3FY4A

(6-4) photolyase crystal structure
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
522
structure length
522
Chain Sequence
GSGSLIWFRKGLRVHDNPALEYASKGSEFMYPVFVIDPHYMESDPSAFSPGSSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQEWKVKRLCFEYDTDPYYQALDVKVKDYASSTGVEVFSPVSHTLFNPAHIIEKNGGKPPLSYQSFLKVAGEPSCAKSELVMSYSSLPPIGDIGNLGISEVPSLEELGYKDDEQADWTPFRGGESEALKRLTKSISDKAWVANFEKPKGDPSAFLKPATTVMSPYLKFGCLSSRYFYQCLQNIYKDVKKHTSPPVSLLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMVQLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQFNRIYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIVGKDYPKPMVLHDSASKECKRKMGEAYALNKKMDGKVDEENLRDLRRKLQKDEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-4 photolyase
publication title Functional motifs in the (6-4) photolyase crystal structure make a comparative framework for DNA repair photolyases and clock cryptochromes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 190
structure length 522
sequence length 522
chains with identical sequence B, C
ec nomenclature ec 4.1.99.13: (6-4)DNA photolyase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 3fy4A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3fy4A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fy4A01
1NUUA 1GPMA 3P0JA 3GLVA 3D6VA 4EG1A 3F3MA 1VBNA 4S1OA 3ZIUA 2VTBA 4EFKA 1IFXA 4JYZA 2QUHA 1VBKA 4QBTA 3UC5A 1CT9A 3ND6A 2A4MA 1KAQA 2IJGX 3DO8A 3KT0A 3AL0C 4JXXA 2WQ7A 5TGTA 1MC1A 4ZCTA 4KR6A 1I6LA 4MVYA 4MVWA 3LE8A 1U7DA 3DLAA 4FZJA 4DE5A 3RHSA 5KCMA 4PBSA 3IDFA 1H3NA 1KQNA 1I6KA 1YUMA 2YWCA 1MOPA 1F4LA 1O94C 5TS2A 3P0HA 3ILVA 1X8XA 1JHDA 1R6TA 4KR7A 1U3DA 1IHOA 1PFVA 1T6XA 3IMEA 1Q15A 2J09A 3FIUA 2QJOA 4ZCPA 2QUIA 3IOBA 5JBNA 1JZQA 3SZGA 2A86A 1EFPB 4R2MA 2PXHA 4MW9A 3H99A 3G6KA 3KT3A 1LI5A 1TYBE 4YMIA 1ZH0A 1LW7A 3X1KA 1GLNA 1H3FA 1O0BA 1PG2A 4PY2A 4EG4A 4NDAA 1VLHA 1TEZA 1G8GA 3COVA 3N2YA 1MAWA 1WQ4A 1MB9A 4MVXA 3GUZA 1H3EA 4MUFA 3AKZA 1TQ8A 2EJCA 4NX2A 2DR2A 4CQNA 2AZXA 4ZT3A 1NYLA 1Q77A 4JFAA 3Q12A 3U1VA 1SURA 4YP5A 1HYBA 1GN8A 4OJMX 3A4IA 2OQ2A 4MLPA 3DPIA 3FWKA 4HPWA 4MW5A 4ZCSA 4I6EA 1ILEA 3P52A 1OWLA 5TEWA 1WOYA 3MLAA 5H16A 2DEUA 1MRZA 3QTTA 2A7XA 1X6VA 1G8HA 2J4DA 1JIKA 4J76A 3MXTA 4MVCA 3IODA 4KKVA 4I6JA 3ZGZA 4MUIA 4PBRA 2CUZA 3CR8A 4L2IB 1KAMA 3I05A 1WXFA 3Q10A 1QU3A 3P0IA 1J1ZA 3MUEA 1GTRA 4R0NA 3CVUA 4GU5A 3D6UA 4TS1A 1MJHA 3BL5A 3PRHA 1EXDA 3ISJA 4G5FA 4ZT6A 1N2OA 3G5AA 3RK0A 2I1LA 4RPIA 1NZJA 2X0KA 3CLUC 4YP6A 3PNVA 5F23A 2QUKA 1OBCA 4F4HA 2J07A 1P7PA 1EUQA 1IVSA 2GM3A 3FG9A 5IJXA 1NSYA 2X1LA 1WKBA 1O96A 3ND5A 3ZJVA 2E89A 3IUEA 4MW7A 4PBTA 1OWOA 1YULA 1I6MA 1NURA 5BNZA 1ZUNA 2X3FA 5KWVA 1IQ0A 2R5WA 3FDXA 3IH5A 2HMAA 5HG0A 1QU2A 3ND7A 4MWDA 3G59A 1D2RA 4I6GA 5DASA 1JZSA 1IH8A 2ZP1A 4WSOA 2JANA 3CVXA 3IVGA 1U0BB 3N8HA 2D13A 2DLCX 1NP7A 4JXZA 3L93A 1GAXA 2EL7A 3MLBA 2CYAA 3VGJA 2WB2A 3DV2A 4MULA 1J20A 4BWVA 1O94D 1EE1A 2NZ2A 4DNXA 1ULHA 4P2BA 3ZJTA 5J59A 3N9IA 2QJTA 3CLRD 4UZEA 3A04A 3Q4GA 1QQTA 3AIIA 3IOCA 4NATA 2CT8A 2QTRA 1KR2A 1M8JA 1MAUA 1QRSA 5AHWA 3TQIA 2YWBA 4GRIA 4MUEA 3FI0A 2RD2A 3UOWA 3CLSD 1NUSA 5FO0A 2Z3VA 5LM3A 2IP1A 3GMIA 1N2JA 1VBMA 1UFVA 1XJQA 2GOYA 1Q19A 4MW2A 1NUQA 5K0TA 4JZYA 4NAUA 4MUGA 1O96B 4EG5A 1N3LA 1WXIA 4U63A 2V0CA 2DPLA 4CDMA 1KQPA 2O5RA 2O8VA 1U7XA 3C8ZA 1T9GS 1O95D 2JA2A 1V8FA 1EUYA 3TZEA 1JIIA 3SEQA 4F3RA 2J5BA 5DB4A 2E18A 1G59A 1KORA 3KT6A 1GTSA 2PIDA 4ND7A 4AS1A 3KT8A 1WXGA 3UY4A 2PG3A 3UMVA 2TS1A 1QJCA 4MW1A 1WJGA 2VTBB 3K9WA 3TS1A 1O5TA 3FH0A 4AQ7A 3IVXA 3FETA 1XNHA 5FO1A 1M1ZA 1QNFA 5DK4A 2D54A 1PFWA 2PFSA 2CV1A 2QJFA 1JEDA 3IMCA 4ZCRA 1KKUA 3E27A 3FNRA 5K0SA 4CT0A 4HJRA 3HZRA 1JIJA 3TQOA 3SYTA 1J21A 1JEEA 1QTQA 3M5WA 3TZLA 2A1UA 2OV4A 4ZT2A 1PFUA 3PNYA 2A84A 3CVWA 5FNZA 1NUPA 3HV0A 1T9GR 1O97C 2V0GA 3INNA 4XSVA 1ZH6A 3IVCA 4DDKA 1TFUA 2AG6A 4U8HA 5J5AA 2X1MA 1PFYA 3VU8A 3CVVA 4YBRA 4K03A 4YP7A 1R6XA 4MUKA 3AG5A 1F9AA 1U3CA 3H9CA 3NBAA 1VL2A 3RJZA 3K32A 1N77A 2DERA 3AG6A 1KQOA 4XFJA 3SZ3A 3CVYA 3FOCA 1N2BA 4XFDA 1MBZA 2E21A 4MW0A 1NUTA 3FHJA 3ZJUA 2B7LA 5EKDA 1M8PA 2DUMA 4MUNA 4E1AA 4EG8A 2WQ6A 4KPUA 4ZCQA 2IELA 3IMGA 3HGMA 1K4MA 2CYBA 1M8KA 1JILA 1T6YA 1WZ2A 2RE8A 3HFJA 2QUJA 3VRHA 2AKEA 3JXEA 2PZ8A 4ZT5A 1B6TA 1WY5A 1XNJA 1YI8A 5J58A 3CLTC 3PXUA 1FFYA 1YIAA 1JECA 1IQRA 1S4MA 2CYCA 4X0EA 1K97A 1T6ZA 3X1JA 2A1UB 3NV7A 1TYCA 1WXHA 3CA8A 1K92A 1MB2A 1FYDA 2QTNA 2ZUFA 2NSYA 5LLTA 1OWPA 3A05A 4HK4A 2PZBA 3ZXIA 5IHXA 5HUJA 4G6ZA 4MW4A 4OUDA 4DDMA 3COWA 5HUHA 1N2GA 1KH2A 5H7XA 3LCJA 2A88A 1COZA 4MUHA 1N1DA 1TYAE 3IOEA 2JAXA 4ZT4A 3HMQA 2CSXA 4CDNA 1OBHA 4MWEA 4L2IA 1N2EA 1O0CA 2QTMA 3QE4A 2YXNA 1IRXA 3RFFA 4EF6A 1KP2A 1KH3A 4QRDA 4J75A 2BTEA 3COYA 3OTWA 2C5SA 4DDHA 1N2IA 1EFVA 3SEZA 3CLRC 4EG6A 2D5BA 4KPUB 2DETA 4U7JA 2DXIA 1K4KA 1O6BA 2HZ7A 2WSIA 2HGZA 3ELBA 3PNBA 3N05A 2GKSA 1M8GA 2ZUEA 1QRUA 1JGTA 4QREA 4NAHA 4DJAA 1R6UA 2CV2A 1M8FA 4R2LA 3ZXSA 2YY5A 2CV0A 1OWMA 2H2AA 4EG7A 3CLSC 1BS2A 1EJ2A 2A1TS 1NI5A 1F7UA 1O97D 1GZUA 4MQ6A 1A8HA 4MW6A 1V47A 3IUBA 1WXEA 3COZA 1QRTA 3RBAA 3CLUD 4ARCA 1F7VA 5TEVA 2Z08A 1O95C 4A91A 1RQGA 5LFAA 3A2KA 1M83A 2PZAA 3LOQA 3L92A 1XNGA 2CFOA 2H29A 3AFHA 1J70A 3X1MA 1DNPA 1JMVA 4G5YA 2XRYA 1YUNA 4OUDB 3KFLA 1I2DA 1N2HA 4EG3A 1KH1A 4UZFA 4DLPA 3H97A 1PG0A 1Y42X 4WNYA 5DEOA 2BYTA 1G8FA 1H1TA 4MWCA 2J08A 4K0RA 3RK1A 3UK2A 4ND6A 1OD6A 5KHAA 4MWBA 1WQ3A 2E0IA 4MUJA 4ZT7A 3HL4A 4HJXA 3TNJA 3FY4A 2A1TR 1EFVB 4NZPA 4ARIA 4KR9A 3NBKA 4EGAA 3CLTD 1OWNA 3MMXA 3ZUGA 3H05A 4MAFA 1EFPA 3SP1A 2Z09A 3H9BA 1Q11A 3QTBA 1LI7A 3S3TA 1KP3A 1N75A 1ZJWA 2VXOA 1J1UA 1J09A 1YIDA 4H3SA 1TYDE 4Q93A 4Q16A 2XRZA 1IQUA 4RUKA 1N78A 3SDBA 3OP1A 2G36A
chains in the Genus database with same CATH superfamily
3N28A 3KK0A 4LK3A 1PI3A 4JN6B 1ZEJA 4NZZA 3OIDA 1CQJB 2LKCA 5G55A 3A0RB 3SKVA 4MVYA 3PFBA 2AXZA 4UD2A 1VLLA 1GGEA 1KQNA 3KOXA 2B37A 1NMEA 4BO2A 4DDWA 2YQZA 5IDQA 2ZSJA 3SFZA 1PD0A 2HNBA 4BFWA 3L8EA 4GYOA 3HVJA 1F8YA 2X4DA 5CM8B 4NU6A 3DTTA 1X1RA 4FC6A 1KI8A 4QPPA 2B1IA 3K35A 2XPCA 4Z1OA 3MAAC 3EDMA 4A8HA 3H5AA 3U6KA 4I6EA 4IMJB 3N2GB 4O4LB 3ZD9A 3T61A 5A4AA 2X2PA 1EJ0A 3PCXA 4D41A 1WW8A 3BK1A 2XMPA 3QKIA 3HXQA 2C9OA 3BRWA 3HXPA 3GNLA 4JT4A 3ZE6A 2GPBA 4YH1A 3SXUB 3RV4A 1Z0DA 1VSUA 4FFSA 3EVCA 5IMSA 4GPMA 4DCVA 3GGOA 1QU2A 4MWDA 4F1SA 3U3KA 1Q6ZA 4F85A 1GG8A 5H3LA 2Z57A 3ICQB 5AVTA 3WISA 1ULHA 2A0WA 3T5CA 3N9IA 2H0RA 3PQ6A 4Y0NA 1QQ7A 3ACCA 3NBMA 2X6TA 1E2QA 4HBGA 1X14A 4GG1A 3N70A 1WLSA 4QFDA 2PLWA 4AQYB 2YV1A 5T4HA 1AQIA 1GV1A 2HA5A 1E96B 4WX2B 3WLOA 1CSEE 5JDCC 1XRLA 3VQTA 2FQWA 4MV7A 2PZIA 5IXJA 3RBXA 1XQ6A 221PA 3NBNB 4GZ3A 3WJ2A 2Y9MB 5CCMA 3VMFA 1GXSA 3IVXA 3FETA 3HSSA 4KWIA 2GZMA 4NYIQ 4A82A 3UH0A 3KSUA 3HTXA 1JLKA 2J9YB 2YMMA 1J24A 2XNDD 4PONA 2WWGA 5JVDA 3ZXUB 4ZOQI 1B41A 2R4TA 1KIFA 4MARA 5E7IA 1DJNA 3BTSA 3L79A 1IN7A 3MRXA 4EKGA 4J1QA 3P4UA 1CQZA 2DR3A 1OOEA 4TWJA 3FX2A 3OFNA 1D7OA 3FEYA 1KZ1A 5HI7A 3VMMA 1OLUB 3EJWA 5HBGA 4DLTA 1H2YA 4LRQA 3EF0A 2Q1WA 2YWJA 3WAGA 4IG4A 1VCIA 5AQAA 2VF5X 4JUIA 3I8OA 3RPEA 1FDUA 4L9SA 4A27A 4YJHA 4QYMA 1Q17A 3VPFA 1YIAA 1JECA 2F59A 4AU1A 2VNSA 3HZHA 4LYDA 3MINA 4AYWA 3WIVA 2WYVA 5EA2A 4R1QA 3A9TA 3EIFA 2FOIA 3F3SA 4C1BA 3I30X 3NIDB 1RAGA 2VRWA 3HBJA 3T5MA 3TKAA 4CDNA 2IIPA 2ZRGA 3CSDA 4M8IA 3VLEA 3I62A 2XB9A 2DQ4A 2H4WA 2XF8A 2G5GX 2UZ3A 1JGTA 3KSQA 1M8FA 3VZQA 1GEGA 2BFOA 3ZHSA 3SX2A 3ORQA 3HY6A 4RZIA 1IM5A 4NH0A 1OLXA 4I9EA 3ZNPA 1BX1A 4TRRA 5I5GA 1P61B 5DTRA 2IYNA 5AW2A 4HNTA 1BU9A 1FSFA 4M0MA 4XJXA 4IW3B 3DVQX 5FLYA 3W1VA 5KWEA 4IVQA 4P83A 3NBZC 3BD9A 1E9AA 2L18A 3DJFA 1H23A 3WGJA 1G60A 2ZIUB 2Y6VA 3WWOA 1SC1A 3MMXA 2XWSA 4ATZD 2RGCA 2M6RA 3BSYA 3ORSA 4MMYB 1K2VN 3TLKA 5CD9A 3KNZA 4F6RD 4GSYA 4I17A 3EK2A 1N5OX 3UIPC 1OZAA 3DTVA 4DA8A 4L2LA 1R9NA 3KB8A 2UUPA 3DL7A 2FK8A 4N3CA 5IT0A 4I3HA 4BQPA 5L3RA 1XIVA 1CY2A 1KJZA 3FSGA 2BELA 3VOTA 2ZU6A 1Q6YA 2H4HA 1CFJA 3EUWA 1N8TA 5IU6A 2BTDA 1GPDG 1ZR2A 1QZXA 3HYLA 3U4QB 2QIPA 3K6SA 1EG7A 3K5IA 1QGUB 4J91A 2B98A 3NJ4A 4HL6A 2CSUA 3KJIA 3FF4A 5E2AA 4L50A 5HF6A 3EUAA 4F84A 1UJ5A 3EZLA 3GUZA 5HCIA 4EFDA 4C0SA 2YXBA 1KYWA 2N47A 3IELA 1I24A 4GPTA 2KB0A 4PR3A 2RGWA 3EZXA 4OLAA 2H07A 1YBMA 1AQUA 4WLFA 4AICA 1JWLA 4Q9NA 3DWLG 5JQGB 1NT4A 1ID1A 2NYRA 1TJ5A 4GLLA 1F9EA 5CU7A 2LIPA 1ZESA 4ZOLB 3MA5A 1DC7A 3CUTA 3OEHA 2QUKA 4F4CA 1JAIA 3GQBA 2KMLA 3OT5A 1IYGA 3T5PA 1ZUNA 3ROPA 5B58C 4RABA 3OZXA 3ZNQA 2GK6A 4EK9A 3GFRA 4HB5A 1PNOA 1MJGM 3GFBA 1RC1A 2R66A 5KYWA 1R12A 4WKOA 1VI2A 5BRAA 3MQ4A 2QM8A 4EJMA 4P2BA 4E09A 2FCRA 3A04A 3IOMA 5IT9A 4YBZA 1FL9A 1NMSA 1EEHA 2VDWB 1K1EA 4Z7QB 4RKQA 3UJ8A 3VR5A 1MG0A 1RI3A 3ZN2A 4Q24A 2R8PA 4AM9A 3GMIA 4C3VA 5AKHA 2P78A 4LCBA 2WMNB 3LPAA 1R8YA 2FP4B 2V0CA 4HAYA 1MEEA 1SKYE 4X95A 1OC4A 1TYEB 5LZ9A 5FUWA 3Q2IA 5ALMA 3P20A 1WUYA 3IR6A 2HADA 2C07A 3GVCA 2JVIA 5KREA 2WWFA 2E4AA 4RD0A 2QL9A 3W1WA 1UOOA 3JR3A 1J25A 3G2HA 5AM0A 4URZR 1UW4B 2IDZA 3AKCA 1DRVA 1YDEA 1U2DA 4JD2G 4I4LA 1NXPA 1CDZA 3ROEA 3GWZA 2QUAA 3P9IA 3QB2A 1EK5A 2P0YA 2XVYA 1DWPA 2V7PA 2LR0A 2XI4A 1DFIA 2QN9A 3QXGA 1JVSA 3BRWD 1WV0A 3V79K 2UYOA 4LJ8A 4TUYF 1W9MA 1O03A 1IB0A 1QK4A 2QY6A 3NV7A 1FXSA 1XDGA 2QTNA 3DO6A 3H7AA 4ZMSA 3UPTA 3KZ1E 4K8OA 3TWSA 1CLUA 1E3SA 1SFRA 3NRCA 2BSXA 3ILHA 1MO5A 2V3VA 4YUWA 4LX0A 1SQFA 5KTRA 2WMDA 4QHYA 2EAUA 4LSMA 4DSTA 4LBWA 4KO8A 5E6UB 1UP4A 1EXMA 4LOHA 3GUVA 1JFFA 1RP1A 4B48A 4N5IX 4UWKA 1YVEI 2B92A 4YRTA 2WJVA 3G0DA 4ALJA 1B15A 1S2GA 3FR8A 4ZO8A 1VOTA 1ZC4A 4PZ0A 3HJFA 4AT1A 4XPIA 1MEOA 4LQLA 4HAIA 4OBXA 3WLEA 5KX5A 4GTOA 3KFLA 4NULA 4M7WA 3QBVA 3ZV7A 5CLJA 1N2HA 2I2OA 3DDWA 2PSHA 1TK9A 1Z4NA 4UZFA 2H31A 2BZGA 5BURA 1HE4A 1Y4AE 3KOUA 1R0BA 5GZ3A 5AJLA 4ETIA 4MWBA 3N87A 4OHBA 2A1TR 3NHRA 2WA1A 3NBKA 3O9VA 5I45A 2PZGA 3Q6NA 2WFZA 4KQ6A 4IUYA 4UVGA 4E5UA 4WESA 4RUKA 4M9UA 3WMEA 4BNZA 2A5UA 3N59A 1CUBA 4AG5A 4GMDA 1E3DA 2HT1A 2ETBA 5J2TB 5AICA 1YRBA 4PPQA 2GJ8A 3OFND 3CZPA 4LY9A 1I6LA 4QQNA 3G23A 4Q02A 5G1NA 1KHHA 2HIAA 4CM4B 3ZTYA 1LK5A 5EXPA 3OH8A 4KUHA 2ZIZA 4KWHA 3KT3A 2B20A 1ZH0A 3LHKA 3IV0A 2A5EA 2RARA 1V2GA 1YZHA 1VLHA 3MJSA 5KOIA 4LGVA 4FC7A 4HFNA 3MM4A 1A04A 1A4XA 1PZMA 2OD2A 3AU5A 1ZK3A 4KFSA 1TJ4A 2FG6C 1A8SA 3E8SA 2CDCA 1FMTA 2KBFA 3MXTA 4I6JA 2IIQA 1TA4A 3KHTA 5I3CA 2WF9A 2HI0A 5EE5B 3LOPA 1Y1TA 2WF5A 2FF5A 3CEAA 1A27A 2WFLA 5JI2E 1NYTA 4R1MA 1W5BA 2I76A 4O1IA 5HOQA 4XWKA 5JO0A 3SQOA 3FZNA 4KMOA 3CVXA 2WHPB 5IG2A 3UC9A 2LNIA 1ZN8A 2RGNA 4DLRA 2AF4C 2JFXA 3MTGA 4FX2A 5KYXA 3LBYA 3OTGA 4DNXA 1N5JA 3DBSA 2PKWA 3B52X 3C3CA 1PL6A 4RTOA 4MJ7A 1TVCA 2ZTSA 4P54A 1PAQA 2C9ZA 3WZMA 4IDOA 4J6FA 3CW8X 1FTSA 2F3QA 1EPUA 1XVTA 2Q2NA 1DVPA 4C7VA 2GM4A 3WKCA 5GV8A 3FCYA 2ZATA 3VKVA 1E8ZA 2HO5A 3KCNA 5FL7A 3T9AA 1BDIA 5C8YF 3UYKA 4GCOA 4BO9A 5BV1A 5DNYB 5DOZA 4MAMA 2IU1A 1YB5A 3NV9A 2L69A 1ZIOA 4QJ4A 1YZTA 4H77A 3V3TA 3AJ9A 3TXXA 4PDXA 1D8AA 2JH8A 3DOIA 5F64A 1DWQA 1Y33E 4UATA 3IV9A 3PJGA 2WE7A 3LP5A 1KSFX 3HN2A 3V3KA 4GI3A 3OIUA 3V2IA 1QIEA 1FCJA 4Z2YA 1S2OA 3BIXA 3GA0A 3SX0A 4XSGA 4MV5A 3NTUA 2AVNA 2XSZA 1W1UA 1DHRA 2IW3A 4YBRA 1ST2A 3SR3A 5T8KA 5JFOA 2JATA 3KOYA 1MHTA 4LF4B 3Q49B 1QBQA 3DT8A 4X6UA 1NVMB 4P7FA 4N48A 1D1QA 2ATIA 1EIZA 1CEQA 1K88A 3WJ1A 1GXSB 2ONDA 2QYHA 1T5HX 1T6YA 1Z4MA 4B84A 3AXSA 3KL4A 4BATA 4INZA 4M0KA 2V6BA 3PXUA 3PRJA 4Y1RA 3U44A 4MX8A 1SK9A 5H1YA 2IU3A 3LY8A 5CFOA 5JVDB 3K7EA 1L5MA 4U4AA 4FN5A 1Z8NA 5IHXA 2JLAA 2NADA 2JGFA 2JRCA 4YA6A 4JLSA 5F76A 4E1BA 4GL2A 2CNLA 3TJPA 3P96A 5BMVF 3TKYA 4XH9B 1VE1A 3BIFA 3X1DA 2CUTA 2PJDA 1WU7A 2E4YA 1BCSA 4A0RA 4WA7A 1PT7A 4TRJA 3VR5D 1OCCE 4YJHB 3QVMA 4EYKA 4ZO6A 5JQWA 3KAJA 3UAVA 1RXVA 3PIRA 5GIOE 3D4NA 3HRIA 3MINB 3AWDA 3KTFA 4X20A 2Y1FA 4JD5A 1XZDA 3T5BA 4AZWA 4IIBA 1Z2NX 4KYVA 8MHTA 4B74A 3FDIA 3AGPA 4EZBA 1H0SA 1Y7HA 5K4GA 3QMVA 2QZAA 2OAEA 1I2BA 1IYZA 1L5GB 4EHFA 4RJTA 1BVHA 3LPLA 2P62A 2Z5GA 1IXRC 1C2TA 3LXXA 3UOAB 3FTNA 1ZD3A 3ZHZA 1OLXB 2E37A 3CUSA 2DP4E 1ATIA 2GCPA 4G0MA 1GPMA 3GLVA 2AW5A 2HIMA 1E8NA 4HWSA 3VTZA 3I76A 4MGIR 3O4FA 3IC5A 3KIPA 4G0YA 3KT0A 2DKNA 1E2MA 2AH5A 1PBNA 3DXZA 3UAXA 3HR7A 4ESOA 1M6HA 4JB0A 3AI2A 1QHSA 3QFCA 2SICE 4BNKA 1UM9A 2QD1A 2B4TO 2ZJOA 2J09A 4FHKA 1DU4A 2PMBA 1N5KA 1SKMA 1F6DA 3C85A 2X58A 2A5YB 1DCKA 3VKWA 2I2BA 3IDAA 4ZVVA 2AQIA 1FS6A 4GW3A 1RXSA 2E6KA 1ZI8A 3FOEC 2FSGA 3ZH2A 3DTVB 3LLMA 4KGZA 4FFWA 4KRXA 1PT9A 2ZYWX 3MCZA 2WINI 1LA2A 4HQNA 4KO2S 5AESA 2R6JA 2IXBA 1COWD 3EYWA 3VLFA 2K2QB 3IP3A 4G25A 2CXQA 4URWR 2ZU6B 3V7YA 4IEEA 2CXHA 1OAKA 1XQYA 1TLTA 2NPFA 3D8HA 4MEBA 4M53A 5I9IA 3AUKA 1O08A 2Q5JA 4BVFA 3K6SB 1O57A 3TDMA 5ESRA 4YPFA 3GYGA 1E4EA 4QO8A 1W49A 4J8DA 4NCHA 1RRKA 4I8XA 3H3JA 4B8YA 3CG0A 1I3OA 4XDHA 1N0WA 3D9JA 5L4NA 4TM8A 3UPUA 1XRSB 1C41A 1NQUA 4R05A 3RRXA 4YCLA 3GRZA 3TNYA 2Q45A 4W8HA 3IP9A 1KFJB 1LQ2A 2I6TA 3QZUA 5FZQA 1JN0A 2ZI7A 4UZEA 3B3FA 3SG0A 1EK2A 1U1DA 3PXGA 2JIZA 2CG3A 2GEDA 3BXPA 2IOLA 2G88A 1CXZA 3FOFC 1OGJA 3GQBB 1Y7LA 4BLSA 2PVSA 2J4CA 3QXXA 1N2XA 3JQFC 3GHYA 2VCYA 2GEFA 4DYDA 4Z9YA 4FP9A 1JIIA 1QKIA 5FI1B 4ZU1X 1G2IA 1KK3A 1BE0A 2XTAA 3QLVC 4L22A 4HDAA 2OYCA 2HPZA 4FSHA 3WLPA 3JD3A 3FTUA 5KYWB 1T8TA 2IYWA 5DK4A 2EX0A 4IDQA 4MKRA 1NM5A 3C7KA 4GZMA 3II6X 2PQRA 4WZBE 3B5IA 1WXXA 2R68A 4MCAA 3IXMA 3BH6A 2G5PA 3OCCA 3OU6A 3AM4A 4QUKA 3OOHA 1O5MA 5AJXA 4PC1A 2VQFB 4IYJA 4AB1A 2P2LA 1Y5MA 4DW8A 1MA3A 3A1TA 4E03A 4EZJA 2LBPA 3E3MA 2YMPA 3M4NA 1THTA 1IPFA 3SC2A 2O0HA 3T3EA 4X45A 5HFNA 3I3NA 2YJ5A 1NLZA 1QR2A 4C7MA 4AJNA 3IEGA 4UQOA 2I3DA 1D2NA 1OBOA 1S6YA 3LBHA 4LHSA 1H2VC 4BB9A 1W52X 3DAPA 1ZGZA 1A8UA 2QTLA 1K7EB 4JOCA 1Z4QA 1NMQA 1EQUA 5FOWA 2VPZA 5KWIA 3TRDA 3PNKA 1JEOA 4OIMA 3Q5EA 3PZ2A 3L16A 4IICA 2INGX 2AMVA 2HAEA 3ZYKA 2DBQA 2E5WA 5AIJA 3C5CA 4FFBA 4BP1A 4Y6PA 4R3NA 4II2A 1DAOA 5FL7D 1EYHA 1AKQA 2I9PA 1Q16A 4KQ1A 4NAVA 3KJFA 2MMCA 3I2KA 4EP1A 4TM7A 1ISMA 1M67A 2OLJA 1P18A 4F1WA 2AE1A 2VPPA 1YZNA 1P1JA 4H7XA 2WAYA 1UZAA 1JFFB 4LXGA 5B7PA 3RIEA 2WJPA 2HBQA 1DI0A 4NPCA 3H9BA 2AOVA 4EB8A 3S1LA 3W06A 1FE8A 2ZG6A 2QRVA 1XXLA 4FJYA 3PKIA 2OHXA 4ZO9A 3KWJA 4UAVA 1LPAB 2OV3A 1LBTA 2X77A 4QE3A 4EG1A 4XPIB 2IHUA 2JCXA 5KX5B 1P0CA 3IHTA 3GRYA 2CFSA 1ORWA 1NQAO 1C1YA 2EDAA 3OU7A 3AVTA 3P2JA 1CZUA 3NH9A 3OLVA 4Q4CA 5CDHA 4N2SA 1WABA 3VNSA 3U3WA 4GPKA 4HAZA 1Z5VA 4ME6A 1B42A 4WESB 1YCDA 5C3MA 4OEHA 3B6IA 2X2EA 1GN8A 4OJMX 521PA 5F1YA 1K98A 4QTYA 4XYBA 3V1NA 2IYEA 1JR2A 2NZWA 5I48A 4RPJA 2GS9A 3L8ZA 1Y8ZA 1JEQA 4OLFA 2YXPX 1IVSA 4FEEA 3ZG6A 3RADC 5KTPA 5FWYA 1CRQA 3EHQA 3DHVA 2QTHA 2P9PG 3WFJA 4CIXA 2OFWA 2XUJA 1K08A 4TV8F 3N6VA 2ADOA 2KW5A 1E1RA 1HM5A 2FMIA 5DXAA 4TUYA 4P08A 3BXHA 4IVNA 1FOEB 5KKNB 1OU4A 4O5AA 2WHYA 2V6MA 2ILRA 1TI7A 3DHEA 3D3KA 3W5UA 3X2FA 3QPBA 5EKQD 1EK1A 3TW0A 5DF1A 1JG4A 4U9IS 3GLKA 4HKTA 4PVCA 1JCSA 1RI4A 2C4MA 2PL1A 1JDSA 3R7WA 3ASFA 3IAFA 2VDRB 5AXCA 3EJ6A 4R31A 4E2YA 2ZAOA 5EX0A 2PLNA 4BPBA 4G11A 2QE7D 1JBEA 4D74A 2NZYA 4CUKA 1MAHA 2VQ2A 3HK2A 1SAYA 1W4AA 3WGIA 5KYXB 3NWPA 5H8WA 2RHGB 2WIBA 1NF3A 3BL8A 4BASA 3ZDQA 2D2VA 2PCJA 1MX5A 4BAUA 2HCJB 2QLNA 4KX3A 3I4LA 1CUJA 1PS8A 1L6RA 2ZB8A 3IVCA 2JJMA 1LDNA 3EF3A 2OBYA 1U9CA 5ESWA 2HWXA 2OHVA 2PJUA 4D4MA 2YHUA 5FZRA 1KBQA 1CYDA 4WNFA 1AKYA 4JQOA 4NOLA 4IDGA 5DW0A 3GJSA 3GPCA 4XVRA 2VOJA 1R8JA 5D8DA 3F6PA 4MQLA 4RFSA 3FPBA 4LXHA 1U7HA 2VUUA 5KWDA 4WASA 5GY7A 4NDNE 1S7GA 4PX3A 3P9XA 5CDFE 1U1FA 3V8PA 2Z1MA 1KJYA 3USZA 3I45A 4E3WA 2FXVA 5LLTA 1NULA 2YX1A 4MO9A 2F3PA 3LCJA 4Z9XA 1NVFA 3GGGA 1OROA 5EE3A 2D4HA 5IJZA 1PX2A 4LOJA 2PX8A 1AQLA 3HBLA 3GPBA 1JV2B 4GYWA 2LCIA 1JKXA 1PGPA 2MR6A 1FYEA 1NDUA 3CNLA 5CB6A 2GSWA 4MK4A 1OTXA 2QD3A 3FUJA 5IJWA 1C8BA 5FQNA 4Y1RB 3U44B 3A6ZA 2PUHA 3AUJB 1T5IA 2PN1A 4FONA 5A04A 3Q6MA 3I9V6 4QEKA 1YU6A 3MT8A 1O6FA 2LSUA 2CL7X 3EQ9A 4LISA 3BREA 4ZGGA 1NR1A 1Z4OA 1E58A 5JOQA 4AIIA 2PX3A 1FFWA 3I1IA 5UKDA 1RMYA 1AHIA 3OEEA 1XRQA 1BCSB 3TQTA 3QFFA 4Z9FA 3VXKA 3T9KA 3FEXA 3O73A 3IUYA 1G66A 2QT9A 3R5FA 1A97A 3ZLUA 3WS7A 2FLVA 1ZJZA 4HOQA 4X20B 4JYZA 1XHEA 1J0BA 4S1NA 5KNGA 2AEEA 2WVHA 2IEIA 1E5LA 1Z6XA 3ZXXA 5I9SA 2BH2A 5C7IO 3M6XA 3C5HA 4NFYA 1PJSA 3MEQA 2VDMB 3O4IA 5JS2A 4WBNF 2ZT7A 3TB4A 2BW0A 4ID3A 5DTIA 5HR5A 5C8YA 3LX8A 2HSGA 4I1AA 3JYNA 4UAJA 4ZYUA 5K3EA 4U1RA 2H1HA 5CITA 2YOFA 5B1EA 1GZ7A 4ZT3A 3DBLA 2VDPB 3ANLA 2H0AA 2OQ2A 2PX4A 1PEYA 5EGSA 1XOIA 4JUFA 4LE2A 1XCPA 3GUUA 1G64A 5LUBA 4LGCA 1J2EA 3CRVA 1G3IA 4JP1A 1BS1A 5KQMA 2P6RA 1K9SA 1UM9B 1SZ9A 3FOAA 1KS9A 1L9KA 3P9SA 5DM70 2ZYGA 1N7GA 4PBTA 1ADGA 4BNWA 3HUDA 4I1SA 5DBOA 3F6EX 5AKZA 2PTGA 4EHBA 4XI9A 1Y37A 1V25A 3KKKA 5AW9A 1E4YA 4TKUA 2L42A 2X9QA 4B3GA 3DSWA 3E23A 5FHRA 3ROTA 2W2PA 1WSDA 1YZLA 2E4UA 1Z16A 1ABFA 3M3PA 4KO4S 2V5QC 5IT4A 1KSJA 4UM9D 1E4EB 4ZJUA 2ATXA 4MZDA 1NUQA 2FX5A 1SWWA 1VZ3A 3VR5H 2BJVA 5BMVA 2OCIA 4CKXA 1EAYA 3ZU5A 2P75A 1QE5A 5KOJA 4II3A 4ANFA 5HQ3A 3TFOA 3PXXA 4IS2A 4EA8A 1D0SA 1T1JA 3ZGLA 1JEDA 1J2YA 1IEVA 5KTOA 4NBLA 4DIUA 1JCQA 5ELXA 3MSXA 2XT9A 3VAZA 1LUAA 3OE4A 2AG6A 3MWDA 3GZNA 1D3AA 2DT5A 1JHVA 2R6AA 1KDRA 4QBFA 5KVAA 3D0KA 2AR0A 4XOUA 4D7AA 4AUEA 4WWNA 2IP2A 2W2TA 4B2LA 2GN8A 3HDJA 3W6ZA 5F5XA 3HMKA 3BFPA 3E05A 1QZ2A 3GCWA 1E9FA 3O75A 5AI9A 4BL5A 1NG1A 2FAXA 4B79A 1KEVA 1HMPA 3HCNA 3IHLA 4ZWNA 4LJSA 2OQVA 4N5NA 2MSWA 2ERXA 5G02A 3CW9A 2P6UA 1R5BA 4WKBA 5FKJA 3SJ7A 1W73A 2HPAA 3A58B 2ID9A 4KN9S 4US0R 3WC4A 1SUIA 4LVOA 2LXMA 5BPHA 2G9ZA 3R9KA 1TAGA 1V8DA 1Y6FA 4D92A 1IN5A 3IIKA 3UH1A 2YWGA 2Q9UA 4J7XA 1HFAA 3SC2B 4CGYA 5LBUA 3AS4A 3CHSA 2B9EA 2XTMA 2VRCD 4FQ8A 4IOMA 1OHHD 4MW6A 2FYTA 4N65A 1DPGA 4QGSA 2CNWA 4DPLA 2D4AA 4ZOBA 1QVAA 1HLPA 4GT1A 1CRWG 3B60A 5HDQA 3PXDA 3AV3A 4D4LA 4Q9DA 3DBVO 2EQ5A 2WIKA 1EFRD 1TGYA 4N6GA 1A5EA 3H13A 1K66A 4ZVPA 3MGBA 3EPRA 4ZU6X 3H1FA 3QEMA 4EUSA 2VT7A 3PI6A 4OVUA 3F47A 1Y9AA 3UCEA 3L7YA 4LHXA 3QC1A 1IXZA 3DL0A 2JHCA 3G8AA 3W5IA 1Y1LA 3TEJA 5HIMA 3UANA 2ZGGA 3TKLA 4A0FA 4N40A 4NRHB 1R6BX 3VKUA 3YASA 3AL0C 3GFGA 1Y3BE 1SQ6A 3QUAA 5REQA 4D99A 4MS6A 4ISBA 2V4ZA 3A4VA 5AJTA 3IL2A 1Z6QA 1T6XA 5J2UF 3CKKA 3PGLA 1W48A 4PAGA 4Z6KA 1XO1A 4W63A 1CY7A 1AC5A 4QASA 1JIQA 2QRVB 1Y1SA 4O60A 1LD7A 2MSDB 1SOMA 3UM9A 3MTJA 1JSRA 3NCTA 1LV7A 2IWRA 5FL3A 3PWTA 4WY8A 1NXQA 3AKEA 3DEKA 1W1IA 1EP3B 1BVUA 1VE7A 3UJAA 4J8PA 4YRBA 5E0KB 1E3JA 2TECE 3NWJA 3TD9A 3I05A 1WXFA 2E2WA 3OZTA 2QV0A 2XA2A 5AENA 1P9NA 1I1OA 1AHPA 2UZ4A 1LB1B 2YC2C 1I3NA 1DAIA 3SC4A 4RKEA 4DLSA 4EPWA 1U2GA 4RMNA 4UASA 4H0FA 5LJIA 2QRQA 4IDCA 2A9JA 1ODTC 5HG0A 1GM5A 2X6KA 2CHEA 4N5LA 2GDZA 1U0NA 4OL9A 4HWRA 2ECOA 1IRIA 1U7TA 3GI1A 5IW8A 2JFNA 1J22A 2COEA 2OEVA 4BNFA 1VLZA 3IMKA 2B34A 4RXUA 4MJXA 3HNRA 2WHQA 4URYR 1G8JA 4I9GA 4ZO4A 1FVHA 5JYEA 1JEQB 5DHPA 2H1RA 1D7AA 2V5VA 1WPRA 3FTEA 2R5SA 3R3SA 4A0HA 5EY5B 2H8GA 3GLIA 2QGFA 4IO1A 4PLTA 5FWYB 4J4BA 1UN9A 1GG9A 2VHTA 4YQZA 2C31A 5FWXA 4DWJA 2ZRIA 3E34A 4PLWA 3G49A 4P3KA 3DWGA 5K05A 5FI0B 3DGFC 2BM8A 2BUAA 4TUYB 4FFRA 4KQWA 3HABA 3SN6A 3LRXA 1MP0A 3AI7A 4JLUA 5CR9A 4YAKA 1QHIA 3PQ2A 1IKND 3I04A 3AUXA 1A82A 1O97C 4TLEA 5LZ8A 4JR1A 5K3AA 1B1CA 3PLAE 1DUSA 3TWQA 3SBXA 4F4JA 2W0MA 3R7WB 3DL4A 1XCBA 2WPNA 4FT2A 3VYUB 1OI4A 5ENPD 4LFCB 4TWIA 4LF7B 2IODA 3M33A 3PIDA 2YJZA 3PJDA 1W25A 5F7OA 4BUCA 4UUOA 4DUGA 2OM6A 2HV9A 2CWDA 4HMOA 4PGGA 1JILA 4F11A 5EZYF 2M63A 1MU0A 3OO1A 1LU9A 4H3KB 4MH0R 2XADA 3KKPA 4V2IA 3ZGQA 4BFRA 3QUCA 3T3IA 4RVGA 4O2LA 3L0SA 2R48A 3ZXIA 3GVPA 4BFUA 4M87A 4RVHA 4XQ0A 4YASA 5C7YA 3HLKA 4IHQA 4HXFB 1V39A 3QE4A 4A2QA 3IQHX 4YX9A 2CGEA 1MF7A 2BTEA 2VZ8A 5EERA 3BWBA 3UJNA 1SXJA 1ZVVA 5JY6A 2M6SA 4OK6A 4RFSB 1ENYA 4KDCA 3ONEA 4AMVA 4EY5A 2OP0A 2OT3B 2OB2A 5C4IA 4YUXA 2ZRJA 3O91A 1UEJA 2WT4A 3QX8A 1D4ZA 1ZN2A 1NN5A 2WHPA 3IHWA 2QGNA 2YBDA 1D6NA 3PTZA 1FC0A 1XPOA 4W99A 2KLBA 4U5QA 3ELUA 1F2UA 2R6GA 1EGQA 1FJ2A 5H82A 5K0CA 3QUSA 4CEHA 3OE7A 3ECSA 1NVTA 4W8OA 3DBRA 3INGA 3OQPA 3PQFA 3HLTA 2QZ9A 4U0SA 2ODWA 2VQSA 1NV8A 1H6OA 1HG2A 4U2CA 1FU4A 2A94A 1IQUA 1ZK1A 2QYTA 4IH4A 4TV8A 5MF6A 3BB1A 1NL4A 4FKBA 5FEUA 3ZWQA 4ZARA 3D5TA 1U28A 1A50B 2XWJI 2A4MA 3WMXA 3IR5A 5FZSA 1AXGA 4I1MA 4N7RA 3BB4A 3RHSA 3ZE1B 4EY3A 4PBSA 1DO8A 2Z3WA 1K7CA 3EAFA 4JA2A 1Z6PA 3HHMA 1JR3A 2QVCA 1TPZA 3UMJA 2O2IA 3T7IA 1QVZA 1LI5A 4DPMA 5K0NA 3X2EA 2J7PA 4PY2A 2YWEA 2R96A 4QG7A 1EFTA 3WSTA 1I5OA 1NI3A 3JWGA 5ALZA 2J9FA 3A4IA 1ODIA 3SLRA 4X3OA 3M9XA 3PYXA 2QV7A 3OLZA 3P19A 2QRMA 4CLEA 4J8EA 3KE8A 5JZMA 3QTTA 4JJKA 4HDNA 5ICEA 3UA4A 2RAVA 2ZRHA 1TC1A 3ENNA 1UPBA 1QU3A 3CVUA 2FSSA 1H0HA 1P9RA 3OJFA 3WNZA 1Y1QA 2EU8A 3HYMB 5C8YB 5AI4A 3ZCTA 2I6SA 4A73A 3ELDA 5D51S 3CN7A 1YJ8A 3NDBB 5GJCA 3K92A 1N3IA 4WOPA 4LDAA 3A9UA 3ML9A 5FUXA 1RZRD 3D9LA 4CV2A 3MT9A 4DC0A 3VSAA 4MQEA 1U0SY 3DBLB 5DASA 5CW1A 3WWZA 1CZHA 3ER8A 4LHWA 1AMOA 3TGLA 1G41A 1J1IA 2QTZA 3WV4A 1XLWA 4RPHA 4QVGA 4F96A 4CIAA 4LFAB 4JBNA 2M1ZA 4FR0A 2R4QA 5A7DB 2HK6A 5L8VA 3QKTA 3UM1A 1QBGA 1P7YA 1QLHA 1Z5PA 2O8FA 3C48A 4OQPA 1F0PA 2D5LA 4KT6B 2PANA 2I4NA 3ZVKA 2D6FA 1ORIA 5B36A 1SOWA 2YQ4A 3JZAA 1X1QA 1TRHA 2PG3A 5EIOA 5DGXA 2ZJYA 2H1IA 4TKUB 3G5UA 4PSDA 3O5AA 1XPUA 3D0OA 3D8TA 2J3LA 2M1XA 3TNFA 5J43A 3V80A 3ER6A 3FNRA 4E0BA 4OI1A 1UJ4A 3W9YA 4MCIA 3EVZA 4DB2A 4L16A 2LVBA 4I9HA 4YDYA 4DREA 2QY7A 4J07A 3JCZA 3KUUA 1VHLA 2PGLA 1T26A 2Y0DA 4G9BA 2OBNA 1YKGA 1WZEA 1W2GA 2XDWA 1R66A 3NBAA 3HXKA 3RS3A 5BMVB 1T43A 1VDZA 3PQ5A 4DNOA 2FJ0A 5IKPA 3RRYA 1GPYA 5KOJB 5HQ3B 3ZWAA 1YZGA 3CG4A 3UPVA 4QQIA 1WV1A 1M9NA 2XE4A 4KR0A 1B26A 3HRHA 1M7HA 2Z0MA 3CKLA 5IZCC 2C4NA 4R83A 3EVAA 3DCYA 4I5FA 1NA0A 2OG2A 3MWDB 3ENKA 1B2LA 5HKKD 3GZNB 5D87A 5KB3A 1IUPA 3K6RA 4BCBA 2I2AA 2VLBA 3ZIMA 1OBHA 3DXYA 4WBNA 4FMDB 5A1JA 3WWYA 3BFKA 3S8MA 1VSTA 5HVNA 2O06A 1ETHA 2C95A 4KZPA 3ZCRA 4Y18A 2DGDA 4LRWA 4MYHA 4P34A 5AK4A 2ORED 1SC4A 3KSLA 1GRQA 1PTJA 5A0TA 5MN6A 3QWIA 3S70A 1JALA 5AM2A 4KQIA 5A23A 5CLQA 3HXOA 4ARVA 1LS1A 5EMJA 2Z5LA 2ZTHA 3IEIA 4R8VA 1XEWX 2XRYA 3LJNA 1JMYA 3WNDA 3SNKA 4RTKA 5BYKA 5I3ZA 2FMHA 3HSKA 2GK4A 3DOEA 4U2EA 1CUFA 2OZEA 3PRYA 3Q98A 3L7CA 1JVBA 3CR3A 1L1QA 1DCMA 4RYDA 4JBHA 1UBCA 2JAPA 3SK0A 5I7AA 3MERA 1XFAA 4WOJA 1DOAA 4HLDA 3GVXA 3LI2A 5CYPA 1FLAA 1YHNA 1PFKA 3F3MA 3DCNA 5EPUA 3E9NA 4WGGA 4CYMA 1O9HA 3S81A 5DHRA 2CB0A 2NO7A 1XWFA 4PCAA 5HF8A 4J3NA 4ZPXA 5AJWA 3DMHA 4R3WA 4TMFA 3WLJA 1KEZA 3WVNA 3G8DA 1XSEA 1T10A 2GQ0A 3QEMB 1RPTA 5KVVA 1FQWA 2C9DA 4OYSA 1ZNXA 2XLBA 1V3UA 2AMFA 3WRXC 3N0TA 5JAQA 4MUYA 1HWYA 4O2BA 3F0TA 4HAVA 1RJWA 3CPHA 4FDUA 1AM4D 5FJJA 4EO7A 4I1UA 2O23A 4UEOA 3PCTA 1EVEA 2FWRA 2XHEA 2W2LA 4CU5A 3HP1A 3TE6A 2ALJA 4DUPA 1EK0A 2IPXA 4CL8A 1M0SA 4FGKA 4JPSA 4ZXFA 4JC4A 1IXSB 2ZJ2A 5REQB 4HH4A 1I4LD 5I51A 4R2KA 4LZLA 1G4AE 5DX0A 5CA0A 2VYVA 2NO6A 5JEDA 3NRBA 3PC6A 3FJYA 4L5BA 1R3DA 3NUQA 2ZE5A 1Y3DE 3P71T 3O9ZA 3DMTC 3EWIA 4P98A 4N41A 4IDEA 3K8QA 5LQCA 3WMFA 3K16A 1U0BB 1ECCA 4HRNA 3PH0C 2J4FA 4KNVA 5A5DA 2ILTA 5T4BA 2FFAA 1QXSA 2DPHA 4C2TA 5I7EA 4P0QB 3LWBA 3IT1A 1CHDA 1TEHA 1ONOA 1K8XB 3RS4A 5DJ5A 3Q72A 3W5BA 4Y1FA 3E7PA 1QGOA 3KTOA 1MLDA 5K0TA 3PX3A 5AH0A 1NSFA 4G0UA 3JD0A 5CRUA 1RHJA 1JI3A 2D1TA 2F1RA 2Q4OA 5KNHD 5EN4A 1T4GA 3IGFA 3QHAA 3GT3A 4OJNA 3KHSA 3KQWA 1E5VA 1Q1EA 2Z6UA 2VPTA 2VNAA 2D54A 2VZLA 1Y6RA 5FH9A 5SYMA 2FGJA 4O25A 2XUHA 3PNYA 1CNEA 3FYHA 2QEQA 3LEWA 2XGOA 1IZYA 3ISVA 2FRXA 4LJYA 2LWIA 4ND8A 1GU7A 5G0VA 3GLIB 1RXYA 1JJFA 1DV1A 3QQPA 4D0RA 1F1BA 5FWXB 3MYYA 3NT5A 4OKSA 3ASGA 3RIMA 2HFKA 3X0DA 4FFVA 1SHLA 3F7MA 1UBFA 3ZLJA 3HFJA 2D5CA 2BFAA 3LLCA 3C7DB 4APOA 5H02A 5EHXA 4N7JA 1IL0A 1MQSA 3KEZA 2Y27A 4AKHA 3FBTA 2OEPA 1KT0A 5BYAA 1GV0A 4LA4A 1P77A 4D8XA 2ZM6B 1S89A 4BMVA 1FDIA 4KBYA 5KBYA 4U9HS 5AHOA 3HFRA 3PL1A 5J2UA 4F12A 4GA2A 1MORA 3GCGA 4Y2UA 1R0LA 5EHZA 1VGRA 2BKGA 2YICA 1U81A 4HQKA 2VNKA 3KXIA 3BIWA 3JTEA 2RI0A 3HCEA 1H6AA 4DSOA 1GUZA 4IGAA 3S7BA 2F2TA 1S2IA 1JKMA 1Z25A 3LPDA 1XKQA 5DMXA 4HOUA 3AW8A 2BBSA 4NZOA 5IN4A 2V6GA 1DAGA 1NBOA 2PBLA 3A2NA 3MIIA 1BGXT 2J8SD 1SXJB 4BB0A 3CRRA 3DSSA 1YS1X 3CLTD 4MV0A 4MQFA 4Z9BA 5CVVA 3AZOA 4Q4LA 4APFA 3AF1A 4RKRA 2HDNB 3URKA 1XL0A 2VF2A 5IEJA 3O26A 4KK4A 2OLKA 4B82A 3WKDA 4LI3X 4OX9B 5JHBA 4AAYA 5JIBA 4WAUA 2F8MA 3PEUA 1GZ6A 3Q11A 2EJUA 2OB1A 4KQJA 3F6RA 2CK3A 4MS4A 4K2AA 2DFDA 4F93B 1AZTA 1F2UB 3NBUA 1YUMA 1W46A 2IOYA 4D8WA 2RH5A 4CEHB 1KGDA 3KOWA 2NZJA 1Z35A 2RAPA 4JSYA 2I9KA 3VO9A 1OXXK 2B6HA 1E1LA 1SVIA 4YMHA 2GCNA 3DBRB 3DTVD 4CKWB 5ICFA 3QW4B 1Y5NA 5LCWC 3TVDA 4HEA1 4NE2A 1H8EA 1HE1C 3W3AA 4ETWA 1CRZA 2EYQA 4TV8B 3GFPA 3FSGD 2E55A 2DTDA 3DW3X 5DYTA 3STYA 3RR2A 3FFBA 3MG9A 4ZAVA 3B9BA 1ILEA 3TOZA 3OCXA 7MHTA 3RK4A 1OCOE 4XDZA 3WL3A 5EIDA 2FUG6 4DV7B 1Y6QA 4B93B 3O4RA 4J7UA 1U0GA 3LOUA 1US8A 1DIAA 1OBCA 2AMJA 3PGVA 1L9XA 3PI7A 3HGTA 4OCZA 4X93A 5T3UA 3REFA 3FU3A 4UHFA 4G8CA 2BKXA 5H80A 4RHXA 4ZI5A 4FOTA 2J9FB 1HTTA 2HK8A 4BVEA 5EZYA 3R3UA 4BC1A 4YAIA 3OEHD 4IQGA 4EDFA 4MDEA 4HDNB 5CCEA 2WU8A 3GCZA 4EVRA 5JJTA 5EQFA 1EBBA 4MKXA 3SZOA 3TSOA 1JWGA 4DMGA 4R41A 1U4NA 5I9TA 1HNZB 3F1LA 1Z5OA 3ZTTA 3DZIA 3R6LA 1DJLA 5FPTA 4GDMA 2V7QA 3OKPA 2PE5A 4QQFA 4YNBA 3VZPA 4NACA 4K9QA 4H59A 3JCKC 3EIWA 1VMDA 5JCOA 3IDQA 3FYDA 3F7TA 4MQEB 4ZEVA 4UEWA 2GM5A 5FWQA 1ACLA 1XC7A 1K3ZD 4ZO7A 3W8NA 4PX2A 3D9QX 1SRRA 4GKJB 3JQ9C 2GAOA 1P4SA 1URPA 3RVLA 1TUIA 1WRBA 2A57A 1P2FA 2RFMA 2H57A 5B7QA 3N7UA 4YRLA 3P5SA 3OECA 2QOEA 4HLUC 4B34A 1TFUA 5JO9A 1ZRHA 3VGPA 4XR9A 1TM2A 2W2LD 3IVRA 2O8FB 5HILA 1XZMA 3EPHA 2DERA 1RIIA 4RTSA 4RADA 1RPAA 5HGJA 4AZTA 3ZHEA 1D5WA 2FPMA 1KKMA 3U4GA 1YOBA 3HDQA 1JPLA 4H15A 1N3YA 5FPPA 4L8FA 5EMLA 1FX1A 3DSUA 4AJ9A 1L5SA 2NSYA 4A6PA 4DILA 1G20A 2HLPA 4EGFA 4OXRA 2OORC 1U2QA 4F7WA 4JBYA 1BJKA 3FLBA 4JI0B 1NW4A 2QROA 2H52A 2D1FA 2E4ZA 3GGJA 3X1WA 1Y4ZA 4YVOA 4M9RA 5F21A 3TAUA 3GPDG 2IY0C 4HGNA 2ZUEA 2YINA 4JB8A 1SUFA 2VEDA 4DA6A 3WK7A 2JBAA 2ZJBA 1EJ2A 3K9NA 4Q01A 2OMEA 3A9CA 2K87A 4KDEA 4ES6A 2X0IA 3ROMA 1QPBA 3SQNA 1NBAA 4PN7A 5JZOA 3LFTA 1N4AA 4QQRA 1WR8A 5ENVA 1IJEA 1UOHA 4YCBA 4NMLA 4WBNB 2JRLA 3W2GA 4CF4A 2GRAA 4X41A 5AJDA 4FBLA 4NBUA 3ABQB 1DP4A 5CDSA 3O21A 4UBJA 2QWXA 3HZOA 3TCKA 3TNDA 1RHMA 1EFAA 4KJXA 1IATA 4AIFA 5CRVA 2GTHA 1LWOA 2QG6A 4GWLA 3CK8A 3L8MA 5DWVA 4HVLA 1GO2A 4ZIRA 3PNTB 1OIVA 3IEKA 1ODCA 4Y3UA 1Q14A 4Y6SA 1H9AA 1XZPA 1HA3A 4UUBA 3I0MA 2PT6A 3AC0A 3VI4B 4TLLB 4MP6A 1GKYA 1M1YE 1GDDA 4RG9A 1YDGA 3OQIA 1G8MA 1VB5A 3KHUA 1FNNA 4HWPA 1I4OA 5E9JA 4TLCA 2MHKA 3LL7A 5BOVA 3P1JA 2HXGA 2WHEA 1L7VC 3C6BA 3G2OA 4ML3A 1KJ8A 4G5SA 3Q5MA 3DO5A 3IKMB 3IUNA 4X1YA 2R8YA 3I52A 1KFEB 3KKQA 1A98A 1Q7CA 2QMHA 3ZWXA 3CQGB 4AYTA 4EAAA 2A0XA 4UMDA 2ZRKA 2ZKLA 4YYEA 4Z3KA 3HXMA 4G3XA 3K70B 2O4CA 3DLTA 3VPDA 4C05A 1PN3A 2J49A 4ZV9A 4PHFA 3IPCA 2P79A 4O2BB 4PLVA 1G3QA 1JH9A 4BFSA 1MVNA 1JI0A 4F53A 2RD0A 3G3EA 2F0YA 1H5UA 3UMRA 4A1OA 5DTJA 5ENQD 5K01A 1QFJA 1N4RA 3LQ1A 3DBIA 4ISCA 2XCLA 4C01A 1DCTA 1Q0HA 1ZA1A 2FBNA 3EXHA 4DLKA 5LSAA 3ND9A 4WCFC 4HNVA 1S01A 3QHQA 4Z7OB 2VH1A 1T2DA 1SUPA 2VH5R 5CA0B 5JZBA 5A0FA 3GFVA 1OT3A 3O4JA 3QVJA 4W7IA 4JZYA 2QXTA 3MW8A 1ATZA 5BN3A 3L01A 3VZCA 2W0SA 4GKAA 3B8EA 4S04A 5FIOA 3KLOA 2CK3D 3F78A 4R54A 3NU1A 5HRAA 1YIOA 5C52B 5CCXA 1LX7A 4QT4A 1NVGA 4KC0A 5E3HA 3T38A 3HYSA 3A26A 3BSFA 3HVEA 3D7LA 2FHPA 5JUWA 2O8BA 5IWCA 2IIBA 1B8NA 2AI2A 3FVQA 1R2QA 1XTTA 2PUWA 3OHPA 5G4KA 1H8ED 5TR9A 1UBRS 4MVJE 5FA8A 5C34B 1LNQA 3MWGA 1YKSA 3G7NA 5L9AA 3TQHA 4TYMA 4R1UA 5AQ1A 3T4EA 3OM9A 1H6BA 2FW0A 3IOYA 1SBZA 2P4EA 1YZ3A 2RHBA 1CDOA 1ZNZA 4Q3KA 2BR5A 1B6TA 3L4BC 4FLFA 3IBTA 2XSZD 5BUZA 3AVWA 3ZD7A 4M1TA 2AC2A 4JGGA 3E18A 3DV9A 2OLEA 2AS0A 1OAOC 3FA2A 1N0UA 1FW6A 9LDBA 2BC9A 4C4SA 3BIOA 2LUHA 4ND8B 3KKZA 5TX7A 1PKEA 1KH2A 3DOFA 4M1SA 3DB2A 3PV0A 4UOZA 3LCAA 4A5OA 3DFMA 1FDSA 1KJJA 4JUBA 1SIUA 2V7TA 3OKCA 4FE3A 4OH1A 1ND6A 4ZVNA 5ULLA 1M74A 2FMUA 3H8WA 3EYAA 2X13A 1YOVA 2ODBA 4WNIA 1M2WA 1XP5A 2JCGA 3R2JA 4B6PA 3PDHA 4BMYA 3O8DA 4EI7A 5SICE 2V7QD 1RKVA 3FFXA 3PHHA 2XZTG 3H1TA 4EBAG 4C2AA 3RVJA 5LJLA 3I32A 2VI5A 1VQ1A 4F8EA 3RVMA 3Q9LA 1WSAA 3ADDA 3HV2A 1XMQB 1L7XA 1W8IA 3BMOB 2FQYA 2JARA 2PPLA 5C7OO 3PNSA 3FJOA 4JYCA 2DQKA 5J2UB 3IDSA 2H0QA 3OLXA 1M33A 2GFQA 4BLOA 4EPTA 2Z2XA 4N3GA 4DUZB 2V8SE 2IYSA 3IA7A 3QKUA 3LS2A 4NEQA 1N75A 5J1TB 4CG3A 1VCMA 3CLJA 1K3TA 1UKAA 1GW6A 3NO4A 4F45A 4WLUA 2GJKA 3AO0B 2YMLA 1M6EX 1L4MA 4A3TA 3SHVA 4S1OA 4CLXA 4RMJA 4D0GA 1USUA 1RHKA 4B2IA 2YR0A 1WEHA 1II9A 4ER6A 4J0FA 5IANA 1R8SA 5M7EA 4MYCA 5DTMA 2PA0A 1CIVA 5GJWC 1HL7A 3VOBA 1J0AA 3W79A 5AVQA 4ND4A 4YTEA 1SM4A 4R1PA 2GHIA 1N5IA 4MQFB 1I80A 2RG7A 3EVDA 3K0BA 4U7TB 5IX8A 4A8PA 3CXUA 4EAQA 2B8TA 1R8QA 4G4IA 4JI4B 4RZHA 4D0SA 2AZMA 2OKCA 3PXAA 4OYHA 3RVSA 3PEUB 1MN6A 1UN8A 3ONLA 2XKAA 5FBQB 5H16A 2BF0X 4E15A 5BQPA 5BRJA 4N18A 4MS4B 4YP9A 1HDRA 3QX7A 2CUZA 3MKQA 4JJ7A 3PXBA 5DGCA 5EZ5A 3QPVA 4D97A 1T8YA 1WTAA 3DAFA 3Q3VA 3G5AA 3MJDA 1BEUB 3KEFA 3OPQA 2H5IA 3M49A 3FUNA 2V8OA 1FS5A 1R00A 3KVVA 1DRUA 4HNGA 2F1HA 3CISA 4JH0A 4EA7A 2ZXFA 3LX5A 3VI3B 1A17A 1ZO8A 1RQRA 1Q7RA 2O0LA 1RYMA 3V2HA 4BUJA 1ZK0A 1XNQB 1QCCA 3KB1A 1O5IA 4RZUA 1Z5UA 1TOAA 2KS6A 3FMOB 4DX1A 1PV1A 2NXNA 3MUNA 1H0RA 3EX7C 4R6XA 4B6GA 2HXYA 1U6IA 3H9EO 4U7WA 2FEWB 2AXNA 2O3TA 3X2SA 1OLOA 1US8B 4IJMA 4GQIA 2R84A 1CU1A 1DFHA 5T3YA 2QK4A 4LKRA 4D9GA 4TZ6A 1H5NA 3EGCA 4OGWA 4M54A 1GHTA 2IXTA 3FUWA 4KGDA 3N8IA 3FVVA 3H1AA 4F3RA 2Y1LE 2ZBEA 5AKIA 2LCFA 4AUKA 4W5RA 2JIZD 3TS1A 5EZYB 3IKTA 2PMEA 1T3TA 5JD4A 2O1EA 3QX3A 1JLSA 3P9NA 1SUCA 2GZSA 3LVRE 1OX6A 1BQ4A 2C9BA 4AO6A 4JP3A 4ZYVA 2W6QA 2Z4RA 1LXCA 1I10A 5BORA 3SF8A 1TW3A 2ZBGA 3ZS9A 5I6DA 3KSZO 4I1RA 3L7KA 1XZCA 4MUKA 3FZYA 3CX4A 1GSIA 3ZU6A 1LVUA 2G3YA 1QTIA 2OZLA 4E5DA 3WY9A 3LUCA 5G04C 4L15A 2DX7A 1JJ7A 3FPGA 4XX1A 8ADHA 4AI6A 1FVXA 4LW8A 4C20A 2AEJA 5IWAB 3FI9A 2BI4A 2EFJA 5A06A 4ZOAA 4AKSA 3O0DA 4TL7A 1P7CA 5ED4A 3O7MA 3VZDA 1R0ZA 3UXYA 4R8RA 4P38A 1XEAA 4D9JA 2XNSA 3DE4X 3VDRA 4RTMA 3WL7A 1KEPA 4YC7A 1GRNA 4JJZA 2O54A 4J0QA 3JUEA 4MZXA 3ZHEB 3SEZA 4HFRA 1Z26A 2DETA 4KIGA 2G8NA 4G37A 3Q73A 2NSJA 3C0KA 2PS3A 4YROA 3F5SA 1YQXA 1F7UA 1SU7A 1H6PA 4XE0A 2QLFA 1QQ6A 3RBAA 1DKUA 3VUEA 2DVWA 1CUYA 3A2KA 1TECE 3ZEAA 1B89A 1KDYA 1G20B 4E21A 1DAEA 1Z0JA 4C08A 5KTNA 1NQXA 5A7GA 5KWJA 2IF2A 2P2SA 5E9WA 1YQTA 3QGMA 4MWCA 3D9PA 3Q1LA 4IFTA 1M34A 1Z73A 2A9PA 1F6BA 1TVMA 4OFBA 1HH4A 2W4IA 3RTEA 2GD6A 2WEKA 3PJRA 3T3DA 4JSTA 5AR1A 3G2NA 1GPBA 2MU1A 3V8BA 3WQHA 3KZMA 2B3DA 2JBAB 2FN9A 3S55A 1H0AA 1BMTA 3IJRA 4L4RA 2WV9A 2PUBA 1V8ZA 1ZCAA 3LWDA 2GRQB 1KI6A 3OMXA 2EX4A 2YJTD 3L1VA 3URZA 3TR5A 1B93A 1HORA 2D0PB 3CX3A 1J42A 1O1YA 3I9FA 1IPEA 4PZAA 4UBKA 2YQ8A 1OY3D 2ZSEA 2TSYB 4LV6A 1TQHA 2Y9PB 2BGTA 1AA9A 1WQ1R 2DM6A 4ZCPA 3QVVA 3RUEA 4CE6A 1E9SA 1TYBE 2JC3A 3TWUA 1OE0A 1B3BA 1C0PA 4UOQA 3JZIA 4K6FA 3PRZA 3BE5A 5CPBA 4N5CA 1FF9A 2FK7A 1QHHA 2E2EA 3PB3A 2PWAA 3CBQA 4XD2A 1BXKA 2R2LA 2AN9A 4ZIRB 4B43A 2A7XA 1YC5A 4G1BA 5JNSA 2Q3HA 1X7WA 4Q69A 5GTDA 2DUNA 3C3WA 1NR7A 1MD9A 2J07A 3OQIB 3SIWA 5K8LA 5G0SA 2F3UA 2YS6A 3ABZA 2CNNA 1W0JA 2YHSA 1RWWA 4I6GA 4X1YB 3N5KA 2GEBA 1AZWA 3MLBA 2DSNA 4IFBA 4XIIA 2KCVA 3FTPA 1LBEA 4DX2A 4JOQA 2PA3A 1ECBA 5JBIA 2KZTA 3IDZA 1XF1A 3HDVA 3RS0A 3ICWA 1YC2A 3ZK7A 2VP5A 4MUEA 2JLSA 2GBLA 4OP3A 1ZMBA 5E6SA 1UK7A 1VCNA 3HCWA 4LWPA 4TMZA 4N47A 1XHLA 3AVOA 1CIJA 3ZDRA 1BW9A 2XTZA 3DLPX 1E1RD 4RENA 1TT5A 4JJFA 1JNXX 3MX3A 2J9ZB 3E5RA 4K9NA 2TS1A 5TS3A 2Q6TA 1AS0A 3SBTB 5EL0A 2ON6A 1WWKA 5HGXA 3R40A 4L6AA 5AXBA 3EXHB 4FI3F 1QO7A 3T9EA 2AN1A 1U1IA 2IU0A 4JA9A 3RTDA 4EMBA 1BKSB 3AOEA 1RYDA 4R9VA 1ELRA 1Z15A 1XTIA 5J5AA 1JR6A 2J6HA 4IIGA 4MQBA 1PQYA 5LP6F 5BN3B 5M5BA 2I6UA 2FWJA 3FOCA 1HKHA 4ERNA 3OZBA 2Z8XA 3IA2A 5AXAA 2J5RA 1W76A 1DKOA 1JRLA 1XCGB 1LSSA 1WZ2A 1M6YA 3GH1A 3LLVA 3ADOA 1VLMA 4KN8A 1OFIA 1IK4A 3HVEB 1R64A 2O8BB 2H18A 1PNTA 4TGLA 4C4OA 1CLEA 2C3OA 3WJ7A 1YDHA 3OESA 2X0JA 5G4KB 4LE1A 1HSOA 4Y6OA 3THXA 4QICA 1TTTA 3QU2A 4WKNA 4DM7A 3NB0A 5BSTA 2XE6A 2CFRA 4P3NA 3GJYA 3AY0A 3RLFA 4PYQA 1ISPA 5JPIA 4YP1A 4E4TA 4BE7B 4GX5A 3WWDA 2WPDA 1N6LA 2NZUG 5DGHA 4CIYA 4Q18A 3NEYA 1BO6A 1O1RA 1SGWA 3C8UA 5EKXA 1WXEA 1SVLA 2I29A 4QUDA 4ARCA 3RUDA 5TEVA 1QQBA 3NVAA 3H9UA 3AFHA 2WXRA 2ZBRA 4M1MA 2FPPA 5AUPB 3NAGA 2FPSA 1E5TA 3UJDA 2IO3C 2WWTA 3RU7A 2D1QA 2EW8A 4K46A 1VFPA 2BYTA 3TSZA 3BEDA 3L04A 4RS3A 4NE9A 4NZPA 2A5JA 3ENEA 1ELWA 1GYPA 3CMMA 1OXBB 1U0EA 3H05A 1YOVB 4Q3EA 5EJEA 1U7PA 1AA6A 3GJ3A 2W2OA 2GKOA 1NVBA 5TQ2A 3BQMB 4PNZA 5JXWA 4KGVA 1AK9A 2FPUA 1VBNA 4D26A 4A7PA 2VDQB 1DBRA 1ESMA 4LXYA 2QTFA 5JBQA 3OEED 4A10A 3EZ7A 2WAMA 5E1BA 2NUAB 3A6HA 3T34A 3D6TB 1X8XA 4E5PA 1YJBA 3U09A 2YFHA 1Q15A 1KO7A 5SY4A 2A86A 2ZYSA 1OXMA 2OCGA 3A3YA 3N8GA 4ZODA 3APCA 4KLAA 4R98A 3C97A 4OHYA 4U7DA 1H2AS 3EEBA 1PK7A 3C98A 1P5FA 2YW2A 1T4MA 2I7XA 4FYVA 4DAOA 2YZMA 3KD2A 1KAEA 3BDVA 1QHGA 2ZRQA 1XCJA 1LPBB 1DBVO 1CEEA 1RLTA 2BONA 2QLMA 3WICA 1ZK2A 3PRHA 3G2WA 4E14A 1NZJA 1H05A 4FS3A 2BE7A 3W8EA 4TKLA 5TGDA 4NYMQ 4U7HA 5ALJA 5BPPA 3ZH9B 3D4LA 3LGAA 1E90A 4G56A 3KQYA 1CULC 1HDGO 1O89A 1LX6A 4KMRA 4HV4A 4LG1A 3UMYA 1HF8A 1J56A 1D04A 4YRQA 4B7XA 4D2IA 1YQ9A 5TMDA 1Y6GA 4YRDA 4R6WA 4B3IA 2WUDA 5J59A 3VDNB 1QTRA 3MKQB 3CUUA 4NQZA 1M8JA 3F6SA 2CWWA 3DNPA 2FFJA 4P7JA 2FZWA 2BFCA 2CFZA 3MWFA 5JI3E 2IUFA 3DPUA 1JHUA 2J33A 5GOZA 1ZD5A 2B25A 2YJ3A 4PSKA 3KT8A 4ZP1A 2B9VA 4IXDA 1V1RA 1GUAA 1WBDA 1XDBA 1MC5A 3LY9A 3H6GA 2OKGA 4CT0A 2AZ4A 2TYSB 1PWYE 1W30A 5A9SA 3CH7A 2VCHA 1LDYA 3UMBA 2QW0X 1ML4A 1R4MA 3W9UA 1XGKA 4QC2A 2A9QA 4IM7A 5CDTA 3PNQA 4RSHA 3QH4A 3O84A 5EGNA 1MIHA 4Y6GB 2H6FA 2L9BA 3M5CA 2QMOA 4L8GA 3AG6A 1Y5IA 4HXYA 1BHQ1 4IH1A 3Q2KA 5AKYA 4LJ6A 4BGVA 1KJWA 4W5WA 3QKYA 1LDGA 2X0DA 4ZVMA 4Q19A 1FRFS 2C7VA 4CKWA 2RE8A 1JVNA 3JWPA 5JMWA 4HLNA 4RK7A 4OATA 2VNIA 1Q3HA 4HQFA 1ZH8A 4RA6A 1FP4A 2P9TA 1C50A 3SF8B 4KPFC 5C5EA 3OOJA 3U7FB 1XYVA 4LYHA 4IJVA 4DIBA 2FTKE 1L7BA 3L7NA 2PX0A 3OWOA 1BD3A 4QDJA 3MWLA 2OZLB 4Z8YA 1U8AA 2FLKA 1OPRA 1YS6A 3AF3A 2O7NA 4CR7A 3M89A 1U2EA 4F60A 2ODAA 4BGUA 5IULC 3SVLA 3ENZA 4O3MA 3ADBA 1G21A 4FCWA 3VU9A 2ZRCA 4MI1A 1T0UA 2NZ8A 2HT6A 3V1LA 4IHAA 3BQ9A 2YN2A 3TINA 1YR9A 3CE9A 3FRIA 5H7PA 2PL3A 3ESLA 3IAEA 3E9EA 1BSVA 2GYWA 3G1UA 4OIFA 5CBOA 4WHMA 1G8FA 4DCNA 2POCA 4E31A 1F14A 4QWWA 3UHAA 3D1LA 1UWLA 2C4TA 2D8MA 3CNOA 1N1EA 5I9NA 4ZXPA 4DGQA 3HG7A 3HVKA 3M5PA 1V4BA 1DEXA 4BRSA 2CNWD 4GWGA 4OP2A 3W78A 4HS9A 3N8KA 4ZK2A 1V7CA 3HDXA 2Q5OA 5FFNA 2LNDA 3CVNA 2OILA 4K5AB 5KNCA 1Q0TA 4MPJA 2OXFA 4L8YA 2Z58A 2NP6A 3A6LA 1CS4C 1GGHA 5SY6A 4UNNA 2Y99A 3H5VA 1H1LA 2PLFA 4DMHA 4PLZA 1M34B 2GWRA 1I51A 5JV5A 1A7AA 2R85A 5DNEA 3KAKA 3B2NA 4F92B 4NZ9A 2NVOA 4BX3A 3LTEA 1DTSA 5I8PA 4BVBA 1CDDA 1SPBS 1VXOA 2HRBA 1Q84A 2BL4A 8AT1A 1WQ4A 1NONA 4EQZA 4JL6A 1KI6B 4EHHA 3W4JA 2HF9A 4PLYA 4E5MA 2FW1A 5KBAA 2CLEB 2AMYA 4BN0A 5CEEA 1QHNA 1TUBA 3UAWA 2WIJA 1LBIA 4URUR 1Q20A 2RHMA 4H7HA 3BQOA 3DM9B 3EDQA 1PHPA 3O93A 1PYGA 1BWSA 3K1AA 1ACMA 2AV6A 1TIBA 3TXNA 5BSVA 2Y4NA 2IYXA 1SVOA 1MOSA 2PX5A 3VSBA 1ZSNA 4BE9A 5C8DA 9GPBA 2K2WA 1QHHB 3DSXA 4TMXA 2RGXA 1AQ6A 1IH8A 4UUAA 3RAGA 4XIGS 1SU8A 4NRDA 2YNMA 3I1JA 3ZDBA 5JSZA 1KJNA 1QHEA 1W2HA 4WBSA 2XHZA 4M9SA 4E11A 4KREA 3Q4GA 5JW6A 4RULA 1X7WB 3TQIA 4HS2A 4IINA 4B8ZA 1TVEA 1E0JA 5TV2A 2P9YA 5F4BA 5DIZA 4JKIA 1O0SA 5C5CA 2QX8A 4PC7A 1P0PA 2HU7A 2XVMA 2HHHB 2NZVG 5LWHA 1ICEA 1W59A 1M5RA 3F5FA 3VR6A 3SQVA 1LBSA 1XV5A 5A3JA 3OICA 4IOLA 3L0OA 3GGSA 1G5PA 1IG0A 1IY0A 3R74A 1EX9A 2Q3FA 2KZTB 5F3RA 4KDRA 3WWEA 2Z6VA 4JT9A 2HQ1A 3PVCA 3ZYZA 1WSWA 3GJ7A 1RADA 2O2JA 1MCZA 1P1BA 3P9ZA 5C37A 5EUQB 1TEVA 10MHA 5E6SB 4C7JA 4O2AF 1V6AA 2YWFA 2E1RA 4R7TA 1GKLA 4EMUA 1BW9B 4QAJA 4MSUA 1TT5B 1P4AA 3L9WA 1GT6A 1L5RA 2X8AA 7REQA 1F20A 5HS0A 3MTBA 4I14A 1O4WA 2BEUA 2ETCA 3LU1A 3WTBA 2V45A 5HE8A 3DDUA 2JVKA 2VHJA 2ZI9A 4PO1A 4J49A 3L77A 4H4CA 4DR4B 1W47A 3MWYW 3ZHRA 1WX1A 1Y5RA 4EQFA 1HYHA 3L9XA 1L1RA 2GR9A 1N36B 1LCIA 2ZRMA 1YRWA 2ETXA 4UE6A 2WP0A 4CIBA 4UTZA 2HA0A 4II7A 3NHFA 4NCAA 3COWA 3IVMA 1X8JA 4DUGD 2H2WA 3TH5A 1KAHA 4P58A 3UB3A 2XEDA 1ZOIA 1NY5A 3WGKA 4NK5A 3U7IA 5I7HA 1FNBA 2BKLA 4LUNU 3G2KA 2O0MA 1MX9A 4MGYR 3OE5A 5F98A 4WZAA 1UEXC 5F78A 3B1VA 1PEKE 2PD4A 2CV0A 1JKFA 1NVXQ 1A5AB 3DFKA 4ERXA 2VK4A 2GH1A 5ECGC 1LF8A 5AVOA 2ZJFA 2I6FA 2I3ZA 3H4VA 1W4ZA 3QF4A 4DKXA 1MHQA 3T06B 1SXJD 3THXB 5HZHA 2NO5A 4AFNA 2FU5C 1K3UB 3V1MA 1Q2XA 821PA 3NHWA 4HX5A 1LDEA 1B0ZA 1UJJA 3Q1KA 2Q07A 4RBNA 3ZNGA 2FSUA 4E4RA 5JD3A 3FR7A 5CFQA 1NBEA 4BYMA 1K63A 1J8DA 2C2WA 4X1KA 1WEKA 4BO1A 3UOGA 2ZWPA 3QOFA 2R5NA 4WL0A 3MS4A 4YALA 3FKSA 2BZSA 2G36A 2Q5CA 2UU9B 4DWWA 1XHFA 1VKRA 3D6VA 2LAIA 3AHJA 1HNNA 2P3QA 3DQQA 4KL8S 1E7SA 1WDTA 3NT4A 2FPPB 1W3BA 1U2TA 2NV0A 3VPXA 3OE7D 3GEDA 1TW2A 1G6KA 1N32B 4LECA 1E6UA 1Z5GA 2QYUA 4UI9C 4UWFA 1LD8A 4V0LA 1HZZA 2CW5A 1U3DA 5FUQA 3SIPA 5JBNA 3KP1A 3P2BA 4MQUA 5TQ2B 3TR6A 3NWOA 3RRUA 4H6XA 2OAP1 1GL3A 2EQXA 5BUQA 5LD2B 3L4SO 4GEGA 4LOAA 4PE5B 2DR2A 1NW6A 3WGNA 4MGZR 3CCBA 4NBNA 3V1KA 3KZKA 3ZCQA 1U9JA 2WWYA 1R16A 3FTVA 4QFMA 1JFTA 2HQOA 3G17A 5BQ5A 1JR3D 5CUQA 4IX1A 3KJXA 5DP2A 2WJYA 3B6MA 5CJJA 4OSPA 4C1NA 2J7PD 4NFLA 2XA1A 4OHZA 2YL2A 3O1IC 4L3OA 2XCCA 1U0HC 2FWAA 5LP6A 5HFJA 1XD9A 2ECKA 3UNXA 1U3WA 3HJGA 2CFCA 4OB6A 1UPCA 2WZBA 3TN7A 2FEPA 3JWIA 1R7RA 2P5TB 1P73A 4JLVA 1ABEA 3E5HA 1Y8RB 1K27A 1OXSC 3LDUA 4Z68A 1VXRA 3B5JA 3L8FA 4KXXA 4ZAWA 4DUYB 2VFAA 2JANA 3HUTA 4KMSA 4PC6A 2BBOA 2AG8A 3GR6A 1EVZA 2YUIA 3FD8A 4ZYYA 4ZDJA 1Q57A 1XJ5A 1TMGE 1WO8A 1FP1D 3AH8A 1ULBA 2GILA 2FA9A 4KXUA 4XB6B 1CPYA 1GCAA 3RC8A 2FOLA 1DQPA 5ALUA 5JWRA 1QE3A 4QELA 2AIRA 4IEIA 1XTUA 1A2QA 3BMOA 4IY1A 1A9RA 1OXJA 1CB7A 1EUYA 4ZTBA 2W43A 4C4YA 1QM5A 2HLDA 4QFCA 4BO4A 5EP1A 2ESRA 3A3KA 2PRJA 1DIRA 5F5LA 3O3CA 3G7SA 4ND5A 2HU5A 4DX6D 2AYZA 4HAWA 2YRXA 1KHTA 3IMFA 2AJCA 5ALKA 4QUBA 1MB4A 3E03A 2IVFA 3GMTA 2XB4A 1G0NA 2BFCB 3WGTA 4UXIA 2MYTA 3O3OB 1OVMA 1AXEA 3EVEA 2KCKA 4BFLA 1RQ7A 2EJBA 2WWXA 3ED5A 2NSZA 4D42A 4BQIA 5IM4F 1QP8A 3QPWA 2EZ4A 1H4QA 2OHGA 1U5CA 2H9IA 2P5YA 2XEVA 4BP3A 2FFQA 3I0NA 1V1RB 3B1ZA 5JCZA 4BESA 3NVMB 2QVYX 3WI7A 2CVPA 3HR8A 4J9VA 4R8SA 3G2VA 2IYLD 1E77A 4BNLA 2L6BA 5A9SB 5CGQB 4HWOA 3D43A 5LDDC 1R4MB 1UBLS 1SOVA 3HCRA 3P7MA 4EJSC 3PEWA 4IJWA 3ELYA 2P9BA 1SR8A 4H7KA 3L43A 4BQRA 4JLMA 3DOOA 3G88A 4BKMA 4LIPD 2ZIWB 2ANBA 4KAJA 3OUZA 3TTUA 2UUCB 1DQNA 4J0HA 1UDAA 3PNMA 4IH9A 3W2EA 4X63A 4DIMA 1MR3F 2B1QA 3ANSA 1OILA 3PHGA 4RA6B 1FP4B 3QKSA 1BJRE 4HZUA 1DDGA 3PFIA 2H63A 2NC9A 2CFOA 1DAPA 3ERCA 4AULA 5DNDA 1BX3A 1ADBA 3VNQA 3WBBA 3W9FA 1H2FA 1JQAA 1XMJA 4MO2A 3WLTA 3W04A 3DWEX 3PUWA 4LF9B 2CMGA 2JDIA 1EZZA 5E2IA 2C83A 1J5PA 3Q9UA 1C14A 3HB1A 1KPSB 2EBFX 4TRQA 2Q3MA 4B0OA 3ISMC 1RLJA 5HOEA 1XMIA 2R9VA 5THQA 3KXPA 3HA7A 2Z04A 4N9QA 3BKXA 5F7JA 3CY6A 2AEMA 3A3PA 3T3HA 4KFTA 1G21B 3VU9B 2WXLA 1A9PA 3R8FA 3WYCA 1S8FA 3C4JA 4UTNA 1AKUA 1JNYA 4P92A 3MHTA 3ULYA 1WMDA 3TFQA 2IF0A 1MC1A 4MMXB 4F06A 3THYA 1XTPA 2GX6A 3RWOA 2HMTA 2OO5C 3ACDA 1YB1A 2RONA 4J6EA 2GYUA 3N2IA 1E2HA 5EJ6A 3UV3A 3VHRA 2ZBQA 4CYMD 2KXPC 4HEJA 1O0BA 2GXQA 3FCAA 2A9VA 1S9DA 5CM9C 4JVOA 1ZHFA 5HIKA 2A9OA 1W44A 2DWCA 3K70D 5ECDA 5GPBA 2A1IA 2VT3A 4U2BA 4ENSA 1H1LB 2RH4A 4GZLA 2W2KA 4GZCA 2OSBA 1YSCA 4WXEA 2FQQA 2QRJA 3M34A 4WWOA 1P4RA 5DHFA 13PKA 3TSAA 1FRQA 4J3JA 1T29A 3KQTA 4K5BA 1TCVA 1P1IA 1VPLA 1R74A 3DNMA 4AL4A 1IQ0A 3DMGA 4MDFA 4XLLA 4UU0A 4D6PA 2C7BA 3EC2A 2VYVD 2PPVA 3ZVVA 4QU5A 5PNTA 1SJ9A 1TUBB 3Q40A 2DG2A 2IVZA 3BTVA 4EPXA 2F6RA 3ASNE 4XX5A 1CHNA 1UXHA 4LMAA 3DZBA 3DPSA 2CEKA 1PL0A 3K1AB 4FYKA 1R0XA 3ZDCA 4OJYA 3FKSD 5J40A 5CPFA 3AHFA 2ZXWE 1IULA 4J2TA 5I8ZA 5C1BA 4MUGA 4CDMA 2O8VA 5L7WA 2HRCA 3FCOA 4BLTA 1WXGA 4DLBA 4J1TA 4EHDA 3UT7A 2BRUA 5AW3A 2XUGA 2B1JA 4KB5A 5JSZB 4R01A 4QJIA 2H85A 4Q4AA 1SQ5A 4TVOA 1DSSG 1OQAA 3CK9A 4ZT2A 4P7GA 3BMQB 1TQDA 2WAXA 2EINE 2CXPA 5DH9A 3BGDA 1OI7A 1CIPA 2HSDA 5E7JA 4R2XA 1E9CA 3WK5A 1E3EA 2QG4A 2PWZA 3MCVA 4C88A 1SH7A 3R9MA 3KJQA 2XMZA 3VNRA 3KQNA 4G26A 3QJYA 2LXNA 4AJLA 1OV4A 3D5QA 2DYKA 5EKDA 5KQSA 3UYLA 1O77A 1TX4B 3NHJA 5TQJA 3VRHA 2R02A 1QB7A 1BNCA 2ZITA 4NSNA 1T9AA 3U5TA 5DHQA 5M04A 1Y9JA 1FYDA 5LNK6 2PO7A 1ZM4A 1XROA 5JXHA 2YWXA 3HNPA 4WOCA 4TXLA 1B73A 1XT6A 2XCIA 1TMKA 4JYPA 4IPTA 2JAXA 1T3GA 4IVPA 1EP9A 4MPTA 7REQB 3FPEA 2BEUB 3LBAA 4L4YA 5FBVB 2AXVA 1I30A 1O6BA 3H5OA 2ZREA 4KVOA 3UGQA 3BF7A 1Z47A 1KOJA 4P4UA 3M9LA 3V8RA 3NPAA 2P9HA 4KHPB 4KQEA 3TR0A 1F7VA 1S96A 5JMOA 1K86A 2B6NA 5JAIA 4EHLA 2H29A 1C4OA 1R5JA 4GXRA 3KR9A 1KYYA 5KYVA 1LTKA 3CV0A 1KH1A 3QENA 3R9AB 3JX9A 3K15A 5C1IA 1HG1A 1N3BA 4KO3S 3FOZA 3TQQA 3ZV3A 5FNVF 1L8AA 4GL4A 1N0QA 4EHKA 4WKPA 2YY7A 5D85A 3CKCA 2MSNA 4R9UC 1M2HA 4BMDA 4WZAB 4RH1A 1KJQA 1XDUA 2I8CA 5FR2A 5A0VA 1UL1X 3UBMA 3AU8A 3TRKA 1C3EA 1E1DA 4TXHA 4DQDA 3CVLA 1PL7A 1YJAA 1VI6A 1PJAA 4MR9A 3QF4B 3NDIA 3NH6A 3JPYA 3VYRB 4B4UA 4RD1A 4ZI3A 1KAQA 3DO8A 3CHOA 1SCQA 2UZ1A 5DBIA 2GHQA 1INLA 4B3JA 3D6NB 3I8SA 3CFYA 2XPYA 2ZI5A 2WM2A 3ZYLA 2EF0A 5FORA 5K9ZA 4PXAA 4TV3A 2W2QA 1YA8A 2X2FA 4DADA 5AWFC 5C4GB 1GU0A 4B4OA 4X1KB 1PJLA 3Q8KA 4EKDA 3PFGA 1E2LA 5L95A 4RK5A 4H18A 4YWHA 4TN1A 4CG2A 1CW2B 2CHZA 3DXXA 4RL4A 3QWPA 2PQNA 2ZGVA 5BQFA 4PIVA 2HCRA 2ASEA 3HWX1 3RJ9A 3SM3A 3JQBA 2ABWA 2Z9CA 3JAWA 4IQFA 4PBRA 3T1TA 1X94A 3DGEC 3OFJA 1V5WA 3W3AD 1DE0A 5HMMA 1TZCA 2ARKA 3SZ7A 2D7DA 1MJ5A 5HF9A 5C1PA 4ONEA 1ZNWA 2Q6OA 1A5TA 5CFMA 4ROSA 4UHKA 2Q8QA 1ISJA 3OX2A 2DLCX 2D5IA 1GAXA 3PFKA 2GCIA 4RGVA 4ZQHA 4A55A 2GZ3A 3LLSA 2IQ5A 1CUCA 2J67A 2VP3A 3CLRD 1ZVKA 3HVRA 2VYNA 2CVZA 4NZYA 2WU3A 3L6CA 3NRJA 5LP6B 3MOGA 3BM5A 5LL6P 5G2OA 4Q37A 2II6A 4U2GA 2BP7A 1MZPA 1UJ6A 2QTTA 1ICIA 1XA0A 1ZUIA 4U7GA 4INAA 4L5JA 3REGA 4AS1A 3UTCA 4WEOA 3HS3A 4ARBA 3QQ5A 3FNGA 3D1JA 1RBZA 4I1VA 4LUCA 1GNQA 5DGTA 1CDEA