3FY4A

(6-4) photolyase crystal structure
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
522
structure length
522
Chain Sequence
GSGSLIWFRKGLRVHDNPALEYASKGSEFMYPVFVIDPHYMESDPSAFSPGSSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQEWKVKRLCFEYDTDPYYQALDVKVKDYASSTGVEVFSPVSHTLFNPAHIIEKNGGKPPLSYQSFLKVAGEPSCAKSELVMSYSSLPPIGDIGNLGISEVPSLEELGYKDDEQADWTPFRGGESEALKRLTKSISDKAWVANFEKPKGDPSAFLKPATTVMSPYLKFGCLSSRYFYQCLQNIYKDVKKHTSPPVSLLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMVQLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQFNRIYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIVGKDYPKPMVLHDSASKECKRKMGEAYALNKKMDGKVDEENLRDLRRKLQKDEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords 6-4 photolyase
publication title Functional motifs in the (6-4) photolyase crystal structure make a comparative framework for DNA repair photolyases and clock cryptochromes.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 190
structure length 522
sequence length 522
chains with identical sequence B, C
ec nomenclature ec 4.1.99.13: (6-4)DNA photolyase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 3fy4A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3fy4A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fy4A01
1M8PA 2HGZA 4DLPA 4MWEA 4F3RA 1Q77A 1I6KA 5H16A 3ZJUA 4MAFA 2J09A 5KCMA 1I6LA 2D5BA 1Q15A 1Y42X 1EFVA 4ND6A 2A84A 2YWCA 3TQOA 1GTRA 2H29A 4QRDA 1N75A 2PFSA 3MXTA 3N8HA 4MW9A 4EG8A 5DB4A 4YP6A 4R2MA 4NZPA 2CV2A 2AKEA 4YP5A 1WQ3A 2NSYA 2E0IA 1WXIA 3P0IA 4JXZA 3CVVA 1A8HA 2YXNA 2WB2A 2GM3A 3H97A 1JMVA 3AG6A 1JIJA 1I2DA 1KQOA 3ZGZA 4G5FA 1U3CA 1JIIA 3SZ3A 3VU8A 2H2AA 1QTQA 4MUFA 4DJAA 3CLTD 2I1LA 2DXIA 3H99A 3RBAA 2PZAA 2X1LA 4MW7A 1M1ZA 3PNYA 2ZP1A 3N2YA 1KQPA 2OV4A 1YUMA 1NUQA 1EUQA 4EF6A 4ZT7A 1MAWA 4MUEA 3HGMA 3UY4A 4G5YA 3CVYA 2JAXA 1OWPA 2CUZA 2CYBA 3MLBA 4MULA 4U8HA 2QTRA 3HV0A 1F9AA 3H9BA 3ELBA 4RPIA 1ZH0A 3RK0A 4MW4A 1TEZA 3RJZA 1N2BA 3DO8A 4E1AA 2GKSA 2Z08A 3RFFA 1MAUA 1ZJWA 4OUDB 4CQNA 4FZJA 3C8ZA 4RUKA 2ZUEA 4PY2A 4CT0A 1S4MA 1TFUA 1K92A 1IVSA 3OP1A 1KR2A 1PG0A 1D2RA 4MUJA 1WXFA 4MUIA 1OWOA 1NZJA 4KPUB 1T9GS 4ARCA 1IQ0A 3TZLA 1ULHA 2Z09A 2XRYA 2QUIA 3KT8A 3GMIA 1WZ2A 2X0KA 4MW0A 1O0CA 2E89A 3SP1A 1FFYA 1U0BB 4PBSA 1KKUA 1O97C 1EJ2A 3SDBA 3L93A 4EG5A 4HPWA 5DASA 4I6JA 3HFJA 2AG6A 3CLSC 1O94C 5K0SA 4MW1A 3I05A 5FO0A 3KT3A 4OUDA 4CDMA 1ZH6A 4S1OA 3H9CA 4EG3A 3COVA 1J1UA 1P7PA 4OJMX 4HJXA 1U7XA 3ND6A 1O96B 1QNFA 4KPUA 5KWVA 1T6ZA 1VLHA 1MB2A 2BTEA 3VGJA 3ZJTA 1IFXA 1O5TA 3UMVA 1NYLA 4EFKA 1TQ8A 1TYBE 1ZUNA 3FY4A 3KT0A 4PBTA 3COWA 2D13A 1K97A 4TS1A 4DDHA 1XNHA 1LI7A 4NAHA 1H3EA 3N9IA 3PNVA 4JYZA 1M8FA 3AFHA 1J21A 3N05A 2DLCX 3CLRC 5TEWA 4EG1A 1RQGA 4CDNA 1ILEA 1JEDA 1Q19A 2J5BA 3SEZA 1V8FA 1K4MA 2VTBB 3VRHA 1EFPA 3HZRA 3MMXA 3JXEA 3ILVA 4MWBA 3LOQA 1PFYA 3QTTA 2VXOA 4ZT3A 3IMGA 1NI5A 5BNZA 1TYCA 3Q4GA 1O96A 2Z3VA 3KT6A 3LCJA 3MLAA 4KKVA 2AZXA 1O0BA 4I6GA 3AIIA 1QU3A 1KP2A 2DR2A 3X1MA 1N2IA 1XNGA 2V0CA 3IMEA 1QRUA 1N2JA 1WXHA 4HJRA 2HZ7A 2J07A 4BWVA 3IMCA 4EGAA 2OQ2A 2PG3A 3ISJA 1T6XA 1JHDA 4MUNA 3CVWA 2E18A 3AL0C 5IJXA 4MW5A 1MRZA 3PRHA 2A7XA 4DE5A 1WY5A 4R2LA 2VTBA 3QE4A 3E27A 2E21A 4JXXA 4ZT5A 2YY5A 4ZT2A 1XJQA 2A88A 1JEEA 1N3LA 1OWNA 2D54A 1WOYA 3IOBA 3CA8A 5LFAA 3FHJA 2GOYA 4ZT6A 1WXGA 3MUEA 3DLAA 4MQ6A 1QU2A 1NUSA 1G8HA 1V47A 1WXEA 3U1VA 3IODA 3HL4A 1G8GA 4EG4A 3INNA 1Q11A 4J75A 1JGTA 1WQ4A 1M8KA 1T6YA 2CT8A 4DDKA 3FWKA 3SZGA 2A1TR 5J58A 4ARIA 3KFLA 1O97D 4WNYA 5TEVA 2QUJA 3IDFA 1JECA 5J5AA 2DETA 4KR6A 4ZCRA 3CLSD 4MUGA 4WSOA 4MWDA 1XNJA 4K0RA 5LLTA 4YMIA 4A91A 1MOPA 2A1UB 3G59A 1GTSA 4ZCPA 1N1DA 3TZEA 2O8VA 1IQUA 1IQRA 3Q10A 3CR8A 2RD2A 1T9GR 3A2KA 1YIAA 3RHSA 3IVGA 3D6VA 1OWLA 4MWCA 1VBKA 1PFVA 2QUHA 3COZA 4MVCA 1O95C 5DK4A 4ZCSA 2DEUA 4MW6A 2IJGX 2DUMA 2WSIA 4DDMA 3IVXA 1GAXA 1LW7A 3TNJA 4MLPA 1UFVA 1PG2A 4MVXA 4XSVA 1VL2A 1G8FA 3ZXSA 3G5AA 3IH5A 1U3DA 2G36A 4DNXA 1VBNA 3H05A 1G59A 1IH8A 3DV2A 2QTMA 1H3FA 4EG6A 1QRTA 1N78A 2A1UA 1F7UA 1PFWA 4ZT4A 4H3SA 4L2IB 3TS1A 1F7VA 3D6UA 1H3NA 1OD6A 3GUZA 3FH0A 1JIKA 2ZUFA 3TQIA 2PIDA 4KR7A 2WQ7A 4Q93A 1KAMA 4MVYA 2DPLA 4Q16A 3FI0A 3IUEA 1VBMA 1QQTA 4JZYA 1X6VA 2EJCA 4NX2A 4XFJA 5TGTA 1K4KA 1PFUA 1KH2A 2EL7A 4NDAA 1X8XA 2CYCA 4YBRA 3P0HA 3RK1A 1J09A 3K32A 1N2EA 3SYTA 4JFAA 1R6XA 3X1JA 3ND7A 2XRZA 1R6TA 3CLUC 3P0JA 2DERA 3P52A 5HUHA 1MJHA 1JILA 2QJTA 3PXUA 1B6TA 2A86A 3ND5A 1F4LA 4L2IA 2CV0A 5H7XA 2CV1A 1DNPA 1KH1A 3GLVA 3FNRA 3LE8A 4QBTA 1M83A 2HMAA 3A4IA 4KR9A 4AQ7A 5KHAA 1KAQA 3F3MA 1TYDE 4X0EA 2NZ2A 1IHOA 2JA2A 3CVXA 3ZUGA 4ZCTA 4UZEA 3NV7A 5F23A 1U7DA 4G6ZA 2QJOA 1FYDA 1MBZA 4R0NA 1KQNA 1GPMA 1N77A 3A04A 1J70A 1N2OA 3NBAA 4ZCQA 2B7LA 5HUJA 3QTBA 1BS2A 1YULA 3Q12A 2CFOA 2CSXA 1KORA 4UZFA 1I6MA 5AHWA 1M8GA 4U63A 5JBNA 1IRXA 3K9WA 1OWMA 1QRSA 1EUYA 2TS1A 3FG9A 5LM3A 1KH3A 1MC1A 3X1KA 1HYBA 3FDXA 4U7JA 2IP1A 3ZJVA 3BL5A 1GN8A 4I6EA 3UC5A 5HG0A 1YUNA 1JZSA 3FETA 1QJCA 1NSYA 4MUHA 3CLTC 4J76A 3AKZA 4MW2A 2A1TS 1O94D 3IOCA 3OTWA 1N2GA 1O6BA 3A05A 3SEQA 2R5WA 4NATA 2PZBA 1R6UA 3UK2A 2V0GA 3IUBA 2PXHA 4MUKA 1O95D 2QJFA 1N2HA 4P2BA 4MVWA 1NP7A 3CVUA 3ZXIA 1EXDA 3IVCA 2BYTA 4PBRA 1NUTA 5TS2A 3UOWA 1GZUA 2QUKA 2X1MA 2A4MA 2PZ8A 1LI5A 1MB9A 1NUPA 1OBHA 3FIUA 2J08A 5K0TA 2JANA 1NURA 3HMQA 2C5SA 2X3FA 1J20A 4AS1A 3FOCA 1SURA 1YIDA 3M5WA 1WKBA 3G6KA 3COYA 1JZQA 4EG7A 5FNZA 4GU5A 4F4HA 3L92A 1GLNA 1H1TA 1EFVB 5FO1A 3CLRD 2CYAA 1WJGA 1YI8A 2O5RA 3DPIA 1KP3A 3PNBA 1OBCA 1COZA 1CT9A 4HK4A 4GRIA 4XFDA 4QREA 2WQ6A 4YP7A 3ZIUA 3AG5A 1J1ZA 3IOEA 1EFPB 4NAUA 2J4DA 4K03A 1NUUA 1TYAE 2QTNA 5IHXA 3S3TA 2RE8A 3CLUD 1M8JA 4ND7A 3NBKA 5J59A 2YWBA 2IELA 5DEOA 5EKDA 1EE1A
chains in the Genus database with same CATH superfamily
2P6RA 2PT5A 4PZLA 4WX2B 4DIUA 5BXQC 2XNCA 4WZ6A 3WLQA 5LPNA 4DR5B 2WM9B 3H3FA 4CGVA 4JJEA 3CRZA 4RTOA 3FUTA 3EODA 1UZNA 1WXIA 4DR4B 1JN0A 1VHDA 1ZKMA 5CJ2A 3GY0A 2H31A 3N8KA 3TXMA 4FGZA 4MUFA 4TSFA 4RQUA 4B7XA 1XTVA 4HNAB 2FI7A 1QYXA 5IC6A 2FDCA 5DBFA 3SXPA 5AHXA 2G4LA 3RREA 2ZCVA 1DARA 3DOCA 4RUKA 4OHXA 4RVGA 1KOLA 3N0XA 2QKYA 1P17A 1KR2A 4AOFA 1X19A 5CDFE 3E3NA 1LQ2A 1U6IA 3WK9A 1U0BB 1FVHA 2PRSA 1R0RE 2DMRA 4FNGA 1CEEA 4I9UA 2J4CA 4G37A 4W6ZA 1PCXA 4I08A 4O1OA 1KU0A 4Q48A 3A9SA 1AHNA 4EJ0A 3SY2A 3PITA 2RHJA 1CUIA 1LBHA 3S2IA 3FPLA 1KJQA 2UYOA 5C1DA 4N8SA 1KWKA 4DA8A 3KJXA 3AS8A 1YQWA 3BD9A 5JZ9A 2PUCA 4GOKA 3M33A 1NW6A 2WFLA 1EIZA 2FCAA 2EU8A 3OTGA 3G0HA 3WHIA 2WVAA 2GO1A 4HLUA 3G7UA 3D7LA 3NHLA 5AXAA 4BTEA 3HBFA 5CFLA 3FLMA 3RIXA 5A6SB 2OEPA 3DZKA 3KLPX 2J07A 5KNHD 1CJKC 5FL7A 2JJQA 2E18A 4OLFA 2PPVA 2DZNA 1NC1A 1BOFA 1DC7A 3FCSB 4M8SA 2PRZA 3R0QA 3MPOA 1Q21A 1R37A 3F2IA 1S63A 1T6YA 3VUFA 2RB4A 5I45A 2QP9X 4HTFB 4X1YB 3G5UA 3I5MA 5JRDS 5BSWA 1GILA 3L7JA 1HORA 3NHFA 1A8PA 3CUUA 1OAKA 1WCXA 2QK4A 2PWYA 3P0EA 1YOVA 1A76A 2RHCA 1YZKA 5EX0A 4B82A 1G8FA 3K96A 1UUFA 4AMGA 1V8PA 4GTRA 3O0DA 4AB1A 4AQYB 1QRTA 1BHSA 3OTIA 2NPIA 3R3JA 3FPSA 2WF5A 2C2KA 4LX0A 3GUZA 3KTAA 3H5TA 2GYUA 5DX0A 2X0EA 1KH2A 2J9YB 1AGYA 2MINB 4Z0HO 4PR0A 1DQRA 3PD1A 3A2MA 4A82A 2VLBA 3O4JA 2B5WA 4CKCB 4HC4A 2ZT7A 1WSWA 2LBPA 5F64A 5H7XA 1JWAB 4LQCA 1JIQA 5ENDA 5CTAA 4U00A 4GYYA 4LVUA 4O4HF 2W2PA 3C85A 3QE0A 5L9AA 3MWLA 5KTKA 2WU8A 1GDDA 1TL7C 3OESA 1N1MA 5IU6A 1RQRA 3FG9A 3BGOS 3I12A 2H18A 4M1WA 1S70B 5I9IA 2OCLA 1FFXB 3GAFA 3EGXA 3TIVA 3H2IA 4BN0A 4QHYA 5K0FA 5IAGA 3OZTA 3ENKA 5D3MA 2YXLA 5KAPA 4JI7B 4NFSA 4KE7A 2WAMA 4AZ0A 3B7BA 3QBEA 2A33A 3MOIA 2O54A 4Q4JA 3TL2A 1SK8A 3I0NA 2ERXA 5BPHA 5KJ1A 4XB1A 3HMQA 6YASA 1HNWB 1Q91A 4EPVA 4NARA 1NBMA 3PEUA 3TF5A 1Q3HA 4IG9A 5HF6A 1V8DA 1KP3A 4UPVA 1EDUA 1BWRA 3IV0A 3W8NA 3GRKA 3B51X 4CMIA 4BQNA 5BSHA 1IZ9A 4U0KA 2WVJA 3V32A 1WXDA 3OZGA 2EBWA 3MF4A 2VYVD 1WD5A 3ZBUA 3QPUA 3TIGA 1VE9A 4HI0E 4L7VA 3HU1A 3E9RA 1QHIA 3ZWAA 3CQ9A 4PC2A 1AF7A 3ENEA 4JN6B 2ORYA 3L02A 2IHZA 4IDFA 2O3QA 4J6IA 4PO3X 3FUDA 5ALMA 1SKQA 4QWMA 3KXPA 3BE8A 1RZ3A 4F3VA 4QM6A 3O31A 1Z5VA 1GQOA 1B3RA 3CUSA 3OD1A 4JODA 1TD9A 4RL6A 2FSSA 1Z6PA 1EUQA 3SQWA 4KXVA 3UY4A 3A6HA 2VCHA 5LCWJ 4MINA 4DQKA 4KOAA 4EKIA 3LSTA 3AH8A 4YRDA 3BL8A 1V2HE 3SDSA 3AFNA 4OSPA 2DWZA 4Q7JB 3B5JA 4JC4A 4GBMA 2C77A 3I1IA 2JIBA 4FCTA 3GZJA 1U28A 4LGCA 2HSWA 4Q3CA 4BATA 4HBDA 3AR7A 4B73A 1XJ0A 2X5XA 4Q18A 2LXNA 2DHEA 4PGFA 1GPYA 1ZNXA 1Z5SC 4O6VA 2D0OB 1ULAA 4YJHB 5EMHA 3IDZA 5U9CA 1EVZA 3NBYC 3FHCB 2RFMA 3A6FA 1FBNA 3S2EA 4L75A 4ANWA 4C7OB 4NC9A 1AHPA 3L6BA 4GXRA 5JJLA 4LHXA 4RF3A 5C37A 1PJZA 3IAFA 2CLHB 3GA0A 3OSZA 3HHMA 3WGLA 3L4EA 5LVAA 3SG0A 5FOWA 2G9ZA 2AWNA 2XUHA 3HUEA 3JQ1A 3CB4A 3ILVA 5ALJA 4N3CA 5LMNB 4B3FX 3V1MA 4ZVSA 3B5EA 3C3YA 1DPFA 3OLWA 1YJQA 1TAHA 4P4LA 2DWOA 3PHHA 3VKGA 2I2FA 3ZDFA 1G8MA 2O8EB 2XQVA 3GAAA 1K6XA 1KZYC 5AW9A 4HEHA 1GFSA 1US8B 5EP3A 3U1VA 5CD9A 4L0DA 4HNTA 2ONCA 4RA6B 3G3EA 3RVPA 5BVHB 5ENRD 4TL7A 4QAQA 1GU7A 3W6OA 3PXDA 4NPCA 1WMBA 3L0OA 1OLUB 4BO4A 2R4QA 1OCZE 3ZR4B 5F3WB 3CH5A 1BXZA 4QLBA 1Z4JA 1TADA 2EIKE 4U7EB 1JU9A 3TLZA 1BHQ1 4IDEA 3GLSA 5CDYA 3NPAA 4RQIA 1LVHA 4ZAWA 2EBUA 3TUJC 5IANA 4PHGA 5ITVA 1FJ2A 4NG5A 3F9RA 3UAYA 3UICA 4NFLA 1MIOA 1P77A 4D5EA 3BB3A 1IN1A 2CLLB 4TOIA 3QPBA 2CZGA 4WDQA 1P1IA 1XZEA 5JNLA 4DWVA 3ABOB 3U0BA 1K4KA 3IT2A 4PQFA 3A9CA 1Z7WA 3O0TA 1BA2A 1NZFA 4IHJA 1O03A 2ZYWX 1SHKA 4O0LA 2OZPA 5E6RB 4YJ2F 1B14A 1R0XA 4CFYA 1A9SA 3DBVO 2BUBA 4IGIA 2QFCA 4ZPJA 4RHUA 4FPXA 3TOSA 2KSQA 4G86A 4JHRA 4LSZE 2JGMA 5KHAA 1DAPA 3PENA 1K3FA 1E9FA 4URVR 4Z7OB 2IYTA 4NS4A 4FYXA 621PA 3EASA 2BFEB 1BX3A 5E8RA 4XEHA 4X1IB 3D02A 3DL4A 3ZQKA 4GM4A 1Y7IA 1Q14A 1Z34A 3X1KA 1XEWX 5A3JA 3PDJA 3GQBA 4PIPA 4RV4A 2XEEA 3H0KA 4L5JA 3HUFA 4LRYA 4NATA 5ERGB 1CFZA 4MGKR 1NSTA 1IC6A 1BI7B 3IFSA 1WB6A 4KK4A 1QP0A 1VE6A 3EISA 5AOVA 1KZPA 4GPTA 3W6PA 2Y0EA 2ACKA 5E3HA 3RUDA 3KR1A 4GSKA 2COUA 5D8DA 3OA0A 2HO1A 2OO5C 1JYEA 1GT6A 1RCTE 4NCKA 1K3TA 2UU9B 5KOHB 5GONA 3GVPA 4QFVA 3EEOA 4GOOD 1B16A 4MICA 3FHTA 3CNHA 2IFUA 4D5GA 1LPSA 5CM8B 4XCXA 4PXYA 3VZCA 4F04A 3GVCA 2JIZA 1W1WA 1ML4A 4MPRA 5KO2A 3F4KA 4KXLA 1KEUA 3NBZC 2NX2A 2C99A 3D64A 5FBVB 3PA6A 1TJFA 3AVOA 4P54A 3OOEA 1N9GA 1RNLA 5H80A 3OLVA 5JAIA 2ODEA 1EINA 1TA0A 4IDGA 3CUVA 1NR1A 2FZGA 3ZGZA 2PFKA 4CM9D 1A5AB 2QLFA 2OBMA 4WEQA 3DFFA 4UI9C 1VL8A 2WFZA 1IXRC 2M6KA 4RANA 4PO1A 3SSAA 1EHIA 4D3FA 2B36A 2QMHA 1CS0A 2J9FB 4NCJA 3H65A 5EMMA 3F9CA 2CLSA 5FBRB 4QGBA 4U8HA 4MHSA 4O60A 1W4CA 8ADHA 1NL3A 5JDCA 1GAQA 1JQLB 2QNRA 3M6FA 3QVXA 2ACVA 1XCBA 1UMBB 4QXPA 3SVLA 1OCCE 3NM5A 3TWOA 3DTYA 4K2AA 1HUQA 3VOAA 5T4YA 4C0KA 5DNVA 2C20A 1HTTA 1UFKA 4FXPA 2EZ4A 5EJMA 2WOJA 1FMLA 3GRUA 2DH5A 4JHLA 3OM1A 5F2KA 2G0AA 3M2PA 5G4KA 1FS6A 1DCQA 5ALVA 4C4ZA 1LTHR 5ITZF 3QVWA 1F4VA 1DC6A 2EBFX 4YFYA 2BGGA 1O8CA 2Q3CA 3N5KA 3NFRA 4Z6KA 1PJ3A 2C5GA 4RH1A 3EA5A 3D9HA 4YRTA 5AQBA 5AYVA 1UPXA 2GUWA 2DPGA 3DEFA 4JOSA 3F90A 1EPUA 3I73A 1J21A 4Z86A 1VI5A 3FPFA 5EIBE 2HPHA 2WQZA 4ZT3A 1P7ZA 1XAHA 1DTSA 5MFPA 2X42A 1V5GA 3VISA 3IPAA 3H7AA 1P19A 3LO8A 4DIEA 2Q28A 2QI9C 3UM9A 2EKQA 3ZFWA 5JADA 2AJCA 3OO1A 2EX0A 1D9SA 1P0FA 3KHTA 3W9UA 4CI9A 4Y9RA 3I28A 3IKLA 5MDHA 1HETA 2I3DA 2QTAA 4XIYA 2VVTA 1LJLA 4RGYA 2QRLA 1Z37A 4JD5A 4HRXA 1OI2A 3DEYX 5TQVA 2Z5VA 2AN4A 2J87A 2P2NA 2YINA 3FFXA 2EFDB 2Z04A 2VI5A 3PZRA 4JWKA 2F0YA 4CDGA 2OLEA 5K05A 3SS7X 2IW1A 3MGBA 5LP6B 4DJDC 5LWQA 1WO8A 1H1LA 3FOFC 3K1AB 2J0SA 1JR3D 3P2IA 1S2IA 4JA9A 4MVCA 3CPHA 1JQEA 3H4MA 4AVYA 4MOWA 3SHQA 4Z2AA 4ZU3A 1YXMA 3ISMC 3H1AA 3OC0A 4JEMA 2PUAA 3FHOA 1KEVA 5BVGA 4RFSA 4JNKA 2IQIA 1ZJYA 4XR4A 3Q3GE 4FFVA 1TUEA 5TGTA 3VDXA 4AJKA 3QYJA 3EUEA 4REQA 4IIJF 1H85A 3I9NA 4PLYA 3L77A 2IS6A 4HWTA 2VGXA 2ZIEA 1XZCA 1V8ZA 3D54D 3UKUG 3UHPA 5CFZA 1M33A 4D9EA 1N5KA 4NE7A 3JD1A 3IQXA 1IHBA 1PAUA 2JI4A 4I8XA 1FPMA 4ZK2A 3HPQA 4OYYA 3ABME 2B1QA 2RC5A 4HRYA 1GZ6A 3KTFA 2F9LA 4UTXA 4F5YA 5MGBA 1FX1A 2IP1A 1I3LA 3WGJA 5F9FA 1DC4A 3DL7A 4FZ3A 1Z63A 1E1KA 5FI5A 5J2UA 4TYYA 2A58A 3GI1A 5EQDA 5BMVF 4L4UA 3OJ0A 2A5UA 3V2OA 3VAZA 5F52A 2KX7A 3KVVA 1SH7A 4BE9A 2NXNA 1M2VA 4PBRA 5AKGA 4KX5A 1SO8A 3ZD7A 5CEFA 3MYRA 1E6LA 2L69A 1MJ0A 3Q7TA 1RJFA 4D80A 4G1CA 4F8JA 2BHLA 3TL3A 2BFBB 1BHO1 4BN4A 3WYGA 1XQ9A 2ZYSA 1U81A 2ZUCA 2PKCA 4XFDA 2IEAA 2GR9A 3F96A 1ZBPA 3HXBA 4OQDA 3NYQA 4L27A 2OBLA 4NE2A 5CH5A 3ICWA 4MJLA 4YRBA 3M9WA 3ES9A 2JFXA 2FMUA 2Q50A 2CLFB 4HLCA 3ND8A 4N3BA 3NKVA 4UTNA 1SXJE 4MR8B 4YP6A 4EITA 4UD2A 1JCRA 1Z6XA 1JQDA 3NT5A 3U3ZA 2P9EA 2F90A 2VJLA 1I2DA 4EBAA 3K53A 2MT9A 2Q5OA 4QFCA 2FLWA 1LK5A 1DBWA 2GK6A 1KTIA 4D0NA 3TVYA 3L2OB 4B31A 1YQ9A 3MJEA 1CRPA 4II7A 2R7LA 3LQQA 3WMEA 5BOSB 3ED1A 5FR1A 2JHPA 3TO5A 2A9VA 3TRDA 4F3YA 1HLFA 4DMLA 3GLHA 4E5VA 1I32A 3MAJA 2UXCB 4HXEB 1ZI8A 1IVSA 1JQBA 1ZOPA 2X7HA 2D1TA 2VC2B 2XNKA 3MS4A 1PZNA 4UARA 4Y98A 1M10A 4XE5A 1XCOA 1XKLA 3ZKAA 3GRRA 4EVIA 2Q29A 3JQEA 3IPLA 4DSAA 3O38A 1DCKA 4RWEA 1EFLA 2E3JA 1LTXA 1CZRA 3DT9A 3ICPA 3KUXA 3FJ1A 4BSZB 4ABTA 4IRUB 2JHCA 4UWLA 3R7WB 5KCZA 2VJAA 1WOMA 1D2GA 3ZKWA 4GVLA 5P8WA 3DFIA 3UTCA 3NTOA 2ZS7A 6AT1A 1RFLA 3QOWA 2XZTA 1O89A 1GCOA 4QTXA 1NYQA 3D5EA 4B83A 2AFHA 4ZTUB 1CEXA 1NG1A 1NMYA 2X41A 2Y3IA 4OXKA 1X8LA 3HY3A 5KVCA 3LWZA 2JEYA 4D79A 2FSFA 5CM9C 1YBVA 2H7YA 1EVLA 2J6CA 1DXQA 2EIME 3IHVA 2IT1A 4OM8A 1JMYA 2CCKA 4TMVA 3LXXA 3BHJA 2VBIA 2IEBA 1S2LA 4F38A 1MRZA 3V30A 2VTBA 2ON6A 1C2TA 3Q9NA 2QN6A 3KSMA 2J3LA 3CA8A 2HRBA 1BU5A 2KQUA 2Z43A 4BO2A 3DD1A 2D3TA 3IHYA 1T0IA 1UM9A 4ARIA 3KFLA 2IBMA 3CLVA 4CV2A 4AX4A 1L4FA 1H42A 4Z51A 2JEKA 3ROQA 1RWOA 4CF5A 3G59A 1Y80A 4LHZA 4Y6LA 3BSFA 1PN3A 4OP2A 2BMDA 1G21A 4B3HA 3GD7A 5IBRA 4RM2A 4UOZA 5FYQA 5B37A 4HT3B 2WSBA 3MBIA 1KOFA 4XOIA 3C3RA 1K1EA 1CZUA 4MV6A 4QA9A 5EPEA 2QVZX 3WQQA 3DDSA 2FP4A 4W5TA 13PKA 2C0PA 5EXEA 1G59A 1WHTB 1YA0A 2HSDA 4WRRA 4NY1A 4DL9A 3MA0A 3F5SA 1GAWA 3HI4A 1FLVA 5KNBA 1T43A 3GN2A 4MS3A 4NLLA 5E9AA 5JNRA 1Z07A 3RFXA 1DXYA 5JS1A 4FOSA 1MO5A 1YKGA 2AJTA 2Z58A 4JA0A 2QTZA 2ABWA 1R66A 2O1SA 4UBMA 4C22A 5ALFA 4FB5A 4MDFA 1DOZA 4C6RA 1P73A 1KAQA 2OHJA 3EXFA 4GP7A 5BYBA 4CNBA 1BJRE 4UCFA 3AESB 1XVIA 1GNRA 4DR3B 3OIVA 4HXFB 3AXSA 2PHZA 1W5TA 4ZQCB 2R86A 4CLRA 3X43A 4JMPA 2MWMA 3ZE9A 3WO1A 3ZDDA 4CN8A 5H7PA 1H2RS 5E95A 5HHTA 2SKEA 3SQNA 3HVJA 2B4TO 4G1BA 5K0NA 3LXRA 4M0UA 3EFHA 3IKMB 3EQ9A 1TTPB 2Q7DA 4TQUS 3IO3A 4WXPA 1Y82A 3KL2A 3BXHA 3P4YA 3ESYA 2WXPA 4XJTA 1JAYA 1U7ZA 4FN4A 3VVMA 2QU8A 2EDCA 1OU4A 4F4HA 4YAOA 2DHCA 1VLZA 5A9RA 1NPDA 1L5GB 2F8XK 3K2IA 4JGIA 5BWLA 2ZTLA 3QUTA 3FE2A 4Z0NA 2EDAA 3NRJA 2ZW9A 3H5AA 3C3DA 4PGMA 1SUWA 2UY1B 1QYWA 2WTEA 1P91A 2F59A 2BFDA 2YOGA 4JUIA 5LYYA 4ND6A 1OLXB 2OQVA 3PXAA 1QDUA 3LJKA 1UT8A 4ZI7F 4L2YA 3KFVA 2VATA 1F8FA 5K1ZA 3ZU3A 4Q05A 1LDEA 4HDKA 2OGWA 2FK7A 3OM0A 3OZVA 4FGJA 5I47A 5DTQA 4I46A 3CW8X 4J8FA 4FFPA 1YB4A 5CH8A 4CPDA 3SD7A 5FTMA 3MTEA 4C7MA 1WIWA 2POCA 3OWHA 1GUZA 1R9NA 1LF0A 3DYIA 4DNOA 2CN1A 2G70A 1ISFA 4KPFC 3V3KA 3GLTA 2ORIA 1VTKA 1C9JA 4ARUA 4EZLA 1XL1A 1A7UA 3NDJA 4EHJA 4LY0A 2XBUA 2I2XB 3LIPA 1LVUA 1JSZA 2P9LG 4ZC1A 2JFNA 2B98A 4MB0A 2X0KA 4R81A 3HKCB 4WUTA 3E03A 5JAZA 3FFAA 2BEUA 5HCNA 3FYDA 3A10A 3RGWS 2QJWA 3T3MB 2JH8A 4CTNA 4R7ZA 3ML1A 1X74A 1JB1A 5K3BA 4MVJP 3RWBA 5LYJF 1XZPA 1KEEB 2ADFA 2FEKA 3P97A 4UEQA 3AY0A 3JQ9C 1M0EA 3U09A 4J7AA 4LZWA 2GBIA 1TKCA 5FPPA 2OA0A 1GZ4A 2IUTA 1IQPA 4OQNA 1VDYA 2ANBA 4R5HA 3G68A 2WJGA 1SCQA 4ATZD 3BFJA 3V42A 1SZ9A 1X2BA 5AKXA 4ND8A 3WTBA 3Q9SA 4AJ4A 2WXOA 3B1FA 4IO1A 4DN6A 1CY2A 4MNTA 1W4AA 4QYXA 4Q1VA 3ESKA 3AB7A 3PA8A 3RO7A 1JWBB 1VHWA 2C8LA 1HNXB 3FHJA 1QC5A 2MDTA 4P9NA 4XVCA 3PT9A 3ORHA 4JBXA 2CVOA 4F56A 4HOUA 1B1AA 4ZZ1A 4K87A 2JLCA 4YEDA 4MLZA 5H9WA 3D4OA 5K2MA 4R5MA 2NV2B 1UDXA 4Y6WA 1B73A 1YVRA 2F43A 3ETEA 4GCNA 1J8MF 4C89A 2WWYA 1GAXA 5JPIA 3R9XA 3WLNA 1W8DA 2HO4A 1RP1A 4BMCA 1IHXA 1YV9A 1W1UA 1OGJA 1ZK4A 2EX1A 1QVWA 3TNLA 1GM5A 4UFNA 4XYEA 1ZGGA 3GUHA 3R3WA 4FGWA 1BMDA 4F1SA 3CXUA 2IYEA 1X80B 2OD9A 4O4LF 4Y6GB 3A8TA 2HADA 2QVBA 3SYTA 4Z1MA 4EZJA 1M9NA 3GOQA 3NB0A 5HUHA 3K9FC 3T5CA 3HXFA 3R9IA 3N2ZB 5FINA 4QDXA 3RAUA 3B1JA 2VT2A 3SM3A 4O6FA 1OA1A 3OBBA 4GI1A 1WTAA 3QQPA 3T3DA 3FPHA 4FE7A 3OQVA 3VR2A 5D5PA 3UKOA 2C04A 1MTOA 1N6LA 4ZQIA 3MA5A 3OTWA 1V39A 3ZHUA 3NWOA 4CFSA 3HKEA 2VRCA 5AW2A 2FG5A 5BN4A 2VHVA 1HL3A 5CYFA 3EZ9A 3NAGA 2F8YA 1MB9A 4XIJA 1ESEA 2W58A 1VP3A 3RUAA 3KQOA 1E90A 2CZCA 2QY9A 1L5HA 3W3AA 5FTPA 2X6HA 3KLBA 5I48A 3ZTWA 2NUTA 1IJFA 1ISJA 4W9MC 3AG2E 1E3DA 3R41A 3T15A 3QUCA 4IYPA 1PF7E 2NSHA 4XLTA 3QKTA 3B70A 2IYUA 3CXRA 3LVFO 1JAXA 3W4KA 3EPLA 2IPLA 2JAWA 2FW1A 1N5RA 2VPXA 4FA6A 2Q4RA 4ABYA 5CJJA 4MUBA 3S28A 3VSCA 1P8JA 1RLOA 2ZWPA 3SZUA 1GZVA 2V4LA 2NSYA 3OF2A 1G7CA 3V31A 2ZS8A 5E38A 1WR8A 1TO1E 1LA2A 2XCLA 4YJDA 3BREA 4OVUA 4QSMA 1C0EA 2GCGA 3A3KA 5DM2A 1T4CA 1TJ4A 3LDZA 4ANVA 4Q4AB 2ZP1A 2AE1A 1DG9A 1AP7A 1BA3A 4FMCB 2FUG6 4KXKB 4YRNA 2IXDA 1H8HA 3DRAA 2XD9A 5C7LO 4TTRA 4MITA 1KMHB 2V6GA 4HH0A 5CG2A 4D9BA 2EARA 4BVJA 3AGPA 2ZUEA 2ZJ8A 4JLAA 3CRVA 3R5FA 2RAFA 4F6RA 4TS3A 3RJMA 1T9GS 3TCNA 3HR4A 2VZLA 2XTZA 1HURA 4MW0A 5AI6A 4GA1A 1EF1C 1EJ2A 5C7IO 5DASA 1OH7A 2VJDA 1I2AA 1PEYA 4RNCA 2IUFA 3IRVA 4MCAA 2JS7A 3CVQA 3PUZA 1MW8X 3SF8B 2ZKLA 3E3AA 3D5QA 1D2CA 2R25B 2WJVA 1Z2DA 3IDAA 4CKYA 1TQ8A 2CNBA 1OFUA 3UINC 1GRNA 2J3EA 1WHSB 1HE4A 3F2VA 5KINB 3B6MA 5K9ZA 2J5BA 1JG3A 4RSMA 2WINI 2PV7A 2HWXA 4KP7A 3M6WA 1ISMA 3BZBA 2EJBA 3AI2A 4BNKA 1WUJS 3H42B 1H2ZA 1ZJ4A 4TLLB 1P5ZB 2VAVA 3OJWA 4I8IA 3IMEA 4MQEA 4FLEA 4Q9AA 2DCUA 2RBEA 3GAMA 2A14A 3CVWA 5KYXA 3OH8A 4PG6A 4M0MA 1M6VB 5DW3A 1ABEA 1N2CA 1NW3A 1OTHA 4YONB 3F5DA 1YJCA 5F21A 2A35A 2FX2A 3FCCA 4TQ9A 3VNBA 4NBNA 1N1GA 2JLBA 6REQA 2AE2A 2NAFA 5AW0A 1HDXA 4Z5XA 5LQUA 4NEQA 5AUNB 3U4QB 1SQSA 4DXAA 2B5OA 4DI3A 2JGRA 1DAOA 4M0CA 4BMYA 4HUQA 4PR3A 3ZWPA 3H8VA 4O2BA 4NJOA 1C0IA 5G3YA 1L6IA 2H3EA 3QLVA 2X6RA 1FRFS 2RHWA 2AXQA 4S05A 4UM5A 3CHMA 1E79D 3G17A 5K4GA 4KAAA 3SMVA 2FRVA 1Y63A 2DR3A 1V55E 3B8EA 1TZ2A 3HFSA 3ZPJA 3L0BA 2ZSJA 1PFUA 3ER9A 2WMDA 2YJ3A 3E6AA 1T4BA 4M0FA 2OBFA 4YHBA 1ZGZA 4B3GA 1GNQA 1Z2CA 4ALJA 2AK3A 3T9BA 4ILKA 3RHTA 3T5VA 4KMOA 5CXSA 3KR0A 2KW5A 2R2GA 2BM0A 1ZD1A 4XQGA 1W25A 2H5JA 1XMQB 2BBOA 1KMIY 2ISSD 2FOLA 3RABA 4WN3A 2N47A 2Y6VA 1MC1A 3C70A 2RJOA 2IWHA 3CGGA 2CDBA 4IO0A 3FETA 4C4AA 3N0VA 2GVZC 3BG0B 5TMPA 4WY5A 4MVJH 4WADA 4RVFA 2IYYA 5TPWA 3AL3A 1F51E 5LIRA 3QU4A 3VHXB 4CQJA 2YNMA 1ND6A 3ENZA 5GM2A 2E2EA 4YAGA 2G1AA 3ZCRA 2F2TA 3UXGA 1VSVA 2YJ4A 4HNUA 4TZ0A 3H13A 2IU3A 3DQQA 1TK2A 4LXTA 2HA2A 4N7RA 3IAS1 1L4GA 1P60A 1Z6TA 3G5TA 1WKBA 1ORDA 3UOAB 1J39A 5J1SB 4NRDA 2O6HA 4ITRC 1PUXA 4EMUA 3DDWA 3U3OA 4JJIA 5F7XA 2JI8A 4G5HA 1QQ5A 2I2BA 2PX2A 1P5JA 4HFJA 4JVNA 3TIFA 2E4ZA 1AXGA 3OPYI 2OILA 3U1BA 4PCLA 5EYPA 2CNKA 1G98A 1RLTA 1DX6A 4YX9A 1ZJZA 3TQOA 3TNDA 3KE8A 4F5WA 5E6SB 4EG8A 2WKSA 1IN4A 4GRAA 3NHRA 3BFKA 2IS1A 1Q0LA 4QDKA 1P1KA 3VH2A 2QX4A 3VFDA 2G28A 2G82A 3J80A 2NU6A 1ZM3A 3ET5A 4GE0A 1QQAA 2XMPA 4Y6QA 1NOKA 3C7TA 1KQPA 4JB8A 4D81A 1SBHA 1UADA 4QYTA 3P7MA 3ANMA 1G38A 1R9JA 5GZ6A 3ZYLA 2VH1A 1F0KA 4OGKA 2JJ8A 3LGXA 1SHZA 3TWSA 4IXWA 1CRZA 1ZD3A 4DMFA 4TWZA 2EIJE 4IH9A 4OBEA 4CVNA 4WA7A 5TARA 3C1TA 2IVZA 3M1YA 5JCJD 5T8IA 2JJ2D 3W5BA 5LDDC 3FM9A 3CG0A 4NENB 2H16A 3Q8KA 4R2JA 2B61A 2H00A 1F2UB 2HMVA 4B47A 5T3UA 2P6MA 2HQSA 4H7HA 4I9GA 4JB2A 2PUGA 1ODKA 5TDHA 1NJ1A 5IKPA 4XYLA 3NBNB 2Y1FA 1SHJA 1KRWA 4OXXA 2A9FA 4CF6A 4UNPA 1M6HA 1YB6A 1ZNZA 2EINE 4I9NA 3EAGA 3KOOA 2XIQA 4D25A 3RRFA 4D4LA 1Y5IA 1QG2A 4DK5A 4JLWA 3V33A 4S12A 4KAJA 4UQXA 3E81A 3OXLA 3ADCA 2VN8A 2R60A 4C0MA 1QVAA 3H2YA 5IW8A 1TM1E 3HDYA 4TZKA 3TRHA 1KC1A 1K6MA 4DA7A 5LZ2A 1UBHS 5D1NA 3R4VA 4TM7A 1TK3A 2D3WA 5I4KA 2WMNA 1OKKD 1VE7A 4KR6A 3CF4G 3EZFA 2DQZA 1NASA 4BFXA 1JEQA 4INPA 1L5ZA 2HV8A 3EZGA 2FFAA 3V2IA 3QC1A 4QSHA 2GB4A 5DE3A 1P5HA 2PEYA 1V7QA 3KBBA 1U2ZA 3IT0A 1WG8A 4HVBA 2W2QA 4GA2A 3WB0A 2VQSA 3L6EA 1U3DA 3EAQA 1JFSA 5JH7F 2XHZA 4RIHA 1LY1A 4ZT4A 4E09A 2XGGA 5EHGA 3WIVA 5L3SB 2JGDB 5HYVA 1U8XX 4EGJA 5K8UA 3L82A 1LBQA 3F7NA 5DYNA 1WNFA 1RM4A 2WU3A 4ZV9A 4NQ0A 4BB6A 1LFAA 1JXQA 5DOZA 4RMIA 1TMYA 5BUCA 2GFHA 5TV2A 3SNHA 3T9DA 3AB8A 3K15A 3FCUB 2BGWA 4BKPA 1Q7BA 3ZEFA 1VLVA 5CU7A 3DXXA 3SZRA 1NYRA 2A67A 1VMDA 5KMGA 3AW8A 3QEOA 2VT3A 5F23A 3A9WA 2ID9A 3ORFA 3SSMA 1NDQA 1P9LA 4JLUA 5CT4A 4OXYA 5ALRA 5EWJA 3A4VA 3LAWA 2HLDD 1K7YA 1JHZA 3KYJB 4FT4A 5J47A 4FEYA 2UYCA 4DRXA 2AQIA 1MC5A 3VX4A 1MG5A 1XF1A 3RE1A 1Y3HA 4HQNA 4EJSC 3EEIA 2PM8A 2I7CA 2BBTA 1UWKA 2R02A 2C97A 5K8CA 4B6QA 3H2BA 2AW5A 4TZ6A 3THSA 1OFUX 2WXLA 1SFRA 2CDCA 3OPXA 2BTDA 3AMVA 1E8MA 3PQ4A 4B34A 3TSYA 4ZARA 1MO6A 3O8LA 2X4IA 4OYHA 4GLBA 2P30A 5G1OA 5EJEA 3WFZA 2KLBA 2WKPA 3B60A 3SC4A 1KJZA 1UDBA 4JVLA 4RY8A 2QN9A 4ESOA 1ENZA 2HW8A 3WC4A 1BXGB 4B3BA 3TBKA 1Q77A 5F1OA 3I61A 5AVWA 2J09A 2BEWB 3IESA 4OXQA 1U7WA 1SCJA 1MIHA 2QZZA 3DFKA 1L1RA 5LSAA 1QXSA 4IKOA 3CEQA 5CG1A 1GAJA 3TBHA 1D0SA 4LC9A 3AP2A 4EX7A 1JMVA 1ZO8A 1HH4A 3A6EA 4IUBS 2I22A 4PF1A 1ISRA 2X0RA 1BXKA 2PA3A 1UXKA 1OXUA 1JDNA 2OC4A 3CX4A 5AH0A 4O2AF 3WKBA 3TXAA 4ZHQF 5KEIA 3QPCA 3AK4A 3NHMA 1GCIA 2AS0A 4RPIA 4QHTA 4M3NA 4GKKB 4FP7A 3AOEC 5JZBA 5IJAA 1VHTA 4KZKA 2MSCB 3H04A 3IALA 3T1TA 1SXGA 2HA4A 3IO5A 2WIDA 3ILHA 4M4SA 2IZOA 3LJ3A 3N28A 3YASA 2LIPA 2WNHA 1LWOA 3EZYA 4ZVUA 3LI2A 4YNDA 5ALPA 1CETA 4NMLA 3PICA 4LVOA 1E2HA 1GPKA 3OD5A 1YOBA 2DTDA 3DJYA 1E60A 2FYTA 1RC8A 4MWSA 1GDTA 4RHXA 3KYDA 4BFSA 3HKBA 3EA4A 4JL8A 1KSGA 1Q16A 1NQTA 1THMA 2E4YA 2A57A 4KQWA 3X1YA 3HJBA 5EC8A 3K0CC 2GM4A 2IIQA 1SG0A 3B7SA 4R9SA 3TWXA 4B71A 5T7BA 5G04J 2JBAA 4L1BA 3QXHA 1JHVA 4L0MA 1H4SA 4Z2YA 1AQYA 5J1TB 4ZO9A 4DSTA 2LKCA 4YDSA 3R8XA 4EKYA 3PRKE 5BN5A 3AYZB 3ZY2A 4X20A 4AMVA 4RENA 5ED0A 2YUIA 2ZR9A 1H8ED 2BEKA 1KBZA 5DSTA 4P36A 3MQFA 1P6QA 3FYSA 3DZ8A 2QT1A 3RD5A 3KRTA 1TKAA 1TQ4A 1ZDMA 3HO1A 1KY4A 3LLSA 1CJCA 1F3OA 2HMTA 3D6VA 2GNOA 1CB0A 4CEJA 3EK2A 4JXJA 4C5AA 2X1VA 3KKNA 1YR3A 2C2XA 5AXCA 5CFNA 2FK8A 3KQTA 3KKKA 2GWRA 3C5VA 2AMLA 1YL5A 4QNNA 3KSDO 4AV7A 4KN5A 1PX2A 1PFWA 3PC4A 2X0IA 4UNNA 4GOND 1HZ4A 4F7WA 2ECOA 3DGEC 3KKMA 3H83A 1ETUA 2J0EA 2BI4A 4D0GA 2FWMX 3PDNA 5JTUA 3FUHA 2WSSA 4BQSA 3DGFC 4QODA 2NV6A 3DKVA 1CR2A 1YMVA 1UKZA 2ETBA 3S7BA 3T54A 2E4XA 4EYGA 3T0FA 4YFVA 1X9HA 2X5KO 1DUVG 3E18A 3ESRA 3C7DB 2BONA 5BV2P 4BCBA 1X7ZA 4B43A 2ZRGA 1KDOA 4HQ0A 1P0QA 4AL4A 4R4JA 4ERNA 2AZMA 1WTCA 3QNKA 3FRIA 1M5TA 1UBFA 5EHNA 4D3YA 1XA0A 1U0RA 1YHZA 4BB0A 4YVOA 2V3CC 5I7FA 3ZV5A 3TJRA 1B76A 2QOEA 3GW4A 4YALA 3G2PA 3VHRA 2XOKA 3ESCA 3E5MA 3BAZA 1MA3A 2BHSA 3WNZA 3QXJA 5A9SA 1E62A 5IX8A 4YO7A 4UE2A 4IFEA 4Q02A 2VK8A 5KNCA 4CG3A 4G5OA 1H23A 2QN8A 3VR0A 3HCAA 3GB9A 4E4TA 4NAUA 1TZKA 5AO9A 3SHVA 2OHIA 2I2WA 2ZULA 5E7QA 5KOYA 1NT2A 5L4NA 3RV3A 3JALA 3DHWC 3WGUA 3PVCA 3EQ7A 3I39X 3E9QA 5HIKA 3DS8A 1INLA 3L1KA 4EEKA 4WKNA 5HW0A 4UM9D 3SNXA 3VQTA 2MHKA 3KFXA 3FCAA 1RKBA 3I1FA 4P7FA 1CZOA 1IN5A 3TI7A 3GYBA 4G1FA 4CIBA 2BM1A 1SU7A 1GZ3A 5C18A 5D87A 2NTEA 4QG3A 1DI0A 1PSZA 2W5UA 2Y2UA 1JU4A 2DPXA 1OV6A 1NVDA 3DMPA 1Z2OX 3OLXA 1R6AA 3MWJA 4UXIA 3KQVA 2YWHA 3IP8A 1OAOA 5ES3A 5BUZA 4OP1A 3L6CA 3F49S 5ARFA 3MD0A 5A3SA 3U4AA 4CV0A 2J4FA 3HKDB 2WXFA 2GZ3A 2PLAA 2I6FA 3QIVA 1QS0A 3QVTA 3GPDG 1L5MA 3FUFA 5ALDA 4UEKA 3QBVA 4GPAA 3KT3A 9LDBA 1Q2XA 2V8OA 1ZH6A 3SY8A 3OPVA 4EI2A 2XYRA 1JG6A 1TJ3A 4Z0TA 2PZJA 4EQZA 5DRYA 4G2TA 5AVYA 3GARA 5CBPB 3WZ2A 4P7BA 1E7RA 2NG1A 3N39C 3ZJTA 3QFRA 4M46A 4KGDA 4ZOBA 2H4XA 5B1SA 3CPSA 3IQGX 1Y1SA 2AKYA 3KQSA 3CLRC 3MYYA 5FPKA 1DLJA 1KBOA 1R8XA 4KVFA 4BV8A 2VHXA 3EIQC 1PJTA 1MT3A 2ZI6A 2RHLA 3MLAA 3KLOA 3DPYA 1UMDA 2PGOA 5C35A 5IWCA 5K8LA 1OAAA 2CL6X 4AYXA 2AW6A 3TLKA 1QHHA 5KZMB 5JW6A 1JDVA 3DZJA 4LNUA 1TM5E 2IP4A 4GOJA 3AS5A 1XZJA 5G55A 2UYYA 2C5BA 5E1BA 3UCEA 2BP7B 2XT0A 4CYMA 1JGTA 1V16B 1V3TA 4OCZA 2EF0A 1JECA 1O5OA 3NJRA 1XU4A 3ZHEA 1L5VA 3DF7A 1PVVA 4B3MB 1W35A 3U66A 4L4YA 4CJXA 5IK2A 2QTFA 1LBTA 1M2EA 1PT5A 5DHAA 3FOWA 5FB3A 4QVKA 2GN1A 1PQYA 1RYZA 1NC3A 2X6IA 4CDRA 5KWIA 4B40A 2C5EA 3QVGA 5DBOA 1XAGA 4XZ4A 2DIWA 8AT1A 4D4KA 3VV3A 1VP9A 4O4JB 4RETA 1BN6A 3PPXA 3BL6A 3L79A 4MX8A 4R2IA 1I10A 3AG3E 4D8UA 5TT0A 3MTDA 2V59A 4QAJA 5H02A 3L84A 5KTMA 3ANLA 5E2BA 2BUAA 2CFTA 3QWVA 3DBLA 3RS4A 5TR9A 4QC2A 3L8MA 1VG8A 3D8SA 4JJAA 1KHHA 3HJRA 1S8OA 3F98A 1TYDE 3ZUGA 1HBJA 4E70A 4PIMA 1C5KA 4UHBA 5JDIA 4A8JC 4JQOA 2YASA 4LXXA 2O06A 4ENTA 4ENWA 1NVTA 1UPFA 3PYMA 1ZVJA 1XDDA 4K9MA 5SY9A 1DG1G 1ZL0A 1Z82A 1W36D 2JLYA 1MOQA 1NHWA 2HV9A 2I3AA 3AWDA 1A96A 2PJUA 2BJHA 3AR9A 1YB5A 1A77A 2IZ7A 1TXGA 4J0EA 1YA8A 2V7XA 3NUQA 3BIXA 1N6KA 2EW8A 4ALNA 1YU9A 4KACA 1CCWA 4CM7A 3RYFA 4LW8A 1SGWA 5JPCA 3FVQA 3M5PA 3KK0A 3E7PA 1MDFA 2NU7A 1JVNA 4GRIA 3PRYA 3RVMA 1SUEA 4R1TA 1R64A 4FLFA 5IMSA 1EWVA 1C9YA 3LT1A 2I55A 1FX0B 1XELA 2HK9A 3RFCA 1PWYE 2HMUA 1Y42X 4WCVA 1E2NA 2B4AA 5CTJA 5IKEA 3H16A 3OECA 3PZ2A 2QNIA 3B7PA 5DB4A 1WPXA 1KIMA 2ZJ1A 1KT0A 2FEXA 3OCWA 4PYQA 2XB6A 1N36B 4TKLA 2H92A 1NU6A 5IWAB 4BAZA 1SVIA 3U5ZB 5J3JA 2JAUA 2ZVDA 1M1ZA 4XLLA 1YB7A 1NJGA 3RF6A 1X1TA 3U4IA 2PSHA 1S0UA 2W2XA 4KLRA 4WASA 5I6DA 4G0VA 1SIUA 1SBTA 1RWMA 4ZHBA 3VR6A 4N7BA 1KY2A 1EWRA 5DBHX 3K8ZA 2Q41A 1P4JA 1XFAA 2JGJA 1I2ZA 4PSAA 4R1SA 1O0CA 3SP1A 4BX9A 1KS9A 3N3BC 3FSGD 1Y8ZA 1ADYA 1Q12A 4EHMA 4PZAA 1CRWG 4TT3D 5A0FA 4NU6A 2ZSHA 4PS1A 3O48A 3K0AA 4CR7A 4ZK6A 4HLLA 2AEEA 1IYZA 4UQLA 1MOSA 4IWXA 1XPJA 3QX3A 2GRUA 5HA5A 4R1NA 1VE1A 1LWNA 4DV1B 3TFOA 2UVQA 4HDRB 4NU8X 2A9OA 4QEKA 2OCGA 4DHWA 2QLMA 2VDPB 3NP7A 1PUJA 2UZAA 4B6PA 3BE5A 3I4LA 4I4LA 1L5WA 4DCJA 1S02A 4Q3EA 5KYYA 1U02A 3TTTA 2YKGA 3IX7A 4P4TA 3GBSA 1QZ3A 4NMMA 3NAZA 4CCYA 3EXHB 4ZVPA 2HK7A 3ASUA 1X1AA 1N6RA 5E2IA 4B6SA 5JTTA 3SBSA 4IXTA 4Y6SA 2DETA 2AG0A 1T5LA 4ZEXA 1L8AA 1V6SA 4XTRA 1SXJD 1NBME 4QUEA 2FWAA 2VOEA 2VQ2A 4RF4A 5B2FA 3STUA 1UEJA 4HYEA 4GPBA 1ZRNA 2XUGA 1V48A 3SIXA 2DUMA 1K2VN 5DTJA 1Q0QA 3I2KA 3O84A 3AVYA 1UPBA 2C9CA 1JIVA 2W22A 4H4CA 4JT4A 3ZX4A 3KB6A 3B3FA 4EA6A 4Q9DA 3HEAA 4A3VA 2BHNA 5D2CA 3LMKA 1F2TA 1V2GA 4B8AA 1N52A 4R7TA 4B35A 1U8EA 2ORWA 3C7AA 3GN1A 3DWEX 3L07A 1NDHA 2C1EA 4BOYA 4C0SA 2A86A 3GL9A 3K8YA 2JEZA 4XX0A 2CV1A 4US1R 1NF2A 2GK7A 3KSAC 3U7GA 3F3MA 4MYUA 5LD2C 3GFFA 4ZCTA 2W6QA 3I1JA 4H31A 1CP3A 1RAGA 3WGOA 1YJAA 3WQSB 1HA3A 4Y8VA 4PTYA 3AEQB 5AKLA 2JFFA 3O4IA 4DMHA 1WZEA 2IZZA 3CF2A 5G0UA 2IP2A 5CT5A 4AJ1A 5AVKA 1QGAA 4KQ1A 3CBGA 4MW2A 1IPHA 5EE5B 4QO7A 1FVOA 2ZISA 1EGQA 2WSMA 2XWSA 1N5DA 1XROA 4NH0A 4LSMA 2BE9A 4FUQA 3HE3A 3KQUA 2VEOA 5IUKC 4CKEA 3KS9A 3RAJA 4DIBA 4EW3A 4I9CA 4IJWA 3MLEA 3U4DA 4M8NE 5TF0A 3OUUA 1DJPA 3WDLA 3NEPX 1Y5LA 2K2QB 1G9SA 1AUQA 4KW7A 1JL3A 2QVXX 1U1DA 1WCIB 5K4AA 2G1KA 3BRWA 1AK9A 2V7EA 2V4HC 4UREA 4B3SB 3EMBA 2D8AA 4W9NC 1BIFA 4DLPA 2BSQA 2IFTA 3Q87B 3ZY4A 3SBOA 5F3DA 2PN1A 3AI7A 2LSVA 4UU7A 1W0JA 2XTAA 1U31A 4ZRNA 3ESQA 5H3LA 1P2VA 3FWPA 1P61B 2XENA 4I43A 4LTDA 5EJ4A 4DLZA 4NFHA 4DCOA 4F2DA 5AJTA 1XR3A 4RL4A 4Q9KA 3BFPA 3HCEA 4ZJZA 1X7WB 2I7XA 5CLGA 2FMIA 2CFCA 5LQAA 3T6KA 3QUQA 1B26A 3KZKA 3MB8A 2PKRA 1ZD5A 3OQMA 4KTTE 3JAKA 1S4MA 3P9XA 2CNWA 3UJAA 4LSWA 3S2FA 5BW8A 1YC2A 1W5AA 4OAQA 4NU0A 3F47A 3IGFA 4B2PA 4BV9A 2QE7D 1QBQA 3GH3A 1FW8A 1II8A 1VIAA 3FKSD 4JL0A 3ITNA 2UZ1B 3JXIA 3SFXA 1XZNA 4QD3A 1ORHA 4QQFA 1U7HA 2QM7A 5ADVA 3DXFA 4DPMA 5EWLB 3VGJA 3R3XA 3DBRA 2OCPA 1CJVC 3UB4A 5BV1A 4D99A 3FTVA 2V3WA 5KBAA 4GLJA 3L6AA 4J8SA 1M8FA 1PGPA 2GGFA 3AKEA 1XAJA 4ROTA 3FUJA 4WZZA 2H2DA 2WJ4A 4IVPA 1NLMA 2VXOA 3BD8A 1D6MA 3ZE6A 4UUMA 3E35A 4M7PA 2ZT5A 4HRMB 3V8PA 1D8AA 3HEMA 3V6LA 1FNBA 2D2IA 3VAAA 1FU7A 1JDSA 3PLNA 2O2JA 2FB9A 1NW5A 1JG1A 4HPXB 5KNCH 4LXQA 1EVQA 2KBXA 5B5SA 3HB5X 2M63A 4G8KA 3KB2A 1A5SB 1PNVA 1ORTA 1BX0A 2J6IA 4J0HA 4INJA 1DQSA 2OHVA 4KH0A 2C07A 2YMLA 1UWLA 1PZGA 2Q6VA 1HO8A 4WMLA 4PPNA 1F0PA 2H4ZA 2VFAA 3PVZA 3TR5A 3RAPR 1D0VA 4KZ0A 2EW1A 1VHJA 3QU7A 1W0KA 4DDMA 4LERA 1YZQA 3VNUA 3ZIMA 4PHCA 3FTEA 4S0XA 3DPSA 1RZRA 4R9VA 1A5BB 5CNMA 4AC9A 3E2IA 2DFLA 3LLVA 1NXVA 1HSZA 1YZGA 2PIDA 1LD8A 5CXQA 4RH3A 3FSRA 3FDFA 2JFYA 3LLCA 2R0QC 3LCCA 3LS2A 4J0CA 5LXTA 1QV7A 5JAPA 3KKOA 2FHPA 5C8DA 2OO5A 4ZYLA 4KO8A 4GL2A 5JUWA 4LCBA 4MVJM 1J8VA 3FU5A 1IVNA 3OJLA 2CWDA 1Y89A 1MORA 1TNUA 3OE4A 1FFHA 1LLDA 4TYWA 3PNMA 1JG2A 4JXKA 4BP9A 4G6ZA 5C3MA 3P9ZA 3A6GA 3KO8A 4EABA 2QL9A 4GF5A 2YQ8A 4KVOA 1JKIA 5TQ2B 1VMAA 4NI5A 4DR2B 3L6RA 3U3KA 1KYVA 1S0PA 1O1SA 4PX9A 3N7TA 1CY0A 3CK9A 1QPBA 4MGIR 4U7JA 5ISMA 4PTZA 2BFNA 1J90A 3KZNA 1KFEB 6NULA 3L0SA 2F1IA 5DN6D 3DV0A 1JT9A 3I09A 1RZUA 3PGVA 1HF8A 1HE5A 2R3SA 5LJLA 4Z3OA 5AM2A 1KJ9A 4PPYA 1GZUA 3EVFA 4R1LA 2GM5A 1OH6A 5K0JA 2O0KA 1XCPA 3N2GB 2E5LB 2GBCA 3H6HA 1I4OA 3DPIA 1EDDA 5ALNA 1Z68A 2HSZA 4IIEA 3AP3A 4MA5A 2IA5A 1FP1D 5JXIA 3KTDA 2FLKA 3VJMA 1GA1A 1KAOA 5DK6A 5ALUA 2PNFA 2PBRA 4Q1EA 2OGZA 1CUAA 1E1RD 4HNAD 1EBFA 2B8WA 1K66A 1CR0A 2QD4A 1TFRA 1N75A 5ABPA 1ZSYA 3FBWA 1HEYA 4E5KA 4ZHSA 2YZ2A 3CTMA 3EUFA 3LT0A 2ZQ5A 2HX1A 5H1YA 5LIPA 3AXTA 3NI2A 2EP8A 4DDUA 4G41A 4DUZB 4A2CA 2B4RO 1L3BA 4WT7A 2AVNA 5FLKA 5DH9A 5IJWA 3RYCA 3O1IC 3FH5A 1AGXA 1DDOA 2JD1A 2VHJA 2Z83A 3EZXA 1JHPA 4LZNA 3E32A 2PAAA 3RK0A 2M6LA 1N2BA 1BDMA 4PFKA 3E9ZA 1JYFA 2B20A 3NTVA 4JLSA 2FKAA 2Y1DA 4UFPA 4RVHA 1AA6A 3KYBA 1W85A 1BJTA 3U3RA 4P3YA 4Z4EA 3NBMA 5HI7A 3LQKA 2CMKA 2XUOA 2Y0DA 5KYNA 3CLSC 3SC3A 1E1DA 3P2EA 4EG3A 2BCGY 3DYBA 4EAQA 1BDBA 3WDSA 2XS8A 1SELA 3X2QE 4ESHA 2G9UA 2ZR7A 3W06A 3RYHB 3EDCA 1SD5A 2FZLA 5EX3A 2QUZA 2R8XA 2AQHA 4MUXA 4JYZA 2B8JA 1RHMA 4N2SA 4TXMA 4X9XA 3TUZC 1QMGA 2OXCA 3QG5A 4J4TA 4ILEA 1N9KA 4EYQA 5BW5A 3RI3A 3N2LA 3SPXA 5B3LA 5B12A 3ZY5A 3IP5A 3QFHA 5CA1F 5KYGA 3IPXA 2W83A 3VYTB 1CY6A 4PICA 2OGTA 1SKMA 2NT3A 2PMWB 4YV2A 3WO0A 3PU6A 4D1YA 1UC5B 1X13A 1Z5PA 5JECA 5LFAA 1WL8A 1IPFA 1U6JA 2RGEA 2DY1A 4G0QA 1E9VA 4JQYA 1UJ4A 2ZZNA 1YOVB 1E6EA 4UCQA 2ZYGA 3T52A 4JLOA 3RS7A 4Y2JA 4KIUA 1SCDA 2ZUUA 5GQSA 5GV7A 1JDBB 1E58A 3R5JA 3N8NA 3E58A 4GEGA 1WSDA 1SKAA 3CSDA 4EJFA 3KTAB 4DCPA 1T8YA 1V5EA 4J6EA 2PMKA 4OHWA 3QVVA 5FUBA 1Y9AA 1VL6A 1W3BA 2NUPA 4J4HA 1E2PA 2HAEA 3KSLA 4UNSA 3DMNA 2Q7OE 2ADMA 4RJTA 3A1SA 4CLOA 1SVMA 1NUAA 4US2R 3FTCA 1PL8A 3WMRA 2WQ7A 4WY2A 2BLNA 1VFPA 5K0LA 1XKQA 5AW5A 1CEQA 3QVJA 3ZYKA 4DHEA 2FFRA 1E0SA 4AY5A 4R2XA 5FA8A 4W5OA 2YOFA 2XYGA 5CMYA 3EARA 3FNRA 3NHWA 4XGQA 3R6LA 3EGXB 1LXCA 1PDOA 5D3MB 5IF3A 2XF8A 1LK7A 1OB2A 1NMSA 1E0KA 1QGYA 3GLHE 4QUGA 4AZ0B 4U7TB 3JWHA 4JUAA 1QRSA 2K87A 4TN5A 1MPTA 2CNLA 4EGQA 3GK3A 2YY6A 1K7EB 3EIFA 4EP1A 4IFTA 1UOEA 4KBGA 2D06A 4CCWA 5LNK1 3ME5A 3PEUB 3IJEB 4HOQA 4AG6A 5EJAA 2Z98A 1MXHA 1U8FO 3TPFA 1QTRA 2JIQA 3WHLA 4BO8A 4CMIB 3C3PA 2QLNA 1W1IA 3WP0A 2C4MA 1E3LA 3TZBA 2X3FA 1NDUA 4U2GA 1PE0A 4MVJE 3CISA 3H0EA 5IABA 5JO9A 4G84A 3BTUA 4LBZA 4BCDA 1WJGA 3W9BA 1E3MA 2Y6UA 2YC4C 2G07A 3OAAA 5EGNA 1T15A 2NYVA 2RHGB 2AFHE 3DEKA 2BWJA 2VDLB 1YI0A 3GELA 3DKKA 4EKGA 2BM8A 1FFBA 1H2HA 3MQ4A 1JFVA 3WSWA 2HH9A 3R3YA 1S2OA 3FGPA 2NZJA 2VQEB 5K03A 3P4UA 3NLLA 4WINA 1LSUA 3Q7EA 1N7GA 2J3DA 2HU7A 2FG7C 1H19A 1SBCA 3Q7RA 1GLVA 4D9FA 2IPOA 3TZ6A 1RMTA 3WWEA 2XBMA 4WNDA 2ZUDA 3GNSA 3AEXA 4B32A 3K2QA 2UZ3A 3EEYA 3MJVA 2PJDA 4LTMA 5CP8A 4ARZB 5AOCA 4P5DA 4ENSA 2EYUA 1TNYA 3JAWA 3EWNA 2E82A 2CLEB 1G21E 3O8BA 4ETNA 4U9HS 2NO4A 1COWA 1PR2A 3DXMG 1N8KA 1VCIA 2JHFA 1EHCA 1E2MA 5DRTA 4HGOA 4IKPA 3UJCA 3WRXC 4KPGA 4B7CA 4IVRA 1JBKA 4NQRA 2PD6A 2B35A 2ECPA 2FN3A 3VNQA 1OIXA 2JFGA 3RVRA 2ZRQA 3H9CA 1N95A 3MT9A 2Q45A 2JH9A 2NSLA 1II9A 2GD0A 1T0PA 1Z38A 5EAIA 3Q9LA 2D0PB 2WUVA 1YS6A 2EGHA 5T4BA 3RT9A 3O7WA 2C7RA 2B6HA 1M1UA 3DM9B 1KAGA 4J43A 5EVJA 3SKXA 4GPMA 2FH5B 1LUAA 3QVUA 1MHPA 4NIMA 3HU2A 3PPVA 3TW0A 1LDNA 1DL5A 2WILA 1XXLA 3MEKA 5CEJA 3LYHA 5EINA 5KWEA 3AUJB 2REOA 3B12A 3MWDA 3K9BA 1P4AA 4D56A 1KP2A 3W5HA 4XXHA 1CNFA 1NI4A 1YS1X 4UC0A 4IG4A 3REGA 3ISJA 2Z3WA 5AKJA 2RGAA 2R6ZA 5JQGA 4IH4A 2G4VA 1OC2A 2QTVA 3W90A 5CIYA 3DCJA 4PFJA 1WBBA 5HF8A 5C7YA 2XD4A 2PGLA 2P1DA 3WA6A 1IUKA 5A5VA 3HJFA 3LP8A 2QTBA 1DBQA 1FRQA 3WIBA 2CJXA 2CWWA 4MDHA 4JK3A 2X6QA 3WZMA 1MIOB 1AQ6A 2FF7A 1Z56C 2RC6A 2NP7A 1HE3A 3TZEA 1BU9A 4HEQA 4XCVA 3RHSA 4L72A 1PD1A 2AJ8A 1KZ1A 3V1LA 5JSHA 2HPVA 1GTL1 3NUZA 4IHJB 3SBTB 1BZYA 4DILA 5JMND 2IF0A 3G2IA 1H2AS 3ZN3A 1V41E 5IJZA 1F7UA 3ASFA 4UUOA 1FFDA 1WU8A 1XDBA 3DE3X 1QX3A 5AXDA 1KAMA 3TKYA 3I9KA 3BQ9A 4XYMA 1JH8A 1V3VA 3TJMA 4RYLA 2R6CA 3FLBA 1JJIA 3A58B 2BGNA 3H5VA 3DDOA 4R0MA 1O77A 5IVHA 4JW1A 1LU9A 3OJXA 2VF4X 2NU8A 3TECE 1EEXB 4CMEA 3D3JA 2X8WA 4M55A 4ZALA 1OHHA 4AUNA 2DYSE 2Q6TA 3Q88A 4JA2A 4QJ5A 2C3YA 4UM7A 4UZFA 1TNOA 4EO9A 2JFPA 4B5LA 1Z18A 3CEMA 4LDZA 5ALWA 3MMPA 1KDPA 2FQYA 4MUHA 2OK7A 2ZRAA 4I7EA 1SHLA 3ZQ4A 5KNBH 4OYRA 4U8GA 5JXHA 4DAOA 3T1NA 3AI3A 5B55A 4EGSA 4OA5A 3IXLA 2XODA 1YSCA 4NOJA 4ZA2A 2EQ5A 4KXFB 3DDUA 5CB8A 1KO8A 2OSVA 1MOZA 2GHIA 4OXIA 2POQX 3WV4A 1N9GB 3VYRB 4JI0B 5KVSA 4BZXA 3DOUA 3WWZA 2W93A 4YCLA 5D5QA 4QOGA 1OFHA 4Q96A 3TINA 3VPFA 4JEUA 1B7GO 3E4CA 4MO9A 1OH5A 3PUWA 4D41A 3SDZA 2Y4UA 1CS0B 2X1HA 3FDHA 3T1QA 3H5NA 1A9QA 5FLXA 3I52A 3MRXA 4K6KA 3HU5A 4BMZA 1NYTA 2XGSA 1E5XA 3BSSA 5BURA 2JGKA 2IF4A 4EPWA 4E5PA 1Y4DE 1E2UA 2OOEA 5JMOA 3WMXA 1SBYA 2XT6A 4JS0A 1QRAA 5T67A 1RWKA 1CRQA 3BH0A 3SFYA 4BIMA 1E4EA 4OAOA 4HQ6A 4YQYA 3R23A 1J00A 4CRWA 3U9SA 4U7HA 5SY6A 1LJUA 1U0HC 2PUHA 2R8EA 4F92B 2E1RA 4AX8A 5JSZA 1I7SB 1XDWA 4PWZA 1TTQB 4D4GA 1XEXA 3G7SA 4JP5A 4U6QA 1E0DA 4GL4A 3L7YA 1YQDA 4M86A 1HRKA 2YS7A 1O7JA 5DBKA 5JO0A 3OQIA 2C7OA 2CHWA 4FYWA 4OAUC 5ELLA 2Y77A 3ZKJA 4CETA 2FFHA 4TRJA 3MW8A 2ZQZA 3L40A 1EK5A 4AS3A 4GECA 4EG1A 1AGPA 4UAVA 4H1HA 3FNQA 1TYCA 1PV4A 1UM8A 5EHIA 5DCWA 3GXOA 1G8KA 3KB8A 3WJ1A 1A1VA 1P18A 2QGNA 4W7IA 1N2JA 1L8OA 4C6TA 4EZIA 5FNVA 5JANA 3J7AC 2WJ6A 5CFPA 3PL1A 5H0IA 4URKA 3AV0B 2OLJA 4GDFA 3K31A 4K0KB 1ML3A 4Y1RA 2IH4A 1H1LB 1Y1LA 3HL4A 1NY5A 3GFOA 4WNYA 5NLLA 3NATA 1Z6AA 4HSGA 2XCCA 3ZZTA 2RGDA 4JL6A 1NP3A 2PO5A 1K88A 2W2VA 4ZCPA 5BVGB 4RFSB 2YV1A 4O3FA 4ECEA 3NVDA 3EOBI 1RYMA 1YR1A 2FDXA 2QUHA 1X1EA 4HAIA 3EPHA 1EG2A 4J8DA 4REQB 1X7HA 4E94A 3K94A 3ZDXB 5HMLA 2GVDC 2VGXB 1UOQA 3VH1A 2EGGA 3TWTA 1ULBA 4CM3A 1Q1NA 2VYNA 5TVKA 2ZG6A 4MUYA 5EJ2A 2PUJA 4QDZA 1ST2A 3QMWA 4DMKA 2QZ9A 3K32A 4FLMA 2B4QA 4TMYA 2H2WA 3MJ4A 2GN9A 4MKRA 5IFKA 2FI1A 3JQGB 4TX1A 5J2UB 1CD5A 3S7TA 4Q7LA 1CQWA 3VMFA 4U7PB 3AEUA 1PR1A 4BVBA 3NBAA 2ZTUA 2H7XA 3LK7A 1V7ZA 4U63A 3DBIA 1IRXA 1M2VB 3GF4A 4G5XA 1QG4A 4RV5A 3QG1A 1W5FA 2VHYA 3U64A 3NRBA 5IC5A 2CVFA 3EG9A 3CLTC 2YHCA 1RWPA 4U39A 2QRVA 1E9EA 5CFOA 3IUBA 4URFA 2ZIFA 1R0ZA 2JB9A 2B30A 1W9MA 1Z28A 4AKHA 2GEFA 1S2NA 5KQGA 2CUNA 5M7EA 1R9MA 4B6GA 1LKZA 4RM3A 1K5HA 1XHEA 2ACEA 3EXIA 3LC0A 3KWJA 2QQEA 4UNIA 5K3AA 2NVOA 2ZIVB 1SVSA 3ADPA 1CT9A 2I6UA 2PKQP 2PDAA 4ZO7A 4QU5A 2DUUA 2FO7A 3N7UA 3TZQA 1I94B 4D3ZA 4N5NA 3GMDA 3KAJA 3L8CA 3IAHA 1Z33A 1CQPA 5F4BA 3G5LA 1XRQA 4ZZIA 5HBRA 1W96A 3IAEA 5DHQA 5CGQB 4D3SA 2QM3A 1FUEA 3VTKA 4D9KA 4EYEA 4NYIQ 4BY6A 4IQGA 4O1HA 3E05A 1PLLA 2C1XA 4I1MA 2H07A 3OZ7A 4TL8A 1Y5RA 2UWJG 5BYJA 1NUHA 1U2RA 3D1JA 5JNVA 3GLHB 3BMQA 1ISSA 2ZRDA 4PS7A 1K8XB 1C80A 1IEWA 5C2YA 3DPUA 4CL2A 1XNRB 1WW2A 3HACA 5CFQA 3H1PA 5B6JA 2FKNA 3CGWA 2ZJ5A 1NBEA 3W3AH 4RS4A 4OYSA 2V9ZA 1CNMA 4JBHA 3E22A 4XVRA 1VPVA 3RVQA 2O23A 2D6FA 4CTKA 2JIRA 4CQNA 3HA2A 3B82A 5CB4A 1UXHA 2MIIA 2J48A 3PFGA 2VJBA 4DCTA 5FQ4A 4B6OA 3ZKWB 5CDUA 1FP4A 2WUWE 4LISA 3KKLA 1Z6QA 4X65B 4TTVA 2ZWOA 4HATA 3GEBA 1N4RA 2AFHB 4NULA 5KTTA 4KWCA 2YFQA 2A2ZA 5ICFA 3TX6A 1CUSA 2F3QA 3WAGA 1KOGA 3O4RA 1VLHA 4KWEA 4MYHA 3UMVA 4BSXA 1Z5UA 4EBBA 2YZ7A 3FZGA 4PTLA 4DDHA 3I5PA 2XUZA 1P2TA 4HVTA 3VKWA 5BXYA 2UXBB 2VTBB 2FWJA 1XQXA 2ZYIA 1TF2A 2I99A 3A6LA 2VQ3A 1PZXA 3IT3A 2I6TA 4DVGA 3P4XA 4YN3A 4I9FA 1MVLA 1UM9B 2GN4A 3DJFA 2H4JA 1AY0A 4Q9JA 2NVWA 5JJ6A 1VCNA 2RHMA 4DDTA 1T8RA 4LZOA 2XBLA 1PEKE 1DB3A 2WG0A 2YJGA 4E6PA 4ER7A 4D42A 2O19A 1NXSA 2FMXA 4MKGA 5CT8A 1G21B 2O2IA 3T5DA 4JJGA 1A04A 1Z2AA 1OASA 1QE5A 1E7YA 2ZXFA 3JYQA 1IVYA 2Q6IA 3H8SA 1ZRMA 2FP4B 5F2NA 3AF4A 4KYTA 1KJWA 1HFKA 3CO5A 4A91A 2GD2A 2G76A 4X45A 3A25A 3VNRA 4HLEA 3UWMA 5FPQA 4ONEA 4BT9A 4MS3B 4BY9E 1NA5A 3BE4A 2XDYA 4I4IA 5M04A 1S4QA 1G9TA 2P2CA 1UWCA 2R68A 1R6DA 1ACLA 3K9NA 4DDWA 2XJ9A 3O8QA 2XXJA 5ILGA 3H1TA 3RU9A 3RBXA 3EXFB 1A4UA 2CXTA 2I4IA 3ABQB 4DCMA 5KSPA 4G0XA 2Q3DA 4RZSA 2EJCA 2EL7A 1EK6A 1QDEA 5IZ4A 1EKXA 4CLRB 5D1HA 4QUJA 3WJAA 2FU5C 1FZQA 2WG2A 5FQ7A 1E1MA 5A4MS 3ROEA 3DEZA 1QBKC 4RW0A 3PNLA 2O1EA 2ZZKA 4UZEA 4R0NA 3UMYA 3QYFA 3ORYA 3KIPA 3UUWA 4TTPA 1QGUA 4K88A 4HH3C 2NUAA 1WLSA 4JOCA 3VTFA 4L16A 4RJ2A 3OZIA 2NT4A 3K70C 1P7VA 3GFRA 3H2KA 5DTIA 2ZJOA 4OTZA 3LY7A 4F6CA 1KXJA 1VB3A 4HKTA 2ZBUA 4AY3A 1Z22A 3UQYS 5CT9A 2PFGA 4D9JA 1KI9A 3MMZA 4RZ3A 3KXLA 3BG5A 3JQFC 4K28A 4F5ZA 2OE2A 3ZHQA 2BFDB 1NX6A 4DQ0A 1P8AA 3BHIA 3EYWA 3CW2A 2WQ6A 1C8KA 3O21A 3NIGB 4QT4A 2P9IG 1LFDB 2G88A 4HDKB 5J59A 3HB1A 4FBMA 2L42A 5IZCC 4BYGA 3ZYZA 1TKBA 2XKAA 2WTXA 3S1AA 2XYHA 5I5EA 2AX4A 5AIBA 2J31A 3RIGA 4ZVRA 5JYEA 2BHRA 5EIDA 1DS6A 4MYSA 1UAYA 3FB4A 1C0KA 4EB8A 1E2EA 4FFDA 2HXSA 1JG4A 1WETA 2IXAA 2YS6A 3VHQA 1T3LA 1KJNA 3IUYA 1OROA 2NZWA 3QQ5A 5A4FS 4Z4GA 1NUQA 3R0ZA 2QD3A 2HMWA 3LCAA 2BEUB 3O2SB 4LJ8A 3QE2A 1L4LA 2P0AA 2RKBA 1AV6A 2BFWA 4H60A 3DR3A 1RPJA 1W48A 4EI9A 3CVPA 5JVDB 1WZNA 3DG9A 1KFJB 4KT6B 2XMBA 1A3CA 2RGUA 3ZWXA 4J7WA 4G4SO 3D8HA 2OBBA 2XF2A 1VL1A 1SMKA 3N75A 3PB3A 2R85A 4MTLA 2C88A 1J9EA 3IIKA 5EUBA 5IBQA 3IILA 5LP1A 2OYCA 4MLCA 3Q8LA 3RRJA 1X14A 5H68A 1CUXA 3WA7A 1P4SA 2H4WA 3AUKA 2YRXA 1THGA 4RY9A 4ND8B 1P3DA 4UHKA 5DZSA 1RRKA 2NNLD 1TVKA 4IIYA 4QUAA 3QNUA 4BFWA 2NO7A 4K8RB 2R79A 3U37A 4BLQA 3UPTA 4NPAA 3ODGA 4YRMA 1KVRA 1RKQA 1XRSB 1QC5B 5I7HA 4XKCA 2BFOA 3VVLA 4R8LA 1ZESA 4MR7A 3ZCVA 2GBLC 2ZUVA 4ICIA 4LMBA 3D1VA 4S1VA 2YW9A 1XLWA 3ADDA 5BW4A 4BERA 2NU9A 2H2HA 4AJIA 2IZ6A 1KFCB 1GZ7A 1JR6A 2IS4A 2BL4A 1ZH8A 3CZRA 5LB4A 5AJWA 2F43B 4L57A 5FUQA 2PGDA 2E5WA 5FZRA 4AY6A 3R9XB 2FSUA 2VZ9A 5HRYA 2ATCA 2Q4TA 4QPNA 5EIBD 3PJDA 3P2KA 3C3CA 3VO8A 5KOIA 4FHJA 4FKBA 1YRQA 1UFVA 1PG2A 3T3OA 4G8BA 4U96D 1GKKA 3E61A 1WPRA 1E5TA 3THYA 1H3FA 4EJSA 5KTOA 4XKBA 3ZYCA 3OBIA 4BFLA 3R3SA 1N4AA 4O2RA 5FZSA 5HDQA 2F64A 3DYVA 1TGYA 5EXSA 3GJRA 3HJGA 2BTOA 3L1JA 3MSCA 4IRXA 1ULZA 2EX4A 1UJ6A 4M83A 1EK0A 1ONBA 1JHQA 4C2TA 3AIOA 2NLOA 4L15A 1RVV1 3OT5A 5LQDA 1N11A 3TG5A 1DQPA 3HKEB 3HSYA 3E8MA 3QVLA 5BN4B 3OE7A 1CVRA 4HBZA 2WJIA 3N87A 4R40A 4MV8A 4Y2QA 3VYUB 3N6RA 4MV5A 4WAFA 2LP4Y 3HNRA 1L5HB 2JFUA 2VTVA 2Q46A 1J24A 2XCOA 3B7RL 5SY4A 1VJDA 3QGMA 1DIRA 3AHJA 3VDMA 2NUTB 1GCUA 1HYEA 1LLFA 3HDGA 4BGDA 5AIJA 1BE8A 3AETA 1BTOA 1VSTA 1GGFA 1J49A 5IAKA 1P0CA 1Q5PA 4GTSA 5H4HA 3RKSA 4PSVA 3FKJA 4WKPA 4QPPA 3BWXA 2OAGA 2V55B 4KE9A 3MSXA 3RC9A 2R6JA 1FJXA 4ND5A 4OA8A 4X3OA 5FIOA 2BKXA 4RSRA 3DZGA 2QTNA 3AOEA 3GIDA 4LBVA 3DDCA 2Y4TA 2HBRA 1I2MA 1G66A 1XO1A 1ODSA 1UF9A 4YAKA 1T4CB 3R7SA 3ICEA 3EZ2A 3IKJA 3OZBA 1CX9B 2O0MA 1SA4A 1V1MA 2WXHA 2DYRE 2Y0BG 3JS5A 4S0ZA 1RTTA 1UEIA 1ZISA 3GNLA 4MARA 1DBSA 2CCJA 2BKGA 1F8XA 1IONA 3GPLA 2DJIA 1HMYA 3DPDA 1SBZA 1PGNA 1XZ8A 2V5VA 3UT7A 3ZXYA 3NNDA 4LOLA 1XU9A 4F6RB 3MGKA 3N2YA 1KT1A 3OZWA 4D9GA 1L5FA 3TLYA 2OCCE 3OJFA 1FTYA 1BKDR 3P2JA 2XA1A 2FMHA 5AENA 3LUAA 2IDJA 1FDIA 4EQFA 3DDHA 2BFFA 4V0SA 3LD9A 1P2UA 5G05C 4F1PA 5JFTA 3H84A 3K0CA 2DUWA 4JPSA 5CDTA 1KDRA 4UVHA 1DDIA 4M60A 3GJ0A 5D7BA 1EH5A 2PVCA 4NNJA 1CZKA 2INGX 3UIOC 1EG7A 4F4UA 4LZAA 3UZUA 2FG6C 2PKWA 3MKRA 1T35A 4JHXA 4F86A 4OUDA 3AERA 3RQIA 4H6VA 1XX6A 4RD3A 4V0NA 2P3OA 2QSUA 1TA4A 4EQ6A 5AQ9A 2C2ZA 1GG9A 3LA8A 4MQEB 1K97A 5KX5F 1N7HA 1N7JA 1XEWY 1K06A 5JS7A 1I8TA 5KYXB 1DKUA 1X2EA 1NATA 2HDNB 3KM0A 1QKIA 3ZGXA 4XQ0A 2B4KA 3VUEA 2EATA 3INGA 1O96A 2XYPA 4WWOA 2YIVX 3RRXA 1K7CA 6REQB 4EKDA 4G0WA 5DNAA 3N59A 3KOUA 1Z13A 4RQAA 3VDQA 4DGSA 3Q78A 4EGAA 4DWWA 2O8NA 1QIFA 2KPOA 3LT5A 4FWIB 1GD1O 3SI7A 1N54A 5EI5A 3WK6A 2VP0A 2HBZA 2ZIZA 2NQTA 4HUQB 2EVWX 2M32A 4RG9A 2GZRA 4CF7A 4O2BB 1T9KA 1XVVA 3LU1A 3WOHA 1N8SA 2ZDQA 4G4JA 1SZJG 2BCJQ 4MEJA 1H0SA 4I50B 1JVBA 1GGMA 1ABFA 4E2WA 1PJBA 3CX6A 4WBNF 5KSOA 4MWCA 3GEDA 1Z73A 3ZBPA 3HIZA 2EQBA 2DZDA 3HYTA 3I6MA 3PGXA 5EZ5A 3GUCA 3JZFA 2F55A 5GJBA 4B8WA 3CEHA 1UPAA 3CHYA 3LUDA 2OEWA 3D8BA 3HRIA 2G5TA 1L6RA 5LOVF 1NVKA 1X8KA 5JH7A 4KBQA 4BQQA 3UPVA 4IOLA 3W7BA 3JRXA 3H19A 3QX7A 4M9RA 3TQSA 2CYCA 1T8TA 3NWJA 1GARA 3O92A 2ZBFA 2PNNA 2PTHA 5KREA 2ZCUA 4I4TF 2ZJ3A 3TQRA 2WWTA 3IVMA 2C57A 2Y9MB 2NYJA 2IUEA 5C1PA 4OBXA 5TPWB 3ROKA 3CPJB 4KYUA 2GJSA 1FYDA 2H6FA 2WIGA 3TD6A 2VEDA 3O94A 3QJYA 2BDTA 4ZCQA 3W8EA 4X1OA 4YLYA 1FUIA 3FROA 5DW0A 3GJYA 2A5DA 4ZZ2A 4G24A 4QQRA 5BT9A 1BYIA 2M98A 2G7MC 3L5KA 3QEMA 4PS8A 1QIHA 2VKTA 4B9AA 3H8JA 2A1TS 5HKPA 5DTEA 1T9AA 5HFNA 3P9QA 5ESDA 4HB2A 2VDKB 2I6HA 2R03A 3ISTA 2DGDA 3LKDA 3WISA 4YDYA 3DMDA 3UUXA 2B1GA 2YVKA 3MTJA 5TS2A 1U8UA 2A59A 2PYZA 4MS1A 3S5JA 1MJ5A 2DBYA 2X6JA 4U3JA 1ZN9A 2PGNA 5EYPB 1N0RA 2DPYA 1SXQA 2RGRA 3I04A 5ENZA 5A5DA 3NOQA 3JTMA 5KNDD 1N3IA 1YJ5A 3TLBA 1ADFA 1DUSA 5EWMA 3NHPA 2Z2ZA 4YLEA 4Q7QA 2GHRA 4L5BA 4YCMA 4X8OA 4UNQA 1EYZA 2NU6B 2MOKA 2MSNA 5DGIA 3MOSA 2CFIA 3GPBA 4RJJA 5TVGA 3LGAA 2AFVA 4FCCA 1KARA 5CDGA 3A31A 4R41A 2J45A 1F06A 1C7ZA 4EK9A 1RWXA 3VR3A 4EKNB 4WWPA 1Y8QA 4JNCA 4ARAA 2RONA 5G02A 2H65A 4EB0A 4M21A 4JUDX 4RVDA 2P5UA 3UW1A 4Y67A 4M99A 1XSEA 4TUYF 3HGMA 2WT9A 2Y66A 5JJBA 1WVIA 4O2AA 3PSAA 5FUMA 2WI8A 5CCBA 1V3UA 3EIQA 4P4SA 1NLYA 1N0VC 1V26A 4RXUA 2VPQA 4YMTA 1GG8A 2V98A 4LNHA 4EFDA 5CB6A 4BECA 5BR7A 3DMYA 1ISPA 1UANA 4Z7NB 5LQNA 3PS6A 1U2SA 5H82A 1MZCA 4X24A 4PHFA 4EA7A 1EVJA 1AKYA 4ER5A 1T5TA 5EUMA 1S7GA 5IHPA 2W6ID 3B7UX 1Z4KA 4JLDA 1U94A 2QPAA 2IUYA 5JWHA 4PC7A 1ZM9A 1FK8A 1V6AA 1KERA 1CBUA 1CQZA