2DZNA

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
226
structure length
226
Chain Sequence
NYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition between the regulatory particles Nas6 and Rpt3 of the yeast 26S proteasome
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Probable 26S proteasome regulatory subunit p28
total genus 70
structure length 226
sequence length 226
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2dznA00
2RFMA 2ETCA 1MJ0A 5HS0A 1IKND 4YDWA 4BETA 5CBNA 2KBXA 4GMRA 4B93B 3V2XA 3W9GA 5KNHD 3ZUVB 4HRNA 4DX2A 4K5BA 1N0QA 2KXPC 3B7BA 2XENA 4O1PA 4DRXE 5HKPA 5AQAA 1MX4A 1SVXA 3V2OA 3V79K 2A5EA 3EU9A 4HRMB 2DZNA 3C5RA 3EHRA 4K5CA 5KNGA 3SO8A 4BESA 2RFAA 3HG0D 1BI7B 1S70B 3W9FA 1QYMA 2ZGDA 4N5QA 3DEPA 2J8SD 3JXJA 5AAOA 2HE0A 5JMND 5AN8A 5FIOA 1YYHA 3HRAA 5BXOA 2XEEA 2DZOA 4LSZE 3TWRA 1WDYA 4DX6D 4U8VD 3DEOA 3TWTA 1DC2A 4G8KA 1TR4A 4UUCA 1BI8B 2ETAA 2DWZA 3KEAA 4GPMA 1K3ZD 4O60A 5KBAA 1D9SA 5HRYA 3T8KA 4A63B 2DVWA 4RLYA 2FO1E 3UTMA 3TWSA 4LNUD 2JABA 3B95A 2Y1LE 2PNNA 4DX5D 1N11A 4DX7D 5ENPD 5FINA 1NFIE 2QC9A 1K1BA 4J7WA 3ZU7B 4J8YA 4DX1A 3TWWA 5EIDA 1WG0A 5AQ7A 3ZNGA 3Q9NC 3F6QA 4U96D 2V5QC 5CEAA 3J5PA 1DCQA 2BKGA 3AJIA 1OT8A 4BEPA 3JUEA 4C48B 1YCSB 3JXIA 3TWVA 5CEDB 2B0OE 1MX6A 4QFVA 4ZFHA 3UI2A 5CECB 4DUIA 1BD8A 3NOGD 1G3NB 3ZKJA 4BSZB 4O1OA 5EYPF 2XEHA 3LJNA 2VGEA 4HRLA 5D66A 5JA4D 5CERB 3NOCD 3NBNB 4K5AB 2ZGGA 3D9HA 3TWUA 3TWXA 2F8XK 5ENOD 3UXGA 5KWDA 1BLXB 3J5QB 2V4HC 5ENSD 4F1PA 2Y0BG 5AQ9A 3T9KA 2P2CP 4HBDA 2F37A 4HI9A 4HQDA 4Z68A 4NIKA 5ENQD 4CZ2D 4F6RD 5ITZF 4G8LA 2XZDG 1MX2A 2ETBA 5EYLA 5EILA 1A5EA 1K1AA 1BU9A 5AQBA 3IXEA 3V31A 1UOHA 2L6BA 4OAVB 4OAUC 1MYOA 4ATZD 1AP7A 2NYJA 3AAAC 2BKKB 4HLLA 5ENRD 4ZHBA 2MYOA 2QYJA 3TWQA 1AWCB 4YDYA 4HI8A 5EIBE 2F8YA 5EN5D 4CYMD 1SW6A 1N0RA 4TUMA 4LG6A 5BXUA 3Q9UC 3EHQA 1OY3D 1YMPA 5AARA 4BERA 1IHBA 2AJAA 5CBOA 1IXVA 4U95D 2XZTG 4U8YD 3V30A 4HB5A 4HNAD 4JB8P 5ENTD 4QQIA
chains in the Genus database with same CATH superfamily
2ZIRA 4BETA 3UT4A 2KBXA 4GMRA 4I1AA 5DIZA 3OXFA 1N0QA 3FFLA 3B7BA 2XENA 4DRXE 3JQ0A 2HM8A 3EU9A 1X81A 2C0MA 4PUCA 3JXJA 2HE0A 4AIFA 3ZN3A 4GZCA 1N4SA 5FZRA 5A6CA 5T4YA 4G23A 1SZAA 3OAWA 3UINC 3T8KA 2PM6A 3D3MA 1OWMA 3SFYA 5FZQA 2GRLA 1K1BA 2R03A 3MA5A 2OV8A 3URZA 1S0PA 1G3NB 4WWPA 4DI3A 3CHMA 3EHNA 1SA5A 3BEEA 5ENSD 1Y6IA 5ENQD 1E8XA 4UQXA 4AXHA 1SA4A 2H6IA 3VLEA 4W9RA 3LY9A 1JWFA 2IF4A 4CT4A 3V31A 3SFXA 3AAAC 3AU5A 4GU5A 1SW6A 4DPRA 4GB9A 5EDSA 1YMPA 4JPSA 5FQ4A 3LKUA 1IXVA 1IHGA 2GRQB 1QQEA 5AYWD 2HR2A 1O1TA 3DSUA 3GYZA 4KVMA 3D9MA 3OXGA 3V79K 3O4ZA 4HLEA 1JWGA 4GTOA 3DEPA 2WXFA 1QNFA 4MS6A 1DC2A 3ABKE 2V4LA 3ZXPA 2I2OA 1VDYA 3SGHA 4GA2A 1ELRA 3B7RL 3FP3A 3CKCA 1E7UA 1Z3YA 3ABLE 4JEHA 1O1SA 4JZYA 4O6FA 3KSLA 2OVFA 3JCKC 4R7LA 2NC9A 3NOGD 3ESLA 3APCA 1HH8A 3LJNA 2LAHA 3FEXA 4F7AA 2ONDA 4CGWA 3NBNB 3CVPA 3GZSA 5FQ7A 4FA6A 4JD2G 4GAAA 3SI5A 1LD7A 3NQPA 4U0SA 4N5CA 2VGXA 4I6JA 4AP2A 3FTWA 4L2LA 1HE8A 1HFAA 4JW1A 2RG8A 4GYYA 3CVYA 1UOHA 2L6BA 3KAEA 4URKA 2MOWA 3ASGA 1TNUA 5EN5D 4AEZC 3C3QA 3SHFA 3BUAA 3LS8A 2AJAA 4BFRA 3EJNA 3EIJA 3SBTB 5ENTD 5KJNA 1OWLA 1IQRA 5LCWC 3WXXA 4XZ4A 4GPKA 3MJWA 1OCCE 4GCNA 3AG2E 3U4TA 4K5CA 4BESA 4N5QA 2OEWA 3VLFA 1BI8B 3NF1A 4BTBA 2FEZA 2WXPA 2B6CA 3CHRA 3TWSA 1FCHA 3I4GA 2YINA 4GZ6A 3FTXA 5DBKA 2BF0X 1WG0A 2XPZA 1Z5SC 3FDHA 3UMVA 2WM9A 1LD8A 2XHEA 2B0OE 3HXFA 4MKTA 3IHVA 3LVRE 2I6HA 2WXIA 3QKYA 2LSVA 3FTVA 5KJKA 3CHPA 1X5BA 3HXCA 4YVOA 4F1PA 3ZGQA 4WNFA 4I2WA 2AW6A 3I4RB 3DRAA 3IXEA 4B94A 3RSEG 5E76A 3VTYA 5ENRD 3CQCB 4AJWA 4LG6A 4N2SA 3IHYA 4HB5A 2IO2C 4J8EA 4QQIA 1DVPA 1N9AA 2LNIA 4K5BA 4GZ3A 4XKBA 4CEMA 2J09A 1MX4A 2DZNA 5CHEE 3FUNA 5J90A 3QAQA 3CKBA 2X38A 1E8YA 4WNGA 4KZCA 4Q96A 4CT0A 1QBQA 2PM7A 2VSYA 1TNYA 4LNUD 1UN9A 5BW8C 2J07A 5D0OD 3D9JA 4LEUA 3TJPA 4J6IA 3DSSA 5EX3A 5C2YA 5D0QD 3TWVA 1MX6A 3OTNA 2ZU6B 2CG3A 5CECB 4F53A 4AM9A 5EX0A 3Q49B 3QJZA 3TWXA 2F8XK 4FC8A 2DIWA 3ASDA 2P2CP 5G55A 1S64A 3CK9A 1TNZA 3SFZA 4KBQA 3ZIMA 3CV0A 1A5EA 3MV2B 2XGOA 3EIQC 2QFCA 3UIOC 4OVUA 3UM3A 4NQ0A 2IEJA 2LAIA 1EPUA 2IQCA 3T5VA 1SZ9A 1WM5A 4JB8P 5AJLA 2Y69E 4O1PA 3V2OA 3C3OA 3PNTB 2XQ0A 4B89A 2XCBA 4G25A 1SQMA 3IKOB 4GZDA 2HYZA 1MZCA 4GMLA 4UUCA 2ETAA 4WWNA 4GPMA 4BX8A 5CMYA 3LYAA 2FO1E 2XS8A 5ENPD 3TG5A 4ANVA 1IQUA 4J8SA 3ZNGA 3ML8A 3ASOE 4WUYA 3KSQA 1ZU2A 2R59A 1U3CA 4ANWA 3MKQA 2WB2A 3PS6A 3UI2A 2DBAA 5D66A 5CERB 5HQ8A 4JL0A 3TWUA 2WXOA 3FEYA 3AS5A 2P9IG 2VJ8A 4C0EA 4L23A 2P9PG 5EILA 2R5SA 1N94A 3UT8A 1DNPA 2KZTB 2KZTA 4D10C 4CDRA 1TJFA 5G05J 4HOUA 1HS6A 2EIKE 2AXZA 2PQRA 5CBOA 4FHJA 1RZ4A 5A23A 2RFMA 2VTBA 2YQ8A 2KATA 4I6GA 1N4RA 4EBAG 1N54A 5JHBA 1JUQA 2WMNA 3QOUA 1S70B 3D9LA 3CK7A 5LCWJ 4AY5A 2P9SG 3MX3A 1TNBA 3TWRA 2I9CA 3TWTA 4ACLA 4NACA 3G2TA 1HX8A 4BTAA 2RKKA 4RLYA 3APFA 3L13A 3CVLA 3B7UX 4XKCA 2V0PA 3AU4A 1D8EA 2XRYA 5EIDA 3ULYA 1GW6A 4RSYA 4C48B 1YCSB 3L82A 5CEDB 5JHAA 5JJ7A 4ATGA 2FF4A 2PL2A 2VGEA 3RU0A 4N3CA 1E96B 4P29A 2J4BA 2AVPA 4JHRA 2VSNA 4CDNA 2GRRB 5KWDA 1BLXB 4PS8A 4KVOA 3ZYQA 4UWKA 4WNDA 1INZA 4E6HA 4Y6WA 3EDTB 1E90A 2WXJA 4OAVB 3HVEA 4G24A 4HXIA 3ASFA 3ULQA 4XX5A 5FQ6A 5BPPA 2WXGA 2IY0C 1KT0A 1H2TC 2EINE 4DK5A 2VGYA 3QC1A 4I2ZA 2WXNA 3HVEB 5HS0A 3CK8A 3FUFA 5G04J 5CBNA 4DX2A 1U2VG 4APFA 2WXRA 2IU1A 3FU6A 5AQAA 5G2NA 4A3VA 1HG5A 2UY1B 1FVFA 5A7DB 4UWGA 5AN8A 3SZ7A 2X3MA 5JJ6A 4X8QA 4DLOA 3DSVA 3BU8A 3FU5A 4MBGA 2OCCE 4NURA 3CEQA 4J0UA 2GW1A 3SF4A 2VSOE 3L54A 1UN8A 3DSTA 4A55A 4DX1A 2IJGX 2H6FA 3I3NA 3X2QE 3BG1B 4GTRA 4QFVA 4I6EA 5IY5E 3MEKA 2MHKA 3ZYMA 4HQDA 2XZDG 2XGSA 5EYLA 1N4QA 3Q4AB 3ZPJA 3BQOA 1O1RA 3UKRG 3LEWA 2VTBB 4XI9A 2ZISA 4DLQA 4ZHBA 2FBNA 3ZYKA 5J08A 3T8MA 4XE0A 3EHQA 3CR3A 4EHMA 3V30A 3QWPA 2WQ7A 3R9AB 1XNFA 4YNDA 4C0MA 3ONLA 2WXQA 2LUHA 4I43A 4ABNA 3E33A 3UPVA 3EHRA 1Z6TA 1BI7B 5JMND 3PREA 2V5FA 5FIOA 4HFGA 2BEDA 4B8CB 3RO2A 2J49A 1N4PA 4ILHB 3O48A 1TEZA 3L17A 1N52A 1K3ZD 2KCLA 2Y4TA 4A63B 4FJYA 4EZJA 3D9IA 3LDZA 3ASNE 3MKQB 1D8DA 3DPDA 2KC7A 3ABME 4J8FA 3NAWA 5D2MC 2AXUA 3Q9NC 1JPLA 1UG3A 1DCQA 4UWLA 2ILRA 2UWJG 3OXLA 3RAUA 3DXMG 4EZLA 5BV0A 4XI0A 4UWHA 4LUNU 1MQSA 5KJLA 3FUKA 2JLBA 5AQ9A 4TUUA 4ANUA 4HI9A 5FQ8A 4EBAA 2ETBA 4HOQA 2E0IA 2E2EA 3LY7A 3SQVA 3ZFWA 2L6JA 3SBSA 2L9BA 4M7CA 4ILIA 2MYOA 1AWCB 5BT1A 2OVBA 4FU3A 3E30A 2P9KG 3FTYA 3R7QA 1TN6A 3E37A 4N39A 2P9UG 4BSXA 1U3DA 4FADA 3QNKA 2L0TB 5HI7A 4HRNA 5ARFA 3ZUVB 1OUVA 3MV3B 5C1DA 2J8SD 2DYSE 4KXKB 3UM2A 4CCAA 4UI9C 3HXEA 5BXOA 2X6IA 2XEEA 4LSZE 1ZB1A 4UWFA 4G8KA 3LXUX 1KLXA 3CVVA 2UY1A 3RK6A 2R05A 3HXBA 3DBSA 4EQFA 4XIFA 4CRWA 4U0ZA 2CG2A 1A17A 4ZFHA 4PDXA 2MRIA 1OCRE 4O1OA 3RIBA 4JXTA 3ULEG 5JA4D 3Q47B 4FLBA 1IYGA 5ENOD 1HG2A 4UQYA 2GRNB 3UT7A 2CHZA 3FTUA 3QARA 2PQNA 3QDNA 2XEVA 3MZLB 3EHMA 3CVQA 1WAO1 2L0IA 5ANLA 5ENNA 4LNGA 3C98A 4BT9A 2EIJE 4UI9J 2R17C 2WXHA 4BT8A 5CMWA 1V54E 5EIBE 4JHKA 4PS3A 3AG3E 3IBEA 3G2UA 4U95D 2EIME 1NZNA 3PZDA 1OWPA 3L08A 4U07A 3V2XA 3W9GA 3RRMB 5LOZA 3AS8A 3K9IA 2IOLA 4WWOA 3SO8A 1OWOA 4JA7A 4GZ5A 4JEUA 5G05C 2XRZA 1HU3A 4H7YA 4L9PA 4N3AA 4ACKA 2XS1A 4BWRA 2I1JA 1WDYA 3MKRA 3DEOA 4GTMA 4U8VD 2CFUA 1ZBPA 1FVHA 3HHMA 5B1BE 4U7EB 3WG7E 4UI9K 5JJTA 4HOTA 2VQ2A 2DCPA 3PH0C 4AV7A 3TWWA 3F6QA 1NL4A 1KPSB 3D9NA 3PUJA 3FUEA 3AS4A 2OOEA 4OYSA 3LY8A 1YA0A 2A5UA 1NP7A 4K5AB 4U8HA 2BTDA 4PS7A 2ZXWE 5AIJA 1FT2A 3LJ3A 3DWLG 3FUDA 2XPYA 3LPZA 3TL5A 4FULA 3U3WA 1KZOA 5AQBA 3PZ3A 1P5QA 5ARGA 1AP7A 2NYJA 1H2VC 4HI8A 4GTQA 3L22A 4E85A 5T8IA 2XZTG 4ME2A 4F3VA 2J9QA 3CLJA 5M72A 2ETCA 1IKND 4YDWA 3CSFA 3FH5A 2J4DA 4WAFA 2XPIA 3UIPC 2VGXB 3FU3A 4N2QA 4GA1A 3CVNA 3Q7FA 5KNGA 3CVUA 3W9FA 3FH7A 2NXPA 2KCVA 3FUIA 3JQ1A 3VTXA 2X6JA 5B1AE 2EQXA 2YNQA 3G2VA 3PZ4A 3SY2A 3TG4A 2J08A 1OWNA 3ENEA 2CFZA 2Y1LE 3RKVA 1N11A 4DX7D 4C9BB 2C0LA 1NFIE 5AQ7A 3TXNA 3KEZA 5FJYA 3PRZA 2X6KA 4GTPA 4IYPA 4U0UA 4BX9A 3S7JA 3ML9A 2XEHA 2R02A 4GYOA 4PH4B 3ONKA 3UXGA 3E4BA 1FPPA 5LX8A 1HF8A 1NA3A 3RRNB 4F6RD 4G8LA 3G2WA 1MX2A 3FH8A 1V55E 4B0ZA 3FWVA 1K8KG 3MGBA 4KT6B 5FZSA 2FO7A 4J8DA 4I9EA 3FU0A 2F8YA 3Q73A 5BV1A 1TJCA 4TXPA 5BXUA 1OY3D 3IEGA 4EZKA 4JHJA 2P58C 4HNAD 3CQGB 3R7RA 4NRHB 3D9KA 4K0RA 4LERA 3PZ2A 4APOA 2P9LG 2ZGDA 1RW2A 3PEVB 2DZOA 2CHWA 4O60A 5BUZA 1D9SA 2NSZA 3CSTA 3UTMA 2JABA 3ZVVA 3HYMB 1O5MA 2KCKA 1H19A 1S63A 3LCAA 3UUXA 2PZIA 4BEPA 3JUEA 1ELWA 4ANXA 2WMOA 1BD8A 1TN8A 1NA0A 3PNLB 4BSZB 3Q5MA 3EU5A 5CCMA 3DXKG 3GZ2A 4I1OB 3GW4A 4WNEA 4K03A 1E7VA 3D9HA 2IFUA 4FLHA 1HO8A 3PDNA 4GTVA 3S7BA 3GZ1A 4HBDA 4YVQC 1EDUA 3ISMC 1JCRA 2OEVA 1ELKA 4IULA 2HO1A 4H7XA 1EYHA 4A1GA 2H6HA 5LP0A 1LTXA 3L6AA 4ATZD 4JA9A 2GRPB 3QK0A 3Q75A 4A1SA 4HVBA 3ZHEB 3Q9UC 4BERA 1IHBA 1Y8MA 2Q7FA 4MRUA 3G2SA 4U8YD 4GMJA 3FY4A 2WVIA 1H2UA 2VYIA 4XEIG 4AOFA 1PY1A 4Y6CA 2A5EA 4FHKA 4ILGA 2WQ6A 5AJDA 1E8ZA 5AAOA 1QYMA 3CVWA 4UQZA 1HXIA 3CHQA 4OVVA 4FJZA 4CDMA 3KS2A 3KEAA 3ZW3A 5KBAA 5E75A 5EKQD 4EECA 2A4ZA 4N3BA 3ASHA 4RG9A 4V3IA 3ESKA 5CCLA 2QC9A 3ZU7B 1OCOE 3FUHA 5CRUA 3CVXA 4U96D 3HDXA 4U63A 3TXMA 3J5PA 5CEAA 2BKGA 3AJIA 3I5PA 3JXIA 5BNWA 3S7DA 2AXVA 2XGMA 3NZUA 1H6PA 2ZGGA 5B3SE 2QY7A 4YDOA 4TV3A 3J5QB 2V4HC 2F37A 1PC2A 5ITZF 3L16A 5FWQA 3ZRHA 2M63A 4IN3B 1L5JA 3FTZA 1BU9A 1OXJA 4GTTA 4HOSA 3PE4A 5FTPA 3T5XA 3JYSA 4HLLA 3B7TA 2QYJA 2EILE 1TNOA 3NB2A 3CIAA 4YDEA 1Q2ZA 4L1BA 4I9CA 4B93B 3UQ3A 4GYWA 5KJMA 2KM4A 3B7SA 5CRVA 3QWWA 2Y3AA 5HKPA 4HRMB 3SD5A 4JC8A 3AG1E 3APDA 4LNBA 1YYHA 2QZAA 3QWVA 4HS2A 1MHQA 4F1SA 3FTSA 2DVWA 4LRZA 3B95A 4TRQA 1UW4B 3HIZA 4KMOA 3Q7AA 2V5QC 3FUJA 2WXLA 2WQHA 2GRMA 3PUKA 5KCMA 1N95A 3CHOA 3PVLA 2Y4UA 1JCSA 4DUIA 2DYRE 3UM1A 3ZKJA 1DCEA 3TAXA 2GGFA 3Q79A 4HRLA 2X6FA 4GA0A 1NI1A 3D9OA 3PZ1A 3ZHEA 3T9KA 4IRUA 3ZYLA 3PEUB 4Q69A 3CGHA 1OCZE 4U04A 3FHEA 4HORA 4KYOB 3RJVA 4AY6A 3P2BA 4TUMA 1UJJA 5AARA 3B13A 4Q94A 2IO3C 1QZ2A 1XGWA 1H0AA 2VSXE 1KT1A 2YHCA 5KNHD 4M3OA 2KXPC 2XCCA 2LO6A 3C5RA 2I1KA 3HG0D 1TYQG 2LSUA 3QB2A 4RG6A 2R2LA 3HRAA 1BPOA 4L7TA 2P9NG 1TR4A 2DWZA 5FT9A 3RRUA 1TN7A 5HRYA 2LXLA 2PNNA 5G04C 1KZPA 3JUIA 3HXDA 3N71A 5FINA 3E32A 3Q78A 2JEKA 4J8YA 4JVSA 4CGVA 4B8AA 1OT8A 3IV0A 1E8WA 3E34A 1H6OA 3BG0B 4I17A 3C3RA 3LVQE 5H7PA 4I1MA 5LFAA 5ANRA 3ZXSA 3DSXA 3S2AA 2Y0BG 1EF1C 2AWIA 2BUGA 3UKUG 3R9MA 1WY6A 1UJKA 1PAQA 4L2YA 3U9WA 3C72A 1K1AA 1MYOA 3AG4E 3P1UA 2BKKB 3TWQA 2WXKA 4YDYA 3FULA 4CYMD 1N0RA 3FUMA 2WPVA 3EUVA 4AVXA 3TGOA 1MJ0A 2IOSA 3CHSA 4A3TA 3ZEFA 4TXQA 1SVXA 3KD7A 3U66A 2RFAA 3UX4A 2CHXA 3UM0A 3L9TA 2WXMA 4RQIA 4DX6D 3NZSA 4BY6A 2YHEA 4G11A 1B89A 3RO3A 2IONA 1W3BA 4DX5D 1HZ4A 2FI7A 2F0YA 4J7WA 5AENA 2GROB 2FULA 1Z3XA 4G2VA 5T3RA 1FT1A 3Q15A 3PE3A 4GTSA 5EYPF 4RVBA 4EPZA 2V8SE 3NOCD 1JCQA 3DSWA 4G26A 4DI4A 4Z68A 4DJAA 3MCXA 4NIKA 4CZ2D 2LXMA 4KZ0A 2C2LA 3MYVA 2RD0A 4G1TA 3VLDA 4FP7A 3U64A 3SNXA 4OAUC 2QYUA 1H6KA 3DPYA 2H6GA 1LF8A 3D9PA 4LCTA 4MLPA 4GCOA 4TXRA 2X6HA 3S7FA
chains in the Genus database with same CATH topology
2RFMA 2ETCA 1MJ0A 5HS0A 1IKND 4YDWA 4BETA 5CBNA 2KBXA 4GMRA 4B93B 3V2XA 3W9GA 5KNHD 3ZUVB 4HRNA 4DX2A 4K5BA 1N0QA 2KXPC 3B7BA 2XENA 4O1PA 4DRXE 5HKPA 5AQAA 1MX4A 1SVXA 3V2OA 3V79K 2A5EA 3EU9A 4HRMB 2DZNA 3C5RA 3EHRA 4K5CA 5KNGA 3SO8A 4BESA 2RFAA 3HG0D 1BI7B 1S70B 3W9FA 1QYMA 2ZGDA 4N5QA 3DEPA 2J8SD 3JXJA 5AAOA 2HE0A 5JMND 5AN8A 5FIOA 1YYHA 3HRAA 5BXOA 2XEEA 2DZOA 4LSZE 3TWRA 1WDYA 4DX6D 4U8VD 3DEOA 3TWTA 1DC2A 4G8KA 1TR4A 4UUCA 1BI8B 2ETAA 2DWZA 3KEAA 4GPMA 1K3ZD 4O60A 5KBAA 1D9SA 5HRYA 3T8KA 4A63B 2DVWA 4RLYA 2FO1E 3UTMA 3TWSA 4LNUD 2JABA 3B95A 2Y1LE 2PNNA 4DX5D 1N11A 4DX7D 5ENPD 5FINA 1NFIE 2QC9A 1K1BA 4J7WA 3ZU7B 4J8YA 4DX1A 3TWWA 5EIDA 1WG0A 5AQ7A 3ZNGA 3Q9NC 3F6QA 4U96D 2V5QC 5CEAA 3J5PA 1DCQA 2BKGA 3AJIA 1OT8A 4BEPA 3JUEA 4C48B 1YCSB 3JXIA 3TWVA 5CEDB 2B0OE 1MX6A 4QFVA 4ZFHA 3UI2A 5CECB 4DUIA 1BD8A 3NOGD 1G3NB 3ZKJA 4BSZB 4O1OA 5EYPF 2XEHA 3LJNA 2VGEA 4HRLA 5D66A 5JA4D 5CERB 3NOCD 3NBNB 4K5AB 2ZGGA 3D9HA 3TWUA 3TWXA 2F8XK 5ENOD 3UXGA 5KWDA 1BLXB 3J5QB 2V4HC 5ENSD 4F1PA 2Y0BG 5AQ9A 3T9KA 2P2CP 4HBDA 2F37A 4HI9A 4HQDA 4Z68A 4NIKA 5ENQD 4CZ2D 4F6RD 5ITZF 4G8LA 2XZDG 1MX2A 2ETBA 5EYLA 5EILA 1A5EA 1K1AA 1BU9A 5AQBA 3IXEA 3V31A 1UOHA 2L6BA 4OAVB 4OAUC 1MYOA 4ATZD 1AP7A 2NYJA 3AAAC 2BKKB 4HLLA 5ENRD 4ZHBA 2MYOA 2QYJA 3TWQA 1AWCB 4YDYA 4HI8A 5EIBE 2F8YA 5EN5D 4CYMD 1SW6A 1N0RA 4TUMA 4LG6A 5BXUA 3Q9UC 3EHQA 1OY3D 1YMPA 5AARA 4BERA 1IHBA 2AJAA 5CBOA 1IXVA 4U95D 2XZTG 4U8YD 3V30A 4HB5A 4HNAD 4JB8P 5ENTD 4QQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RFM A;  2ETC A;  1MJ0 A;  5HS0 A;  1IKN D;  4YDW A;  4BET A;  5CBN A;  2KBX A;  4GMR A;  4B93 B;  3V2X A;  3W9G A;  5KNH D;  3ZUV B;  4HRN A;  4DX2 A;  4K5B A;  1N0Q A;  2KXP C;  3B7B A;  2XEN A;  4O1P A;  4DRX E;  5HKP A;  5AQA A;  1MX4 A;  1SVX A;  3V2O A;  3V79 K;  2A5E A;  3EU9 A;  4HRM B;  2DZN A;  3C5R A;  3EHR A;  4K5C A;  5KNG A;  3SO8 A;  4BES A;  2RFA A;  3HG0 D;  1BI7 B;  1S70 B;  3W9F A;  1QYM A;  2ZGD A;  4N5Q A;  3DEP A;  2J8S D;  3JXJ A;  5AAO A;  2HE0 A;  5JMN D;  5AN8 A;  5FIO A;  1YYH A;  3HRA A;  5BXO A;  2XEE A;  2DZO A;  4LSZ E;  3TWR A;  1WDY A;  4DX6 D;  4U8V D;  3DEO A;  3TWT A;  1DC2 A;  4G8K A;  1TR4 A;  4UUC A;  1BI8 B;  2ETA A;  2DWZ A;  3KEA A;  4GPM A;  1K3Z D;  4O60 A;  5KBA A;  1D9S A;  5HRY A;  3T8K A;  4A63 B;  2DVW A;  4RLY A;  2FO1 E;  3UTM A;  3TWS A;  4LNU D;  2JAB A;  3B95 A;  2Y1L E;  2PNN A;  4DX5 D;  1N11 A;  4DX7 D;  5ENP D;  5FIN A;  1NFI E;  2QC9 A;  1K1B A;  4J7W A;  3ZU7 B;  4J8Y A;  4DX1 A;  3TWW A;  5EID A;  1WG0 A;  5AQ7 A;  3ZNG A;  3Q9N C;  3F6Q A;  4U96 D;  2V5Q C;  5CEA A;  3J5P A;  1DCQ A;  2BKG A;  3AJI A;  1OT8 A;  4BEP A;  3JUE A;  4C48 B;  1YCS B;  3JXI A;  3TWV A;  5CED B;  2B0O E;  1MX6 A;  4QFV A;  4ZFH A;  3UI2 A;  5CEC B;  4DUI A;  1BD8 A;  3NOG D;  1G3N B;  3ZKJ A;  4BSZ B;  4O1O A;  5EYP F;  2XEH A;  3LJN A;  2VGE A;  4HRL A;  5D66 A;  5JA4 D;  5CER B;  3NOC D;  3NBN B;  4K5A B;  2ZGG A;  3D9H A;  3TWU A;  3TWX A;  2F8X K;  5ENO D;  3UXG A;  5KWD A;  1BLX B;  3J5Q B;  2V4H C;  5ENS D;  4F1P A;  2Y0B G;  5AQ9 A;  3T9K A;  2P2C P;  4HBD A;  2F37 A;  4HI9 A;  4HQD A;  4Z68 A;  4NIK A;  5ENQ D;  4CZ2 D;  4F6R D;  5ITZ F;  4G8L A;  2XZD G;  1MX2 A;  2ETB A;  5EYL A;  5EIL A;  1A5E A;  1K1A A;  1BU9 A;  5AQB A;  3IXE A;  3V31 A;  1UOH A;  2L6B A;  4OAV B;  4OAU C;  1MYO A;  4ATZ D;  1AP7 A;  2NYJ A;  3AAA C;  2BKK B;  4HLL A;  5ENR D;  4ZHB A;  2MYO A;  2QYJ A;  3TWQ A;  1AWC B;  4YDY A;  4HI8 A;  5EIB E;  2F8Y A;  5EN5 D;  4CYM D;  1SW6 A;  1N0R A;  4TUM A;  4LG6 A;  5BXU A;  3Q9U C;  3EHQ A;  1OY3 D;  1YMP A;  5AAR A;  4BER A;  1IHB A;  2AJA A;  5CBO A;  1IXV A;  4U95 D;  2XZT G;  4U8Y D;  3V30 A;  4HB5 A;  4HNA D;  4JB8 P;  5ENT D;  4QQI A; 
#chains in the Genus database with same CATH topology
 2ZIR A;  4BET A;  3UT4 A;  2KBX A;  4GMR A;  4I1A A;  5DIZ A;  3OXF A;  1N0Q A;  3FFL A;  3B7B A;  2XEN A;  4DRX E;  3JQ0 A;  2HM8 A;  3EU9 A;  1X81 A;  2C0M A;  4PUC A;  3JXJ A;  2HE0 A;  4AIF A;  3ZN3 A;  4GZC A;  1N4S A;  5FZR A;  5A6C A;  5T4Y A;  4G23 A;  1SZA A;  3OAW A;  3UIN C;  3T8K A;  2PM6 A;  3D3M A;  1OWM A;  3SFY A;  5FZQ A;  2GRL A;  1K1B A;  2R03 A;  3MA5 A;  2OV8 A;  3URZ A;  1S0P A;  1G3N B;  4WWP A;  4DI3 A;  3CHM A;  3EHN A;  1SA5 A;  3BEE A;  5ENS D;  1Y6I A;  5ENQ D;  1E8X A;  4UQX A;  4AXH A;  1SA4 A;  2H6I A;  3VLE A;  4W9R A;  3LY9 A;  1JWF A;  2IF4 A;  4CT4 A;  3V31 A;  3SFX A;  3AAA C;  3AU5 A;  4GU5 A;  1SW6 A;  4DPR A;  4GB9 A;  5EDS A;  1YMP A;  4JPS A;  5FQ4 A;  3LKU A;  1IXV A;  1IHG A;  2GRQ B;  1QQE A;  5AYW D;  2HR2 A;  1O1T A;  3DSU A;  3GYZ A;  4KVM A;  3D9M A;  3OXG A;  3V79 K;  3O4Z A;  4HLE A;  1JWG A;  4GTO A;  3DEP A;  2WXF A;  1QNF A;  4MS6 A;  1DC2 A;  3ABK E;  2V4L A;  3ZXP A;  2I2O A;  1VDY A;  3SGH A;  4GA2 A;  1ELR A;  3B7R L;  3FP3 A;  3CKC A;  1E7U A;  1Z3Y A;  3ABL E;  4JEH A;  1O1S A;  4JZY A;  4O6F A;  3KSL A;  2OVF A;  3JCK C;  4R7L A;  2NC9 A;  3NOG D;  3ESL A;  3APC A;  1HH8 A;  3LJN A;  2LAH A;  3FEX A;  4F7A A;  2OND A;  4CGW A;  3NBN B;  3CVP A;  3GZS A;  5FQ7 A;  4FA6 A;  4JD2 G;  4GAA A;  3SI5 A;  1LD7 A;  3NQP A;  4U0S A;  4N5C A;  2VGX A;  4I6J A;  4AP2 A;  3FTW A;  4L2L A;  1HE8 A;  1HFA A;  4JW1 A;  2RG8 A;  4GYY A;  3CVY A;  1UOH A;  2L6B A;  3KAE A;  4URK A;  2MOW A;  3ASG A;  1TNU A;  5EN5 D;  4AEZ C;  3C3Q A;  3SHF A;  3BUA A;  3LS8 A;  2AJA A;  4BFR A;  3EJN A;  3EIJ A;  3SBT B;  5ENT D;  5KJN A;  1OWL A;  1IQR A;  5LCW C;  3WXX A;  4XZ4 A;  4GPK A;  3MJW A;  1OCC E;  4GCN A;  3AG2 E;  3U4T A;  4K5C A;  4BES A;  4N5Q A;  2OEW A;  3VLF A;  1BI8 B;  3NF1 A;  4BTB A;  2FEZ A;  2WXP A;  2B6C A;  3CHR A;  3TWS A;  1FCH A;  3I4G A;  2YIN A;  4GZ6 A;  3FTX A;  5DBK A;  2BF0 X;  1WG0 A;  2XPZ A;  1Z5S C;  3FDH A;  3UMV A;  2WM9 A;  1LD8 A;  2XHE A;  2B0O E;  3HXF A;  4MKT A;  3IHV A;  3LVR E;  2I6H A;  2WXI A;  3QKY A;  2LSV A;  3FTV A;  5KJK A;  3CHP A;  1X5B A;  3HXC A;  4YVO A;  4F1P A;  3ZGQ A;  4WNF A;  4I2W A;  2AW6 A;  3I4R B;  3DRA A;  3IXE A;  4B94 A;  3RSE G;  5E76 A;  3VTY A;  5ENR D;  3CQC B;  4AJW A;  4LG6 A;  4N2S A;  3IHY A;  4HB5 A;  2IO2 C;  4J8E A;  4QQI A;  1DVP A;  1N9A A;  2LNI A;  4K5B A;  4GZ3 A;  4XKB A;  4CEM A;  2J09 A;  1MX4 A;  2DZN A;  5CHE E;  3FUN A;  5J90 A;  3QAQ A;  3CKB A;  2X38 A;  1E8Y A;  4WNG A;  4KZC A;  4Q96 A;  4CT0 A;  1QBQ A;  2PM7 A;  2VSY A;  1TNY A;  4LNU D;  1UN9 A;  5BW8 C;  2J07 A;  5D0O D;  3D9J A;  4LEU A;  3TJP A;  4J6I A;  3DSS A;  5EX3 A;  5C2Y A;  5D0Q D;  3TWV A;  1MX6 A;  3OTN A;  2ZU6 B;  2CG3 A;  5CEC B;  4F53 A;  4AM9 A;  5EX0 A;  3Q49 B;  3QJZ A;  3TWX A;  2F8X K;  4FC8 A;  2DIW A;  3ASD A;  2P2C P;  5G55 A;  1S64 A;  3CK9 A;  1TNZ A;  3SFZ A;  4KBQ A;  3ZIM A;  3CV0 A;  1A5E A;  3MV2 B;  2XGO A;  3EIQ C;  2QFC A;  3UIO C;  4OVU A;  3UM3 A;  4NQ0 A;  2IEJ A;  2LAI A;  1EPU A;  2IQC A;  3T5V A;  1SZ9 A;  1WM5 A;  4JB8 P;  5AJL A;  2Y69 E;  4O1P A;  3V2O A;  3C3O A;  3PNT B;  2XQ0 A;  4B89 A;  2XCB A;  4G25 A;  1SQM A;  3IKO B;  4GZD A;  2HYZ A;  1MZC A;  4GML A;  4UUC A;  2ETA A;  4WWN A;  4GPM A;  4BX8 A;  5CMY A;  3LYA A;  2FO1 E;  2XS8 A;  5ENP D;  3TG5 A;  4ANV A;  1IQU A;  4J8S A;  3ZNG A;  3ML8 A;  3ASO E;  4WUY A;  3KSQ A;  1ZU2 A;  2R59 A;  1U3C A;  4ANW A;  3MKQ A;  2WB2 A;  3PS6 A;  3UI2 A;  2DBA A;  5D66 A;  5CER B;  5HQ8 A;  4JL0 A;  3TWU A;  2WXO A;  3FEY A;  3AS5 A;  2P9I G;  2VJ8 A;  4C0E A;  4L23 A;  2P9P G;  5EIL A;  2R5S A;  1N94 A;  3UT8 A;  1DNP A;  2KZT B;  2KZT A;  4D10 C;  4CDR A;  1TJF A;  5G05 J;  4HOU A;  1HS6 A;  2EIK E;  2AXZ A;  2PQR A;  5CBO A;  4FHJ A;  1RZ4 A;  5A23 A;  2RFM A;  2VTB A;  2YQ8 A;  2KAT A;  4I6G A;  1N4R A;  4EBA G;  1N54 A;  5JHB A;  1JUQ A;  2WMN A;  3QOU A;  1S70 B;  3D9L A;  3CK7 A;  5LCW J;  4AY5 A;  2P9S G;  3MX3 A;  1TNB A;  3TWR A;  2I9C A;  3TWT A;  4ACL A;  4NAC A;  3G2T A;  1HX8 A;  4BTA A;  2RKK A;  4RLY A;  3APF A;  3L13 A;  3CVL A;  3B7U X;  4XKC A;  2V0P A;  3AU4 A;  1D8E A;  2XRY A;  5EID A;  3ULY A;  1GW6 A;  4RSY A;  4C48 B;  1YCS B;  3L82 A;  5CED B;  5JHA A;  5JJ7 A;  4ATG A;  2FF4 A;  2PL2 A;  2VGE A;  3RU0 A;  4N3C A;  1E96 B;  4P29 A;  2J4B A;  2AVP A;  4JHR A;  2VSN A;  4CDN A;  2GRR B;  5KWD A;  1BLX B;  4PS8 A;  4KVO A;  3ZYQ A;  4UWK A;  4WND A;  1INZ A;  4E6H A;  4Y6W A;  3EDT B;  1E90 A;  2WXJ A;  4OAV B;  3HVE A;  4G24 A;  4HXI A;  3ASF A;  3ULQ A;  4XX5 A;  5FQ6 A;  5BPP A;  2WXG A;  2IY0 C;  1KT0 A;  1H2T C;  2EIN E;  4DK5 A;  2VGY A;  3QC1 A;  4I2Z A;  2WXN A;  3HVE B;  5HS0 A;  3CK8 A;  3FUF A;  5G04 J;  5CBN A;  4DX2 A;  1U2V G;  4APF A;  2WXR A;  2IU1 A;  3FU6 A;  5AQA A;  5G2N A;  4A3V A;  1HG5 A;  2UY1 B;  1FVF A;  5A7D B;  4UWG A;  5AN8 A;  3SZ7 A;  2X3M A;  5JJ6 A;  4X8Q A;  4DLO A;  3DSV A;  3BU8 A;  3FU5 A;  4MBG A;  2OCC E;  4NUR A;  3CEQ A;  4J0U A;  2GW1 A;  3SF4 A;  2VSO E;  3L54 A;  1UN8 A;  3DST A;  4A55 A;  4DX1 A;  2IJG X;  2H6F A;  3I3N A;  3X2Q E;  3BG1 B;  4GTR A;  4QFV A;  4I6E A;  5IY5 E;  3MEK A;  2MHK A;  3ZYM A;  4HQD A;  2XZD G;  2XGS A;  5EYL A;  1N4Q A;  3Q4A B;  3ZPJ A;  3BQO A;  1O1R A;  3UKR G;  3LEW A;  2VTB B;  4XI9 A;  2ZIS A;  4DLQ A;  4ZHB A;  2FBN A;  3ZYK A;  5J08 A;  3T8M A;  4XE0 A;  3EHQ A;  3CR3 A;  4EHM A;  3V30 A;  3QWP A;  2WQ7 A;  3R9A B;  1XNF A;  4YND A;  4C0M A;  3ONL A;  2WXQ A;  2LUH A;  4I43 A;  4ABN A;  3E33 A;  3UPV A;  3EHR A;  1Z6T A;  1BI7 B;  5JMN D;  3PRE A;  2V5F A;  5FIO A;  4HFG A;  2BED A;  4B8C B;  3RO2 A;  2J49 A;  1N4P A;  4ILH B;  3O48 A;  1TEZ A;  3L17 A;  1N52 A;  1K3Z D;  2KCL A;  2Y4T A;  4A63 B;  4FJY A;  4EZJ A;  3D9I A;  3LDZ A;  3ASN E;  3MKQ B;  1D8D A;  3DPD A;  2KC7 A;  3ABM E;  4J8F A;  3NAW A;  5D2M C;  2AXU A;  3Q9N C;  1JPL A;  1UG3 A;  1DCQ A;  4UWL A;  2ILR A;  2UWJ G;  3OXL A;  3RAU A;  3DXM G;  4EZL A;  5BV0 A;  4XI0 A;  4UWH A;  4LUN U;  1MQS A;  5KJL A;  3FUK A;  2JLB A;  5AQ9 A;  4TUU A;  4ANU A;  4HI9 A;  5FQ8 A;  4EBA A;  2ETB A;  4HOQ A;  2E0I A;  2E2E A;  3LY7 A;  3SQV A;  3ZFW A;  2L6J A;  3SBS A;  2L9B A;  4M7C A;  4ILI A;  2MYO A;  1AWC B;  5BT1 A;  2OVB A;  4FU3 A;  3E30 A;  2P9K G;  3FTY A;  3R7Q A;  1TN6 A;  3E37 A;  4N39 A;  2P9U G;  4BSX A;  1U3D A;  4FAD A;  3QNK A;  2L0T B;  5HI7 A;  4HRN A;  5ARF A;  3ZUV B;  1OUV A;  3MV3 B;  5C1D A;  2J8S D;  2DYS E;  4KXK B;  3UM2 A;  4CCA A;  4UI9 C;  3HXE A;  5BXO A;  2X6I A;  2XEE A;  4LSZ E;  1ZB1 A;  4UWF A;  4G8K A;  3LXU X;  1KLX A;  3CVV A;  2UY1 A;  3RK6 A;  2R05 A;  3HXB A;  3DBS A;  4EQF A;  4XIF A;  4CRW A;  4U0Z A;  2CG2 A;  1A17 A;  4ZFH A;  4PDX A;  2MRI A;  1OCR E;  4O1O A;  3RIB A;  4JXT A;  3ULE G;  5JA4 D;  3Q47 B;  4FLB A;  1IYG A;  5ENO D;  1HG2 A;  4UQY A;  2GRN B;  3UT7 A;  2CHZ A;  3FTU A;  3QAR A;  2PQN A;  3QDN A;  2XEV A;  3MZL B;  3EHM A;  3CVQ A;  1WAO 1;  2L0I A;  5ANL A;  5ENN A;  4LNG A;  3C98 A;  4BT9 A;  2EIJ E;  4UI9 J;  2R17 C;  2WXH A;  4BT8 A;  5CMW A;  1V54 E;  5EIB E;  4JHK A;  4PS3 A;  3AG3 E;  3IBE A;  3G2U A;  4U95 D;  2EIM E;  1NZN A;  3PZD A;  1OWP A;  3L08 A;  4U07 A;  3V2X A;  3W9G A;  3RRM B;  5LOZ A;  3AS8 A;  3K9I A;  2IOL A;  4WWO A;  3SO8 A;  1OWO A;  4JA7 A;  4GZ5 A;  4JEU A;  5G05 C;  2XRZ A;  1HU3 A;  4H7Y A;  4L9P A;  4N3A A;  4ACK A;  2XS1 A;  4BWR A;  2I1J A;  1WDY A;  3MKR A;  3DEO A;  4GTM A;  4U8V D;  2CFU A;  1ZBP A;  1FVH A;  3HHM A;  5B1B E;  4U7E B;  3WG7 E;  4UI9 K;  5JJT A;  4HOT A;  2VQ2 A;  2DCP A;  3PH0 C;  4AV7 A;  3TWW A;  3F6Q A;  1NL4 A;  1KPS B;  3D9N A;  3PUJ A;  3FUE A;  3AS4 A;  2OOE A;  4OYS A;  3LY8 A;  1YA0 A;  2A5U A;  1NP7 A;  4K5A B;  4U8H A;  2BTD A;  4PS7 A;  2ZXW E;  5AIJ A;  1FT2 A;  3LJ3 A;  3DWL G;  3FUD A;  2XPY A;  3LPZ A;  3TL5 A;  4FUL A;  3U3W A;  1KZO A;  5AQB A;  3PZ3 A;  1P5Q A;  5ARG A;  1AP7 A;  2NYJ A;  1H2V C;  4HI8 A;  4GTQ A;  3L22 A;  4E85 A;  5T8I A;  2XZT G;  4ME2 A;  4F3V A;  2J9Q A;  3CLJ A;  5M72 A;  2ETC A;  1IKN D;  4YDW A;  3CSF A;  3FH5 A;  2J4D A;  4WAF A;  2XPI A;  3UIP C;  2VGX B;  3FU3 A;  4N2Q A;  4GA1 A;  3CVN A;  3Q7F A;  5KNG A;  3CVU A;  3W9F A;  3FH7 A;  2NXP A;  2KCV A;  3FUI A;  3JQ1 A;  3VTX A;  2X6J A;  5B1A E;  2EQX A;  2YNQ A;  3G2V A;  3PZ4 A;  3SY2 A;  3TG4 A;  2J08 A;  1OWN A;  3ENE A;  2CFZ A;  2Y1L E;  3RKV A;  1N11 A;  4DX7 D;  4C9B B;  2C0L A;  1NFI E;  5AQ7 A;  3TXN A;  3KEZ A;  5FJY A;  3PRZ A;  2X6K A;  4GTP A;  4IYP A;  4U0U A;  4BX9 A;  3S7J A;  3ML9 A;  2XEH A;  2R02 A;  4GYO A;  4PH4 B;  3ONK A;  3UXG A;  3E4B A;  1FPP A;  5LX8 A;  1HF8 A;  1NA3 A;  3RRN B;  4F6R D;  4G8L A;  3G2W A;  1MX2 A;  3FH8 A;  1V55 E;  4B0Z A;  3FWV A;  1K8K G;  3MGB A;  4KT6 B;  5FZS A;  2FO7 A;  4J8D A;  4I9E A;  3FU0 A;  2F8Y A;  3Q73 A;  5BV1 A;  1TJC A;  4TXP A;  5BXU A;  1OY3 D;  3IEG A;  4EZK A;  4JHJ A;  2P58 C;  4HNA D;  3CQG B;  3R7R A;  4NRH B;  3D9K A;  4K0R A;  4LER A;  3PZ2 A;  4APO A;  2P9L G;  2ZGD A;  1RW2 A;  3PEV B;  2DZO A;  2CHW A;  4O60 A;  5BUZ A;  1D9S A;  2NSZ A;  3CST A;  3UTM A;  2JAB A;  3ZVV A;  3HYM B;  1O5M A;  2KCK A;  1H19 A;  1S63 A;  3LCA A;  3UUX A;  2PZI A;  4BEP A;  3JUE A;  1ELW A;  4ANX A;  2WMO A;  1BD8 A;  1TN8 A;  1NA0 A;  3PNL B;  4BSZ B;  3Q5M A;  3EU5 A;  5CCM A;  3DXK G;  3GZ2 A;  4I1O B;  3GW4 A;  4WNE A;  4K03 A;  1E7V A;  3D9H A;  2IFU A;  4FLH A;  1HO8 A;  3PDN A;  4GTV A;  3S7B A;  3GZ1 A;  4HBD A;  4YVQ C;  1EDU A;  3ISM C;  1JCR A;  2OEV A;  1ELK A;  4IUL A;  2HO1 A;  4H7X A;  1EYH A;  4A1G A;  2H6H A;  5LP0 A;  1LTX A;  3L6A A;  4ATZ D;  4JA9 A;  2GRP B;  3QK0 A;  3Q75 A;  4A1S A;  4HVB A;  3ZHE B;  3Q9U C;  4BER A;  1IHB A;  1Y8M A;  2Q7F A;  4MRU A;  3G2S A;  4U8Y D;  4GMJ A;  3FY4 A;  2WVI A;  1H2U A;  2VYI A;  4XEI G;  4AOF A;  1PY1 A;  4Y6C A;  2A5E A;  4FHK A;  4ILG A;  2WQ6 A;  5AJD A;  1E8Z A;  5AAO A;  1QYM A;  3CVW A;  4UQZ A;  1HXI A;  3CHQ A;  4OVV A;  4FJZ A;  4CDM A;  3KS2 A;  3KEA A;  3ZW3 A;  5KBA A;  5E75 A;  5EKQ D;  4EEC A;  2A4Z A;  4N3B A;  3ASH A;  4RG9 A;  4V3I A;  3ESK A;  5CCL A;  2QC9 A;  3ZU7 B;  1OCO E;  3FUH A;  5CRU A;  3CVX A;  4U96 D;  3HDX A;  4U63 A;  3TXM A;  3J5P A;  5CEA A;  2BKG A;  3AJI A;  3I5P A;  3JXI A;  5BNW A;  3S7D A;  2AXV A;  2XGM A;  3NZU A;  1H6P A;  2ZGG A;  5B3S E;  2QY7 A;  4YDO A;  4TV3 A;  3J5Q B;  2V4H C;  2F37 A;  1PC2 A;  5ITZ F;  3L16 A;  5FWQ A;  3ZRH A;  2M63 A;  4IN3 B;  1L5J A;  3FTZ A;  1BU9 A;  1OXJ A;  4GTT A;  4HOS A;  3PE4 A;  5FTP A;  3T5X A;  3JYS A;  4HLL A;  3B7T A;  2QYJ A;  2EIL E;  1TNO A;  3NB2 A;  3CIA A;  4YDE A;  1Q2Z A;  4L1B A;  4I9C A;  4B93 B;  3UQ3 A;  4GYW A;  5KJM A;  2KM4 A;  3B7S A;  5CRV A;  3QWW A;  2Y3A A;  5HKP A;  4HRM B;  3SD5 A;  4JC8 A;  3AG1 E;  3APD A;  4LNB A;  1YYH A;  2QZA A;  3QWV A;  4HS2 A;  1MHQ A;  4F1S A;  3FTS A;  2DVW A;  4LRZ A;  3B95 A;  4TRQ A;  1UW4 B;  3HIZ A;  4KMO A;  3Q7A A;  2V5Q C;  3FUJ A;  2WXL A;  2WQH A;  2GRM A;  3PUK A;  5KCM A;  1N95 A;  3CHO A;  3PVL A;  2Y4U A;  1JCS A;  4DUI A;  2DYR E;  3UM1 A;  3ZKJ A;  1DCE A;  3TAX A;  2GGF A;  3Q79 A;  4HRL A;  2X6F A;  4GA0 A;  1NI1 A;  3D9O A;  3PZ1 A;  3ZHE A;  3T9K A;  4IRU A;  3ZYL A;  3PEU B;  4Q69 A;  3CGH A;  1OCZ E;  4U04 A;  3FHE A;  4HOR A;  4KYO B;  3RJV A;  4AY6 A;  3P2B A;  4TUM A;  1UJJ A;  5AAR A;  3B13 A;  4Q94 A;  2IO3 C;  1QZ2 A;  1XGW A;  1H0A A;  2VSX E;  1KT1 A;  2YHC A;  5KNH D;  4M3O A;  2KXP C;  2XCC A;  2LO6 A;  3C5R A;  2I1K A;  3HG0 D;  1TYQ G;  2LSU A;  3QB2 A;  4RG6 A;  2R2L A;  3HRA A;  1BPO A;  4L7T A;  2P9N G;  1TR4 A;  2DWZ A;  5FT9 A;  3RRU A;  1TN7 A;  5HRY A;  2LXL A;  2PNN A;  5G04 C;  1KZP A;  3JUI A;  3HXD A;  3N71 A;  5FIN A;  3E32 A;  3Q78 A;  2JEK A;  4J8Y A;  4JVS A;  4CGV A;  4B8A A;  1OT8 A;  3IV0 A;  1E8W A;  3E34 A;  1H6O A;  3BG0 B;  4I17 A;  3C3R A;  3LVQ E;  5H7P A;  4I1M A;  5LFA A;  5ANR A;  3ZXS A;  3DSX A;  3S2A A;  2Y0B G;  1EF1 C;  2AWI A;  2BUG A;  3UKU G;  3R9M A;  1WY6 A;  1UJK A;  1PAQ A;  4L2Y A;  3U9W A;  3C72 A;  1K1A A;  1MYO A;  3AG4 E;  3P1U A;  2BKK B;  3TWQ A;  2WXK A;  4YDY A;  3FUL A;  4CYM D;  1N0R A;  3FUM A;  2WPV A;  3EUV A;  4AVX A;  3TGO A;  1MJ0 A;  2IOS A;  3CHS A;  4A3T A;  3ZEF A;  4TXQ A;  1SVX A;  3KD7 A;  3U66 A;  2RFA A;  3UX4 A;  2CHX A;  3UM0 A;  3L9T A;  2WXM A;  4RQI A;  4DX6 D;  3NZS A;  4BY6 A;  2YHE A;  4G11 A;  1B89 A;  3RO3 A;  2ION A;  1W3B A;  4DX5 D;  1HZ4 A;  2FI7 A;  2F0Y A;  4J7W A;  5AEN A;  2GRO B;  2FUL A;  1Z3X A;  4G2V A;  5T3R A;  1FT1 A;  3Q15 A;  3PE3 A;  4GTS A;  5EYP F;  4RVB A;  4EPZ A;  2V8S E;  3NOC D;  1JCQ A;  3DSW A;  4G26 A;  4DI4 A;  4Z68 A;  4DJA A;  3MCX A;  4NIK A;  4CZ2 D;  2LXM A;  4KZ0 A;  2C2L A;  3MYV A;  2RD0 A;  4G1T A;  3VLD A;  4FP7 A;  3U64 A;  3SNX A;  4OAU C;  2QYU A;  1H6K A;  3DPY A;  2H6G A;  1LF8 A;  3D9P A;  4LCT A;  4MLP A;  4GCO A;  4TXR A;  2X6H A;  3S7F A; 
#chains in the Genus database with same CATH homology
 2RFM A;  2ETC A;  1MJ0 A;  5HS0 A;  1IKN D;  4YDW A;  4BET A;  5CBN A;  2KBX A;  4GMR A;  4B93 B;  3V2X A;  3W9G A;  5KNH D;  3ZUV B;  4HRN A;  4DX2 A;  4K5B A;  1N0Q A;  2KXP C;  3B7B A;  2XEN A;  4O1P A;  4DRX E;  5HKP A;  5AQA A;  1MX4 A;  1SVX A;  3V2O A;  3V79 K;  2A5E A;  3EU9 A;  4HRM B;  2DZN A;  3C5R A;  3EHR A;  4K5C A;  5KNG A;  3SO8 A;  4BES A;  2RFA A;  3HG0 D;  1BI7 B;  1S70 B;  3W9F A;  1QYM A;  2ZGD A;  4N5Q A;  3DEP A;  2J8S D;  3JXJ A;  5AAO A;  2HE0 A;  5JMN D;  5AN8 A;  5FIO A;  1YYH A;  3HRA A;  5BXO A;  2XEE A;  2DZO A;  4LSZ E;  3TWR A;  1WDY A;  4DX6 D;  4U8V D;  3DEO A;  3TWT A;  1DC2 A;  4G8K A;  1TR4 A;  4UUC A;  1BI8 B;  2ETA A;  2DWZ A;  3KEA A;  4GPM A;  1K3Z D;  4O60 A;  5KBA A;  1D9S A;  5HRY A;  3T8K A;  4A63 B;  2DVW A;  4RLY A;  2FO1 E;  3UTM A;  3TWS A;  4LNU D;  2JAB A;  3B95 A;  2Y1L E;  2PNN A;  4DX5 D;  1N11 A;  4DX7 D;  5ENP D;  5FIN A;  1NFI E;  2QC9 A;  1K1B A;  4J7W A;  3ZU7 B;  4J8Y A;  4DX1 A;  3TWW A;  5EID A;  1WG0 A;  5AQ7 A;  3ZNG A;  3Q9N C;  3F6Q A;  4U96 D;  2V5Q C;  5CEA A;  3J5P A;  1DCQ A;  2BKG A;  3AJI A;  1OT8 A;  4BEP A;  3JUE A;  4C48 B;  1YCS B;  3JXI A;  3TWV A;  5CED B;  2B0O E;  1MX6 A;  4QFV A;  4ZFH A;  3UI2 A;  5CEC B;  4DUI A;  1BD8 A;  3NOG D;  1G3N B;  3ZKJ A;  4BSZ B;  4O1O A;  5EYP F;  2XEH A;  3LJN A;  2VGE A;  4HRL A;  5D66 A;  5JA4 D;  5CER B;  3NOC D;  3NBN B;  4K5A B;  2ZGG A;  3D9H A;  3TWU A;  3TWX A;  2F8X K;  5ENO D;  3UXG A;  5KWD A;  1BLX B;  3J5Q B;  2V4H C;  5ENS D;  4F1P A;  2Y0B G;  5AQ9 A;  3T9K A;  2P2C P;  4HBD A;  2F37 A;  4HI9 A;  4HQD A;  4Z68 A;  4NIK A;  5ENQ D;  4CZ2 D;  4F6R D;  5ITZ F;  4G8L A;  2XZD G;  1MX2 A;  2ETB A;  5EYL A;  5EIL A;  1A5E A;  1K1A A;  1BU9 A;  5AQB A;  3IXE A;  3V31 A;  1UOH A;  2L6B A;  4OAV B;  4OAU C;  1MYO A;  4ATZ D;  1AP7 A;  2NYJ A;  3AAA C;  2BKK B;  4HLL A;  5ENR D;  4ZHB A;  2MYO A;  2QYJ A;  3TWQ A;  1AWC B;  4YDY A;  4HI8 A;  5EIB E;  2F8Y A;  5EN5 D;  4CYM D;  1SW6 A;  1N0R A;  4TUM A;  4LG6 A;  5BXU A;  3Q9U C;  3EHQ A;  1OY3 D;  1YMP A;  5AAR A;  4BER A;  1IHB A;  2AJA A;  5CBO A;  1IXV A;  4U95 D;  2XZT G;  4U8Y D;  3V30 A;  4HB5 A;  4HNA D;  4JB8 P;  5ENT D;  4QQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...