1S64A

Rat protein geranylgeranyltransferase type-i complexed with l-778,123 and a sulfate anion
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Crystallographic Analysis Reveals that Anticancer Clinical Candidate L-778,123 Inhibits Protein Farnesyltransferase and Geranylgeranyltransferase-I by Different Binding Modes.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 126
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1s64A00
3E33A 3DSVA 4GTTA 1JCRA 1LD7A 1KZPA 1N4QA 1N4PA 1TNYA 1JCSA 2ZIRA 3DSTA 3PZ4A 1N4SA 1N9AA 1N4RA 1TN7A 1S64A 4GTOA 4EHMA 4GTRA 3E37A 4GTQA 4L9PA 2IEJA 3HXFA 3PZ1A 1S63A 1SA5A 3DSWA 3SFXA 2BEDA 2R2LA 3Q7AA 1N94A 2H6IA 1FPPA 2H6HA 3E30A 1NL4A 1TNUA 1DCEA 3C72A 1NI1A 3DPYA 4MBGA 1TNOA 4GTMA 1LD8A 3DSUA 2H6GA 1KZOA 3EU5A 1X81A 3HXEA 1O1SA 1FT2A 2F0YA 1O1TA 3PZ3A 4LNBA 3E32A 3Q7FA 1MZCA 3SFYA 3DRAA 3Q75A 2ZISA 3DSSA 3E34A 1JCQA 3HXBA 1TN6A 3Q78A 3HXCA 4GTPA 3Q79A 1TN8A 1O5MA 1TNBA 3DSXA 1SA4A 1O1RA 4YDOA 1N95A 1TNZA 2H6FA 1D8EA 1QBQA 3EUVA 3HXDA 4GTSA 4YDEA 3KSLA 3Q73A 1LTXA 4GTVA 3KSQA 3PZ2A 4LNGA 1FT1A 1D8DA
chains in the Genus database with same CATH superfamily
1N54A 4K5CA 4E6HA 4OYSA 2VSXE 3DSVA 3C98A 1LD7A 4XKBA 2NC9A 2ZU6B 3SGHA 3MV3B 2VSNA 3LYAA 1AP7A 3QOUA 3RK6A 1OCRE 5G05J 4CGVA 5FQ4A 3SBTB 3HHMA 1NA0A 4BETA 4BX9A 4AY5A 4G1TA 4WNGA 2EIKE 4EQFA 4HRNA 4GTMA 4DX6D 1HFAA 2XGOA 4NIKA 4KBQA 4ATZD 3ULQA 3SFYA 1E96B 3NAWA 1IQUA 3WXXA 2YQ8A 3PUKA 2CG2A 3ISMC 5LFAA 1PY1A 3TXNA 4NRHB 4N3CA 4U8VD 5HS0A 3TWSA 1OWNA 2DBAA 5CERB 5JJ6A 2EQXA 2P9PG 1VDYA 5AENA 3UUXA 3CVVA 4J0UA 3ASFA 4JHKA 1N95A 4GCNA 3K9IA 1U3CA 4GTSA 1H6KA 4BWRA 1LTXA 2I9CA 2OCCE 3FEYA 4NURA 4RQIA 4GMLA 4BX8A 5KNGA 5BXOA 5AAOA 4KZCA 4U95D 2WXPA 2VSOE 3I4GA 3B7SA 3TGOA 2UY1B 1Y8MA 4PH4B 3I3NA 3QC1A 2P9NG 2R03A 2LUHA 1KPSB 3VLDA 2FO7A 3SFZA 2EINE 4I9CA 4A3TA 5LOZA 2B6CA 5HQ8A 2FI7A 2XGMA 1BLXB 5H7PA 5FZSA 3W9GA 2J8SD 3L16A 3ZYMA 2PM7A 3CGHA 1O1TA 1H19A 2KBXA 4Y6CA 4YNDA 4F1SA 2YNQA 5EIBE 3ZYKA 3W9FA 1Z3YA 1HG2A 2WXMA 3V2OA 3ZPJA 1NP7A 3C3OA 4U8HA 5BV0A 3DSXA 1QQEA 3CSFA 3L22A 3NOCD 3HIZA 2CHXA 3VTYA 2IOLA 3FU3A 3N71A 3O48A 1BU9A 1A17A 2I1KA 4Z68A 4ACKA 4TRQA 4IULA 4CGWA 5J08A 1BPOA 3QAQA 5A6CA 2AXZA 3EDTB 4G24A 4FHKA 1N52A 2ZXWE 2AVPA 5JMND 5LCWC 5EX3A 1S64A 2DVWA 1Y6IA 4LERA 2GRNB 2OEVA 1B89A 2X3MA 3ABME 2QYUA 3OXGA 1KT0A 1DCEA 3ZNGA 3HRAA 3FUEA 3DXKG 5LCWJ 3JQ1A 2IONA 1E90A 2Q7FA 4WWNA 4N3BA 3SQVA 5ENNA 4UWGA 3Q75A 1HZ4A 2Y4UA 1QYMA 2J4DA 2XEEA 1TN6A 3UXGA 1NFIE 3QB2A 2OEWA 4J8YA 4XKCA 3UT4A 4C0EA 5BW8C 3HXDA 3KSQA 1DNPA 5HI7A 2KCVA 3VTXA 4GCOA 4FHJA 1QZ2A 3ZN3A 2B0OE 2WVIA 3QK0A 4FULA 4J8DA 2BUGA 4KT6B 2JABA 4AVXA 3T5XA 4EBAA 3Q9NC 2V4HC 3CHSA 3SBSA 4ILIA 2HYZA 3PH0C 1HU3A 3UI2A 4OAVB 2IJGX 3ASHA 3MGBA 5FT9A 4KXKB 4UWKA 1LD8A 3EHQA 3CLJA 2FF4A 4CT0A 1HX8A 2L6BA 4N2QA 2JLBA 5FQ8A 1TYQG 4H7YA 2IOSA 3JUIA 1BI8B 2F37A 3LY9A 3D9HA 5ARGA 4G11A 1U3DA 1E8XA 4FA6A 3AJIA 1Z5SC 5FQ6A 1UJKA 4KVOA 1O1RA 4YDOA 2WXQA 3RSEG 2HO1A 4HNAD 4LCTA 4PS8A 1DCQA 3L17A 4YDEA 4U8YD 4F1PA 3ASGA 4LUNU 4TV3A 3ENEA 5ENRD 3MKRA 2VGXA 2J09A 3C5RA 4I6JA 2BKKB 1YMPA 3ZHEB 4E85A 3GYZA 5KJLA 3AG3E 3ZW3A 3HDXA 1TN7A 4HB5A 5ARFA 3D3MA 4BSXA 3QWVA 3ZXPA 4A55A 3FU5A 3GZSA 4HI8A 3O4ZA 4HFGA 3L54A 4GA1A 5AQAA 2I6HA 2WXNA 2MHKA 2EIJE 1NL4A 1TNUA 1H2VC 4F6RD 1YA0A 1NI1A 4TXQA 4DLOA 2J49A 4G25A 4V3IA 1KLXA 2NSZA 5CECB 1Q2ZA 2XCCA 5AJLA 3V2XA 3ML8A 2R05A 1YCSB 3PNLB 4U0UA 2NXPA 3PDNA 2KXPC 5ENPD 1E8ZA 3UKRG 3CVWA 3MV2B 4KMOA 3UM0A 3JCKC 5EYPF 2V5FA 3ZUVB 3FTSA 1P5QA 4AIFA 4BTBA 5EX0A 4ZFHA 3LJ3A 3MX3A 2GRRB 3SF4A 5CCMA 5AARA 5AQ9A 4DJAA 3GZ2A 4UQYA 3JYSA 3EU9A 3FP3A 3R7RA 1FVHA 1FT1A 2OOEA 2C0LA 2KZTB 4FADA 1OCCE 1HG5A 2RD0A 4GTTA 3PVLA 1OCOE 1N4PA 4J8FA 3ULEG 1JCSA 3V30A 3PZ4A 2XEVA 1N9AA 3JUEA 2R17C 4EHMA 4HXIA 3RU0A 2VQ2A 1LF8A 3D9PA 4A1SA 3FUJA 3I4RB 2CFUA 4N3AA 4LG6A 2WM9A 2WPVA 2GRPB 3TWVA 2RKKA 3VLFA 3DPYA 1TNOA 3ZYLA 3D9KA 4UQXA 3FH7A 1H6PA 2XHEA 3CEQA 3PZDA 1MZCA 3Q47B 3VLEA 4Q96A 3U3WA 4DX7D 5JJ7A 1HH8A 4BTAA 3CK7A 5FIOA 3HXBA 3QWPA 5KJNA 3AS8A 3Q79A 1IHGA 5DIZA 3PUJA 4YDYA 1N11A 1MQSA 4UUCA 4AXHA 4J7WA 1E8YA 3T5VA 3D9OA 2FO1E 1XNFA 3UQ3A 4WNEA 4HOSA 2EILE 5E75A 1H2UA 1Z6TA 4RG6A 4CDNA 4LNGA 1FCHA 1D8DA 2R5SA 3BU8A 3BUAA 5LP0A 2YHEA 5JJTA 1SZAA 1A5EA 2P9LG 4XI9A 4JEHA 3U64A 4O1PA 4Y6WA 1NZNA 4ILGA 5HKPA 4L7TA 3PEUB 4A3VA 2WXKA 5FWQA 5D0OD 3FTWA 3C3RA 3ABLE 3U9WA 2LAIA 3APCA 2HR2A 2IY0C 3Q7AA 4O1OA 3FY4A 2XCBA 1D9SA 4GZ5A 1HF8A 4M3OA 2NYJA 3C72A 4BT9A 1UN8A 4XIFA 5BNWA 3MKQA 3L08A 5CRUA 4BESA 2CHZA 4HRLA 3FTVA 2A5UA 4AEZC 1WM5A 3E32A 1L5JA 4HOQA 4KVMA 4UWHA 3HXCA 2X38A 3DEPA 3LPZA 3IHVA 2BKGA 4FC8A 1WAO1 3KEZA 3HVEA 3Q5MA 3QKYA 3FEXA 3BG1B 3B13A 3EJNA 2ZGGA 2X6FA 3Q73A 3DPDA 4JZYA 4I2WA 3LJNA 1K1AA 2AXVA 5CEDB 5BT1A 3CQGB 4CEMA 1X5BA 3ZU7B 3G2VA 3ZKJA 1WG0A 4AV7A 3TJPA 1OCZE 3ZFWA 2RFAA 2QYJA 4DK5A 3QWWA 1TR4A 4N5CA 3CK9A 2ONDA 3TWWA 3AS5A 3PE3A 1OY3D 3OXFA 4ILHB 3URZA 2XPIA 3FU6A 4JHRA 3E30A 5B1AE 1SQMA 3UMVA 2WMNA 3UX4A 1U2VG 3RO2A 3ML9A 4PS3A 4MS6A 2LXLA 4HRMB 2E0IA 4YDWA 2R02A 1OT8A 3WG7E 2XS8A 4EZLA 1MYOA 2Y69E 4LRZA 5KWDA 3NB2A 5AIJA 3TG5A 2IQCA 2LXMA 5HRYA 2PL2A 1EPUA 3AS4A 4CDRA 2C0MA 2L0TB 4ZHBA 1INZA 4RSYA 1MX2A 3S7FA 4F3VA 5BUZA 1JUQA 1SA4A 4JC8A 4UQZA 1TNZA 2H6FA 1TJFA 5EILA 4B89A 3UINC 2XZDG 3G2TA 3UM3A 4G26A 4W9RA 2XS1A 4K0RA 3V31A 5G2NA 4L1BA 3HYMB 4M7CA 3IXEA 2FEZA 5EKQD 4U63A 3TAXA 3PRZA 1UG3A 3AG2E 5FJYA 4XX5A 2UWJG 5FINA 4UWFA 2KCKA 1EF1C 2XPZA 4GTRA 5FZQA 4L9PA 2DZOA 4U0ZA 3ASOE 3HXFA 5A7DB 3D9JA 2BEDA 3IHYA 1K8KG 2PNNA 3R9AB 3CHMA 3CVNA 1FPPA 4GYWA 4JPSA 4JB8P 3LY8A 4OVUA 4GYYA 2Y3AA 1ELKA 5CMWA 1W3BA 3D9LA 3P1UA 2VTBA 1TJCA 4UWLA 5D2MC 4XEIG 4GPKA 3AAAC 2DWZA 1O1SA 1OWLA 4J8SA 5KCMA 3MCXA 3EHMA 4JXTA 4XI0A 1UW4B 1IQRA 4O6FA 1HXIA 2WXJA 2AWIA 4HVBA 5AN8A 1JCQA 4RG9A 1OXJA 2PZIA 5C1DA 3QDNA 1TNBA 5ANRA 4G8LA 4HORA 3S7BA 4D10C 2Y1LE 4J6IA 5CRVA 4FU3A 2V0PA 3B7RL 3NOGD 2X6HA 3L13A 3LCAA 3TWXA 2R59A 5KJMA 3KSLA 2FBNA 3SD5A 4YVQC 3MYVA 3CVYA 4K5BA 2KATA 1OWMA 2RG8A 2QZAA 3UPVA 4HS2A 1N0RA 4GZCA 1N4SA 3Q4AB 2OV8A 5EYLA 3UT8A 4C9BB 4DUIA 3PREA 3LVRE 4C48B 4G2VA 4JHJA 3L6AA 5ENSD 2OVFA 4DI3A 3B7UX 3CHQA 2WQ6A 4DI4A 3EU5A 5KJKA 1MX4A 1IHBA 3TWTA 2WXOA 1DC2A 4L2YA 4GZ3A 3DRAA 4H7XA 3LKUA 4CT4A 3IBEA 3C3QA 5FZRA 2VGYA 2PM6A 2ZISA 3FDHA 5E76A 2KC7A 3X2QE 4KYOB 3IEGA 3CKBA 3UKUG 2RFMA 3BEEA 3FUFA 2P9KG 1O5MA 1N0QA 2A4ZA 3KEAA 2WXLA 3T8KA 5LX8A 1K3ZD 4IRUA 4JA9A 4PUCA 4NQ0A 2IO3C 4LSZE 3FH5A 4NACA 5CCLA 2J9QA 4TUUA 2LNIA 4APOA 1YYHA 4RVBA 3HG0D 1IKND 3DBSA 3FTXA 5BPPA 1OWOA 4B94A 1FVFA 1KZPA 3OTNA 3CVXA 2ILRA 2XPYA 3DSTA 1E7UA 2IF4A 2P58C 5JHBA 2LSVA 2YHCA 4ANXA 3OAWA 1HS6A 4I43A 4EPZA 2Y0BG 3SFXA 2R2LA 2UY1A 4GPMA 3IV0A 4JA7A 2HM8A 3ESLA 1OUVA 3UIOC 4EZJA 4HOTA 2L0IA 3PNTB 5G04C 3MEKA 4DLQA 4WWOA 3AU4A 3SZ7A 4UI9K 5B1BE 4CDMA 4U7EB 2J08A 1KZOA 2F8YA 5T4YA 4I6EA 4QFVA 3SNXA 3FH8A 4JEUA 4LNBA 3EHNA 4K03A 5M72A 3ASDA 4HQDA 4XZ4A 2ETAA 3DSSA 5G05C 3E34A 2OVBA 3UT7A 3GW4A 4O60A 2AXUA 3LXUX 5G04J 3DWLG 3B7BA 3EHRA 1EDUA 1TN8A 1V54E 3LDZA 3FTZA 4GMRA 4WWPA 1H0AA 4B0ZA 4ANUA 2V8SE 5KNHD 2P2CP 1TEZA 4APFA 1D8EA 2VGXB 2A5EA 2BF0X 3NF1A 2DYSE 3CVQA 1KT1A 3APDA 3UTMA 1JWGA 3AG4E 3PZ2A 3KAEA 3QARA 4FJYA 3JQ0A 3ZRHA 4AP2A 3R9MA 4EECA 3TWQA 2QC9A 3G2WA 3S2AA 3RJVA 3L82A 1N4RA 4PS7A 4K5AB 3TL5A 2VSYA 1IYGA 1G3NB 1BI7B 1SA5A 2DIWA 2I2OA 3ABKE 2LAHA 3QNKA 2WXIA 3SO8A 3J5QB 1OWPA 2WQ7A 5EIDA 3CR3A 1AWCB 3DSUA 3RAUA 3HXEA 1XGWA 4I2ZA 2F8XK 4P29A 3ZXSA 2V4LA 4JW1A 4CCAA 3FTUA 5EDSA 4UI9C 4BFRA 4ANWA 2XRZA 4RLYA 3QJZA 2VYIA 4HOUA 2ZGDA 5BV1A 2P9UG 4L2LA 5T3RA 4BY6A 2DYRE 4WNFA 1GW6A 4F53A 2L9BA 3TG4A 1HE8A 4LNUD 3U4TA 2X6JA 2XENA 4UI9J 3G2UA 2BTDA 3L9TA 5CMYA 4CZ2D 3IKOB 3B7TA 4GAAA 4Q94A 3ONLA 5J90A 3CV0A 4I1MA 2XRYA 1TNYA 1ZU2A 2LO6A 4DPRA 3R7QA 3U66A 3ASNE 4GTOA 4F7AA 3PE4A 4GTQA 3MJWA 3FTYA 3AU5A 3APFA 2H6IA 4MLPA 4I1AA 2I1JA 3CQCB 4GYOA 4TXRA 5C2YA 4ACLA 3CHRA 4C0MA 1MX6A 2CHWA 4B8CB 4G8KA 2P9IG 4DRXE 2WB2A 2IO2C 1EYHA 4U0SA 3CHPA 1UOHA 4EBAG 4JD2G 4MKTA 2L6JA 1ELWA 2CG3A 1QNFA 3CVPA 2WMOA 4B93B 4J8EA 3RIBA 3BG0B 4HLEA 4A63B 3ULYA 3LVQE 3FUHA 4MRUA 2VGEA 1BD8A 3ESKA 3SY2A 1JWFA 2XEHA 4AJWA 4I9EA 1V55E 3NZUA 3F6QA 5ENQD 4BEPA 5IY5E 2KCLA 2GW1A 3FUDA 5CHEE 2AJAA 4XE0A 3T8MA 4N2SA 3Q15A 3FFLA 4U04A 4LEUA 2GROB 3E33A 4YVOA 3CSTA 4FLHA 3MZLB 4IYPA 3ZIMA 5KBAA 2E2EA 3ZHEA 4WAFA 3UM2A 3B95A 3PS6A 1S63A 3ZYQA 2J4BA 3MKQB 4B8AA 4N5QA 4U07A 3FUKA 4X8QA 4JL0A 5B3SE 2DZNA 1IXVA 5A23A 3CVLA 3RRUA 4MBGA 2EIME 4GMJA 4ABNA 2MYOA 2ETBA 5D66A 2WXHA 2HE0A 3FWVA 2F0YA 2IU1A 4I17A 2VJ8A 3CIAA 2WQHA 3OXLA 3DEOA 3ONKA 1S0PA 3HVEB 4GA0A 5JHAA 4G23A 5AQ7A 3JXJA 2QFCA 2C2LA 5AYWD 4OVVA 3NZSA 4CYMD 3D9NA 2KM4A 4DX1A 3ZEFA 3UM1A 3LEWA 2PQNA 3D9MA 4CRWA 2WXFA 5ENTD 4GTVA 3NBNB 4URKA 1NA3A 3EIJA 3LS8A 4I1OB 2X6IA 3RRNB 1MHQA 5ENOD 5G55A 3CHOA 2KZTA 2M63A 1WY6A 2XZTG 2J07A 1RW2A 3E37A 3FHEA 1DVPA 1H6OA 3GZ1A 2IEJA 2WXRA 2FULA 4KZ0A 2WXGA 2P9SG 3DSWA 3FUIA 2XQ0A 3BQOA 4Q69A 2H6HA 3ZVVA 1UN9A 1SVXA 3NQPA 1PC2A 2LSUA 4TXPA 2H6GA 3SI5A 1X81A 2DCPA 1FT2A 4GZDA 4WUYA 3PZ3A 5ANLA 1E7VA 3FUNA 4L23A 4AOFA 4IN3B 3I5PA 4GU5A 3FULA 3FU0A 1K1BA 4QQIA 3S7JA 4HBDA 1MJ0A 5BXUA 2ETCA 3CK8A 5D0QD 1UJJA 1JPLA 3Q49B 4ATGA 1HO8A 1ZBPA 4I6GA 3Q9UC 2CFZA 1Z3XA 3EUVA 3J5PA 3TWRA 4WNDA 2GRMA 4GB9A 4BERA 1E8WA 3EIQC 4FP7A 3P2BA 3KD7A 1SZ9A 3S7DA 4HLLA 4U96D 5EN5D 3FUMA 1JCRA 4R7LA 2V5QC 1N4QA 2ZIRA 1RZ4A 1PAQA 4GZ6A 3AG1E 4PDXA 2Y4TA 5FTPA 3MA5A 1H2TC 2XGSA 4ME2A 3PZ1A 4GA2A 2GRLA 5ITZF 2VTBB 1N94A 3LY7A 5AQBA 3SHFA 5CBOA 4DX5D 4JVSA 3D9IA 2PQRA 3E4BA 4OAUC 4HI9A 4TUMA 4BSZB 2MOWA 2QY7A 3CKCA 5JA4D 3TXMA 3JXIA 3G2SA 5FQ7A 1ELRA 4EZKA 1ZB1A 3Q7FA 3PEVB 3RO3A 4ANVA 2MRIA 2IFUA 5T8IA 3ZGQA 3RRMB 4AM9A 2YINA 3TWUA 3Q78A 2AW6A 3DXMG 2GRQB 3RKVA 4GTPA 2GGFA 1WDYA 4FJZA 2X6KA 5CBNA 1SW6A 3UIPC 4DX2A 4FLBA 4N39A 1QBQA 1S70B 5AJDA 4A1GA 3KS2A 5DBKA 3V79K 3CVUA 2JEKA 4AY6A 3T9KA 5CEAA 4BT8A
chains in the Genus database with same CATH topology
3E33A 3DSVA 4GTTA 1JCRA 1LD7A 1KZPA 1N4QA 1N4PA 1TNYA 1JCSA 2ZIRA 3DSTA 3PZ4A 1N4SA 1N9AA 1N4RA 1TN7A 1S64A 4GTOA 4EHMA 4GTRA 3E37A 4GTQA 4L9PA 2IEJA 3HXFA 3PZ1A 1S63A 1SA5A 3DSWA 3SFXA 2BEDA 2R2LA 3Q7AA 1N94A 2H6IA 1FPPA 2H6HA 3E30A 1NL4A 1TNUA 1DCEA 3C72A 1NI1A 3DPYA 4MBGA 1TNOA 4GTMA 1LD8A 3DSUA 2H6GA 1KZOA 3EU5A 1X81A 3HXEA 1O1SA 1FT2A 2F0YA 1O1TA 3PZ3A 4LNBA 3E32A 3Q7FA 1MZCA 3SFYA 3DRAA 3Q75A 2ZISA 3DSSA 3E34A 1JCQA 3HXBA 1TN6A 3Q78A 3HXCA 4GTPA 3Q79A 1TN8A 1O5MA 1TNBA 3DSXA 1SA4A 1O1RA 4YDOA 1N95A 1TNZA 2H6FA 1D8EA 1QBQA 3EUVA 3HXDA 4GTSA 4YDEA 3KSLA 3Q73A 1LTXA 4GTVA 3KSQA 3PZ2A 4LNGA 1FT1A 1D8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E33 A;  3DSV A;  4GTT A;  1JCR A;  1LD7 A;  1KZP A;  1N4Q A;  1N4P A;  1TNY A;  1JCS A;  2ZIR A;  3DST A;  3PZ4 A;  1N4S A;  1N9A A;  1N4R A;  1TN7 A;  1S64 A;  4GTO A;  4EHM A;  4GTR A;  3E37 A;  4GTQ A;  4L9P A;  2IEJ A;  3HXF A;  3PZ1 A;  1S63 A;  1SA5 A;  3DSW A;  3SFX A;  2BED A;  2R2L A;  3Q7A A;  1N94 A;  2H6I A;  1FPP A;  2H6H A;  3E30 A;  1NL4 A;  1TNU A;  1DCE A;  3C72 A;  1NI1 A;  3DPY A;  4MBG A;  1TNO A;  4GTM A;  1LD8 A;  3DSU A;  2H6G A;  1KZO A;  3EU5 A;  1X81 A;  3HXE A;  1O1S A;  1FT2 A;  2F0Y A;  1O1T A;  3PZ3 A;  4LNB A;  3E32 A;  3Q7F A;  1MZC A;  3SFY A;  3DRA A;  3Q75 A;  2ZIS A;  3DSS A;  3E34 A;  1JCQ A;  3HXB A;  1TN6 A;  3Q78 A;  3HXC A;  4GTP A;  3Q79 A;  1TN8 A;  1O5M A;  1TNB A;  3DSX A;  1SA4 A;  1O1R A;  4YDO A;  1N95 A;  1TNZ A;  2H6F A;  1D8E A;  1QBQ A;  3EUV A;  3HXD A;  4GTS A;  4YDE A;  3KSL A;  3Q73 A;  1LTX A;  4GTV A;  3KSQ A;  3PZ2 A;  4LNG A;  1FT1 A;  1D8D A; 
#chains in the Genus database with same CATH topology
 1N54 A;  4K5C A;  4E6H A;  4OYS A;  2VSX E;  3DSV A;  3C98 A;  1LD7 A;  4XKB A;  2NC9 A;  2ZU6 B;  3SGH A;  3MV3 B;  2VSN A;  3LYA A;  1AP7 A;  3QOU A;  3RK6 A;  1OCR E;  5G05 J;  4CGV A;  5FQ4 A;  3SBT B;  3HHM A;  1NA0 A;  4BET A;  4BX9 A;  4AY5 A;  4G1T A;  4WNG A;  2EIK E;  4EQF A;  4HRN A;  4GTM A;  4DX6 D;  1HFA A;  2XGO A;  4NIK A;  4KBQ A;  4ATZ D;  3ULQ A;  3SFY A;  1E96 B;  3NAW A;  1IQU A;  3WXX A;  2YQ8 A;  3PUK A;  2CG2 A;  3ISM C;  5LFA A;  1PY1 A;  3TXN A;  4NRH B;  4N3C A;  4U8V D;  5HS0 A;  3TWS A;  1OWN A;  2DBA A;  5CER B;  5JJ6 A;  2EQX A;  2P9P G;  1VDY A;  5AEN A;  3UUX A;  3CVV A;  4J0U A;  3ASF A;  4JHK A;  1N95 A;  4GCN A;  3K9I A;  1U3C A;  4GTS A;  1H6K A;  4BWR A;  1LTX A;  2I9C A;  2OCC E;  3FEY A;  4NUR A;  4RQI A;  4GML A;  4BX8 A;  5KNG A;  5BXO A;  5AAO A;  4KZC A;  4U95 D;  2WXP A;  2VSO E;  3I4G A;  3B7S A;  3TGO A;  2UY1 B;  1Y8M A;  4PH4 B;  3I3N A;  3QC1 A;  2P9N G;  2R03 A;  2LUH A;  1KPS B;  3VLD A;  2FO7 A;  3SFZ A;  2EIN E;  4I9C A;  4A3T A;  5LOZ A;  2B6C A;  5HQ8 A;  2FI7 A;  2XGM A;  1BLX B;  5H7P A;  5FZS A;  3W9G A;  2J8S D;  3L16 A;  3ZYM A;  2PM7 A;  3CGH A;  1O1T A;  1H19 A;  2KBX A;  4Y6C A;  4YND A;  4F1S A;  2YNQ A;  5EIB E;  3ZYK A;  3W9F A;  1Z3Y A;  1HG2 A;  2WXM A;  3V2O A;  3ZPJ A;  1NP7 A;  3C3O A;  4U8H A;  5BV0 A;  3DSX A;  1QQE A;  3CSF A;  3L22 A;  3NOC D;  3HIZ A;  2CHX A;  3VTY A;  2IOL A;  3FU3 A;  3N71 A;  3O48 A;  1BU9 A;  1A17 A;  2I1K A;  4Z68 A;  4ACK A;  4TRQ A;  4IUL A;  4CGW A;  5J08 A;  1BPO A;  3QAQ A;  5A6C A;  2AXZ A;  3EDT B;  4G24 A;  4FHK A;  1N52 A;  2ZXW E;  2AVP A;  5JMN D;  5LCW C;  5EX3 A;  1S64 A;  2DVW A;  1Y6I A;  4LER A;  2GRN B;  2OEV A;  1B89 A;  2X3M A;  3ABM E;  2QYU A;  3OXG A;  1KT0 A;  1DCE A;  3ZNG A;  3HRA A;  3FUE A;  3DXK G;  5LCW J;  3JQ1 A;  2ION A;  1E90 A;  2Q7F A;  4WWN A;  4N3B A;  3SQV A;  5ENN A;  4UWG A;  3Q75 A;  1HZ4 A;  2Y4U A;  1QYM A;  2J4D A;  2XEE A;  1TN6 A;  3UXG A;  1NFI E;  3QB2 A;  2OEW A;  4J8Y A;  4XKC A;  3UT4 A;  4C0E A;  5BW8 C;  3HXD A;  3KSQ A;  1DNP A;  5HI7 A;  2KCV A;  3VTX A;  4GCO A;  4FHJ A;  1QZ2 A;  3ZN3 A;  2B0O E;  2WVI A;  3QK0 A;  4FUL A;  4J8D A;  2BUG A;  4KT6 B;  2JAB A;  4AVX A;  3T5X A;  4EBA A;  3Q9N C;  2V4H C;  3CHS A;  3SBS A;  4ILI A;  2HYZ A;  3PH0 C;  1HU3 A;  3UI2 A;  4OAV B;  2IJG X;  3ASH A;  3MGB A;  5FT9 A;  4KXK B;  4UWK A;  1LD8 A;  3EHQ A;  3CLJ A;  2FF4 A;  4CT0 A;  1HX8 A;  2L6B A;  4N2Q A;  2JLB A;  5FQ8 A;  1TYQ G;  4H7Y A;  2IOS A;  3JUI A;  1BI8 B;  2F37 A;  3LY9 A;  3D9H A;  5ARG A;  4G11 A;  1U3D A;  1E8X A;  4FA6 A;  3AJI A;  1Z5S C;  5FQ6 A;  1UJK A;  4KVO A;  1O1R A;  4YDO A;  2WXQ A;  3RSE G;  2HO1 A;  4HNA D;  4LCT A;  4PS8 A;  1DCQ A;  3L17 A;  4YDE A;  4U8Y D;  4F1P A;  3ASG A;  4LUN U;  4TV3 A;  3ENE A;  5ENR D;  3MKR A;  2VGX A;  2J09 A;  3C5R A;  4I6J A;  2BKK B;  1YMP A;  3ZHE B;  4E85 A;  3GYZ A;  5KJL A;  3AG3 E;  3ZW3 A;  3HDX A;  1TN7 A;  4HB5 A;  5ARF A;  3D3M A;  4BSX A;  3QWV A;  3ZXP A;  4A55 A;  3FU5 A;  3GZS A;  4HI8 A;  3O4Z A;  4HFG A;  3L54 A;  4GA1 A;  5AQA A;  2I6H A;  2WXN A;  2MHK A;  2EIJ E;  1NL4 A;  1TNU A;  1H2V C;  4F6R D;  1YA0 A;  1NI1 A;  4TXQ A;  4DLO A;  2J49 A;  4G25 A;  4V3I A;  1KLX A;  2NSZ A;  5CEC B;  1Q2Z A;  2XCC A;  5AJL A;  3V2X A;  3ML8 A;  2R05 A;  1YCS B;  3PNL B;  4U0U A;  2NXP A;  3PDN A;  2KXP C;  5ENP D;  1E8Z A;  3UKR G;  3CVW A;  3MV2 B;  4KMO A;  3UM0 A;  3JCK C;  5EYP F;  2V5F A;  3ZUV B;  3FTS A;  1P5Q A;  4AIF A;  4BTB A;  5EX0 A;  4ZFH A;  3LJ3 A;  3MX3 A;  2GRR B;  3SF4 A;  5CCM A;  5AAR A;  5AQ9 A;  4DJA A;  3GZ2 A;  4UQY A;  3JYS A;  3EU9 A;  3FP3 A;  3R7R A;  1FVH A;  1FT1 A;  2OOE A;  2C0L A;  2KZT B;  4FAD A;  1OCC E;  1HG5 A;  2RD0 A;  4GTT A;  3PVL A;  1OCO E;  1N4P A;  4J8F A;  3ULE G;  1JCS A;  3V30 A;  3PZ4 A;  2XEV A;  1N9A A;  3JUE A;  2R17 C;  4EHM A;  4HXI A;  3RU0 A;  2VQ2 A;  1LF8 A;  3D9P A;  4A1S A;  3FUJ A;  3I4R B;  2CFU A;  4N3A A;  4LG6 A;  2WM9 A;  2WPV A;  2GRP B;  3TWV A;  2RKK A;  3VLF A;  3DPY A;  1TNO A;  3ZYL A;  3D9K A;  4UQX A;  3FH7 A;  1H6P A;  2XHE A;  3CEQ A;  3PZD A;  1MZC A;  3Q47 B;  3VLE A;  4Q96 A;  3U3W A;  4DX7 D;  5JJ7 A;  1HH8 A;  4BTA A;  3CK7 A;  5FIO A;  3HXB A;  3QWP A;  5KJN A;  3AS8 A;  3Q79 A;  1IHG A;  5DIZ A;  3PUJ A;  4YDY A;  1N11 A;  1MQS A;  4UUC A;  4AXH A;  4J7W A;  1E8Y A;  3T5V A;  3D9O A;  2FO1 E;  1XNF A;  3UQ3 A;  4WNE A;  4HOS A;  2EIL E;  5E75 A;  1H2U A;  1Z6T A;  4RG6 A;  4CDN A;  4LNG A;  1FCH A;  1D8D A;  2R5S A;  3BU8 A;  3BUA A;  5LP0 A;  2YHE A;  5JJT A;  1SZA A;  1A5E A;  2P9L G;  4XI9 A;  4JEH A;  3U64 A;  4O1P A;  4Y6W A;  1NZN A;  4ILG A;  5HKP A;  4L7T A;  3PEU B;  4A3V A;  2WXK A;  5FWQ A;  5D0O D;  3FTW A;  3C3R A;  3ABL E;  3U9W A;  2LAI A;  3APC A;  2HR2 A;  2IY0 C;  3Q7A A;  4O1O A;  3FY4 A;  2XCB A;  1D9S A;  4GZ5 A;  1HF8 A;  4M3O A;  2NYJ A;  3C72 A;  4BT9 A;  1UN8 A;  4XIF A;  5BNW A;  3MKQ A;  3L08 A;  5CRU A;  4BES A;  2CHZ A;  4HRL A;  3FTV A;  2A5U A;  4AEZ C;  1WM5 A;  3E32 A;  1L5J A;  4HOQ A;  4KVM A;  4UWH A;  3HXC A;  2X38 A;  3DEP A;  3LPZ A;  3IHV A;  2BKG A;  4FC8 A;  1WAO 1;  3KEZ A;  3HVE A;  3Q5M A;  3QKY A;  3FEX A;  3BG1 B;  3B13 A;  3EJN A;  2ZGG A;  2X6F A;  3Q73 A;  3DPD A;  4JZY A;  4I2W A;  3LJN A;  1K1A A;  2AXV A;  5CED B;  5BT1 A;  3CQG B;  4CEM A;  1X5B A;  3ZU7 B;  3G2V A;  3ZKJ A;  1WG0 A;  4AV7 A;  3TJP A;  1OCZ E;  3ZFW A;  2RFA A;  2QYJ A;  4DK5 A;  3QWW A;  1TR4 A;  4N5C A;  3CK9 A;  2OND A;  3TWW A;  3AS5 A;  3PE3 A;  1OY3 D;  3OXF A;  4ILH B;  3URZ A;  2XPI A;  3FU6 A;  4JHR A;  3E30 A;  5B1A E;  1SQM A;  3UMV A;  2WMN A;  3UX4 A;  1U2V G;  3RO2 A;  3ML9 A;  4PS3 A;  4MS6 A;  2LXL A;  4HRM B;  2E0I A;  4YDW A;  2R02 A;  1OT8 A;  3WG7 E;  2XS8 A;  4EZL A;  1MYO A;  2Y69 E;  4LRZ A;  5KWD A;  3NB2 A;  5AIJ A;  3TG5 A;  2IQC A;  2LXM A;  5HRY A;  2PL2 A;  1EPU A;  3AS4 A;  4CDR A;  2C0M A;  2L0T B;  4ZHB A;  1INZ A;  4RSY A;  1MX2 A;  3S7F A;  4F3V A;  5BUZ A;  1JUQ A;  1SA4 A;  4JC8 A;  4UQZ A;  1TNZ A;  2H6F A;  1TJF A;  5EIL A;  4B89 A;  3UIN C;  2XZD G;  3G2T A;  3UM3 A;  4G26 A;  4W9R A;  2XS1 A;  4K0R A;  3V31 A;  5G2N A;  4L1B A;  3HYM B;  4M7C A;  3IXE A;  2FEZ A;  5EKQ D;  4U63 A;  3TAX A;  3PRZ A;  1UG3 A;  3AG2 E;  5FJY A;  4XX5 A;  2UWJ G;  5FIN A;  4UWF A;  2KCK A;  1EF1 C;  2XPZ A;  4GTR A;  5FZQ A;  4L9P A;  2DZO A;  4U0Z A;  3ASO E;  3HXF A;  5A7D B;  3D9J A;  2BED A;  3IHY A;  1K8K G;  2PNN A;  3R9A B;  3CHM A;  3CVN A;  1FPP A;  4GYW A;  4JPS A;  4JB8 P;  3LY8 A;  4OVU A;  4GYY A;  2Y3A A;  1ELK A;  5CMW A;  1W3B A;  3D9L A;  3P1U A;  2VTB A;  1TJC A;  4UWL A;  5D2M C;  4XEI G;  4GPK A;  3AAA C;  2DWZ A;  1O1S A;  1OWL A;  4J8S A;  5KCM A;  3MCX A;  3EHM A;  4JXT A;  4XI0 A;  1UW4 B;  1IQR A;  4O6F A;  1HXI A;  2WXJ A;  2AWI A;  4HVB A;  5AN8 A;  1JCQ A;  4RG9 A;  1OXJ A;  2PZI A;  5C1D A;  3QDN A;  1TNB A;  5ANR A;  4G8L A;  4HOR A;  3S7B A;  4D10 C;  2Y1L E;  4J6I A;  5CRV A;  4FU3 A;  2V0P A;  3B7R L;  3NOG D;  2X6H A;  3L13 A;  3LCA A;  3TWX A;  2R59 A;  5KJM A;  3KSL A;  2FBN A;  3SD5 A;  4YVQ C;  3MYV A;  3CVY A;  4K5B A;  2KAT A;  1OWM A;  2RG8 A;  2QZA A;  3UPV A;  4HS2 A;  1N0R A;  4GZC A;  1N4S A;  3Q4A B;  2OV8 A;  5EYL A;  3UT8 A;  4C9B B;  4DUI A;  3PRE A;  3LVR E;  4C48 B;  4G2V A;  4JHJ A;  3L6A A;  5ENS D;  2OVF A;  4DI3 A;  3B7U X;  3CHQ A;  2WQ6 A;  4DI4 A;  3EU5 A;  5KJK A;  1MX4 A;  1IHB A;  3TWT A;  2WXO A;  1DC2 A;  4L2Y A;  4GZ3 A;  3DRA A;  4H7X A;  3LKU A;  4CT4 A;  3IBE A;  3C3Q A;  5FZR A;  2VGY A;  2PM6 A;  2ZIS A;  3FDH A;  5E76 A;  2KC7 A;  3X2Q E;  4KYO B;  3IEG A;  3CKB A;  3UKU G;  2RFM A;  3BEE A;  3FUF A;  2P9K G;  1O5M A;  1N0Q A;  2A4Z A;  3KEA A;  2WXL A;  3T8K A;  5LX8 A;  1K3Z D;  4IRU A;  4JA9 A;  4PUC A;  4NQ0 A;  2IO3 C;  4LSZ E;  3FH5 A;  4NAC A;  5CCL A;  2J9Q A;  4TUU A;  2LNI A;  4APO A;  1YYH A;  4RVB A;  3HG0 D;  1IKN D;  3DBS A;  3FTX A;  5BPP A;  1OWO A;  4B94 A;  1FVF A;  1KZP A;  3OTN A;  3CVX A;  2ILR A;  2XPY A;  3DST A;  1E7U A;  2IF4 A;  2P58 C;  5JHB A;  2LSV A;  2YHC A;  4ANX A;  3OAW A;  1HS6 A;  4I43 A;  4EPZ A;  2Y0B G;  3SFX A;  2R2L A;  2UY1 A;  4GPM A;  3IV0 A;  4JA7 A;  2HM8 A;  3ESL A;  1OUV A;  3UIO C;  4EZJ A;  4HOT A;  2L0I A;  3PNT B;  5G04 C;  3MEK A;  4DLQ A;  4WWO A;  3AU4 A;  3SZ7 A;  4UI9 K;  5B1B E;  4CDM A;  4U7E B;  2J08 A;  1KZO A;  2F8Y A;  5T4Y A;  4I6E A;  4QFV A;  3SNX A;  3FH8 A;  4JEU A;  4LNB A;  3EHN A;  4K03 A;  5M72 A;  3ASD A;  4HQD A;  4XZ4 A;  2ETA A;  3DSS A;  5G05 C;  3E34 A;  2OVB A;  3UT7 A;  3GW4 A;  4O60 A;  2AXU A;  3LXU X;  5G04 J;  3DWL G;  3B7B A;  3EHR A;  1EDU A;  1TN8 A;  1V54 E;  3LDZ A;  3FTZ A;  4GMR A;  4WWP A;  1H0A A;  4B0Z A;  4ANU A;  2V8S E;  5KNH D;  2P2C P;  1TEZ A;  4APF A;  1D8E A;  2VGX B;  2A5E A;  2BF0 X;  3NF1 A;  2DYS E;  3CVQ A;  1KT1 A;  3APD A;  3UTM A;  1JWG A;  3AG4 E;  3PZ2 A;  3KAE A;  3QAR A;  4FJY A;  3JQ0 A;  3ZRH A;  4AP2 A;  3R9M A;  4EEC A;  3TWQ A;  2QC9 A;  3G2W A;  3S2A A;  3RJV A;  3L82 A;  1N4R A;  4PS7 A;  4K5A B;  3TL5 A;  2VSY A;  1IYG A;  1G3N B;  1BI7 B;  1SA5 A;  2DIW A;  2I2O A;  3ABK E;  2LAH A;  3QNK A;  2WXI A;  3SO8 A;  3J5Q B;  1OWP A;  2WQ7 A;  5EID A;  3CR3 A;  1AWC B;  3DSU A;  3RAU A;  3HXE A;  1XGW A;  4I2Z A;  2F8X K;  4P29 A;  3ZXS A;  2V4L A;  4JW1 A;  4CCA A;  3FTU A;  5EDS A;  4UI9 C;  4BFR A;  4ANW A;  2XRZ A;  4RLY A;  3QJZ A;  2VYI A;  4HOU A;  2ZGD A;  5BV1 A;  2P9U G;  4L2L A;  5T3R A;  4BY6 A;  2DYR E;  4WNF A;  1GW6 A;  4F53 A;  2L9B A;  3TG4 A;  1HE8 A;  4LNU D;  3U4T A;  2X6J A;  2XEN A;  4UI9 J;  3G2U A;  2BTD A;  3L9T A;  5CMY A;  4CZ2 D;  3IKO B;  3B7T A;  4GAA A;  4Q94 A;  3ONL A;  5J90 A;  3CV0 A;  4I1M A;  2XRY A;  1TNY A;  1ZU2 A;  2LO6 A;  4DPR A;  3R7Q A;  3U66 A;  3ASN E;  4GTO A;  4F7A A;  3PE4 A;  4GTQ A;  3MJW A;  3FTY A;  3AU5 A;  3APF A;  2H6I A;  4MLP A;  4I1A A;  2I1J A;  3CQC B;  4GYO A;  4TXR A;  5C2Y A;  4ACL A;  3CHR A;  4C0M A;  1MX6 A;  2CHW A;  4B8C B;  4G8K A;  2P9I G;  4DRX E;  2WB2 A;  2IO2 C;  1EYH A;  4U0S A;  3CHP A;  1UOH A;  4EBA G;  4JD2 G;  4MKT A;  2L6J A;  1ELW A;  2CG3 A;  1QNF A;  3CVP A;  2WMO A;  4B93 B;  4J8E A;  3RIB A;  3BG0 B;  4HLE A;  4A63 B;  3ULY A;  3LVQ E;  3FUH A;  4MRU A;  2VGE A;  1BD8 A;  3ESK A;  3SY2 A;  1JWF A;  2XEH A;  4AJW A;  4I9E A;  1V55 E;  3NZU A;  3F6Q A;  5ENQ D;  4BEP A;  5IY5 E;  2KCL A;  2GW1 A;  3FUD A;  5CHE E;  2AJA A;  4XE0 A;  3T8M A;  4N2S A;  3Q15 A;  3FFL A;  4U04 A;  4LEU A;  2GRO B;  3E33 A;  4YVO A;  3CST A;  4FLH A;  3MZL B;  4IYP A;  3ZIM A;  5KBA A;  2E2E A;  3ZHE A;  4WAF A;  3UM2 A;  3B95 A;  3PS6 A;  1S63 A;  3ZYQ A;  2J4B A;  3MKQ B;  4B8A A;  4N5Q A;  4U07 A;  3FUK A;  4X8Q A;  4JL0 A;  5B3S E;  2DZN A;  1IXV A;  5A23 A;  3CVL A;  3RRU A;  4MBG A;  2EIM E;  4GMJ A;  4ABN A;  2MYO A;  2ETB A;  5D66 A;  2WXH A;  2HE0 A;  3FWV A;  2F0Y A;  2IU1 A;  4I17 A;  2VJ8 A;  3CIA A;  2WQH A;  3OXL A;  3DEO A;  3ONK A;  1S0P A;  3HVE B;  4GA0 A;  5JHA A;  4G23 A;  5AQ7 A;  3JXJ A;  2QFC A;  2C2L A;  5AYW D;  4OVV A;  3NZS A;  4CYM D;  3D9N A;  2KM4 A;  4DX1 A;  3ZEF A;  3UM1 A;  3LEW A;  2PQN A;  3D9M A;  4CRW A;  2WXF A;  5ENT D;  4GTV A;  3NBN B;  4URK A;  1NA3 A;  3EIJ A;  3LS8 A;  4I1O B;  2X6I A;  3RRN B;  1MHQ A;  5ENO D;  5G55 A;  3CHO A;  2KZT A;  2M63 A;  1WY6 A;  2XZT G;  2J07 A;  1RW2 A;  3E37 A;  3FHE A;  1DVP A;  1H6O A;  3GZ1 A;  2IEJ A;  2WXR A;  2FUL A;  4KZ0 A;  2WXG A;  2P9S G;  3DSW A;  3FUI A;  2XQ0 A;  3BQO A;  4Q69 A;  2H6H A;  3ZVV A;  1UN9 A;  1SVX A;  3NQP A;  1PC2 A;  2LSU A;  4TXP A;  2H6G A;  3SI5 A;  1X81 A;  2DCP A;  1FT2 A;  4GZD A;  4WUY A;  3PZ3 A;  5ANL A;  1E7V A;  3FUN A;  4L23 A;  4AOF A;  4IN3 B;  3I5P A;  4GU5 A;  3FUL A;  3FU0 A;  1K1B A;  4QQI A;  3S7J A;  4HBD A;  1MJ0 A;  5BXU A;  2ETC A;  3CK8 A;  5D0Q D;  1UJJ A;  1JPL A;  3Q49 B;  4ATG A;  1HO8 A;  1ZBP A;  4I6G A;  3Q9U C;  2CFZ A;  1Z3X A;  3EUV A;  3J5P A;  3TWR A;  4WND A;  2GRM A;  4GB9 A;  4BER A;  1E8W A;  3EIQ C;  4FP7 A;  3P2B A;  3KD7 A;  1SZ9 A;  3S7D A;  4HLL A;  4U96 D;  5EN5 D;  3FUM A;  1JCR A;  4R7L A;  2V5Q C;  1N4Q A;  2ZIR A;  1RZ4 A;  1PAQ A;  4GZ6 A;  3AG1 E;  4PDX A;  2Y4T A;  5FTP A;  3MA5 A;  1H2T C;  2XGS A;  4ME2 A;  3PZ1 A;  4GA2 A;  2GRL A;  5ITZ F;  2VTB B;  1N94 A;  3LY7 A;  5AQB A;  3SHF A;  5CBO A;  4DX5 D;  4JVS A;  3D9I A;  2PQR A;  3E4B A;  4OAU C;  4HI9 A;  4TUM A;  4BSZ B;  2MOW A;  2QY7 A;  3CKC A;  5JA4 D;  3TXM A;  3JXI A;  3G2S A;  5FQ7 A;  1ELR A;  4EZK A;  1ZB1 A;  3Q7F A;  3PEV B;  3RO3 A;  4ANV A;  2MRI A;  2IFU A;  5T8I A;  3ZGQ A;  3RRM B;  4AM9 A;  2YIN A;  3TWU A;  3Q78 A;  2AW6 A;  3DXM G;  2GRQ B;  3RKV A;  4GTP A;  2GGF A;  1WDY A;  4FJZ A;  2X6K A;  5CBN A;  1SW6 A;  3UIP C;  4DX2 A;  4FLB A;  4N39 A;  1QBQ A;  1S70 B;  5AJD A;  4A1G A;  3KS2 A;  5DBK A;  3V79 K;  3CVU A;  2JEK A;  4AY6 A;  3T9K A;  5CEA A;  4BT8 A; 
#chains in the Genus database with same CATH homology
 3E33 A;  3DSV A;  4GTT A;  1JCR A;  1LD7 A;  1KZP A;  1N4Q A;  1N4P A;  1TNY A;  1JCS A;  2ZIR A;  3DST A;  3PZ4 A;  1N4S A;  1N9A A;  1N4R A;  1TN7 A;  1S64 A;  4GTO A;  4EHM A;  4GTR A;  3E37 A;  4GTQ A;  4L9P A;  2IEJ A;  3HXF A;  3PZ1 A;  1S63 A;  1SA5 A;  3DSW A;  3SFX A;  2BED A;  2R2L A;  3Q7A A;  1N94 A;  2H6I A;  1FPP A;  2H6H A;  3E30 A;  1NL4 A;  1TNU A;  1DCE A;  3C72 A;  1NI1 A;  3DPY A;  4MBG A;  1TNO A;  4GTM A;  1LD8 A;  3DSU A;  2H6G A;  1KZO A;  3EU5 A;  1X81 A;  3HXE A;  1O1S A;  1FT2 A;  2F0Y A;  1O1T A;  3PZ3 A;  4LNB A;  3E32 A;  3Q7F A;  1MZC A;  3SFY A;  3DRA A;  3Q75 A;  2ZIS A;  3DSS A;  3E34 A;  1JCQ A;  3HXB A;  1TN6 A;  3Q78 A;  3HXC A;  4GTP A;  3Q79 A;  1TN8 A;  1O5M A;  1TNB A;  3DSX A;  1SA4 A;  1O1R A;  4YDO A;  1N95 A;  1TNZ A;  2H6F A;  1D8E A;  1QBQ A;  3EUV A;  3HXD A;  4GTS A;  4YDE A;  3KSL A;  3Q73 A;  1LTX A;  4GTV A;  3KSQ A;  3PZ2 A;  4LNG A;  1FT1 A;  1D8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...