1S64A

Rat protein geranylgeranyltransferase type-i complexed with l-778,123 and a sulfate anion
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Crystallographic Analysis Reveals that Anticancer Clinical Candidate L-778,123 Inhibits Protein Farnesyltransferase and Geranylgeranyltransferase-I by Different Binding Modes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 126
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1s64A00
1JCRA 2H6FA 3KSQA 3HXBA 3HXEA 1N94A 1KZPA 4LNGA 1N4PA 2ZIRA 3DSUA 3EU5A 1D8EA 1LD8A 3DSWA 3DRAA 3HXCA 4EHMA 1TN8A 3DPYA 1MZCA 3EUVA 3Q79A 1O1RA 4GTRA 4YDEA 4GTTA 4L9PA 4GTMA 1TN6A 2F0YA 2IEJA 3DSXA 3Q7FA 1D8DA 1FT2A 1TNZA 2BEDA 1FT1A 2R2LA 1N4SA 3Q7AA 2H6GA 1FPPA 1TNBA 1TNUA 1SA4A 1S64A 3E32A 4LNBA 3SFYA 3HXDA 4YDOA 1LTXA 1X81A 1TN7A 3C72A 3PZ1A 4GTOA 1JCSA 4GTVA 3PZ2A 1NI1A 3E37A 3PZ3A 1KZOA 3Q78A 1TNOA 1LD7A 3KSLA 3E30A 3E34A 1JCQA 2H6IA 3PZ4A 1O1TA 1O1SA 1N9AA 1N4RA 3Q75A 1O5MA 2ZISA 4MBGA 1N4QA 3E33A 3DSVA 1QBQA 1SA5A 3DSSA 4GTPA 1N95A 2H6HA 4GTQA 1TNYA 1S63A 4GTSA 3HXFA 3DSTA 1DCEA 3Q73A 3SFXA 1NL4A
chains in the Genus database with same CATH superfamily
3V30A 2GRMA 3ONLA 4AIFA 1ZBPA 3CV0A 2Y4UA 1UN9A 3DBSA 4CZ2D 1PC2A 2L6JA 4APFA 5AQAA 4LNUD 4KZ0A 2J4BA 4D10C 2WXKA 4WNFA 4KMOA 5D0QD 2V5QC 3FTUA 3ISMC 2XPYA 5IY5E 3I5PA 2XS8A 1N4SA 2AXUA 3SNXA 1TNBA 2ONDA 3IKOB 4J8FA 4U0UA 1H2VC 5G05J 4TV3A 3WG7E 2NC9A 3ZN3A 4B94A 3PREA 2WXNA 3EIQC 3UIOC 1NP7A 2AWIA 3PEVB 1IHGA 4XKCA 5ENSD 1LTXA 3B13A 2X6JA 2FEZA 3APFA 5EN5D 4YDYA 2XEEA 4GMLA 3RO2A 4BETA 2CFUA 3FH7A 2QFCA 3UXGA 3NBNB 4CYMD 1B89A 4Z68A 4N39A 1OT8A 4HOUA 3PVLA 3JUEA 4Q69A 4HRLA 5AIJA 1Y6IA 1RW2A 1N95A 4HVBA 4CEMA 3TWSA 3UX4A 1E8YA 3RO3A 1MQSA 2WXFA 2DWZA 3MV3B 3ULQA 2OEVA 5JHBA 2ETCA 1UN8A 3KEZA 4FHJA 3MCXA 4L2YA 4CDNA 1QYMA 3J5PA 1HF8A 4K5AB 2KXPC 4LSZE 1O1RA 2EINE 4GTRA 3C5RA 4PS3A 4O1OA 5KNHD 3U3WA 3AU5A 3TXNA 3AJIA 4WNGA 1UJJA 4G8KA 3QC1A 4UWKA 2ETAA 1IXVA 2FULA 2VTBB 1DNPA 4IN3B 3SFZA 4EQFA 3AU4A 3MV2B 5BT1A 5A7DB 1IYGA 4GTOA 4PH4B 3FY4A 4HBDA 1H19A 1N0QA 4WWPA 4J6IA 2HR2A 1HS6A 2FO1E 4N5CA 4PDXA 4DI4A 5FT9A 5AQBA 4F3VA 4NURA 1N54A 4MKTA 3ABKE 3UM2A 4U0SA 5KWDA 1MX4A 3FHEA 1SW6A 2X3MA 2B0OE 3MKRA 4AEZC 4G25A 1LF8A 3JYSA 4FLHA 4UQYA 5KJMA 2LAIA 5KJNA 5BV0A 2PQNA 4WAFA 3ONKA 3ZYQA 3HG0D 3FUIA 2IY0C 4G8LA 1IQRA 3AG3E 2XEVA 1OUVA 4C48B 3S7JA 4OYSA 3LY9A 3AS8A 5FQ8A 3L17A 2VGYA 2IU1A 1PAQA 3ASHA 4B0ZA 3FUKA 3UMVA 2P9PG 2YHEA 4TXRA 1EPUA 1ELKA 1OY3D 4IRUA 5LP0A 2GW1A 1FT2A 4YVQC 2ZGDA 4TXQA 4J0UA 3O4ZA 4CDRA 2VSOE 4JXTA 3RRNB 1H2TC 2WM9A 4DX2A 4BT8A 1WY6A 4UQXA 3X2QE 3C3QA 5AAOA 4ZHBA 1QZ2A 4N3AA 2VSXE 1HG5A 3LVRE 5LOZA 3FWVA 4HS2A 4U8VD 5FINA 3TWQA 1WAO1 5EIDA 4BTAA 2L0IA 5JJ6A 3L9TA 3KSLA 1BPOA 3PZ4A 3W9GA 3RIBA 3TAXA 2MOWA 4APOA 1BI8B 4JPSA 4K03A 3QDNA 3CLJA 2V4LA 1DC2A 4HOTA 1JPLA 1K1BA 2R05A 1YA0A 3B7SA 1V54E 5D66A 3CEQA 2XCCA 3FTXA 3Q73A 4GZCA 5T3RA 4Q96A 4I6JA 5M72A 4PS7A 1S70B 3AG1E 1E7UA 3HXEA 3S2AA 4RG9A 3U64A 4U04A 4LNGA 1N4PA 1OWPA 2ZIRA 3DSUA 2I2OA 4GMRA 3AG2E 4FJYA 5ITZF 3Q79A 2IFUA 4HOQA 4L9PA 4GMJA 4C9BB 1G3NB 2PNNA 4JVSA 3Q15A 2QYJA 1ZU2A 4UWLA 1X5BA 2IONA 2LXMA 4HI9A 2EIJE 1S64A 3B7UX 1OWMA 3GW4A 5EIBE 4ILGA 2VYIA 3BG0B 3CIAA 3R9MA 2QC9A 4TXPA 4X8QA 3ULYA 1Y8MA 2VGXA 3KEAA 1TEZA 3ASGA 3C3OA 2J9QA 5T4YA 3TWUA 4OAUC 2FI7A 1UJKA 1O1TA 2NXPA 2XENA 3D9HA 5KJKA 1HH8A 2ILRA 5FTPA 1K8KG 2WXHA 1KPSB 2IO3C 3CKCA 4Y6CA 2H6HA 2WXOA 3FUJA 1BLXB 2MRIA 4I9EA 4NRHB 3VTYA 1SZ9A 3KS2A 2KC7A 2J09A 4AVXA 1KZPA 3PH0C 3ABME 4I6GA 4U63A 4N3BA 4EZJA 3CHOA 4K5BA 3L13A 1BD8A 4ILIA 4DLOA 3RRMB 3P1UA 1TN6A 1NA0A 3MKQA 3ZW3A 5CHEE 3CSFA 1XNFA 1TNZA 2B6CA 3CVVA 3MA5A 1NZNA 3V31A 3EHMA 1TNUA 4JEHA 4BT9A 5ARGA 1H2UA 1HU3A 3T5VA 2HYZA 4EZLA 4KZCA 3VLEA 3UM0A 2GGFA 2ETBA 4G26A 4ANWA 1Z3XA 3NOGD 3FULA 4GA2A 4GZDA 4F7AA 4XE0A 2WQHA 4PS8A 3HRAA 4N2SA 4GZ3A 5KBAA 5BW8C 4BTBA 3PUKA 5ENRD 2L9BA 5LX8A 4G1TA 1HG2A 4HRNA 3CVQA 1NL4A 4V3IA 2H6FA 4GZ6A 3D9OA 3G2TA 3Q9UC 5CRVA 3FUHA 2DYRE 4U07A 3DPYA 3LDZA 3BG1B 5T8IA 2WB2A 4FJZA 4BEPA 4IULA 3S7FA 1P5QA 2F37A 2J07A 5JA4D 2F8YA 4BSZB 2KCKA 3APCA 4AP2A 3LY8A 3ML9A 3URZA 3SFYA 2L0TB 3CVYA 3LYAA 3K9IA 2OOEA 2PM6A 1HXIA 2LNIA 2J08A 1U2VG 1X81A 3UTMA 4JB8P 2WXIA 2GROB 5FZRA 4BY6A 3QK0A 2MHKA 3CHSA 3CVWA 5BNWA 4YNDA 3DXMG 2OV8A 2WXRA 1MHQA 1N9AA 4ANVA 2XEHA 2AJAA 3RJVA 3QARA 1OWOA 4XI9A 2BKKB 5ENTD 1OWLA 2RG8A 4AM9A 3DEOA 4CGVA 3FUMA 3SZ7A 4F1PA 5HRYA 4KYOB 4ATGA 5JJ7A 3ABLE 3E4BA 1ELWA 3R7QA 3JXJA 2HM8A 3G2UA 2JLBA 1MZCA 3GZ1A 4DJAA 4N2QA 1Z6TA 3BQOA 3SGHA 4HFGA 4MS6A 2F0YA 3ASNE 5JMND 2R02A 2DIWA 3Q49B 1EF1C 1KT1A 2LUHA 4J8YA 4PUCA 3ZVVA 2P9LG 3PUJA 2CFZA 3OTNA 2LSUA 4A55A 4ILHB 2LAHA 3CK9A 5BUZA 4I1OB 4B8CB 4GAAA 2X6KA 4W9RA 3CQGB 4KVMA 3C72A 1HFAA 3PZ1A 1JCSA 5B1BE 5EILA 3UKRG 2XRZA 2WMOA 3PE4A 3L08A 1MYOA 2AXZA 3UM1A 1HZ4A 2H6IA 3VLDA 4C0EA 4G11A 4I2ZA 4MLPA 3SQVA 4HOSA 4NACA 3ZPJA 1QQEA 2QZAA 4GCOA 2PM7A 3BUAA 3ZU7B 4HRMB 2JEKA 2OCCE 3D9PA 4CT0A 3PDNA 5FJYA 3AS5A 4O6FA 2P9UG 3DSWA 3Q47B 3CK8A 4RQIA 1UOHA 5EKQD 3EHRA 4GPKA 5ENOD 4H7YA 2A4ZA 1OCCE 4JW1A 2V4HC 3I3NA 3MYVA 5CECB 2Y0BG 3CQCB 2R2LA 3CHPA 2RFAA 3W9FA 2H6GA 3PS6A 4LG6A 1SA4A 4FLBA 4GB9A 4KT6B 3RKVA 4E85A 1IHBA 4XI0A 2R5SA 2XQ0A 1U3DA 3IHVA 3PNLB 3T9KA 2Y69E 4WUYA 3NF1A 1EDUA 3E37A 4CT4A 3ZYMA 3FH8A 3NB2A 5KCMA 2KCVA 3G2WA 4BESA 1HX8A 3UUXA 1OCRE 3CSTA 4FC8A 2WXJA 1K3ZD 3NOCD 1HE8A 3QWPA 2J4DA 3ASDA 3Q4AB 5C2YA 2R17C 3GYZA 2GRQB 3LY7A 3FU5A 3S7DA 3ZEFA 2I1KA 3AS4A 3PNTB 2BKGA 2RKKA 2DVWA 3ZGQA 5EX3A 1E96B 2NSZA 4CRWA 1U3CA 2WQ6A 2KZTA 3U66A 3APDA 2XZTG 2IO2C 2CHWA 5J90A 3SHFA 4I9CA 1TJCA 4BERA 3D9NA 2WPVA 4A1GA 3TXMA 4EZKA 3Q7FA 5JHAA 4HORA 1JWFA 3TWTA 4UWFA 3EHNA 3KD7A 3FTSA 3IV0A 1WDYA 1WM5A 1AP7A 3RRUA 4LNBA 2A5UA 1YMPA 4G23A 3LCAA 1ELRA 5HKPA 4YDOA 4Y6WA 5C1DA 1MX6A 2PL2A 4RVBA 4O1PA 4OVVA 3L22A 4GTVA 2R03A 3GZ2A 5CBNA 4RSYA 4B8AA 4YVOA 5AQ7A 5CEAA 4F1SA 3FTZA 2KM4A 2Q7FA 1JCQA 4XIFA 2KCLA 3R9AB 4DK5A 4Q94A 3CK7A 4XX5A 3AAAC 3DSVA 3FFLA 1SA5A 4BWRA 3J5QB 3UT7A 3EDTB 1S63A 2WMNA 3L54A 3FU6A 4JL0A 1XGWA 3ML8A 4KVOA 5HI7A 4AXHA 3ULEG 2BTDA 3KSQA 5D2MC 1N52A 4M7CA 2DZOA 3CHQA 3LJ3A 4OAVB 3GZSA 1N11A 4DX5D 1VDYA 4KBQA 3U4TA 3DRAA 3FH5A 3HXCA 4DX6D 3ZKJA 3TWXA 3JQ0A 4GTTA 4CCAA 3MZLB 4GTMA 2IOSA 2IEJA 5FQ6A 3T8KA 2XHEA 3PZDA 1NFIE 1GW6A 4M3OA 5BPPA 3SO8A 3ESLA 4ACKA 5EX0A 2P9NG 3PZ2A 4HLEA 2WXQA 4JD2G 3PZ3A 3U9WA 5A23A 2VTBA 3E34A 3FP3A 3NZUA 4J8EA 2PQRA 3ESKA 4J8DA 2YHCA 2BF0X 1ZB1A 3B7RL 3OXGA 1QBQA 4E6HA 1Z5SC 3ENEA 2XCBA 4EPZA 1SZAA 1TNYA 4L7TA 4WWNA 4DLQA 5B3SE 3CHMA 4AY5A 1JCRA 2WXMA 3JQ1A 1KT0A 4F6RD 3OAWA 3P2BA 5CCMA 4ATZD 4TRQA 3FUDA 5G04J 3JUIA 3RSEG 4DI3A 2Y4TA 4A3TA 5EYPF 3EUVA 3RK6A 1DVPA 1UW4B 3MJWA 3UT4A 4JA7A 3UI2A 4XZ4A 5CBOA 2DBAA 4JEUA 5EYLA 4GYWA 3BEEA 4KXKB 5FIOA 2P9KG 1TYQG 2P9IG 3PE3A 2WXGA 2P9SG 2XRYA 3HXDA 2E0IA 1IQUA 4AOFA 2I9CA 2GRNB 3S7BA 3TJPA 1TR4A 3ZUVB 1NI1A 1L5JA 5CEDB 2VSYA 1IKND 4NQ0A 5BXUA 5ENNA 3G2SA 1H0AA 3CHRA 4B89A 2EIME 3L16A 3RAUA 4U0ZA 1O5MA 2F8XK 2MYOA 4FA6A 4I17A 3ZYKA 3IXEA 2CG3A 3UQ3A 3MEKA 4G24A 3DSTA 5CRUA 3FEYA 3HHMA 3D9KA 2WVIA 3HXBA 1E8ZA 2NYJA 3PEUB 5AENA 3DWLG 2WXPA 3EU5A 3LS8A 3V2OA 1YYHA 3UT8A 4QFVA 4B93B 5G2NA 5EDSA 4A1SA 4YDEA 2Y3AA 2EQXA 3DEPA 4N5QA 1V55E 3D9JA 2J8SD 1MJ0A 1FT1A 4FU3A 2RFMA 5FZSA 2VGXB 2R59A 2ZGGA 3PRZA 1H6PA 5BV1A 2AVPA 3SY2A 4ANXA 3QOUA 4MRUA 3HVEA 4GPMA 4CGWA 4P29A 4WNEA 5DBKA 3UKUG 4U8HA 4ZFHA 1BI7B 3CKBA 3CVXA 2XPIA 4FP7A 2X38A 2LSVA 5FZQA 3C98A 4GU5A 2ZISA 2XGOA 2OEWA 4UI9K 4L1BA 3E33A 4FADA 4EBAA 3DSSA 1DCQA 3G2VA 4EECA 3L82A 2FBNA 4JC8A 3TWVA 3Q9NC 3HXFA 4I6EA 3HYMB 3FUNA 3EJNA 4LERA 1A17A 1HO8A 2CHZA 3MKQB 3D3MA 4G2VA 1N94A 1FCHA 1E7VA 3NZSA 4RG6A 4WNDA 1LD8A 3ZHEA 4TUUA 3ASFA 4ME2A 5CMYA 5AQ9A 4N3CA 1E8XA 4F53A 5AJDA 4JHRA 1UG3A 3LJNA 3MGBA 3R7RA 3TG5A 3CR3A 3ASOE 3V79K 5HQ8A 3AG4E 3BU8A 3TWRA 3KAEA 4UQZA 2X6FA 5G55A 3C3RA 4K5CA 3UPVA 3LEWA 5FQ7A 3DPDA 3LKUA 2DZNA 2DYSE 4DRXE 4A3VA 1K1AA 4J8SA 3NQPA 1WG0A 1KLXA 3QWVA 4GYOA 2UY1A 2I6HA 5FWQA 4WWOA 3DXKG 1TJFA 5DIZA 2CHXA 5KNGA 4HNAD 1FVFA 2QYUA 3E30A 4I2WA 2OVBA 1INZA 3L6AA 4EBAG 1Z3YA 2GRPB 3Q75A 3I4GA 3LPZA 4LEUA 4MBGA 5ENQD 3CVLA 4UI9C 4L23A 3QWWA 3B7BA 2L6BA 5JJTA 4LUNU 1SVXA 4JHJA 2YINA 3CVNA 2KATA 3SBSA 4XKBA 5G04C 3HIZA 3QNKA 3CVPA 2VJ8A 5CERB 1D8EA 3EIJA 4A63B 3CVUA 5FQ4A 2C0MA 2VSNA 3FUEA 4U7EB 2EILE 2GRLA 3SBTB 4UWGA 3QB2A 4ANUA 3CGHA 1W3BA 4GA0A 3TG4A 4HB5A 4CDMA 4BX8A 3FUFA 4GCNA 5LCWC 2IJGX 3FTVA 4AV7A 2P2CP 3I4RB 1FVHA 2DCPA 1QNFA 5ARFA 5A6CA 1TN7A 2VQ2A 2AXVA 5ANRA 4AJWA 4OVUA 4GZ5A 3N71A 3D9IA 4H7XA 1KZOA 5HS0A 3FU3A 4L2LA 1H6KA 5AN8A 3UINC 3ZXSA 5H7PA 4DUIA 5ENPD 2ZXWE 2FO7A 4C0MA 3TGOA 4GTPA 2OVFA 4K0RA 2UWJG 4GTSA 1YCSB 2WXLA 3IHYA 3IBEA 3ZFWA 1N0RA 4ACLA 3Q5MA 2HO1A 5CMWA 3ZNGA 3HVEB 2XGSA 1SQMA 4J7WA 1S0PA 1E8WA 4QQIA 3TWWA 5G05C 2XGMA 4RLYA 1D9SA 3JCKC 2IOLA 2C0LA 2CG2A 4DX1A 2FF4A 3QAQA 4FULA 2Y1LE 1Q2ZA 5CCLA 4DX7D 3JXIA 3RU0A 1OCZE 4BFRA 5AJLA 4LCTA 1JUQA 5ANLA 3TL5A 5BXOA 1FPPA 1A5EA 3FU0A 3SF4A 3QKYA 2XZDG 1OCOE 5AARA 3B95A 2YNQA 5LFAA 2KBXA 4XEIG 3NAWA 3FDHA 4JA9A 3SD5A 3LXUX 3OXFA 4GYYA 2X6HA 4BSXA 5AYWD 3Q78A 1MX2A 3ZHEB 3VTXA 3T5XA 4HLLA 3IEGA 3LVQE 4I1MA 2AW6A 1BU9A 4R7LA 5B1AE 2LXLA 3FTYA 2HE0A 2BUGA 4NIKA 1RZ4A 3MX3A 4U96D 2A5EA 4GTQA 2E2EA 4U8YD 2XPZA 2VGEA 3UM3A 1DCEA 4HXIA 4HI8A 2J49A 5KJLA 1OWNA 4U95D 2EIKE 2IQCA 3V2XA 3F6QA 4UUCA 3ZXPA 4URKA 3VLFA 2UY1B 4GA1A 1H6OA 4LRZA 2IF4A 4IYPA 4UI9J 4EHMA 1TN8A 2V0PA 4AY6A 4BX9A 1OXJA 2X6IA 2C2LA 3FEXA 1EYHA 1NA3A 4FHKA 3DSXA 4ABNA 1D8DA 3D9LA 2P58C 2BEDA 4YDWA 3ZYLA 2RD0A 3Q7AA 3SI5A 4O60A 1AWCB 3E32A 2QY7A 2V8SE 4I1AA 1PY1A 2YQ8A 5E75A 4JZYA 3UIPC 4HQDA 2XS1A 3O48A 2ZU6B 4DPRA 3B7TA 3WXXA 4JHKA 4TUMA 2PZIA 5J08A 2I1JA 3D9MA 1TNOA 1LD7A 5E76A 2WQ7A 1O1SA 3QJZA 3T8MA 1N4RA 5LCWJ 3EHQA 2LO6A 1N4QA 4UWHA 3HDXA 2GRRB 4I43A 3ZRHA 1E90A 2V5FA 3FTWA 5D0OD 1JWGA 2KZTB 3OXLA 3ZIMA 2JABA 2M63A 3SFXA 3EU9A
chains in the Genus database with same CATH topology
1JCRA 2H6FA 3KSQA 3HXBA 3HXEA 1N94A 1KZPA 4LNGA 1N4PA 2ZIRA 3DSUA 3EU5A 1D8EA 1LD8A 3DSWA 3DRAA 3HXCA 4EHMA 1TN8A 3DPYA 1MZCA 3EUVA 3Q79A 1O1RA 4GTRA 4YDEA 4GTTA 4L9PA 4GTMA 1TN6A 2F0YA 2IEJA 3DSXA 3Q7FA 1D8DA 1FT2A 1TNZA 2BEDA 1FT1A 2R2LA 1N4SA 3Q7AA 2H6GA 1FPPA 1TNBA 1TNUA 1SA4A 1S64A 3E32A 4LNBA 3SFYA 3HXDA 4YDOA 1LTXA 1X81A 1TN7A 3C72A 3PZ1A 4GTOA 1JCSA 4GTVA 3PZ2A 1NI1A 3E37A 3PZ3A 1KZOA 3Q78A 1TNOA 1LD7A 3KSLA 3E30A 3E34A 1JCQA 2H6IA 3PZ4A 1O1TA 1O1SA 1N9AA 1N4RA 3Q75A 1O5MA 2ZISA 4MBGA 1N4QA 3E33A 3DSVA 1QBQA 1SA5A 3DSSA 4GTPA 1N95A 2H6HA 4GTQA 1TNYA 1S63A 4GTSA 3HXFA 3DSTA 1DCEA 3Q73A 3SFXA 1NL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCR A;  2H6F A;  3KSQ A;  3HXB A;  3HXE A;  1N94 A;  1KZP A;  4LNG A;  1N4P A;  2ZIR A;  3DSU A;  3EU5 A;  1D8E A;  1LD8 A;  3DSW A;  3DRA A;  3HXC A;  4EHM A;  1TN8 A;  3DPY A;  1MZC A;  3EUV A;  3Q79 A;  1O1R A;  4GTR A;  4YDE A;  4GTT A;  4L9P A;  4GTM A;  1TN6 A;  2F0Y A;  2IEJ A;  3DSX A;  3Q7F A;  1D8D A;  1FT2 A;  1TNZ A;  2BED A;  1FT1 A;  2R2L A;  1N4S A;  3Q7A A;  2H6G A;  1FPP A;  1TNB A;  1TNU A;  1SA4 A;  1S64 A;  3E32 A;  4LNB A;  3SFY A;  3HXD A;  4YDO A;  1LTX A;  1X81 A;  1TN7 A;  3C72 A;  3PZ1 A;  4GTO A;  1JCS A;  4GTV A;  3PZ2 A;  1NI1 A;  3E37 A;  3PZ3 A;  1KZO A;  3Q78 A;  1TNO A;  1LD7 A;  3KSL A;  3E30 A;  3E34 A;  1JCQ A;  2H6I A;  3PZ4 A;  1O1T A;  1O1S A;  1N9A A;  1N4R A;  3Q75 A;  1O5M A;  2ZIS A;  4MBG A;  1N4Q A;  3E33 A;  3DSV A;  1QBQ A;  1SA5 A;  3DSS A;  4GTP A;  1N95 A;  2H6H A;  4GTQ A;  1TNY A;  1S63 A;  4GTS A;  3HXF A;  3DST A;  1DCE A;  3Q73 A;  3SFX A;  1NL4 A; 
#chains in the Genus database with same CATH topology
 3V30 A;  2GRM A;  3ONL A;  4AIF A;  1ZBP A;  3CV0 A;  2Y4U A;  1UN9 A;  3DBS A;  4CZ2 D;  1PC2 A;  2L6J A;  4APF A;  5AQA A;  4LNU D;  4KZ0 A;  2J4B A;  4D10 C;  2WXK A;  4WNF A;  4KMO A;  5D0Q D;  2V5Q C;  3FTU A;  3ISM C;  2XPY A;  5IY5 E;  3I5P A;  2XS8 A;  1N4S A;  2AXU A;  3SNX A;  1TNB A;  2OND A;  3IKO B;  4J8F A;  4U0U A;  1H2V C;  5G05 J;  4TV3 A;  3WG7 E;  2NC9 A;  3ZN3 A;  4B94 A;  3PRE A;  2WXN A;  3EIQ C;  3UIO C;  1NP7 A;  2AWI A;  3PEV B;  1IHG A;  4XKC A;  5ENS D;  1LTX A;  3B13 A;  2X6J A;  2FEZ A;  3APF A;  5EN5 D;  4YDY A;  2XEE A;  4GML A;  3RO2 A;  4BET A;  2CFU A;  3FH7 A;  2QFC A;  3UXG A;  3NBN B;  4CYM D;  1B89 A;  4Z68 A;  4N39 A;  1OT8 A;  4HOU A;  3PVL A;  3JUE A;  4Q69 A;  4HRL A;  5AIJ A;  1Y6I A;  1RW2 A;  1N95 A;  4HVB A;  4CEM A;  3TWS A;  3UX4 A;  1E8Y A;  3RO3 A;  1MQS A;  2WXF A;  2DWZ A;  3MV3 B;  3ULQ A;  2OEV A;  5JHB A;  2ETC A;  1UN8 A;  3KEZ A;  4FHJ A;  3MCX A;  4L2Y A;  4CDN A;  1QYM A;  3J5P A;  1HF8 A;  4K5A B;  2KXP C;  4LSZ E;  1O1R A;  2EIN E;  4GTR A;  3C5R A;  4PS3 A;  4O1O A;  5KNH D;  3U3W A;  3AU5 A;  3TXN A;  3AJI A;  4WNG A;  1UJJ A;  4G8K A;  3QC1 A;  4UWK A;  2ETA A;  1IXV A;  2FUL A;  2VTB B;  1DNP A;  4IN3 B;  3SFZ A;  4EQF A;  3AU4 A;  3MV2 B;  5BT1 A;  5A7D B;  1IYG A;  4GTO A;  4PH4 B;  3FY4 A;  4HBD A;  1H19 A;  1N0Q A;  4WWP A;  4J6I A;  2HR2 A;  1HS6 A;  2FO1 E;  4N5C A;  4PDX A;  4DI4 A;  5FT9 A;  5AQB A;  4F3V A;  4NUR A;  1N54 A;  4MKT A;  3ABK E;  3UM2 A;  4U0S A;  5KWD A;  1MX4 A;  3FHE A;  1SW6 A;  2X3M A;  2B0O E;  3MKR A;  4AEZ C;  4G25 A;  1LF8 A;  3JYS A;  4FLH A;  4UQY A;  5KJM A;  2LAI A;  5KJN A;  5BV0 A;  2PQN A;  4WAF A;  3ONK A;  3ZYQ A;  3HG0 D;  3FUI A;  2IY0 C;  4G8L A;  1IQR A;  3AG3 E;  2XEV A;  1OUV A;  4C48 B;  3S7J A;  4OYS A;  3LY9 A;  3AS8 A;  5FQ8 A;  3L17 A;  2VGY A;  2IU1 A;  1PAQ A;  3ASH A;  4B0Z A;  3FUK A;  3UMV A;  2P9P G;  2YHE A;  4TXR A;  1EPU A;  1ELK A;  1OY3 D;  4IRU A;  5LP0 A;  2GW1 A;  1FT2 A;  4YVQ C;  2ZGD A;  4TXQ A;  4J0U A;  3O4Z A;  4CDR A;  2VSO E;  4JXT A;  3RRN B;  1H2T C;  2WM9 A;  4DX2 A;  4BT8 A;  1WY6 A;  4UQX A;  3X2Q E;  3C3Q A;  5AAO A;  4ZHB A;  1QZ2 A;  4N3A A;  2VSX E;  1HG5 A;  3LVR E;  5LOZ A;  3FWV A;  4HS2 A;  4U8V D;  5FIN A;  3TWQ A;  1WAO 1;  5EID A;  4BTA A;  2L0I A;  5JJ6 A;  3L9T A;  3KSL A;  1BPO A;  3PZ4 A;  3W9G A;  3RIB A;  3TAX A;  2MOW A;  4APO A;  1BI8 B;  4JPS A;  4K03 A;  3QDN A;  3CLJ A;  2V4L A;  1DC2 A;  4HOT A;  1JPL A;  1K1B A;  2R05 A;  1YA0 A;  3B7S A;  1V54 E;  5D66 A;  3CEQ A;  2XCC A;  3FTX A;  3Q73 A;  4GZC A;  5T3R A;  4Q96 A;  4I6J A;  5M72 A;  4PS7 A;  1S70 B;  3AG1 E;  1E7U A;  3HXE A;  3S2A A;  4RG9 A;  3U64 A;  4U04 A;  4LNG A;  1N4P A;  1OWP A;  2ZIR A;  3DSU A;  2I2O A;  4GMR A;  3AG2 E;  4FJY A;  5ITZ F;  3Q79 A;  2IFU A;  4HOQ A;  4L9P A;  4GMJ A;  4C9B B;  1G3N B;  2PNN A;  4JVS A;  3Q15 A;  2QYJ A;  1ZU2 A;  4UWL A;  1X5B A;  2ION A;  2LXM A;  4HI9 A;  2EIJ E;  1S64 A;  3B7U X;  1OWM A;  3GW4 A;  5EIB E;  4ILG A;  2VYI A;  3BG0 B;  3CIA A;  3R9M A;  2QC9 A;  4TXP A;  4X8Q A;  3ULY A;  1Y8M A;  2VGX A;  3KEA A;  1TEZ A;  3ASG A;  3C3O A;  2J9Q A;  5T4Y A;  3TWU A;  4OAU C;  2FI7 A;  1UJK A;  1O1T A;  2NXP A;  2XEN A;  3D9H A;  5KJK A;  1HH8 A;  2ILR A;  5FTP A;  1K8K G;  2WXH A;  1KPS B;  2IO3 C;  3CKC A;  4Y6C A;  2H6H A;  2WXO A;  3FUJ A;  1BLX B;  2MRI A;  4I9E A;  4NRH B;  3VTY A;  1SZ9 A;  3KS2 A;  2KC7 A;  2J09 A;  4AVX A;  1KZP A;  3PH0 C;  3ABM E;  4I6G A;  4U63 A;  4N3B A;  4EZJ A;  3CHO A;  4K5B A;  3L13 A;  1BD8 A;  4ILI A;  4DLO A;  3RRM B;  3P1U A;  1TN6 A;  1NA0 A;  3MKQ A;  3ZW3 A;  5CHE E;  3CSF A;  1XNF A;  1TNZ A;  2B6C A;  3CVV A;  3MA5 A;  1NZN A;  3V31 A;  3EHM A;  1TNU A;  4JEH A;  4BT9 A;  5ARG A;  1H2U A;  1HU3 A;  3T5V A;  2HYZ A;  4EZL A;  4KZC A;  3VLE A;  3UM0 A;  2GGF A;  2ETB A;  4G26 A;  4ANW A;  1Z3X A;  3NOG D;  3FUL A;  4GA2 A;  4GZD A;  4F7A A;  4XE0 A;  2WQH A;  4PS8 A;  3HRA A;  4N2S A;  4GZ3 A;  5KBA A;  5BW8 C;  4BTB A;  3PUK A;  5ENR D;  2L9B A;  5LX8 A;  4G1T A;  1HG2 A;  4HRN A;  3CVQ A;  1NL4 A;  4V3I A;  2H6F A;  4GZ6 A;  3D9O A;  3G2T A;  3Q9U C;  5CRV A;  3FUH A;  2DYR E;  4U07 A;  3DPY A;  3LDZ A;  3BG1 B;  5T8I A;  2WB2 A;  4FJZ A;  4BEP A;  4IUL A;  3S7F A;  1P5Q A;  2F37 A;  2J07 A;  5JA4 D;  2F8Y A;  4BSZ B;  2KCK A;  3APC A;  4AP2 A;  3LY8 A;  3ML9 A;  3URZ A;  3SFY A;  2L0T B;  3CVY A;  3LYA A;  3K9I A;  2OOE A;  2PM6 A;  1HXI A;  2LNI A;  2J08 A;  1U2V G;  1X81 A;  3UTM A;  4JB8 P;  2WXI A;  2GRO B;  5FZR A;  4BY6 A;  3QK0 A;  2MHK A;  3CHS A;  3CVW A;  5BNW A;  4YND A;  3DXM G;  2OV8 A;  2WXR A;  1MHQ A;  1N9A A;  4ANV A;  2XEH A;  2AJA A;  3RJV A;  3QAR A;  1OWO A;  4XI9 A;  2BKK B;  5ENT D;  1OWL A;  2RG8 A;  4AM9 A;  3DEO A;  4CGV A;  3FUM A;  3SZ7 A;  4F1P A;  5HRY A;  4KYO B;  4ATG A;  5JJ7 A;  3ABL E;  3E4B A;  1ELW A;  3R7Q A;  3JXJ A;  2HM8 A;  3G2U A;  2JLB A;  1MZC A;  3GZ1 A;  4DJA A;  4N2Q A;  1Z6T A;  3BQO A;  3SGH A;  4HFG A;  4MS6 A;  2F0Y A;  3ASN E;  5JMN D;  2R02 A;  2DIW A;  3Q49 B;  1EF1 C;  1KT1 A;  2LUH A;  4J8Y A;  4PUC A;  3ZVV A;  2P9L G;  3PUJ A;  2CFZ A;  3OTN A;  2LSU A;  4A55 A;  4ILH B;  2LAH A;  3CK9 A;  5BUZ A;  4I1O B;  4B8C B;  4GAA A;  2X6K A;  4W9R A;  3CQG B;  4KVM A;  3C72 A;  1HFA A;  3PZ1 A;  1JCS A;  5B1B E;  5EIL A;  3UKR G;  2XRZ A;  2WMO A;  3PE4 A;  3L08 A;  1MYO A;  2AXZ A;  3UM1 A;  1HZ4 A;  2H6I A;  3VLD A;  4C0E A;  4G11 A;  4I2Z A;  4MLP A;  3SQV A;  4HOS A;  4NAC A;  3ZPJ A;  1QQE A;  2QZA A;  4GCO A;  2PM7 A;  3BUA A;  3ZU7 B;  4HRM B;  2JEK A;  2OCC E;  3D9P A;  4CT0 A;  3PDN A;  5FJY A;  3AS5 A;  4O6F A;  2P9U G;  3DSW A;  3Q47 B;  3CK8 A;  4RQI A;  1UOH A;  5EKQ D;  3EHR A;  4GPK A;  5ENO D;  4H7Y A;  2A4Z A;  1OCC E;  4JW1 A;  2V4H C;  3I3N A;  3MYV A;  5CEC B;  2Y0B G;  3CQC B;  2R2L A;  3CHP A;  2RFA A;  3W9F A;  2H6G A;  3PS6 A;  4LG6 A;  1SA4 A;  4FLB A;  4GB9 A;  4KT6 B;  3RKV A;  4E85 A;  1IHB A;  4XI0 A;  2R5S A;  2XQ0 A;  1U3D A;  3IHV A;  3PNL B;  3T9K A;  2Y69 E;  4WUY A;  3NF1 A;  1EDU A;  3E37 A;  4CT4 A;  3ZYM A;  3FH8 A;  3NB2 A;  5KCM A;  2KCV A;  3G2W A;  4BES A;  1HX8 A;  3UUX A;  1OCR E;  3CST A;  4FC8 A;  2WXJ A;  1K3Z D;  3NOC D;  1HE8 A;  3QWP A;  2J4D A;  3ASD A;  3Q4A B;  5C2Y A;  2R17 C;  3GYZ A;  2GRQ B;  3LY7 A;  3FU5 A;  3S7D A;  3ZEF A;  2I1K A;  3AS4 A;  3PNT B;  2BKG A;  2RKK A;  2DVW A;  3ZGQ A;  5EX3 A;  1E96 B;  2NSZ A;  4CRW A;  1U3C A;  2WQ6 A;  2KZT A;  3U66 A;  3APD A;  2XZT G;  2IO2 C;  2CHW A;  5J90 A;  3SHF A;  4I9C A;  1TJC A;  4BER A;  3D9N A;  2WPV A;  4A1G A;  3TXM A;  4EZK A;  3Q7F A;  5JHA A;  4HOR A;  1JWF A;  3TWT A;  4UWF A;  3EHN A;  3KD7 A;  3FTS A;  3IV0 A;  1WDY A;  1WM5 A;  1AP7 A;  3RRU A;  4LNB A;  2A5U A;  1YMP A;  4G23 A;  3LCA A;  1ELR A;  5HKP A;  4YDO A;  4Y6W A;  5C1D A;  1MX6 A;  2PL2 A;  4RVB A;  4O1P A;  4OVV A;  3L22 A;  4GTV A;  2R03 A;  3GZ2 A;  5CBN A;  4RSY A;  4B8A A;  4YVO A;  5AQ7 A;  5CEA A;  4F1S A;  3FTZ A;  2KM4 A;  2Q7F A;  1JCQ A;  4XIF A;  2KCL A;  3R9A B;  4DK5 A;  4Q94 A;  3CK7 A;  4XX5 A;  3AAA C;  3DSV A;  3FFL A;  1SA5 A;  4BWR A;  3J5Q B;  3UT7 A;  3EDT B;  1S63 A;  2WMN A;  3L54 A;  3FU6 A;  4JL0 A;  1XGW A;  3ML8 A;  4KVO A;  5HI7 A;  4AXH A;  3ULE G;  2BTD A;  3KSQ A;  5D2M C;  1N52 A;  4M7C A;  2DZO A;  3CHQ A;  3LJ3 A;  4OAV B;  3GZS A;  1N11 A;  4DX5 D;  1VDY A;  4KBQ A;  3U4T A;  3DRA A;  3FH5 A;  3HXC A;  4DX6 D;  3ZKJ A;  3TWX A;  3JQ0 A;  4GTT A;  4CCA A;  3MZL B;  4GTM A;  2IOS A;  2IEJ A;  5FQ6 A;  3T8K A;  2XHE A;  3PZD A;  1NFI E;  1GW6 A;  4M3O A;  5BPP A;  3SO8 A;  3ESL A;  4ACK A;  5EX0 A;  2P9N G;  3PZ2 A;  4HLE A;  2WXQ A;  4JD2 G;  3PZ3 A;  3U9W A;  5A23 A;  2VTB A;  3E34 A;  3FP3 A;  3NZU A;  4J8E A;  2PQR A;  3ESK A;  4J8D A;  2YHC A;  2BF0 X;  1ZB1 A;  3B7R L;  3OXG A;  1QBQ A;  4E6H A;  1Z5S C;  3ENE A;  2XCB A;  4EPZ A;  1SZA A;  1TNY A;  4L7T A;  4WWN A;  4DLQ A;  5B3S E;  3CHM A;  4AY5 A;  1JCR A;  2WXM A;  3JQ1 A;  1KT0 A;  4F6R D;  3OAW A;  3P2B A;  5CCM A;  4ATZ D;  4TRQ A;  3FUD A;  5G04 J;  3JUI A;  3RSE G;  4DI3 A;  2Y4T A;  4A3T A;  5EYP F;  3EUV A;  3RK6 A;  1DVP A;  1UW4 B;  3MJW A;  3UT4 A;  4JA7 A;  3UI2 A;  4XZ4 A;  5CBO A;  2DBA A;  4JEU A;  5EYL A;  4GYW A;  3BEE A;  4KXK B;  5FIO A;  2P9K G;  1TYQ G;  2P9I G;  3PE3 A;  2WXG A;  2P9S G;  2XRY A;  3HXD A;  2E0I A;  1IQU A;  4AOF A;  2I9C A;  2GRN B;  3S7B A;  3TJP A;  1TR4 A;  3ZUV B;  1NI1 A;  1L5J A;  5CED B;  2VSY A;  1IKN D;  4NQ0 A;  5BXU A;  5ENN A;  3G2S A;  1H0A A;  3CHR A;  4B89 A;  2EIM E;  3L16 A;  3RAU A;  4U0Z A;  1O5M A;  2F8X K;  2MYO A;  4FA6 A;  4I17 A;  3ZYK A;  3IXE A;  2CG3 A;  3UQ3 A;  3MEK A;  4G24 A;  3DST A;  5CRU A;  3FEY A;  3HHM A;  3D9K A;  2WVI A;  3HXB A;  1E8Z A;  2NYJ A;  3PEU B;  5AEN A;  3DWL G;  2WXP A;  3EU5 A;  3LS8 A;  3V2O A;  1YYH A;  3UT8 A;  4QFV A;  4B93 B;  5G2N A;  5EDS A;  4A1S A;  4YDE A;  2Y3A A;  2EQX A;  3DEP A;  4N5Q A;  1V55 E;  3D9J A;  2J8S D;  1MJ0 A;  1FT1 A;  4FU3 A;  2RFM A;  5FZS A;  2VGX B;  2R59 A;  2ZGG A;  3PRZ A;  1H6P A;  5BV1 A;  2AVP A;  3SY2 A;  4ANX A;  3QOU A;  4MRU A;  3HVE A;  4GPM A;  4CGW A;  4P29 A;  4WNE A;  5DBK A;  3UKU G;  4U8H A;  4ZFH A;  1BI7 B;  3CKB A;  3CVX A;  2XPI A;  4FP7 A;  2X38 A;  2LSV A;  5FZQ A;  3C98 A;  4GU5 A;  2ZIS A;  2XGO A;  2OEW A;  4UI9 K;  4L1B A;  3E33 A;  4FAD A;  4EBA A;  3DSS A;  1DCQ A;  3G2V A;  4EEC A;  3L82 A;  2FBN A;  4JC8 A;  3TWV A;  3Q9N C;  3HXF A;  4I6E A;  3HYM B;  3FUN A;  3EJN A;  4LER A;  1A17 A;  1HO8 A;  2CHZ A;  3MKQ B;  3D3M A;  4G2V A;  1N94 A;  1FCH A;  1E7V A;  3NZS A;  4RG6 A;  4WND A;  1LD8 A;  3ZHE A;  4TUU A;  3ASF A;  4ME2 A;  5CMY A;  5AQ9 A;  4N3C A;  1E8X A;  4F53 A;  5AJD A;  4JHR A;  1UG3 A;  3LJN A;  3MGB A;  3R7R A;  3TG5 A;  3CR3 A;  3ASO E;  3V79 K;  5HQ8 A;  3AG4 E;  3BU8 A;  3TWR A;  3KAE A;  4UQZ A;  2X6F A;  5G55 A;  3C3R A;  4K5C A;  3UPV A;  3LEW A;  5FQ7 A;  3DPD A;  3LKU A;  2DZN A;  2DYS E;  4DRX E;  4A3V A;  1K1A A;  4J8S A;  3NQP A;  1WG0 A;  1KLX A;  3QWV A;  4GYO A;  2UY1 A;  2I6H A;  5FWQ A;  4WWO A;  3DXK G;  1TJF A;  5DIZ A;  2CHX A;  5KNG A;  4HNA D;  1FVF A;  2QYU A;  3E30 A;  4I2W A;  2OVB A;  1INZ A;  3L6A A;  4EBA G;  1Z3Y A;  2GRP B;  3Q75 A;  3I4G A;  3LPZ A;  4LEU A;  4MBG A;  5ENQ D;  3CVL A;  4UI9 C;  4L23 A;  3QWW A;  3B7B A;  2L6B A;  5JJT A;  4LUN U;  1SVX A;  4JHJ A;  2YIN A;  3CVN A;  2KAT A;  3SBS A;  4XKB A;  5G04 C;  3HIZ A;  3QNK A;  3CVP A;  2VJ8 A;  5CER B;  1D8E A;  3EIJ A;  4A63 B;  3CVU A;  5FQ4 A;  2C0M A;  2VSN A;  3FUE A;  4U7E B;  2EIL E;  2GRL A;  3SBT B;  4UWG A;  3QB2 A;  4ANU A;  3CGH A;  1W3B A;  4GA0 A;  3TG4 A;  4HB5 A;  4CDM A;  4BX8 A;  3FUF A;  4GCN A;  5LCW C;  2IJG X;  3FTV A;  4AV7 A;  2P2C P;  3I4R B;  1FVH A;  2DCP A;  1QNF A;  5ARF A;  5A6C A;  1TN7 A;  2VQ2 A;  2AXV A;  5ANR A;  4AJW A;  4OVU A;  4GZ5 A;  3N71 A;  3D9I A;  4H7X A;  1KZO A;  5HS0 A;  3FU3 A;  4L2L A;  1H6K A;  5AN8 A;  3UIN C;  3ZXS A;  5H7P A;  4DUI A;  5ENP D;  2ZXW E;  2FO7 A;  4C0M A;  3TGO A;  4GTP A;  2OVF A;  4K0R A;  2UWJ G;  4GTS A;  1YCS B;  2WXL A;  3IHY A;  3IBE A;  3ZFW A;  1N0R A;  4ACL A;  3Q5M A;  2HO1 A;  5CMW A;  3ZNG A;  3HVE B;  2XGS A;  1SQM A;  4J7W A;  1S0P A;  1E8W A;  4QQI A;  3TWW A;  5G05 C;  2XGM A;  4RLY A;  1D9S A;  3JCK C;  2IOL A;  2C0L A;  2CG2 A;  4DX1 A;  2FF4 A;  3QAQ A;  4FUL A;  2Y1L E;  1Q2Z A;  5CCL A;  4DX7 D;  3JXI A;  3RU0 A;  1OCZ E;  4BFR A;  5AJL A;  4LCT A;  1JUQ A;  5ANL A;  3TL5 A;  5BXO A;  1FPP A;  1A5E A;  3FU0 A;  3SF4 A;  3QKY A;  2XZD G;  1OCO E;  5AAR A;  3B95 A;  2YNQ A;  5LFA A;  2KBX A;  4XEI G;  3NAW A;  3FDH A;  4JA9 A;  3SD5 A;  3LXU X;  3OXF A;  4GYY A;  2X6H A;  4BSX A;  5AYW D;  3Q78 A;  1MX2 A;  3ZHE B;  3VTX A;  3T5X A;  4HLL A;  3IEG A;  3LVQ E;  4I1M A;  2AW6 A;  1BU9 A;  4R7L A;  5B1A E;  2LXL A;  3FTY A;  2HE0 A;  2BUG A;  4NIK A;  1RZ4 A;  3MX3 A;  4U96 D;  2A5E A;  4GTQ A;  2E2E A;  4U8Y D;  2XPZ A;  2VGE A;  3UM3 A;  1DCE A;  4HXI A;  4HI8 A;  2J49 A;  5KJL A;  1OWN A;  4U95 D;  2EIK E;  2IQC A;  3V2X A;  3F6Q A;  4UUC A;  3ZXP A;  4URK A;  3VLF A;  2UY1 B;  4GA1 A;  1H6O A;  4LRZ A;  2IF4 A;  4IYP A;  4UI9 J;  4EHM A;  1TN8 A;  2V0P A;  4AY6 A;  4BX9 A;  1OXJ A;  2X6I A;  2C2L A;  3FEX A;  1EYH A;  1NA3 A;  4FHK A;  3DSX A;  4ABN A;  1D8D A;  3D9L A;  2P58 C;  2BED A;  4YDW A;  3ZYL A;  2RD0 A;  3Q7A A;  3SI5 A;  4O60 A;  1AWC B;  3E32 A;  2QY7 A;  2V8S E;  4I1A A;  1PY1 A;  2YQ8 A;  5E75 A;  4JZY A;  3UIP C;  4HQD A;  2XS1 A;  3O48 A;  2ZU6 B;  4DPR A;  3B7T A;  3WXX A;  4JHK A;  4TUM A;  2PZI A;  5J08 A;  2I1J A;  3D9M A;  1TNO A;  1LD7 A;  5E76 A;  2WQ7 A;  1O1S A;  3QJZ A;  3T8M A;  1N4R A;  5LCW J;  3EHQ A;  2LO6 A;  1N4Q A;  4UWH A;  3HDX A;  2GRR B;  4I43 A;  3ZRH A;  1E90 A;  2V5F A;  3FTW A;  5D0O D;  1JWG A;  2KZT B;  3OXL A;  3ZIM A;  2JAB A;  2M63 A;  3SFX A;  3EU9 A; 
#chains in the Genus database with same CATH homology
 1JCR A;  2H6F A;  3KSQ A;  3HXB A;  3HXE A;  1N94 A;  1KZP A;  4LNG A;  1N4P A;  2ZIR A;  3DSU A;  3EU5 A;  1D8E A;  1LD8 A;  3DSW A;  3DRA A;  3HXC A;  4EHM A;  1TN8 A;  3DPY A;  1MZC A;  3EUV A;  3Q79 A;  1O1R A;  4GTR A;  4YDE A;  4GTT A;  4L9P A;  4GTM A;  1TN6 A;  2F0Y A;  2IEJ A;  3DSX A;  3Q7F A;  1D8D A;  1FT2 A;  1TNZ A;  2BED A;  1FT1 A;  2R2L A;  1N4S A;  3Q7A A;  2H6G A;  1FPP A;  1TNB A;  1TNU A;  1SA4 A;  1S64 A;  3E32 A;  4LNB A;  3SFY A;  3HXD A;  4YDO A;  1LTX A;  1X81 A;  1TN7 A;  3C72 A;  3PZ1 A;  4GTO A;  1JCS A;  4GTV A;  3PZ2 A;  1NI1 A;  3E37 A;  3PZ3 A;  1KZO A;  3Q78 A;  1TNO A;  1LD7 A;  3KSL A;  3E30 A;  3E34 A;  1JCQ A;  2H6I A;  3PZ4 A;  1O1T A;  1O1S A;  1N9A A;  1N4R A;  3Q75 A;  1O5M A;  2ZIS A;  4MBG A;  1N4Q A;  3E33 A;  3DSV A;  1QBQ A;  1SA5 A;  3DSS A;  4GTP A;  1N95 A;  2H6H A;  4GTQ A;  1TNY A;  1S63 A;  4GTS A;  3HXF A;  3DST A;  1DCE A;  3Q73 A;  3SFX A;  1NL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...