3FY4A

(6-4) photolyase crystal structure
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
522
structure length
522
Chain Sequence
GSGSLIWFRKGLRVHDNPALEYASKGSEFMYPVFVIDPHYMESDPSAFSPGSSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQEWKVKRLCFEYDTDPYYQALDVKVKDYASSTGVEVFSPVSHTLFNPAHIIEKNGGKPPLSYQSFLKVAGEPSCAKSELVMSYSSLPPIGDIGNLGISEVPSLEELGYKDDEQADWTPFRGGESEALKRLTKSISDKAWVANFEKPKGDPSAFLKPATTVMSPYLKFGCLSSRYFYQCLQNIYKDVKKHTSPPVSLLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMVQLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQFNRIYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIVGKDYPKPMVLHDSASKECKRKMGEAYALNKKMDGKVDEENLRDLRRKLQKDEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-4 photolyase
publication title Functional motifs in the (6-4) photolyase crystal structure make a comparative framework for DNA repair photolyases and clock cryptochromes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 190
structure length 522
sequence length 522
chains with identical sequence B, C
ec nomenclature ec 4.1.99.13: (6-4)DNA photolyase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 3fy4A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3fy4A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fy4A01
1M8KA 2A84A 4P2BA 1X8XA 2A1UB 3P0HA 3OP1A 3HZRA 4ZT7A 1F4LA 4NZPA 4H3SA 4MVYA 2VTBB 3ND7A 4KPUA 2J09A 5EKDA 5HUHA 3G6KA 1VLHA 3Q12A 1KH3A 3COYA 3AL0C 1TYBE 3TZLA 4YBRA 1J1ZA 3KT6A 2E89A 2BYTA 2QUHA 3N2YA 2D13A 3HFJA 1ZH0A 3FHJA 3H97A 3GUZA 2QTNA 2WB2A 1O96B 2J4DA 2EJCA 4ZCQA 3IVCA 5K0TA 1V47A 1B6TA 3L93A 1EUQA 4I6GA 3C8ZA 2C5SA 1N2JA 1PFYA 3RHSA 3SYTA 2YXNA 2GOYA 1N2EA 1NZJA 1P7PA 3CVUA 3PXUA 4E1AA 1Q11A 4UZEA 1D2RA 3LE8A 1WOYA 3D6UA 3ND6A 3COZA 1R6UA 1WY5A 2H2AA 3H9CA 5H16A 1A8HA 1NUQA 3K9WA 1NUSA 3KT8A 4MW7A 2QTRA 1PG2A 1QTQA 1QRSA 1PG0A 1NUPA 2ZP1A 5AHWA 2DEUA 1G8FA 1H1TA 1JIIA 4OUDB 3IVGA 4J75A 2CYBA 2V0CA 3DLAA 4HJRA 1JIJA 2PZ8A 3HL4A 3X1KA 1QU2A 1JGTA 2A7XA 1U7XA 4DDHA 2WQ6A 4CDNA 1T9GS 3MLAA 3N9IA 1YIDA 4KR9A 1NSYA 1GAXA 1XNGA 4ND7A 4MW9A 4TS1A 1VBKA 5KHAA 1MRZA 1WXEA 1JIKA 4EGAA 4MWCA 1LI5A 1M8JA 1OD6A 1WQ3A 5DK4A 1KAQA 2AZXA 1KAMA 1JEDA 1WXHA 1OWPA 1KP2A 1KQPA 3FDXA 4ZCSA 3U1VA 4EG6A 2DUMA 2PFSA 2D54A 5HUJA 2X0KA 1JMVA 1G59A 3UMVA 4QRDA 3CLSD 4MQ6A 1KQNA 1I6LA 3RBAA 2B7LA 2QUJA 3HGMA 2JAXA 1K4KA 3AG6A 4CDMA 3A04A 1EFPA 1MAWA 3IUEA 2I1LA 4EG8A 3KFLA 1J21A 4YMIA 4R2MA 1IH8A 1EFVB 2DR2A 3PNYA 4GRIA 3IDFA 4KR6A 4RPIA 2DETA 2DERA 2NSYA 1U3CA 5FO1A 3QE4A 4ZCPA 1T6YA 4OJMX 3M5WA 4MWBA 1O97D 4ZCRA 3KT0A 2IJGX 5FO0A 4MAFA 1ZH6A 1GTRA 2E0IA 2TS1A 1VL2A 5LM3A 1TYDE 3NBKA 4MW0A 4MWDA 5DEOA 5IHXA 4ZT4A 3ELBA 1KORA 1NUTA 1R6TA 2RD2A 1N3LA 3FETA 1O97C 3OTWA 4ARIA 1GLNA 3TNJA 4WSOA 1MOPA 3RJZA 4L2IB 4S1OA 3IOBA 1XNJA 1N2IA 4PBSA 3MXTA 3A4IA 4KPUB 1XJQA 5KCMA 1QRUA 2HGZA 2WQ7A 3FNRA 4DLPA 4MWEA 4MUNA 3SEQA 4MUIA 1F9AA 1PFUA 1TQ8A 2IP1A 3IUBA 1PFWA 1SURA 3G5AA 1ZJWA 1N2OA 4A91A 5TEVA 1TYAE 4MUGA 3SZGA 1GN8A 2OQ2A 4DJAA 1GZUA 1LW7A 4MW5A 2VTBA 3FOCA 3S3TA 1N78A 3GLVA 3LOQA 3QTBA 3CVXA 2E18A 3Q4GA 2RE8A 1GPMA 2R5WA 4XFJA 1G8GA 1MAUA 3A2KA 2Z09A 1K97A 4G5FA 3E27A 3ZJUA 3CLRD 4DDKA 4MW2A 4NAUA 4RUKA 1H3EA 5J58A 1TFUA 4MW1A 4U7JA 4ZT2A 3AG5A 3PNVA 2CV1A 1M83A 2AG6A 4EG3A 3CLTD 4HK4A 1S4MA 1QU3A 4MW4A 1KR2A 2EL7A 4MW6A 1FYDA 5TGTA 1U0BB 1MBZA 3SEZA 1N75A 4QBTA 3P52A 2ZUEA 1VBNA 1N2BA 1O6BA 1ILEA 1OWNA 3ZXSA 3FI0A 3VGJA 3IOCA 3ZJTA 1Q19A 3CLTC 3TS1A 1TEZA 2HZ7A 1H3NA 4YP6A 4R0NA 1T9GR 1ZUNA 1JILA 3P0JA 1KQOA 4CT0A 3P0IA 4EG1A 4Q93A 4JXZA 4MUFA 1OWMA 2QJFA 2A4MA 3INNA 3G59A 3RFFA 2A86A 3IMEA 1NYLA 1WXFA 1MB2A 3IMCA 4I6JA 1WXIA 4XSVA 4G5YA 1YI8A 5JBNA 4JXXA 2PZBA 3JXEA 2CFOA 4MVXA 4AS1A 4ARCA 3UK2A 4R2LA 3X1MA 3TQIA 1I6KA 3CLSC 4AQ7A 1U3DA 3H99A 1WQ4A 3IOEA 5K0SA 4PBTA 3FWKA 4ZT3A 1UFVA 3NBAA 1VBMA 2H29A 2JANA 4NX2A 2CYAA 4Q16A 4PY2A 4EF6A 3N8HA 1KH1A 2DXIA 1QQTA 3ILVA 2QJTA 1M1ZA 1NI5A 3GMIA 5IJXA 1QJCA 1MJHA 1WKBA 3MUEA 4I6EA 4ZCTA 3Q10A 2A1TS 2QTMA 3N05A 4UZFA 1YULA 2O5RA 1JHDA 3CLUD 4NATA 3SDBA 1HYBA 4JFAA 3AKZA 1O94D 3FIUA 2CUZA 3UC5A 1OWOA 5F23A 1U7DA 3BL5A 3FG9A 4MUKA 5DASA 2DPLA 3PRHA 3TZEA 3RK1A 3CLUC 5TEWA 1J70A 4K0RA 1EE1A 3VU8A 1O94C 1FFYA 1KP3A 1WZ2A 4F4HA 1MB9A 1QRTA 1IHOA 2X1MA 2IELA 4MUHA 5DB4A 1MC1A 1V8FA 5HG0A 1KKUA 1BS2A 4MUJA 2PXHA 2A1UA 3COWA 3IMGA 2CV2A 3LCJA 1KH2A 5KWVA 3MLBA 1OWLA 2PG3A 3SZ3A 3KT3A 1YIAA 3QTTA 4F3RA 2GM3A 3COVA 3H05A 4YP7A 1JZQA 4YP5A 3SP1A 1NURA 4X0EA 1M8GA 1IFXA 1IVSA 1NP7A 1ULHA 1O0CA 2NZ2A 3CR8A 2E21A 4HPWA 3H9BA 3HV0A 4DNXA 1G8HA 3D6VA 3HMQA 4MVCA 4MULA 5TS2A 3UY4A 1N2HA 2Z3VA 2WSIA 4EG4A 1N77A 3ZIUA 1O96A 1Y42X 1WXGA 4MVWA 3ZUGA 2PZAA 3VRHA 3FY4A 4NAHA 3CLRC 1YUNA 2QUKA 4KR7A 1PFVA 5BNZA 1J09A 3ISJA 4EG5A 4XFDA 5H7XA 1EUYA 4K03A 2YWCA 2PIDA 5J5AA 4QREA 3CA8A 1NUUA 1OBHA 3I05A 2QUIA 3CVYA 4MLPA 1IQ0A 1OBCA 2XRYA 4WNYA 4ND6A 2D5BA 2ZUFA 1EXDA 3CVWA 1YUMA 1Q77A 4KKVA 2CYCA 1O5TA 4JYZA 1JECA 2BTEA 2X1LA 3ZXIA 3ZGZA 1K4MA 2OV4A 1TYCA 3AFHA 1J1UA 4OUDA 3X1JA 3DPIA 1I2DA 4PBRA 1EJ2A 2O8VA 2Z08A 3NV7A 4EG7A 4ZT6A 3DV2A 3ZJVA 1EFPB 2CT8A 4U8HA 2J07A 3F3MA 1RQGA 1F7UA 4GU5A 5J59A 2YWBA 2XRZA 3IVXA 4CQNA 1F7VA 5LFAA 2DLCX 1I6MA 1JZSA 4J76A 3MMXA 4BWVA 5FNZA 1COZA 1LI7A 2VXOA 1O0BA 4DE5A 4EFKA 1IQRA 3CVVA 3ND5A 3L92A 2AKEA 2QJOA 3UOWA 2V0GA 3RK0A 1CT9A 1H3FA 3DO8A 4MUEA 3TQOA 3A05A 1R6XA 2YY5A 4G6ZA 1EFVA 1T6ZA 1IQUA 1N1DA 1QNFA 5LLTA 1O95D 2HMAA 2J5BA 2CV0A 4JZYA 1JEEA 2A1TR 4ZT5A 3K32A 4HJXA 2JA2A 3AIIA 1N2GA 3PNBA 4DDMA 2J08A 3IH5A 1T6XA 3IODA 2CSXA 1K92A 1DNPA 1J20A 1O95C 1M8FA 1Q15A 2GKSA 4NDAA 1GTSA 2G36A 4FZJA 3FH0A 1WJGA 2A88A 2X3FA 1M8PA 4U63A 1IRXA 1X6VA 4L2IA 1XNHA
chains in the Genus database with same CATH superfamily
3SVTA 1P19A 3S2AA 1JXAA 4M1KA 5I01A 1M0TA 2H1LA 4OO3A 5KIAA 4J43A 1VCMA 5EHQA 1A5EA 4RAQA 1GG5A 3HNOA 2RFMA 4CG3A 1NQWA 3CEJA 4B76A 3PXUA 4F4IA 3HJAA 2EGGA 5KYVA 1RC8A 5DV9A 1WSBA 2BM8A 2PGOA 3CX8A 5IF3A 1P74A 2QLJA 1VJ5A 1QBKC 4JD5A 4Z2YA 3SBXA 3GG2A 4KVFA 4M7PA 3ZY6A 2H5EA 2P1RA 5CG2A 5NULA 2OYRA 4MKIA 4WXYB 3V8MA 4GYWA 2A9PA 2BCEA 2Q1XA 1H6OA 2PA3A 1T1RA 5FWXB 2IA5A 1VI2A 1KP2A 2BRUC 4AP2A 1BDBA 4UBIA 4RLSA 5EWJB 2AV6A 1X19A 3CV0A 2UVDA 1QO9A 1KO7A 3BL6A 2VJPA 2WTEA 5LD2C 1FVXA 4X1IB 4Y98A 4R6WA 1MTZA 2WU0A 1XKLA 4L6CA 3U3JA 1Q92A 3UMFA 1QYDA 4P33A 5EYLA 1ZQ1A 1NBWB 1G18A 1FRVA 3R8FA 4ZO4A 4HH0A 2XV1A 2Z30A 3C87A 4UUAA 2XQIA 5C9ZA 3GD7A 2FEZA 2OHIA 4N2SA 4BLWA 1W5SA 4AO8A 1E5QA 2QC9A 3ANSA 1H2UA 1AGNA 5H3HA 4R1OA 2DY0A 4OQYA 2NU7A 4CYMA 2A33A 4C5AA 4G4SP 3AKYA 2C00A 1Z88A 3GNTA 3IKTA 2XVMA 2KS6A 2HW8A 3SJBA 4F1PA 8ADHA 4XYLA 2IH2A 3FMPB 4OGFA 1QFYA 4CUJA 5A7DB 2VJCA 5JFGA 1NYLA 4KOEC 3HHMA 2ZJ4A 5B4TA 5BXQC 5AN8A 2OK8A 5ALHA 1H2EA 5CIYA 1U65A 1TR4A 5JSKA 1GDHA 2SKCA 4C03A 2V6JA 3ZNGA 4XR9A 4CM4A 2ECOA 1T0PA 1E5LA 4PY2A 4MRUA 1I4OA 2XE4A 3WY9A 3Q98A 3GCZA 1Q83A 5U1PA 3ZKJA 3KYIB 5JCJD 5JTUA 1E3WA 3D5EA 2ACVA 2JLSA 3LDHA 1VBFA 4W9MC 4MRSA 2Y77A 3PUIA 2VJLA 3R09A 3JQCA 4NFLA 3DFMA 5LDGA 4RHUA 1E61A 2OLKA 2O2XA 1U8XX 5CCDA 5FBKA 4BLSA 4DDUA 1RXYA 4YB8A 3URZA 5DW0A 2B1GA 3F6CA 2J9YB 1XU7A 4JQZA 4MVWA 3CLRC 2FQXA 3GNLA 3BFVA 2O3QA 3DPDA 1CUWA 2VWHA 1GAWA 4J8PA 3P0RA 2ZAMA 5EE5B 2BRUA 3EHNA 4IKOA 2VHCA 1ZC3A 4XQGA 5LU9A 2HF7A 2PCJA 3HRHA 3FU5A 4DJEC 2OM6A 2J6BA 3L40A 4GEKA 3WK5A 3F3MA 3AONB 4FWTA 4LSZA 3RS8A 3ZN2A 3PA8A 1ZRHA 4HH1A 3MIZA 4K3UA 1DEKA 1S9HA 2P4SA 2A3NA 4I46A 1V9CA 2V0GA 4BZPA 4FLBA 2IIQA 4B3JA 2XE7A 2JZOA 2XNKA 1OOEA 4DV1B 2VUUA 4MLZA 3EIWA 3KJZA 2WWRA 2HCJB 4P84A 4U7GA 1OFUA 3U1BA 1BHSA 3BXEA 2GK6A 5H81A 3K6RA 4DNFA 4J0EA 3T1VA 5CGQB 2PM8A 3RWOA 2BYTA 5DMHA 5J1SB 3F6YA 3N2ZB 3OPYA 1JNYA 4C30A 3AYZB 1V7PC 5BMOA 3LV8A 2O8DA 2RCYA 2I29A 2G9VA 1ZKDA 1WOYA 3ZU2A 1WY5A 3OLVA 4ICIA 4Q7MB 3W8DA 3MWJA 4PRKA 6CHYA 2ABWA 5DM70 4RSGA 4XE5A 4EQFA 1MFPA 3EGDB 3HU1A 3ESYA 4BTBA 1E4OA 4R41A 5KJ1A 4PZEA 1G5HA 2BFFA 5EIFA 2PL3A 2WTXA 4A9AA 3G2HA 3PGVA 7YASA 2QSUA 3OZXA 4KSYA 5DM60 4GRAA 4D41A 1XF1A 3QWHA 4FD3A 1QZ2A 4CMBA 1ODIA 1FSFA 4GPEA 4KAAA 1U3CA 3GLFE 1MJ5A 2ZKIA 5K6TA 2HXGA 3V55A 1L4YA 1GG8A 2YZ7A 5JPDA 4UW9A 2A5JA 4ZVSA 3P2MA 3RRUA 5FL7A 4BPBA 1DBWA 1VFNA 1ZMRA 3ILXA 4UASA 2XVAA 4AFNA 5LQUA 5JH7A 1NI4B 2B83A 1U9CA 1JG4A 3R6LA 3O0TA 4AS3A 4XWYA 5K3AA 3W2HA 4YRNA 2V9ZA 1P75A 1U9ZA 4PHCA 1CRQA 4I50B 1ZU4A 1KI7A 4P3OA 3CKCA 3UGQA 4HRAA 4U7TB 2R5WA 3QVLA 2ZOSA 3GEGA 5T6BA 3ZJUA 2WVGA 4Y8VA 1PGJA 4RA9A 3PNLB 2HPZA 4OLHA 4AO6A 4WLFA 3JWJA 3LVRE 4GCOA 4QGBA 3B1JA 4G81A 4MV4A 4Z0TA 4QGSA 5GPBA 1CUYA 1KU0A 3R3YA 3V7UA 3UBTA 5BQ3A 5IJ9A 4LJSA 5LIPA 2WMYA 3VU9A 4H3HB 4PXAA 1ZIYA 3ANXA 3VLFA 1T5BA 3VYSB 5JWHA 3QHPA 1FNMA 3VC1A 1S8FA 2AVPA 1PL7A 3B36A 3VPGA 1Y5IA 4UTZA 4D5EA 4N0EA 1PJLA 4CCSA 4WT7A 1SHJA 1S70B 2JFGA 2H4WA 2IEAA 4QKQA 5DYWA 4YFYA 3GDGA 5CDYA 1K7EB 4I8XA 4HS2A 4D4JA 4FE3A 1XD8A 2YJTD 3I0ZA 2CHZA 2W00A 3ZYKA 5CDUA 2FZ5A 2JGIA 5CDHA 2NXCA 4N3GA 5F23A 4MV5A 3LW7A 3O1JC 4TL8A 3G2PA 3GL9A 5D2CA 4KTVE 2VUHB 5AW0A 3FOAA 2WV7A 1L7XA 3UMGA 3PENA 3THYA 3KT3A 5DP1A 1IFXA 3CLVA 2GJSA 2IZZA 2DHRA 3KOWA 3J7AC 4EPTA 1U3WA 1CYEA 4X3CA 4RTJA 4JHKA 3TIGA 3VU3A 3KZ1E 3R7FA 4U9HS 5DBIA 3IP6A 1YB4A 4BZWA 4ADSG 2HREA 1E2EA 4XUEA 1STOA 4U7PB 3WLAA 4F8EA 2ORVA 3N2GA 4D3FA 1JFFB 4ZVOA 4JP1A 4CIAA 3CRQA 2F90A 2LXNA 2XKKA 4AZ0A 2WOJA 4E03A 1FQJA 3N3AC 4DA4A 1XZGA 1QWOA 1KRWA 1KDZA 3EJNA 3C98A 1UBEA 2D7DA 4FOPA 3PCRB 2D2VA 3I8SA 5ICSA 5ENQD 2H4XA 2QWXA 1GR1A 3O0DA 5CTJA 2CFRA 4FFSA 3LIPA 4MRNA 1UQTA 5IDWA 2KZTA 3SEFA 5JD5A 1DDIA 4CFZA 1WBJB 1A98A 5EVCA 1LJ8A 4EDHA 1Q50A 2Y05A 2H08A 3LDZA 2P1DA 3EFOB 2VTDA 1PTKA 5ESWA 5C8YA 3R7DA 5EKDA 1MX5A 2QN6A 3RYFB 3D6FA 3LLVA 4Y7CA 3PFHA 3QA3E 1G6HA 1T2UA 4QBGB 5KEIA 1VRCA 1E0DA 4N3AA 4TPKA 5C4MA 3D9MA 1PZGA 4IYRA 3TQSA 1ZNQO 3IEIA 2Y4TA 2ANBA 2FFJA 1GJRA 5KNBD 4HDQB 4BY9E 3LF1A 4KX3A 1ZX1A 1VZ3A 4KGDA 3JQBC 2VYFA 3ZX5A 4UQZA 3TWQA 3CTMA 2HBYA 3O74A 2G0NA 2RSLA 2RH5A 2RJOA 4OPMA 4FKBA 3R0IA 4X3OA 3M82A 3D3EA 2PT9A 3C1OA 4GEGA 3EWSA 4GOOD 4PGFA 3VPFA 4PYKA 4CN8A 3KZVA 4I08A 4YDEA 3UV7A 3IC5A 5ITSA 3TEJA 5AI9A 2ID8A 2FSUA 3ZNOA 3D9IA 5JUWA 4EFMA 3HBJA 4GWLA 1N7IA 3QE4A 3EUAA 1D09A 4ZYZA 5LXTB 4Y6QA 3A3YA 4CCYB 2XTJA 2ZJ5A 3KAEA 3JQDA 1KOGA 1E6UA 3BUAA 4ARIA 1D2MA 2F3QA 3E1SA 3WQBA 2DUUA 4QEKA 2AMLA 2H48A 4GXQA 4LNGA 2LDBA 3I5YA 1L6IA 1INZA 3G6WA 4BJ3A 2NU8A 4GX5A 1T6NA 2PLNA 4BVBA 1R12A 1A9OA 4RK0A 3JSXA 1DC4A 2AXUA 2WWWA 1LB1B 3KJNA 1N9AA 2RAFA 3FJYA 3AHIA 1JQJC 1R9JA 1U7TA 2PQMA 5JQGB 2RHGB 3TSWA 4RD2A 4BV3A 1DRJA 1B8VA 3CZ5A 2D5IA 2HU2A 4CTMA 1ZUNA 4YJDA 1KDOA 2F43A 4RKWA 1KEVA 1GPKA 4P7KA 2Q4RA 4OYLA 1KOLA 3ZN3A 3KOOA 2VKTA 3REFA 4JUAA 3NJRA 4UBLA 3X1MA 5I9BA 1AS0A 1JU9A 2R6R1 4OY3A 3PEVB 4D9FA 1FMFA 4ZT3A 4JA0A 5H9WA 2PZEA 3NETA 5IYZB 1HYQA 3U1TA 5DHRA 1FZQA 4YRSA 3TIFA 1TN8A 4DR7B 3CKYA 3OECA 4D8UA 1HL3A 1SXPA 3NT5A 2NQ8A 1L7EA 2PU5A 4HKTA 2ZT6A 5EXTA 4RTMA 3C3YA 1BOOA 1L5FA 1JHPA 3ORSA 2VH2A 5EDSA 4Q4JA 3ZDRA 5E0KB 3FPHA 2VJNA 2PD6A 4OMFG 3S7FA 5CBPB 1ECGA 3I0MA 1UZNA 3JQBA 2XDWA 2E37A 2HJWA 4NPAA 4KE8A 2VDVE 3KZNA 1GYQA 1ZL0A 4FFMA 5GV8A 4BP8A 2QM7A 2D5BA 5B64A 1DAMA 1TTHA 5SY9A 2ERCA 2RK3A 4PONA 2EKLA 1PAUA 3WSVA 4AOFA 1Y9ZA 4K8OA 1AKUA 3C3DA 4R1MA 2CHXA 2ECKA 2HDWA 4ZHBA 4GU5A 1ZN9A 1RYNA 3QC1A 3MILA 1TN6A 3ZHQA 4BBJA 4U1RA 1V25A 1H2FA 3ICOA 1E0JA 5KJEA 3M89A 5HIMA 4R7ZA 5L4SA 4GRDA 5FA8A 4CKEA 4DLXA 1K0FA 1QWSA 3SYKA 2PAFA 3T6KA 3QSGA 2CVHA 3K70B 4ZEWA 1C0LA 4W5HA 5LC1A 3U64A 1QOPB 2XB9A 5JRZA 1E2FA 2J9ZB 4A03A 3U9SA 4KPUA 2J09A 1V3QE 3E9DA 3EHQA 4AZ3B 4CM5A 1R50A 3GFVA 3EBOA 3LHKA 1BJTA 1YNOA 4CT4A 3TWOA 1CD5A 4ZCQA 2PWYA 2ETCA 4J8DA 1B00A 2GN8A 1NZJA 1M6EX 4WZBA 1IZ7A 3JQ7A 1ZBQA 1LK7A 1QC5B 1L7MA 2LD4A 1CETA 4PX2A 4N48A 1C7IA 2QAJA 4EPZA 1QIGA 3SJUA 3AR8A 1PN3A 1ARZA 2R59A 5G4LA 3BZBA 2AGVA 2G6BA 2CYBA 1U90A 5B6IA 2R7LA 4AJ4A 3W5HA 1AKMA 4TS1A 2A0XA 4P0QB 2RGUA 4XEHA 2LIPA 4G8CA 3OFND 3RBXA 3GDOA 3DAGA 3MX3A 1BXRA 2XUOA 3B5IA 3HIZA 1TUBA 1G4AE 5ALLA 5EN4A 4RK4A 4NNOA 1ELWA 2VNKA 2NSYA 2PL1A 4KO1S 4BO9A 4P4SB 4XCXA 2CCGA 1NUHA 3N7UA 5EIOA 1HK7A 3BEEA 2OCBA 3AETB 1XMIA 2C8JA 3IFSA 2P30A 3DAPA 4LA4A 2JCBA 2AB0A 5DOZA 1YL7A 4D9BA 4IJ6A 5TPZD 1NL4A 3ZIDA 1G21B 2RGNC 4HGZA 4WJKB 2ENUA 1NF3A 1JFLA 3PDHA 3MT0A 4H0CA 3W4JA 2PUWA 4PICA 4F9EA 1Q0TA 4KBQA 2EARA 2VP6A 4XIFA 4Y2UA 4DCJA 3L0SA 1AMUA 3AWDA 2W0MA 4BUZA 1XCPA 5CJPA 5TGTA 5HJ5A 2WICA 5AKJA 4YONB 1L0BA 4NBNA 1FP1D 4MUFA 3W8NA 3IMEA 1GFZA 4G1CA 5FR2A 3B1WA 2XEHA 1E1RD 1VL0A 1D5WA 1YA0A 1URPA 3X0DA 2FWPA 2FZLA 3KKEA 2QP4A 3OXLA 3U4MA 2I3DA 4A4DA 5PNTA 2H1VA 1AA9A 3PR1A 3IQEA 3AU5A 3D6TB 4TT3D 3GGPA 3U3OA 2JAWA 3GCGA 4KXQA 2NGRA 2DR0A 3UVEA 4P29A 3KU1A 2DP4E 4XA8A 2WYIA 1LQTA 4QHYA 3K8QA 4GOMD 3D7MA 2P9ZA 4JOBA 4WGFA 5DASA 3CLJA 1W85A 5EKUA 2OEVA 3RTCA 3O8OA 4DJTA 1QRTA 3DNMA 3DFIA 1X9GA 1COWD 3SI7A 4KQIA 4GTRA 1SD1A 2XDQA 1W87A 4EOGA 4YRMA 3H5VA 3W5BA 1USVA 1PK9A 3RAUA 5HRAA 1BD8A 1U2GC 2IV3A 1G0NA 4NCBA 4RGYA 4FNOA 1Q0SA 5AI0A 3A6HA 5C7OO 3NQPA 3DHNA 4UC0A 4BB5A 4WZAB 4R0MA 3QXXA 4Q69A 2C5HA 2ARKA 4FFRA 1E8DA 2C9BA 4ND6A 4A8TA 2FEMA 2C7VA 2ZCJA 4C29A 3U4QB 1VCNA 1U0FA 3UJNA 1NJ6A 4ALJA 3AXSA 1IHXA 2C04A 1EVYA 4B46A 5ELXA 3WZMA 5TVGA 5LFAA 3AY0A 2DLCX 1IN4A 3PJGA 5EE1A 3QXHA 1S96A 1RBYA 1GEGA 4DE5A 4GM4A 821PA 5IDYA 4BQNA 3RUFA 1LDNA 4XKJA 2AXVA 4C0SA 3VPAA 1EFVA 3M6WA 3L17A 2LCQA 3UTMA 1SKYB 3O8CA 5DBKA 1T6XA 2FKNA 2Q3EA 4LZZA 1R2QA 2G25A 4D8WA 2V7GA 1FY2A 2RGNA 5JMPA 1QPGA 3JYNA 2V9CA 4NKRA 3LVFO 1VPLA 2BFAA 4NZPA 4JENA 3JZAA 2Y67A 5DH9A 1GRVA 1V7ZA 4OP1A 2OXRA 4G0OA 4JJFA 4V0ME 2NO5A 1U5BA 3CY6A 1X1RA 2NPFA 4UUNA 3ZQ4A 2V03A 1VB5A 1MZCA 1ZCAA 3M6AA 2OD2A 3IESA 2H07A 4IL5A 3ND6A 3C8HA 3L0PA 2YY7A 1H69A 1YACA 2YJGA 4KTTE 4MVJD 3KB1A 4JC8A 3VZQA 5MN5A 2Y1WA 5EN5D 5AW6A 2IO2C 3H75A 3P4XA 4TMVA 2AXQA 1OYWA 2Q27A 2GA8A 2X3MA 5AI8A 2FY8A 3UXYA 5AWFC 4LHVA 4HLUC 1CUFA 4R2KA 1EFPA 4WY2A 2AN4A 4BERA 1CY0A 5KCZA 4KR6A 1CTQA 2H2WA 3ROKA 2LNIA 3WADA 4C1NA 1S2OA 2W43A 4ZCRA 4MPDA 1DJLA 1JB9A 3D8UA 3TCNA 5AIAA 3WZLA 1LNQA 4HDAA 4G5OA 4EKGA 4RV5A 1W0JA 4FDAA 4MH0R 2A5GA 1A96A 1QE3A 4PWYA 3E9RA 4RJJA 2FQYA 1E6KA 4MUIA 1QGAA 4MR8B 4ZDWA 3ZI0A 1SURA 4BS9A 3G5AA 5D5PA 1U2GA 1Q0RA 1ID1A 1TTPB 3GPLA 1I3KA 5BNFA 1NW6A 2B8WA 2D0IA 2MSNA 2KCLA 5K4AA 1G8GA 3ZGXA 4RDIA 5AW5A 4ZFNA 3PQ6A 1YBMA 1XRSB 4F6RA 2WUFA 2BFDA 3O1IC 3F0TA 5G3ZA 3X1XA 1I4EB 3O21A 1RQLA 3V4PB 5ER9A 2QXUA 4TS9A 4WNCA 3ZXSA 4V1CI 4PNHA 4DUIA 1TQ4A 5A3JA 2OAEA 2CNKA 3STXA 1GPLA 1VE7A 3MD9A 2WWYA 3I28A 2Z43A 2VSOA 3D8SA 4EA8A 3LJNA 2RFAA 2GLXA 4HNHA 2QAGB 2JCSA 2RHTA 3IDOA 1NXPA 1MEJA 1AKVA 3PWZA 4S1VA 3ZKWA 1Z33A 2QL7A 4OP3A 5JYCA 2Z04A 4BV8A 2XBMA 2C59A 1LD7A 4QXAA 4EF6A 1JDJA 2AMJA 5CECB 2JDIA 1AGYA 4XQEA 5FUYA 1OF1A 1P62B 3RV3A 5JSZA 2FWNA 1V11B 3TBKA 1F2UA 3MA0A 4H1HA 3TW4A 2ENWA 3HFRA 5ALTA 3VXKA 4E15A 1JKMA 1LPBB 3JYPA 5ES3A 5YASA 3QLJA 5HIIA 5ARGA 2J6CA 3TLGA 3DHVA 5AJHA 3T3OA 2HMVA 1C9NA 1KYZA 2XTNA 4CEHB 1U2QA 5KTYA 1LTHR 4UQXA 5B57C 4JYMA 4WKBA 4KQKA 2XB4A 1IONA 4W82A 2ZUDA 1NBMA 4NBSA 1ZJJA 3U7FB 1O5IA 4A36A 4QVKA 1GL9B 5L3SA 4TXMA 4FXPA 3FRHA 4HLUA 4AJEA 4CQMB 4P22A 4OX9B 4GSKA 1RW2A 4TMYA 3ENNA 1DHTA 3MMZA 1GZDA 1CG6A 3G2LA 1Z3YA 3KZCA 3KTOA 3CF0A 3RVRA 3NPAA 2R2AA 4PCAA 2OOEA 1LA2A 4EZJA 4HYTA 4A6PA 1JFVA 1F0NA 4F5EA 1Z5OA 4HC4A 1Z0FA 2BKGA 1Z6GA 3SHQA 2P3SA 3WLJA 3CNHA 3W5VA 4KGZA 3C85A 4I4TF 1PV4A 1XYGA 3QLEA 1JAHA 1O95C 1TF5A 1E79A 4QDJA 3S28A 1A8UA 4BNNA 5EWLB 3BPSA 2XENA 4MKXA 4QU8A 2CHFA 3KJFA 2CDNA 1RLOA 4Q39A 2AFHB 1ZK1A 2QYOA 4GB9A 2RHRA 3DMPA 5DW3A 5AM3A 3FTFA 5C7IO 2J9FA 3FFBA 3H97A 2PSFA 1FDIA 2N1MA 5CT8A 3G0OA 3OSZA 1GY8A 3ZK9A 1SA4A 4F38A 1KMHA 3DSRA 3NPMA 3GZSA 1YXMA 4F86A 4IJVA 1G8FA 3ECCA 4S2EA 1MZPA 2VF7A 4BKRA 3WGTA 1M0WA 3U7IA 4M9QA 1M8JA 4RH0A 4RVNA 1JFRA 4B7XA 1MHPA 3UOAB 4A0FA 1Q44A 1OWPA 1XEAA 2Q1WA 4R71A 1KGSA 1QRDA 2PFSA 2C2OA 3U7QB 5I8WA 1MABA 2BUCA 3L7KA 4EG0A 5GMOA 3STTA 1QG0A 3KYCA 3FGPA 3E18A 2L42A 2BHSA 3C6YA 4ZEMA 3QOUA 3ER8A 1I7DA 4CW7A 4IXWA 4LBZA 5EYPB 2PX8A 3EVGA 1DAIA 5BWMA 1U3VA 5D3MA 3TNJA 3KKQA 3TX2A 1HDRA 4G85A 3R9KA 4ENQA 3NYQA 4EHMA 3LWBA 1TQ8A 3BM5A 1C14A 4YTEA 1EYHA 5ISMA 2PAAA 4GM0A 2TRSB 1SVOA 3NAGA 3FOCA 4S04A 5KOIA 4XWTA 3NBXX 5JJ5A 2P5YA 3JY6A 1YC5A 3BWMA 3MJFA 3AJDA 1X7XB 1E4VA 4C08A 4NJEA 3QPUA 3FF1A 4B40A 3K09C 1TFUA 1WL8A 1LBEA 3VH2A 1R66A 2PM7A 1YS2X 4XOUA 4BQRA 1ZMBA 5ALDA 1K75A 2WFAA 5DBFA 4MCIA 1F8UA 4BQQA 4JVLA 5CEAA 4TVKA 5BNTA 1NBOA 3AP2A 4LDAA 4PUCA 1Z45A 4M0MA 2WFZA 1I4LD 2FG6C 4KHPB 4O1PA 1OH6A 3IHYA 1Z08A 1GM5A 2H9AA 3EIQA 3OX2A 1O7JA 4LDPA 2VHQA 4OA8A 2A57A 4PLYA 4C21A 3H7IA 3MGKA 4AU1A 5KJLA 2OR3A 1H94A 1O95A 2FUNB 1THGA 4QULA 4EPWA 3AFNA 1T2NA 3Q7QA 1C4XA 4JJ8A 4TTJA 1L8AA 4X44A 2BSXA 1XCBA 1RM0A 4BNJA 5D5QA 4B4OA 2WNHA 4PEVA 1DMRA 3RS2A 2F3TA 4DQDA 3MOGA 1WVMA 4K0RA 5AARA 2ZREA 3MTIA 1MB9A 1M2KA 1QYRA 4L02A 3GCWA 4AKSA 3GGSA 5KBYA 1ZVJA 1DMSA 3IAHA 1M1YE 2JI9A 1SGWA 2PG3A 3DFUA 5CH5A 1POXA 4KE6A 3TH5A 5JNRA 2GN2A 3DDNA 1ULHA 1E2QA 5T3UA 5DTMA 3D3WA 4KAFA 5AOAA 2QZPA 1L1RA 1CFJA 5JQWA 4LQLA 3PFGA 1GGFA 4TTVA 3I05A 3LP6A 2NM0A 3AGPA 1KJYA 2F1IA 3DT8A 2G1UA 4MZDA 4LRWA 2IHNA 3LBFA 4U04A 4BFZA 4X8MA 5EJEA 2CNNA 1CSEE 2JAOA 4GBJA 1RE1A 3UFBA 4TTTS 3WWEA 3IVXA 3WIBA 2GEVA 4DZTA 3RREA 3CK9A 1HWYA 1XZDA 2EIJE 4II7A 4PZLA 4G2NA 4TZ0A 3DE3X 2XIJA 3G2NA 2B92A 4BLTA 4TYPA 1WSDA 4XWGA 2LPMA 1FYXA 2J5BA 1FYFA 2WWIA 2ZBUA 3TLZA 2YCBA 4GKVA 1Q15A 2BEVB 4KXMA 3GN2A 1Z2CA 3H17A 4BIMA 5EHGA 2YH2A 4ZI2A 3THWA 4EITA 2V1UA 2MYOA 1XYYA 3K0BA 2DQSA 2DTEA 1HXHA 4PSKA 2VPXA 3K09A 2VUSA 1KZ4A 3PHGA 4BC0A 4ENVA 3LUKA 3RHSA 4DNOA 4UAJA 2UZAA 1C1XB 4RIGA 1JHUA 5FIOA 5H16A 2P9LG 1NUSA 5E1MA 4Q9AA 4HB2A 2NYVA 3QFSA 1OT3A 4HWSA 4WK2B 3WB1A 2RK4A 4D4MA 2YMMA 1U3GA 4YREA 2OAGA 3EULA 3MLAA 4XARA 4GAAA 3M83A 4HDMB 1MRZA 4QOSA 1DAKA 4DS3A 4OHVA 3SYNA 1N0VC 3DSXA 2JGEA 1D0SA 1T29A 4J4HA 4B32A 3ABLE 4NXMB 4LTMA 2FPXA 2DFDA 2QVXX 2UKDA 4JLAA 1J49A 3V2IA 2CG3A 1ORHA 1THTA 3L7NA 3I2IA 2QR5A 4O63O 3EFHA 2VPWA 3N86A 5LLDA 2H3EA 2OCIA 3R9IA 3NGLA 2ASVA 2WIGA 1L5HB 2FVYA 2EX1A 3N5CA 1XA0A 4LI0A 3OO0A 3JQAD 1FFAA 3EXG1 5TQ0B 4MLCA 2Z56A 3I3OA 1V1MA 3D2BA 4C3VA 2AMFA 3MWEA 3JQ0A 3TTSA 2B2CA 4MQBA 5CD1A 1T9AA 4NZMA 2OP1A 4ZVRA 1CUSA 2ON6A 2QM0A 4PZZA 4OHPA 2HRRA 1LTKA 5GONA 4JVNA 2EHDA 3RS3A 4JWKA 3FFAA 5DJ5A 1E8MA 4KVGA 4CL3A 2ASEA 2XMCA 2C7PA 4N8SA 4ND8B 5GTDA 4DEXA 3GH1A 3FU0A 1BN6A 4DLAA 1NVUQ 4JBYA 3ABME 4JLMA 5KWJA 2UYOA 4YP0A 1SUIA 4TYYA 3CLKA 2JEYA 4F91B 3PSAA 4D98A 2KB0A 2PX4A 4EMUA 4FYWA 1PBTA 1E1YA 4EBAG 3C6KA 1OWMA 4OLBA 3SK0A 2QI9C 3AILA 3GFPA 1SIUA 4EY6A 1ZYUA 1CUEA 4Q6BA 1QQ5A 3FGNA 4TTRA 4NBVA 4MQEA 2CFOA 3PXCX 1SKQA 1FXSA 4BEWA 2H65A 2II6A 1O1SA 4NICA 1O77A 3OESA 3WGLA 3P8ZA 4YIKA 4Q94A 4LGCA 2G09A 3BH6A 3FWNA 1QZZA 3GJ6A 3ZHBA 3RNOA 2R1UA 3OHSX 4Z4EA 4Q9HA 2YY6A 1XX6A 4MYUA 3SNHA 3GMIA 2FN3A 2Y8EA 1L3BA 3EVDA 4RD1A 2VLBA 1M2OB 1Z5WA 2B4KA 3JYOA 2DUNA 1Z68A 4B71A 5JZMA 2FXVA 1WQ1R 3PDWA 2CF6A 1TLTA 2GSDA 3QELA 1Z0AA 5G53C 5JJCA 5KTPA 1E64A 4ZC1A 4ZAGA 5EJ9A 4Z1MA 4GZMA 3KCNA 4J1TC 2VA9A 3Q7SA 3ORQA 1LK5A 4Q3DA 2KYRA 1N77A 1CV2A 3IPRA 3AKCA 3PT9A 1J42A 3F4LA 4LE1A 4FHEA 3CA8A 1QGUA 2ZBEA 3IMKA 2PNNA 4GP7A 5DPMA 4ZEXA 3Q5DA 3DKIA 2LIVA 3W1EA 1S02A 1NQ5A 3EA0A 2VXYA 2VHXA 2DVMA 3KQQA 3JAKA 4LWZA 4M8KA 1RC1A 3ZK8A 4P9NA 4ONEA 4O2AF 3MW8A 5DF1A 2WJ4A 3PUVA 4R7GA 4YDHB 2N1BA 3V4LA 2R84A 2AR9A 1UPXA 2VDMB 1UXGA 2DHDA 1ZEMA 1F0KA 1V39A 3OKFA 4LGMA 1ADBA 1G8MA 4PO1A 4TM7A 1UJMA 3A3KA 4ARZA 2PZMA 4WESB 1H2HA 4NABA 4PWZA 1K1EA 3Q8KA 5BYKA 1F8XA 3KKLA 2GJ9A 4DSOA 4C6RA 1KEEB 3TUIC 2H4JA 1JP7A 2V8BA 4U63A 2G88A 4FZVA 4B3GA 3KTDA 5JMND 5C8VA 2A6PA 3WFIA 2HE0A 4ILEA 2DWQA 3V9AA 1U8TA 5JTTA 2Y0BA 1NLZA 5KSOA 2Q8QA 3KIPA 2H1WA 5IMBA 1EIWA 5EOVA 2VRCD 3BWBA 1QIEA 3FGZA 1KY2A 4QD3A 1DFGA 2GHQA 3NTRA 1XQ1A 1IY0A 2Q6OA 1L5GB 3ZTWA 1C0IA 2LNDA 5K9ZA 1UAAA 1G0OA 3ZIAD 1V43A 1JGTA 1PJZA 2FRVA 3DM5A 2AL7A 4PTLA 5AJTA 1YA6A 1QK3A 3VU1A 3GFFA 4HNUA 1D6MA 3MCTA 4ANFA 4QRDA 4MS4B 1XWFA 4ZCIA 1BKYA 2W8ZA 3EVAA 4CDMA 4F72A 5F4ZA 1J21A 4YMIA 3VBCA 2JFOA 1KVQA 1XVAA 1QMPA 3OD1A 2VJAA 2VTEA 2DCPA 3K71B 3ONLA 5FWDA 1SVIA 1GGNA 3B3AA 3UZUA 1N3LA 2FYTA 3S4YA 5LQKA 5KTSA 1MOPA 3MBOA 4L2IB 1KWGA 4PAMA 3AF3A 3L0IB 1IHYA 1K8YB 1Q0UA 1JR2A 2IHJA 1BMQA 1ORTA 3P4UA 4J8EA 4J1TA 2UYHA 1X2BA 1J00A 1ZJ6A 3N0RA 2O14A 5J4LA 5EJ5A 2Y1LE 4L4UA 1V2GA 5HKBA 5A6SB 3DLCA 2C92A 3ZU5A 4CIDA 3H5RA 1Q21A 2DPMA 3GV0A 4HRYA 4A82A 1W1IA 4GZ6A 2RE8A 1Y89A 1U0NA 1WR8A 4J0KA 1AGXA 4RHTA 2W48A 3E27A 4B0ZA 1XZNA 1JU3A 1GCOA 3FDZA 2FH5B 3WISA 2IYOA 2VSNA 5CCMA 3CLTD 3REOA 3RKVA 3TTUA 1P17A 3F8SA 3H04A 1OWNA 3TSOA 2PBFA 4BAUA 2WHXA 3LKVA 2EILE 4KSBA 1CUVA 1UXJA 3V33A 3HN7A 3DZDA 3SOZA 1O58A 1IXSB 1DJNA 4DTCA 3TWSA 4OH1A 4KQMA 1BCSA 1XZEA 1SCUA 1AZLA 3I2YX 3LS2A 2BTQA 2QLMA 3USZA 5KNLA 3IP3A 5C1IA 4PBTA 4KYVA 5J2TB 3K1AA 5CRIA 3WMXA 5GGXA 2VF8A 4DHWA 1D4AA 5FEMA 3LTNC 5FYDA 4N03A 4XEIG 2BEUB 2CYAA 1T25A 5E7JA 4CKCB 4LVCA 2XT6A 3HUUA 1NJ2A 5D3KA 4EF5A 1ULZA 2GK4A 5FNVF 3ENVA 1KPSB 3QLVC 3FAZA 1J24A 5TDHA 4E5VA 3OBBA 3GUVA 4MUKA 1WSAA 5JAIA 1TVKA 3KHSA 3N71A 1ACMA 4F7DA 3AEXA 3GGJA 3HCFA 4EX6A 1X8JA 2EBWA 4HAVA 3RD5A 4FYMA 5C0OE 1WF6A 5CVJA 3KPJA 1W1UA 3QNWA 5IN4A 5EERA 2CXXA 2IUYA 1BDIA 3HMQA 1PDVA 1V16B 2VAXA 4FQ5A 5ABPA 5BSEA 1XG5A 3WGHA 3OQOA 4J7WA 4KR7A 1PFVA 4DBZA 5CT9A 3VTZA 3OHMA 3CJTA 1S1CA 2GILA 4OCZA 4GH5A 2PRYA 1RPNA 1C8KA 1SUCA 3EPKA 2G40A 3TXAA 1UKAA 3BTOA 3B6KA 1U28C 4LC1A 2QRJA 1ZZEA 1OTYA 1YONA 4CG2A 2O8VA 1YTLA 3RABA 2F8SA 2P5UA 5KOHA 3U3KA 5REQA 4PPNA 4CQNA 2PRKA 2W5UA 1E6MA 1T24A 1NNEA 2VXOA 3UOGA 2OMKA 2XODA 3RS4A 2FMXA 1H9CA 1OLUA 1VKNA 4PSVA 3TWTA 5T4BA 5J2UB 4CGYA 1SKBA 3Q72A 3PGLA 4AS2A 3VFDA 2FGKA 3H7AA 5AIJA 2Q2OA 1WUTA 4LF8B 1M8FA 5HKKA 1ZIPA 4NDAA 5CK4A 4FMCB 4M49A 3SFYA 4TMTA 3WQHA 3N2IA 1Z6QA 5TGZA 3W04A 2G77B 4K3VA 4MRMA 5BYBA 4PSAA 2ZRQA 1G9TA 4OFWA 4UUPA 2EEPA 4FYKA 5AVRA 3C5HA 2AE1A 1HG5A 4UD2A 3K9BA 2G4LA 3SZ7A 1W8DA 3ZXYA 3QZUA 3D6UA 2V5FA 1XTIA 5A03A 2HF9A 1ODFA 2DYKA 3MUFA 3SVZA 3LO5A 5BQOA 1P9NA 4YUVA 4Z3DA 1ECFA 3VTYA 2DUWA 3HI6A 2CXSA 3T1NA 1CF9A 3MGBA 1Z16A 4HOUA 1BI8B 2C58A 4MJ3A 4O08A 2AOXA 1MEEA 1SVNA 1YIDA 1XNGA 4P7JA 1ESDA 2YASA 4GBGA 4U8VD 2OBLA 1EDOA 1XZLA 4TMKA 1FDUA 1CJTC 4U95D 4GPZA 5BXOA 2IY8A 1CQPA 1ZR2A 1N5LA 4M9RA 1PHRA 2DHEA 1YR2A 3ZEFA 3AUKA 3WG7E 1TK3A 3PNYA 1NOKA 3QLVA 4DJFC 1NMEA 1QE5A 1SHZA 3QY0A 5FDFA 4DLNA 5CNKA 1TMOA 2K7FA 1BA3A 1GU0A 2ZRLA 4B8ZA 3H3FA 3I76A 3GT0A 1CZRA 4IO1A 1QLJA 3DE6X 4UFPA 1S6YA 2WMNA 3CZ4A 1QLHA 4MARA 2HKIA 4JBGA 1TTTA 4JP8A 4Q3EA 5EKTA 4PAWA 1TEHA 3QI7A 3ZI4A 3ZW9A 1NG9A 3IEUA 3IT1A 3D7KA 1A17A 3UG7A 3E7FA 1KT0A 1DXOA 3DDUA 1ULAA 2O8CB 2W6JD 1KTVA 2GAOA 1ID8A 1O4WA 1R4ZA 4S05A 1NVWQ 3MFYA 2ONYA 2N75A 3ZVKA 1B14A 1U28A 1JR3E 2J4BA 1RHQA 2RFLA 5CBOA 2AN1A 1HL7A 2ZRGA 4UDXX 4S35A 4KXWA 3VZRA 1SEPA 4K5QA 4R0NA 4I1YA 1SOAA 2I4NA 2ZISA 4OG2A 2VGXB 4X7MA 3TFQA 2WIDA 2GARA 1A1SA 1IHGA 2EFDB 4TXJA 5GOZA 3CUTA 4QE3A 4YYEA 1RPZA 4R2LA 4U6QA 4YCAA 4AQ7A 1NHWA 1NJ5A 1LF8A 4UAUA 3SQLA 1OB5A 3KNZA 4RJIA 1KI4A 3BXHA 1ODTC 3IP8A 5K51A 1FP7A 1BMFA 3LT1A 5IJXA 4ZYVA 4CLEA 3MCUA 5LOVB 5J43A 1XHEA 3ULEG 3RU7A 2PXXA 3QEBZ 2TECE 2PGAA 4II3A 3AU4A 2JAHA 4RK1A 5FA5A 5KPJA 1B42A 5A4FS 3KSZO 4QPJC 4AXHA 4WUYA 1N95A 4QQ8A 4MGIR 3IT3A 4CGZA 1R8JA 2O2JA 1RI3A 5GY7A 2ZRMA 4LN1A 1VDZA 1OU4A 1P1BA 3DBLB 3KRTA 1PS9A 2AFIA 4RHFA 4EI9A 3FVRA 2AUTA 2ICAA 2XVZA 2P8SA 4M8NE 2GEKA 1E2LA 2WE7A 2HLDA 4B4UA 3TNYA 1Y7HA 3TL6A 1GA4A 3R7LA 1AUPA 3OPMA 4H7FA 4TXLA 5FR1A 4ARBA 5BWCA 1O6ZA 4DXDA 3N7AA 4JBNA 1Z9BA 4YBZA 1K08A 1ZN7A 3PE3A 1H5UA 3CGGA 3BGDA 1TI7A 1KIAA 4RVGA 1XXHE 3W6ZA 2H7XA 5I48A 3KE9A 2HSDA 5B53A 4MINA 1I2CA 1HXIA 2JI7A 5DNCA 2HA6A 3M2TA 3TN7A 2ID9A 2WG2A 2Z8XA 4O5OA 1DELA 2XUIA 5CG1A 3HXBA 1R0LA 1CC1S 1SHUX 1PR3A 3K32A 4MWSA 2FF7A 1YRWA 2B2NA 1JBKA 3P9PA 4RTKA 3O4HA 3UT7A 3UIPC 3VNVA 2ECPA 1XPJA 2W6CX 3QKYA 2PKQO 1H4QA 1M8KA 1C8BA 3NKLA 3W2TA 3G0BA 3NAQA 4B0PA 2IEJA 1U4NA 5KKAA 1AKYA 1I3MA 2Z4TA 3RUIA 2Y4NA 3ND9A 4O60A 5DKFA 2DT5A 2IEGA 3EJ6A 2B94A 4WVLA 3OQVA 3PTLA 1MB0A 4U7HA 3BE6A 3HA5A 2BT4A 2HHAA 5L7WA 5CA0F 1FQWA 2D7CA 3AHHA 1YZVA 4ESVA 1PEAA 1KIFA 1XQ6A 4NBUA 2JEOA 2CCJA 3CW2A 1GDTA 2ZUVA 3TLBA 1K8KG 3WB0A 1WXHA 4YR7A 3ZJ5A 3D8TA 1OE0A 1RRMA 3URKA 2I54A 2UVPA 4PLGA 3EJWA 2AQHA 1QX4A 3L7YA 3W2IA 2AT1A 1HLDA 1BCRB 1ZGGA 4J91A 4LECA 4UPEA 1P39A 1A8PA 3ZY2A 1O97D 2FGJA 4NMWA 1VL2A 2WHPB 1II8B 4WASA 4INJA 5C3UA 2F8TA 1GRCA 1P5QA 3WTBA 3K72B 1ESEA 2HNBA 1P6UA 2I3GA 4KQ1A 2VT3A 2QXYA 3LYHA 1P1RA 1YBFA 2R5FA 5ENRD 1Z75A 4RCVA 5D85A 5BN5B 4F2DA 2P62A 5ALIA 3EIOA 1T5HX 4JU8A 3W6NA 1FRZA 2VP4A 3F73A 3DE4X 2YUIA 1DV2A 1HSOA 3C5EA 1G8KA 1H4VB 2NTVA 5KDLA 4BO6A 3BT7A 1XEWX 1F0PA 3GLGB 4OX9Y 1LSUA 5JAQA 5H3LA 2CSUA 5JVDA 2D00A 4LWQA 4RENA 4X1YA 4B3FX 3TS1A 3BWCA 4NPCA 1JAXA 2ADOA 1JIVA 2RKWA 1FL9A 1BHO1 2Y1FA 3HGTA 1RWVA 4R54A 1WXFA 2GCOB 5TXGA 2A5LA 5L6LB 1MOQA 3LUJA 1Z4IA 4MRVA 1BU9A 5CU7A 3S7DA 4B80A 4R51A 3WXXA 5JD6A 1WMAA 3WGUA 1GU1A 1VRVA 3BU8A 5BMVA 2RB5A 3MINB 4B3DA 2P91A 1XQVA 4RDXA 4L9RA 4ZALA 5E6SA 1R0WA 2QQ5A 3SQXA 1WXWA 3SSMA 3UW1A 2KATA 5JEEA 4ERXA 2OVFA 1P72A 1YZ3A 2OZPA 1YCGA 3ANYB 3UT5B 4MKZA 4RO0A 2H54A 2O4UX 1YIOA 4Q3BA 2UYGA 4EABA 2GPTA 4GPD1 5BVGA 4FADA 3HJRA 4JASB 4WBNA 1AA6A 4YN3A 1LRLA 3FKSD 4UUOA 1CF4A 2HM7A 3CEMA 5BSFA 2QP3A 3RYHB 3FKJA 3D9PA 2OXIA 3IIIA 1YUNA 1EK0A 1AV7A 2VZ9A 3LAWA 3A6DA 3TSCA 2KHZA 3LY8A 3FFWA 1NI3A 5DX0A 1RSZA 1X1TA 3AJ9A 4TV9F 4MI1A 1TM1E 2D3TA 1GZ4A 3TYXA 1Q3TA 3AKEA 3R41A 3L02A 5A62A 2QE6A 2CXHA 1AF4A 2JFBA 1FFXB 2QNIA 2JJ2D 1R0CA 5AHXA 4AJPA 2YHIA 4KQJA 1DC8A 1FUIA 1Q3HA 2ZSKA 2JGMA 1YVUA 4NEQA 5T5QA 5FAKA 1H3FA 3RSSA 5FYQA 1S0UA 2O2YA 2AKAB 4UU7A 4GUDA 1FSZA 4J3FA 4QQIA 1QYIA 1YD7A 3OF3A 4FZJA 4QUJA 4DY6A 3NEJA 1ICIA 2X3FA 3I9KA 2HI0A 2XAAA 3HDGA 2J31A 2F8YA 1K7YA 4WINA 2EWMA 4HPJB 4BN5A 4DRXE 4MR7A 1HM5A 3IILA 1QCDA 3L6DA 2XNDA 4O4IA 2QK4A 1C3XA 1Q16A 4LRXA 4C4ZA 2H2IA 3BSYA 3SAJA 1R37A 3Q3VA 3PQ8A 1OYYA 3CNQS 1GZ3A 4RWEA 2F48A 3OEHD 4CL2A 2N46A 2I1WA 3DCIA 3JRXA 4HQFA 1PP4A 3NP7A 1EBFA 3TLEA 3LP8A 2PXCA 3F8TA 2ATIA 3FUVA 1PG2A 4B7ZA 3NV9A 1WLYA 4YP1A 2YW9A 4B93B 4D8YA 1JIIA 1RIIA 2PX5A 1RRGA 3NQ41 3U13A 2O20A 2PX0A 3IBGA 3KAJA 5B6JA 3OZDA 4AWXA 1YT5A 4BLPA 4KJZA 3WA7A 2C78A 2GMWA 1YZFA 3KSDO 2X3YA 4XXHA 5ULLA 3ZGVA 4BHTA 2CXTA 1GN9A 3CWCA 1IUOA 2KBEA 2Q6LA 2JFHA 1XAHA 4H7XA 5DIZA 3AERA 4M87A 1JALA 2CMKA 4ILGA 1O8BA 2GD1O 4NCXA 3HG7A 1W6RA 3QX7A 5F98A 3U3RA 2WIBA 1EFCA 2HDHA 4B3BA 3KBBA 3UTCA 5C34B 3QFRA 2FEAA 2KJQA 2GZDA 4RETA 4KB5A 2Y92A 3CONA 2PWPA 3D3JA 1K3FA 4GFDA 1X1EA 3HXTA 4XM2A 1YJCA 4GVPA 3TXYA 3A06A 1T2AA 3EIHA 3RHFA 5FBZA 1Y3HA 4BY6A 1TYAE 3T5PA 4DIOA 3ABKE 1K6IA 3CHMA 5G4KB 1LLFA 4XIJA 4RF3A 4KXXA 2KPOA 2WIAA 1RMYA 4GC5A 2JLZA 4X91A 4D82A 4IOLA 1QH1A 4XJTA 1U99A 3CRVA 4FKZA 5CYGA 1Z47A 3UW3A 5KJFA 3ZDZB 1X14A 3O8BA 3M6VA 2WE8A 3LXUX 2H06A 2HSWA 4A2PA 1WM5A 3SF8B 3RSOA 4L22A 1QPBA 2FX5A 1NRJB 5LZ5A 2F55A 3EODA 3AVOA 2HYZA 3PZ1A 3TE6A 3D5QA 1P5JA 1XCGB 1FSSA 4AN0A 4OSEA 2RONA 3OKPA 1DLIA 3TQIA 5I8PA 1SFRA 5KYKA 3FHOA 4TRNA 4WW0A 5MFPA 4INAA 1VBMA 3A8TA 2PS3A 2MSEB 4H27A 4H9GA 3ABQB 2YWJA 3PICA 3CV3A 3B1XA 2IYAA 2QTMA 1EP1B 2ZQYA 3TW0A 3DHWC 3Q6MA 1NYQA 2AJBA 3HRIA 1MIOA 3LCCA 1G5QA 1OT5A 5BT8A 3OBIA 3X2FA 1VKZA 3IAFA 5DSXA 1X15A 2GCPA 1OXTA 4ZV9A 1USGA 3N2KA 4YP5A 4ISBA 5JMWA 1ZD5A 1IK4A 3AF0A 3P71T 4JQYA 4XSHA 1WDYA 1M5RA 4TUUA 3ETDA 3C97A 5DGDA 4LPSA 4MJXA 3TOSA 1U1FA 3AHGA 4KE9A 4OI0A 2H7VA 3BDAA 2F7SA 4RAOA 2AG5A 4FI3F 1V7QA 4L7TA 2HBQA 2WTMA 2QL6A 3VAAA 2Z9DA 4IBOA 4IJUA 1PVDA 3GRCA 2F17A 2VAWA 3NBQA 5J59A 4L3VA 3T0GA 4U7WA 4N5IX 1SVUA 2AA3A 4J29A 3M5PA 4HTFB 2VJYA 3KD2A 1U2ZA 4ZZ2A 3OFKA 1E66A 4ATZD 1M9NA 1T6ZA 2R00C 3WMRA 1WB6A 3UC9A 4A8PA 5A5FA 2VYQA 4L8VA 1HOTA 1OLOA 3Q1LA 5F3WB 2VRBA 1HQDA 2Q4OA 4CU5A 2BHRA 1GUBA 1M8PA 2UZ1A 3D0RA 3WLMA 3E5NA 2I6GA 1D0IA 3OC0A 4FFBA 1QF6A 4K2HA 4H3SA 2QZJA 1C2YA 1JI0A 4LHXA 5EINA 4PZAA 4JR0A 3KT6A 3LEWA 3R7RA 3HKCB 4DABA 4LKRA 4NBRA 1D2NA 1JQEA 3KAPA 2IFUA 5BNWA 5E9QA 1QV7A 2Q5QA 1N2EA 3W8RA 1AY0A 3QMWA 4KFUA 1A71A 4WFQA 4B5LA 2QRVA 1RXUA 4JLOA 3ZHZA 3NGMA 1BXGB 1SR8A 5DYTA 1JG1A 1TAQA 3AJ8A 1K5PA 5T6MA 5COQA 1NA3A 3LLSA 3C3QA 2I9CA 1BDMA 4EHIA 5I9IA 2O1SA 4OHZA 4E14A 1MJ0A 3W5UA 3TFWA 4BDSA 4PHFA 1X7WB 3DV9A 3T94A 1SU8A 5FKJA 5BO5A 4DLKA 5FOUA 2ATVA 4UNPA 4KITB 4OQLA 1R00A 3HDVA 3BWEA 3QFTA 3B8EA 4WCDA 4MYTA 1JJAA 5HS4A 1RTTA 3PEWA 3A9UA 5B7QA 3IUEA 1P1FA 3MC1A 2AN5A 5DO9A 2Q21A 1L5OA 4WVFA 1P0MA 1AMNA 1M6VA 4BLRA 5LDHA 1VHLA 3K20A 2IYUA 4Q4AB 2QJWA 1XL0A 4JI2B 3Q8MA 3CHYA 2HA2A 1ODCA 1P2BA 3OY7A 1ZN2A 1T8YA 3DYBA 4BUJA 3SX4A 5FUWA 3JQGA 1RQNA 3FTYA 5EUCA 3FB4A 3HXPA 1DRVA 3DZKA 4NQ0A 1XJQA 4KO2S 2JLAA 1JEQB 3Q9SA 3IUBA 5CB6A 2BEKA 4CV3A 3RYCA 3ANLA 1D7AA 1DOAA 2WP8J 4WOCA 1UWCA 2Y0CA 2AMYA 1RLUA 4M9ZA 5KTKA 3BGWA 2DKOA 3PR2B 3K2BA 5KNDH 4XKCA 1M5TA 2HFKA 5EXDA 2EXXA 5BNIA 5DCWA 3U5TA 5IT9A 2WJ3A 3LSTA 3HBLA 1PTJA 3EEFA 4M0DA 3CJRA 2FOLA 3LCRA 4BRZA 1W29A 3VDRA 4JQSA 2EP8A 4RGVA 4MVJI 4QTZA 9LDTA 1XMXA 3TLXA 3S44A 5AQ1A 1X7YB 1L7OA 3H5OA 1FC0A 4IS2A 3P7MA 1TX4B 2M6SA 3HO6A 2ZSIA 5IARA 5CX1A 4HAWA 3RRXA 2B6CA 3LCAA 2R00A 3K0AB 1J90A 2XYGA 3IOEA 4ITVA 3QUCA 1B6SA 4K7JA 1UC4B 3EIQC 1DCEA 2GKGA 2Q8NA 3DAYA 1QQTA 3H19A 3KK0A 1FTGA 4FDLA 2IZ0A 1GYRA 1QJCA 3ULQA 1SK9A 3FPEA 3LHSA 2VNSA 2XT0A 2R751 1FE8A 3ADOA 4TVOA 4RM3A 2ETBA 3CIFA 3P2OA 3WGYA 4HAUA 1F2TB 5JAPA 3ET4A 3H9UA 4U07A 4YT5A 3A2MA 2F59A 5FTKA 1VDMA 4KWTA 3PI7A 1J5PA 4OGGA 3MSCA 4PVCA 2XMQA 4AQDA 1Y81A 3GEIA 3CXUA 2JFZA 2W6NA 2YHUA 5I9MA 2EOAA 5A1TA 3WLKX 1N2ZA 4EF4A 1GNQA 1KY4A 1X9IA 2NAFA 1JAYA 2Z2YA 3R3HA 3JWIA 2RHHA 4JAVC 2BMWA 3TXNA 1KPHA 1UL1X 3R3JA 1ONNA 3DC7A 2ZYRA 4PTZA 3CIAA 1P7ZA 3LWZA 2JJQA 3W1VA 2UZ3A 3CN7A 3N28A 4BNTA 2JPDA 4L75A 1E6WA 2DQ4A 4D2IA 3PDNA 1YMUA 4ON9A 1GPBA 2OO3A 4QELA 1B41A 3K5WA 5ESXA 2GBPA 3WL3A 1QXSA 1NXOA 3ELUA 4YXFA 1EHYA 4TL7A 3HSKA 3ETJA 2PNFA 2OZLB 5JO9A 1KVUA 4CEJA 1QMGA 1KO4A 5K8JB 4TXHA 4DR2B 1GKYA 1A9QA 4I1OA 3ZUVB 3Q7RA 1VE1A 3E7XA 4DCOA 1QVAA 3ZBPA 2O2ZA 1Y9AA 5IXSA 3D7NA 3USES 1M34B 1RXVA 3M5CA 3AY3A 5J4YA 4RQBA 1QYCA 4LHEA 4JSYA 4P08A 4CNQA 3IEPA 3NCHA 1R64A 4DSTA 3QVVA 3M6LA 3MJEA 1T8RA 3WE7A 3BHIA 1TRHA 3R4CA 1KJJA 2O3JA 3MJRA 3RVOA 3MCAA 2G4CA 2P6RA 4RWZA 2A3RA 4QGGA 2FK8A 1E1CA 5LL6P 2LSUA 3HKBA 4ZVUA 5LB4A 4PS8A 3WLNA 2XUGA 4R9VA 4FN4A 3V34A 2W2NA 4UWHA 4ROSA 3E3MA 1YS1X 5AJXA 3T9KA 4WKNA 3KFLA 2AJCA 3PNTB 1QQBA 2C07A 4Z7OB 1JBQA 3PZ2A 4NE7A 3HUFA 3C7DB 5CDGA 2JKZA 2RGBA 3A11A 4X6YA 4DCGA 2B5VA 3CHQA 2N0SA 4EZKA 4ZO8A 1VE9A 2ID7A 4JDUA 1C0KA 4LAFA 4H1TA 4X8HA 3LDAA 2CLSA 1YZQA 4FC7A 3FNRA 4NBLA 1JMYA 4JYAB 1EP2B 3EGXB 4GECA 1ZRMA 1Q2ZA 2B20A 3S3TA 1J8FA 1PYOA 3GDWA 3QOXA 4WFIA 4AB1A 1VIDA 1PJTA 1MAUA 4O6FA 4L7QA 5LUBA 5CA1A 4MTLA 4C06A 1XDDA 3L0CA 4PZCA 1IZYA 2PQRA 4M99A 4NENA 4KX5A 4MA5A 5A7GA 4D8TA 3TD6A 2WNIA 5DOVA 2QM8A 1DAGA 4ZODA 3H3XA 1M7HA 3UT6A 2ES4A 2DRIA 2VBIA 4PNEA 2GXSA 4C4XA 1PJRA 3ZHRA 4M7OA 5EMLA 1PYDA 3AH8A 1SO8A 1ZJYA 2G6TA 2JBWA 2VF2A 5SV2A 1MX1A 1F12A 2J6HA 1GYPA 5CDFE 2C1EA 4PO3X 5DP2A 4A10A 3AR7A 1KHTA 4IDOA 1UBNA 3B9PA 3PFKA 2V6IA 1GOTA 1W59A 2FJPA 4H60A 2KW5A 3GLIA 3NOOA 5A06A 3CPEA 4K6HA 2I2XB 3GFOA 2V5UA 4BP3A 3RTEA 3LKDA 4ZREA 3NTLA 1V3VA 3UINC 4DZZA 3W8FA 1TM4E 1CQJA 1Q1ZA 4YRBA 2H2GA 4JOSA 2LUOA 2H00A 3DBHB 1OFTA 4O02B 1HDYA 3C2QA 3BZUA 4DI4A 3CSUA 2FFHA 5CB8A 1TNBA 3EDOA 1U1GA 3U3WA 1FFDA 3CHPA 1VJGA 2QX4A 4IP0A 1VYUA 3HUEA 2P6PA 2JI4A 2WK1A 2IYYA 4PG6A 4Y67A 5ANRB 2ZS8A 4B3RB 3B52X 1UDCA 2Z8ZA 3EMKA 2UYYA 1FP2A 3EGWA 1AQLA 4KRFA 2L6BA 3GOHA 1QG6A 2EDCA 3UM9A 1VMDA 3I5UA 3NH6A 5IU6A 5EQJB 1E62A 4TTAA 3X1JA 3R0ZA 4EWLA 3FOFC 1REQA 2OZEA 5JZBA 2XSZA 4UXHA 2D8AA 3QBDA 1RQGA 1ZI8A 2KLBA 2D1YA 1LW6E 2HRDA 4U2CA 4CCAA 3HBFA 1BG6A 2PZIA 2W0SA 2CCKA 5JJ7A 2FQQA 1XU4A 3IRVA 1Y5RA 5CLQA 3VV3A 4EVIA 2NV0A 2GEJA 2WXRA 3KYJB 1HRKA 5A23A 1YB6A 3DV0B 5LBTA 2YS7A 4FR2A 4EI8A 3D0OA 4MA0A 5TB5A 4BO5A 3GRUA 4V2IA 1UC9A 2VRNA 3F7NA 2OV8A 1SVMA 2FWMX 1HDOA 3IHWA 1P60A 4YJ3F 1ZRNA 3UAXA 2GWRA 3O94A 5E2AA 1ZNWA 3HPRA 3TX6A 1RRCA 3QY9A 1H9AA 4YNDA 5CMYA 5L6MB 3MMSA 3SZMA 1S2IA 5M29A 2R6GA 2YNMD 2Y2UA 3R75A 3AB7A 4O59O 2E4WA 5TE9A 2ZDHA 1U2PA 1VBKA 3HE3A 3QOFA 4JJEA 3F6QA 2BUGA 4YMVA 4YVFA 1QHSA 4W8HA 2PK3A 3WGIA 3PXAA 2B7LA 3AG6A 3BDIA 3JAWA 4GLFA 2HCFA 3QYJA 5ARDA 2KXPC 4C2BA 1R8YA 2XF2A 2ZIXB 1SXJA 2AOVA 3TG5A 1XNQB 1NMQA 1IC6A 4YALA 3F2VA 2ZS7A 2NX2A 3RASA 3IV7A 4C2TA 4ZV7A 3K96A 4R8KA 4WCVA 4FW8A 4L4YA 1EB8A 2PLWA 4X5OA 1A4UA 4MB6A 1JH8A 1VMKA 3C3AA 3GHYA 4PBSA 4D0LB 1JQKA 3AUUA 4YJHA 1NJFA 1CE8B 2HO5A 4OXYA 4MV6A 1KXZA 2XZTA 5L9AA 1BWSA 4ZICA 1E2BA 4ENWA 4I4TB 1H2RS 3QKRB 2JFNA 2NO4A 2VEOA 4MV0A 2WBLC 2I34A 1I2AA 1YQGA 3A26A 1B43A 3ZCSA 2QAIA 1FDWA 5KC9A 4L76A 3F74A 5FOXA 4HH4A 2XGJA 3EUEA 2O0KA 1QTIA 3AB8A 3LQYA 2ZUEA 3HXKA 1E2UA 1NRXA 4D45A 2GHTA 4YUZA 4L8LA 1AKRA 1GFWA 3JQEA 1AM4D 1BWRA 2DSTA 4P32A 4GLOA 1BGXT 4BFWA 2H1FA 3LNTA 3L84A 5JYDA 2FF5A 3DSUA 5MN4A 2W4MA 1GIAA 4OOEA 4E46A 1V4NA 3ONKA 2C9CA 2PBLA 3IUNA 3SWWA 4ZAWA 6REQB 4BFLA 4TM8A 4C89A 1Y6GA 2EFYA 4P3PA 3THSA 3L0DA 2XYHA 4PS3A 5KOJB 1R5BA 4KMOA 4E21A 2O05A 4WEQA 1WXDA 3PJRA 2ZBDA 3DTVB 2XGSA 3TG8A 1WETA 3AM5A 1SAYA 5EUBA 4QUGA 3D4PA 5HK9A 2Y6UA 3WL5A 1YRBA 3VUFA 4HRLA 1H6CA 3BZWA 4JPSA 2WVHA 4EB6B 3HXOA 2WA1A 2QZSA 4IKPA 1CUJA 4Q03A 3NBNB 1D03A 1LTQA 1I0ZA 2YC2C 3M6UA 4QXRA 2GM3A 4YRZA 1Y3BE 4AURA 3KEZA 3AEZA 4O6VA 2JJ1D 5IKMA 4O2RA 3FNHA 3AR9A 1Z73A 4EGSA 1HE3A 3QX8A 4JBXA 4B34A 5BSRA 4UDYX 2GZ3A 5GIPE 3U9TA 2XZDA 1IK6A 3EF0A 4YRFA 1DC6A 1TNOA 3QVGA 4H3KB 5HMLA 3QLUA 5NLLA 1ZK0A 1JR4A 4NDZA 5FXMA 5FPPA 1B3RA 2XNCA 4K9OA 3I4GA 4BMSA 5JXIA 2ZPUA 2DMRA 4I2NA 1MFZA 4JKOA 4NBKA 3HVEB 5P21A 2G4VA 5EWJA 4N2QA 1Y1QA 3JTMA 2NIPA 1X8KA 4R40A 3BEDA 5C5DA 2W2QA 3DO8A 5C8XA 1DWOA 1XMJA 3QPWA 1Y6QA 1XDSA 4D8XA 4X1IA 4URVR 1DRKA 4QHTA 3BN3A 1QS0B 1TGYA 4EH1A 2QA5A 5ERGB 5AHOA 2IYWA 3JZDA 1G8YA 2FWJA 5C32A 1OA1A 2GO1A 1OQAA 1DTWB 4DLZA 5CNMA 5KKCA 3S7JA 3SHWA 3VR4D 4B3SB 4BTEA 3VR3A 1UADA 1JBEA 5B5SA 4WACA 3PDIB 4N54A 4LFBB 3OI7A 2AXZA 3ORYA 1DIBA 1GGEA 4CLRB 4BXOB 1EDBA 1L7RA 2WLTA 2Z2ZA 1GRNA 1A2OA 1WDTA 5DWVA 4G23A 4CKWB 1VKJA 5ILQA 2J3KA 3O92A 4TRJA 3CRNA 2Z1MA 2JRCA 3OZAA 3CRZA 3ZLJA 5IK2D 1SXIA 4C7OB 3EWNA 1FRFS 2JS7A 3X1KA 1WUJS 1KDVA 3VNQA 4L9WA 2WU4A 4GPIB 1YC2A 2HA4A 4XASA 2UZIR 3EZ2A 3SM9A 3FYTA 5KTMA 1X1DA 4B85A 3HEMA 2P35A 2RH9B 4AZTA 1P1HA 4HVAA 3PRZA 2FXIA 4RD4A 3IQXA 4HXEB 1DCMA 4S1PA 1XMSA 4PYQA 4KVAA 3UKUG 3BFXA 1FS5A 2JABA 1G8JA 5C37A 1PW5A 5EY5B 2IITA 1TC1A 1RCFA 2EP7A 4DCCA 3SHOA 2WOOA 4GPBA 4JL8A 1V7CA 2ZIVB 4JNKA 4S1OA 1N2IA 1GG2A 3BMQB 2I2BA 1E79D 2GT1A 4IHKA 4EAQA 3I9JA 4FJ2A 4DMGA 4KZ0A 1PWZA 4W63A 2OAQ1 3RSCA 2OQ2A 3W7VA 4WA7A 1RLMA 2CZCA 1P4JA 1SW6A 2EFGA 2QUZA 4CQLB 2QPOA 1U3FA 5T57A 2IS4A 1MQAA 2ODAA 3AHCA 4TXRA 3FBWA 1KO1A 1LXCA 5LMCA 1V5IA 3NHMA 4WDQA 3UAWA 2FAXA 3QQPA 3A6LA 3AP1A 2XJ4A 3SX0A 1IEVA 2PGDA 1Y82A 4DA7A 3SLGA 4J7AA 2H2HA 4BGEA 3LKUA 3OCVA 1YI8A 2GBLC 2QF7A 3TSZA 1TF2A 3GAAA 4I5EA 1BMTA 1JHRA 3DVAB 3RCBA 1R27A 4UD6A 2FPIB 4N47A 1ZIXA 2X5NA 1CYDA 4J0GA 4D80A 1SRRA 1XCMA 5I5EA 5ALMA 2DXIA 4N1AA 3H6GA 1RP1A 13PKA 5JU6A 2GRJA 1IJBA 3T7KA 5KINB 3LCMA 2ZRAA 1ZM9A 3F3KA 3FG9A 3RI3A 3PRHA 2FV8A 4QPNA 5D0QD 3SFTA 3VOBA 4PDXA 2WU1A 1NV9A 4NPHA 1RM5A 2WW8A 2GRLA 1CUZA 3B6EA 3HSYA 1NUAA 5AVXA 5EHZA 4ZCLA 2W70A 4N3BA 2WHYA 4M38A 3KEFA 3LHFA 1J8QA 3HV0A 5CXUA 3NHRA 2BSQA 5L40A 3LI2A 3ET5A 4GYJA 1USUA 2B21A 5EJ7A 4PYJA 4I9CA 3EDRA 1NPYA 2A9FA 1P91A 2ZI9A 3CN9A 1HT3A 4R9UC 3FEYA 1Q0PA 2FMIA 1YGPA 3CF6R 1YO6A 1VB3A 1SWVA 4RLHA 3LT5A 3OSUA 4BBZA 5HRCA 2CYCA 5K0CA 3G68A 4R1PA 4HX5A 2HY7A 2A2ZA 3U7GA 2PUJA 3VHRA 4IF6A 2FRXA 4EY8A 2Q9CA 1PT5A 2EG5A 3EGDA 1KZOA 3FRJA 3ZOZA 3ZDAA 3PJDA 1TL7C 2X9QA 5K0BA 4Q9JA 4BWVA 3P9RA 4RTOA 5M3BA 4F5DA 3SX2A 2SECE 2DYRE 4MWTA 1UBJS 5IANA 1QTNA 4TL6A 1LDYA 3ULYA 2J87A 5DM0A 4AN4A 3G17A 2AE2A 1O95D 3FHTA 3W5AA 2JA2A 1NOIA 3U48A 2YQZA 5ITVA 3DSVA 3HUDA 3LG2A 1M6YA 4QWWA 5JI3E 4KFCA 5I7WA 1GAQA 3HN6A 1NI4A 1DUSA 4ILIA 4BP9A 3D54D 2OHXA 1N11A 4XIYA 3EQZA 1C3EA 4AK9A 3SFXA 4LHWA 4PFKA 2H0RA 2UXCB 3P96A 1NKSA 5JWRA 2E49A 4DSUA 3PG5A 5JD4A 1UDWA 3VVLA 3G2OA 1UJ2A 4DCTA 4IIDA 3O73A 5EJ6A 1HFWA 2GYUA 4Q18A 4W8OA 2BE7A 3PRJA 4NU0A 4Q3LA 2DBAA 3V1TC 2QMQA 4OMCA 3ESLA 1N33B 1UMCA 2J45A 4LOJA 3OPNA 4R1UA 2IF0A 4RTLA 4Q3AA 4UE3S 3TR6A 1K5DA 2O3TA 1M1NB 3Q73A 2GBLA 1W49A 3UMSA 2ADFA 2MCFA 2ONCA 4ATGA 1CJKC 4G25A 3P9NA 2PSJA 3DAFA 3SN6A 3SQNA 2M63A 1JVSA 4TQGA 3SLKA 1EF1C 3VTAA 3R9XB 5F78A 4JS0A 2OXEA 3D4IA 2IZ6A 1ZNYA 5LWQA 1K2WA 5F2KA 1G3QA 3A6FA 2NP6A 1R10A 3A04A 4OEHA 2AVDA 1CQWA 4YMHA 4HB4A 2W2PA 1LX6A 1HUQA 3GX1A 4BKMA 3NBKA 4MW0A 3DT6A 4M7CA 3I2KA 3SZRA 1NUTA 5AM2A 2Z2JA 3ED5A 3D59A 1NI1A 4G8DA 5E6UA 5KU1A 3OIWA 4DIMA 5CM8B 2IPNA 4UHCA 4G1FA 1GCUA 3JVIA 2G8NA 1XKQA 2QENA 2VHJA 1CZOA 4XB1A 5EXSA 2GN4A 1VGRA 3L7JA 1G9XA 3IT0A 4DLSA 1U8ZA 1M0SA 2XEVA 5LCWC 4BQSA 4MA4A 4J49A 2NSZA 3S5UA 3C4QA 3ZZ0A 3CISA 1XDBA 2XOXA 3IOYA 5H83A 4DGQA 1BFUA 1DAHA 3SHVA 4WDRA 3GGDA 3KS9A 3BOSA 3QKWA 2AHRA 1GR0A 1TVMA 3BORA 3G59A 5HILA 2PE5A 1MB2A 3TRDA 1JFFA 3SJAA 3RVDA 3UATA 4RKEA 4DT1B 3VDQA 2P75A 1UDRA 4RA6A 4QARA 5IS2A 3BTSA 2Y1CA 1V1RA 2YMPA 2YWRA 3FCSB 3V1MA 1JWLA 4NX2A 3PEYA 2HTFA 1SQGA 1DRUA 3OPQA 1OGIA 1JJ7A 2NQTA 5KJMA 3WVNA 4X20B 3C1TA 3PQDA 3TBFA 1YE3A 4HUQB 2JVJA 4GL4A 2HQBA 3MCZA 1XEFA 4MUHA 4OQXA 1BS1A 1U9JA 4OL9A 1G2IA 3EFOA 1CZNA 1ADYA 5SZIA 1Z37A 4C48B 3WYDA 4DDVA 2CLLB 5BOVA 1RBZA 1P2FA 3B6JA 2YOHA 1I5EA 2GPJA 2HQSA 5B1EA 5ANLA 4QGFA 5I45A 3DR5A 4V24A 4JLJA 4PN3A 1CUGA 3JATB 1NQVA 3OA2A 4JVMA 1SWWA 3HDTA 4NS1A 1YTUA 4ZARA 4RVUA 2Y1DA 4LNUA 3WL6A 1JKIA 3HCAA 2RHMA 4GXNA 3NCTA 4ZTBA 1CERA 2Y0PA 1Y8CA 1IZZA 1TD9A 3OQ1A 3A6JA 3N6XA 3NIBA 4LSWA 1KK0A 5EZSA 1EGQA 4B6RA 5D01A 3ZZUA 2VP5A 4EIWA 4JB0A 3IIJA 3G8BA 4G4SO 1TKBA 2X5JO 1Q91A 2XHZA 3EQ8A 4R9SA 1MJGA 1NSFA 4BQIA 1WO8A 4GE0A 4F5YA 3JQQA 1R16A 3I9LA 4JDPA 3VZDA 5K20A 4FOSA 4AMVA 1ECCA 5T7BA 3C7CB 3CO0S 4BZZA 3FYUB 4ESOA 4D9CA 1WVGA 2BEJA 3V7YA 2QD1A 2J08A 2WA2A 4OMDA 5CUQA 1H8EA 2IV7A 3W3AH 2V97A 3WS7A 3F6EX 3UAZA 2JD0A 3R9WA 4RG6A 1SH7A 3TIIA 3INTA 4HLCA 4PGHA 1H2YA 3OU7A 3K70C 1T3ZA 2GCNA 2I71A 5FNVB 2AMVA 3GUZA 4FW9A 2QTNA 4GX2A 2YOGA 2EDAA 2P9GA 4N6GA 3ZHEA 3E5HA 1GADO 3AVTA 4TN1A 4ZYYA 2CFUA 1CNEA 5JQGA 2NO6A 4GWKA 5TPWB 2OCCE 3DYIA 3ZDFA 1NN3A 1YBVA 2FB9A 2D1TA 1RRPA 3MYYA 5CMWA 2WQ6A 1EQ2A 1CB0A 2OXCA 4DDWA 4J2OA 2I4MA 3LT4A 1TCBA 5G02A 3W9YA 2E9SA 4B75A 3OKAA 1Z7GA 2GJAA 1W6UA 5G2OA 4B5KA 2CHUA 2TYSB 5LYJF 3H4TA 4O4LF 4RMHA 4PHHA 3NTXA 4EG8A 5ENVA 3SBSA 1A9XB 3PEVA 4WLVA 3SD7A 3Q1KA 5IYZA 2E2EA 1Y9EA 3RRNB 4QYWA 4XVUA 2I67A 1VPVA 3BXFA 1RRKA 4OXRA 1DV1A 3P2KA 2PSSA 4JZKA 2Q0SA 4OB6A 3A36A 4W1PA 2HB6A 4PV7A 5EQDA 3RLIA 1GKKA 4MUNA 5AK4A 1V6SA 2PWAA 1XXLA 1U2VG 2X40A 3HJHA 2ERXA 5KYWB 4RPCA 3GLFB 5EMHA 3S55A 2ETVA 3RT9A 2X13A 3RFCA 2ZJBA 2LUHA 3QITA 1H85A 2KE5A 3CE9A 2CMDA 4X90A 3DNPA 1QQ7A 3EB9A 5HIAA 4CVNA 4N7BA 2O54A 4Z9FA 4HK4A 3NW9A 4CYMD 2ORIA 4MI3A 4UHEA 4RS4A 2JARA 2ZYVX 1SC1A 2QQFA 4ZK6A 3LL4A 4EA6A 4KHZA 2W2LA 3O8QB 2HJGA 1SA0A 3UHPA 3R7WB 2K87A 2V59A 3QEJA 4N9WA 1PT8A 2O19A 5JBNA 4RELA 3RC2A 5CNIA 3RSQA 3KR0A 2OVBA 1QR2A 4B09A 3OXFA 4MVJE 4U0JA 1NIJA 3VZCA 5A2QA 3NIDB 2FI1A 5D5HA 5CB0A 4R5MA 5KDDA 3W77A 3TZEA 4XQCA 2C95A 3CPSA 1IHDA 1OFGA 1XTZA 1W5FA 3H2HA 3IHTA 2M1ZA 2VJMA 7MHTA 2Z6VA 2EKQA 3COVA 4C7XA 2X38A 3GXBA 3N59A 4HPWA 5EIWA 4GYKA 1DIGA 2AVNA 1NWCA 3QAQA 3HCPA 2ZM6B 4QOFA 2DHCA 5EKSA 5LCXA 1MP0A 5BYAA 2IU3A 2IL1A 1QC5A 3E5MA 3ACCA 1IQ0A 4HLDA 1EUDA 4RVBA 4L5AA 5JECA 2Z1DA 5BN1A 2GBIA 4AY4A 1YRQA 4J3JA 4XIGS 3A4YA 5HF8A 4F53A 2DJIA 3O9ZA 2C57A 3L54A 3V1UA 1O0SA 3DV2A 9ATCA 3JR3A 1QHGA 1UBTS 4L5JA 2E4ZA 2IS2A 1A4XA 5DSZA 3PHIA 4HNQA 2DVWA 3K4QA 3QUSA 3B82A 1LS6A 3K4HA 4W5WA 4H4CA 4IGFA 4LYFA 3R4VA 4X24A 2QW1A 3NRBA 1H42A 3PFBA 5IRCD 2DU8A 3EAGA 4A6XA 3AIIA 4P4SA 3AR3A 3JARA 1ELRA 3LMKA 2QMHA 5INTA 2A88A 2CK3A 4C7MA 1PNRA 3BX1A 1VQ1A 2YHEA 4WK4B 3G6KA 3AL0C 5CB4F 2WHEA 4RTRA 1J0DA 1TLLA 2X8LA 5K2OA 3T95A 1G21A 3PD7A 2Y93A 3E1GA 2W42A 3DL2A 4CGVA 3JALB 1Q11A 1LDGA 1PNQA 4DCUA 3COZA 3QU2A 1RZUA 5ERXA 5BSWA 4PAOA 4ZO9A 2Z5VA 4OBBA 3VH1A 3EHEA 1MYOA 3GUHA 1E32A 2I7DA 3I73A 3CT6A 4ZOAA 1E58A 4ABTA 2ZB8A 4UZSA 4CE6A 4E6PA 2QRLA 4OI1A 2A9RA 5H4HA 2NLOA 2IHTA 2Y3IA 4HNAB 4E5PA 1N4SA 2XCIA 3OA0A 4NCKA 1YZYA 4C20A 2YIDA 1G16A 1HDXA 1DC5A 1WPRA 1X74A 4NYMQ 4UUQA 5AKLA 4ZJYA 4BO0A 4HEJA 3PL5A 3IJ5A 5CYFA 2GO7A 2LKDA 2ZJZA 1S4QA 4DIDA 4HOTA 1OXVA 2YIMA 3L8ZA 1KI6B 3I1JA 1DQYA 1LLUA 4PC3A 2P2ZA 4FYYA 4CMIB 3GLQA 5FL7D 1GD1O 1N1EA 4IS3A 1D2CA 2GF9A 1MMFB 3ADPA 2F3SA 4AIRA 3EU5A 4F92B 1PC2A 1C3OA 5LQMA 3ADDA 2R02A 1E9BA 1Y7LA 1O1RA 2G28A 1LBQA 4RY8A 5IAEA 3ZTTA 1ZMOA 1XZBA 4DYDA 3AIOA 3UH0A 1X13A 1NLFA 5DGXA 1NL3A 3IDQA 1DHRA 5BVHA 4XFJA 4BKOA 1UF9A 3MJVA 4V39A 3L6CA 5FF9A 2P9SG 3KQOA 3CLRD 3AM4A 1UBMS 3VV2A 2FPMA 4PRLA 3G9ZA 3ZDEA 1RHKA 1DEAA 4EG3A 3QHQA 4JBWA 1QO7A 4GMXA 3WMFA 1ATZA 1E5TA 1DCKA 1N2BA 4QJ4A 2D5CA 1JQ3A 2HZ7A 1UZMA 3DMRA 4HDRB 5C31A 3P0JA 1IOZA 2I33A 3BUSA 3TJPA 1PTJC 5DCLA 3A28A 3L04A 2G9QA 5U4QA 3H5WA 3IMCA 1C50A 2XRMA 4U5QA 3B8HA 5ALXA 3TVYA 3SOPA 1I4TD 1N5JA 1JDBB 3DB1A 5C81A 1A1VA 3M4ZA 1KZ7B 1ZDMA 2GJ8A 1WKBA 1UN8A 2QAGC 1Z83A 2EKPA 4W99A 5KVQA 5AYWD 3VNUA 1DIAA 3WWYA 1VIYA 2NUAA 1FPPA