1S64A

Rat protein geranylgeranyltransferase type-i complexed with l-778,123 and a sulfate anion
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Analysis Reveals that Anticancer Clinical Candidate L-778,123 Inhibits Protein Farnesyltransferase and Geranylgeranyltransferase-I by Different Binding Modes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 126
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1s64A00
3DSWA 4GTQA 1JCQA 3DRAA 3Q75A 4MBGA 1MZCA 1N4QA 1TNUA 1LTXA 1FPPA 1TNYA 3EUVA 1O1TA 1TN6A 2IEJA 3E32A 2H6IA 3HXBA 3DPYA 1X81A 3SFYA 1N4PA 3Q7AA 1NI1A 3HXEA 2F0YA 2H6GA 1FT1A 1NL4A 1SA5A 1N94A 3Q78A 2ZIRA 3DSTA 3HXDA 3EU5A 4GTTA 2ZISA 4GTRA 1TNBA 4EHMA 4GTOA 1JCRA 3E30A 1KZOA 1TN7A 4GTSA 4LNBA 3PZ4A 1QBQA 1O1RA 3PZ1A 1LD7A 3DSVA 1SA4A 3Q73A 1O1SA 4GTMA 1N4SA 1JCSA 1N9AA 2BEDA 3KSLA 3PZ3A 4GTVA 3KSQA 4LNGA 1TNOA 2H6FA 1S64A 2H6HA 3Q7FA 1DCEA 1TN8A 3C72A 3DSSA 3E37A 3PZ2A 4GTPA 1N4RA 1KZPA 4YDOA 1S63A 2R2LA 1LD8A 3HXFA 3HXCA 1TNZA 3SFXA 1D8EA 4L9PA 3E34A 3DSXA 3Q79A 3DSUA 1FT2A 4YDEA 1O5MA 1D8DA 1N95A 3E33A
chains in the Genus database with same CATH superfamily
4XKCA 5ENTD 1OY3D 1FCHA 4N39A 4ATGA 3LYAA 3UM3A 5EILA 4XZ4A 3HVEB 2ETBA 4MLPA 2XGOA 3G2VA 2QYJA 4GPMA 1WY6A 1N4PA 2RFMA 5ARGA 4TXQA 4HVBA 1TYQG 4BESA 2H6GA 2V8SE 5CRVA 2ZIRA 5ENRD 4EECA 3JUIA 1BD8A 4I6GA 3SNXA 5BUZA 2FULA 4JA7A 5J08A 5CERB 3NF1A 2RD0A 3UM1A 3L9TA 3TJPA 2WXRA 1H2VC 4N2SA 4LRZA 4H7XA 5ARFA 4CZ2D 2V5FA 4C48B 3L6AA 4LNGA 1U2VG 3FUHA 2H6FA 2DVWA 4GA0A 5CMYA 3CKCA 1DCEA 4G23A 1E8WA 3C72A 5CMWA 2BUGA 1ZBPA 4WNEA 3PZ2A 1NP7A 3ASGA 4LEUA 1MX2A 1SQMA 2L0TB 2X6JA 5EX3A 4BY6A 3HXCA 3UQ3A 4XI9A 4U0SA 3CHOA 2XGMA 1XGWA 4IRUA 5BV1A 4DX2A 2XHEA 3ZW3A 2RG8A 4MBGA 4OAUC 4DX5D 2WXJA 3AU4A 4LNUD 1SZAA 1TNYA 1QQEA 4G25A 2M63A 4K0RA 5ANRA 2ETAA 3AG1E 2L6BA 2MOWA 2WQHA 2AJAA 3FP3A 5FTPA 4HS2A 4Q96A 4CGWA 4UI9K 5HS0A 3Q78A 3UIOC 2MHKA 1HF8A 4BSZB 4HRMB 3SBSA 4W9RA 4LUNU 1VDYA 4EHMA 1K1BA 3TWRA 3DEPA 1JWGA 3E30A 3TG5A 1HE8A 5AN8A 4RG6A 4Q94A 4JXTA 4HOQA 3UM0A 4JL0A 1WDYA 2GRNB 3AAAC 4FLHA 5ENNA 1Z6TA 2XCBA 4HI9A 3NB2A 1IHBA 2GGFA 4FULA 3B7UX 1IKND 2WXMA 3Q9UC 2H6HA 1OCRE 4LG6A 2XRZA 5AJDA 3EHRA 4UWKA 3IXEA 2KATA 1DNPA 1GW6A 2VSOE 4HOSA 1KT0A 3G2TA 2C0LA 5DBKA 3T8KA 1YA0A 2P9KG 2WM9A 2OCCE 2WXNA 3E33A 3FEYA 5EDSA 3LXUX 3FH5A 1O1TA 3EIQC 4AY6A 5D2MC 3JYSA 5FT9A 3HXBA 3LPZA 3UIPC 3PNTB 4B8CB 3V2OA 4LERA 3NZUA 4UWHA 4I1MA 1YCSB 3QARA 2X6FA 1E8ZA 3ZRHA 2B6CA 1Z3XA 4Y6CA 4D10C 3ABKE 3L54A 5T8IA 3MV2B 4GTRA 3G2UA 3PS6A 4B8AA 4GTOA 2IF4A 4DJAA 4OVUA 4K5AB 1OCOE 4BTAA 4B93B 3FTXA 3VTYA 5CECB 3WG7E 1MX6A 1O1RA 1Q2ZA 2Y0BG 4A1SA 1PC2A 1JUQA 3HIZA 1H6PA 1TNOA 3VLEA 3Q7FA 2I6HA 1MJ0A 3V2XA 4HQDA 5BNWA 3ML8A 4WWPA 4GZ6A 1U3CA 4I43A 4J8FA 5ANLA 4XX5A 5A23A 1AP7A 3I5PA 2VYIA 3DXMG 1TNZA 2XRYA 3ASHA 2WXQA 3S7JA 4ABNA 3Q79A 5FJYA 2VQ2A 2V4HC 5AENA 3EHMA 2YHEA 3CLJA 3CVYA 3FTUA 5BV0A 4G11A 2BTDA 2I2OA 1SVXA 4J8SA 4G8LA 3Q7AA 5ENQD 4WUYA 2WXGA 4RG9A 4AEZC 3P1UA 1FT1A 3HYMB 1OCZE 2EIKE 4NRHB 3ZKJA 3KEZA 4GB9A 2WXLA 3HXDA 4BERA 4ILIA 3LVRE 3N71A 5EKQD 2XGSA 3FFLA 5G05J 2WXOA 1UOHA 2EIME 2X38A 3S2AA 3UUXA 1JPLA 2R5SA 3D9OA 1H0AA 1OWNA 3LJ3A 1LD7A 1IHGA 2AW6A 1RW2A 4GTMA 2UY1A 3KSLA 3RJVA 1BU9A 3T5VA 4AY5A 1WAO1 4EBAG 1S64A 3ZYKA 2YINA 2WB2A 3ASFA 3ZHEB 2P9UG 3TWTA 3ZFWA 2PQNA 4DX7D 3JXIA 4ME2A 3U9WA 3ABLE 3G2SA 5CBNA 3I3NA 2P9NG 4J0UA 2VGXB 2XZTG 5JJ6A 2HO1A 3CSFA 2LO6A 3QK0A 1E7UA 1NFIE 5B1AE 1FT2A 1IXVA 3UX4A 4X8QA 2LUHA 2PL2A 2WXPA 5EX0A 4L2YA 3RRUA 1D9SA 3S7BA 5KJNA 1LTXA 3JQ1A 4G1TA 5JMND 1E8YA 3TGOA 3UT8A 3ONKA 3R7RA 1UJJA 1FVFA 1OWPA 1N11A 4FC8A 3SF4A 3FUNA 2OEWA 4KVMA 5E76A 4BT9A 1NI1A 5IY5E 4HRLA 4HXIA 4IYPA 3MZLB 4F1SA 3EU5A 5HQ8A 4FJYA 4RQIA 1DC2A 3CKBA 4ZFHA 1KPSB 3OAWA 2OVFA 5KWDA 4NACA 3ZN3A 3DPDA 2MRIA 1ELKA 5FINA 4AOFA 3APCA 3LEWA 3ZGQA 4WNFA 3OXGA 1JCSA 3ENEA 5EYPF 4GTVA 5G55A 4NURA 3ISMC 3L08A 2PNNA 3TG4A 2IO3C 4FP7A 5J90A 4HBDA 3PEVB 3T5XA 2ETCA 3LCAA 2V5QC 2XZDG 2IO2C 1NZNA 3HRAA 2XENA 4F3VA 3JQ0A 4YDEA 3S7FA 3L22A 1N95A 2CG3A 4QFVA 4TUMA 1QNFA 3CIAA 4AP2A 3CK7A 4FHJA 3U4TA 5BW8C 1MZCA 3NQPA 2VSYA 5AJLA 1TN6A 1IQRA 3TWUA 5ENOD 3HHMA 4K5BA 4XIFA 1W3BA 2RFAA 2LXLA 3D9KA 4J8DA 5FQ8A 3AU5A 1V54E 5AAOA 1X5BA 2OVBA 2VJ8A 3W9FA 1EF1C 2FEZA 2AXVA 2DZOA 4CRWA 2X6KA 1H6KA 3Q4AB 3DSVA 2DIWA 3U66A 2IU1A 5AQBA 5B1BE 1N0QA 4JHJA 1TEZA 2WMOA 3RSEG 1ELWA 3FU3A 2Y3AA 3CVPA 3WXXA 4FHKA 3Q9NC 4U04A 3TWXA 2ZXWE 5AQ9A 1LD8A 3HXFA 4DUIA 3PE3A 3ZUVB 4DRXE 2VSXE 4G2VA 4APOA 3EJNA 4CDRA 3HVEA 3KD7A 3C3RA 4F1PA 2AXZA 3Q47B 1N54A 3TWWA 1JWFA 3SBTB 3SFZA 3MCXA 3CK9A 2IQCA 4TUUA 4HLLA 3UMVA 3UXGA 4O1PA 5LX8A 2J4BA 4N2QA 1N94A 3ABME 2XCCA 4GTTA 3C3QA 5T3RA 1Y8MA 3L17A 4C9BB 2DYSE 3NAWA 2QYUA 5BXUA 2QFCA 3UPVA 4GTSA 3MKQA 5EIDA 3QB2A 2DYRE 4JA9A 2XPIA 3RAUA 4R7LA 4BSXA 4B89A 4N5QA 3J5PA 4I2WA 2ZU6B 1N4SA 2L0IA 5FIOA 4Q69A 3D9JA 3ZXPA 4I1AA 1HU3A 1BI7B 4L7TA 4A3TA 5HI7A 1OUVA 3FTSA 2NC9A 4ANXA 4GPKA 4EZJA 2CHXA 3FUKA 3VTXA 3UKRG 3VLDA 2C2LA 3K9IA 3MKQB 2XEHA 4FADA 4U96D 5G05C 3FUDA 3EDTB 4A3VA 2LAHA 2A5UA 1UJKA 2R05A 2ONDA 2GRPB 1N4QA 1Y6IA 4GYOA 4ANWA 4OAVB 3E32A 4KVOA 3IBEA 4JB8P 1A5EA 4NIKA 3ZNGA 2ZGGA 1NL4A 3SZ7A 3ML9A 3LDZA 1E7VA 3MEKA 1H2TC 2WQ6A 1JCRA 3LY8A 4V3IA 4F6RD 2FBNA 4YDWA 1RZ4A 3I4RB 4U0ZA 4EQFA 3NBNB 2GW1A 4GZ3A 4AV7A 4KT6B 3D9HA 2R59A 2VSNA 2V4LA 2ZGDA 3FH7A 3KAEA 5AARA 2WXFA 3FU0A 1KZPA 4YDOA 4GZ5A 2YNQA 4YNDA 4BX9A 2WMNA 1Z5SC 3B7SA 3EIJA 3QJZA 4PS3A 3CGHA 4K5CA 1FVHA 4I1OB 4OYSA 4E6HA 1BLXB 3DSWA 4MKTA 4L2LA 5ENPD 4JPSA 3ZYMA 1TNUA 3AS5A 2CHWA 3C5RA 2WQ7A 2R02A 5JA4D 4K03A 4WNGA 1ZB1A 2PZIA 4PDXA 2CFUA 2WXKA 4F7AA 3PDNA 4GMLA 3RK6A 4NQ0A 5KJKA 3MKRA 3C3OA 3ZYQA 3MV3B 5C2YA 1UG3A 4OVVA 4B94A 3BQOA 1OXJA 4PH4B 3I4GA 5CRUA 5B3SE 3CVQA 3FDHA 3BG0B 2HE0A 3L16A 2YHCA 4RVBA 2IJGX 5AQ7A 4EZKA 1MHQA 3RRNB 4J6IA 3CVWA 4F53A 3U64A 4G26A 3UT7A 5A7DB 1DVPA 1AWCB 1XNFA 4JEUA 3AS4A 4PUCA 2DBAA 4I17A 4GU5A 3CEQA 1D8DA 4HRNA 3TL5A 3T9KA 4C0EA 1IYGA 3IHVA 5G2NA 2GRMA 4LSZE 4BWRA 2KZTA 3EHNA 2C0MA 1EYHA 3V79K 4I9EA 4O6FA 3FY4A 3ONLA 4QQIA 3GW4A 4APFA 3TXMA 4GMRA 3CHSA 4IULA 4I2ZA 1TR4A 2KCVA 5LOZA 3QC1A 1WM5A 2ILRA 3ESLA 5D0QD 4U95D 3Q49B 3IEGA 4LNBA 4I6JA 1SZ9A 3JUEA 3MGBA 5CBOA 5KJLA 3PREA 5E75A 3OXLA 3LS8A 5LCWJ 5FZQA 3ZHEA 4UWGA 2PM7A 1YMPA 3PZ3A 1OT8A 3VLFA 2R17C 3ZEFA 4O60A 3QWVA 4L1BA 4FA6A 5A6CA 5DIZA 1HXIA 5T4YA 1S63A 2HYZA 2OOEA 3ASDA 3B7RL 2LAIA 3RKVA 4YVQC 4JC8A 1D8EA 3C98A 1HH8A 3CHPA 5HRYA 5G04C 3J5QB 3FTWA 2J8SD 2KCKA 4DLQA 1TJFA 2LSUA 3AJIA 4PS7A 2LNIA 2VTBB 4WNDA 3UTMA 1ZU2A 1K1AA 1N52A 3OXFA 5EN5D 4CEMA 4GAAA 3EUVA 4ANUA 2KC7A 1EDUA 3V30A 3CVLA 3SFYA 3FUIA 4UUCA 4G8KA 3D3MA 3AG4E 1DCQA 1SA5A 4WAFA 3Q15A 3ZXSA 3Q5MA 3OTNA 2DZNA 1S0PA 3L82A 1INZA 4CT4A 4UQYA 1TNBA 4GYWA 2LSVA 4URKA 2P9IG 5BXOA 2QZAA 2QY7A 3PNLB 3PEUB 4KYOB 2L9BA 2FO7A 2NSZA 5LFAA 3O48A 3SHFA 2AWIA 4U8VD 3UM2A 5JHAA 2J49A 3PH0C 5KCMA 2J09A 3UINC 3ASNE 5JJ7A 1NA0A 1U3DA 5CCMA 1N4RA 2RKKA 2GRLA 2P2CP 2JEKA 4WWOA 2DCPA 4RSYA 3SFXA 3GYZA 3V31A 3DSUA 3UI2A 2J07A 3FUJA 4JD2G 3B7TA 4JZYA 3GZ2A 3B13A 1PAQA 3FU6A 5G04J 5AYWD 3QKYA 4I6EA 1OWMA 2IFUA 5FQ4A 2A4ZA 3PVLA 2IEJA 3PE4A 2MYOA 4J7WA 4BX8A 4GA1A 4ILGA 4UQZA 4GZCA 2Y1LE 2A5EA 3HXEA 2EILE 3NOCD 1KT1A 4KZCA 2CHZA 3ZIMA 3RO3A 4ACLA 5HKPA 3SD5A 4ANVA 4DX6D 2BF0X 4TXPA 2GRRB 3URZA 4UI9J 1KZOA 1TN7A 3FH8A 3UKUG 1MX4A 4JEHA 4BETA 4DPRA 5JJTA 3AG3E 4BFRA 4GZDA 5LCWC 1N9AA 4CYMD 4HOTA 5CCLA 4DX1A 3QWWA 5EIBE 2EIJE 1UN8A 4TXRA 3L13A 2WVIA 2F8YA 2XS8A 4ACKA 3IKOB 5H7PA 3MYVA 5M72A 3FTVA 2VGYA 1YYHA 3BEEA 2P58C 5LP0A 2CG2A 3FUFA 3CVVA 3FWVA 2VTBA 4WWNA 3SQVA 3ULQA 2WXHA 4UWLA 3GZ1A 3D9PA 3RIBA 3CR3A 3LY7A 2F0YA 3TAXA 4U0UA 4M7CA 2V0PA 1OCCE 4AIFA 1L5JA 3BU8A 2IONA 2Y4TA 3DSTA 4AJWA 2XS1A 5ITZF 4IN3B 2ZISA 4A63B 1WG0A 2I1KA 2NXPA 1HO8A 3DXKG 3CQCB 2I1JA 4Z68A 2AXUA 4CDMA 1UN9A 5AQAA 4N5CA 1Z3YA 2CFZA 3EU9A 4JVSA 2BEDA 4M3OA 1HG2A 2P9LG 3FTYA 4JHKA 3CHMA 2GRQB 3KSQA 5FWQA 2J4DA 3FHEA 1A17A 2FF4A 2B0OE 4GMJA 1BPOA 3DSSA 3NZSA 3BG1B 1MYOA 4JW1A 5KBAA 1MQSA 2LXMA 3CVNA 2HM8A 4A55A 3TXNA 3P2BA 4FJZA 3X2QE 4AVXA 1SW6A 2XPYA 1HFAA 1PY1A 1O5MA 3LJNA 2IOSA 4U07A 5AIJA 2E0IA 2KZTB 4GTQA 3W9GA 4EZLA 2XEVA 2J9QA 5CHEE 4HI8A 3ZYLA 4KMOA 4U8YD 3SO8A 4PS8A 1NA3A 3FUMA 4GCNA 4N3BA 3R9MA 2R03A 3D9NA 3DWLG 3DPYA 3PUJA 1S70B 1HX8A 3ZPJA 4KXKB 1K3ZD 3APDA 3ULYA 4CCAA 3ASOE 4N3AA 3LVQE 3FEXA 4HNAD 4J8YA 4CGVA 2Y4UA 1E96B 2HR2A 3LKUA 3MX3A 5FZRA 4AXHA 3QAQA 1TJCA 3D9IA 3CVUA 3ULEG 3PZ4A 2JLBA 3QNKA 3CHQA 1SA4A 2WPVA 4EBAA 3U3WA 2X3MA 3FTZA 1H2UA 4ATZD 2QC9A 4FLBA 4YVOA 3CHRA 4KBQA 2P9SG 2UY1B 4E85A 1E90A 4UQXA 2P9PG 2EQXA 3CSTA 3QDNA 3G2WA 3S7DA 3APFA 3PRZA 4L23A 4EPZA 1ELRA 2DWZA 3IHYA 4CT0A 4L9PA 4I9CA 4DI3A 3E34A 2JABA 4GYYA 4XEIG 5FQ7A 3O4ZA 3SI5A 2KBXA 4TV3A 2PQRA 3UT4A 1JCQA 2Q7FA 3TWVA 3IV0A 2J08A 3D9LA 1FPPA 4A1GA 1QZ2A 3E4BA 4HB5A 4U63A 3PZDA 5FQ6A 4U8HA 2FO1E 1X81A 3SGHA 1B89A 2XQ0A 4G24A 4GCOA 4Y6WA 3TWSA 3AG2E 2E2EA 3HDXA 1UW4B 3DBSA 2UWJG 4C0MA 4KZ0A 4RLYA 3JXJA 1H19A 3FULA 3JCKC 3MA5A 1LF8A 1G3NB 1H6OA 4MS6A 2KCLA 1OWOA 3PZ1A 2NYJA 3CV0A 3SY2A 4LCTA 2EINE 4BEPA 5D0OD 2KXPC 5KNHD 3EHQA 3ZVVA 3HG0D 1N0RA 2GROB 5EYLA 4JHRA 4TRQA 4HOUA 2X6HA 5BT1A 1V55E 4HORA 3QWPA 1TN8A 2AVPA 3R7QA 4FU3A 3RU0A 1BI8B 2VGEA 3E37A 4UWFA 4GTPA 4P29A 3ESKA 5JHBA 3B95A 3RRMB 2KM4A 4DLOA 4ILHB 4J8EA 5KNGA 3DSXA 2YQ8A 1P5QA 3AS8A 3T8MA 3B7BA 4HFGA 1KLXA 1OWLA 2FI7A 3F6QA 2BKGA 5KJMA 3MJWA 3DRAA 3Q75A 3RO2A 2X6IA 3NOGD 2PM6A 4CDNA 3BUAA 3CK8A 2XEEA 3QOUA 1E8XA 4ZHBA 2H6IA 3KS2A 4H7YA 3FU5A 4BTBA 5ENSD 5BPPA 5D66A 4AM9A 4U7EB 3TWQA 4N3CA 2F8XK 4XE0A 5FZSA 1EPUA 3ZU7B 1IQUA 4DI4A 2OEVA 3PUKA 1QYMA 2WXIA 3LY9A 3DEOA 4O1OA 4DK5A 5CEAA 2IOLA 2L6JA 1QBQA 2F37A 4MRUA 3GZSA 3Q73A 1O1SA 1HS6A 4B0ZA 4UI9C 4BT8A 5C1DA 4HLEA 3D9MA 1HZ4A 2BKKB 3KEAA 4GA2A 2XPZA 3CVXA 4XKBA 3R9AB 4YDYA 2I9CA 2R2LA 3CQGB 1HG5A 2OV8A 2IY0C 2Y69E 2VGXA 5CEDB 3FUEA 4XI0A 1K8KG
chains in the Genus database with same CATH topology
3DSWA 4GTQA 1JCQA 3DRAA 3Q75A 4MBGA 1MZCA 1N4QA 1TNUA 1LTXA 1FPPA 1TNYA 3EUVA 1O1TA 1TN6A 2IEJA 3E32A 2H6IA 3HXBA 3DPYA 1X81A 3SFYA 1N4PA 3Q7AA 1NI1A 3HXEA 2F0YA 2H6GA 1FT1A 1NL4A 1SA5A 1N94A 3Q78A 2ZIRA 3DSTA 3HXDA 3EU5A 4GTTA 2ZISA 4GTRA 1TNBA 4EHMA 4GTOA 1JCRA 3E30A 1KZOA 1TN7A 4GTSA 4LNBA 3PZ4A 1QBQA 1O1RA 3PZ1A 1LD7A 3DSVA 1SA4A 3Q73A 1O1SA 4GTMA 1N4SA 1JCSA 1N9AA 2BEDA 3KSLA 3PZ3A 4GTVA 3KSQA 4LNGA 1TNOA 2H6FA 1S64A 2H6HA 3Q7FA 1DCEA 1TN8A 3C72A 3DSSA 3E37A 3PZ2A 4GTPA 1N4RA 1KZPA 4YDOA 1S63A 2R2LA 1LD8A 3HXFA 3HXCA 1TNZA 3SFXA 1D8EA 4L9PA 3E34A 3DSXA 3Q79A 3DSUA 1FT2A 4YDEA 1O5MA 1D8DA 1N95A 3E33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSW A;  4GTQ A;  1JCQ A;  3DRA A;  3Q75 A;  4MBG A;  1MZC A;  1N4Q A;  1TNU A;  1LTX A;  1FPP A;  1TNY A;  3EUV A;  1O1T A;  1TN6 A;  2IEJ A;  3E32 A;  2H6I A;  3HXB A;  3DPY A;  1X81 A;  3SFY A;  1N4P A;  3Q7A A;  1NI1 A;  3HXE A;  2F0Y A;  2H6G A;  1FT1 A;  1NL4 A;  1SA5 A;  1N94 A;  3Q78 A;  2ZIR A;  3DST A;  3HXD A;  3EU5 A;  4GTT A;  2ZIS A;  4GTR A;  1TNB A;  4EHM A;  4GTO A;  1JCR A;  3E30 A;  1KZO A;  1TN7 A;  4GTS A;  4LNB A;  3PZ4 A;  1QBQ A;  1O1R A;  3PZ1 A;  1LD7 A;  3DSV A;  1SA4 A;  3Q73 A;  1O1S A;  4GTM A;  1N4S A;  1JCS A;  1N9A A;  2BED A;  3KSL A;  3PZ3 A;  4GTV A;  3KSQ A;  4LNG A;  1TNO A;  2H6F A;  1S64 A;  2H6H A;  3Q7F A;  1DCE A;  1TN8 A;  3C72 A;  3DSS A;  3E37 A;  3PZ2 A;  4GTP A;  1N4R A;  1KZP A;  4YDO A;  1S63 A;  2R2L A;  1LD8 A;  3HXF A;  3HXC A;  1TNZ A;  3SFX A;  1D8E A;  4L9P A;  3E34 A;  3DSX A;  3Q79 A;  3DSU A;  1FT2 A;  4YDE A;  1O5M A;  1D8D A;  1N95 A;  3E33 A; 
#chains in the Genus database with same CATH topology
 4XKC A;  5ENT D;  1OY3 D;  1FCH A;  4N39 A;  4ATG A;  3LYA A;  3UM3 A;  5EIL A;  4XZ4 A;  3HVE B;  2ETB A;  4MLP A;  2XGO A;  3G2V A;  2QYJ A;  4GPM A;  1WY6 A;  1N4P A;  2RFM A;  5ARG A;  4TXQ A;  4HVB A;  1TYQ G;  4BES A;  2H6G A;  2V8S E;  5CRV A;  2ZIR A;  5ENR D;  4EEC A;  3JUI A;  1BD8 A;  4I6G A;  3SNX A;  5BUZ A;  2FUL A;  4JA7 A;  5J08 A;  5CER B;  3NF1 A;  2RD0 A;  3UM1 A;  3L9T A;  3TJP A;  2WXR A;  1H2V C;  4N2S A;  4LRZ A;  4H7X A;  5ARF A;  4CZ2 D;  2V5F A;  4C48 B;  3L6A A;  4LNG A;  1U2V G;  3FUH A;  2H6F A;  2DVW A;  4GA0 A;  5CMY A;  3CKC A;  1DCE A;  4G23 A;  1E8W A;  3C72 A;  5CMW A;  2BUG A;  1ZBP A;  4WNE A;  3PZ2 A;  1NP7 A;  3ASG A;  4LEU A;  1MX2 A;  1SQM A;  2L0T B;  2X6J A;  5EX3 A;  4BY6 A;  3HXC A;  3UQ3 A;  4XI9 A;  4U0S A;  3CHO A;  2XGM A;  1XGW A;  4IRU A;  5BV1 A;  4DX2 A;  2XHE A;  3ZW3 A;  2RG8 A;  4MBG A;  4OAU C;  4DX5 D;  2WXJ A;  3AU4 A;  4LNU D;  1SZA A;  1TNY A;  1QQE A;  4G25 A;  2M63 A;  4K0R A;  5ANR A;  2ETA A;  3AG1 E;  2L6B A;  2MOW A;  2WQH A;  2AJA A;  3FP3 A;  5FTP A;  4HS2 A;  4Q96 A;  4CGW A;  4UI9 K;  5HS0 A;  3Q78 A;  3UIO C;  2MHK A;  1HF8 A;  4BSZ B;  4HRM B;  3SBS A;  4W9R A;  4LUN U;  1VDY A;  4EHM A;  1K1B A;  3TWR A;  3DEP A;  1JWG A;  3E30 A;  3TG5 A;  1HE8 A;  5AN8 A;  4RG6 A;  4Q94 A;  4JXT A;  4HOQ A;  3UM0 A;  4JL0 A;  1WDY A;  2GRN B;  3AAA C;  4FLH A;  5ENN A;  1Z6T A;  2XCB A;  4HI9 A;  3NB2 A;  1IHB A;  2GGF A;  4FUL A;  3B7U X;  1IKN D;  2WXM A;  3Q9U C;  2H6H A;  1OCR E;  4LG6 A;  2XRZ A;  5AJD A;  3EHR A;  4UWK A;  3IXE A;  2KAT A;  1DNP A;  1GW6 A;  2VSO E;  4HOS A;  1KT0 A;  3G2T A;  2C0L A;  5DBK A;  3T8K A;  1YA0 A;  2P9K G;  2WM9 A;  2OCC E;  2WXN A;  3E33 A;  3FEY A;  5EDS A;  3LXU X;  3FH5 A;  1O1T A;  3EIQ C;  4AY6 A;  5D2M C;  3JYS A;  5FT9 A;  3HXB A;  3LPZ A;  3UIP C;  3PNT B;  4B8C B;  3V2O A;  4LER A;  3NZU A;  4UWH A;  4I1M A;  1YCS B;  3QAR A;  2X6F A;  1E8Z A;  3ZRH A;  2B6C A;  1Z3X A;  4Y6C A;  4D10 C;  3ABK E;  3L54 A;  5T8I A;  3MV2 B;  4GTR A;  3G2U A;  3PS6 A;  4B8A A;  4GTO A;  2IF4 A;  4DJA A;  4OVU A;  4K5A B;  1OCO E;  4BTA A;  4B93 B;  3FTX A;  3VTY A;  5CEC B;  3WG7 E;  1MX6 A;  1O1R A;  1Q2Z A;  2Y0B G;  4A1S A;  1PC2 A;  1JUQ A;  3HIZ A;  1H6P A;  1TNO A;  3VLE A;  3Q7F A;  2I6H A;  1MJ0 A;  3V2X A;  4HQD A;  5BNW A;  3ML8 A;  4WWP A;  4GZ6 A;  1U3C A;  4I43 A;  4J8F A;  5ANL A;  4XX5 A;  5A23 A;  1AP7 A;  3I5P A;  2VYI A;  3DXM G;  1TNZ A;  2XRY A;  3ASH A;  2WXQ A;  3S7J A;  4ABN A;  3Q79 A;  5FJY A;  2VQ2 A;  2V4H C;  5AEN A;  3EHM A;  2YHE A;  3CLJ A;  3CVY A;  3FTU A;  5BV0 A;  4G11 A;  2BTD A;  2I2O A;  1SVX A;  4J8S A;  4G8L A;  3Q7A A;  5ENQ D;  4WUY A;  2WXG A;  4RG9 A;  4AEZ C;  3P1U A;  1FT1 A;  3HYM B;  1OCZ E;  2EIK E;  4NRH B;  3ZKJ A;  3KEZ A;  4GB9 A;  2WXL A;  3HXD A;  4BER A;  4ILI A;  3LVR E;  3N71 A;  5EKQ D;  2XGS A;  3FFL A;  5G05 J;  2WXO A;  1UOH A;  2EIM E;  2X38 A;  3S2A A;  3UUX A;  1JPL A;  2R5S A;  3D9O A;  1H0A A;  1OWN A;  3LJ3 A;  1LD7 A;  1IHG A;  2AW6 A;  1RW2 A;  4GTM A;  2UY1 A;  3KSL A;  3RJV A;  1BU9 A;  3T5V A;  4AY5 A;  1WAO 1;  4EBA G;  1S64 A;  3ZYK A;  2YIN A;  2WB2 A;  3ASF A;  3ZHE B;  2P9U G;  3TWT A;  3ZFW A;  2PQN A;  4DX7 D;  3JXI A;  4ME2 A;  3U9W A;  3ABL E;  3G2S A;  5CBN A;  3I3N A;  2P9N G;  4J0U A;  2VGX B;  2XZT G;  5JJ6 A;  2HO1 A;  3CSF A;  2LO6 A;  3QK0 A;  1E7U A;  1NFI E;  5B1A E;  1FT2 A;  1IXV A;  3UX4 A;  4X8Q A;  2LUH A;  2PL2 A;  2WXP A;  5EX0 A;  4L2Y A;  3RRU A;  1D9S A;  3S7B A;  5KJN A;  1LTX A;  3JQ1 A;  4G1T A;  5JMN D;  1E8Y A;  3TGO A;  3UT8 A;  3ONK A;  3R7R A;  1UJJ A;  1FVF A;  1OWP A;  1N11 A;  4FC8 A;  3SF4 A;  3FUN A;  2OEW A;  4KVM A;  5E76 A;  4BT9 A;  1NI1 A;  5IY5 E;  4HRL A;  4HXI A;  4IYP A;  3MZL B;  4F1S A;  3EU5 A;  5HQ8 A;  4FJY A;  4RQI A;  1DC2 A;  3CKB A;  4ZFH A;  1KPS B;  3OAW A;  2OVF A;  5KWD A;  4NAC A;  3ZN3 A;  3DPD A;  2MRI A;  1ELK A;  5FIN A;  4AOF A;  3APC A;  3LEW A;  3ZGQ A;  4WNF A;  3OXG A;  1JCS A;  3ENE A;  5EYP F;  4GTV A;  5G55 A;  4NUR A;  3ISM C;  3L08 A;  2PNN A;  3TG4 A;  2IO3 C;  4FP7 A;  5J90 A;  4HBD A;  3PEV B;  3T5X A;  2ETC A;  3LCA A;  2V5Q C;  2XZD G;  2IO2 C;  1NZN A;  3HRA A;  2XEN A;  4F3V A;  3JQ0 A;  4YDE A;  3S7F A;  3L22 A;  1N95 A;  2CG3 A;  4QFV A;  4TUM A;  1QNF A;  3CIA A;  4AP2 A;  3CK7 A;  4FHJ A;  3U4T A;  5BW8 C;  1MZC A;  3NQP A;  2VSY A;  5AJL A;  1TN6 A;  1IQR A;  3TWU A;  5ENO D;  3HHM A;  4K5B A;  4XIF A;  1W3B A;  2RFA A;  2LXL A;  3D9K A;  4J8D A;  5FQ8 A;  3AU5 A;  1V54 E;  5AAO A;  1X5B A;  2OVB A;  2VJ8 A;  3W9F A;  1EF1 C;  2FEZ A;  2AXV A;  2DZO A;  4CRW A;  2X6K A;  1H6K A;  3Q4A B;  3DSV A;  2DIW A;  3U66 A;  2IU1 A;  5AQB A;  5B1B E;  1N0Q A;  4JHJ A;  1TEZ A;  2WMO A;  3RSE G;  1ELW A;  3FU3 A;  2Y3A A;  3CVP A;  3WXX A;  4FHK A;  3Q9N C;  4U04 A;  3TWX A;  2ZXW E;  5AQ9 A;  1LD8 A;  3HXF A;  4DUI A;  3PE3 A;  3ZUV B;  4DRX E;  2VSX E;  4G2V A;  4APO A;  3EJN A;  4CDR A;  3HVE A;  3KD7 A;  3C3R A;  4F1P A;  2AXZ A;  3Q47 B;  1N54 A;  3TWW A;  1JWF A;  3SBT B;  3SFZ A;  3MCX A;  3CK9 A;  2IQC A;  4TUU A;  4HLL A;  3UMV A;  3UXG A;  4O1P A;  5LX8 A;  2J4B A;  4N2Q A;  1N94 A;  3ABM E;  2XCC A;  4GTT A;  3C3Q A;  5T3R A;  1Y8M A;  3L17 A;  4C9B B;  2DYS E;  3NAW A;  2QYU A;  5BXU A;  2QFC A;  3UPV A;  4GTS A;  3MKQ A;  5EID A;  3QB2 A;  2DYR E;  4JA9 A;  2XPI A;  3RAU A;  4R7L A;  4BSX A;  4B89 A;  4N5Q A;  3J5P A;  4I2W A;  2ZU6 B;  1N4S A;  2L0I A;  5FIO A;  4Q69 A;  3D9J A;  3ZXP A;  4I1A A;  1HU3 A;  1BI7 B;  4L7T A;  4A3T A;  5HI7 A;  1OUV A;  3FTS A;  2NC9 A;  4ANX A;  4GPK A;  4EZJ A;  2CHX A;  3FUK A;  3VTX A;  3UKR G;  3VLD A;  2C2L A;  3K9I A;  3MKQ B;  2XEH A;  4FAD A;  4U96 D;  5G05 C;  3FUD A;  3EDT B;  4A3V A;  2LAH A;  2A5U A;  1UJK A;  2R05 A;  2OND A;  2GRP B;  1N4Q A;  1Y6I A;  4GYO A;  4ANW A;  4OAV B;  3E32 A;  4KVO A;  3IBE A;  4JB8 P;  1A5E A;  4NIK A;  3ZNG A;  2ZGG A;  1NL4 A;  3SZ7 A;  3ML9 A;  3LDZ A;  1E7V A;  3MEK A;  1H2T C;  2WQ6 A;  1JCR A;  3LY8 A;  4V3I A;  4F6R D;  2FBN A;  4YDW A;  1RZ4 A;  3I4R B;  4U0Z A;  4EQF A;  3NBN B;  2GW1 A;  4GZ3 A;  4AV7 A;  4KT6 B;  3D9H A;  2R59 A;  2VSN A;  2V4L A;  2ZGD A;  3FH7 A;  3KAE A;  5AAR A;  2WXF A;  3FU0 A;  1KZP A;  4YDO A;  4GZ5 A;  2YNQ A;  4YND A;  4BX9 A;  2WMN A;  1Z5S C;  3B7S A;  3EIJ A;  3QJZ A;  4PS3 A;  3CGH A;  4K5C A;  1FVH A;  4I1O B;  4OYS A;  4E6H A;  1BLX B;  3DSW A;  4MKT A;  4L2L A;  5ENP D;  4JPS A;  3ZYM A;  1TNU A;  3AS5 A;  2CHW A;  3C5R A;  2WQ7 A;  2R02 A;  5JA4 D;  4K03 A;  4WNG A;  1ZB1 A;  2PZI A;  4PDX A;  2CFU A;  2WXK A;  4F7A A;  3PDN A;  4GML A;  3RK6 A;  4NQ0 A;  5KJK A;  3MKR A;  3C3O A;  3ZYQ A;  3MV3 B;  5C2Y A;  1UG3 A;  4OVV A;  4B94 A;  3BQO A;  1OXJ A;  4PH4 B;  3I4G A;  5CRU A;  5B3S E;  3CVQ A;  3FDH A;  3BG0 B;  2HE0 A;  3L16 A;  2YHC A;  4RVB A;  2IJG X;  5AQ7 A;  4EZK A;  1MHQ A;  3RRN B;  4J6I A;  3CVW A;  4F53 A;  3U64 A;  4G26 A;  3UT7 A;  5A7D B;  1DVP A;  1AWC B;  1XNF A;  4JEU A;  3AS4 A;  4PUC A;  2DBA A;  4I17 A;  4GU5 A;  3CEQ A;  1D8D A;  4HRN A;  3TL5 A;  3T9K A;  4C0E A;  1IYG A;  3IHV A;  5G2N A;  2GRM A;  4LSZ E;  4BWR A;  2KZT A;  3EHN A;  2C0M A;  1EYH A;  3V79 K;  4I9E A;  4O6F A;  3FY4 A;  3ONL A;  4QQI A;  3GW4 A;  4APF A;  3TXM A;  4GMR A;  3CHS A;  4IUL A;  4I2Z A;  1TR4 A;  2KCV A;  5LOZ A;  3QC1 A;  1WM5 A;  2ILR A;  3ESL A;  5D0Q D;  4U95 D;  3Q49 B;  3IEG A;  4LNB A;  4I6J A;  1SZ9 A;  3JUE A;  3MGB A;  5CBO A;  5KJL A;  3PRE A;  5E75 A;  3OXL A;  3LS8 A;  5LCW J;  5FZQ A;  3ZHE A;  4UWG A;  2PM7 A;  1YMP A;  3PZ3 A;  1OT8 A;  3VLF A;  2R17 C;  3ZEF A;  4O60 A;  3QWV A;  4L1B A;  4FA6 A;  5A6C A;  5DIZ A;  1HXI A;  5T4Y A;  1S63 A;  2HYZ A;  2OOE A;  3ASD A;  3B7R L;  2LAI A;  3RKV A;  4YVQ C;  4JC8 A;  1D8E A;  3C98 A;  1HH8 A;  3CHP A;  5HRY A;  5G04 C;  3J5Q B;  3FTW A;  2J8S D;  2KCK A;  4DLQ A;  1TJF A;  2LSU A;  3AJI A;  4PS7 A;  2LNI A;  2VTB B;  4WND A;  3UTM A;  1ZU2 A;  1K1A A;  1N52 A;  3OXF A;  5EN5 D;  4CEM A;  4GAA A;  3EUV A;  4ANU A;  2KC7 A;  1EDU A;  3V30 A;  3CVL A;  3SFY A;  3FUI A;  4UUC A;  4G8K A;  3D3M A;  3AG4 E;  1DCQ A;  1SA5 A;  4WAF A;  3Q15 A;  3ZXS A;  3Q5M A;  3OTN A;  2DZN A;  1S0P A;  3L82 A;  1INZ A;  4CT4 A;  4UQY A;  1TNB A;  4GYW A;  2LSV A;  4URK A;  2P9I G;  5BXO A;  2QZA A;  2QY7 A;  3PNL B;  3PEU B;  4KYO B;  2L9B A;  2FO7 A;  2NSZ A;  5LFA A;  3O48 A;  3SHF A;  2AWI A;  4U8V D;  3UM2 A;  5JHA A;  2J49 A;  3PH0 C;  5KCM A;  2J09 A;  3UIN C;  3ASN E;  5JJ7 A;  1NA0 A;  1U3D A;  5CCM A;  1N4R A;  2RKK A;  2GRL A;  2P2C P;  2JEK A;  4WWO A;  2DCP A;  4RSY A;  3SFX A;  3GYZ A;  3V31 A;  3DSU A;  3UI2 A;  2J07 A;  3FUJ A;  4JD2 G;  3B7T A;  4JZY A;  3GZ2 A;  3B13 A;  1PAQ A;  3FU6 A;  5G04 J;  5AYW D;  3QKY A;  4I6E A;  1OWM A;  2IFU A;  5FQ4 A;  2A4Z A;  3PVL A;  2IEJ A;  3PE4 A;  2MYO A;  4J7W A;  4BX8 A;  4GA1 A;  4ILG A;  4UQZ A;  4GZC A;  2Y1L E;  2A5E A;  3HXE A;  2EIL E;  3NOC D;  1KT1 A;  4KZC A;  2CHZ A;  3ZIM A;  3RO3 A;  4ACL A;  5HKP A;  3SD5 A;  4ANV A;  4DX6 D;  2BF0 X;  4TXP A;  2GRR B;  3URZ A;  4UI9 J;  1KZO A;  1TN7 A;  3FH8 A;  3UKU G;  1MX4 A;  4JEH A;  4BET A;  4DPR A;  5JJT A;  3AG3 E;  4BFR A;  4GZD A;  5LCW C;  1N9A A;  4CYM D;  4HOT A;  5CCL A;  4DX1 A;  3QWW A;  5EIB E;  2EIJ E;  1UN8 A;  4TXR A;  3L13 A;  2WVI A;  2F8Y A;  2XS8 A;  4ACK A;  3IKO B;  5H7P A;  3MYV A;  5M72 A;  3FTV A;  2VGY A;  1YYH A;  3BEE A;  2P58 C;  5LP0 A;  2CG2 A;  3FUF A;  3CVV A;  3FWV A;  2VTB A;  4WWN A;  3SQV A;  3ULQ A;  2WXH A;  4UWL A;  3GZ1 A;  3D9P A;  3RIB A;  3CR3 A;  3LY7 A;  2F0Y A;  3TAX A;  4U0U A;  4M7C A;  2V0P A;  1OCC E;  4AIF A;  1L5J A;  3BU8 A;  2ION A;  2Y4T A;  3DST A;  4AJW A;  2XS1 A;  5ITZ F;  4IN3 B;  2ZIS A;  4A63 B;  1WG0 A;  2I1K A;  2NXP A;  1HO8 A;  3DXK G;  3CQC B;  2I1J A;  4Z68 A;  2AXU A;  4CDM A;  1UN9 A;  5AQA A;  4N5C A;  1Z3Y A;  2CFZ A;  3EU9 A;  4JVS A;  2BED A;  4M3O A;  1HG2 A;  2P9L G;  3FTY A;  4JHK A;  3CHM A;  2GRQ B;  3KSQ A;  5FWQ A;  2J4D A;  3FHE A;  1A17 A;  2FF4 A;  2B0O E;  4GMJ A;  1BPO A;  3DSS A;  3NZS A;  3BG1 B;  1MYO A;  4JW1 A;  5KBA A;  1MQS A;  2LXM A;  3CVN A;  2HM8 A;  4A55 A;  3TXN A;  3P2B A;  4FJZ A;  3X2Q E;  4AVX A;  1SW6 A;  2XPY A;  1HFA A;  1PY1 A;  1O5M A;  3LJN A;  2IOS A;  4U07 A;  5AIJ A;  2E0I A;  2KZT B;  4GTQ A;  3W9G A;  4EZL A;  2XEV A;  2J9Q A;  5CHE E;  4HI8 A;  3ZYL A;  4KMO A;  4U8Y D;  3SO8 A;  4PS8 A;  1NA3 A;  3FUM A;  4GCN A;  4N3B A;  3R9M A;  2R03 A;  3D9N A;  3DWL G;  3DPY A;  3PUJ A;  1S70 B;  1HX8 A;  3ZPJ A;  4KXK B;  1K3Z D;  3APD A;  3ULY A;  4CCA A;  3ASO E;  4N3A A;  3LVQ E;  3FEX A;  4HNA D;  4J8Y A;  4CGV A;  2Y4U A;  1E96 B;  2HR2 A;  3LKU A;  3MX3 A;  5FZR A;  4AXH A;  3QAQ A;  1TJC A;  3D9I A;  3CVU A;  3ULE G;  3PZ4 A;  2JLB A;  3QNK A;  3CHQ A;  1SA4 A;  2WPV A;  4EBA A;  3U3W A;  2X3M A;  3FTZ A;  1H2U A;  4ATZ D;  2QC9 A;  4FLB A;  4YVO A;  3CHR A;  4KBQ A;  2P9S G;  2UY1 B;  4E85 A;  1E90 A;  4UQX A;  2P9P G;  2EQX A;  3CST A;  3QDN A;  3G2W A;  3S7D A;  3APF A;  3PRZ A;  4L23 A;  4EPZ A;  1ELR A;  2DWZ A;  3IHY A;  4CT0 A;  4L9P A;  4I9C A;  4DI3 A;  3E34 A;  2JAB A;  4GYY A;  4XEI G;  5FQ7 A;  3O4Z A;  3SI5 A;  2KBX A;  4TV3 A;  2PQR A;  3UT4 A;  1JCQ A;  2Q7F A;  3TWV A;  3IV0 A;  2J08 A;  3D9L A;  1FPP A;  4A1G A;  1QZ2 A;  3E4B A;  4HB5 A;  4U63 A;  3PZD A;  5FQ6 A;  4U8H A;  2FO1 E;  1X81 A;  3SGH A;  1B89 A;  2XQ0 A;  4G24 A;  4GCO A;  4Y6W A;  3TWS A;  3AG2 E;  2E2E A;  3HDX A;  1UW4 B;  3DBS A;  2UWJ G;  4C0M A;  4KZ0 A;  4RLY A;  3JXJ A;  1H19 A;  3FUL A;  3JCK C;  3MA5 A;  1LF8 A;  1G3N B;  1H6O A;  4MS6 A;  2KCL A;  1OWO A;  3PZ1 A;  2NYJ A;  3CV0 A;  3SY2 A;  4LCT A;  2EIN E;  4BEP A;  5D0O D;  2KXP C;  5KNH D;  3EHQ A;  3ZVV A;  3HG0 D;  1N0R A;  2GRO B;  5EYL A;  4JHR A;  4TRQ A;  4HOU A;  2X6H A;  5BT1 A;  1V55 E;  4HOR A;  3QWP A;  1TN8 A;  2AVP A;  3R7Q A;  4FU3 A;  3RU0 A;  1BI8 B;  2VGE A;  3E37 A;  4UWF A;  4GTP A;  4P29 A;  3ESK A;  5JHB A;  3B95 A;  3RRM B;  2KM4 A;  4DLO A;  4ILH B;  4J8E A;  5KNG A;  3DSX A;  2YQ8 A;  1P5Q A;  3AS8 A;  3T8M A;  3B7B A;  4HFG A;  1KLX A;  1OWL A;  2FI7 A;  3F6Q A;  2BKG A;  5KJM A;  3MJW A;  3DRA A;  3Q75 A;  3RO2 A;  2X6I A;  3NOG D;  2PM6 A;  4CDN A;  3BUA A;  3CK8 A;  2XEE A;  3QOU A;  1E8X A;  4ZHB A;  2H6I A;  3KS2 A;  4H7Y A;  3FU5 A;  4BTB A;  5ENS D;  5BPP A;  5D66 A;  4AM9 A;  4U7E B;  3TWQ A;  4N3C A;  2F8X K;  4XE0 A;  5FZS A;  1EPU A;  3ZU7 B;  1IQU A;  4DI4 A;  2OEV A;  3PUK A;  1QYM A;  2WXI A;  3LY9 A;  3DEO A;  4O1O A;  4DK5 A;  5CEA A;  2IOL A;  2L6J A;  1QBQ A;  2F37 A;  4MRU A;  3GZS A;  3Q73 A;  1O1S A;  1HS6 A;  4B0Z A;  4UI9 C;  4BT8 A;  5C1D A;  4HLE A;  3D9M A;  1HZ4 A;  2BKK B;  3KEA A;  4GA2 A;  2XPZ A;  3CVX A;  4XKB A;  3R9A B;  4YDY A;  2I9C A;  2R2L A;  3CQG B;  1HG5 A;  2OV8 A;  2IY0 C;  2Y69 E;  2VGX A;  5CED B;  3FUE A;  4XI0 A;  1K8K G; 
#chains in the Genus database with same CATH homology
 3DSW A;  4GTQ A;  1JCQ A;  3DRA A;  3Q75 A;  4MBG A;  1MZC A;  1N4Q A;  1TNU A;  1LTX A;  1FPP A;  1TNY A;  3EUV A;  1O1T A;  1TN6 A;  2IEJ A;  3E32 A;  2H6I A;  3HXB A;  3DPY A;  1X81 A;  3SFY A;  1N4P A;  3Q7A A;  1NI1 A;  3HXE A;  2F0Y A;  2H6G A;  1FT1 A;  1NL4 A;  1SA5 A;  1N94 A;  3Q78 A;  2ZIR A;  3DST A;  3HXD A;  3EU5 A;  4GTT A;  2ZIS A;  4GTR A;  1TNB A;  4EHM A;  4GTO A;  1JCR A;  3E30 A;  1KZO A;  1TN7 A;  4GTS A;  4LNB A;  3PZ4 A;  1QBQ A;  1O1R A;  3PZ1 A;  1LD7 A;  3DSV A;  1SA4 A;  3Q73 A;  1O1S A;  4GTM A;  1N4S A;  1JCS A;  1N9A A;  2BED A;  3KSL A;  3PZ3 A;  4GTV A;  3KSQ A;  4LNG A;  1TNO A;  2H6F A;  1S64 A;  2H6H A;  3Q7F A;  1DCE A;  1TN8 A;  3C72 A;  3DSS A;  3E37 A;  3PZ2 A;  4GTP A;  1N4R A;  1KZP A;  4YDO A;  1S63 A;  2R2L A;  1LD8 A;  3HXF A;  3HXC A;  1TNZ A;  3SFX A;  1D8E A;  4L9P A;  3E34 A;  3DSX A;  3Q79 A;  3DSU A;  1FT2 A;  4YDE A;  1O5M A;  1D8D A;  1N95 A;  3E33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...