BA 3UUXA 4AXHA 3Q9NC 4LCTA 1IXVA 2CHZA 2QZAA 4YDEA 2R2LA 2KCKA 2HE0A 5EDSA 3AS4A 1N11A 3ML8A 3CVYA 4JHJA 3PZDA 4N5CA 2P9PG 5CERB 1OUVA 3FTXA 1SVXA 4FHJA 3ZYLA 4O60A 3URZA 1SZ9A 3ABME 3ASHA 3C72A 5DIZA 4ACLA 2XHEA 3OTNA 2XS8A 1MX6A 1FVFA 1UOHA 3FTVA 2MYOA 3HXCA 5KBAA 2C0LA 2XZDG 3QOUA 3HHMA 4Q96A 4ILGA 1N4QA 5CECB 1JUQA 3V30A 3FY4A 3VTXA 5AJLA 1LD7A 3DSXA 2VJ8A 1TJCA 2I1JA 4GCOA 3ZIMA 3LS8A 4XX5A 3FTZA 3FU3A 4KMOA 4W9RA 1Z3XA 1K1AA 4UWHA 4FJZA 4G26A 3S7BA 5CEDB 4LNGA 3CKBA 2L9BA 2WQ6A 4JL0A 4KXKB 4GTSA 2P9LG 1SW6A 4RG6A 4BEPA 4RQIA 2V8SE 1YCSB 3V2OA 3AG1E 4AIFA 3Q7AA 3ONKA 3CLJA 2WXHA 3MGBA 1YA0A 1N4SA 1JCQA 4K5CA 2BF0X 2DIWA 4H7XA 4LRZA 3AG3E 3Q78A 5C1DA 3TWTA 4GZ3A 4Q69A 1TN8A 5FQ6A 1QNFA 1E96B 3EHMA 4O1OA 4TRQA 4E6HA 3E32A 1QBQA 2I1KA 3UT4A 4TXPA 1HG2A 3E33A 2XQ0A 2J9QA 3ZYKA 1OWPA 2BUGA 3Q15A 4TV3A 1LTXA 4URKA 2P58C 3DWLG 3LY8A 4O6FA 1WG0A 3R7RA 2GRPB 4BETA 2IFUA 1K8KG 3QWVA 1BPOA 2WXRA 3E34A 5CRVA 3UINC 2EQXA 2XGMA 3T8MA 3PZ3A 1H19A 3MZLB 1BLXB 3FDHA 5AARA 3Q73A 1X5BA 2NXPA
chains in the Genus database with same CATH topology
2WXIA 3O4ZA 4FJYA 3PDNA 4I1OB 4PDXA 4FP7A 5FTPA 1NZNA 3RK6A 5AIJA 4AJWA 2VSOE 3CKCA 2DBAA 4XI0A 1N54A 4L23A 5LCWJ 4BWRA 4RSYA 1B89A 3ZYQA 4CDMA 4P29A 3TXMA 4DK5A 4UWKA 4Y6CA 2XCBA 4IN3B 3SF4A 3VTYA 4F7AA 2XCCA 3RIBA 2WPVA 2WQ7A 3IHVA 4XE0A 2X6KA 3UX4A 2WM9A 3Q47B 1S0PA 3TJPA 2Y4UA 4EBAG 4YVOA 2I9CA 4JA9A 1EF1C 4DLQA 3TG5A 4GA2A 3ZW3A 2C0MA 3RRUA 5G04C 1XNFA 4I2WA 2X6IA 2VGYA 2X6HA 2VGXB 3CVYA 3R9AB 4AY5A 3FUNA 2LAIA 4HFGA 3CHOA 4C0MA 3RKVA 3ZXSA 4HOQA 3FH7A 3PUKA 5FQ8A 2KZTB 3IBEA 3D9LA 2LO6A 4BY6A 4FHKA 2FEZA 3CHMA 2VTBA 3RO3A 5KJKA 1JPLA 1NA3A 3AS8A 4B89A 5KJLA 4NURA 2L0TB 2ZU6B 1H2TC 4FC8A 4Y6WA 2DCPA 3JQ1A 3ESKA 1Y6IA 1KLXA 4N2SA 1VDYA 3FU5A 2GRLA 3U9WA 4ABNA 4APOA 3PVLA 4RVBA 3QB2A 3SZ7A 3LY9A 2RD0A 4DLOA 3GW4A 5HQ8A 2WXGA 3IHYA 2YHEA 3Q4AB 2YNQA 3CV0A 4GMJA 3ASFA 2HYZA 3VLEA 3HVEB 4BTAA 2LNIA 3VLFA 1HF8A 3CVNA 3ZFWA 1U3DA 4Q94A 2J49A 4I9EA 4KZ0A 3FUFA 3ULQA 3AU4A 1N52A 4D10C 3G2TA 4F53A 3APCA 1QQEA 4L2LA 3TL5A 3T5VA 2WMOA 3CSTA 4WWNA 5ANRA 2V5FA 5CMYA 4AVXA 3CR3A 3CIAA 2KATA 3OXLA 3ZEFA 4N3BA 3TGOA 2GGFA 1IYGA 4XZ4A 2WVIA 3HDXA 4AOFA 3S7JA 2CG3A 3D9IA 4OYSA 4UI9K 3GZSA 4GAAA 3L54A 3FUKA 4EZKA 3CHPA 3ML9A 4I6EA 3FP3A 5A7DB 2KCLA 4N3CA 3LCAA 1JWGA 2J07A 4I1MA 3G2UA 4KT6B 2PL2A 2AWIA 2XPZA 1H6KA 2A5UA 5HI7A 2LSVA 3FUEA 1W3BA 3KD7A 4L2YA 4R7LA 2OOEA 5T4YA 4CGWA 2JEKA 2VGXA 4PS7A 2IF4A 4GYYA 1ZU2A 4U0UA 4A3VA 2PM7A 4BX8A 4L1BA 2FI7A 5G04J 3LJ3A 3IV0A 5FQ7A 4AM9A 1UN9A 5LFAA 1LF8A 2WXFA 4GZ6A 4ANWA 5E76A 3G2SA 4HS2A 3JCKC 3APDA 5FT9A 1IHGA 3CGHA 4J8FA 4AV7A 2JLBA 3U64A 3ENEA 5JHBA 4PS8A 4AEZC 1OWOA 4GPKA 3C98A 4JEUA 2Y4TA 1H2VC 2LSUA 1OWNA 5FJYA 3T5XA 1KT0A 3MKRA 1SQMA 1IQUA 3D9OA 4GB9A 4IULA 3I4GA 5J08A 3B7RL 1NP7A 4IYPA 3FUHA 1DNPA 2XRYA 3QC1A 4TUUA 2VSNA 4MKTA 3UT8A 3RJVA 4B0ZA 4GYOA 2WXOA 4GA0A 3AS5A 3G2VA 3FU6A 3EIQC 2J4DA 3HVEA 4XKCA 1E8WA 4UWLA 5LOZA 5ANLA 3L17A 3EJNA 2AXUA 4BT8A 4EZJA 5D0OD 4HLEA 3B7TA 4U0SA 2HO1A 4YNDA 5CMWA 3PNLB 3MV2B 2ILRA 3CVWA 3L16A 1UJJA 2UY1A 3LEWA 2AXVA 3TG4A 2WMNA 4OVVA 5JJ6A 2IJGX 5BPPA 3U66A 3ESLA 3RU0A 2GW1A 3I5PA 3P1UA 4N3AA 2V4LA 4GZDA 1ELRA 3L13A 1E90A 2QY7A 4JPSA 4NRHB 4KVMA 3SI5A 4DJAA 3OXGA 2MOWA 3PS6A 3ZPJA 4ANVA 3PH0C 3KEZA 4J8EA 2AVPA 1KT1A 2WXNA 4PUCA 4N2QA 2CFZA 3FH8A 2YHCA 3CHSA 2E2EA 3ZRHA 1PAQA 2I6HA 2FF4A 1WM5A 4KBQA 1OWMA 2J4BA 1HXIA 2FULA 3QWPA 4JA7A 3FTYA 3CK8A 1UJKA 3CHRA 3FULA 3B7UX 3LPZA 4EBAA 3B13A 4UWGA 3LDZA 4GZCA 2XGOA 5LP0A 3HYMB 3O48A 4QFVA 2XPIA 3IKOB 4U04A 4UQZA 5AYWD 2KM4A 3LVRE 1UW4B 4G2VA 3DBSA 4HOTA 1E7VA 3BG0B 1H0AA 1H2UA 4UI9C 3ZYMA 5E75A 3SNXA 4A55A 3MKQA 3CK7A 4HXIA 4C0EA 5AENA 4N39A 2VQ2A 2WXJA 2L0IA 4UWFA 1HG5A 3EHNA 4ANUA 4BT9A 1XGWA 2OVFA 2YQ8A 4JVSA 3CQCB 4NQ0A 4F3VA 2XRZA 1HH8A 2WXQA 3FWVA 3MEKA 3ZHEB 2YINA 3QNKA 2IOSA 4KYOB 5EKQD 3CHQA 2Y3AA 3K9IA 4UQYA 4PH4B 5DBKA 4JHRA 2WXMA 3FH5A 3UT7A 3LY7A 3SBSA 5LCWC 4J8DA 1MHQA 3BG1B 3MV3B 4XIFA 3FTUA 2CG2A 3IEGA 5EX3A 5J90A 4ACKA 4I2ZA 3EDTB 1P5QA 4J8SA 5M72A 1E7UA 3Q5MA 5A23A 4B8AA 2XEVA 3UUXA 4CDRA 5FZQA 4AXHA 3MYVA 3D3MA 4MLPA 1EDUA 3CVXA 4GZ5A 2R17C 2MRIA 3OAWA 4LCTA 4U07A 2CHZA 4CRWA 4CT4A 3PEUB 2GRMA 5LX8A 4WUYA 4E85A 3QJZA 3B7SA 2KCKA 4K03A 2PQNA 4G23A 4A3TA 3LYAA 5BV1A 3AS4A 5EDSA 4FLHA 2V0PA 4GCNA 4KZCA 3NQPA 3OXFA 4AP2A 1TJFA 1Z6TA 3ML8A 4ATGA 2X6JA 3PZDA 1OWLA 3BEEA 4HOUA 4JHJA 4N5CA 3SHFA 2XGSA 4A1GA 1OUVA 3FTXA 2KCVA 2KC7A 2WXLA 4FHJA 2WQHA 3ZN3A 3ZYLA 3FFLA 5BW8C 2PZIA 3URZA 2BTDA 1SZ9A 2KZTA 3UPVA 3ASHA 3R7QA 5DIZA 1UN8A 5FZRA 2FBNA 4I1AA 4ACLA 3CVUA 3FTSA 2XHEA 3OTNA 4G25A 4H7YA 1INZA 4J0UA 3QWWA 2IU1A 4DI3A 3FUIA 3PEVB 1L5JA 4U8HA 1FVFA 3D9KA 4FA6A 5CCMA 5CCLA 3MX3A 4FU3A 4AY6A 3FTVA 4FADA 4HORA 3GZ1A 5EX0A 2AXZA 4DI4A 3Q49B 4BSXA 1PC2A 2CHXA 3P2BA 1JWFA 4V3IA 2C0LA 3LXUX 3QOUA 3L6AA 5JJTA 4JEHA 3HHMA 4Q96A 4HOSA 4ILGA 5T8IA 4I17A 2AW6A 3PRZA 1TEZA 3G2WA 1JUQA 3FY4A 2M63A 4M3OA 2MHKA 3VTXA 4XKBA 5ARFA 3E4BA 5AJLA 1HZ4A 1HO8A 1MQSA 4G1TA 4WWPA 3SBTB 3APFA 4HVBA 1HU3A 3MA5A 4JW1A 2PQRA 2VJ8A 3L22A 1TJCA 2I1JA 4GCOA 3ZIMA 2C2LA 2X38A 4LERA 3U3WA 1PY1A 3FUDA 3LS8A 3LKUA 4ANXA 4XX5A 3FTZA 2X6FA 5KJMA 2IOLA 3FU3A 1FVHA 4GYWA 4KMOA 4CT0A 4W9RA 3QAQA 3QK0A 4BFRA 1NA0A 4JXTA 1Z3XA 5G55A 2VYIA 3FEXA 2R5SA 4GA1A 2J08A 4UWHA 5CHEE 3CK9A 3ASGA 3FUJA 5D0QD 3FU0A 3SD5A 4FLBA 3JQ0A 4GU5A 4FJZA 2Q7FA 4G26A 3S7BA 4EECA 4K0RA 1DVPA 4CGVA 3CKBA 1ZBPA 3CVQA 2L9BA 5ENNA 2WQ6A 4JL0A 4KXKB 5KJNA 4WWOA 1E8XA 3D9PA 4RG6A 4DPRA 1WAO1 3CEQA 4ILHB 4MS6A 2V8SE 4JHKA 2L6JA 2R59A 5KCMA 3U4TA 4CDNA 3WXXA 2X3MA 1SZAA 3UMVA 5BT1A 3KS2A 4WNDA 4AIFA 3JYSA 1FCHA 4ILIA 3ONKA 5AJDA 5G05C 3CLJA 5C2YA 3TXNA 3RRMB 5BUZA 2WXKA 1A17A 2WXHA 3GZ2A 3SFZA 2WXPA 1YA0A 3MGBA 3CVPA 4U63A 1IQRA 4LEUA 3ZGQA 1ELWA 2ONDA 4CEMA 3FTWA 2BF0X 1HX8A 4EQFA 2DIWA 1Z3YA 2IQCA 4I6JA 4F1SA 4A1SA 4G11A 2J09A 4C9BB 4WNEA 3I4RB 2RG8A 5FWQA 4H7XA 4I6GA 4LRZA 1UG3A 1EPUA 3QKYA 4RG9A 4JZYA 4KVOA 1U3CA 4J6IA 4UQXA 2XPYA 3PE3A 3JUIA 4L7TA 5C1DA 2WB2A 2OVBA 3D9JA 4GMLA 4GZ3A 3S7DA 3N71A 2CFUA 4CCAA 4B94A 3FEYA 3I3NA 3CVVA 4Q69A 2FO7A 3HIZA 5FQ6A 4ME2A 1QNFA 3NZUA 4B8CB 1E96B 2CHWA 3EHMA 1HE8A 3FHEA 3QDNA 4TRQA 5BV0A 4E6HA 3NF1A 4I9CA 4IRUA 2IONA 2VSYA 3EIJA 4PS3A 2I1KA 3SGHA 2VSXE 4G24A 3UT4A 2UY1B 3D9NA 4WAFA 5T3RA 1E8YA 2I2OA 2OV8A 4YVQC 1HG2A 3NZSA 2PM6A 5BNWA 2UWJG 3GYZA 2LAHA 3S7FA 3ONLA 1E8ZA 2XQ0A 3MCXA 4JC8A 2J9QA 3ZYKA 2HM8A 3FUMA 4BTBA 1OWPA 2BUGA 1ELKA 3CSFA 3Q15A 4TV3A 5FZSA 3UQ3A 4I43A 5A6CA 4URKA 2P58C 4XI9A 3LY8A 4O6FA 3PE4A 4WNFA 5JJ7A 3R7RA 3RRNB 4MRUA 3TAXA 3KAEA 3PUJA 1Y8MA 4OVUA 2IFUA 2VTBB 1HS6A 3QWVA 3LVQE 3ZVVA 1BPOA 3PREA 1HFAA 2WXRA 2NC9A 3PNTB 1QZ2A 5FQ4A 3DPDA 4EPZA 2HR2A 2EQXA 3CVLA 4NACA 2XGMA 1EYHA 3AU5A 3T8MA 2E0IA 1WY6A 1H19A 5JHAA 5G05J 3MZLB 5G2NA 4APFA 3MJWA 5ARGA 4EZLA 3FDHA 3L08A 3RO2A 4UI9J 3CQGB 3MKQB 2A4ZA 3ASDA 4WNGA 3D9MA 3ZHEA 4FULA 2QFCA 1GW6A 3QARA 3VLDA 1X5BA 3S2AA 4LUNU 4U0ZA 4BX9A 2NXPA 2NSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9N A;  4FU3 A;  2DCP A;  2V8S E;  3D9O A;  3LDZ A;  4GZC A;  3D9P A;  1HG2 A;  1SZA A;  1HFA A;  5CMY A;  3RRU A;  4AVX A;  5J08 A;  5LP0 A;  1MHQ A;  1PY1 A;  1VDY A;  3D9J A;  2KM4 A;  4GZD A;  3ONL A;  1JWF A;  3ONK A;  2QY7 A;  3CLJ A;  4NAC A;  1EYH A;  3ZYL A;  4Q96 A;  1H0A A;  3ZYQ A;  3G2V A;  3ZYK A;  3ZYM A;  2MOW A;  1LF8 A;  4JXT A;  4HFG A;  1ELK A;  1SZ9 A;  3D9I A;  3G2S A;  1EDU A;  3G2W A;  1JUQ A;  5LOZ A;  2L0I A;  1HG5 A;  1XGW A;  4FLB A;  3D9L A;  2LO6 A;  3D9M A;  2BF0 X;  5CMW A;  1INZ A;  1DVP A;  1HX8 A;  1HF8 A;  2DIW A;  4Q94 A;  3G2T A;  1UJJ A;  1JPL A;  1JWG A;  1X5B A;  3G2U A;  3D9K A;  1UJK A;  2L0T B; 
#chains in the Genus database with same CATH topology
 4CZ2 D;  3PDN A;  5FTP A;  1S64 A;  3CKC A;  2A5E A;  5LCW J;  1N54 A;  4BWR A;  4RSY A;  1B89 A;  4P29 A;  4LSZ E;  3VTY A;  4F7A A;  2XCC A;  2WPV A;  2X6K A;  2WM9 A;  2IO3 C;  1DCE A;  3D9H A;  2P9I G;  3DSW A;  3UM2 A;  5AQA A;  4HFG A;  3CHO A;  5ITZ F;  3BQO A;  2KZT B;  3ABL E;  1KPS B;  2P9S G;  3ZXP A;  1JPL A;  1BU9 A;  3UI2 A;  1NA3 A;  1LD8 A;  2DCP A;  4L9P A;  1VDY A;  2GRN B;  1A5E A;  3PVL A;  2LXL A;  3LY9 A;  5HQ8 A;  2YHE A;  2HYZ A;  5ENP D;  2LNI A;  3CVN A;  1U3D A;  2J49 A;  4I9E A;  5BXU A;  1QQE A;  4WWN A;  2KAT A;  3TGO A;  4UI9 K;  4U7E B;  3FUK A;  4EZK A;  3Q79 A;  3CHP A;  4U96 D;  2XZT G;  2ZIS A;  4XEI G;  2J8S D;  1W3B A;  5CBN A;  4CGW A;  2B0O E;  3EHQ A;  2ZGG A;  1LF8 A;  4GZ6 A;  5E76 A;  5HS0 A;  4HS2 A;  3APD A;  3EUV A;  1IHG A;  3CGH A;  3ENE A;  5JHB A;  4PS8 A;  1TNU A;  4JEU A;  2Y4T A;  4JD2 G;  4GB9 A;  1D8D A;  1DNP A;  2VSN A;  4U95 D;  3RJV A;  4B0Z A;  3FU6 A;  3HVE A;  2AXU A;  4BT8 A;  3PNL B;  3MV2 B;  4J7W A;  3L16 A;  3TG4 A;  1N0Q A;  4OVV A;  4OAV B;  5BPP A;  1RZ4 A;  3ESL A;  2GW1 A;  3I5P A;  2V4L A;  2QY7 A;  2R03 A;  3SI5 A;  4ANV A;  3Q9U C;  2AVP A;  1KT1 A;  2CFZ A;  2ZXW E;  4GTR A;  2FF4 A;  3CK8 A;  3FUL A;  1X81 A;  4GZC A;  2XGO A;  1H2U A;  4UI9 C;  5B3S E;  3T9K A;  4A55 A;  3MKQ A;  3EHR A;  4C0E A;  5AEN A;  1TNO A;  4UWF A;  3EHN A;  2OVF A;  1HH8 A;  2WXQ A;  3FWV A;  3MEK A;  3QNK A;  3SBS A;  1ZB1 A;  3EDT B;  5M72 A;  4G8L A;  2XEV A;  1OY3 D;  5FZQ A;  4GZ5 A;  2R17 C;  5B1A E;  3J5P A;  4WUY A;  2PQN A;  4F6R D;  3LYA A;  3UKU G;  4FLH A;  4KZC A;  3NQP A;  1TJF A;  4A1G A;  4HOU A;  2XGS A;  2KCV A;  2KC7 A;  2WQH A;  3HXF A;  3FFL A;  5BW8 C;  2PZI A;  1UN8 A;  3E30 A;  2Y0B G;  4G25 A;  2IU1 A;  2FO1 E;  3PEV B;  4U8H A;  3D9K A;  4FA6 A;  5CCL A;  3NOC D;  4FAD A;  4HOR A;  3GZ1 A;  4V3I A;  3TWS A;  4JEH A;  3B95 A;  4I17 A;  1TEZ A;  3G2W A;  4M3O A;  2MHK A;  4XKB A;  3DSU A;  3AG4 E;  1HZ4 A;  1HO8 A;  1AP7 A;  4HVB A;  1HU3 A;  1N95 A;  4YDY A;  4LER A;  1NFI E;  3QAQ A;  4GA1 A;  2J08 A;  3KEA A;  5CHE E;  3CK9 A;  3R9M A;  4GU5 A;  1DVP A;  1MJ0 A;  5ENN A;  4DX5 D;  1WAO 1;  3CEQ A;  4JHK A;  5FIO A;  3PZ2 A;  3UMV A;  3JYS A;  1FCH A;  2V5Q C;  3W9G A;  3GZ2 A;  2GRO B;  3Q75 A;  4B93 B;  1IQR A;  3ZGQ A;  3TWV A;  2OND A;  4CEM A;  1JCR A;  1TNY A;  2IQC A;  4G11 A;  2J09 A;  4C9B B;  2RG8 A;  1UG3 A;  4GTT A;  4RG9 A;  3UIO C;  2BKG A;  2F0Y A;  1U3C A;  4J6I A;  4UQX A;  4L7T A;  2WB2 A;  2OVB A;  3D9J A;  4GML A;  3S7D A;  3L9T A;  2CFU A;  4B94 A;  5ENS D;  3C3Q A;  1N94 A;  2FO7 A;  2H6I A;  3C3R A;  4B8C B;  2CHW A;  3UXG A;  1TR4 A;  4GTQ A;  4PS3 A;  4G24 A;  2UY1 B;  3D9N A;  4WAF A;  1E8Y A;  1O5M A;  3GYZ A;  2GRQ B;  1E8Z A;  3MCX A;  4JC8 A;  3TWU A;  1SA4 A;  2HM8 A;  2IY0 C;  4I43 A;  3BUA A;  5EIL A;  3DSV A;  3RRN B;  4YDO A;  4OVU A;  4ATZ D;  1FT2 A;  3ZVV A;  2ZGD A;  3DPD A;  2HR2 A;  4DX7 D;  4NAC A;  2EIJ E;  4APF A;  5JMN D;  3TWW A;  1MZC A;  3L08 A;  3RO2 A;  2LXM A;  3CQG B;  4WNG A;  4FUL A;  3QAR A;  4LUN U;  4K5A B;  5EN5 D;  1D9S A;  4I1O B;  4PDX A;  3NBN B;  4AJW A;  1G3N B;  4XI0 A;  3ZYQ A;  1DCQ A;  4Y6C A;  2WQ7 A;  3IHV A;  4YVO A;  4GTV A;  4JA9 A;  1EF1 C;  4DLQ A;  2OCC E;  5HRY A;  3RRU A;  2X6H A;  2VGX B;  4AY5 A;  3FUN A;  4HRL A;  3PUK A;  3ZU7 B;  3IBE A;  2LO6 A;  3CHM A;  3UM1 A;  4DX6 D;  4TXQ A;  4Z68 A;  3AS8 A;  5KJL A;  4NUR A;  5CBO A;  3ZNG A;  1Y6I A;  1KLX A;  3SZ7 A;  3QB2 A;  2ETC A;  2RD0 A;  4DLO A;  3GW4 A;  3IHY A;  3CV0 A;  1BI8 B;  4GMJ A;  4BTA A;  1O1T A;  1HF8 A;  3ISM C;  3ULQ A;  3UTM A;  3DEO A;  1Q2Z A;  4AVX A;  5B1B E;  3X2Q E;  3CIA A;  3OXL A;  4TXR A;  4JB8 P;  4DX2 A;  4J8Y A;  1OCR E;  2CG3 A;  3SFX A;  1YMP A;  2KCL A;  4I1M A;  3G2U A;  2PL2 A;  5EYP F;  5HI7 A;  2LSV A;  3FUE A;  4R7L A;  2OOE A;  2JEK A;  4PS7 A;  2IF4 A;  1S70 B;  4A3V A;  3C5R A;  2DYR E;  1Z5S C;  4DX1 A;  4L1B A;  5FQ7 A;  1UN9 A;  4ANW A;  3G2S A;  3JCK C;  5FT9 A;  2JLB A;  5AQ7 A;  2RFM A;  3ABK E;  4GPK A;  1N9A A;  4ZFH A;  1H2V C;  5FJY A;  3MKR A;  1SQM A;  3D9O A;  3I4G A;  5J08 A;  3QC1 A;  4MKT A;  2WXO A;  3G2V A;  2J4D A;  5ANL A;  4EZJ A;  3B7T A;  3J5Q B;  2HO1 A;  4YND A;  5CMW A;  1N4P A;  3CVW A;  3LEW A;  3KSQ A;  5H7P A;  1KZP A;  2IJG X;  4K5B A;  3TWR A;  3RU0 A;  1TN7 A;  2EIN E;  3L13 A;  1E90 A;  4KVM A;  3UM0 A;  4DJA A;  4HLL A;  3PH0 C;  3KEZ A;  4J8E A;  4PUC A;  1FT1 A;  2DZO A;  2YHC A;  1MYO A;  3WG7 E;  1PAQ A;  1WM5 A;  1OWM A;  2FUL A;  3QWP A;  4JA7 A;  3FTY A;  1UJK A;  3LPZ A;  5LP0 A;  4QFV A;  3IKO B;  4U04 A;  1YYH A;  1S63 A;  4C48 B;  1UW4 B;  5E75 A;  3TWX A;  4N39 A;  4BT9 A;  3AG2 E;  2IOS A;  2F37 A;  1BD8 A;  2Y3A A;  3K9I A;  5DBK A;  4JHR A;  3FH5 A;  3UT7 A;  1MHQ A;  3BG1 B;  2CG2 A;  4J8S A;  1P5Q A;  1E7U A;  4B8A A;  4CDR A;  3MYV A;  4MLP A;  4U07 A;  4CT4 A;  2GRM A;  2R05 A;  5LX8 A;  4E85 A;  3QJZ A;  3B7S A;  4A3T A;  3E37 A;  5BV1 A;  5ENT D;  1MX2 A;  4GCN A;  3OXF A;  4AP2 A;  4MBG A;  3SO8 A;  4ATG A;  1OWL A;  1QYM A;  3BEE A;  3SHF A;  2WXL A;  3ZN3 A;  1N0R A;  5FZR A;  4I1A A;  1INZ A;  3CVU A;  4H7Y A;  4DI3 A;  3V79 K;  1L5J A;  3DPY A;  4AY6 A;  4FU3 A;  3NAW A;  5EX0 A;  1IKN D;  3P2B A;  3JUE A;  1JWF A;  3L6A A;  3PZ4 A;  4HOS A;  5T8I A;  2AW6 A;  2M63 A;  5CRU A;  1MQS A;  3ZKJ A;  1V54 E;  2PQR A;  1JCS A;  3L22 A;  3TWQ A;  2X38 A;  1PY1 A;  3FUD A;  3LKU A;  4ANX A;  5KJM A;  2XS1 A;  1FVH A;  4HB5 A;  4BFR A;  1NA0 A;  5G55 A;  3FEX A;  2R5S A;  3UM3 A;  2H6F A;  5D0Q D;  3FU0 A;  3SD5 A;  4FLB A;  2Q7F A;  4EEC A;  4CGV A;  3CVQ A;  2LUH A;  5ENR D;  5JA4 D;  5KJN A;  4U8V D;  4MS6 A;  5KCM A;  4CDN A;  2L6J A;  2R59 A;  4BES A;  2X3M A;  5ENO D;  3KS2 A;  4WND A;  5C2Y A;  3UIP C;  3RRM B;  2WXK A;  4DUI A;  3SFZ A;  3CVP A;  1ELW A;  3HXE A;  4EQF A;  4F1S A;  4WNE A;  4GPM A;  4I6G A;  4JZY A;  3PE3 A;  2EIL E;  4CCA A;  1V55 E;  3FHE A;  1HE8 A;  3QDN A;  5KNH D;  4N5Q A;  5BV0 A;  2ION A;  2VSY A;  4LNB A;  4F1P A;  5T3R A;  2IO2 C;  2PM6 A;  3ONL A;  3DXM G;  4BTB A;  3UQ3 A;  3CSF A;  5FZS A;  5A6C A;  1OXJ A;  5JJ7 A;  3PUJ A;  2VTB B;  3PRE A;  3PNT B;  4HI8 A;  3CVL A;  1EYH A;  3AU5 A;  1WY6 A;  2ZIR A;  3MJW A;  5ARG A;  4UI9 J;  3MKQ B;  2QYJ A;  3ZHE A;  1OT8 A;  4BX9 A;  4L23 A;  4CDM A;  3TXM A;  4DK5 A;  4IN3 B;  5IY5 E;  3RIB A;  3Q47 B;  1S0P A;  4GTM A;  2Y4U A;  4EBA G;  2DVW A;  3B7B A;  4GA2 A;  2C0M A;  1XNF A;  3HXB A;  5D2M C;  3R9A B;  4C0M A;  4HOQ A;  3FH7 A;  4BY6 A;  4FHK A;  3SFY A;  3V31 A;  2L0T B;  2ZU6 B;  1H2T C;  2KXP C;  3FU5 A;  2GRL A;  3U9W A;  4APO A;  3Q4A B;  4RLY A;  2ETA A;  3VLF A;  3ZFW A;  4Q94 A;  4KZ0 A;  1N52 A;  4D10 C;  3G2T A;  3APC A;  3DEP A;  4L2L A;  4A63 B;  3T5V A;  2WMO A;  5ANR A;  2V5F A;  3CR3 A;  3ZEF A;  4N3B A;  2GGF A;  1IYG A;  3HDX A;  1DC2 A;  4AOF A;  4OYS A;  4GAA A;  3L54 A;  1OCO E;  2Y1L E;  3ML9 A;  4I6E A;  5A7D B;  3LCA A;  1JWG A;  3IXE A;  4KT6 B;  1H6K A;  2A5U A;  3HG0 D;  1BI7 B;  4EHM A;  3KD7 A;  4L2Y A;  2VGX A;  4U0U A;  1ZU2 A;  4GTO A;  2PM7 A;  3AJI A;  3BU8 A;  2FI7 A;  4AM9 A;  3LJ3 A;  3IV0 A;  1D8E A;  4AV7 A;  5HKP A;  1OWO A;  3C98 A;  4OAU C;  1OWN A;  1TNZ A;  1IQU A;  2VGE A;  4IUL A;  3ASN E;  3B7R L;  2KBX A;  3AS5 A;  4XKC A;  1E8W A;  4UWL A;  4LG6 A;  3L17 A;  1H6O A;  2QYU A;  4TUM A;  2WMN A;  5JJ6 A;  3EU9 A;  3U66 A;  2JAB A;  4GZD A;  4JPS A;  4NRH B;  2MOW A;  3PS6 A;  3ZPJ A;  2DZN A;  2WXN A;  3CHS A;  2E2E A;  4KBQ A;  3B7U X;  3DSS A;  4QQI A;  4EBA A;  1AWC B;  1OCC E;  3LDZ A;  1TNB A;  3HYM B;  3O48 A;  2XPI A;  4UQZ A;  2KM4 A;  2DWZ A;  3DBS A;  3EU5 A;  3BG0 B;  3ZYM A;  3C3O A;  3CK7 A;  1HG5 A;  2V4H C;  2YQ8 A;  4JVS A;  4F3V A;  2XRZ A;  5EKQ D;  3CHQ A;  2RKK A;  4UQY A;  4PH4 B;  3LY7 A;  5LCW C;  3MV3 B;  4XIF A;  3IEG A;  5EX3 A;  5J90 A;  4ACK A;  4BER A;  5AN8 A;  3Q5M A;  5A23 A;  2Y69 E;  3D3M A;  1O1S A;  1EDU A;  3CVX A;  5D66 A;  1IHB A;  2MRI A;  3OAW A;  2F8X K;  4CRW A;  3PEU B;  4M7C A;  4K03 A;  4G23 A;  2P2C P;  2V0P A;  2R02 A;  4HQD A;  1Z6T A;  2X6J A;  3RAU A;  2EIM E;  2BTD A;  2KZT A;  3UPV A;  3R7Q A;  1H6P A;  2FBN A;  5AQ9 A;  3FTS A;  4J0U A;  3QWW A;  3V2X A;  4NIK A;  3FUI A;  5CCM A;  3MX3 A;  2AXZ A;  4DI4 A;  3Q49 B;  4BSX A;  1PC2 A;  2CHX A;  3LXU X;  5JJT A;  3PRZ A;  5ARF A;  3E4B A;  4G1T A;  4WWP A;  3SBT B;  3APF A;  2H6G A;  3MA5 A;  5FIN A;  3DXK G;  4JW1 A;  4U8Y D;  2P9U G;  2C2L A;  3U3W A;  1K3Z D;  2IEJ A;  2X6F A;  2IOL A;  4GYW A;  4CT0 A;  3QK0 A;  4JXT A;  2NYJ A;  2VYI A;  3KSL A;  3ASG A;  3FUJ A;  3DST A;  3JQ0 A;  4K0R A;  1ZBP A;  2RFA A;  4WWO A;  1E8X A;  3D9P A;  4DPR A;  2GRR B;  4ILH B;  1K1B A;  3U4T A;  1RW2 A;  3WXX A;  1SZA A;  1TYQ G;  5BT1 A;  3NOG D;  4ILI A;  5EID A;  3TXN A;  5AJD A;  5G05 C;  3LJN A;  5BUZ A;  4O1P A;  1A17 A;  3JXI A;  2WXP A;  3NB2 A;  4U63 A;  4LEU A;  5BXO A;  3FTW A;  1HX8 A;  1N4R A;  5KWD A;  1Z3Y A;  4I6J A;  4A1S A;  5KNG A;  5FWQ A;  3I4R B;  3HRA A;  1EPU A;  3QKY A;  4KVO A;  2XPY A;  3JUI A;  3N71 A;  1NI1 A;  3AAA C;  3FEY A;  3CVV A;  3HIZ A;  2B6C A;  5ENQ D;  4ZHB A;  4ME2 A;  3NZU A;  3SY2 A;  3UKR G;  3NF1 A;  4I9C A;  4IRU A;  3PZ1 A;  3EIJ A;  3SGH A;  2VSX E;  3SQV A;  2I2O A;  2OV8 A;  1FPP A;  4YVQ C;  4HI9 A;  3NZS A;  5BNW A;  2UWJ G;  2AJA A;  2LAH A;  3S7F A;  4G8K A;  3FUM A;  4UUC A;  1ELK A;  3ULY A;  3HXD A;  4XI9 A;  3PE4 A;  4WNF A;  3JXJ A;  4MRU A;  3TAX A;  4GMR A;  3KAE A;  5CEA A;  1Y8M A;  1HS6 A;  3F6Q A;  3LVQ E;  1HFA A;  2NC9 A;  1QZ2 A;  5FQ4 A;  4EPZ A;  2E0I A;  2H6H A;  5JHA A;  5G05 J;  4EZL A;  5G2N A;  3DRA A;  2A4Z A;  3ASD A;  3D9M A;  2QFC A;  1GW6 A;  3VLD A;  2BED A;  3S2A A;  4U0Z A;  3I3N A;  2NSZ A;  2WXI A;  3O4Z A;  4FJY A;  4FP7 A;  1NZN A;  3RK6 A;  5AIJ A;  2VSO E;  2DYS E;  2DBA A;  1U2V G;  4UWK A;  2XCB A;  3SF4 A;  5AAO A;  4XE0 A;  3UX4 A;  3TJP A;  2I9C A;  3TG5 A;  3ZW3 A;  4HBD A;  5G04 C;  4I2W A;  2X6I A;  2VGY A;  2LAI A;  3RKV A;  4HRN A;  3ZXS A;  5FQ8 A;  3D9L A;  4DRX E;  2FEZ A;  2VTB A;  3RO3 A;  5KJK A;  4B89 A;  3L82 A;  2P9N G;  4FC8 A;  4Y6W A;  3JQ1 A;  3ESK A;  4N2S A;  4ABN A;  1TN6 A;  4RVB A;  4HRM B;  3T8K A;  2WXG A;  2YNQ A;  2OEW A;  3VLE A;  3ASF A;  3HVE B;  3FUF A;  3AU4 A;  4F53 A;  4BSZ B;  3TL5 A;  3CST A;  2PNN A;  5CMY A;  1WDY A;  3W9F A;  4XZ4 A;  2WVI A;  3S7J A;  3D9I A;  3GZS A;  4GTP A;  4YDW A;  3FP3 A;  4N3C A;  2J07 A;  1OCZ E;  2AWI A;  2XPZ A;  2XEN A;  3RSE G;  1O1R A;  4X8Q A;  3Q7F A;  5T4Y A;  3ZUV B;  4GYY A;  4HNA D;  4BX8 A;  5G04 J;  5LFA A;  2WXF A;  2XEH A;  4J8F A;  3U64 A;  2XEE A;  5AQB A;  4CYM D;  4AEZ C;  1NL4 A;  2LSU A;  3T5X A;  1KT0 A;  1NP7 A;  4LNU D;  4IYP A;  3FUH A;  2XRY A;  2ETB A;  4TUU A;  3UT8 A;  4GYO A;  2BKK B;  4GA0 A;  3EIQ C;  5LOZ A;  3EJN A;  4HLE A;  5D0O D;  4U0S A;  2ILR A;  5EYL A;  1UJJ A;  2UY1 A;  2AXV A;  2QC9 A;  4N3A A;  3P1U A;  1ELR A;  3ULE G;  2EIK E;  3OXG A;  4N2Q A;  3FH8 A;  5EIB E;  3ZRH A;  2I6H A;  2J4B A;  1HXI A;  3CHR A;  3B13 A;  4UWG A;  5AYW D;  3LVR E;  4G2V A;  4HOT A;  1MX4 A;  1E7V A;  1H0A A;  3SNX A;  4HXI A;  2VQ2 A;  2WXJ A;  2L0I A;  4ANU A;  1XGW A;  4NQ0 A;  3CQC B;  3ZHE B;  2YIN A;  1SA5 A;  4KYO B;  2P9K G;  2OEV A;  2WXM A;  4J8D A;  3FTU A;  4I2Z A;  1KZO A;  3ASO E;  2F8Y A;  2L6B A;  3UUX A;  4AXH A;  3Q9N C;  4LCT A;  1IXV A;  2CHZ A;  2QZA A;  4YDE A;  2R2L A;  2KCK A;  2HE0 A;  5EDS A;  3AS4 A;  1N11 A;  3ML8 A;  3CVY A;  4JHJ A;  3PZD A;  4N5C A;  2P9P G;  5CER B;  1OUV A;  3FTX A;  1SVX A;  4FHJ A;  3ZYL A;  4O60 A;  3URZ A;  1SZ9 A;  3ABM E;  3ASH A;  3C72 A;  5DIZ A;  4ACL A;  2XHE A;  3OTN A;  2XS8 A;  1MX6 A;  1FVF A;  1UOH A;  3FTV A;  2MYO A;  3HXC A;  5KBA A;  2C0L A;  2XZD G;  3QOU A;  3HHM A;  4Q96 A;  4ILG A;  1N4Q A;  5CEC B;  1JUQ A;  3V30 A;  3FY4 A;  3VTX A;  5AJL A;  1LD7 A;  3DSX A;  2VJ8 A;  1TJC A;  2I1J A;  4GCO A;  3ZIM A;  3LS8 A;  4XX5 A;  3FTZ A;  3FU3 A;  4KMO A;  4W9R A;  1Z3X A;  1K1A A;  4UWH A;  4FJZ A;  4G26 A;  3S7B A;  5CED B;  4LNG A;  3CKB A;  2L9B A;  2WQ6 A;  4JL0 A;  4KXK B;  4GTS A;  2P9L G;  1SW6 A;  4RG6 A;  4BEP A;  4RQI A;  2V8S E;  1YCS B;  3V2O A;  3AG1 E;  4AIF A;  3Q7A A;  3ONK A;  3CLJ A;  2WXH A;  3MGB A;  1YA0 A;  1N4S A;  1JCQ A;  4K5C A;  2BF0 X;  2DIW A;  4H7X A;  4LRZ A;  3AG3 E;  3Q78 A;  5C1D A;  3TWT A;  4GZ3 A;  4Q69 A;  1TN8 A;  5FQ6 A;  1QNF A;  1E96 B;  3EHM A;  4O1O A;  4TRQ A;  4E6H A;  3E32 A;  1QBQ A;  2I1K A;  3UT4 A;  4TXP A;  1HG2 A;  3E33 A;  2XQ0 A;  2J9Q A;  3ZYK A;  1OWP A;  2BUG A;  3Q15 A;  4TV3 A;  1LTX A;  4URK A;  2P58 C;  3DWL G;  3LY8 A;  4O6F A;  1WG0 A;  3R7R A;  2GRP B;  4BET A;  2IFU A;  1K8K G;  3QWV A;  1BPO A;  2WXR A;  3E34 A;  5CRV A;  3UIN C;  2EQX A;  2XGM A;  3T8M A;  3PZ3 A;  1H19 A;  3MZL B;  1BLX B;  3FDH A;  5AAR A;  3Q73 A;  1X5B A;  2NXP A; 
#chains in the Genus database with same CATH homology
 2WXI A;  3O4Z A;  4FJY A;  3PDN A;  4I1O B;  4PDX A;  4FP7 A;  5FTP A;  1NZN A;  3RK6 A;  5AIJ A;  4AJW A;  2VSO E;  3CKC A;  2DBA A;  4XI0 A;  1N54 A;  4L23 A;  5LCW J;  4BWR A;  4RSY A;  1B89 A;  3ZYQ A;  4CDM A;  4P29 A;  3TXM A;  4DK5 A;  4UWK A;  4Y6C A;  2XCB A;  4IN3 B;  3SF4 A;  3VTY A;  4F7A A;  2XCC A;  3RIB A;  2WPV A;  2WQ7 A;  3IHV A;  4XE0 A;  2X6K A;  3UX4 A;  2WM9 A;  3Q47 B;  1S0P A;  3TJP A;  2Y4U A;  4EBA G;  4YVO A;  2I9C A;  4JA9 A;  1EF1 C;  4DLQ A;  3TG5 A;  4GA2 A;  3ZW3 A;  2C0M A;  3RRU A;  5G04 C;  1XNF A;  4I2W A;  2X6I A;  2VGY A;  2X6H A;  2VGX B;  3CVY A;  3R9A B;  4AY5 A;  3FUN A;  2LAI A;  4HFG A;  3CHO A;  4C0M A;  3RKV A;  3ZXS A;  4HOQ A;  3FH7 A;  3PUK A;  5FQ8 A;  2KZT B;  3IBE A;  3D9L A;  2LO6 A;  4BY6 A;  4FHK A;  2FEZ A;  3CHM A;  2VTB A;  3RO3 A;  5KJK A;  1JPL A;  1NA3 A;  3AS8 A;  4B89 A;  5KJL A;  4NUR A;  2L0T B;  2ZU6 B;  1H2T C;  4FC8 A;  4Y6W A;  2DCP A;  3JQ1 A;  3ESK A;  1Y6I A;  1KLX A;  4N2S A;  1VDY A;  3FU5 A;  2GRL A;  3U9W A;  4ABN A;  4APO A;  3PVL A;  4RVB A;  3QB2 A;  3SZ7 A;  3LY9 A;  2RD0 A;  4DLO A;  3GW4 A;  5HQ8 A;  2WXG A;  3IHY A;  2YHE A;  3Q4A B;  2YNQ A;  3CV0 A;  4GMJ A;  3ASF A;  2HYZ A;  3VLE A;  3HVE B;  4BTA A;  2LNI A;  3VLF A;  1HF8 A;  3CVN A;  3ZFW A;  1U3D A;  4Q94 A;  2J49 A;  4I9E A;  4KZ0 A;  3FUF A;  3ULQ A;  3AU4 A;  1N52 A;  4D10 C;  3G2T A;  4F53 A;  3APC A;  1QQE A;  4L2L A;  3TL5 A;  3T5V A;  2WMO A;  3CST A;  4WWN A;  5ANR A;  2V5F A;  5CMY A;  4AVX A;  3CR3 A;  3CIA A;  2KAT A;  3OXL A;  3ZEF A;  4N3B A;  3TGO A;  2GGF A;  1IYG A;  4XZ4 A;  2WVI A;  3HDX A;  4AOF A;  3S7J A;  2CG3 A;  3D9I A;  4OYS A;  4UI9 K;  3GZS A;  4GAA A;  3L54 A;  3FUK A;  4EZK A;  3CHP A;  3ML9 A;  4I6E A;  3FP3 A;  5A7D B;  2KCL A;  4N3C A;  3LCA A;  1JWG A;  2J07 A;  4I1M A;  3G2U A;  4KT6 B;  2PL2 A;  2AWI A;  2XPZ A;  1H6K A;  2A5U A;  5HI7 A;  2LSV A;  3FUE A;  1W3B A;  3KD7 A;  4L2Y A;  4R7L A;  2OOE A;  5T4Y A;  4CGW A;  2JEK A;  2VGX A;  4PS7 A;  2IF4 A;  4GYY A;  1ZU2 A;  4U0U A;  4A3V A;  2PM7 A;  4BX8 A;  4L1B A;  2FI7 A;  5G04 J;  3LJ3 A;  3IV0 A;  5FQ7 A;  4AM9 A;  1UN9 A;  5LFA A;  1LF8 A;  2WXF A;  4GZ6 A;  4ANW A;  5E76 A;  3G2S A;  4HS2 A;  3JCK C;  3APD A;  5FT9 A;  1IHG A;  3CGH A;  4J8F A;  4AV7 A;  2JLB A;  3U64 A;  3ENE A;  5JHB A;  4PS8 A;  4AEZ C;  1OWO A;  4GPK A;  3C98 A;  4JEU A;  2Y4T A;  1H2V C;  2LSU A;  1OWN A;  5FJY A;  3T5X A;  1KT0 A;  3MKR A;  1SQM A;  1IQU A;  3D9O A;  4GB9 A;  4IUL A;  3I4G A;  5J08 A;  3B7R L;  1NP7 A;  4IYP A;  3FUH A;  1DNP A;  2XRY A;  3QC1 A;  4TUU A;  2VSN A;  4MKT A;  3UT8 A;  3RJV A;  4B0Z A;  4GYO A;  2WXO A;  4GA0 A;  3AS5 A;  3G2V A;  3FU6 A;  3EIQ C;  2J4D A;  3HVE A;  4XKC A;  1E8W A;  4UWL A;  5LOZ A;  5ANL A;  3L17 A;  3EJN A;  2AXU A;  4BT8 A;  4EZJ A;  5D0O D;  4HLE A;  3B7T A;  4U0S A;  2HO1 A;  4YND A;  5CMW A;  3PNL B;  3MV2 B;  2ILR A;  3CVW A;  3L16 A;  1UJJ A;  2UY1 A;  3LEW A;  2AXV A;  3TG4 A;  2WMN A;  4OVV A;  5JJ6 A;  2IJG X;  5BPP A;  3U66 A;  3ESL A;  3RU0 A;  2GW1 A;  3I5P A;  3P1U A;  4N3A A;  2V4L A;  4GZD A;  1ELR A;  3L13 A;  1E90 A;  2QY7 A;  4JPS A;  4NRH B;  4KVM A;  3SI5 A;  4DJA A;  3OXG A;  2MOW A;  3PS6 A;  3ZPJ A;  4ANV A;  3PH0 C;  3KEZ A;  4J8E A;  2AVP A;  1KT1 A;  2WXN A;  4PUC A;  4N2Q A;  2CFZ A;  3FH8 A;  2YHC A;  3CHS A;  2E2E A;  3ZRH A;  1PAQ A;  2I6H A;  2FF4 A;  1WM5 A;  4KBQ A;  1OWM A;  2J4B A;  1HXI A;  2FUL A;  3QWP A;  4JA7 A;  3FTY A;  3CK8 A;  1UJK A;  3CHR A;  3FUL A;  3B7U X;  3LPZ A;  4EBA A;  3B13 A;  4UWG A;  3LDZ A;  4GZC A;  2XGO A;  5LP0 A;  3HYM B;  3O48 A;  4QFV A;  2XPI A;  3IKO B;  4U04 A;  4UQZ A;  5AYW D;  2KM4 A;  3LVR E;  1UW4 B;  4G2V A;  3DBS A;  4HOT A;  1E7V A;  3BG0 B;  1H0A A;  1H2U A;  4UI9 C;  3ZYM A;  5E75 A;  3SNX A;  4A55 A;  3MKQ A;  3CK7 A;  4HXI A;  4C0E A;  5AEN A;  4N39 A;  2VQ2 A;  2WXJ A;  2L0I A;  4UWF A;  1HG5 A;  3EHN A;  4ANU A;  4BT9 A;  1XGW A;  2OVF A;  2YQ8 A;  4JVS A;  3CQC B;  4NQ0 A;  4F3V A;  2XRZ A;  1HH8 A;  2WXQ A;  3FWV A;  3MEK A;  3ZHE B;  2YIN A;  3QNK A;  2IOS A;  4KYO B;  5EKQ D;  3CHQ A;  2Y3A A;  3K9I A;  4UQY A;  4PH4 B;  5DBK A;  4JHR A;  2WXM A;  3FH5 A;  3UT7 A;  3LY7 A;  3SBS A;  5LCW C;  4J8D A;  1MHQ A;  3BG1 B;  3MV3 B;  4XIF A;  3FTU A;  2CG2 A;  3IEG A;  5EX3 A;  5J90 A;  4ACK A;  4I2Z A;  3EDT B;  1P5Q A;  4J8S A;  5M72 A;  1E7U A;  3Q5M A;  5A23 A;  4B8A A;  2XEV A;  3UUX A;  4CDR A;  5FZQ A;  4AXH A;  3MYV A;  3D3M A;  4MLP A;  1EDU A;  3CVX A;  4GZ5 A;  2R17 C;  2MRI A;  3OAW A;  4LCT A;  4U07 A;  2CHZ A;  4CRW A;  4CT4 A;  3PEU B;  2GRM A;  5LX8 A;  4WUY A;  4E85 A;  3QJZ A;  3B7S A;  2KCK A;  4K03 A;  2PQN A;  4G23 A;  4A3T A;  3LYA A;  5BV1 A;  3AS4 A;  5EDS A;  4FLH A;  2V0P A;  4GCN A;  4KZC A;  3NQP A;  3OXF A;  4AP2 A;  1TJF A;  1Z6T A;  3ML8 A;  4ATG A;  2X6J A;  3PZD A;  1OWL A;  3BEE A;  4HOU A;  4JHJ A;  4N5C A;  3SHF A;  2XGS A;  4A1G A;  1OUV A;  3FTX A;  2KCV A;  2KC7 A;  2WXL A;  4FHJ A;  2WQH A;  3ZN3 A;  3ZYL A;  3FFL A;  5BW8 C;  2PZI A;  3URZ A;  2BTD A;  1SZ9 A;  2KZT A;  3UPV A;  3ASH A;  3R7Q A;  5DIZ A;  1UN8 A;  5FZR A;  2FBN A;  4I1A A;  4ACL A;  3CVU A;  3FTS A;  2XHE A;  3OTN A;  4G25 A;  4H7Y A;  1INZ A;  4J0U A;  3QWW A;  2IU1 A;  4DI3 A;  3FUI A;  3PEV B;  1L5J A;  4U8H A;  1FVF A;  3D9K A;  4FA6 A;  5CCM A;  5CCL A;  3MX3 A;  4FU3 A;  4AY6 A;  3FTV A;  4FAD A;  4HOR A;  3GZ1 A;  5EX0 A;  2AXZ A;  4DI4 A;  3Q49 B;  4BSX A;  1PC2 A;  2CHX A;  3P2B A;  1JWF A;  4V3I A;  2C0L A;  3LXU X;  3QOU A;  3L6A A;  5JJT A;  4JEH A;  3HHM A;  4Q96 A;  4HOS A;  4ILG A;  5T8I A;  4I17 A;  2AW6 A;  3PRZ A;  1TEZ A;  3G2W A;  1JUQ A;  3FY4 A;  2M63 A;  4M3O A;  2MHK A;  3VTX A;  4XKB A;  5ARF A;  3E4B A;  5AJL A;  1HZ4 A;  1HO8 A;  1MQS A;  4G1T A;  4WWP A;  3SBT B;  3APF A;  4HVB A;  1HU3 A;  3MA5 A;  4JW1 A;  2PQR A;  2VJ8 A;  3L22 A;  1TJC A;  2I1J A;  4GCO A;  3ZIM A;  2C2L A;  2X38 A;  4LER A;  3U3W A;  1PY1 A;  3FUD A;  3LS8 A;  3LKU A;  4ANX A;  4XX5 A;  3FTZ A;  2X6F A;  5KJM A;  2IOL A;  3FU3 A;  1FVH A;  4GYW A;  4KMO A;  4CT0 A;  4W9R A;  3QAQ A;  3QK0 A;  4BFR A;  1NA0 A;  4JXT A;  1Z3X A;  5G55 A;  2VYI A;  3FEX A;  2R5S A;  4GA1 A;  2J08 A;  4UWH A;  5CHE E;  3CK9 A;  3ASG A;  3FUJ A;  5D0Q D;  3FU0 A;  3SD5 A;  4FLB A;  3JQ0 A;  4GU5 A;  4FJZ A;  2Q7F A;  4G26 A;  3S7B A;  4EEC A;  4K0R A;  1DVP A;  4CGV A;  3CKB A;  1ZBP A;  3CVQ A;  2L9B A;  5ENN A;  2WQ6 A;  4JL0 A;  4KXK B;  5KJN A;  4WWO A;  1E8X A;  3D9P A;  4RG6 A;  4DPR A;  1WAO 1;  3CEQ A;  4ILH B;  4MS6 A;  2V8S E;  4JHK A;  2L6J A;  2R59 A;  5KCM A;  3U4T A;  4CDN A;  3WXX A;  2X3M A;  1SZA A;  3UMV A;  5BT1 A;  3KS2 A;  4WND A;  4AIF A;  3JYS A;  1FCH A;  4ILI A;  3ONK A;  5AJD A;  5G05 C;  3CLJ A;  5C2Y A;  3TXN A;  3RRM B;  5BUZ A;  2WXK A;  1A17 A;  2WXH A;  3GZ2 A;  3SFZ A;  2WXP A;  1YA0 A;  3MGB A;  3CVP A;  4U63 A;  1IQR A;  4LEU A;  3ZGQ A;  1ELW A;  2OND A;  4CEM A;  3FTW A;  2BF0 X;  1HX8 A;  4EQF A;  2DIW A;  1Z3Y A;  2IQC A;  4I6J A;  4F1S A;  4A1S A;  4G11 A;  2J09 A;  4C9B B;  4WNE A;  3I4R B;  2RG8 A;  5FWQ A;  4H7X A;  4I6G A;  4LRZ A;  1UG3 A;  1EPU A;  3QKY A;  4RG9 A;  4JZY A;  4KVO A;  1U3C A;  4J6I A;  4UQX A;  2XPY A;  3PE3 A;  3JUI A;  4L7T A;  5C1D A;  2WB2 A;  2OVB A;  3D9J A;  4GML A;  4GZ3 A;  3S7D A;  3N71 A;  2CFU A;  4CCA A;  4B94 A;  3FEY A;  3I3N A;  3CVV A;  4Q69 A;  2FO7 A;  3HIZ A;  5FQ6 A;  4ME2 A;  1QNF A;  3NZU A;  4B8C B;  1E96 B;  2CHW A;  3EHM A;  1HE8 A;  3FHE A;  3QDN A;  4TRQ A;  5BV0 A;  4E6H A;  3NF1 A;  4I9C A;  4IRU A;  2ION A;  2VSY A;  3EIJ A;  4PS3 A;  2I1K A;  3SGH A;  2VSX E;  4G24 A;  3UT4 A;  2UY1 B;  3D9N A;  4WAF A;  5T3R A;  1E8Y A;  2I2O A;  2OV8 A;  4YVQ C;  1HG2 A;  3NZS A;  2PM6 A;  5BNW A;  2UWJ G;  3GYZ A;  2LAH A;  3S7F A;  3ONL A;  1E8Z A;  2XQ0 A;  3MCX A;  4JC8 A;  2J9Q A;  3ZYK A;  2HM8 A;  3FUM A;  4BTB A;  1OWP A;  2BUG A;  1ELK A;  3CSF A;  3Q15 A;  4TV3 A;  5FZS A;  3UQ3 A;  4I43 A;  5A6C A;  4URK A;  2P58 C;  4XI9 A;  3LY8 A;  4O6F A;  3PE4 A;  4WNF A;  5JJ7 A;  3R7R A;  3RRN B;  4MRU A;  3TAX A;  3KAE A;  3PUJ A;  1Y8M A;  4OVU A;  2IFU A;  2VTB B;  1HS6 A;  3QWV A;  3LVQ E;  3ZVV A;  1BPO A;  3PRE A;  1HFA A;  2WXR A;  2NC9 A;  3PNT B;  1QZ2 A;  5FQ4 A;  3DPD A;  4EPZ A;  2HR2 A;  2EQX A;  3CVL A;  4NAC A;  2XGM A;  1EYH A;  3AU5 A;  3T8M A;  2E0I A;  1WY6 A;  1H19 A;  5JHA A;  5G05 J;  3MZL B;  5G2N A;  4APF A;  3MJW A;  5ARG A;  4EZL A;  3FDH A;  3L08 A;  3RO2 A;  4UI9 J;  3CQG B;  3MKQ B;  2A4Z A;  3ASD A;  4WNG A;  3D9M A;  3ZHE A;  4FUL A;  2QFC A;  1GW6 A;  3QAR A;  3VLD A;  1X5B A;  3S2A A;  4LUN U;  4U0Z A;  4BX9 A;  2NXP A;  2NSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...