The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
190
|
sequence length |
522
|
structure length |
522
|
Chain Sequence |
b'GSGSLIWFRKGLRVHDNPALEYASKGSEFMYPVFVIDPHYMESDPSAFSPGSSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQEWKVKRLCFEYDTDPYYQALDVKVKDYASSTGVEVFSPVSHTLFNPAHIIEKNGGKPPLSYQSFLKVAGEPSCAKSELVMSYSSLPPIGDIGNLGISEVPSLEELGYKDDEQADWTPFRGGESEALKRLTKSISDKAWVANFEKPKGDPSAFLKPATTVMSPYLKFGCLSSRYFYQCLQNIYKDVKKHTSPPVSLLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMVQLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQFNRIYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIVGKDYPKPMVLHDSASKECKRKMGEAYALNKKMDGKVDEENLRDLRRKLQKDEHE'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Functional motifs in the (6-4) photolyase crystal structure make a comparative framework for DNA repair photolyases and clock cryptochromes.
pubmed doi rcsb |
molecule keywords |
6-4 photolyase
|
source organism |
Arabidopsis thaliana
|
molecule tags |
Lyase
|
total genus |
190
|
structure length |
522
|
sequence length |
522
|
chains with identical sequence |
B, C
|
ec nomenclature |
ec
4.1.99.13: (6-4)DNA photolyase. |
pdb deposition date | 2009-01-21 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00875 | DNA_photolyase | DNA photolyase |
A | PF03441 | FAD_binding_7 | FAD binding domain of DNA photolyase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 | DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 | ||
Mainly Alpha | Alpha Horseshoe | Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat | Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | HUPs |