3FY4A

(6-4) photolyase crystal structure
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
522
structure length
522
Chain Sequence
b'GSGSLIWFRKGLRVHDNPALEYASKGSEFMYPVFVIDPHYMESDPSAFSPGSSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQEWKVKRLCFEYDTDPYYQALDVKVKDYASSTGVEVFSPVSHTLFNPAHIIEKNGGKPPLSYQSFLKVAGEPSCAKSELVMSYSSLPPIGDIGNLGISEVPSLEELGYKDDEQADWTPFRGGESEALKRLTKSISDKAWVANFEKPKGDPSAFLKPATTVMSPYLKFGCLSSRYFYQCLQNIYKDVKKHTSPPVSLLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMVQLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQFNRIYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIVGKDYPKPMVLHDSASKECKRKMGEAYALNKKMDGKVDEENLRDLRRKLQKDEHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-4 photolyase
molecule tags Lyase
source organism Arabidopsis thaliana
publication title Functional motifs in the (6-4) photolyase crystal structure make a comparative framework for DNA repair photolyases and clock cryptochromes.
pubmed doi rcsb
total genus 190
structure length 522
sequence length 522
chains with identical sequence B, C
ec nomenclature ec 4.1.99.13: (6-4)DNA photolyase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 3fy4A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3fy4A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fy4A01
4EG4A 1KH2A 4DDHA 4Q16A 1D2RA 1NURA 3NBAA 3IUBA 5TGTA 2E89A 4MVYA 2AZXA 1GTRA 3KFLA 1QJCA 1NZJA 4MWDA 1JEEA 1PFVA 2NZ2A 2YY5A 1QRSA 1KORA 2Z09A 3I05A 1U3DA 1WXGA 5FO0A 2DERA 1COZA 1F4LA 3SP1A 3CVWA 3AG6A 3KT8A 3COVA 2AKEA 3TQOA 2E0IA 5K0TA 3KT3A 1GN8A 1K92A 2XRYA 1MB2A 3DO8A 1O0BA 4YMIA 3RK1A 2RD2A 1O5TA 1T9GS 2QTRA 1KAQA 2X0KA 2YWBA 5LLTA 1R6XA 1VL2A 3RJZA 3FNRA 1BS2A 5EKDA 2CYAA 1CT9A 3LE8A 4OUDA 3PNBA 1PG2A 4HJRA 4ZT3A 4EFKA 3TZEA 1UFVA 3CLSD 1O95C 3H9CA 4XFDA 1OWOA 5KWVA 4NDAA 4CDNA 1MBZA 1T6YA 2R5WA 1EUYA 1GTSA 5KCMA 3GLVA 5DASA 5JBNA 2WQ6A 3GUZA 1GAXA 1MAWA 3Q12A 3FI0A 1J20A 2EL7A 3FHJA 1KQOA 2VTBB 2X3FA 4JFAA 5TS2A 3U1VA 1IQ0A 4MW4A 1K97A 5HUHA 4U8HA 3VGJA 1N2EA 1YUNA 2PZAA 3IUEA 1O94D 4WNYA 1J1ZA 2A1TS 4R2MA 1MJHA 1KAMA 3IOBA 2CV2A 1YI8A 4GRIA 4DLPA 4ARIA 1OWPA 3MMXA 1I6MA 1EJ2A 3IVXA 4EG8A 4MQ6A 4EG3A 5TEWA 3ZXSA 1QQTA 1KP3A 1NI5A 2J08A 2XRZA 5F23A 1TYBE 2A4MA 1VBNA 3QTTA 3H97A 3DPIA 3LCJA 4JYZA 3JXEA 3OP1A 4MVCA 4GU5A 1RQGA 3ZXIA 1QNFA 1N3LA 3INNA 1EFPB 2CUZA 3HMQA 1OWMA 4FZJA 1N2IA 3X1JA 1PFYA 3P0IA 1JZSA 4PBRA 4MW5A 3MXTA 3NBKA 4MUFA 4Q93A 2E21A 2Z3VA 1T9GR 1NUTA 1IRXA 3FY4A 1A8HA 4KPUB 1ULHA 1IQUA 2PZ8A 2V0GA 1O97C 4MW7A 3ZJVA 2H2AA 1U7DA 3CLTC 2D5BA 2ZP1A 2J07A 1J21A 3SDBA 1PFWA 1NUPA 4EF6A 4ARCA 1LW7A 3ISJA 4F4HA 1H1TA 1KH3A 4MLPA 2IP1A 3SEZA 1N2OA 1G8FA 1M1ZA 3FOCA 1X8XA 2CV1A 3D6UA 2QJTA 3Q4GA 5J58A 2JAXA 3FWKA 1TQ8A 4KKVA 2QUJA 1IHOA 3TNJA 2PIDA 2DEUA 2CSXA 2QJFA 3NV7A 3RFFA 3COZA 2PFSA 3COYA 3SEQA 2A86A 4RUKA 2CV0A 3UOWA 4MUJA 4P2BA 3LOQA 2HGZA 1N2BA 1R6TA 3ZUGA 4K03A 1G59A 1I6LA 1M8FA 4G5FA 4YP5A 4MULA 3E27A 1WXEA 3IDFA 5K0SA 1XNJA 4UZFA 5J59A 4CT0A 2IELA 2IJGX 4MVXA 3UK2A 3MLAA 4AQ7A 2J4DA 4PBSA 4AS1A 3PNYA 4ZCSA 1NUUA 3RK0A 3ZJTA 4U63A 3HGMA 4YP6A 3IVGA 3CLSC 5FO1A 1MB9A 3CLUD 3AL0C 1WOYA 2DLCX 4XSVA 1WXFA 1TYAE 2D54A 1H3NA 4MUEA 3IMEA 1VBMA 5IJXA 4MAFA 1TFUA 4X0EA 1JEDA 3CA8A 1K4KA 5TEVA 1WQ3A 1ZJWA 4F3RA 1M8JA 2HZ7A 1YUMA 3ILVA 2H29A 2QUIA 2CYCA 3G59A 3ND5A 3DV2A 3L92A 1QU2A 4DJAA 2VXOA 4NZPA 1QRTA 1OWLA 4ZT2A 3CLUC 4EG6A 3HFJA 1S4MA 1KQNA 1F9AA 4ZT7A 2JANA 4G6ZA 3RHSA 2PZBA 1JILA 1QTQA 3OTWA 2QUHA 3FG9A 1JIIA 1HYBA 4KPUA 1F7UA 1J1UA 1JZQA 4MWBA 1WQ4A 1Q77A 4HJXA 1MOPA 1N2GA 1N75A 4S1OA 1IVSA 3A4IA 2OV4A 4DDKA 1PG0A 3IVCA 1WJGA 2B7LA 1P7PA 1WKBA 2WB2A 4TS1A 3TS1A 3A04A 5J5AA 4L2IB 3AIIA 1MC1A 2ZUFA 1T6XA 4MUIA 4NX2A 3CLRD 4NATA 2D13A 1WZ2A 4R2LA 4CDMA 2PG3A 2CYBA 3A05A 1Q15A 4MUNA 3ND7A 4MUKA 1EUQA 4YBRA 4MW0A 4PBTA 3IOCA 2WSIA 4ZCPA 4EG5A 3ZJUA 2J09A 1O94C 1M8KA 1M8PA 3HZRA 1J70A 2YWCA 4MWEA 1V47A 5LM3A 3MUEA 4J76A 1X6VA 2BTEA 5HUJA 5BNZA 3CR8A 2PXHA 3CVVA 3VRHA 2CT8A 2A1UB 5LFAA 3HV0A 2A7XA 2VTBA 1N1DA 1T6ZA 2QJOA 4DE5A 1I2DA 3FH0A 1GLNA 5DEOA 1LI5A 1YULA 1OD6A 4HK4A 3K32A 1KP2A 3Q10A 4DNXA 1J09A 5HG0A 1EE1A 4QBTA 1VLHA 3IMGA 2A1TR 3CVYA 2J5BA 3H05A 3IMCA 4JXXA 1NSYA 1JGTA 4EG7A 4NAUA 1VBKA 3AFHA 1I6KA 1N2JA 2GKSA 3AG5A 4J75A 1YIAA 4ND7A 4I6JA 3IH5A 4I6GA 5H16A 3N9IA 1OBCA 4ZCQA 2V0CA 3CLTD 4XFJA 1PFUA 3IODA 2WQ7A 2A88A 3GMIA 4HPWA 4ZCRA 4E1AA 1NYLA 4MW1A 4MWCA 3BL5A 2NSYA 1NP7A 3M5WA 4MW6A 4BWVA 3IOEA 2JA2A 1EFVA 5DK4A 2RE8A 1M83A 1EFVB 4CQNA 3QTBA 4G5YA 1NUQA 2GOYA 3ZIUA 1EFPA 1G8HA 5FNZA 1N2HA 1IQRA 3ELBA 2DPLA 3H9BA 2O5RA 3CVUA 5H7XA 4KR7A 4EGAA 2E18A 2YXNA 2TS1A 3X1MA 3UY4A 4YP7A 3ZGZA 1O96B 1XJQA 3PXUA 1KR2A 1O6BA 1U7XA 2DUMA 1LI7A 3D6VA 1MAUA 1K4MA 3G6KA 3A2KA 4JXZA 2QTNA 1JMVA 1IFXA 1IH8A 1G8GA 1YIDA 1XNGA 3X1KA 3TZLA 2G36A 2AG6A 3FIUA 3SZ3A 2DXIA 4MUHA 1JHDA 2X1LA 4MW2A 1ZUNA 2C5SA 3ND6A 4ZT4A 4DDMA 3FETA 3SZGA 1OBHA 3QE4A 1TEZA 1Y42X 2DETA 3UC5A 4KR6A 4A91A 2ZUEA 3S3TA 1ZH0A 4L2IA 2EJCA 1JECA 3N05A 5IHXA 1F7VA 1V8FA 4ZT5A 1WXIA 3G5AA 4ZCTA 3CVXA 1OWNA 1N77A 1QRUA 1KQPA 1H3FA 1U0BB 3KT0A 4MVWA 1DNPA 2I1LA 1O97D 1WXHA 2O8VA 3P52A 1H3EA 3N8HA 1KH1A 2QTMA 4MUGA 1TYCA 1B6TA 1KKUA 1JIJA 3HL4A 3L93A 3TQIA 1EXDA 3N2YA 4UZEA 4PY2A 1NUSA 4QRDA 4ND6A 1GZUA 2GM3A 1O95D 3FDXA 3RBAA 3K9WA 1ILEA 1N78A 4RPIA 1Q11A 2A84A 3VU8A 1U3CA 4QREA 4OJMX 3MLBA 3PNVA 4R0NA 2BYTA 1FFYA 2CFOA 1MRZA 1M8GA 3UMVA 1ZH6A 3CLRC 4ZT6A 1WY5A 4K0RA 2DR2A 1FYDA 3AKZA 3KT6A 3PRHA 4NAHA 4MW9A 4U7JA 1O0CA 5DB4A 3C8ZA 4H3SA 5AHWA 1Q19A 3DLAA 3SYTA 2OQ2A 2Z08A 4I6EA 4JZYA 3P0JA 2A1UA 1XNHA 1TYDE 3F3MA 1QU3A 3H99A 4EG1A 5KHAA 2HMAA 1R6UA 4KR9A 1JIKA 2X1MA 1GPMA 1O96A 3COWA 4WSOA 3P0HA 4OUDB 2QUKA 1SURA
chains in the Genus database with same CATH superfamily
1HE5A 3PVSA 4Z49A 5EGNA 3VOTA 3FX2A 4ATZD 1RWKA 2YBDA 3IE2A 4HTFA 4MGIR 1CEEA 3LMKA 4NRDA 1PZFA 1BVRA 2J67A 2CDRA 1EZ1A 3BSSA 3I45A 4YUVA 4URHA 4LQDA 5BRNA 1ZRSA 3PEEA 1HH8A 3SGHA 4EHAA 3IE0A 4KQ9A 1XZQA 5LKAA 3TECE 1P6XA 1COZA 2PIAA 1M2WA 1CXZA 3SS9X 3PGLA 4DR3B 4R0MA 1TD9A 4PCLA 5AHXA 5LBUA 3L77A 4URZR 2BM0A 1KBZA 2BDTA 2D1QA 2EFHB 3A9SA 3MB5A 3WKEA 1C30A 1XJCA 4YLYA 5B7PA 4ER0A 3HTXA 1M1NB 4XX1A 1ZY2A 3DEKA 4G8LA 2F1JA 2V5AA 3DW3X 2ZJ8A 2FUKA 3OQHA 1XA3A 1UN9A 1II0A 4PPFA 2J3IA 3CS3A 3T38A 1KRHA 2JLRA 4D82A 4K28A 5ER6A 5CBPB 3BX1A 2ATXA 3CEHA 4HRNA 1CNEA 3D4OA 3E3NA 3PHHA 3RQSA 1GUZA 1Z0SA 3ZIAA 2PU5A 3QOYA 5KS2A 2AV6A 5EKDA 2IDMA 3LHKA 2ZBFA 1T3TA 3C3AA 3ZWNA 4OX9B 1UK7A 1GHTA 3CV3A 3KJQA 3MINB 3PNBA 4NMLA 1Y3BE 3JD0A 3OBBA 5ALPA 4W5QA 2QBYB 1BXGA 1SBZA 2VHXA 4HWKA 3VNQA 4EFKA 3HHEA 1E5VA 1RLIA 2VPWA 5CM9C 5ADWA 1QUFA 2XKJE 4DV0B 2HBYA 4TYQA 1GYQA 3BTSA 3LQ1A 1TNBA 4WNFA 5BQ5A 1DWOA 3LG2A 3KS9A 1F9EA 4DMUB 4G8CA 1TI7A 1JI3A 3WXBA 5JJ7A 1T6YA 3T3OA 2DQSA 1QIGA 3IPCA 4DKXA 2QLJA 3D3QA 1W4LA 4RTOA 1KPGA 2OZLB 2R1VB 2ZXWE 1ZH2A 4LZZA 4QGBA 5B36A 3DYVA 4R6XA 3CLJA 5JCOA 3ITDA 4FW8A 1TR4A 4DTCA 2PT5A 3GP5A 5J40A 1VE5A 2W6NA 1NAIA 3GFPA 3AI1A 4XOUA 3REFA 4MICA 4OQLA 1U6JA 1VLMA 4Y6LA 3ULYA 3B1XA 1EGAA 1K97A 2YJ5A 4DGSA 1INZA 1NQXA 2R8XA 1NHWA 1XAJA 3FTXA 2F2TA 5KBAA 4X20A 1J5XA 2G8LA 1G3MA 3P9ZA 3CVJA 2ZOSA 4FMDF 4QEZA 4JUIA 4XASA 2BDEA 4WACA 1LTKA 2MTBA 3DAYA 1K3UB 1Y9AA 3PXBA 4CMKA 2IQIA 1JEJA 2PR2A 1N8TA 3BMOA 4DV7B 2C9BA 4HN9A 2J5KA 4UNQA 1XEXB 2BRUC 2QRVA 4UNSA 4EKEA 2RFAA 2AEFA 2VDJA 1UK9A 3MBIA 4P1ZA 4BQEA 1Y8AA 5D3MA 3VDMA 4KIGA 3WO1A 1JMYA 1KI9A 1LC3A 2NTJA 2X4LA 1DAFA 3M82A 3IAM6 2XUHA 3QTTA 3H97A 3ZK7A 2W2TA 3HJBA 3PZ3A 3DTTA 3KLBA 5CXXA 4NBNA 4BLSA 1YZGA 2OBFA 3PC2A 1CJKC 3NWOA 3UA3A 1AUXA 4N0DA 4RENA 9GPBA 5EMHA 5K0FA 2K4MA 4IDDA 1S2DA 4ZI7B 1PAQA 5JLAA 4DLKA 1VA5A 1WV0A 5J9FA 1YR6A 1YFLA 4GEGA 3MXTA 2A5FA 1E59A 4EL5A 2F17A 5T6BA 4QT0A 1UC8A 3SF8A 1ZC4A 1E6EA 3C72A 1CW2B 1Y5RA 2VPTA 2QM7A 2ETAA 3I5MA 3AP1A 3T7SA 3GLFA 2QT1A 2A4ZA 2YWGA 4QELA 5F21A 4J2TA 1IBCA 5BYKA 1K89A 3LX5A 4WERA 4ZCMA 5HQTA 2Q4BA 3UCEA 1U02A 5C1BA 2FK7A 5CW2A 2BGMA 3A6GA 4GYJA 2IEYA 1GGKA 4E33A 1LLUA 2FHPA 5TY0A 1HX7A 1DFGA 4KQKA 4Q34A 1YTUA 3MCXA 1N34B 1G8FA 5DDIP 3K9LA 4BJ1A 1NY5A 1G17A 3E2PA 1WDYA 2EG5A 3FKJA 4EA7A 5KX5B 2YC4C 2XDWA 4KKVA 4W82A 1L5FA 1VMKA 4FFOA 1ORDA 4LBWA 4IBOA 2Y4UA 4TXQA 1YGYA 2ZAIA 4LDZA 4RNCA 4OGGA 3AYXB 4OH7A 1TJ5A 4L23A 3G79A 1X87A 4CFSA 3EBLA 5FNVB 5ITWA 1J2JA 3PJGA 5KDOA 4C1BA 4DSAA 3OPQA 4DPMA 3WZMA 4BRSA 5TX7A 1I7SB 4YHHB 2YY6A 5JNUA 1MPTA 3GCWA 4PE5B 1FLAA 2H07A 3DDWA 3P4YA 3SIRA 1H5NA 4U7EB 2H85A 3AG3E 3FNHA 5M29A 3W9GA 1EFRA 3HNPA 1WZNA 4PU0A 3T95A 4JUAA 1TW2A 1Z4LA 2G08A 4LXTA 4S35A 1GRRA 3FZEA 5C31A 2O57A 1V7ZA 5GOTA 1CUVA 3BHNA 4RKFA 3C70A 4UHFA 4V0MA 3WIBA 4N76A 4F12A 4FOTA 1CIJA 3L7DA 3E35A 1WXEA 5M34A 4RJTA 3IHVA 4NG5A 5LUAA 4ZVVA 4HH1A 2XNSA 5DYIA 1QFXA 1I8TA 2R00A 5KNGA 2XDQA 3A4NA 3FRHA 1ISPA 4AS1A 2OGWA 4LTNA 2PNJA 2BFBA 2DSNA 2QVZX 4O3MA 1X70A 1U80A 3OXLA 3TXNA 3EJWA 1JT9A 1X1DA 4IUYA 4MWOA 3RAPR 1P0FA 1MB9A 3CSTA 1R6BX 4Q3NA 1WY7A 1DTWA 1XAGA 4B3SB 3LDHA 2Q8NA 2B34A 3I32A 1C4XA 2G09A 3S5JA 1K8RA 1P9WA 3EMVA 3IB3A 3NHAA 1OYOA 4H60A 2XMZA 1JEDA 4N6GA 1BMFD 2GZRA 3JYOA 3TX6A 2WWYA 1X80B 3CK9A 4H16A 3H8SA 1VDYA 1J90A 1DZIA 2GD2A 3ZBUA 1FYFA 2I2CA 3NXKA 1SA5A 5CNMA 1AZSC 3ZBQA 2H2DA 4LHVA 2CNBA 3IV9A 4IO1A 1GQQA 2BEWA 1TFRA 5AOCA 3T5DA 3R74A 2IYVA 1GDDA 4IDEA 1KU0A 1HO8A 3AONB 4GR5A 3L6BA 3C2QA 4QRHA 3AF3A 5EERA 2XDYA 4DG9A 1EM6A 1AQNA 1OT3A 3WDSA 2V8OA 2E9SA 1EVEA 1R2QA 2PKCA 3DNFA 3VR6H 3HLYA 4IEIA 2QN9A 4DA0A 4P54A 5LP6A 1DBVO 2BEVA 3ZDCA 5G1NA 3E84A 2QN3A 3FA2A 4G6ZA 1X9GA 1JKFA 1TCBA 3WL7A 5A5VA 1ARZA 1LQ2A 1A69A 4KOAA 3U7EB 1PJSA 3DUWA 4QVIA 4X6YA 1KK1A 1JPLA 3OAWA 3EA0A 3E7FA 5DSTA 3KE9A 3B3QA 2BFNA 4DEXA 1EIWA 1F7UA 4B8CB 2GGSA 5D1HA 4QLBA 2HCTA 2IW1A 2WU0A 1HT3A 3FDZA 4CV3A 4DCSA 2ZBQA 1OLOA 2HA4A 1E2IA 5ENNA 2YMLA 1MU0A 4QUIA 4C6TB 2CNLA 1G63A 5FWNA 3KR1A 1FOEB 1NR1A 2BM1A 3AHJA 1QVVA 3MRSA 3PXEA 4Q3CA 4WLFA 1C81A 1GGMA 3WYBA 2BJVA 1C29B 3FDIA 3HSSA 3L6EA 3LBHA 3IQDB 1D8DA 2C7RA 4JI8B 4GA1A 5B1AE 1XE3A 1ZD2P 3CWZA 1FCJA 5LBTA 1TO6A 5BV0A 4RSYA 3Q5DA 5ALIA 5IVDA 4HO1X 2Z4TA 1DE0A 2EQAA 3IPAA 4CDMA 3A05A 4X6LA 3OJOA 4QDXA 1OI3A 4MW0A 3GBPA 4K5QA 2WSIA 1HYHA 1CR0A 3CW8X 5AQBA 1FNBA 2J09A 5T3RA 3PKJA 1ODIA 4YJDA 1TK9A 1N4QA 3ER6A 3QY0A 5HCIA 4QTYA 4JT9A 2Z43A 3K09A 2PRYA 2BF4A 2GWRA 3PTAA 1UBNA 1NBME 2XCBA 1PEKE 1E58A 1F0YA 1C14A 2E4XA 2YJ4A 3EXFA 4RABA 1KYVA 3TMAA 5F9FA 4EI8A 1PVDA 4Y2UA 1WSDA 1XWFA 3MUNA 3VRHA 2V5FA 1WV1A 1GDHA 2W6QA 1T2VA 3BUAA 1AUVA 1SD5A 3UJ7A 5AXCA 3ZDDA 2C29D 2QROA 1MZCA 1S96A 4IJ6A 4MITA 5JHGB 4JL0A 3QQ5A 4JLWA 3AVPA 4AJLA 3N8NA 2HM7A 1CY7A 1NMZA 3UJCA 4IWYA 2V65A 3RYCB 1SVWA 2P9PG 1ZH8A 4R54A 3VPDA 2L19A 3IS3A 5DTJA 4DNXA 3W2EA 4A6DA 3KJIA 1A9XB 2EW2A 4BAZA 5A9SB 2R751 3DC7A 2XUGA 2DHCA 4AZ0A 2IHBA 1KDRA 1UBCA 3EAQA 2X5XA 5HKLA 1VBKA 1WUKS 2JJ2D 1QJ4A 3EXHC 3Q7EA 4RLFA 3RKUA 2LSUA 3MCTA 4MVJP 2MHKA 3PGMA 3T7DA 4YXFA 1VJRA 3EY4A 3K2BA 4QXMA 4I5GA 4EBFA 1NLUA 4B6PA 5A06A 3L4JA 5LQKA 1DKPA 1QYCA 1U8FO 1WM5A 1QNLA 4J16A 4MV8A 3S1AA 4F46A 3ME5A 2QNBA 3SSAA 4EO4A 1UP7A 2BFBB 4C4PA 4CKBA 2H4JA 1C1DB 3R3XA 2QW8A 1NQOA 2RHMA 5FXMA 2VSOA 5IF3A 2VJBA 4DIUA 3TSOA 1C4KA 4HG2A 1ZH4A 1LC0A 1TA0A 1RAGA 3SZMA 2I3DA 1BXRA 1RPJA 1U6IA 1E7WA 3DV9A 2ISCA 3C43A 4QM6A 1DC4A 4OGFA 3V80A 1FY2A 2HIMA 3F78A 1S0UA 4JKOA 4B4KA 4BWVA 2RMKA 2ZUWA 3MTEA 2HY7A 4W4TA 5WRFA 3T7JA 5KVSA 4LOIA 4YCCA 4G4IA 4RY9A 5LP6F 5KSYA 3RAFC 2Q3HA 1HZZC 4BLTA 1ONPA 2JLVA 1AHNA 1MOQA 5J08A 1EFPA 4UMFA 3VSBA 4ZFNA 5K01A 3ULEG 4B6FA 1LPBB 2DPLA 2JFBA 1Z8NA 2ZI3A 3T35A 1Z4PX 2AKAB 2E4WA 2A1IA 1C9JA 2JGJA 1CUDA 2QN6A 2HPHA 3DL7A 3DZKA 3EG5A 3HU3A 1ZG3A 4FILA 4P7GA 2R68A 4CTOA 5JCOC 5K8CA 3IX7A 4TVBA 1PUIA 4DK5A 2XAUA 1YJCA 4ZHBA 1CNMA 2YASA 1B4DA 4F97A 8MHTA 3ED5A 1KE2A 1KR2A 3B13A 2R6DA 2PLAA 1EG2A 1F8UA 3T7CA 3ZVKA 4FYKA 4TLLB 1IFXA 1MG5A 2NZYA 4R3WA 3PWKA 2QOEA 1HT0A 1LTHR 3BCHA 3PF8A 5KJ6A 3EYAA 4NBSA 3S99A 2JB9A 3N6VA 3O8NA 1DIGA 4N65A 2CXQA 2GARA 3HJTA 2B25A 3TG8A 4G09A 4R51A 2PANA 3GNTA 3FSRA 2TSYB 1GP2A 3NHBA 2P78A 5DM0A 4X8QA 3ZE7A 5HRUA 2EARA 2GGFA 4I36A 2AK3A 4B46A 2II6A 1TN7A 2E7ZA 2FFBA 4G81A 1FFXB 3BIXA 4Z1MA 4BUZA 1NXQA 1UMCB 2AOTB 2EEZA 4RAQA 4TKMA 3WKDA 2VTEA 3FNBA 5DGHA 5ECWA 2RHGB 3OEHA 4LRXA 3ML1A 3BD9A 4QAJA 1WETA 3WK6A 1RRKA 2RGXA 4JHXA 5ITZB 1Y8MA 3EIQC 3KKLA 2D2VA 2B2XA 4B32A 4TVSA 5I8WA 1GNQA 1ID8A 2CC2A 2BCEA 4YX9A 2CXOA 1Z3XA 1YVRA 4CU2A 2PUWA 5CEAA 3V2HA 3WLQA 4ANVA 4GZMA 3MAJA 1JNYA 1NBIA 1U99A 4DVGA 1H2EA 4IKPA 4QSHA 4JT2A 4UDNA 3MSXA 1S9HA 2IT1A 1TYCA 1JKIA 2P9FA 3L0SA 3TQIA 4Y2GA 1MAAA 1Z3YA 3ZD8A 3EGDB 4JU9A 3OOSA 4FLHA 2C2BA 1VPVA 4ZICA 5A0VA 5AHRA 4QRDA 2VJPA 4OKIA 5C7YA 1W581 2KSQA 4W5JA 2CXTA 1T10A 1O95D 3M6UA 4NMHA 3K70B 1OLUB 4H77A 3DBSA 3UIPC 3C6KA 4NNOA 3K53A 3QUBA 5JPIA 1BNCA 1FXWF 4FFBA 4HGNA 4HN4B 1SB9A 3VU8A 1FRZA 3RJ9A 2AF3C 1U8XX 4R7LA 5MHTA 3SHTA 3VVMA 3PNVA 1QYXA 1EYZA 1WVIA 4D98A 1FFYA 3RSQA 2PJUA 3V1MA 4GS5A 1G1AA 3HXPA 1Y81A 5IT5A 3AAAC 3U7QA 5JMOA 4ZAYA 2YWJA 1N2SA 1WY5A 4X65B 3ADDA 2DQYA 4LV5B 1DUVG 3RU3A 3ILSA 3NBYC 1OVGA 3OMWA 1V3TA 1N5KA 1DUSA 3NTUA 1U4OA 1D9XA 4OEHA 5ECDA 3VFDA 3ZYKA 2UY1B 4HRMB 2ZFUA 3FOFC 5FPHA 2Q6LA 4KWTA 1FYWA 5CHEA 5IDWA 4J0QA 2YQ5A 1NVWQ 4RTRA 3N2GB 3X1DA 2VRCA 3I83A 4U7HA 1H2RS 1GCUA 1UDAA 5KQMA 3VR3D 3HXDA 2P11A 4G23A 4MV4A 1K8KG 1H6AA 3Q8LA 4EZJA 5EEHA 4N40A 3QY9A 1M2FA 3RPEA 3WIDA 3JAMA 3T0IA 4CM6A 4HZUB 4FU3A 3P2EA 1YK1A 2JJQA 2QUKA 2WXFA 3IEIA 1IPEA 2IHZA 3KJXA 4PVDA 3PRJA 4OQEA 1XZLA 1U2RA 2JFGA 3OLZA 5G4KA 4YT8A 3NNDA 1KOGA 5HQJA 2PH3A 3L0DA 3OTQA 1E32A 1HV8A 1GNVA 1K6MA 1TM4E 1UOQA 2XXJA 1GEGA 2VJLA 4MVYA 3VHQA 1QJCA 2AZXA 4CDRA 4CGVA 2FH5B 5A6VA 1LBHA 1ECBA 5IYZF 1ML3A 1P2FA 2OWEA 3Q73A 2WWTA 1YCGA 2CE7A 1QOPB 4K5AB 2P5TB 4IXTA 2YNQA 1Z6ZA 3ZCSA 3X1YA 2DCUA 3TWTA 2H63A 2WU8A 3O0TA 1T9HA 3FZQA 4O2LA 4NR0A 1ORTA 4OQ4A 3TRDA 3VKVA 2ZIUB 2OBNA 2QVXX 5LB4A 1W25A 2QMOA 2ZT7A 3ADKA 3CKKA 3MF4A 1DP4A 1YJQA 3HB1A 2BLLA 5CEEA 1E3QA 3R5KA 4N82A 3LGSA 4NOKA 5ALFA 1XTRA 3FH7A 2VJDA 3GT3A 4Q03A 1JDJA 1WCV1 2I03A 3IQGX 4BMDA 2CYAA 3KKKA 5DLEA 1B89A 2V7QD 3L4SO 4QUJA 4GTTA 1N3YA 1W8DA 2FWPA 4K05A 4P4NA 4TYWA 3OCVA 1YRYE 4DBVO 1WZCA 1E3IA 1Q1GA 1TRKA 2F59A 1B8PA 4WMLA 3H9CA 2EBWA 1KEVA 4HQRA 5BPPA 3MG9A 2H9YA 3LC1O 3F5SA 5CT6A 3REGA 1U7WA 4GX1A 1NX9A 4HB2A 2R5WA 3D9NA 2QRZA 3BF7A 3I42A 3WGUA 3H1AA 4EBBA 6NULA 2FN4A 3LUJA 2IPAB 3SKVA 3ZDAA 1BA2A 1M6VA 1ZD4A 4OAQA 5CTJA 5HIIA 4UTRA 3H9JA 4APOA 3REOA 1TN6A 1BEZA 2I54A 2VNKA 1CUBA 4S1PA 4IDNA 3IV6A 4EZBA 4NARA 4PS1A 1GT6A 3GPDG 4A8PA 3ZD7A 1ZHFA 1E8WA 1DWPA 1FDVA 1T9CA 2PZAA 2WJYA 5ITVA 3I2GA 5T57A 1IOVA 2WLSA 3EHMA 4L4SA 2IEGA 5CAEB 4D8TA 1MJHA 3U81A 2Q2WA 1YFKA 2DFLA 4A5OA 4K9KA 4WNAB 2CLOB 3GJ5A 5EI5A 3K73O 1QRRA 4M9RA 2QWXA 4IIJF 4UUOA 4IICA 4U8VD 2QBYA 5IAKA 3AEXA 1SHJA 1O77A 1NI5A 2ZYRA 4GXRA 4LVNA 4MMYB 1WBBA 4KRGA 2OZEA 4LYYA 4NJEA 1VYHA 2PWYA 1NJ2A 2Q5FA 3FCOA 2V7BA 4P7KA 5G1PA 4D8WA 4B6EA 3ZN2A 4XQCA 1IN7A 3OP1A 4NPHA 2WG0A 2OCAA 1VSQA 1V5WA 3JQAA 3NH6A 1MJFA 2EFJA 3IAS1 2GAOA 1H2AS 1U0TA 4NE9A 3SHFA 2PSSA 3DXFA 4P84A 3ZYZA 3BFKA 1QV7A 3GVCA 3HA5A 4FC8A 3ZXYA 1D2MA 4NS1A 5D00A 4DFDA 1CE8B 1TYQG 1EFDN 3K9CA 3BZBA 1AUPA 1Q3TA 3BB1A 3ENVA 4XJSA 3R7BA 4TXJA 3CBGA 2PH7A 3P0IA 3WK8A 1QGED 2VYQA 3GRFA 4G84A 2QIOA 5KTOA 3WYNA 3P5SA 1OI2A 1JVSA 2IOFK 1YMQA 3L8MA 3NP9A 4LGMA 4QPCA 4JHJA 4UPVA 5NLLA 2CNWD 2IYOA 4NQZA 4KPUB 2JHAA 4Z9AA 2UVQA 4AAYA 2RHCA 4MEBA 1JSZA 4MRNA 1H2TC 4RG6A 1V6AA 3F4KA 4UBKA 1JXMA 2V3WA 3KETA 2D5BA 1HKUA 3EWIA 1Z3CA 4KI7A 3WYCA 2CFSA 3PITA 1W0CA 2EINE 1T2EA 2HO4A 3NTQA 4EF6A 1WEKA 3W7VA 2QY6A 1DTSA 2W4QA 2IP1A 1DG1G 2C7GA 2O6LA 1KMHA 2QTHA 2X4IA 1X8XA 3AINA 4IGEA 1UBSB 2ZIEA 1YKFA 5DCLA 4XRRA 4XVQA 2PUBA 1ZN7A 2OECA 3E58A 1TQ8A 4ZCLA 3STYA 3DV0A 1YA0A 1I6WA 3CF2A 3GJXC 4AJ4A 3BJMA 3BFVA 4UD6A 3DZDA 3WMXA 2FSGA 4I1OB 3ZBTA 2EGGA 2QJFA 4CMHA 1ZU2A 5G55A 2PYDA 2ZAGA 3ZCUA 1SBNE 3KKMA 3ZPJA 1DHRA 2BTQB 1SQ0A 5A1JA 3CN7A 4OHCA 3W5CA 4X62B 4LY0A 3K9FC 4N7JA 2MSNA 5E2AA 3OLYA 1JHPA 3RW9A 3KZXA 1LQUA 2FQXA 2YDXA 1ZK1A 2BTOA 3OP4A 3LBYA 1NM5C 3LRPA 4IEEA 5JBIA 3B20A 4KMMA 2DB3A 1I6LA 2GROB 3M0EA 3VISA 1CLEA 1X7YB 2E4UA 4MYSA 1XTQA 4UCFA 4Y2XA 2PDAA 1OLUA 3CEQA 3G0BA 5EFOA 3L7IA 1QFSA 3DF7A 1FP4B 4ZZ0A 4Y9RA 3D7MA 2UYOA 3H75A 3FHTA 4BNTA 3E3AA 1RP1A 4E22A 3ETLA 4NULA 1SXJA 4O4JB 4BE7B 4NMXB 4KJXA 3T15A 2H4WA 3P20A 4FYVA 3ENQA 5F52A 1H9CA 3QARA 2NXPA 4NSNA 5EIAA 2WXLA 1ODJA 1ORVA 2QTWB 4M0CA 5HWSA 4FGKA 1TK3A 5D0OD 1QO7A 1AG9A 1G64A 1TVKB 1FQKA 2J6CA 2YJ3A 3B3AA 3BXPA 1ODKA 2I29A 3K1TA 4M0FA 4MWTA 2I34A 3A3PA 2WHPA 4L5YA 5LLDA 1QHHB 2EGUA 3EGVA 1DRUA 1UWCA 3K16A 4KV7A 1PSWA 2BDUA 1TVMA 1BE6A 1H1LA 2WF7A 2WAYA 1A2QA 3F46A 1DJPA 2OP1A 4NAVA 4UJ3A 1CU1A 3T8KA 2D8AA 3GPCA 3HHPA 4I1AA 5GPBA 4CNQA 2HRCA 5E1DA 1DEOA 1VOTA 1GTJ1 2YHBA 4J8DA 2M1ZA 3QRWA 3RS8A 4BJ5A 4D9HA 1V5EA 4ZMBA 1LBEA 5JC8A 5E6UA 2P9LG 1ZJWA 1X7GA 3AHHA 4EO9A 1KFJB 1E2BA 2Q7OE 3CRW1 1IEVA 1KY5A 2Q2NA 1E3DA 1QO0A 4HDKA 5HFAA 5B3JC 3T7IA 2ZSKA 5LC1A 2I4MA 2XJ9A 3FH8A 1JH8A 1L5LA 3STWA 2ZJBA 2EW1A 3NAGA 1JHYA 1RZUA 2F43A 3KYCB 2FBNA 2P9ZA 2VJMA 4XVHA 2O8FB 1BLXB 1X0XA 1ENZA 1YVUA 3G8BA 4OJTA 5DM60 5BUQA 3ASUA 4PXYA 1UZLA 4UHCA 5C3MA 1QRDA 4JAVC 4L9AA 3N2EA 2O8NA 3CHYA 1L7MA 5FJIA 1JSCA 4LWPA 3TQTA 1C7IA 3SZ7A 1HL7A 1QKIA 2H0AA 5F35A 1Q1ZA 3CX4A 3OPXA 2LXLA 1Z5NA 3SR0A 5GVRA 4J0KA 1QOQB 3Q0IA 2GJKA 2KPOA 1ZS9A 3FTYA 5J90A 1CYDA 1E2MA 1WQ4A 2JHPA 2XTJA 4HJXA 1PNQA 4K6KA 1CZKA 2WC1A 4YMGA 5LZ9A 2MYOA 1DLIA 3D9OA 2ZJAA 5KYUB 4ZZ2A 1XZMA 4B7AA 1L4FA 2B7LA 4XB2A 5AD1A 4JLBA 4J2HA 3MS4A 3QX7A 5CYPA 3QNWA 1PF7E 2UDPA 1SXJD 4AIFA 2DWOA 2Z8YA 3A04A 3C7KA 2W83A 3F2VA 1F38A 2GPYA 3PHLA 4D57A 1EM8A 2IYFA 2ZJ7A 1NDQA 1Q1NA 4OHUA 2X9LA 4GE0A 5JSFA 3K6SB 1KLXA 2ZROA 2VF5X 4LHSA 1TQ4A 1BU9A 1UKZA 2AH5A 4Z7NB 2G71A 2BM8A 2GXUA 2FWRA 1MXFA 3C5RA 3GEIA 1G98A 2O23A 3G5TA 4HLQB 3ROZA 4QECA 5GWXA 3ZJUA 3DTNA 3BJIC 3BWDD 3SVZA 3TLEA 3VU1A 1CKEA 1HLPA 1RM4A 5C34B 1FIUA 3I34X 5E95A 5HE8A 1PFQA 4BE4A 4DG8A 1NMEA 4GAEA 4IIJB 4P9NA 1G18A 5IG2A 3AR5A 1NXWA 2ZW9A 2VK4A 2PXHA 2F6RA 2O2ZA 3IKJA 1ECJA 4ZU1X 4QU0A 4YWJA 5IAOA 3KYJB 4IH1A 1Y37A 3RO7A 1UIMA 4D80A 4D9MA 2Y0CA 1FMTA 4RBNA 2OG2A 1H2VC 1DV2A 1FJGB 1R0CA 4M9CA 2DULA 2R4TA 4UEQA 2WT8A 3RFXA 3WAJA 5GAJA 4I66A 3FH0A 4MKZA 3EC2A 4FN5A 1GGFA 4AJOA 3RYCA 2XGGA 4R9UC 4YIKA 1II9A 3SZOA 1Z62A 3A6PC 4P53A 3DLCA 2DBYA 2EZ8A 4UI9C 5BN3B 1QV9A 5BT8A 3NOXA 2F8TA 1XQ6A 5EJ5A 4DI4A 3NHRA 5AM5A 2R6JA 3VO2A 5CDHA 3L84A 1RAAA 1PDVA 4XX0A 1D04A 3TEFA 4D9KA 1JTFA 4E6PA 5KWDA 5A5DA 3AHEA 3I9LA 4XGQA 5B37A 4D92A 3CUWA 3KTFA 2VQ6A 5MF6A 1S3GA 5CEFA 4HH4A 1YIAA 4ND7A 4I6JA 1KYXA 5DM4A 1I4DD 3KTAB 4DL9A 3ABQB 2VEDA 4CM9A 4RC9A 3Q49B 1ZI6A 1KZ7B 4LOLA 4I6GA 4OCZA 4C0AC 1C3OA 3DO6A 4MMXB 3ES9A 4QDZA 4J9UE 1U9ZA 1OFTA 2V0CA 3BB4A 1V1JA 4RIFA 2PSHA 5LN1A 4DR7B 4Y1RA 1PK9A 4K9OA 3IT3A 1VI5A 1K1AA 2YYSA 2XE4A 1OA0A 3E4CA 3JALB 4EBAG 3ZR4B 1ZM3A 3OKCA 1GEEA 5L51A 4KCGA 4ZPJA 4Z53A 1MO4A 4WA7A 1W47A 1L5WA 1ZUHA 1HYGA 4TUYA 2RGNA 3ZWYA 3T5PA 4MMZB 4S0XA 1OV4A 5EYPA 1JAXA 1PJTA 3KZMA 4GLFA 3TYXA 3VYSB 2VQ2A 1TMGE 5IEBA 4HQDA 1M83A 3SR4A 4X20B 4JEMA 5ALOA 1E1QD 1JHOA 2EFCB 3WL6A 2I6UA 1WIWA 4TTIA 2YV4A 1B26A 4OP2A 5IVKA 4TV9B 1S70B 2YRFA 2ZXFA 3QWAA 1XLVA 4GOXA 5KKAA 3VAAA 1LBSA 4MK4A 4AYWA 3KZVA 4N12A 4DLAA 2FFAA 2A9RA 1UP4A 3ESQA 3ITEA 1JHMA 3RNOA 3PNLA 1W5BA 2GTHA 1C0LA 5BSMA 4HGOA 5T41A 4U7DA 4S1NA 1O58A 4D6XA 3V8EA 4M89A 1F3OA 1SVIA 1ZMOA 5I7VA 1US8B 2JI9A 4LISA 4V03A 1AS3A 1O6BA 1HXIA 3TQSA 4C6SA 3SQWA 4FQ7A 1RPAA 4AICA 1S0PA 1JDUA 4OAOA 3IT2A 3OZWA 4P4SB 4C7BA 5B4TA 2YS7A 3THYB 2WXRA 3KZOA 3LZCA 4MPDA 4URFA 1W34A 1E8ZA 2HQRA 3U4GA 3UV6A 1KSHA 1HLGA 1W88A 4I1IA 3FCUB 1FS4A 3BE5A 3GWZA 4GVXA 3SZ3A 1U8UA 5KQSA 1VIAA 2OOSA 1P2DA 2I2AA 3ICEA 2ONKA 4PZZA 4Z9FA 4DW8A 1A8QA 4KITB 4I7EA 3EIWA 4CF7A 4Q4CA 1GZ4A 2GRQB 2AZTA 3DSRA 1T4GA 3TZKA 4ZCIA 2YY7A 2FFHA 3H87A 2Y9PB 5AJWA 1CJUC 4WY2A 4WDQA 3U0BA 2DETA 3HVKA 4GMDA 2VHEA 4NECA 3GLHE 2OBBA 2HMVA 3VR5H 2XB2A 2WI8A 2VOEA 3QEMA 2XVMA 1ZH0A 4L57A 4ZQEA 3PK0A 3AFMA 1LK0A 4U1RA 3DOOA 1LLDA 1KAOA 3G5AA 4B40A 4DJDC 1GUDA 4F8JA 4RQUA 5JNLA 5AI8A 1OT8A 1E92A 1BKDR 1CZNA 1GWNA 3G0CA 3H8WA 1K9VF 3SE0A 3A4MA 4C6RA 3AU4A 1D2GA 3JYHA 4ITRC 4WZ6A 3FRIA 2CMKA 2DKOA 4UM7A 2YXEA 4YDEA 3EMDA 5DULA 5THXA 3N0TA 3M8KA 4PIMA 4QTTB 3R5XA 1Z5ZA 4ZOQI 4K8RB 3B1VA 2ON6A 3KAQA 4UTOA 1K68A 3N8HA 5D3MB 2OV1A 5DK6A 5MDHA 4YQZA 4IOKA 2QL9A 4G26A 3BOSA 4D44A 4L22A 1IK6A 1E0DA 1KETA 2OXEA 3N2YA 3O3OB 2BF7A 1VXOA 2GB4A 3B78A 4FFWA 2V5UA 3GUCA 3LJ3A 2PJZA 4IGKA 1L7AA 2A94A 3VYUB 1IN1A 4D3YA 4LNUA 5A4FS 3B6MA 4NCXA 4FWBA 3VM6A 1N9ZA 3DZBA 3ZBPA 4PQGA 3L17A 3H8JA 2F7SA 1X1RA 4ABYA 3FM9A 3PPYA 2LNIA 3FUDA 2WTNA 3PHGA 4XB1A 3G1TA 5G0WA 2BGRA 3LYLA 1COWA 2QX9A 3MELA 4LHXA 4ZDIA 3WFIA 4EPWA 5JS8A 4ZHSA 4YPVA 2ZK7A 1AUQA 3VZSA 1NMYA 5B3JA 1XYYA 4HX9A 1JAIA 1SPXA 4PW0A 2FW6A 3AG2E 3BD7A 3RLFA 3MWJA 5A4AA 2FDCA 3OM8A 4EMUA 3AKZA 3AVYA 4UE3S 1HZ4A 3VLDA 4Q4HB 1EPUA 5ARFA 1ND6A 2Z56A 1B1CA 1E66A 3HABA 1I7DA 3OPYA 2FMTA 3U44B 4Q1FA 2I7CA 2HM8A 1OC4A 3Q2OA 3CUUA 3IP8A 3KV1A 4L7QA 3RC8A 1PJBA 4EUHA 1YS9A 2Z08A 3JZIA 3TUIC 1JYFA 2ZITA 5K3BA 2XD9A 3HEBA 4RA9B 3HG0D 4YXWA 1V96A 3LLUA 2PCJA 4Q69A 4GI5A 3NM6B 1VLZA 3C1TA 4EWLA 2ZYVX 4ZO7A 3HV2A 2IZ7A 4IQFA 4CMBA 2ZB2A 2MJLA 1I4EB 2GTPA 2BFEB 1YA6A 4TQGA 1U81A 3HDYA 5AI5A 3AM1A 1PD1A 2XE7A 1WS6A 4BB0A 5FQ4A 5IYZB 3APDA 1H22A 3PZDA 1E9DA 1KH2A 1SULA 3A31A 4OHOA 5FQ8A 3VUFA 1N4SA 1QHXA 1KO4A 3FHLA 4J0IA 4EIWA 4IWNA 4ARVA 4JGIA 4LI0A 5D86A 1FS5A 1SUBA 3SE7A 4RWEA 2C3YA 3FSGA 1Q0RA 1NP3A 2PZMA 5JAHA 5AOBA 2ZE5A 1ZK0A 3UWSA 4LV6A 1OCOE 2FMFA 4F9FA 4CM4A 5ALQA 4IZOA 1DX6A 1U8ZA 3QOUA 1YJBA 2W22A 2HXYA 5CD9A 1UOHA 1V1MA 2CXXA 5IDXA 1AKRA 4Q12A 1OYWA 4PHFA 3ETCA 4EGQA 1C7JA 4TMWA 3SYLA 2JCBA 3FGZA 3GLUA 2NIPA 1KEEB 1N9GB 1JG4A 3ZQUA 2ZUBA 4U2CA 1HEIA 5LQDA 2KB0A 2PA3A 3K9NA 4AY3A 1M1YE 5LLTA 3NCHA 2G0NA 2HJVA 3LCAA 4C0SA 4EKIA 2FSVC 1Z4JA 5HIAA 3K35A 2F3UA 2E87A 3MIIA 1Q57A 2I4OA 3IPXA 2HWXA 4JUBA 1IULA 3ZWQA 4B45A 4JKYA 4EUFA 3UBTA 5EGSA 1JFLA 1YDEA 2Z04A 1DLJA 1VIMA 3TZEA 4CKYA 4LYGA 1K7FB 4I43A 2GCGA 2IGTA 3CLSD 4IXNA 1O95C 4LECA 4NZOA 4W1SA 2O2XA 1QG2A 4NHOA 4UUMA 4Y9SA 2ZM5A 2JG3A 4HDRB 4G0UA 1F4PA 1L6RA 3TXXA 3IIEA 4RVNA 5EC8A 2M1XA 3MT8A 4CDNA 1MBZA 2BBOA 3IXQA 1RAIA 3JARB 1W5SA 1Z15A 4ARZB 3TNYA 1JIXA 4JCOA 2Q07A 5DASA 1Z8HA 1WB4A 1N32B 1ZONA 4UM9B 4LVUA 2O8CA 4E3ZA 1TJ3A 4KTVE 4ZIRB 1ZIDA 3NBXX 4PGGA 3ZPXA 1I2ZA 3FHJA 2VTBB 3WHLA 1B7GO 5AO9A 4D6YA 1PWXA 4GZDA 4KVFA 1A5TA 2Q50A 3JRNA 2XXAB 4W9MC 3THXA 3E1SA 3PHIA 4N49A 4ZP1A 4ND4A 2OPHA 1F20A 3DFUA 4E5UA 1OFHA 2G4VA 2QXUA 3N0VA 4ZVUA 3DEOA 4XCXA 1EX6A 3ZDFA 5LMUB 2EWMA 3D3KA 4FHCA 4IRXA 2PUGA 1R18A 1IL0A 1XNFA 1JQJC 1ZINA 2IYYA 4Y8VA 3NVDA 2CCJA 2H52A 2ZPTX 5FQOA 5FTNA 3WY9A 1FTYA 1I6MA 1O9BA 3FYSA 3OE7A 5F7ZA 1VCIA 1XG5A 2H00A 1KMCA 4B3DA 2BP7B 4EG3A 2OCGA 1N6RA 1N0VC 4JI4B 1GTVA 1KP3A 5D6NA 3HXCA 1U94A 3R5JA 3ZWWA 4B3XA 5EFZA 5FOXA 3W9YA 1VBNA 4QG3A 4B43A 4ALMA 3DPIA 1Z0UA 1KYQA 3LCJA 3OIYA 2ZVQX 1TF5A 3H5NA 1S2IA 5JAMA 2VGEA 3Q6NA 4ZJYA 1J8QA 1ZIYA 2A14A 3A70A 3PLNA 2W2PA 2J49A 2NVUB 1EFCA 2A5GA 2CB0A 5JHBA 2QX6A 3C6MA 3NT4A 2YIDA 3URMA 2HA7A 3NGMA 3QPUA 4OHVA 4MV6A 2APJA 3KJEA 5FUWA 3ZNPA 1K88A 3ST7A 3AS4A 1JRLA 1VDZA 4PSDA 2WTEA 1JR4A 1OLXB 2ONDA 3GLGE 1PAUA 3DMNA 4LHWA 3KELA 2IH2A 3M6MD 1XRPA 4ANXA 1JA1A 2FW0A 5F2EA 2HU7A 2HYIC 5COQA 2P6UA 2Q62A 1RC1A 2V58A 3JD1A 3MC1A 4WLOA 3LY9A 3T94A 2RGUA 1FDOA 1Z8FA 1SUIA 3VZBA 4S1WA 4B75A 1Y5IA 2H1HA 3ZY4A 4RTQA 5I7UA 4JFRA 2VHTA 4YMVA 3D8RA 1HEYA 2EJUA 5JXHA 4REMA 3I39X 1KH3A 1T91A 5DF1A 2IQ5A 1HLFA 3RD5A 1LGYA 3S70A 1VCOA 2I6HA 4U02A 4UEOA 4A6XA 4FYYA 1GQRA 1UMBB 1JJFA 2W2MA 5EKTA 2JAXA 3JQGB 4YHBA 5ALUA 5A0TA 3QJYA 5T8KC 5GIOE 1HMPA 3MEKA 3IGFA 5CFRA 2HHHB 5FZSA 1D4FA 3L1UA 3EJNA 1MDFA 4U6NA 3SFZA 1UJCA 1GLGA 3KAPA 1MZPA 3IBYA 3NYRA 1V41E 2CL5A 2PFSA 4B35A 5BV2P 4X1OA 5REQA 4IRMA 1VHWA 3NVAA 5LXTB 1URPA 5A6SB 4RUKA 1TDJA 3IAAA 2XVYA 1L5KA 4KFSA 5DRYA 3ZE0B 3LOQA 2AIRA 2PX2A 4OSOA 5M04A 3BT7A 3BL6A 3FB1A 2YZ7A 2WV9A 3NEYA 3NGXA 5M3BA 3I2FA 3QFTA 4JLSA 3TWVA 1RW2A 4FFPA 2EZUA 2HBQA 4OLFA 1LD3A 4Z9YA 1TQ2A 1QCYA 5FEMA 2HHLA 3OT4A 4PRYA 4IGIA 3TWWA 3UQZA 3BA1A 3D9MA 5JH7A 3V1YA 4TMKA 1MZVA 2NU9A 1FFDA 1EX7A 3PD0A 4G36A 1XNJA 3IEMA 1RJ9A 5H82A 2YVAA 1ZBQA 3CKCA 3UTMA 3QNKA 5B1BE 2V6JA 2Y68A 3JY6A 2W42A 3LZDA 2Y71A 2PZIA 2AJ8A 2DYKA 4N6NA 1VJTA 3UG7A 4BQNA 4BWYA 1KVTA 2HD4A 3INTA 4EJFA 2XENA 3WB9A 4F84A 2YR0A 3KXDA 1XNQB 5JD4A 1IJFA 3JASA 4ZK2A 2VH1A 1FXUA 1FU4A 3ZXUB 5FOUA 3TH5A 3DHVA 1NFRA 1UWVA 1UPUA 3OQPA 3GDWA 1G4AE 1MB3A 3H2ZA 4NBRA 1GR1A 1ZDMA 3HXKA 4ZEOA 4D9JA 4LJYA 5ALHA 2VL7A 1P1IA 4LQLA 5IAAA 1X1EA 3WWCA 2O3QA 4OXQA 5TLSA 1OUMA 1E2UA 1WPXA 4RTSA 1J0BA 4Q1DA 3V6LA 4N3CA 4YCSA 1OYVA 2CBXA 3RNLA 4HI9A 5K0GA 1ZU4A 2Q9AA 1JJBA 2ZUUA 1B1AA 3EPPA 3MQ4A 3O73A 4I3HA 4L5AA 4OG2A 3RS4A 4FT2A 3B95A 3CW9A 4BTBA 3L92A 4CLRA 1WDMA 1EXMA 2JPDA 2QC9A 1OPXA 2JHGA 2MINA 3OOHA 4DHEA 2K2QB 2DIWA 4DYHA 1EEXB 4I19A 1ZZEA 5BN5A 1DADA 3ESYA 2LKDA 4RSRA 1E1RA 4N48A 5DVZA 4Y2PA 4CE6A 2WUVA 3VTXA 1WZUA 5J47A 2ZGGA 4INOA 4EUEA 1TZ2A 2OVBA 2G07A 5EXEA 2R4QA 1IAQA 1J24A 4Y2QA 1AHPA 1QR6A 4BKPA 4CKCA 1PWHA 3BWVA 3GB9A 3IHWA 5FBKA 4G0MA 1JIIA 1CHNA 2HQSA 4FLBA 3GW4A 4OOEA 3C4JA 1P1RA 2I2DA 3EHQA 1HT1E 3CE9A 1Q77A 1G7TA 4MWBA 5CMWA 1ABEA 1JU9A 4HFMA 4P08A 4U07A 5FHRA 3AP3A 1QIJA 5HF8A 1X14A 4BNNA 4KRXA 4DDKA 1WNFA 3GLGB 1MQ8B 2PZLA 4BO7A 3H9GA 4ZMRA 2NUBA 1M1UA 4GKJB 1NYTA 4DA9A 5EWJB 4YO8A 2FW9A 3T4XA 5AVTA 3OU2A 3OQIB 3TB4A 4AG3A 2BGUA 3TCXB 2QMQA 3VU0A 4W1PA 1WCYA 2C84A 3SF4A 4NX2A 5CDFA 1G4HA 1KMQA 3E9NA 3JQQA 3O7WA 3VNBA 1ZD8A 3AR6A 3D1VA 3SZLA 5K6TA 1HZZA 3BMNB 4C07A 4YT4A 1KFKB 2VCEA 2W6MA 1H9BA 1XA4A 2FPGA 1MNQA 4J1TA 4PBTA 4UOEA 3BYZA 4AZ3B 4U9HS 4HNUA 2INGX 3B7TA 3FZYA 3OF3A 5BMOA 2IDJA 3FDFA 4O5AA 4H3VA 3HXFA 1BH2A 3LWDA 2NUAB 5HQ3A 2WAXA 1V47A 3CB2A 2PX3A 2Q5QA 3KD3A 3TIVA 3KU1A 3SVTA 4IRUA 2BTEA 4NBLA 1P1KA 1THGA 3GRUA 2IXAA 1I9CA 5F3WB 2WMOA 1HE2A 1LH0A 2R7LA 1Y33E 4O2AA 3ENWA 3LOPA 1NZFA 2C2OA 3L1IA 3MMSA 1Y6IA 2AVNA 3B52X 4KQWA 4UWHA 4F04A 2FY8A 5COBA 5LR6A 1BCSA 1XPRA 1KZPA 1XEWY 2F37A 3OZXA 5ELXA 1A4RA 1HA3A 1T1EA 1K5DA 2RI6A 3EXHB 4KFRA 5DYTA 3CKLA 3K32A 1C1XB 4ODIA 1V8ZA 2ZSAA 2XZTA 3ZJ4A 1U0FA 2QTVA 1HPLA 2JFUA 2ZIWB 2A0WA 2WSLA 3O4GA 3DEJA 3GFBA 3KAJA 2NO9A 2ZWMA 3J80A 3VR2D 3HN2A 1OI7A 3F8WA 1YR9A 2D1TA 2P1ZA 2M6SA 3EF1A 3Q0EA 4GH5A 5ARDA 3L9XA 2GD6A 1GN9A 1I3OA 1SVKA 5EVCA 1K7YA 3RGWS 1JDVA 4DCOA 5INTA 1KDYA 4ACAA 1HNXB 3R9MA 2Y67A 4CLRB 3IALA 4JJ7A 4LE1A 3RKSA 2PWPA 4YLGA 3CLTD 4BEWA 5IX8A 1QP7A 1YAHA 3L6DA 5PNTA 3QLEA 4KR2A 2OORA 2VBFA 1ZJZA 5B55A 4XYLA 1YCDA 1I13A 2VIIA 3W8NA 5D7NA 4D2IA 3ZU2A 3NH9A 1E2EA 1SHZA 2QMEA 4KQCA 1L2TA 3W4KA 2ZYHA 3BQNB 4ZHQF 3K70C 1WTCA 1EK6A 1JIQA 4OQXA 2LKCA 3S28A 2B7CA 3QXHA 5KYKA 3HL0A 4M1OA 5K3OA 1XMXA 1KY3A 3SJZA 4D99A 2RE8A 2I6QA 1VKRA 2WB4A 4NCHA 4HY3A 4C0EA 1Z5VA 3QTBA 3SX0A 5AW3A 2DF8A 4MKHA 4PLZA 2O54A 1P1BA 4WW0A 4KYIB 1XCPA 4UEJA 3B38A 1JFFA 4AZ0B 4PXAA 4MB6A 3FR7A 4JJZA 2AF4C 3QEBZ 1DARA 1IQRA 3PDUA 5JZOA 4A8TA 2XUJA 2QL5A 3I0ZA 2YVUA 3IURA 3OFSA 4KFCA 2LXNA 3FYDA 1NIJA 2HA5A 3BSWA 3L6CA 1MEEA 2V0NA 3I2HA 3UY4A 4PSUA 1Q2ZA 2EHDA 3FYUB 4RHYA 1Q7BA 2GBLA 1K66A 3LA8A 4RY2A 5BYJA 3FHEA 5CECB 2CLLB 2O0KA 3OZUA 4HPJB 2Z0MA 3GW8A 2P75A 1D9ZA 3OTGA 3PQ4A 4Q1CA 3L8YA 4OQDA 3PS9A 5AKLA 3Q1LA 5FBLB 2PUCA 3C1OA 5JD3A 2REQA 1T26A 5TJ9A 4JXZA 4OQNA 4G9GA 4PC6A 4FYWA 2W8BA 5ED4A 4GM0A 1QF9A 4J0HA 4DY4A 4D0GA 3R7WB 2GJ8A 2AXEA 1RWWA 3HJAA 4FLEA 4GI7A 3WGYA 3WBJA 3N8IA 4K6FA 4PZEA 3X1ZA 1RKQA 3KUUA 3IBSA 2PUAA 3PUHA 2VPYA 1Z6XA 1ESNA 1R5JA 3MRTA 2FRVA 3P96A 3TEJA 3UA4A 3WV4A 3SZRA 1BE1A 5CNIA 4DV6B 3A4LA 2VRCD 1BZYA 1CS0B 4L78A 2V7XA 4WK4B 4F4IA 4BNJA 2B30A 1T2FA 2AMFA 3OJ0A 1D8EA 3X2QE 2X8JA 3D3WB 3RTEA 3PL5A 2X2PA 2BLNA 1JZTA 4O4LB 4QQ8A 1E69A 2QE6A 3MWFA 3WLIA 4D41A 4PQEA 4DR6B 2FA9A 3CMCO 3ULQA 2WINI 3KUKA 4YCMA 2OMEA 1E4EA 4RPHA 5H9WA 1F7VA 1SUDA 3WOHA 3AERB 1IAVA 4JSRA 1X1QA 2J4CA 5EOVA 3RUAA 3JYQA 4RVSA 1KZHA 2J33A 4NFYA 1KVQA 1A9PA 2O2DA 4WXEA 5AKHA 5F2OA 1TM5E 2BRUA 1ZSNA 3G49A 2Q4OA 1MMFB 2WUEA 5BXQC 1I3LA 3KUXA 4OU4A 3KWJA 4HNAD 4X97A 4YAWA 4GL2A 2FGJA 2G25A 3PUZA 3WL4A 2JFYA 3UM3A 5A7FA 1DNPA 3QNUA 5I45A 2I55A 1XZPA 2XDAA 3P52A 3FNFA 2VF2A 3SPXA 2VHUA 1F6WA 4MRMA 5FTWA 3RRYA 1B6TA 4P3OA 2VYNA 5TR9A 1VPLA 3LCVB 4I9NA 5CDTA 2KI5A 4B82A 1RRMA 1G3QA 3O8QB 4U39A 5KKCA 3TLKA 1EINA 3RADC 3ZKJA 2H51A 3C6QA 1AKVA 3DDHA 2Q6IA 4A2QA 3C3BA 5CVCA 3WWDA 4EUNA 1KDTA 2VDOB 3J5PA 3H5IA 4ZVKA 2GRPB 4RPGA 4AXXA 2PBFA 4RPIA 4AD8A 5LOZA 2A84A 4UVEA 3K6KA 1W5TA 4FOPA 2C2WA 1NBOA 2X5NA 2HUPA 3HP1A 3VR4H 1VL8A 1NRXA 3SEAA 5LYJB 3ADBA 4LN1A 1ZJ6A 4MBGA 4RXTA 4MV7A 1NG1A 4QUAA 1NY6A 2IV3A 5AM1A 3KOMA 1VG9B 5EJ7A 3ZGQA 4G0NA 4ZT6A 4FKZA 1PT9A 3GL9A 5A05A 1AO3A 4TYMA 3L07A 1NULA 3PYXA 3OTHA 2BJWA 5BVGA 4JYPA 2OV8A 3U31A 4KGDA 3E3OA 2NV2B 2BP7A 4PG6A 4IVRA 1PVVA 3ASNE 4DLSA 4A8JA 1OXMA 1D7OA 2JJMA 3SYTA 2V8BA 4H4DA 3BWEA 4P86A 5AI6A 1A82A 4EHDA 4Z2AA 2ZIAA 2WD9A 1TYDE 4DIMA 4ZQHA 1TC1A 3B9RA 1MR3F 1OLSB 2ZI4A 1PIWA 1XTSA 4NZMA 4P3KA 4QHTA 4ZVSA 4YRJA 5A2GA 4GPIB 5I7FA 2C54A 1X81A 2CE2X 4O02B 1FZTA 3FWNA 4LC9A 3P0RA 4FMCB 3TQOA 4ALJA 3HXLA 2ZXEA 2A92A 3FHOA 3UOGA 2CEKA 4JKIA 3ZIDA 4DRZA 5DLDA 2P3LA 5LP0A 3KO8A 3CONA 4UE6A 3RSOA 4EHKA 4OGKA 3UT0A 3DZHA 4JBXA 3HVUA 1VE9A 1OYYA 2VZ9A 4LA4A 4CMAA 4RJJA 4D4IA 4PG8A 1JEEA 4PNEA 1YWGO 2BH9A 3DCJA 2GT1A 3ROMA 1DXQA 1KJQA 4YJKA 1VCHA 2HHCA 2GBFA 3D64A 1DXHA 1JNXX 2JEKA 1MJ5A 1DQPA 1VYTA 3AUKA 4N39A 4II7A 3AS5A 3W1VA 4C5BA 4DQXA 2RGBA 4CNBA 2XA9A 2PUDA 1INLA 1E9FA 5KYUA 4TOIA 2B2NA 3HNRA 2C1XA 2V7EA 1F2TA 4KN8A 5HEKA 3RK1A 1LLCA 1KRXA 2Q2VA 3I9V6 5AUQA 2BMAA 3UMRA 3I62A 1MOZA 3V79K 3BXFA 3EFHA 2QTRA 2PVPA 3MTQA 2X0IA 1CUSA 1FDWA 2X0KA 2YWBA 4CFYA 1NKSA 5C51B 4XGNA 2LAIA 1LD8A 1USVA 1YR1A 3MWLA 3OQOA 3NZSA 4BPBA 1VFNA 1R5BA 2CL7X 2MMGA 3GR6A 4O4IA 5DX8A 3OVMA 5FWDA 4OHMA 2D6FA 3GF4A 4RX1A 2KZTA 3KV3O 3JVDA 4JVMA 2BFEA 2GCPA 4B3RB 3M49A 1NVEA 2CNNA 4HJRA 1Y9DA 4QDJA 1I14A 2MSKA 4ZPXA 4ZT3A 2H1SA 1ZICA 3H7IA 3SC3A 4QHYA 1FF9A 2P5UA 3SY2A 5A7HA 5LYJF 4CXMA 2FR8A 2W6OA 1FMFA 4I9GA 1TF2A 3BIJA 3KR2A 3UKDA 1Z9BA 4OM8A 4JEUA 4UQLA 1DX9A 5KNBH 1RKBA 2N47A 2HRBA 2VRWA 3AHIA 4NY1A 1W1UA 3DAGA 3WLTA 4YR7A 1OFUA 1D6JA 3GLVA 4B3JA 2KE5A 2X8JB 1N4DA 1FA9A 3FD8A 3L79A 2O8DA 1XHLA 3R7QA 1P44A 2R8OA 3BTOA 3GUZA 5FUVA 3EG9B 3TRJA 2HDHA 3Q12A 5T3UA 1J20A 4KBFA 2VEOA 3P9RA 3QTLA 1DBWA 5TS2A 1ORWA 3HO6A 1IXVA 3BMXA 3WADA 2GVNA 5EJFA 3SHWA 4G4SO 3ELWA 2VF7A 4J94A 4W9NA 2HIAA 1U7HA 3R7WA 2JLUA 2QORA 4RZ2A 2AW3A 3F5FA 4JXJA 1N6HA 2Y9MB 3CYFA 2A1TS 1YONA 4Q7LA 2R59A 4G97A 3QA9A 4WUYA 2FU5C 1OJ7A 4RS4A 3OQNA 5AVSA 4TXRA 4IR7A 1CETA 3IXEA 2IIPA 4WEOA 1SNYA 1Q95A 3ONKA 4AYXA 3PIDA 1YGPA 3CX6A 2ADMA 3IVXA 3N0WA 5A5FA 5BSHA 5CVTA 3MGGA 3AEYA 4ENSA 2G1JA 3EF3A 5IHPA 3GH3A 2VXBA 2XLBA 5J2TF 3UAWA 4G9BA 3W6ZA 4F4FA 2QX4A 5AP9A 3GX1A 3KVVA 4P29A 4MVCA 5EIOA 2HSJA 3BXXA 3OCUA 4R9NA 4G25A 5HRCA 4UWKA 1VXRA 1MGOA 2XCQA 3L0IB 3CVNA 1GSOA 2F00A 2FCRA 3OJLA 2GO1A 2PM8A 4G86A 5CCDA 5J4LA 5I7EA 1Z2PX 1T5HX 4C0JA 1KSFX 2ZJ6A 4JBYA 1GVHA 4B8WA 2BPOA 4UWGA 1ZBPA 4E51A 5FWXB 4ZAFA 2QV0A 2XNHA 2WD7B 3DB1A 1GPYA 2DC1A 5LCWJ 4JVSB 4U9IS 3VX3A 1HDCA 4XWAA 4DQLA 5CGZA 4YAGA 5IMSA 1JQKA 3HXBA 3AY7A 1OXBB 4N3BA 2OQIA 3NTXA 3QI2A 3BHMA 5ENDA 1VGRA 1Z6YA 2QN7A 1QK3A 4ZU6X 5DNUA 4ND2A 3GP3A 3OZTA 5JVDB 2H2AA 5GONA 2ZZMA 1BDHA 3MV3B 1Z2DA 1NN3A 1Z6GA 4M7CA 2ZP1A 3NHZA 3PGKA 4Y6QA 1MC4A 2VDWB 5F1PA 1X3SA 2QY9A 4P58A 3WLFA 3FGNA 2X6FA 2PE5A 5EEGA 1H1TA 1EDOA 3MRXA 2I7XA 1RI3A 2XXBA 4JP5A 3KD2A 4MYDA 2YMMA 5T3YA 2X4DA 1SRQA 5KSWB 2C2HA 4ZV4A 3OBIA 4FHEA 4I9HA 4ISCA 4V24A 1W48A 1YK0A 2DH5A 2X42A 5CDUA 2DUNA 3D6UA 2IS6A 1AKMA 4LRTB 1M76A 3K0HA 4OHKA 4ML3A 2PSFA 2VAMA 3F7OA 3SQDA 3JYPA 3E37A 1OI4A 3B1YA 2HFJA 4RAOA 1I0ZA 3ZHXA 3WRWA 5BUSA 1Z36A 1Z3IX 1E99A 4FGJA 1NWHA 4U3JA 3QU2A 2OCXA 3COYA 4J4HA 4C0LA 4CG3A 5KTTA 2VK2A 5A3QA 1RFLA 1YZQA 4WVLA 5IAGA 4AS3A 2C9YA 5ILOA 4JQYA 4RVFA 3U40A 4EJ6A 4N4AA 3CCFA 1MLDA 7ABPA 5IT9A 4D97A 2R5SA 2B0OE 1HUQA 2Y1FA 4QQKA 5BSRA 1XMVA 4M37A 2DWUA 3E4DA 2B98A 4OIMA 2O0JA 5FOSA 5EQFA 2GDZA 4IJWA 1JXQA 1L4BA 1VTKA 4RSHA 1RC0A 5C7LO 1SG0A 5D87A 3ER9A 5KYYB 2GM5A 1CS4C 1L5YA 4MCJA 3OPMA 2ZPAA 2PXAA 2QPAA 4UTXA 3MMPA 2LR0A 4EB6A 3N28A 5GIPE 4CT0A 1G291 3NRCA 4F85A 4XA8A 2QFCA 1R5OA 3JALA 3UKJA 3ZNNA 2IH5A 1SA0A 2F8YA 1N25A 4GPKA 4Q1VA 3T5BA 4D6PA 1XXHE 1O8BA 2R8BA 1KZ9A 3TI7A 1LJ8A 1CUIA 1GFZA 1YH3A 5ALJA 1H8EA 2OZVA 3QPBA 2RAVA 1NF9A 1XTKA 3IVGA 1JLKA 4AYTA 4BO1A 3L8DA 2Z2KA 1JAYA 3E4BA 5LP6C 4DANA 2J0UA 3IUJA 1YZVA 4GG1A 2KBEA 1YR2A 3AETA 3DHWC 1R0XA 2H1LA 3IQEA 2XMPA 5IJXA 4PZ0A 3SQLA 3SD5A 2I87A 5B4UA 4E5SA 3TNLA 3OOJA 2HAEA 3B89A 1DC3A 4J03A 4CUJA 1DMRA 4AT1A 2Z1DA 3DVSX 3CJRA 1NT4A 3UK1A 3Q8KA 2H4FA 4ZWNA 4YQYA 2X6IA 3QK7A 5SY6A 1E9AA 3COPA 4A1SA 1TO2E 4BIMA 4PZAA 5IASA 5C1IA 3RVNA 3BJZA 1ELKA 3QG1A 4XI0A 4G0XA 4DJAA 2B8NA 3TDKA 1JDPA 2C4VA 1NOKA 5U4XA 2D5LA 3K1JA 2X5OA 1K5HA 1PTJC 4S04A 1OWLA 5BXOA 2O5CA 2GEFA 1IOLA 2YWXA 4Y7CA 3EOZA 1VKOA 2LD4A 3OE1A 4ZO4A 4L7TA 1A5AB 1QPZA 4RESA 3C8UA 5LMCA 2WD8A 3TLYA 4ALLA 4OLAA 4A0FA 5K0BA 1BDJA 1IUOA 1E79D 4JJKA 4KVOA 3VX4A 1ZW1A 3TL3A 1CDEA 5EUBA 4WBNB 3TRHA 4PTZA 2IOLA 2QVCA 3HN6A 1SN7A 5AJUA 3WGLA 1JPUA 1BYIA 4B71A 3OQIA 3UMSA 1UF9A 3H9EO 4IS2A 2ZZKA 5F77A 4ZYXA 1O54A 5H1YA 3ISTA 1NBAA 1C7RA 5EJMA 4GZCA 1FNSA 5DGXA 3D02A 1K1BA 3OFKA 4CI9A 2H6HA 2H4HA 3PJEA 4G4GA 1NN0A 4TS1A 3RRBA 4MB0A 1ZOPA 2PN1A 3WP0A 1TK2A 1LTXA 5ENTD 2AXVA 4INAA 4TN1A 2H1OA 3PE4A 1JB9A 3DSVA 1PBTA 4NV0A 3R7FA 2UUAB 4P8RA 4WINA 4M9ZA 4G1UC 4L28A 4Q37A 4GIBA 1Y1PA 3H2KA 3LPMA 4K9PA 1AXEA 1Q5PA 3EUVA 2Q3JA 1ISGA 1J5PA 2HADA 1V35A 3F8SA 4TM8A 3WLEA 1M0EA 4XEIG 5KJNA 2NXJA 3CURA 4QJBA 4DXAA 4AW9A 5K0JA 1YDMA 1JLRA 4WE3A 5CB0A 1Q7EA 4DMFA 2PGNA 3BBLA 4JLPA 4GGOA 3U19A 1KYZA 2AQHA 3WKBA 3ZOZA 5IVIA 4N5HX 1V26A 1YL6A 3NAWA 1SCQA 2PLWA 3QEJA 1I51A 3UEOA 5IJAA 5C8VA 1BYUA 2FWMX 3G5MA 3SM3A 4S05A 2RG1A 3AHFA 3EA5A 4OHWA 1QIFA 1SVNA 2HJWA 4FHGA 1N5JA 4Y1FA 4XCQA 2JLBA 4DRXA 5JV5A 1GKLA 3TE7A 4I8DA 1EWQA 1FP2A 1WVGA 4YACA 3NVKI 4WX2B 4TKVA 4NICA 3RVDA 4IZ6A 1C8LA 1ZISA 3OZAA 4JUDX 5TMEA 4OFWA 1Z39A 1N9GA 1W85A 2HK8A 3HCEA 4EF4A 7MDHA 4MGYR 1A71A 2JFQA 1KEEA 4JNKA 2IEJA 4QBTA 2FQ1A 3A7DA 4TRNA 4GMLA 4F91B 2R62A 3N53A 3OUTA 4JASB 2RHRA 3MKQB 1MORA 3S2YA 4EG7A 4M22A 1TN8A 1YS7A 3C7TA 2GR9A 4ANUA 3QVUA 5FPYA 1T1SA 5FQ6A 2V7GA 4PX2A 5JS7A 2HMYB 3ZZNA 3SXJA 5A9TA 3W34A 3DD1A 5JXIA 1UODA 2D7DA 5ENSD 2H11A 3GJZA 1CRPA 1RQRA 4PYRA 1H94A 2C5AA 1F8FA 1WMBA 4GQBA 5HPYB 5KJFA 1BJKA 1WF6A 1T3HA 3P2YA 1S3IA 4YXWD 3R9AB 4CLOA 3P19A 3N9IA 3U6BA 1HLDA 2W98A 4BNFA 4ZHQB 3L7AA 1T9KA 3A1VA 1WUYA 3LZ6A 3NBFA 2R5NA 4REQB 4LERA 3SJ7A 1DB3A 3D4PA 3QUCA 3W4JA 2A88A 4HPWA 5JY6A 1Z8DA 2CDCA 4OYSA 2EBFX 2XMBA 3QXCA 5K7SA 4BFSA 5IXSA 5JI2E 2VDNB 3TKLA 2C7OA 5C37A 5JJTA 1M34A 3OESA 4J0UA 4JL5A 3PT5A 2I4IA 4KYOB 2XUQA 3FHCB 5BQXA 4NOLA 1E2KA 1CFJA 3ECCA 3F3SA 5DZSA 2J9FA 4MQFB 1XRLA 1XTZA 2Z3WA 4HYTA 1UMCA 2AOTA 2QMZA 3RYFB 3H1PA 1N2HA 4BKUA 2BEWB 5IVHA 3G2MA 3UW3A 4ZAVA 5FA6A 5H7XA 3HRKA 3E5RA 1Z75A 3T7EA 2ILVA 2L42A 1U0RA 1SCUA 1LFDB 1U98A 2CD9A 4GFDA 4HKTA 4PLFA 4HN2A 4G65A 4IH4A 1JH9A 1Q20A 2AOWA 4JYBA 4MQLA 3E0QA 3PXUA 1POWA 4DX6D 2A5JA 3X44A 4BPRA 5IK2D 3L7KA 3NHUA 5CXSA 2ZYSA 3FCSB 3MGKA 2RHHA 1T5LA 4MVJD 4CTKA 2XE8A 3CH6A 1H2XA 4X8OA 1SUCA 4ANWA 1DKRA 4DIEA 3W1EA 1V5IA 4RMGA 1Z7BA 4OMDA 1G3IA 1AV7A 1R0LA 3B85A 3AJ8A 2J3HA 5J2TB 2J3JA 2BKAA 3HO8A 5TQJA 1UM9B 1G66A 5LPNA 1IBKB 1XTIA 2ABWA 1KJYA 1FVXA 1WQ1R 2NSHA 2R3SA 4P98A 5FADA 4YC7A 3LRXA 2NYUA 3CGWA 4B2IA 1U9YA 5LUBA 5J4YA 1DQRA 3DFZA 1VKJA 1YNOA 3GAAA 4LJKA 1IBRA 1PT8A 1WD5A 3FETA 2IEIA 3IAM1 3WGKA 1Z7GA 1XL1A 3MD9A 2XIJA 3A27A 4KTTE 2EZTA 4WH0A 4XH9B 5BN4B 2PL5A 3HY4A 4KSYA 4L4ZA 2OQVA 3ZLJA 2GZMA 2QRKA 2VR1A 3HUEA 2J5QA 4GNRA 2YL2A 3GD5A 1Y4SA 1FCHA 1QK5A 2GNAA 3WDKA 5IHXA 1DCTA 4JQZA 5LZ4A 1NKVA 5CA0F 1MO2A 1VQ1A 2JLSA 4G1VA 4AMBA 2WSBA 3VDQA 1Y1SA 4XKCA 4RDXA 4G85A 3LLMA 3SFTA 2XT0A 4AM8A 2IOSA 3QVGA 4CCYB 1AKUA 3DOUA 3EBPA 1CRQA 2GRJA 2WUGA 1QBKC 4HXGA 3HWWA 4PGMA 1JALA 1F6BA 1U7TA 2YZKA 5HF5A 4ED9A 4XM2A 1F2VA 5IC5A 2WFZA 5C46F 1S7GA 5BR8B 1T8PA 2BHNA 2D2FA 2V3VA 2Z5LA 3KB2A 3CEMA 1A9ZA 2D1YA 1NZDA 1AZWA 1N92A 1T4MA 3CUKA 3HKCB 3IDOA 5HMMA 5B12A 1JAHA 5CLLA 4TV8A 5AKKA 4B94A 2BUCA 2BI4A 5DMXA 5K0LA 4OKSA 3UJ9A 3GQBB 4OYYA 4Q7MB 4KNWA 4ZTUB 4WNGA 4BFCA 1NNI1 4HNVA 1U3CA 2OILA 4HOSA 2QYOA 4I4CA 2JFWA 4BQPA 2KATA 2E85A 1D2CA 4AQYB 2FGKA 3C3MA 3JS5A 1WCIA 5BNFA 3TK1A 3WLHA 5F5XA 3FTEA 4YY3B 1MRZA 2PV7A 1KKMA 4EITA 4ATGA 1EDDA 4PYLA 2C42A 3RROA 3F47A 3VZDA 1DC8A 1P4HA 3BWCA 1ZQ9A 2GPWA 2YWHA 3O1JC 1AGNA 4WY5A 5KAPA 4EJSA 1M6VB 3KZCA 2FOLA 4J43A 4Z0NA 3ZHZA 3VPSA 3RSCA 4B81A 3WWOA 1QSGA 4KNYA 1FMJA 3LCCA 4YNDA 1Z2EA 1HNWB 4JENA 2VKTA 2FPPB 1Q19A 4PAOA 1YU6A 3KHKA 5LL6P 1RHUA 1NP6A 1LTQA 2C0CA 4JZYA 4LXYA 3WVNA 3GCGA 2A1UA 1TM2A 5EYPB 4CEJA 4LY6A 4P3NA 3K9QO 3S1LA 1VPWA 1M33A 3C14C 1IY9A 5CNKA 2OXIA 4BNLA 1FPPA 3EU9A 3LK7A 4V38A 3DTVD 2X1MA 1Z38A 3P27A 1P80A 5H0IA 3G9XA 1J8MF 1EMDA 2PQ2A 2YN4A 3CRQA 3G2SA 3QJZA 1JWAB 3QKRA 4YTEA 2EV9A 2XZTG 4UHBA 3VR1A 5DNAA 2AMYA 4TTTS 1Z5UA 3EEQA 3PRYA 2W6IA 1N5OX 2R11A 1XZIA 4CIXA 5EIFA 2E89A 1W7AA 3BRSA 4OBWA 3EZNA 2ZI6A 1R00A 3I23A 1GTRA 1WCWA 4JJ4A 3F6RA 1C1HA 1P5RA 3H3JA 3IP5A 4W5WA 2M6KA 4U7PB 3UB2A 2GCEA 4E6HA 3B3FA 3ROQA 4D3FA 1RJFA 1KEUA 3CSUA 5F2NA 3CVWA 1GA1A 1XTVA 3VO1A 3I61A 2WV7A 4EA6A 3E33A 1P7YA 2ZIVB 3ER8A 4NH4A 1K86A 1LB1B 4Y6RA 2H1CA 4DJ5X 4DKJA 2Z83A 1ISRA 3O21A 1K92A 3GEBA 1Y8RB 1Z5PA 3UH1A 5I9IA 2UZ3A 5C7IO 2ZBVA 3GT0A 5J1TB 1YCSB 2PWAA 1UT5A 2V4UA 4HRLA 3A06A 3HPQA 4ZC1A 5JSYA 2QYUA 5CA1F 3H18A 4I50A 4IJUA 4I1RA 1FE8A 1E6CA 1DPGA 8ABPA 1IDOA 3MJVA 2RJNA 1EXVA 2GNOA 5CT9A 5BV8A 1XEFA 2XBUA 4HWGA 4IIVA 4YJ3F 3FNRA 3TM5A 2CXHA 4YT2A 5CB4F 2LSVA 1RZ4A 2LO6A 3HWX1 4K8OA 3DBIA 3C3CA 5CPFA 4YDRA 3CM0A 2Q5EA 5CFQA 4J3JA 3STUA 3N59A 1PG2A 3DRAA 5HQ8A 1IEQA 1ZCAA 3F6CA 3ODGA 1FTWA 4B80A 3EMBA 5JJ5A 3ORRA 3CIFA 1OWOA 2JKYA 4CKXA 3TEMA 2Q9UA 4YCDA 4PVCA 2ZZNA 3QGMA 3QYFA 2FW7A 3B7PA 1XMJA 2RSLA 1GTSA 4R2KA 5HS6A 5JVDA 3ICPA 4B79A 2Y99A 1Q1EA 3BGDA 1H85A 4JQSA 5AK0A 2CNOA 3SXUA 3WBBA 4YRAA 3BQOA 3LJNA 1MAWA 4FDUA 1DCFA 3AUSA 3PWZA 2ZIRA 4PX3A 2WILA 3RTCA 1KQOA 1MO3A 3O8CA 1NATA 2XS1A 2XEDA 1T0JB 4NU6A 3S2SA 1IJEA 3O03A 4YV1A 2E6KA 4NTZA 1EFAA 1QX3A 2ORED 5GGXA 3EEFA 4LG1A 2A78A 4YUWA 2KC7A 1X15A 3IUEA 2ETVA 4XYGA 4B17A 2BKGA 2HT6A 2OSBA 2YIJA 2C4WA 3SAJA 1W52X 1X19A 2RGYA 5FBZA 3B36A 2N1MA 3EASA 3NLLA 4K6GA 2WJ3A 1GY8A 3PC7A 3F74A 3EVFA 2ZRNA 4YRQA 3TGWA 4CMJA 3L0BA 5LWHA 1NF2A 2FP3A 2JCVA 1UANA 4LNGA 1EX1A 5IVPA 1B6GA 4YVQC 1P5FA 1Q0HA 2ZI9A 1L7PA 2FUG1 1V7QA 3WNZA 5FTJA 1ADJA 4YV2A 4C89A 3EU5A 2E4YA 1YVDA 4MWZA 4U2FA 3AEKB 1Z35A 1TE2A 1TZCA 2HSEA 2VJQA 2KX7A 4FXOA 4YGYA 3JVUA 1N52A 4CI0B 5CG1A 3ZHTA 2OHXA 4BWRA 1I01A 4RQBA 1G21B 1GTG1 1PYDA 4DV4B 5L9AA 3NDPA 4A8JB 2AJCA 4RU1A 1CP3A 3CEJA 4Q3BA 2VHJA 2EZ9A 1W8IA 4TSKA 5ED0A 1QQAA 4N5QA 2XQGA 2NO1A 2I2OA 4LE2A 5CFNA 2AQIA 3BM5A 2CL0X 3TW0A 5HI7A 1KIMA 1U9JA 2E21A 3MVEA 2HV8A 4LF7B 3R0XA 1E6LA 2GFHA 1G4UR 2I8LA 2QYTA 3FY4A 5GGYA 3C1UA 1FXWA 5CB4B 2A0KA 4BT9A 1SAYA 1U8TA 3AF5A 1M7BA 4JP8A 3QYPA 3QEKA 4PANA 4PM4A 3CSFA 2E4ZA 2ORWA 3H1FA 2GK7A 3EYWA 4K2AA 4W99A 5AM4A 5ENVA 4RGQA 2ZS9A 4CR7A 5KDDA 1ZVMA 3Q3CA 5A3SA 1PLJA 2HHJA 1QG6A 5DH9A 1KMIY 4GPMA 4WWPA 3VLEA 2JARA 3H42B 2QTGA 3R20A 4S12A 4UVHA 5IBPA 3UBMA 4HQKA 3VAZA 4PRLA 2XT9A 3HR4A 2CCGA 3KSRA 1YOBA 2ZJ4A 1U1CA 2YV2A 5DIFA 5F9MA 3VO9A 3SFYA 3DMPA 3ZJYA 3WA7A 4PO9A 3ADPA 2G04A 5J4KA 3OQBA 2IX9A 1A97A 2AL7A 3LDUA 1RU3A 3BXEA 5J58A 3C87A 2QAIA 1ZM9A 2XJ4A 3I1YA 3CZRA 2GZ2A 2NV0A 4TZKA 2C8JA 5EKQD 2DRIA 1GXSB 3D9LA 1Z34A 1DGQA 2ZR7A 3W0LB 3WS7A 1M2HA 1SVXA 3HVHA 4IFBA 2WXJA 3R2JA 1VIDA 1BW9B 1N2CE 3DJYA 4US0R 3LYUA 4GI3A 1TVEA 9ATCA 1P4JA 1ZAYA 2GLTA 1CSEE 4E30A 3W5BA 3TZ6A 1PWEA 4E5NA 4K03A 5AR1A 1ILWA 2R7MA 2FZVA 2F8SA 3HDXA 1T0UA 3BGSA 1CC1S 4CM3A 1TM3E 3MLEA 1T5SA 2X3MA 4HLUA 1T9DA 1YZTA 4KZCA 2HUNA 5A02A 5G05C 4HDSA 3D7KA 3R23A 5HP4A 3VJKA 1IXSB 1JWGA 4CEIB 3HB0A 3VTYA 1J49A 2PRIA 3LDGA 5GONF 5L8VA 1JJ7A 4DIFA 1M10A 1ZWKA 3NEAA 1TIPA 1RI5A 1QUEA 2NZXA 4O5OA 2PMEA 3MLAA 3VPCA 1YZNA 1U0HC 2RIRA 1UWKA 4KDCA 1NXOA 3H6HA 2ANBA 2DBRA 3PNYA 2QN8A 5BVHA 5HXAA 2F4VB 1HG0A 5DI3A 1O8CA 3FYTA 4YA6A 3RK0A 5DSZA 1HDYA 4H3KB 3V7YA 2LXMA 3DOJA 3RTDA 1XVUA 3DOEA 1O9GA 2C88A 4FS8A 3ZH9B 1UBRS 1Z4KA 1Z73A 3JW8A 5LQNA 2WZDA 1RQLA 3EQ6A 4WZAB 1WXFA 3OCWA 1QIKA 2L17A 3PUWA 4IGFA 4K6HA 1ZPDA 5KQGA 3RS0A 5JISA 4IAOA 3L6UA 3FTUA 1FSZA 1PL8A 3W5AA 4NURA 2NO4A 4WL0A 4JJFA 1OZ0A 1WZEA 2B4YA 3AERA 3DKVA 1TFUA 3N70A 4JLUA 3PH0C 2PT6A 3DGFC 4LHYA 5SY4A 3ZW8A 3CN9A 4MHTA 2I7DA 4L6AA 4TWZA 4EW6A 3C39A 3WWYA 2CG2A 1PT5A 3K20A 4CN9A 4HRVA 4P82A 1SBQA 3D3WA 1O95A 3E22A 3NO4A 1CY4A 4X3CA 2WM9A 3LU1A 1KZYC 3ELDA 1F2UB 1QCCA 1ZW6A 2XUIA 2QE7A 3B8EA 3NKVA 3NALA 3U9WA 1RLOA 3Q41A 2SNIE 1UL1X 2H5LA 2JFHA 5AW5A 1NVGA 1WULS 1FX0B 1EDEA 2CYCA 2JCSA 1QM5A 1JAZA 2OO7A 4Q9JA 1NBEA 3LP6A 5KVVA 4Q39A 1DJNA 1E2JA 1R7RA 3NHKA 1BEEA 5DX1A 4C2UA 2WNIA 5CA1B 2OXFA 1YAJA 5IM4A 2CGEA 3DJFA 3HA3A 3GK3A 4J0GA 4CMCA 3URZA 5CVJA 4MXDA 2OEVA 3WRYC 2BJHA 5JR3A 1