3FY4A

(6-4) photolyase crystal structure
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
522
structure length
522
Chain Sequence
GSGSLIWFRKGLRVHDNPALEYASKGSEFMYPVFVIDPHYMESDPSAFSPGSSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQEWKVKRLCFEYDTDPYYQALDVKVKDYASSTGVEVFSPVSHTLFNPAHIIEKNGGKPPLSYQSFLKVAGEPSCAKSELVMSYSSLPPIGDIGNLGISEVPSLEELGYKDDEQADWTPFRGGESEALKRLTKSISDKAWVANFEKPKGDPSAFLKPATTVMSPYLKFGCLSSRYFYQCLQNIYKDVKKHTSPPVSLLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMVQLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQFNRIYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIVGKDYPKPMVLHDSASKECKRKMGEAYALNKKMDGKVDEENLRDLRRKLQKDEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Functional motifs in the (6-4) photolyase crystal structure make a comparative framework for DNA repair photolyases and clock cryptochromes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
molecule keywords 6-4 photolyase
total genus 190
structure length 522
sequence length 522
chains with identical sequence B, C
ec nomenclature ec 4.1.99.13: (6-4)DNA photolyase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 3fy4A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3fy4A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fy4A01
2PZ8A 3P0HA 1FFYA 1KP2A 4OUDB 2CV0A 2A84A 4ZCPA 2V0GA 3CVXA 3PNYA 2D5BA 1KQNA 2PZBA 1F7UA 3RHSA 2QUJA 5KWVA 2DXIA 3ILVA 1JMVA 4NAUA 4U8HA 1MB9A 4UZEA 1I6KA 4ARIA 2CYCA 4JYZA 1N75A 1O0BA 1H3NA 4XSVA 1VBKA 2EJCA 4K03A 1QRUA 2X0KA 4E1AA 2WQ6A 1KR2A 3IUBA 1T6ZA 1J20A 3P0JA 1J21A 1G8FA 1N2EA 3FY4A 3UOWA 5FO0A 4MUEA 1K4MA 4ZT5A 1OWMA 3ZIUA 1SURA 3Q12A 5DASA 1J1UA 1N2HA 1JHDA 3NV7A 3HL4A 2PG3A 3G59A 1N2BA 1TYDE 3KT6A 3X1MA 3CLSC 4K0RA 4EG6A 1U7XA 5K0SA 4DNXA 3X1JA 1YUMA 1IQ0A 1R6TA 4MVWA 4MW0A 2RE8A 4I6GA 1NI5A 1KKUA 1R6XA 2DERA 3NBAA 1IQUA 1EXDA 4R0NA 1MC1A 4R2LA 3A05A 3RK0A 1Q15A 1EUQA 1EFVA 3X1KA 5TEWA 4DJAA 2CYAA 3AG5A 4EF6A 4G5YA 3IOCA 1GTSA 4KPUA 5LFAA 2AKEA 5DB4A 3CLRC 4QRDA 3ZJVA 3TQOA 1R6UA 2CSXA 1WZ2A 1GLNA 1M8PA 4MVYA 3COYA 3N8HA 3IDFA 4MAFA 3KT3A 2QUHA 1JECA 2CFOA 1OD6A 1KH2A 1K97A 3CLRD 1O94D 3MMXA 1O97D 3AG6A 2DETA 3CVUA 4MLPA 1QTQA 1TYCA 3N2YA 3IMEA 1EUYA 3ND5A 1QRSA 1M83A 3IMCA 3IVCA 3RFFA 3PXUA 4CDMA 4MUNA 1KQPA 4ARCA 2CUZA 5BNZA 1WXGA 2JANA 5F23A 1ULHA 5HUJA 4ZT2A 3AIIA 4I6EA 1Y42X 3CLSD 4OJMX 4EG4A 3HGMA 1N78A 3IODA 1N2OA 3HMQA 1MOPA 1ZH0A 2QTRA 1IHOA 4BWVA 1NUUA 2HMAA 4MW6A 3TQIA 3OP1A 5LM3A 1WXIA 3FI0A 3SEZA 3A2KA 4NATA 1KORA 1NZJA 2CYBA 1ILEA 3L92A 3RK1A 3VRHA 4DDKA 4EG7A 3CVWA 1H1TA 4FZJA 2D13A 2RD2A 3VU8A 2CV2A 2QTNA 3MLAA 5JBNA 2HGZA 4X0EA 3D6UA 4ZT3A 2HZ7A 1KP3A 3HZRA 1JGTA 3IH5A 1WKBA 1JEEA 4QBTA 1M8GA 4R2MA 2OQ2A 3COZA 2Z08A 4KR6A 1JIKA 3SP1A 2H29A 2ZUEA 3COVA 2B7LA 5KHAA 3DPIA 4DLPA 2PZAA 1HYBA 3LE8A 1I6MA 5J58A 4MUGA 4MUIA 3CLTC 1I2DA 4NAHA 2DPLA 4EGAA 1U3CA 4G5FA 1EE1A 1X6VA 1XNJA 4CQNA 2C5SA 1KAQA 5H7XA 1PFWA 3AL0C 1JILA 3CLUC 5FO1A 4AS1A 3UY4A 4KPUB 2JAXA 4MW1A 4PBRA 5KCMA 4MVXA 1WXEA 4EG8A 1ZH6A 3VGJA 1T9GS 4MWEA 1OWLA 4WSOA 1EFVB 5FNZA 1N2IA 5J59A 1MAWA 4PBTA 3GUZA 1WOYA 3IUEA 1JZSA 1MAUA 1NSYA 3KT8A 2I1LA 4MWBA 4F3RA 3S3TA 1Q11A 2A4MA 2X1LA 4AQ7A 2Z09A 1WJGA 1WQ3A 3PRHA 2O8VA 4MW9A 2QUKA 4OUDA 1GZUA 3UK2A 4QREA 1FYDA 2QTMA 1F4LA 2XRYA 1XJQA 4YP7A 3UC5A 1WXHA 1TQ8A 2Z3VA 1O96A 5IHXA 2VTBB 1VLHA 4U63A 1O5TA 3LOQA 3RJZA 4MVCA 2TS1A 1U7DA 4EG1A 1T6YA 5TS2A 4MUJA 2A88A 1PFUA 1TYAE 4Q93A 4P2BA 3QE4A 1IRXA 4MUFA 3ND7A 4Q16A 3SZGA 3H9BA 3ZJUA 1QJCA 1M1ZA 1JEDA 2A86A 3COWA 4XFJA 4MWDA 1WY5A 3M5WA 2WB2A 4YMIA 3HFJA 4KR7A 3FH0A 3A04A 4MW2A 1N77A 1A8HA 1G8GA 4RPIA 4GRIA 3H97A 3TZLA 1U3DA 2J4DA 2H2AA 1DNPA 3I05A 3K9WA 3ZXIA 4DE5A 4EG3A 4PY2A 1F9AA 2OV4A 2ZP1A 3LCJA 2G36A 3TNJA 2QUIA 1N3LA 5DK4A 1QQTA 3FHJA 1ZJWA 1H3EA 1S4MA 4ZCTA 4MW5A 1V47A 1JIIA 4NDAA 3L93A 1OWPA 1MJHA 5K0TA 2E89A 1G8HA 2IJGX 2QJFA 1O96B 4NX2A 1BS2A 4MWCA 3Q10A 1IQRA 2QJTA 3G6KA 1NUSA 1RQGA 4KKVA 2WSIA 4JZYA 3C8ZA 1NURA 2YY5A 1OBCA 2DLCX 3N05A 1KQOA 2BYTA 3CLTD 4G6ZA 1GN8A 1J09A 4L2IB 5DEOA 1PFVA 1PFYA 1COZA 1Q19A 5TGTA 2PFSA 3ZXSA 3CVVA 3TS1A 1T6XA 3AFHA 4J76A 2A1TS 3MXTA 4MW4A 1IVSA 5H16A 4XFDA 4JFAA 3DV2A 3ELBA 1N2GA 4EG5A 1K92A 2YWCA 1EFPA 3P0IA 1TYBE 1X8XA 4EFKA 4HJRA 1YUNA 3CA8A 4ZT7A 2GOYA 4ZCSA 1H3FA 3FIUA 3PNVA 5LLTA 2X1MA 2VTBA 4ND6A 3KT0A 3PNBA 4U7JA 2YXNA 4CT0A 1N1DA 1O6BA 4MUKA 3SEQA 1CT9A 1Q77A 4ZCQA 4ND7A 2IELA 1TFUA 2YWBA 2J07A 2BTEA 2J08A 3U1VA 2PIDA 1QRTA 1GTRA 2A1UB 1QNFA 3OTWA 2ZUFA 3DO8A 3DLAA 2VXOA 1EJ2A 2A1UA 2V0CA 1KH3A 1KH1A 1XNGA 3SYTA 3NBKA 1J1ZA 3ND6A 3CVYA 1IFXA 3N9IA 2DEUA 2EL7A 3TZEA 5IJXA 1ZUNA 1M8KA 2O5RA 5AHWA 1D2RA 1K4KA 3SZ3A 1OWOA 2NZ2A 4KR9A 1KAMA 2NSYA 2E18A 4F4HA 4J75A 1J70A 5HG0A 1WXFA 3RBAA 2AG6A 2JA2A 1LI5A 3IMGA 4MQ6A 1MBZA 4YP5A 3H05A 1O95D 1QU3A 2QJOA 4YBRA 1VBNA 2XRZA 2A1TR 1NUPA 1NP7A 1NUQA 4JXXA 4PBSA 4JXZA 1OBHA 4HJXA 1MRZA 3QTTA 5EKDA 1XNHA 4CDNA 2D54A 2J5BA 2E21A 4YP6A 1IH8A 3ZUGA 1O95C 4GU5A 1JIJA 3INNA 1I6LA 3H99A 2AZXA 3H9CA 3IOEA 4TS1A 3CLUD 3E27A 1M8FA 4RUKA 3Q4GA 3P52A 4HPWA 2PXHA 3G5AA 1NUTA 4HK4A 3AKZA 1EFPB 2R5WA 4DDMA 2J09A 1PG0A 4MUHA 1G59A 1GPMA 1JZQA 2DUMA 1O0CA 3GLVA 3HV0A 4ZCRA 1WQ4A 1LW7A 3FDXA 3K32A 1YI8A 3BL5A 3KFLA 5J5AA 3FG9A 3FNRA 5HUHA 2GKSA 2X3FA 1TEZA 1PG2A 2E0IA 4H3SA 4WNYA 4MULA 4L2IA 1NYLA 4A91A 1LI7A 1UFVA 1YULA 2IP1A 4S1OA 1O94C 1O97C 3SDBA 4I6JA 1YIDA 1U0BB 3IOBA 3A4IA 1YIAA 2CV1A 1GAXA 3FETA 3FWKA 3MLBA 3ISJA 3F3MA 4ZT4A 3CR8A 5TEVA 4MW7A 2GM3A 3IVGA 3QTBA 1P7PA 3ZGZA 4NZPA 2CT8A 2DR2A 3FOCA 1F7VA 3IVXA 3D6VA 1VBMA 1B6TA 1V8FA 1T9GR 3JXEA 4ZT6A 4UZFA 1VL2A 1QU2A 1M8JA 3MUEA 4DDHA 3ZJTA 1N2JA 1MB2A 2WQ7A 1OWNA 3GMIA 3UMVA 2A7XA
chains in the Genus database with same CATH superfamily
1EFHA 3MCVA 3NNNA 1OCEA 2J85A 2QNIA 3OIDA 1IEQA 3PUYA 1ZCJA 4RA9B 2AJDA 5C7OO 2V0GA 6PFKA 2BT4A 4K86A 3SGHA 4DWOA 3F6EX 4DA6A 3N71A 2RKKA 3PGVA 5D5QA 3DCJA 2JH3A 2PX6A 5DNAA 5MFPA 2HQOA 3IERA 4TT8A 5IASA 1KR5A 4JSTA 3C6ZA 5CT5A 4BQPA 3CS3A 2EEPA 5YASA 2Y1WA 4ZYVA 1PL8A 1PW5A 3D3KA 3O8QA 1JHYA 1EINA 2GT1A 2YNMA 3GT3A 3N0VA 4BFZA 3ENZA 4EJSC 1MAHA 3U4MA 3RDPA 3AU5A 3O4FA 2I1KA 4IHKA 5DBHX 3NW9A 4D26A 2YINC 3QVOA 3WLLA 2ADOA 2AXEA 2WQ6A 2ZTLA 4JJ8A 2OBLA 4XYGA 3PFCA 3V9AA 5KTPA 1BCSB 2VSXE 1SU4A 5ALMA 2X42A 2B0JA 3JAWB 3C3KA 3LQRA 1GDTA 2EBFX 1LZLA 2LUHA 3FDZB 4O8CA 3KNZA 5FO0A 2CEAA 1SBYA 1RXCA 2VK1A 3GO4A 4G8CA 4AYXA 4DQDA 3SQWA 3MHTA 4WA7A 4UPDA 3PHCA 3WLMA 1YB4A 4PQEA 3I5AA 4F3CA 1KK3A 3NHZA 2IS1A 4O4LB 1SBTA 3K0FA 4OLFA 1B89A 4C89A 3O74A 2ZB7A 3CEJA 1AGXA 4RFVA 5T6BA 4NBUA 1J0AA 2AYYA 5ALEA 1K3FA 3OETA 5JASA 2XMQA 3CLSC 3QU4A 4D9CA 5BOSB 1JMYA 1Y8ZA 1WBDA 4I50A 1R0LA 1ULZA 4EB3A 3C4JA 2XQ0A 1OF1A 3MBOA 4RDIA 4CTOA 3QVJA 3D8SA 4J9UE 4TYWA 2AFRA 2WABA 4PV7A 2P4UA 1X92A 2PXXA 2ADFA 2O2HA 1KJNA 4Q02A 4E0BA 4WKBA 4EEXA 1A5AB 2VSQA 2OXEA 4KN8A 4PHGA 2IHNA 3IRUA 1DDIA 3QITA 3P71T 3ABLE 3QHQA 1ZU2A 4I1UA 3F4BA 4KGZA 4EF6A 3KOYA 3ZNQA 2I1QA 1DV1A 3I8OA 3OPYA 1OTYA 1QIEA 3IJRA 5FI1B 3RRUA 2DFNA 3DL4A 4R1PA 3SGLA 3UXHA 3QBDA 4K3UA 5EYLA 2IL1A 2E4XA 1JPJA 4S2EA 3KUUA 3CTPA 2NP6A 2POCA 2QQ0A 2QUHA 2WSYB 4DNPA 2X6QA 1XCBA 2OCPA 4UKDA 4ALKA 1U4NA 2BRUA 3KWLA 4GA0A 2JFXA 3KPWA 3DVAA 4G5QA 2IWHA 3OZTA 3THXA 1OXKB 3MMXA 1K75A 3GJRA 4KREA 3LKDA 3HKDA 3QU7A 1LSSA 4CIDA 3PP8A 4LDPA 4TXHA 2EIHA 3H13A 1TLFA 1YQUA 2ZJ7A 3E9MA 1O2DA 2ZTMA 4X91A 3LY5A 4OGFA 1GGNA 1MKYA 5ALOA 2VAPA 2EG9A 4FHCA 2ZE8A 5KDLA 3GFOA 3W77A 4D8TA 2GZ1A 4A03A 3I4LA 4WNDA 2V6BA 1KAEA 5ARDA 3W1VA 3UHPA 2JGRA 2GW1A 2ZQ5A 1U2DA 2QVCA 5CR9A 1Y9ZA 4UI9J 1FXUA 3EVNA 3VBCA 4D43A 4PSVA 1GO2A 1OQAA 3KE9A 2LRHA 5B2ZA 121PA 2R8EA 1MZPA 1OLXB 1QDUA 1J7KA 2YBDA 2ZBPA 2I1WA 1J22A 3TKAA 1JHVA 4PS8A 1E1RD 3RRZA 4N5CA 4V0SA 4ARUA 5EIEA 4DF3A 1YJ8A 3AVWA 2EARA 1G5PA 1RQPA 1QP7A 3VJMA 4K88A 2W7TA 3MUNA 4HNQA 5DRTA 3ADCA 1KDRA 5COBA 1FDWA 3TZ6A 1C2YA 5L6LB 1R0BA 1P0MA 3QKUA 3JXIA 4J0QA 3MYVA 2G9UA 5EZ5A 4JBIA 3RUCA 3SHOA 3IKJA 4DDKA 1MX4A 1AKQA 5BPPA 3R0JA 3RV3A 4EPXA 2G83A 3EYAA 4YCNA 3NOGD 1Z6AA 2NQ2C 2BI8A 2PMBA 3OAWA 2GEJA 3P9PA 4FYXA 1Y4AE 4RLFA 3TWOA 4AIRA 5CXQA 4X6YA 2A3RA 3BJMA 2W71A 3P27A 3M70A 2GPBA 4I9GA 1OAKA 4IV8A 1WVIA 1DQYA 1QYDA 1RYNA 2AN4A 1VHLA 1VYHA 4TTSA 4KGVA 1FFBA 1ELKA 1D2CA 2NVUB 1OX6A 1P2UA 1K3ZD 2Z08A 1U94A 4HNAA 3TVDA 2G63A 4WXHA 3DQZA 3O3MB 5K2MA 3AY7A 1OX5A 4LYJA 4Y6LA 3SP1A 4XYEA 3WLTA 1I1HA 4IHQA 3I61A 4HLQB 2PZAA 4FZ5A 1IY2A 4HV4A 5ITZA 3PC8A 1XDZA 2GM9A 3BT7A 5ALUA 5BXQC 3TZBA 2CLSA 4FSHA 4JBLA 4OFXA 5A4MS 1P1CA 1RQLA 3JQ8B 3RASA 3RAFC 3KG2A 3HYNA 3OU7A 4G5FA 1J0DA 4Q4AB 1E3QA 3A27A 1UOQA 4KE9A 4AJ9A 4CQNA 3I01A 3M6VA 2V3VA 3PRYA 3VNBA 3WFIA 5KBYA 3VJRA 5FO1A 2PBFA 4MRPA 3NFYA 1YHNA 2CF6A 5KINB 4RSMA 1OIXA 1QQ5A 4YUAA 1WD5A 3LWBA 5BR4A 1V5IA 1Z5VA 2FLKA 1F6WA 4TKUA 3U0BA 4FGWA 2EQ5A 3NG1A 4OHRA 3ZWMA 4B71A 4PPNA 1NVXQ 5LA6B 3T7KA 4A3SA 1A1VA 2B83A 4Y3UA 1H69A 4MX8A 2FDCA 5BQFA 1ZN8A 3ISVA 4FFOA 3ZLVA 1CUHA 5IYZB 4TSFA 3CNQS 4RF3A 2BCJQ 5FAKA 2ID4A 2FW9A 4FMCB 2P9JA 2YFKA 2MSCB 1SA0B 2OC9A 2RAPA 2Q7DA 3PICA 2V4HC 3SHFA 4G36A 3I72A 1WUYA 1PWZA 3AUXA 5LBIA 5IK2D 4OAPA 4AQ7A 4BMOB 2YHIA 4OA5A 2GZHA 3FFBA 4OJKA 5JJ6A 2DCPA 3O8DA 3O93A 4AVXA 3H5RA 2I22A 1F2TB 2RHWA 3LOUA 1QCYA 3QE3A 4KAAA 4UNPA 2CGEA 2VUIB 3DE6X 4DW8A 1XJQA 5LJLA 4AD8A 1UPXA 2XLBA 1H66A 3IQIX 1EVEA 4HRAA 4HAWA 3L0PA 5JYEA 5KS2A 3NHUA 3AEQA 4OAUC 1DE0A 1QK5A 3D6MA 3F5MA 1VLHA 4U63A 1PJBA 3IV7A 4QPDA 1UN9A 4E03A 1UJKA 1P72A 4LJLA 2HOQA 1PT5A 3F97A 2EU8A 2WD8A 3E9QA 4GOMD 2WD7B 4FFLA 5H81A 3WKBA 3JYLA 4DQXA 5BW8C 4PCVA 3SYNA 1UQTA 4WCFA 4FJZA 1BCSA 2HDNB 3ZGVA 5KNCH 4GKJB 3KELA 2IQCA 4W5JA 4NMWA 3K0HA 4MUFA 2QWXA 2Y4OA 4K2HA 1L0BA 4OI0A 3AHIA 3ZGNA 4BLOA 3P9KA 1RZ4A 3CBGA 1SU7A 2R7AA 5F51A 2OCLA 1MO6A 3U62A 4BB6A 3IEVA 2PUGA 4LNBA 3EEQA 3IBCA 3K96A 2QMEA 1HTWA 2D3WA 3QHPA 2L69A 4GYOA 4I7EA 4JT9A 5JMPA 4KR7A 3DBIA 1RKBA 3WOHA 4XDZA 1N77A 2VZLA 2O3TA 3I9KA 3UCFA 4KQIA 2YHAA 1BYUA 1RTTA 1CY1A 4PX2A 4ZI2A 3NJRA 2OE2A 1RRFA 2ECQA 2PGNA 3AXTA 1RABA 3OXLA 1C81A 2LBPA 4FYJA 3WK4A 4JBGA 5GPBA 4JHRA 1RHMA 5IZCA 1FSZA 2ERCA 4PR0A 3AESB 1WB4A 4J7WA 4Q7EA 3NPAA 4FDMA 3OM9A 4XWTA 1SQMA 4UHEA 3ROFA 2Q8NA 1CFJA 1F60A 3PXCX 4MYUA 3B2EA 1XG5A 3QV2A 2EIME 1Z7EA 4PY2A 3ZD7A 2NOAA 3MKQA 2NC9A 2V7QD 1SXJE 2OBYA 3DDWA 3G3EA 3PC7A 5FYDA 1QVWA 2ODAA 4YUYA 3UAWA 1BDIA 2BLLA 1GV0A 4G37A 4GQAA 3DB1A 4EA8A 5ANRB 4NCNA 3KQWA 5IMSA 1CZLA 2HJRA 4MGKR 3CUWA 4Q21A 4RPCA 1N0VC 4RD1A 4CPDA 2ZOSA 1OWPA 3GZ2A 1HH8A 4PAMA 1MJHA 3QARA 1G7TA 2NO7A 3B78A 1Q1AA 1T3ZA 2R17C 1QLWA 4M9XA 5BMVB 1Y3CE 4REOA 3RFVA 4FGSA 4IVNA 3BAFA 4EMUA 2I6UA 2LD4A 4Q37A 5LOVF 1XGKA 2UUOA 4IIXA 3VPAA 1Q3HA 3K1AA 2IDZA 3KLNA 3OEYA 3FTZA 4LIPD 1QO0D 2Q0XA 4I8DA 5E1BA 4JVSB 4CV0A 3CKYA 4OB8A 2W0SA 2WJZB 3SMVA 3CH6A 1N2ZA 2FNAA 1E6KA 1S63A 1DCQA 3HGTA 5GONF 4OLJA 4G6ZA 4ZXFA 1COZA 2Q5JA 3USZA 2H1CA 2JLQA 1E9EA 3EFOA 1FFEA 3EBPA 2GRAA 3PC4A 3WLRA 4BO6A 4BNKA 2PS0A 2C9CA 2DFKB 2QXYA 3UOAB 5K20A 4XIIA 3J81k 3CNBA 1IVSA 2PSDA 4KGXA 2PZLA 2J3LA 3AKEA 4JMLA 4JR2A 1AJEA 1WHTB 4CN8A 2QXTA 1RC8A 1T2FA 1N2GA 3QENA 3DJYA 1ZVKA 2FF5A 4N9QA 4UCQA 3ZZ0A 4EHDA 1RFGE 2EBUA 1L4KA 3CVNA 1RLIA 2VHUA 3ED5A 3PQ4A 4HFJA 2VVTA 4I2VA 4R8LA 3HP4A 4ZCSA 4BZQA 4ANWA 2IIBA 5F2OA 2A4KA 4MICA 4BVLA 3KB8A 1EZ4A 4JLNA 2X1HA 3ELDA 3CUUA 1ZH8A 1OFGA 3K1TA 3D8TA 4ZCQA 1ZC4A 1DC4A 2XZTA 2I5PO 2RHMA 1JDTA 4NYIR 1TFUA 2L0XA 2D06A 4WOBA 4YONB 2J08A 3SR4A 1PJQA 4LJYA 5BRJA 5EYPF 5CYPA 2OBMA 3NIDB 3D2LA 4KL8S 3DLAA 2WSMA 4KXQA 3WQHA 1RTKA 4FWBA 2GCEA 4RYDA 1E2PA 4I1MA 3MSXA 4WESA 3HU2A 1R4NA 2BEJA 1NOJA 1W4ZA 2R97A 1O8CA 3K0EA 4MJXA 4KGDA 3OT1A 1GTMA 1FK8A 2BEDA 1Z0SA 5LMZA 1R9JA 4M98A 3I1FA 4K9PA 3I6YA 4X5OA 1U0FA 1XJCA 4X3OA 4QGSA 2B8TA 1XZJA 2TMGA 3H5TA 1IPFA 1JEQB 3BD9A 3N8IA 4HKTA 3AGQA 2IYXA 3CC8A 1IZZA 2JEYA 3L1IA 3KQOA 4JUCA 5LLSA 1OY1A 2AVPA 3UVEA 5BN1A 2VPZA 2XXAA 4P3YA 4C78A 4YUXA 2YWFA 1XT6A 2RH9B 4JJKA 4FEEA 3E84A 5K51A 4WLNA 2VCHA 4L5CA 1XPOA 2V9CA 4KHPB 5AKYA 3PJRA 3VR1A 5K03A 3DLBA 1KZ6A 3T4XA 5K0BA 3LY8A 1BKYA 5KQMA 3CX4A 1SQ6A 3IURA 4MV0A 4P0PB 3EVEA 3U0VA 4P84A 3V4ZA 1C29B 1RRGA 4DLYA 3LBHA 3LUDA 4GAEA 3BFPA 4L75A 4D4GA 4YT8A 1JBEA 5BV1A 1GDDA 1TKBA 1YI1A 4NNOA 1T43A 3LYLA 4I3GA 1D04A 1GFIA 2HU8A 1IH8A 1CP3A 4GFDA 4FW8A 4WGFA 2OESA 1K8QA 3L7MA 4UBLA 2XKAA 1DELA 4LJ7A 1NM5C 1M1XB 1X0VA 1A8PA 2R60A 4R84A 1PNRA 4QJ4A 3QBTA 4JLPA 4K9LA 2X0NA 4PLWA 1G18A 3T1NA 2UYYA 1B42A 1ZA2A 1YFJA 1I5RA 1Z8FA 3BWXA 3JQQA 4IQ0A 4P7GA 3C3EA 4YJDA 1H93A 4TRJA 3Q4GA 4HLUC 3UUEA 4P3OA 2CVHA 4I4CA 4AXBA 3G5AA 4ARZA 3CZ4A 3ZG6A 3FJ1A 2PVPA 5AJWA 1P6QA 2OGSA 3CZCA 3STYA 1C7QA 4HGYA 2CZCA 3NKLA 1JZQA 4LHXA 1ND6A 2RGEA 2CXUA 5ALRA 1N9KA 4BO9A 2HT1A 5K7SA 3RADC 2G9NA 3RVSA 1E90A 1VI6A 3KUXA 3UPVA 4RQBA 2OXIA 3GLFE 1CUBA 2J1LA 4XTCS 3W2GA 3GLFB 4QQ8A 1GCAA 4B6QA 1QM5A 1Z6QA 2X3FA 4BJ5A 3QEBZ 1OPXA 1TEXA 1PZXA 2I6HA 3Q7AA 3HXEA 3C6KA 3SBTB 5HF6A 4Q3OA 2WXGA 2LPMA 4P1ZA 1L7NA 3H5LA 4UARA 3RIMA 4IN3B 2IHBA 4MI9A 3W9BA 1Z75A 4DEVA 4R7ZA 4EYQA 4S1OA 2XQKA 1IY9A 2A9JA 1MCZA 2CFSA 1H8ED 1KOLA 1IEWA 3L3BA 1RM0A 5H9VA 1I0LA 2JRCA 4XIJA 1CY6A 1QGDA 2VO1A 1JEOA 1YIAA 1XRPA 3A4IA 2DQZA 4HQLA 2W6ID 4PHFA 3O4GA 1V1MA 2X3YA 4R9SA 4RAQA 4U6QA 1TTHA 2RKOA 2V74B 4LE2A 3EOZA 4UUNA 3W3AD 1LPPA 1PFGA 1QOPB 4HC4A 4ZQCB 3SSAA 5FCDA 1W49A 5TARA 2E82A 1EEXB 2GBLA 2W6QA 3AFGA 1JE1A 5KREA 3L4JA 4Z4CA 3GBVA 4PCAA 1NI3A 3PHGA 4L5IA 5AMXA 4JQSA 4HUQB 3Q9NA 4IHJF 4ZRDA 5H0IA 3E82A 1DEAA 3I76A 1CHDA 4BVKA 1KXZA 1Y5MA 1E3JA 3LK6A 4MK4A 1C8BA 2XYQA 1KOGA 1XMQB 4E5VA 3RTCA 2FRXA 4XX0A 1NQVA 1Y80A 4UBJA 2QOEA 3FH7A 1IUKA 2FPIB 1Z25A 2GAFA 2QD4A 3GRPA 3MRSA 3WG7E 3PHJA 4FEYA 5I9TA 4DWVA 2GRJA 5FYQA 4EL0A 4WNIA 2PGAA 2A5LA 2G0NA 3B2QA 3IC5A 5H3CA 3CVXA 4G1TA 3IIMA 4MV6A 3UFBA 2J31A 3VNVA 2HA4A 3MFYA 4B85A 2Y0PA 4M6WB 2L18A 4A82A 1Y9AA 4KLNA 1NL4A 3IQZA 1IU9A 2Q6LA 3I3SR 2AUTA 4FC7A 1P17A 4UZEA 4P81A 1C1DA 5KKAA 1AV7A 5C8YA 2ASEA 3P9IA 4N5IX 5EIBC 4ZI5A 2F1RA 3OG9A 5HF5A 4H77A 1H3NA 3AKDA 2J7PA 3AF5A 3DE1X 4GRAA 4RKQA 4RXTA 3DE7X 4BV8A 3NWOA 4GRDA 1T9AA 3FLAA 1DRWA 1ZOLA 4YRRA 1KR2A 3IUBA 1T6ZA 1GLGA 1LTKA 1B8VA 3P8ZA 3W5SA 4K6FA 1KSJA 3MWDA 1JXAA 4S35A 3RVLA 1KU6A 2QRQA 5CDUA 3O8CA 4TLLB 2IHZA 4PPYA 2XUKA 4YAGA 3RYFB 3W3AH 1QFXA 3LQ2A 1P31A 3M1YA 1IN5A 4U2GA 2W5UA 4QICA 3AHGA 3LP5A 1V16A 7REQA 3CNOA 3PEUA 4QUBA 3FDIA 3HZHA 4JOBA 1ZLXA 4NQRA 4OBXA 4F11A 4OP2A 3I53A 1DLJA 2L82A 4B76A 3G2WA 3LD9A 4RACA 1PJ4A 4HDNA 4AS2A 1YBHA 3JQ7A 3ZX4A 3EWAA 1PWXA 1YS4A 4HGRA 3I9V6 5E3HA 4HQKA 2OK8A 4W9NA 2BFNA 1FNMA 1U7XA 3EMBA 3WBBA 5KVCA 3Q0IA 1RPZA 2BFDA 2IOFA 4JOSA 4G4IA 2WHYA 1YQEA 3H1PA 3VKFA 4BCBA 5F3WB 2DERA 3SX0A 2WKQA 1V8OA 1JWGA 4L50A 4YP0A 2ZVPX 3FPBA 1NVUQ 4IO1A 3FCXA 1YC2A 3IB3A 5EI5A 3FNEA 4PG7A 2Y4TA 3MJHA 5TEWA 3SJCA 3IJEB 3CF6R 3G68A 4MCHA 2XSZD 1MEEA 2C82A 4PTLA 5HKOA 2WHEA 3ORYA 1Z2PX 2XA9A 3GPBA 2O1SA 2RIPA 2WILA 1X7GA 1G4UR 4HDRB 1KZGB 3EBLA 3ZHEB 3TINA 3BIXA 5DHTA 3T7RA 5AJXA 5IJAA 1UM8A 4DUPA 3FA2A 1GG2A 2IEYA 4HNSA 4NZOA 4O4JA 4CEJA 3RS9A 5KJMA 5L4LA 3AK4A 5FUWA 4WK0B 1A4UA 3SJAA 4J8DA 4ENRA 5GZ1A 3PFGA 4O33A 1V4NA 2W6CX 2WWXA 4L6CA 3L8GA 1D9SA 1JLLA 2ZTSA 1TVMA 2A8YA 1Z5ZA 1XZNA 1ZMBA 3BKXA 2OOEA 3WHPA 4NYJR 4DIKA 5K8JB 1TAGA 3VDNB 4BDTA 2B61A 1FUUA 4RD3A 1ESCA 4JGGA 4DR1B 1EUQA 3T41A 3GA0A 3UBTA 1IPHA 1IM2A 1E5LA 2XTZA 4M9QA 1S0UA 5GV7A 4AKHA 4C7VA 2HMSA 3VGPA 1RJGA 2E49A 1DFHA 5DHUA 4JOCA 4ZODA 1V4VA 1KPIA 1WZUA 1DJPA 1E96B 1TUGA 1SKAA 4A3VA 3QBEA 1NXTA 2JK1A 4XWAA 3ZHXA 1BXRB 2MU1A 4BVGA 2G04A 1M83A 5FUXA 4RIIA 2GN2A 4UWHA 3W3ZB 1KFJB 3MWLA 1J0EA 2O7VA 1BX3A 4YJGA 1VCHA 3OFSA 1D8EA 4OJQA 3RSQA 3WWYA 4A6XA 1EXWA 2W0MA 3LKBA 4M8KA 1GUYA 3R0XA 2IY0C 2CL5A 2AHOA 2FCRA 3MJ4A 4RHYA 1XLVA 4OJTA 3E37A 2I1VB 1EK0A 5EHNA 2DY0A 5GMOA 1VPEA 2IC5A 4C3VA 4PH4B 3P2YA 2BEVA 4ZT2A 3HG0D 4HB5A 4I6EA 4F1JA 3M3PA 5KNBD 1HNXB 2ETXA 2IO2C 4OJMX 1OCRE 3JARB 1LPMA 3W0LB 1MNAA 4YVFA 2YN2A 1II0A 3H0KA 4TTVA 2NAFA 5JECA 4YV1A 1CS0B 4CT4A 3PNMA 3ZHBA 2P7IA 3OP1A 1IM8A 4I1OA 1GFSA 2UYGA 2ZULA 3H4TA 3TUIC 5FQ6A 2OR3A 3UIOC 1JJ7A 1OBFO 1KORA 3CKKA 1WF3A 5A6VA 5KMGB 2HMTA 3PDIB 4QEZA 5HM8A 5DH9A 1FLAA 3L92A 1HFEL 4KO1S 2AMLA 3B6JA 1Z6XA 2CHXA 4KWTA 1PLLA 1THTA 5A62A 3DJFA 4XPZA 5BYKA 2PMWB 1LFDB 3QUBA 4NHEA 4A0FA 2GRNB 2IU6A 4FTWA 3SVZA 1JA9A 1EEHA 2VA8A 4RHUA 4BWRA 2NV0A 4BS9A 4F1SA 1HYEA 2JBHA 1EM8B 2LZ0A 2OZLB 4M7PA 1XXHA 4QX6A 1KA9H 3OX4A 4BIIA 4WN3A 4F7DA 4KNYA 3IESA 1W59A 3WLEA 2OQ2A 3V9PA 5CJJA 3UJDA 4U5QA 1VIVA 2NZVG 3GRYA 3OF5A 5DWVA 1CJSA 2GXQA 3GNQA 1M2JA 1WOMA 1MQ9A 1HZJA 4PFQA 1I2DA 3FYCA 3WS7A 5JNTA 1QLJA 1HL7A 1SHZA 1U8AA 1JPUA 3HDVA 4B4DA 3QBJA 4G26A 3WXMA 5G0VA 3O03A 1NUAA 2ZIFA 1QBQA 3BQNB 4H3HB 3LPCA 4Q9LA 4RDXA 1H1LA 1XQVA 2O20A 2VWPA 3CUYA 3OKFA 1MJNA 4JL5A 3MWEA 5F21A 1WHSB 3PI7A 3B1WA 5FFMA 1GQSA 5I47A 3TW8B 2ZDHA 3CPSA 5H3LA 3ZBQA 1R8SA 2B69A 3D7SA 3WSVA 4BO1A 5IT9A 2I6QA 4MVXA 2Y1LA 1AKMA 2V0PA 5D6NA 1XALA 3PZ3A 1BCRB 1QG4A 2CHWA 2BHLA 3LX6A 3O3CA 1IIBA 3PQEA 4MWEA 5JWRA 4Y2TA 1M2VB 1BXZA 1P3DA 2QRZA 3A9VA 4AZVA 3ICPA 2FF7A 5FLKA 3TZQA 1X1BA 1EGAA 3GQBB 2XWPA 3VC7A 3W1EA 5CEJA 3H2IA 1TF5A 3CGGA 1ODSA 2QTWB 3FUWA 4FUQA 4JWTA 4Z51A 3WFJA 1D1TA 3HJBA 5L3QB 3KAQA 4Y8VA 2AD5A 2HWXA 1NXVA 1ONOA 4KHZA 2BFFA 3QF4A 4KPFC 1R6VA 3RVNA 3BA6A 3SHWA 5JNLA 2JIDA 3EQ6A 3KM0A 4LY6A 4OL9A 2PJUA 3MRXA 1H6PA 4Q9NA 4BP1A 3TL2A 3C5EA 3UC5A 1P1BA 1TVEA 3QFHA 4JC8A 1DWPA 1H6OA 2WXJA 3I9OA 2Q45A 4PSKA 1J2JA 3ELUA 2WWFA 1RLMA 3A1CA 4IINA 1G291 4NYJQ 4UU8A 1JAZA 1IOZA 3LOQA 5B4VA 4PS7A 3BCHA 1NPDA 3BXOA 5JDIC 5A4KA 3W04A 5F5XA 1QRDA 1O0SA 1H2TC 1FFWA 1WR8A 2B8NA 1OGYA 2X14A 3DBHA 3AC0A 3B52X 3EFEA 2II6A 4HRXA 4BTEA 3UGJA 2BDEA 1Y5LA 1D6NA 1SU6A 4R7GA 2HMYB 4F45A 4DCTA 1U2VG 4XM2A 5AXCA 3ZHZA 1ZQ9A 3EAQA 3GCDA 3VOTA 3QEJA 3A58B 4RIGA 3AR9A 2VWHA 2AN9A 2ZRPA 5A04A 3REGA 2LUOA 3MB8A 4M46A 2NTYC 5L9AA 2WVGA 3DSUA 2HQ1A 2FEWB 5CBNA 3FH0A 4P53A 3TXAA 4IIVA 2GCOB 1FTSA 3FRHA 1EH5A 1P0IA 2R87A 1G8KA 2ZYHA 1E8MA 4OHZA 4OHFA 1IOVA 3DEPA 3ZDDA 1RADA 1FFCA 5I7OA 2IFTA 4I81A 2PT6A 2E5FA 4IFIA 4O4IF 3HCCA 1YNSA 4CTNA 1VLVA 2OFOA 2WWTA 3LWDA 4WLOA 3ZNOA 4EG3A 3UUFA 4R98A 4QLOA 3WDLA 2X8WA 2HQSA 3GEHA 4O25A 4CR8A 5JDCC 3M6MD 4PC6A 1FDOA 1Q50A 1NQTA 4IKOA 3M33A 5IC4A 3RH0A 3RKRA 3E30A 3WY9A 3PL5A 1XD2B 2VCYA 3SQLA 1NULA 3B7TA 2DM6A 4IWXA 1JQLB 2ZGVA 1BXRA 1EDEA 1MXFA 4PCUA 4F4CA 3WK5A 2Y8EA 3NHFA 4WLFA 1Q12A 3IXQA 3LFTA 2O2XA 2CWDA 4Z2AA 2DSTA 4QU8A 4H1VA 2X38A 2LSUA 2G4CA 4A6EA 2LCFA 5LCXA 4ENUA 2X9QA 3IT0A 1OFIA 2IXFA 2FX2A 2XUIA 2ZZKA 1WMFA 4HAVA 4I0WB 4PAQA 2NV6A 2P8JA 2P6PA 4GS5A 1FP6A 3FB4A 1WTCA 2V03A 1XQ6A 5HKAA 3Q3GE 4BWGA 4DDWA 4DLWA 3VVCA 5EIXA 3DWIA 4IIJF 1E99A 3BSWA 3I37X 5TPWB 1WLSA 5CU7A 4BKOA 5KC9A 3DOIA 2QLBA 3DNFA 3JD2A 1XFAA 2DH5A 3R5KA 1C8VB 2BM0A 4GOOD 3L0OA 1XWIA 4FIDA 5H70A 2G07A 4JLBA 4PHHA 4R2JA 1FXSA 1G6HA 3W5AA 2YFQA 1XNRB 2QU7A 3DCYA 1UC5B 1WNFA 1EB9A 4UM8B 3WNBA 2GO7A 1JLHA 4JYBA 3AU4A 3NUZA 5DBOA 3DKVA 2ECPA 2VTVA 3PXAA 1XN4A 2XLCA 4MEJA 4RGQA 1GADO 3SDSA 4A6DA 1M76A 2Y9MB 3HDQA 4YAFA 3TOZA 4I8XA 3U9TA 4E4RA 4L4UA 5TMPA 3A3OA 3M6IA 1E1KA 4L9PA 1AKNA 1K7XB 4YVOA 2R8BA 3R77A 1PLKA 4Z4IA 2Q50A 3EVFA 4N3BA 1RHQA 5DW0A 3ZVVA 3A6GA 3ZCSA 3EODA 4KQMA 1U7PA 1WP4A 3C43A 4F5ZA 3U7QA 4ZHQB 1FQOA 2IIPA 3A1TA 3FZGA 1Z33A 4YCBA 3IHYA 1ZUIA 2FMIA 1O6BA 2IUSA 4XJXA 3FPEA 3SEQA 2IWRA 1Q77A 1K6IA 5IAKA 2XCIA 1AURA 4YPVA 3DZKA 5EP2A 4XI9A 4CLHA 5EHZA 1VG9B 3ETDA 4ZKDA 2WTNA 4U7DA 4Q82A 1CVLA 1DG1G 1Y8RA 1GQOA 4M7CA 3OTWA 3JS5A 4QUKA 4NJMB 4COOA 1DQPA 4Y6CA 2A1UA 2Q9CA 2P27A 3NANA 1DFIA 4LSWA 1CWUA 4JGIA 2PS3A 2QLFA 5LQNA 2D1FA 4RX1A 3G13A 3SBEA 5LWHA 2HF7A 3IDQA 5JAPA 1G17A 5LKRA 4KFSA 3V00A 3ZOZA 1NBAA 1AZWA 5TC4A 2ATCA 1DAHA 3TO5A 3DMDA 4H2DA 5K3FB 4NH4A 3PFIA 1Y9JA 4LNUB 4YDRA 5FZQA 3AI2A 1KL7A 2WRZA 1C9JA 1TJPB 3W8DA 1JT9A 4UNQA 1KC3A 5TRTA 1FB5A 4BY6A 4PZEA 1ADBA 2DMRA 4RXMA 5TNXA 2G8NA 1BE6A 1WXFA 1YB7A 4IJ6A 3A6LA 2AG6A 3R6DA 3IE2A 4L4YA 1IVYA 4XR4A 3TUZC 3C3OA 1TO6A 3AKYA 2YFYA 1RIIA 4ZO7A 3SAJA 1QU3A 2V97A 3C16C 5KCZA 1PW7A 3LQFA 1S2OA 4HY3A 1NP7A 1T5DX 4QFDA 1Y4SA 1E9CA 3JZFA 2Q62A 3KJGA 2YOGA 3Q11A 4RKWA 5IBCA 1R74A 2G88A 1ADCA 3WO0A 2EHJA 5T4EA 3GYZA 1Z2DA 3UXMA 3S2SA 1WG8A 2QBYB 2E21A 3DHYA 2FKNA 3KCNA 3QPCA 3BB1A 3VDRA 4BBJA 4E2FA 2FU5C 5KB3A 4DNOA 3I5MA 2O1EA 3GD5A 2EEZA 4LYDA 1VZ2A 1A2KC 1Z7GA 1SKUA 1Z5PA 1SZAA 1N2CE 2E6KA 2H9IA 2HA5A 3CW2A 4DKXA 3S8EA 3MSCA 4DLOA 3K4PA 4HGZA 5B7GA 1W6UA 4A0SA 4BECA 4F4UA 2BRUC 3UQZA 1TK3A 2OYSA 1OFVA 2QTFA 3I39X 4WKGA 1Y5NA 3HB9A 3KQTA 3E53A 1MIOB 3NT2A 3P52A 4OYRA 1E61A 2UDPA 4JL8A 1KJ9A 2B20A 2VHXA 2YWEA 1PP4A 3FUHA 3ANYB 4TRMA 3EEYA 3WGLA 3KYCA 1E1DA 1TAQA 4EPZA 2WF8A 1VL5A 3ILHA 4XWOA 1KPHA 4XD2A 1SBQA 2X5KO 1HKHA 1O0CA 2WZCA 3N6XA 1UOHA 4DUGD 2HD4A 4ZJYA 1A4RA 2OCDA 4XD7A 1RLOA 3BHMA 3FDHA 1VB3A 1O1SA 1E5QA 3SO8A 3FDXA 3PGLA 1TNBA 2SECE 1OVMA 5ULLA 3KKKA 1IZYA 4TL9A 1NPYA 3PHHA 5DJ5A 4B7ZA 5ADUS 1RWMA 3K94A 2WXIA 3HO8A 1GSIA 3NVDA 4CM1A 1YGYA 5T8KC 5TQ2B 3RT7A 1DPGA 2FQWA 2PANA 3G89A 4L8GA 1HLGA 1XN1A 5REQA 2RHRA 1ZXBA 3TLGA 3RVRA 3GZNB 3T52A 4ABNA 3LW7A 4JJZA 4W5OA 3HQ4O 2NT4A 3BREA 1UMDB 2F3TA 2O48X 2CLDX 2IOQA 1YZLA 2C4HA 3SZOA 1U0BB 2B5WA 2GZ2A 5G2OA 4QG7A 3GEMA 1HE5A 2QROA 5DX1A 3FWKA 1L4NA 3H17A 1TPZA 5JQGA 1W0JA 1MP0A 4JD2G 1K7EB 3OLQA 4DILA 1FUIA 4PNHA 3C3YA 4V38A 1NW5A 4C03A 4GLJA 4ENSA 3MAJA 5LP0A 5BNWA 3I09A 1PR5A 1YR6A 3FOFC 3NNSA 5E7JA 2C9BA 4G97A 2PM8A 4L57A 4I4TF 5KQPA 4YWHA 3R7WA 2MJLA 3LCCA 2I03A 3TWRA 2PM6A 3E0XA 4MV3A 1FSFA 5LXTA 2C7VA 2OMKA 1UAYA 3K8ZA 1WPQA 4JBYA 1E64A 1UEXC 2C3OA 3K2IA 2M6KA 1HEUA 3TLGB 4BNNA 2XZDG 4MRMA 4MLDA 5L53A 1N7IA 2G0TA 4R9NA 4Z8YA 3KETA 2BFEA 4O1PA 3G8BA 3DVAB 2CNWA 4OFZA 2FUG1 3KVVA 2H5JA 5IVIA 1E9VA 4G9BA 2C0MA 1DQZA 4TX1A 2QJWA 3IVMA 4JLVA 4KO4S 4MXDA 4U0SA 3RVMA 3ZLJA 1F7UA 4LJAA 1ZJ6A 1O6GA 3AR8A 3I9FA 1B2RA 4G8JA 1U2GA 4NPHA 4RYLA 3HA2A 2QS9A 3I30X 3ILVA 2C2LA 1QR2A 3NIFB 3OKCA 5KPJA 1SOVA 1W96A 4MMZB 3WJ7A 3SYMA 1YH3A 4O0MA 1U0HC 4AAYA 2LWIA 5B2EA 5E75A 4QJ3A 2DBQA 4RVSA 4XSVA 2Z4RA 2UZ4A 1HX7A 3BGOS 3T1VA 5MDHA 2X5JO 3EGCA 4ACBA 3FNGA 4D8YA 4QU9A 2AOTA 3K9IA 1UJBA 2SHKA 3TB6A 2O50A 2OFPA 1E7QA 3T3EA 5ES4B 3LCMA 4AS3A 4C4PA 1GVHA 1DBPA 1T5BA 3ZU4A 2IKQA 3TNYA 5A1TA 1BPOA 3KJHA 1VPVA 4GUDA 4UJ3A 4KDEA 5FV7A 2FQXA 3ZEFA 2BELA 2GXUA 2X2OA 3F8WA 2PUFA 4PC3A 3HYMB 4P4NA 4LI0A 2GX6A 3RS2A 3VPFA 2J9XB 1DHRA 2V6MA 5A05A 5C0OE 1ZSVA 3M83A 1X7YA 3Q78A 1AK2A 1WW3A 1UC9A 2V8BA 4YMVA 4RENA 4OK5A 1GPJA 2WVHA 3R7NA 4EJFA 1X77A 3K3PA 3F8SA 1JIQA 3N2EA 4MQEB 4O4JB 4I6GA 1QG0A 4AJ2A 2FR8A 3WNZA 1WMEA 4CODB 4UM7A 2BWJA 1A9PA 3QXSA 4QDKA 2DFVA 2IK8A 4R2LA 1DDGA 4NFHA 4AU1A 4ENVA 5I9BA 1N0IA 4WCFC 1L6IA 4G56A 4PS1A 4QDUA 1IBCA 3GZNA 1IC6A 2Q29A 3TE7A 8ABPA 2AUMA 2PA3A 3VNQA 2X4IA 4LXUA 3V80A 5FORA 4D4MA 3AU8A 3IFSA 1QE3A 4WLVA 2CLKB 3CZ5A 4DSUA 2GXAA 1HFKA 3L7OA 3R3YA 3LO8A 3L0SA 2D7JA 2GM4A 4YGXB 2WIKA 4PHCA 5FAXA 2A1IA 3S2UA 2R6GA 5IZ4A 4WZ6A 1VQ1A 1G8PA 1GLNA 4YAEA 1I10A 4WUVA 3RS5A 3HVJA 1MX2A 3T5MA 3P2KA 3KEFA 5KEIA 3ZUVB 4NSNA 5EE0A 3WYDA 3UANA 2XWQA 4MAFA 2RI6A 5J9FA 1JDUA 4QUEA 2Q9AA 1N5KA 3OA2A 1O1TA 3ENKA 4G4JA 4UTXA 1B43A 3NTOA 1J90A 4JL6A 3GROA 2EFEB 4J1SA 5KJFA 3LQ4A 1YS6A 1I4OA 1JXMA 1T1EA 3I3NA 1F6DA 3FUVA 3IUJA 4EY6A 1QYRA 1UWLA 5HX7A 3FSGA 5AK6A 3RABA 2HMVA 3U3XA 2CFTA 4ZV4A 1ABEA 3KTOA 4BETA 2P9BA 2HSZA 3CNLA 4BPRA 2R9VA 3K8YA 3JXJA 5DOZA 4AULA 4LVCA 4TL8A 4XQ9A 3WLQA 4ETNA 3K6KA 4QQNA 1KEEB 4BTVA 4F91B 1E6EA 4UM9B 3OT4A 4FVTA 3B51X 4RPKA 5JCJA 4DG8A 3OJXA 3IUYA 3VZCA 1IMJA 4ARBA 2Q1TA 3GJ0A 1QIKA 3QXGA 4KYOB 5JR3A 2BKEA 4BJHB 3DDHA 4LXYA 3THWA 5C8YB 3ANLA 2O5EA 1Z3CA 4MCJA 4UMFA 2C4MA 3UJ3X 1TM1E 5HKBA 4EPTA 1Y42X 3CLSD 4EG4A 2P4HX 2XB8A 3CXUA 2ZJBA 4HBZA 1RVDA 5EL0A 5BW6B 3PZ4A 2B36A 3JASA 3WAGA 3LQYA 4BMXA 2EHDA 5MGNA 4JA2A 4MW6A 4U2KA 2EILE 2JGMA 3HYRA 1P0QA 3JQCA 4HADA 4B2LA 4F72A 4ZYYA 1IBMB 3T7DA 3E3MA 1PUXA 1ZGCA 3MQ2A 4HQ0A 2EJVA 4IHAA 5E76A 4KYIB 4PCLA 1DWQA 4PR3A 3USES 4X90A 3K35A 4HZUB 1NQOA 4KCGA 1S9HA 1TX4B 3OVMA 1C1XA 4DPMA 4EG7A 2XMSA 3D81A 2GASA 2VWQA 3VU8A 4UQYA 3VLDA 3ESZA 4EHKA 3IXMA 3EDCA 3G79A 4FFDA 3L07A 4D0RA 4J1NA 5EZ6B 4RO0A 3OZIA 1ESEA 1BMFD 3HZRA 4QAQA 4DC1A 4QBTA 4YJ3A 1HX8A 5TF4A 2A5DA 4D8UA 3HJTA 1QS0A 4DJ5X 1QZZA 3ZY5A 1VDZA 1KAGA 1QAOA 1QFSA 4MR7B 2HFJA 5JAMA 1CUUA 3NHWA 4ZEVA 1WL8A 1KMHB 1R9NA 2WWIA 2XVXA 1GGEA 1XDWA 4Q7KA 4B7CA 2B9EA 1GZ6A 1EXVA 2G76A 1QLHA 2OZEA 3ENWA 3GEBA 3GV0A 1DOZA 3SC6A 2AZMA 3ZDQA 5AQ9A 1XOIA 2XIQA 3QLJA 4NE9A 2DCUA 3CIAA 1JFFB 1KJQA 1V9LA 1KK0A 3H0EA 3JZDA 4J16A 3NDJA 3OUTA 1R3UA 2FFAA 1Y1SA 3BB3A 4BKPA 2JLUA 1QYVA 3K2BA 1KAQA 2SKCA 3UKJA 1TGYA 5FQ4A 1N9GA 2CXNA 3WE7A 3QWPA 3G82C 4H60A 4RMGA 1WE2A 1KYTA 1OT3A 4TXQA 1JLRA 1ZINA 4KXXA 1WMSA 2JAXA 3KKMA 1JQDA 1CERA 4GPZA 3BOSA 1AQIA 4XSGA 1PZFA 2J0QA 2FJUA 4AJNA 4XSHA 5ICFA 1ULSA 5DDIP 4AOFA 1H9CA 2DPMA 3L40A 4B8WA 1Q22A 2PCJA 3FNBA 1OT8A 1G3QA 4MRVA 1C80A 5DK6A 4CW7A 2IH2A 4ZOLF 5G4LA 3R5TA 1YR8A 3NC4A 2CXTA 4GZCA 1X0XA 2ASVA 1TN6A 4EKNB 3ICWA 4F3VA 1BKSB 2A4MA 4QGGA 5C8ZA 4D4HA 3V7NA 4XYMA 5CK4A 2O8VA 3QK0A 3IUMA 3EDMA 3BE6A 1DAGA 2V5UA 4QASA 3SHTA 3FUTA 1SKYE 3S7JA 1TCAA 2CEKA 3JQ8A 4ZC8A 4LYHA 1F38A 2ZRDA 3EJNA 4JEHA 1G9SA 4Y1FA 3V3KA 4CEHA 2BR5A 4FFRA 1V3TA 3TLJA 5DM60 3IPAA 3HI4A 2F62A 4UAJA 3ZWDA 4BN0A 4EX6A 4D0LB 4EHIA 3DC7A 3ER9A 1APBA 4YBZA 4C21A 2NVUA 3N3AC 4LOHA 1L5RA 2LNDA 4ZOAA 3T1YB 2P6MA 2H6HA 2REOA 1ESDA 3Q7EA 5D5HA 1E0DA 3GYGA 2F1HA 2J4FA 2UVQA 4MS1B 3WBFA 3ZIDA 1M1ZA 1H8HD 1VKNA 2DUUA 2Y1CA 3D6FA 2WJ4A 2FEXA 3IKLA 4MQMA 1SD2A 2Y68A 3GJTA 4Q4LA 2AC2A 3MYYA 4HLUA 4L5JA 4IYJA 5C8DA 1P91A 2QFCA 4WACA 4IGAA 3RHZA 1DAFA 1Q74A 4N7RA 4R9VA 1J00A 2XYVA 4TLCA 3GPLA 1NNEA 2Z6UA 1A95A 4CJXA 5AK0A 3TR5A 2PE5A 2ORIA 1HYQA 1W5AA 2DWUA 2EKZA 1P3Y1 1VKJA 1GSAA 1OXJA 3FIJA 4GRIA 3L1JA 2JJYA 4Y9UA 1U3DA 1UWKA 3K72B 3ZDXB 1YCGA 4TZ0A 5IC6A 3DOOA 4LC1A 5JSFA 1I80A 3G0IA 1EJ6A 3MN1A 2OV4A 1V11A 3QVWA 1YB2A 4I46A 3UHAA 3GUHA 2ERYA 5HIKA 4L72A 1NF9A 3CSUA 5LXTB 3QPUA 3DXKG 2BONA 1OJLA 1V8PA 1YKFA 2C31A 3D6TB 4NBNA 3TNJA 4KPEC 2JHFA 1H2AS 3BPSA 1DKMA 1L8AA 3PNPA 1QHYA 1SCBA 1DO8A 2Y3AA 3L93A 4LEUA 3ASYA 1ID1A 2R8RA 1JLKA 2ZR9A 2K87A 3B2NA 1Y6RA 2FPLA 1KQ3A 2WUWE 1W94A 2YJTD 2YZ7A 1OFHA 3Q85A 4GNRA 4N7MA 1KDYA 2PWZA 5JANA 2J4BA 4U7PB 5DHRA 3TAUA 1K5DA 3RJ5A 2X4GA 1QE5A 2IJGX 1P9NA 4JVOA 4NX2A 4Q5IA 2IEZA 4QXAA 3WIVA 2GN6A 3F9CA 3HY4A 5TB5A 1XZMA 1RQGA 4V3IA 1OCOE 5DEIA 3B6MA 2QZZA 2ZI4A 1ZVJA 2ZRCA 5HJ5A 1PV4A 3FPSA 3QZUA 3O48A 1LPOA 2A5FA 2WP0A 4V24A 1IIRA 2EFHB 5G4KB 3CLTD 3EZ2A 1E2HA 3AI7A 1Z4MA 4NIMA 3ZVRA 3MVEA 1KJIA 4LMRA 4FBGA 3WGNA 3ZXSA 5FINA 4ND8A 1T6XA 1U3VA 6ADHA 3VV3A 2WSLA 2B4KA 2NLOA 4OHVA 1NXXA 5FHRA 3PNOA 4BNLA 2EJBA 2NSZA 4NE2A 3SN6A 2FJ0A 1JNXX 1TUEA 4KVMA 1QOZA 1HE4A 3A3YA 2BHRA 1MG0A 5FTNA 2XBMA 1AKVA 3HN7A 2HM7A 3OZAA 1K9VF 4PVDA 2VJLA 4QTXA 4F53A 3S5JA 2YWCA 2BPOA 3E5NA 2ZRAA 1A9QA 1M33A 2OHFA 3QOFA 1NJ6A 4PYNA 3QMPA 5IJ0B 1M2WA 3HDHA 1N2CB 5CFOA 5ALTA 5KVAA 3QIVA 2CLCX 3G6WA 4PLPA 4CT0A 4MUKA 3DEJA 1GCGA 4Q4AA 4EY5A 2DLDA 2SBTA 4QUAA 3TQCA 5ARGA 1S2MA 4X44A 5ITWA 1L5FA 4DEXA 1USGA 3OZDA 4O4LA 2VNKA 3FUJA 1DEHA 5A3SA 1RKXA 2C5FA 3NTQA 4YMTA 1E0JA 4F12A 1TCCA 2A4ZA 2H6EA 3F47A 3GRCA 4LOKA 4DNFA 4Q3DA 5JCZA 4UFNA 1A7JA 1FQWA 5A02A 1XNGA 5KJNA 3OEHD 3C6MA 3LPAA 1PX2A 3NBKA 5CLJA 4INJA 3E2MA 4IV5A 2ZSEA 5FR2A 3GW8A 3IMFA 3CVYA 4FR5A 1IFXA 3TLAA 2NU7A 5JFGA 5BVGB 4ZP1A 1E2EA 3LC2O 4RAOA 3VTKA 1D2RA 3R23A 2IZ0A 1W5EA 3KEQA 3L79A 2QUZA 3MT8A 4HAOA 1RQRA 2IXBA 4HQ6A 1JVNA 2EBHX 4RTRA 3ZDBA 3U7FB 4OXQA 3S1AA 1YDMA 2PAAA 4PG4A 1AXEA 4UWFA 2PLRA 1XZAA 2Q5LA 2QJOA 1DQSA 3GUCA 4XB1A 5GONB 4DIFA 2D3TA 2XRZA 1VLZA 3RU9A 1F1JA 3FKJA 3T99A 2JRLA 4CF6A 2C8JA 2D00A 2IYWA 2XRMA 5CRVA 3HBLA 3ZY2A 4BMPB 4MKTA 3FBGA 3CR3A 1L1QA 1V25A 4AJPA 3BC1A 1P62B 1R8QA 3HCEA 2WD7A 5BXOA 3KJFA 3OZGA 1V3QE 4GX2A 5DX0A 5TVGA 3V8NA 5K3OA 1O89A 3H5AA 1EE9A 1OI7A 1ZSYA 2CSUA 2X7XA 3A0RB 4HQRA 4KXWA 2GM5A 3ROGA 2R48A 1HE8A 2RGAA 1JIJA 3I2FA 5DT9A 5F33A 1ACJA 5EJ9A 1OIWA 2XGMA 1WDWB 2F2TA 4A0HA 1U28C 3KSBC 4LGMA 2E55A 2O2CA 3O4VA 3PVSA 4AJWA 3SIWA 3WWOA 3NUGA 3H8JA 1DMSA 1SUFA 4C1NA 1U90A 2WOJA 1W1WA 1G63A 2NPOA 3DDUA 1FXWF 4MGYR 2RAFA 4IQ4A 4ZJPA 4Y2GA 2V1XA 1CSEE 1GY8A 4HK4A 2IO3C 5CTAA 5J1TB 2G72A 2M9MA 3HXBA 2ZYRA 3A9TA 1XXHB 1DHTA 2PZGA 3IP6A 4QEKA 4DB4A 1ZN2A 8MHTA 1FIUA 3IIEA 3IPXA 1IHYA 2GARA 4BGDA 2XWBF 2NPIA 2ORVA 4NF2A 5HBRA 4Z1MD 4UREA 3DUWA 4L85A 3CZQA 4PPFA 2QW1A 3HR7A 5ALJA 5CD1A 2WHQA 3OIGA 1TK9A 1PSWA 2VBFA 3UXGA 3GDWA 3L49A 4HI8A 3LDHA 4M0PA 1KDZA 5JFTA 4L3VA 2YYYA 4V3BA 1OZ0A 1YIOA 2X76A 4J0HA 1HF8A 4HOQA 2ZRQA 1IK4A 4TTJA 4TQGA 4CTJA 5EXPA 1LI7A 5EJ2A 3UCXA 3BMCA 1XP5A 4IXNA 1N0WA 4ALMA 3GLTA 3C45A 1JCQA 3OPMA 4P8RA 5LMUB 2GF0A 1UR5A 5JVDF 4J4HA 1XMXA 1Y3HA 1ZA1A 1O97C 4UCXA 1F9EA 2YCLA 2VHEA 1T5OA 2PX2A 3ZQJA 4JKIA 1SULA 3D3WA 3FSJX 2X2FA 3PBKA 4GTRA 1JJIA 2JAOA 1ENYA 1WZIA 1JLMA 3BWYA 1NVDA 3BFXA 3HFSA 1IL0A 4MROA 4DX2A 1K98A 3GG2A 1YACA 4G0MA 2LV8A 4X6LA 1H5UA 4I4IA 2NUAA 4BLUA 3MYRA 5BSEA 1TNZA 4INOA 2RJOA 1EVKA 2GEFA 2RAVA 3UMSA 1QIMA 4XM0A 4ZFNA 3MWJA 1TTQB 4LCTA 1CRZA 2Q6KA 4NZPA 1DTWA 1U5BB 3FOCA 4LZLA 4OUKX 2P3OA 4QULA 1U8ZA 2X5NA 3E8XA 5HS6A 2C59A 2JH9A 3F71A 3AFIA 3KIPA 1X1DA 3P32A 3H4IA 2TMDA 2XA1A 5CDSA 2O8BA 3VO2A 3BJRA 4I55F 3WL3A 1OU0A 2OSBA 2HJSA 3I83A 2CVZA 3PUIA 3TTSA 4DDHA 5CBPA 3TJPA 2EKLA 1GFWA 4OEHA 3U1TA 1B4DA 1HSZA 1YS7A 2FSIA 2IIVA 2XOKD 1TO2E 3O4HA 4L4XA 4OREX 4YR9A 4ZCTA 1SR8A 3S2FA 1T2CA 1UWVA 2ONDA 1JBKA 2FE1A 4OOEA 4P6VF 2R6JA 4YRGA 6GPBA 4BLQA 1OH6A 4KLRA 1ZZGA 1QORA 1VCOA 2HPHA 3IAEA 5EZYB 4DCVA 1Q7TA 2QTHA 3G0DA 3FZNA 4OHKA 3GLFA 3GLGB 2OWDA 2X8BA 4WT7A 2OFFA 4KNWA 2GCOA 4IIUA 4NV3A 3S70A 4YAIA 5G0UA 3DOHA 4XJVA 3AW8A 1J07A 3EIWA 3BXFA 1K3UB 1QQEA 3R8XA 2JPDA 4C0MA 2QMYA 4U6NA 2OM2A 3G49A 3MJTA 5GOZA 3UT5A 4JYZA 4MV8A 2KE5A 4PZLA 3Q2OA 3CKCA 4R2WA 1Z35A 2F67A 2RAUA 3TGWA 5DNCA 1BAPA 2ZBGA 4HL6A 4TLMB 3AR5A 3OI7A 5E2BA 3UH1A 1MO3A 4UPEA 1YQGA 2P9ZA 2FDXA 2HLDA 2EZ8A 4L08A 5F98A 1TMYA 4ZPXA 1NT2A 4K9RA 1EX1A 2F8XK 4M4SA 4NBWA 5E7QA 2JFGA 4YYEA 4D9MA 3HCNA 1B1CA 2NGRA 5HZKA 5L6MB 1ELRA 3HHPA 2CHFA 3GT4A 5DFAA 1G2QA 1Q0RA 1I4WA 4XVQA 3YASA 3B89A 1OC2A 4GTVA 1Y1QA 1ST2A 1YRHA 1K86A 3G02A 4Y18A 3TK1A 4E07A 1IDN1 2RGNA 3BRCA 1KARA 1O95A 1QSGA 4Z2YA 5TMBA 4CT4B 3DFIA 3FKQA 3EC1A 3FWZA 1JYSA 2VC2B 3ASUA 4RZUA 5DM70 4XEUA 3T3GA 4K0RA 3M2PA 1X8JA 4Y1GA 3Q15C 3PNTB 3GJ6A 1VHQA 2ZYIA 2W9XA 3RRMA 2L0TB 3RVDA 3VQTA 1X74A 3UB2A 1B76A 4GTOA 3EVCA 1TVKB 3GDFA 3B7WA 2ZBVA 4EZIA 3RFCA 2HHCA 1NJ1A 3MWDB 5C7IO 1XCLA 2YZMA 1TM7E 2KW5A 4B3XA 2JJMA 4B40A 2ZBQA 4XKCA 2FH5B 4HCJA 3BSSA 2Q1SA 3X1KA 4YXFA 3R1IA 1LF8A 2H2GA 4OKNA 2CL0X 1FFXA 3D0OA 3D2CA 1DINA 1ZITA 1AQLA 2VP2A 3KKLA 4W5HA 2HTEA 3D5QA 1H0KA 1UAGA 4D0GA 1C8LA 1RKUA 4Y0NA 2A92A 3CEPB 1EBFA 1Y1LA 2J3EA 4IOMA 4B7XA 4K7JA 1Q0LA 3COYA 4FC8A 3JASB 4NBVA 2RI1A 3O0TA 4OIFA 2FZ4A 1ZNYA 4NK4A 3ASDA 3WLHA 4Q6WA 3FHTA 1U98A 1LTQA 2BEWA 1OLSA 1L3CA 2HBRA 2QTVA 4KXUA 3SJ7A 1T4GA 3BEEA 3L7JA 3ROZA 2CBXA 1U02A 3CX3A 1M34B 2RHDA 1ATZA 2HNAA 1W0KA 4ZQBA 5FLXA 2VSNA 4MRRA 4DMCA 4TPKA 2VYVA 4FBMA 4PLYA 2C4UA 5F4BA 3KQLA 2OZLA 4G67A 1XC7A 4Y7CA 3V6MA 2AT1A 1BQ3A 3CCFA 3HCBA 5A4JA 1DBSA 2CHEA 4DSZA 1NWHA 3SS9X 3UF0A 3IMEA 3AF0A 2I9CA 4C7OA 2VJYA 1UMKA 2GD2A 1ELOA 2B37A 4D8VA 1B0PA 2GFIA 3T35A 3IJPA 4JX9A 4F5DA 1AS3A 3Q9UA 1KHHA 3QF7A 4HDKB 1H6BA 4TWZA 5EHGA 4AL4A 3QU9A 1RWVA 4WN9A 4DHEA 3PSHA 2ENUA 2Z2JA 1QG6A 4J0KA 2YVLA 2RG8A 1Z4PX 3HSSA 1SCUA 4UVGA 4C6TA 3HUUA 4RNDB 3D2AA 4EHJA 1I7PA 2FMHA 2VRCD 3QNKA 2PS9A 2BGJA 4GCNA 1MJGM 4IJVA 4QUDA 1TPYA 5E9WA 4A8HA 3CE9A 3I6MA 4O5AA 4AP5A 1MZVA 3LHSA 3OBBA 1E3MA 3CSFA 1W5SA 1IAQA 4K6KA 3V1MA 1QGAA 4WL0A 2PMFA 2HCRA 1HZZA 2H2HA 2CHGA 4QNRA 1UKEA 4X61A 4B33A 1HURA 2XOEA 1SUIA 4MQ4A 3B8HA 5FA8A 1SHTX 4K9OA 1GDHA 4PN7A 1LC0A 1WUIS 2WTAA 4NI5A 1ECBA 2C84A 4OATA 5G40A 2GAAA 4TYQA 2CDCA 1S2IA 4BV9A 4YRKA 5A1JA 4XOIA 1G5RA 1UPCA 1KK1A 1D3AA 2FZWA 1VJ0A 2D13A 2Q4RA 3DLHA 4H7FA 1GKLA 1Z8HA 3NYRA 3JYOA 1E96A 1V7ZA 1YFZA 3SF8A 4OP1A 4DWWA 3Q8KA 1WSDA 2VUUA 1IZ0A 1F12A 3E0QA 3E9ZA 1WKBA 2GEUA 4GNKA 5B1YA 1C4WA 4MGZR 4IJWA 5TGDA 4ZCLA 4AJHA 3ESYA 5ARCA 1KI6B 4ZV7A 3UG6A 4D4IA 4R31A 5AIAA 2ATIA 2UKDA 5FL7D 3OQOA 3MIZA 1LLUA 1AXRA 1E5TA 1RCTE 1T5IA 2RB5A 3G23A 4U9UA 5CFPA 3KU1A 2YXBA 5JA4D 4L8VA 2GEKA 1V48A 5EVJA 3B7SA 1L1EA 1RHKA 2HK6A 2XNDD 3AB8A 1A5EA 1RAIA 4AM8A 4BE7B 1FX1A 2VWGA 3UM2A 2DPLA 1XEWY 3DEAA 1GZ7A 3ROMA 1QQBA 1X6VA 1XPRA 3A37A 2A7QA 3C3PA 4WTOA 4ZVUA 5AVKA 3H3XA 1LB1B 1J42A 1Z17A 4FQ5A 1U1DA 3Q7IA 2IE0A 3V33A 2JJ2A 1IZ8A 1Z07A 2IEJA 4UUMA 5ERXA 1A5BB 3K70B 4LDJA 5EWLA 5K8LA 4JASB 4HDRA 5SZJA 2PBRA 1PUJA 1YQWA 3ZE2B 4I4TB 4Z4EA 4CCYA 1WHTA 2O8FA 5AIJA 3PPVA 1TYZA 3PXXA 1L4HA 4UAGA 4ND3A 3C3CA 5DN6D 2BZGA 3JPWA 4WFKA 4EKDA 1OWLA 1JSZA 1MQAA 3TTYA 5JMOA 4EI7A 3NAWA 2JCGA 3E5MA 2MCFA 3GIDA 1VSVA 4FQ7A 2OENG 2XTJA 4CUZA 3EISA 1UBCA 3LOPA 1CQXA 1U7ZA 2IXGA 2ZCUA 1A8SA 3OJCA 1U7WA 4ZVMA 3EPRA 2I2XB 4AZ0A 2KZTB 2GBFA 2G77B 4WH0A 4ZN6A 2DBZA 3DO5A 4MW9A 5ALGA 3ZGYA 1OV6A 4TXLA 5DT2A 3L4SO 3DZJA 2R6ZA 4X85A 1WLYA 2R25B 1SH7A 1JKMA 1EUYA 3NALA 1GQRA 2HYDA 2YY7A 5B3KA 3VNRA 3UKUG 3WP0A 3ZV6A 2WM9B 4OQQA 5AJUA 3B9RA 2LIVA 5DSXA 4KMMA 1SCKA 4J8YA 4XVHA 3FUMA 4D10C 1L8XA 3T3HA 3FMFA 3NHAA 1KWGA 2BFMA 2VQ2A 2NXPA 5EAIA 2PGOA 1QRUA 4EG1A 3E7XA 1Z4OA 4MHTA 4Y9TA 3UMRA 4XUEA 1U9JA 2Q1YA 1PFUA 1NMYA 2Z2ZA 3SYKA 3QE4A 3I6IA 4X6UA 4CIAA 2UYHA 3UT8A 1USVA 3RC7A 1E4EA 3SZGA 5BQOA 1JPLA 5AARA 4IEIA 4OAQA 1JEDA 3BGDA 3JW8A 3TCNA 4DLQA 2W93A 5HZHA 4QLBA 4ATNA 3QHAA 4XGRA 5HFNA 1DUIA 4RLQA 5CBKA 5E4JA 1DQRA 4B9AA 1T9CA 1GYQA 2B30A 2GDJA 5CCBA 3S7DA 1CJBA 2H48A 3CEAA 3GLSA 3IQWA 1PKXA 3MPOA 4MW2A 4E13A 2LIPA 3M49A 1PL0A 1T35A 4L5YA 3S99A 2I7XA 2OCBA 4B17A 3GQVA 1G8GA 5CDFE 1FA9A 1ZK4A 2XS1A 5BV2P 2FF4A 4FDUA 2WTEA 4RPIA 5JZ9A 2EFYA 1KI2A 1RPAA 2CDRA 5JXIA 2VPWA 3A28A 1ZL0A 3LBNA 4M9UA 4QDOA 3F1KA 4A2WA 1MG5A 3ZYZA 3FHEA 4AZSA 5ENNA 2JB9A 4K6OA 4MQFA 4KIGA 5AI9A 5DI3A 3GW4A 2WYUA 5K0GA 5I3CA 4HS2A 4R7LA 3DUFA 2EOAA 3H5VA 4V2IA 5FPYA 3H8WA 1C50A 4LVUA 3C74A 4S1PA 3HH8A 1QZXA 3GN2A 3MINB 1PHPA 5E0KB 3E1GA 5IW8A 4F6RB 2C00A 5F52A 3TWTA 3ZW3A 1CTQA 1QH1A 3ADOA 4MAAA 2F4VB 1P45A 2W22A 1YAJA 2WVAA 4QOSA 3Q1LA 4KO2S 2OPBA 1DCKA 1G8HA 3GJSA 3I0MA 1GRNA 4NY1A 1LQTA 4RK4A 3ZPXA 3ZK7A 1H4VB 3LUJA 3ZTTA 4BSZB 2JFHA 3LDUA 5CB4B 4WQMA 2ZJOA 5DYWA 4PAGA 4N47A 2J5XA 3WGYA 4TKVA 3B85A 1ZFNA 2RHLA 3EVAA 3LC1O 4UW9A 4F71A 4ZO9A 3RS3A 2Q27A 2I91A 5E6RB 4MTLA 1H2RS 4C4RA 3LUKA 2P9FA 3ZWBA 3COJA 3BE4A 2DLCX 2W83A 3EHMA 2QBYA 3VH3A 2VBCA 1Y4DE 1WU8A 1L7MA 1ECPA 1NG1A 2EP8A 2ORWA 2X0JA 2ZAIA 3KVOA 4MHSA 2AW3A 2JDIA 3R2JA 5FD8A 3OE1A 3KQUA 3CVVA 1F8YA 1P0CA 3BRWD 1MUUA 2QMQA 3EA4A 2ODWA 2X0EA 5IT0A 2B4TO 2FPPA 2P5YA 5JMWA 2GFHA 1P5ZB 5A4IS 1DBQA 4J76A 1ZAYA 3VR4D 4QARA 2OV1A 3MUOA 2FB9A 1ICIA 4K28A 1W1UA 1Y63A 1Z4QA 2R84A 3MBIA 2JFVA 4NCAA 3IL2A 1FT2A 1K27A 1LI4A 3DV2A 1BD4A 3RNOA 5EG5A 2RHTA 3PB3A 4RIHA 1CVIA 1V71A 1UBLS 3CPHA 3DVSX 3H1BA 2GOYA 3UBMA 2O05A 4WVLA 3BMQA 3MOGA 5KJKA 4BZZA 4F1WA 3PNVA 5JS6A 1NR5A 2QA5A 3IE0A 4X1IB 1K6XA 1DMRA 2HWUA 4U7JA 3BE8A 4CDRA 2H4HA 2WT4A 3ZWNA 1NF3A 3MRTA 3H6KA 1QHGA 2B92A 1IAVA 1BHJA 1X1TA 2R4UA 4IMJB 3NBZC 2OXTA 2YWBA 3G1UA 5TQVA 3W4IA 1YOBA 1YI0A 2IY8A 3BSYA 3JQAB 4X7MA 4Z54A 1U7TA 1QBGA 2DZOA 3HU1A 4IDGA 5HCIA 4XZ4A 2A1UB 1YZ3A 3OESA 3HKCB 3WK8A 3DO8A 3HXMA 3D1JA 1CY2A 1QANA 2VXOA 4AKSA 4X66B 2BL4A 1UBNA 2H11A 2W2PA 3IKMB 1JBQA 5DP1A 3J81A 4QOEA 3MTDA 3WBJA 1G3UA 4WOJA 2YQZA 1G38A 3ZWWA 1EI9A 4JC4A 5H7PA 1YFKA 2HT6A 5G2NA 2W2LD 5BW4A 1VHDA 2GAJA 4ZEXA 1JSXA 1K0UA 2APJA 2JKZA 1F2TA 1BD3A 1CEQA 4IV0A 1U7HA 2BMAA 3FMPB 2Y1KA 4QD3A 3GA5A 4G1FA 3UEOA 2NZ2A 4EFLA 1BHQ1 1DJNA 1U0GA 3FULA 1JDNA 2C97A 1F48A 2WXKA 1UJNA 3H1FA 4JJIA 4LQCA 1RR6A 4RGVA 5CITA 3WMXA 4RPJA 2ZUWA 3LSYA 5AI0A 4IWYA 5BSMA 3UM9A 5M5BA 1BG6A 3KDAA 1CVRA 3KZOA 4J0IA 3MV3B 3H05A 1I5EA 3PWZA 3DMTC 5F3RA 3W34A 4OLBA 1NJ2A 5IDWA 2PZIA 2RGXA 5GTDA 1CG6A 5TQ0B 3BYZA 1CLEA 4CM9A 3HXOA 5F2EA 2Q4TA 4TN5A 1I01A 3QEMB 3RG2A 1GUDA 4JXXA 3F6PA 1OUVA 5TXGA 3T54A 3X3HA 5ALIA 4CKBA 3T3OA 4PNPA 3AERB 1TMGE 2HXYA 1MHTA 1BXGA 1YV9A 4ETWA 1N94A 3SEAA 4G0VA 3ZDRA 2ZG6A 2PJRA 3WLAA 2I33A 3ASHA 3A6FA 1E8DA 4MPPA 4Q9KA 3Q3HA 3VH4A 5KQLA 1FNNA 1JPVA 2HHLA 3O73A 4IIYA 4KACA 3ZW8A 1DKOA 1L5WA 3ZDFA 1GFZA 1ZRHA 2C94A 2VSXA 4YQFA 5CVTA 5FOWA 1WEHA 3G2VA 4YCAA 8GPBA 1OXUA 3DEHA 3HYTA 4ZRMA 3U7GA 1GL7A 2IX9A 2QLLA 3C87A 3O83A 3VZDA 4D4KA 2XGOA 3GAZA 4QPNA 1KYIA 2YWGA 4YPOA 1CZUA 1ZK0A 2K2QB 5JPCA 3JWEA 4ZYZA 3ML9A 1DKRA 3NZSA 4CGYA 2F8YA 4MV1A 3SDZA 4ZPJA 4ECAA 3K6SA 4DPLA 2B6CA 2PPVA 4NC9A 2WAMA 4GQBA 3GLGE 2QVBA 4MWSA 2DUMA 4Q4JB 5CHYA 3P26A 3LT1A 1XD2A 4DTCA 5AVSA 5LWQA 5DPMA 4H17A 3FTQA 1ISIA 2J3IA 5EFZA 2TECE 4PYQA 2XQJA 3NRBA 1IEVA 1WV0A 3JR7A 3VU3A 3ZQUA 1ZK1A 4BRSA 3BL5A 1SXHA 1B3RA 4NJOA 5I8PA 3AR4A 3QXCA 1A7KA 4P31A 3SKYA 1ZVVA 2DY1A 3G2UA 4H3SA 3BTSA 1NAHA 2XMBA 4AK9A 3HJNA 2Z2IA 4YIHA 2WT9A 2J9YB 1PF7E 1E8NA 4PZZA 5DXAA 5A3RA 5EMMA 2C3UA 2Y93A 4DI3A 1SUCA 2A33A 3LCAA 1B0ZA 1T9ZA 2NWQA 3L43A 1FUEA 4AS1A 3JD4A 5FULA 4J29A 1EJBA 5E95A 1Q83A 4C2AA 4CLOA 2XNHA 1Z9BA 2QHXA 5C5CA 2NZJA 1W5FA 4C5BA 3KOMA 2OK7A 1W2HA 2FUNB 1E62A 1KZOA 3WYBA 4U9HS 5LP6B 3SVLA 3AS4A 4RK0A 1NNSA 4DV7B 3U4TA 3ISJA 3NAGA 5CLFA 4M53A 3KD2A 2IYNA 2Y2UA 4RPGA 4WASA 1PYOA 5LL6P 1IBRA 4LHYA 1V6AA 3KU4A 3WL7A 1DXQA 2PYIA 1P7PA 3ZGZA 1Y6ZA 1O87A 3DMYA 2C99A 1G6Q1 2BEUA 3R9MA 3MA0A 4I66A 1X8LA 4F21A 2QPLA 2GEDA 2F55A 1JWFA 3ZCUA 1EDUA 5JWHA 2QRUA 2WAYA 1F2VA 1VBMA 2VK4A 3DDZX 4AWXA 1V8FA 4AZWA 3MKQB 3S44A 1ISPA 2QSZA 4ZI7A 1NW3A 4LXTA 4JSYA 5IG2A 2CLHB 3V8BA 4KV7A 1H2BA 1AZSC 5LLDA 1FJ2A 2UY1A 2BJVA 2AXNA 3SY8A 1ZGAA 5KQGA 5D7BA 3Q5GA 2PKYX 2ENWA 3I2YX 1YR1A 4OHWA 5AOVA 4JLDA 2ZIUB 4TM8A 3WHKA 2O8DA 2Y69E 3FBTA 4RZXA 2C7OA 4ASUA 4AO6A 5IUNC 4BMSA 2Q41A 2ZGGA 1W46A 5C53B 1YFLA 3I0NA 3V31A 3ABOB 3KPYA 3NI2A 5CPFA 2XQVA 2IY9A 3T5DA 2DTEA 3O26A 4B6RA 1DKQA 1N75A 3X1WA 4ATZD 1NBMA 1PEDA 4HH3C 5FUQA 3HHEA 3OX3A 3U80A 1DIBA 1U1GA 3AT1A 5AQ1A 1MW8X 2ZQYA 2WTBA 1GZ4A 4L4ZA 4HOUA 2QAGC 3PUZA 1WSWA 1U0OC 4YMWA 3UIPC 1C30A 3LBAA 3P0JA 4S12A 2NNWB 5GM2A 2H9YA 1FS5A 2P9LG 1GVNB 1YB5A 5J2UF 2PKWA 1Q7EA 1JG3A 2VP4A 1I30A 3QGMA 3HRIA 2WUGA 1CY0A 2FW7A 4HYEA 1ZP6A 3VU1A 5D66A 4C2TA 3OLVA 1PVVA 1RRPA 3HM9A 2QZJA 3VU0A 2QNRA 1DCTA 5AIBA 1P0PA 1TZMA 2GJ9A 3QW2A 4YI3A 4MRUA 3FUNA 3KD7A 2OL4A 4I2WA 1N2SA 1S8NA 3HL4A 2GNPA 3ABQB 3O95A 3R09A 4OYHA 3G59A 4ALJA 1N2BA 3AOEA 1PNOA 1C5KA 3ZYCA 4FB4A 1FZQA 2R2GA 3U4IA 4O5OA 1D2MA 3HPQA 1UG3A 4LG6A 1X2EA 4MVWA 4TV8F 1UZMA 4RC9A 1AHHA 3IQXA 2P9IG 1Y1RA 2YN0A 3B60A 4R0NA 3LGXA 4TL6A 2QC9A 3G0BA 1HXIA 4B94A 1VIDA 2V5VA 4LZPA 5AHRA 3A4YA 1XRJA 2EV9A 1OH5A 2C1EA 2DFLA 3IKOB 1S96A 2BZ1A 4NARA 2ATEA 2PEZA 3FW1A 3JRWA 5CT6A 4L2LA 2ZJ6A 5F64A 3D8BA 4BFLA 4PG8A 2VRBA 3GZSA 3NT4A 4WNAA 3RV4A 4M1KA 5CFLA 4QRDA 1OUMA 1Y3BE 4KQ1A 4XFKA 4LF8B 4I1IA 2CSXA 4C4XA 4KK3A 4NCKA 2H6GA 1BWPA 2XQGA 4IJQA 2P9PG 2A5JA 4OPMA 4A2CA 6YASA 1EVJA 3D7MA 3N8NA 4XYBA 5KNBH 5CURA 2AXZA 4BZPA 1VE5A 1W4LA 3F46A 3NJ4A 3NBMA 5FF9A 2ETAA 2ADMA 4Q9DA 1JECA 2Q5FA 3ML1A 1VI5A 4EI9A 4OKIA 3S28A 3UKRG 2X7HA 3UV6A 4CFZA 2CY0A 3H9GA 1QHSA 2ETBA 5HF8A 3EGXA 9GPBA 1L9KA 2WVIA 2DE0X 4K5QA 2O0KA 1PC2A 4IPTA 4OHUA 4PZ9A 1RXYA 2P62A 2PH3A 2O9JA 3R4VA 2H4FA 4CXMA 3QG5A 3A9CA 4DSAA 2HJWA 3C72A 3GWGA 1BA2A 2IHJA 4RTOA 3D9HA 2IDJA 4Y6SA 3KTFA 1NW9B 3INTA 3FZEA 4B3HA 2GN8A 1LVGA 2BFCB 5T4YA 1R00A 4FKZA 2Q99A 4TTQA 4XUCA 3S8MA 4C22A 4M89A 3T8YA 3WB1A 5COQA 2PMEA 5E6SB 3E9DA 4IOKA 2GYWA 3GY0A 5FA6A 1YBMA 3CV0A 2XZDA 3NWBA 5ERYA 3U4GA 1VJRA 2GRUA 4G84A 3ROPA 4ETMA 4C43A 4JENA 2MSEB 4BJ1A 2JBAA 1I6WA 3EG5A 2X2EA 3B5IA 2P5SA 3IV9A 4BGUA 1R6BX 1XU4A 2JATA 4YFYA 4IX9A 1BVHA 1S3IA 5L3SB 4QT0A 1Y98A 3V2XA 4AIFA 1ZI9A 3JYPA 1Z4NA 3UPTA 5B7QA 1WD7A 1B26A 1WXIA 1XZKA 3B6KA 3MJRA 4B0OA 4OSEA 3UTDA 4E21A 4BIMA 1VHTA 5EKSA 1D8DA 1O57A 4MKGA 4YMUA 2PNNA 3GBSA 2I4NA 4QQIA 3UWMA 2P3LA 1SQ5A 1JWAB 5GAJA 4ER7A 1K8YB 1QUEA 4B8ZA 4R1TA 1AT1A 2COUA 3MLAA 3RKVA 5IJ9A 3MXOA 1Q1EA 1IUNA 1EK5A 1UMBB 1ZD1A 1N0HA 1PZHA 3A36A 4U7TB 5EQTA 13PKA 1NXWA 3WGTA 4F6RA 1DKUA 1WEKA 2X9GA 1KQGA 4BZXA 1KNXA 3EHNA 2QZ9A 4R6XA 4FE3A 3KUCA 2HDHA 4EW2A 3VKGA 1RQNA 3C7KA 3LSTA 4KX5A 1E5VA 2VDLB 3EU9A 4M1OA 3DNPA 3SE0A 2GYUA 3TOVA 1NPTO 5KX5A 2QN1A 1E2DA 3UQ3A 1ZY2A 3K53A 4QE3A 2FPUA 1RPNA 4WEQA 3WOVA 3TH5A 3UMFA 2UYQA 3EPPA 3WZMA 3U3WA 3TX6A 1WM1A 1Z18A 4MMXB 4MWZA 1GYRA 2HWYA 3ZYQA 2O7QA 4MUIA 2JFPA 5TIIA 4JL0A 2CWWA 2Z83A 2ZS7A 4NMMA 2WPDD 1QK4A 4TUYA 2MYUA 4FLEA 1X2BA 3F6SA 3H9QA 3R6GA 1OJ7A 4OU4A 1Z45A 1YA8A 2ZJ0A 1EVLA 3JQ1A 1KTVA 3BAZA 1GN9A 4XX1A 4V0RA 5H7XA 3B36A 2ZETA 2GTIA 3HFRA 1DVPA 5AAOA 1UOPA 3KEMA 3ZCXA 2XOXA 2ID7A 2XX3A 4C5AA 1K4YA 1Y8QB 4BMNA 4CKEB 3O21A 4Q1CA 1H0RA 4ALLA 1XZQA 3PDUA 4TTTS 2BKKB 4RSRA 1GCOA 1P2BA 1U2RA 1WX1A 2VJBA 4JP3A 1YOVB 1T9GS 5FV4A 5CDTA 3R7BA 2XMGA 2I3AA 3KPUA 1N6KA 2UZ1A 3DBRA 4UXJA 3QU2A 3WNQA 1GPKA 1G41A 4EM6A 4E5SA 2AF4C 2CHVA 5HDBB 3ZCRA 3QOXA 3KO8A 1UDRA 4WUYA 1A9OA 3OLYA 4B3IA 4F3RA 1T25A 1Y4UA 4X92A 3ENVA 1C3OA 2ZKLA 5F77A 4DIUA 2V4MA 1RLJA 3W6PA 3L18A 1WQ3A 2MHCA 3FUKA 5B3LA 1RI2A 4DR7B 1V54E 1ADFA 2IBTA 1I1QB 4GOJA 3K9LA 1M9NA 4TT3A 4YP7A 1WXHA 2Z3VA 5KVVA 1IOWA 5A5VA 2GHTA 3ESRA 4M3OA 3OU2A 3O38A 4P54A 4D4LA 2JD2A 1QGED 2AA3A