2DZNA

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
226
structure length
226
Chain Sequence
NYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Structural basis for the recognition between the regulatory particles Nas6 and Rpt3 of the yeast 26S proteasome
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 70
structure length 226
sequence length 226
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2dznA00
1OY3D 2Y1LE 5CEDB 2V4HC 3C5RA 3TWTA 5ENSD 4BSZB 2RFAA 4O1OA 2ETCA 5CBOA 4ZHBA 4BEPA 4GPMA 2XZTG 4BERA 2MYOA 5KWDA 3Q9NC 3ZUVB 5D66A 2ETAA 3JXJA 2NYJA 2F8YA 3JXIA 4DX2A 5JA4D 2A5EA 3J5QB 5KNGA 3J5PA 5AN8A 1UOHA 3DEPA 1MX4A 1IHBA 5JMND 3TWQA 5AQ9A 3TWWA 3NOGD 4U8YD 2RFMA 3UI2A 5EN5D 5FINA 3V30A 4UUCA 3ZU7B 4DX7D 5HS0A 3W9GA 1K1BA 3TWUA 2VGEA 4JB8P 3ZKJA 1BD8A 2ZGDA 3Q9UC 3DEOA 3D9HA 5EYPF 2DZNA 5AAOA 3EHRA 1MX2A 5HKPA 4BESA 5ENRD 1G3NB 1YMPA 3IXEA 5ENPD 1YCSB 5ITZF 1BU9A 1DCQA 2ETBA 2KXPC 2PNNA 5CECB 1NFIE 3HRAA 3B95A 2Y0BG 4HBDA 4NIKA 2HE0A 2QYJA 4QQIA 4A63B 5AQBA 2L6BA 5EIBE 1BI8B 4J8YA 3T9KA 5CBNA 4LG6A 2XEEA 2XZDG 3AJIA 4F1PA 4ZFHA 2DZOA 1D9SA 4J7WA 4Z68A 2XENA 4N5QA 4U96D 4YDWA 1A5EA 1WG0A 2XEHA 2F8XK 4HRMB 5KNHD 3V2OA 3EHQA 3V31A 3UTMA 2V5QC 4HRLA 4G8KA 4DX5D 4U8VD 4O1PA 4LSZE 3V2XA 3F6QA 4DRXE 1N0QA 5FIOA 4YDYA 4OAUC 1YYHA 4GMRA 2BKKB 2P2CP 4K5AB 4CZ2D 4TUMA 3UXGA 2QC9A 5EILA 4HI8A 2AJAA 3T8KA 3TWRA 3NOCD 4CYMD 2BKGA 1MJ0A 3B7BA 4DUIA 5EIDA 5ENQD 2JABA 3HG0D 1WDYA 1AP7A 1DC2A 4ATZD 4BETA 1K3ZD 4O60A 1BI7B 1N11A 1SVXA 5AARA 3TWVA 4HNAD 1BLXB 1MYOA 4U95D 4B93B 3JUEA 4DX1A 1MX6A 5BXUA 2F37A 2KBXA 3ZNGA 3TWXA 5ENTD 1S70B 1SW6A 3W9FA 3AAAC 4HI9A 4F6RD 5BXOA 4RLYA 2FO1E 4QFVA 4HLLA 4G8LA 5CERB 3LJNA 5HRYA 5ENOD 3SO8A 3V79K 1OT8A 4K5BA 3KEAA 1IXVA 2DWZA 1QYMA 5EYLA 4C48B 4HRNA 4K5CA 1TR4A 5CEAA 1N0RA 1K1AA 3TWSA 4LNUD 5AQ7A 2DVWA 4DX6D 2ZGGA 3NBNB 5AQAA 2B0OE 1AWCB 1IKND 2J8SD 3EU9A 4OAVB 4HB5A 4HQDA 5KBAA
chains in the Genus database with same CATH superfamily
5CEDB 3RRUA 1RZ4A 4YDEA 4O1OA 4GPMA 3BG0B 5D66A 2PM7A 1UW4B 3Q5MA 5JA4D 3MCXA 3HDXA 4TV3A 2YHCA 5JMND 4UWFA 3ZGQA 3ZU7B 1E7UA 4AV7A 1OCOE 2DZNA 1MX2A 3Q73A 1N95A 4ILIA 4LCTA 4AEZC 4I2WA 2J09A 2QZAA 1DCQA 2R59A 2CG3A 4BY6A 2QYJA 1MZCA 1L5JA 3FTYA 4ZFHA 1D9SA 3CKCA 3D9NA 4KBQA 2FEZA 2XRYA 5EX3A 5ARGA 4LSZE 2X6HA 3ASGA 1JWFA 4YDYA 4OAUC 3EIJA 4RSYA 3HHMA 3KEZA 4ATGA 2CHXA 5ENQD 2JABA 3PEUB 1KLXA 1TEZA 1RW2A 1BLXB 1KPSB 4FJZA 3RRMB 3FTSA 4RLYA 1S63A 3KAEA 3P2BA 4DI4A 4HVBA 2IOLA 4PS3A 4WWNA 2MHKA 4Y6WA 4I2ZA 3MV2B 4DLQA 3LY9A 3SFYA 4NRHB 4U0SA 4GTPA 1S64A 4EZKA 3RSEG 1FVHA 2LXLA 2OEVA 2WXOA 4MLPA 3PZ4A 1E96B 4E85A 2R03A 3BU8A 5CMYA 1N4QA 5J08A 1LD7A 4OVVA 1H19A 2X6FA 4IYPA 1QZ2A 2X6JA 2P9NG 1ZB1A 4YNDA 4TXPA 5E76A 2R05A 2WXJA 3FUJA 4NIKA 5CCMA 3UUXA 2JLBA 2XZDG 3D9MA 2YHEA 1ELKA 1E7VA 4J8FA 3PRZA 5M72A 4JEHA 4A55A 2XCBA 3ZN3A 4I17A 1NL4A 5BUZA 3ZXPA 2A5UA 3T8KA 4G1TA 2BKGA 4JPSA 4F53A 2MOWA 2GW1A 1MYOA 4U95D 5BXUA 4C0MA 3LJ3A 2KCVA 3ZYLA 1S70B 1OXJA 1DVPA 4HLLA 5CERB 3QAQA 3DXMG 1OWNA 1QYMA 2NXPA 4J8DA 3ENEA 3CVPA 4HB5A 4ACKA 4AJWA 2XZTG 3DXKG 2HR2A 4DK5A 1IHBA 5EN5D 3BQOA 3CK7A 3ZKJA 2WPVA 3CHPA 1BD8A 3BEEA 3EHRA 4OYSA 2IU1A 5ENRD 5BW8C 4KXKB 2XQ0A 3SI5A 3UPVA 3LDZA 5H7PA 2FI7A 2UWJG 2AXVA 2DCPA 3FP3A 4TUUA 5AIJA 2BF0X 1K8KG 3CSTA 4G2VA 1HH8A 2XGSA 3FTWA 2GRNB 4XEIG 3ZEFA 4HOSA 3C3OA 3ONLA 5J90A 2WVIA 4GA0A 4EECA 3E34A 3F6QA 1EF1C 2IEJA 2R2LA 3UMVA 2BKKB 4DLOA 5G2NA 3ZHEB 2RD0A 1DC2A 3NAWA 2L0TB 2GRRB 4UQZA 4BETA 1JUQA 3AAAC 1LTXA 2I1JA 5HI7A 4C9BB 4F6RD 3HXDA 5BXOA 3E30A 4CT0A 4GTRA 2WXMA 4WNFA 3IKOB 2L9BA 3V79K 3OAWA 2AW6A 4GMLA 3MKRA 3T5XA 2VGYA 4YVOA 4AVXA 2XGOA 3ZHEA 4OAVB 5D2MC 1N54A 5T3RA 2LAHA 3CHQA 3PUKA 3AU5A 5LOZA 3K9IA 3VLDA 1H6OA 3CKBA 1X81A 3JXIA 1N4PA 4BTBA 3UIOC 3DPYA 3HYMB 5FINA 4A3VA 1Z3YA 4WNEA 2WXQA 5BT1A 4HLEA 4DI3A 1TNZA 2NC9A 4M7CA 2KXPC 3MEKA 3VTYA 5EKQD 2UY1B 1BI8B 4J8YA 3T9KA 2I2OA 3B13A 4N5QA 4JC8A 2F8XK 3JQ1A 5KNHD 4XI0A 4GTTA 4U07A 3IHVA 3QDNA 4BT8A 1E8YA 5A7DB 3APDA 4FA6A 3ZYQA 3NOCD 2OVBA 2FF4A 3CVYA 1HF8A 4A3TA 3HG0D 4OVUA 3C3RA 3GW4A 4O60A 3I4GA 5LCWJ 2AVPA 4BFRA 2KBXA 4KZ0A 4N2QA 2VGXA 3D9PA 1JCSA 2QYUA 3UM2A 4C48B 2H6HA 3ASHA 2R17C 3NBNB 1EDUA 3ZPJA 2R5SA 4I9EA 5JJ7A 3CHSA 4HFGA 2MYOA 5A23A 4MS6A 4JHKA 4N5CA 4N2SA 4GU5A 3ASNE 2YINA 4JXTA 3UI2A 3LEWA 1FPPA 1D8EA 2JEKA 3HIZA 2GRLA 1E8WA 3IEGA 2IONA 1IQUA 4KVOA 3FEYA 3VLEA 5E75A 5EYPF 2IFUA 2B6CA 2J08A 4I1AA 4U8HA 1U3DA 2VSYA 2P9IG 3LYAA 4QQIA 4I9CA 4UI9K 4FLHA 4GAAA 3FY4A 3RIBA 1PAQA 1H6KA 3AJIA 2H6GA 3PEVB 4Z68A 1TN6A 1N94A 2P9KG 3V2OA 3EHQA 3B7SA 3EHNA 4AOFA 4CGWA 5CHEE 1ELWA 3AG1E 4H7XA 3S7DA 3GZ1A 5FWQA 3AG3E 1SZ9A 3JUEA 2PL2A 1UN9A 3TWXA 5FTPA 4L1BA 4UQYA 4URKA 3VTXA 5BV1A 2KZTA 4PS8A 1TR4A 1HU3A 4EZJA 1O5MA 3EDTB 2XPIA 2DVWA 1EPUA 4HQDA 5A6CA 5KBAA 1KZOA 3O48A 1FVFA 4BERA 3CSFA 3Q9NC 3ZUVB 4GYWA 3DWLG 2NYJA 4HXIA 3FDHA 3U66A 3WG7E 3UT4A 4N3CA 4B94A 2L6JA 3FUNA 4L2LA 4GZCA 1FCHA 2OOEA 5AAOA 1O1RA 4B8AA 2IOSA 5KJKA 3KSLA 3NB2A 3FUDA 5AJLA 2GRMA 4HBDA 5EIBE 2E2EA 1KT1A 1HXIA 1TNUA 1A5EA 1WG0A 1PC2A 3R7RA 3ULYA 3CK9A 2IO2C 4UWGA 4G8KA 1ELRA 5AJDA 2Y69E 2P2CP 4K5AB 3UXGA 4MKTA 5EILA 3D3MA 5IY5E 3FH5A 3D9OA 2LSVA 4ATZD 4AXHA 4M3OA 3E4BA 1AWCB 2WB2A 3PNTB 1N9AA 3MX3A 2VSOE 4DJAA 4WWOA 3X2QE 3L08A 1OT8A 1DCEA 1B89A 4HRNA 3N71A 2C0LA 5AQ7A 4DX6D 4CDMA 3PNLB 3QWPA 3CHOA 2E0IA 1LF8A 3TWTA 3L22A 2ETCA 3ZW3A 3PZ3A 5FQ4A 3ESKA 5CRUA 4XKBA 3PE3A 4GZ3A 3B7TA 2WXNA 4JVSA 2FBNA 5JJTA 4IRUA 4UUCA 2J4DA 4XX5A 3RRNB 2BEDA 3JUIA 3Q9UC 1TJFA 3CQCB 1QQEA 1YA0A 2AWIA 3AS8A 4ILHB 3C3QA 4FP7A 2X6KA 3FHEA 4A63B 2Y4TA 4CDNA 3R9MA 3DSSA 3ULQA 4L23A 3CVNA 2LSUA 4KMOA 4J8EA 3LKUA 4GMRA 2XRZA 4CZ2D 3RU0A 4Q69A 4TRQA 1O1TA 4CYMD 3AU4A 3PVLA 4UQXA 3TJPA 4NQ0A 1WAO1 4HNAD 1Z3XA 3LVRE 3RK6A 4GZ6A 3ZNGA 3PH0C 3FTUA 3S7FA 3L54A 1LD8A 3RO3A 4EQFA 2XS8A 2LXMA 2ZIRA 5CEAA 4GCOA 5ENNA 2ZGGA 4G25A 5AQAA 3S2AA 1XGWA 2PM6A 4E6HA 2RFAA 5CBOA 2EIJE 5KWDA 2ETAA 3JXJA 3LS8A 3FTVA 4XI9A 3FEXA 3LVQE 5BNWA 1HE8A 5B3SE 3NOGD 4JEUA 3RJVA 3CK8A 2EIME 2Y4UA 3ABME 2DBAA 4ILGA 4A1SA 4GCNA 3PDNA 3G2WA 1BU9A 1VDYA 2ETBA 5CECB 3NZSA 3B95A 4JHRA 2C0MA 1NI1A 2OEWA 2KM4A 2C2LA 3LY8A 2EIKE 2KCLA 3D9KA 4U7EB 3MYVA 1UN8A 4W9RA 1N4SA 3KS2A 3IV0A 1N0QA 3ASDA 4DRXE 1QBQA 4GB9A 3TAXA 3FH7A 1HFAA 1KT0A 4K03A 2FULA 4UWHA 1MJ0A 1TJCA 3AS5A 5ANLA 2Y3AA 3CIAA 1SVXA 1N11A 2ONDA 2KCKA 3Q15A 4MBGA 2VSNA 3LXUX 1Y8MA 3W9FA 4HI9A 2A4ZA 2NSZA 2KC7A 4CEMA 5HRYA 4NACA 5EYLA 3MJWA 3SBTB 2LNIA 3DRAA 2XS1A 3ZXSA 2V4HC 4BSZB 3MKQB 3OXGA 3UQ3A 4ABNA 3ZFWA 4N3BA 2RG8A 1H6PA 2IF4A 1E8XA 3QB2A 2OV8A 2CHWA 1JCQA 4GTSA 3ABKE 3OXFA 1PY1A 1UJJA 2YNQA 4KYOB 3MZLB 3U9WA 3TWUA 4GTQA 3D9HA 5DIZA 5HKPA 4HS2A 4GA2A 3G2VA 4ANWA 3FUIA 5ENPD 3MKQA 2EINE 2ZXWE 5G04J 1IHGA 2WXFA 2L6BA 4L7TA 2WXLA 4UWLA 3PZDA 4F1PA 2XPZA 4J7WA 2XENA 4GA1A 1HG2A 3SY2A 3UT8A 3FULA 5G04C 1YYHA 3D9IA 4TUMA 2XGMA 3FU6A 3EHMA 2AJAA 4UI9J 4U63A 3CHMA 1AP7A 3Q49B 5FQ7A 5AYWD 1K3ZD 4BX9A 4AM9A 2CFUA 2GRQB 3UIPC 2VGXB 3PZ1A 3ZRHA 4BX8A 2WQ6A 3AG4E 3G2SA 1OCCE 5ENOD 3SD5A 3SO8A 3DSUA 1N0RA 4IN3B 4LNUD 1H2UA 2XPYA 3SBSA 2EQXA 3UM0A 3ASFA 1E90A 1N52A 3Q7AA 3MGBA 4Q96A 5FJYA 4O6FA 4GMJA 4ANUA 3FWVA 4H7YA 1EYHA 2CFZA 3CVQA 4GPKA 3TXNA 4D10C 4GYOA 5DBKA 1HO8A 5LCWC 2GGFA 3FUFA 5D0QD 5B1BE 5T8IA 5EDSA 1NP7A 3IXEA 3UM3A 1HG5A 4ANXA 3U64A 5FQ6A 2V4LA 1TYQG 2WXIA 2F0YA 2HE0A 2PQRA 2WMOA 1OWPA 5CBNA 1XNFA 5C1DA 2PZIA 4U96D 3FH8A 4YDWA 3FUMA 2IO3C 2J4BA 2V5QC 4CDRA 3LPZA 3U4TA 4FJYA 4IULA 2Q7FA 4DPRA 4JL0A 1TNYA 3TGOA 4HI8A 5FZQA 3APCA 4J6IA 5JJ6A 2WQ7A 4PS7A 4XE0A 4RG9A 2HO1A 4ME2A 4HOUA 2F37A 4I6EA 2AXUA 3DPDA 2V5FA 2R02A 2WXGA 2KZTB 4EBAA 1OUVA 3O4ZA 5LP0A 4K5CA 3UT7A 3TXMA 1A17A 3UINC 1ZU2A 2WXRA 4XIFA 5HQ8A 2XCCA 2XHEA 3GYZA 4X8QA 2YQ8A 3CVVA 3QARA 4JW1A 3HXEA 1Y6IA 5HS0A 2GROB 4LNGA 3U3WA 3DEOA 4I43A 1Z6TA 4GZ5A 3CVWA 1YMPA 3Q78A 4LRZA 3ISMC 3T5VA 5ANRA 4U0UA 3NZUA 4U04A 4AIFA 3ASOE 5AQBA 1H2TC 2PQNA 2VYIA 3E37A 4J0UA 4U0ZA 1OWMA 1HS6A 3IBEA 4BSXA 2M63A 2LO6A 3V31A 2P9SG 4WNGA 4C0EA 1WM5A 4GTOA 3ESLA 3B7RL 3KD7A 3CEQA 1P5QA 3I5PA 4WUYA 3NF1A 3R9AB 4EHMA 3TWVA 5ARFA 3FUEA 4FLBA 3PS6A 1SW6A 3SQVA 2ZISA 3E33A 4HORA 3CVLA 4G8LA 4FU3A 1IXVA 3Q4AB 2J07A 1SZAA 4PUCA 4JA9A 5FT9A 1IKND 4AY6A 3SZ7A 3VLFA 2QY7A 4LERA 4WNDA 1BPOA 1H0AA 1UJKA 2WXPA 2CHZA 5G05J 5LX8A 5KNGA 5AN8A 2L0IA 3OXLA 4F3VA 3V30A 3GZ2A 3W9GA 1K1BA 3ML9A 3SHFA 2ZGDA 4AP2A 5G05C 1V55E 4Y6CA 2P9LG 1SQMA 4V3IA 5ITZF 1NFIE 3JCKC 3QK0A 1TN7A 2EILE 4LG6A 5JHBA 1QNFA 4BT9A 3Q7FA 5BPPA 3FFLA 3TG5A 2VJ8A 3V2XA 2I9CA 4G11A 3L82A 4JD2G 2CG2A 3T8MA 4YVQC 3UX4A 3FTXA 4DX1A 4APFA 3QC1A 3L16A 3P1UA 4RG6A 4QFVA 4PH4B 2FO7A 1E8ZA 3QNKA 1MHQA 1Q2ZA 3TWSA 1DNPA 3L9TA 3UKRG 2J8SD 5JHAA 3C5RA 3DSXA 4FC8A 5ENSD 3L17A 4F7AA 2WXHA 3J5QB 1WY6A 3J5PA 5B1AE 3QWWA 3AG2E 3DEPA 3KSQA 3SNXA 3CVXA 2RFMA 1H2VC 2P9PG 2DYRE 3ZVVA 3QJZA 1OWOA 3PE4A 3HXBA 1ZBPA 2WM9A 3EU5A 1G3NB 2VTBB 1OCZE 4EPZA 3HXCA 4I6JA 2PNNA 1HX8A 4J8SA 3HRAA 2Y0BG 3TG4A 4XKCA 4F1SA 1V54E 4LNBA 1GW6A 2XEHA 2IY0C 3ULEG 4HRLA 2OVFA 1SA4A 4U8VD 2V0PA 4WAFA 4GZDA 2VTBA 3ML8A 3PREA 2H6FA 3LCAA 3B7BA 4BWRA 5T4YA 3SF4A 3FTZA 4LUNU 2X3MA 4MRUA 4GTVA 3BG1B 3LJNA 3KEAA 2DWZA 4HOTA 1JCRA 4FULA 4GYYA 3QOUA 3DBSA 3D9LA 3EU9A 3SFZA 1Z5SC 1INZA 4CRWA 2QFCA 3GZSA 4KVMA 3HVEB 3G2UA 4I1MA 4RVBA 3Q75A 2X6IA 1MX4A 3TWQA 5AQ9A 3TWWA 5KJLA 4G24A 3C98A 2KATA 2LUHA 3JYSA 3SFXA 4I6GA 1YCSB 4BTAA 2HM8A 4EBAG 3HVEA 5KJMA 1U2VG 3ZIMA 3FUHA 3L6AA 5D0OD 4G23A 3NQPA 3RKVA 3QKYA 3I4RB 3CVUA 2IQCA 2QC9A 3TWRA 1MQSA 1WDYA 1SA5A 1N4RA 2GRPB 4JA7A 1NA0A 5AARA 2LAIA 1JWGA 5EX0A 5FZRA 4Q94A 1D8DA 2I6HA 3ZYKA 1JPLA 5AENA 5CRVA 2WQHA 4L2YA 5FQ8A 1OCRE 1KZPA 4AY5A 3HXFA 1FT1A 3QWVA 2MRIA 2Y1LE 3FU5A 4ACLA 2XEVA 4WWPA 2DIWA 1FT2A 2HYZA 2VQ2A 2F8YA 1NZNA 3FUKA 2A5EA 3PZ2A 4UI9C 2WMNA 1IQRA 4A1GA 4N39A 3IHYA 4I1OB 4K0RA 2VGEA 4JB8P 3CQGB 5C2YA 4BESA 5CMWA 3DSTA 4FHJA 4UWKA 1O1SA 3E32A 3MA5A 2H6IA 2RKKA 4GTMA 2UY1A 2ILRA 4B0ZA 2DZOA 4FHKA 4JHJA 1HZ4A 3L13A 2WXKA 3SGHA 4DX5D 2V8SE 4R7LA 3AS4A 3FU0A 3I3NA 3ONKA 2J9QA 4PDXA 3JQ0A 5EIDA 3ZYMA 3DSWA 5CCLA 4P29A 1BI7B 5KCMA 1MX6A 3DSVA 5G55A 4NURA 1W3BA 2FO1E 4N3AA 1NA3A 2P9UG 1K1AA 2IJGX 4KT6B 2B0OE 1OY3D 4G26A 3RAUA 3D9JA 4HOQA 3CR3A 4TXQA 2J49A 4ZHBA 4BEPA 4B89A 2DYSE 3WXXA 3EUVA 4DX2A 4YDOA 3TL5A 3Q47B 2X38A 1UOHA 3FU3A 1IYGA 4U8YD 3URZA 2AXZA 1X5BA 3CGHA 3PUJA 4DX7D 3CLJA 3EIQC 4FADA 1TNOA 5LFAA 3BUAA 3ABLE 2P58C 3B7UX 4TXRA 4JZYA 3S7JA 4KZCA 1TNBA 3R7QA 4CCAA 4CGVA 2XEEA 4XZ4A 5KJNA 3CV0A 4HRMB 4RQIA 2VSXE 3Q79A 3UTMA 4O1PA 3C72A 5FIOA 2I1KA 3CHRA 2OCCE 3UKUG 5BV0A 4DUIA 4APOA 1TN8A 3UM1A 1OWLA 1UG3A 4B93B 5FZSA 3S7BA 4B8CB 2ZU6B 5ENTD 3G2TA 2BTDA 4EZLA 3OTNA 4CT4A 2BUGA 3LY7A 1S0PA 4LEUA 3EJNA 4K5BA 1U3CA 4L9PA 3APFA 3RO2A 3MV3B 4ANVA
chains in the Genus database with same CATH topology
1OY3D 2Y1LE 5CEDB 2V4HC 3C5RA 3TWTA 5ENSD 4BSZB 2RFAA 4O1OA 2ETCA 5CBOA 4ZHBA 4BEPA 4GPMA 2XZTG 4BERA 2MYOA 5KWDA 3Q9NC 3ZUVB 5D66A 2ETAA 3JXJA 2NYJA 2F8YA 3JXIA 4DX2A 5JA4D 2A5EA 3J5QB 5KNGA 3J5PA 5AN8A 1UOHA 3DEPA 1MX4A 1IHBA 5JMND 3TWQA 5AQ9A 3TWWA 3NOGD 4U8YD 2RFMA 3UI2A 5EN5D 5FINA 3V30A 4UUCA 3ZU7B 4DX7D 5HS0A 3W9GA 1K1BA 3TWUA 2VGEA 4JB8P 3ZKJA 1BD8A 2ZGDA 3Q9UC 3DEOA 3D9HA 5EYPF 2DZNA 5AAOA 3EHRA 1MX2A 5HKPA 4BESA 5ENRD 1G3NB 1YMPA 3IXEA 5ENPD 1YCSB 5ITZF 1BU9A 1DCQA 2ETBA 2KXPC 2PNNA 5CECB 1NFIE 3HRAA 3B95A 2Y0BG 4HBDA 4NIKA 2HE0A 2QYJA 4QQIA 4A63B 5AQBA 2L6BA 5EIBE 1BI8B 4J8YA 3T9KA 5CBNA 4LG6A 2XEEA 2XZDG 3AJIA 4F1PA 4ZFHA 2DZOA 1D9SA 4J7WA 4Z68A 2XENA 4N5QA 4U96D 4YDWA 1A5EA 1WG0A 2XEHA 2F8XK 4HRMB 5KNHD 3V2OA 3EHQA 3V31A 3UTMA 2V5QC 4HRLA 4G8KA 4DX5D 4U8VD 4O1PA 4LSZE 3V2XA 3F6QA 4DRXE 1N0QA 5FIOA 4YDYA 4OAUC 1YYHA 4GMRA 2BKKB 2P2CP 4K5AB 4CZ2D 4TUMA 3UXGA 2QC9A 5EILA 4HI8A 2AJAA 3T8KA 3TWRA 3NOCD 4CYMD 2BKGA 1MJ0A 3B7BA 4DUIA 5EIDA 5ENQD 2JABA 3HG0D 1WDYA 1AP7A 1DC2A 4ATZD 4BETA 1K3ZD 4O60A 1BI7B 1N11A 1SVXA 5AARA 3TWVA 4HNAD 1BLXB 1MYOA 4U95D 4B93B 3JUEA 4DX1A 1MX6A 5BXUA 2F37A 2KBXA 3ZNGA 3TWXA 5ENTD 1S70B 1SW6A 3W9FA 3AAAC 4HI9A 4F6RD 5BXOA 4RLYA 2FO1E 4QFVA 4HLLA 4G8LA 5CERB 3LJNA 5HRYA 5ENOD 3SO8A 3V79K 1OT8A 4K5BA 3KEAA 1IXVA 2DWZA 1QYMA 5EYLA 4C48B 4HRNA 4K5CA 1TR4A 5CEAA 1N0RA 1K1AA 3TWSA 4LNUD 5AQ7A 2DVWA 4DX6D 2ZGGA 3NBNB 5AQAA 2B0OE 1AWCB 1IKND 2J8SD 3EU9A 4OAVB 4HB5A 4HQDA 5KBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OY3 D;  2Y1L E;  5CED B;  2V4H C;  3C5R A;  3TWT A;  5ENS D;  4BSZ B;  2RFA A;  4O1O A;  2ETC A;  5CBO A;  4ZHB A;  4BEP A;  4GPM A;  2XZT G;  4BER A;  2MYO A;  5KWD A;  3Q9N C;  3ZUV B;  5D66 A;  2ETA A;  3JXJ A;  2NYJ A;  2F8Y A;  3JXI A;  4DX2 A;  5JA4 D;  2A5E A;  3J5Q B;  5KNG A;  3J5P A;  5AN8 A;  1UOH A;  3DEP A;  1MX4 A;  1IHB A;  5JMN D;  3TWQ A;  5AQ9 A;  3TWW A;  3NOG D;  4U8Y D;  2RFM A;  3UI2 A;  5EN5 D;  5FIN A;  3V30 A;  4UUC A;  3ZU7 B;  4DX7 D;  5HS0 A;  3W9G A;  1K1B A;  3TWU A;  2VGE A;  4JB8 P;  3ZKJ A;  1BD8 A;  2ZGD A;  3Q9U C;  3DEO A;  3D9H A;  5EYP F;  2DZN A;  5AAO A;  3EHR A;  1MX2 A;  5HKP A;  4BES A;  5ENR D;  1G3N B;  1YMP A;  3IXE A;  5ENP D;  1YCS B;  5ITZ F;  1BU9 A;  1DCQ A;  2ETB A;  2KXP C;  2PNN A;  5CEC B;  1NFI E;  3HRA A;  3B95 A;  2Y0B G;  4HBD A;  4NIK A;  2HE0 A;  2QYJ A;  4QQI A;  4A63 B;  5AQB A;  2L6B A;  5EIB E;  1BI8 B;  4J8Y A;  3T9K A;  5CBN A;  4LG6 A;  2XEE A;  2XZD G;  3AJI A;  4F1P A;  4ZFH A;  2DZO A;  1D9S A;  4J7W A;  4Z68 A;  2XEN A;  4N5Q A;  4U96 D;  4YDW A;  1A5E A;  1WG0 A;  2XEH A;  2F8X K;  4HRM B;  5KNH D;  3V2O A;  3EHQ A;  3V31 A;  3UTM A;  2V5Q C;  4HRL A;  4G8K A;  4DX5 D;  4U8V D;  4O1P A;  4LSZ E;  3V2X A;  3F6Q A;  4DRX E;  1N0Q A;  5FIO A;  4YDY A;  4OAU C;  1YYH A;  4GMR A;  2BKK B;  2P2C P;  4K5A B;  4CZ2 D;  4TUM A;  3UXG A;  2QC9 A;  5EIL A;  4HI8 A;  2AJA A;  3T8K A;  3TWR A;  3NOC D;  4CYM D;  2BKG A;  1MJ0 A;  3B7B A;  4DUI A;  5EID A;  5ENQ D;  2JAB A;  3HG0 D;  1WDY A;  1AP7 A;  1DC2 A;  4ATZ D;  4BET A;  1K3Z D;  4O60 A;  1BI7 B;  1N11 A;  1SVX A;  5AAR A;  3TWV A;  4HNA D;  1BLX B;  1MYO A;  4U95 D;  4B93 B;  3JUE A;  4DX1 A;  1MX6 A;  5BXU A;  2F37 A;  2KBX A;  3ZNG A;  3TWX A;  5ENT D;  1S70 B;  1SW6 A;  3W9F A;  3AAA C;  4HI9 A;  4F6R D;  5BXO A;  4RLY A;  2FO1 E;  4QFV A;  4HLL A;  4G8L A;  5CER B;  3LJN A;  5HRY A;  5ENO D;  3SO8 A;  3V79 K;  1OT8 A;  4K5B A;  3KEA A;  1IXV A;  2DWZ A;  1QYM A;  5EYL A;  4C48 B;  4HRN A;  4K5C A;  1TR4 A;  5CEA A;  1N0R A;  1K1A A;  3TWS A;  4LNU D;  5AQ7 A;  2DVW A;  4DX6 D;  2ZGG A;  3NBN B;  5AQA A;  2B0O E;  1AWC B;  1IKN D;  2J8S D;  3EU9 A;  4OAV B;  4HB5 A;  4HQD A;  5KBA A; 
#chains in the Genus database with same CATH topology
 5CED B;  3RRU A;  1RZ4 A;  4YDE A;  4O1O A;  4GPM A;  3BG0 B;  5D66 A;  2PM7 A;  1UW4 B;  3Q5M A;  5JA4 D;  3MCX A;  3HDX A;  4TV3 A;  2YHC A;  5JMN D;  4UWF A;  3ZGQ A;  3ZU7 B;  1E7U A;  4AV7 A;  1OCO E;  2DZN A;  1MX2 A;  3Q73 A;  1N95 A;  4ILI A;  4LCT A;  4AEZ C;  4I2W A;  2J09 A;  2QZA A;  1DCQ A;  2R59 A;  2CG3 A;  4BY6 A;  2QYJ A;  1MZC A;  1L5J A;  3FTY A;  4ZFH A;  1D9S A;  3CKC A;  3D9N A;  4KBQ A;  2FEZ A;  2XRY A;  5EX3 A;  5ARG A;  4LSZ E;  2X6H A;  3ASG A;  1JWF A;  4YDY A;  4OAU C;  3EIJ A;  4RSY A;  3HHM A;  3KEZ A;  4ATG A;  2CHX A;  5ENQ D;  2JAB A;  3PEU B;  1KLX A;  1TEZ A;  1RW2 A;  1BLX B;  1KPS B;  4FJZ A;  3RRM B;  3FTS A;  4RLY A;  1S63 A;  3KAE A;  3P2B A;  4DI4 A;  4HVB A;  2IOL A;  4PS3 A;  4WWN A;  2MHK A;  4Y6W A;  4I2Z A;  3MV2 B;  4DLQ A;  3LY9 A;  3SFY A;  4NRH B;  4U0S A;  4GTP A;  1S64 A;  4EZK A;  3RSE G;  1FVH A;  2LXL A;  2OEV A;  2WXO A;  4MLP A;  3PZ4 A;  1E96 B;  4E85 A;  2R03 A;  3BU8 A;  5CMY A;  1N4Q A;  5J08 A;  1LD7 A;  4OVV A;  1H19 A;  2X6F A;  4IYP A;  1QZ2 A;  2X6J A;  2P9N G;  1ZB1 A;  4YND A;  4TXP A;  5E76 A;  2R05 A;  2WXJ A;  3FUJ A;  4NIK A;  5CCM A;  3UUX A;  2JLB A;  2XZD G;  3D9M A;  2YHE A;  1ELK A;  1E7V A;  4J8F A;  3PRZ A;  5M72 A;  4JEH A;  4A55 A;  2XCB A;  3ZN3 A;  4I17 A;  1NL4 A;  5BUZ A;  3ZXP A;  2A5U A;  3T8K A;  4G1T A;  2BKG A;  4JPS A;  4F53 A;  2MOW A;  2GW1 A;  1MYO A;  4U95 D;  5BXU A;  4C0M A;  3LJ3 A;  2KCV A;  3ZYL A;  1S70 B;  1OXJ A;  1DVP A;  4HLL A;  5CER B;  3QAQ A;  3DXM G;  1OWN A;  1QYM A;  2NXP A;  4J8D A;  3ENE A;  3CVP A;  4HB5 A;  4ACK A;  4AJW A;  2XZT G;  3DXK G;  2HR2 A;  4DK5 A;  1IHB A;  5EN5 D;  3BQO A;  3CK7 A;  3ZKJ A;  2WPV A;  3CHP A;  1BD8 A;  3BEE A;  3EHR A;  4OYS A;  2IU1 A;  5ENR D;  5BW8 C;  4KXK B;  2XQ0 A;  3SI5 A;  3UPV A;  3LDZ A;  5H7P A;  2FI7 A;  2UWJ G;  2AXV A;  2DCP A;  3FP3 A;  4TUU A;  5AIJ A;  2BF0 X;  1K8K G;  3CST A;  4G2V A;  1HH8 A;  2XGS A;  3FTW A;  2GRN B;  4XEI G;  3ZEF A;  4HOS A;  3C3O A;  3ONL A;  5J90 A;  2WVI A;  4GA0 A;  4EEC A;  3E34 A;  3F6Q A;  1EF1 C;  2IEJ A;  2R2L A;  3UMV A;  2BKK B;  4DLO A;  5G2N A;  3ZHE B;  2RD0 A;  1DC2 A;  3NAW A;  2L0T B;  2GRR B;  4UQZ A;  4BET A;  1JUQ A;  3AAA C;  1LTX A;  2I1J A;  5HI7 A;  4C9B B;  4F6R D;  3HXD A;  5BXO A;  3E30 A;  4CT0 A;  4GTR A;  2WXM A;  4WNF A;  3IKO B;  2L9B A;  3V79 K;  3OAW A;  2AW6 A;  4GML A;  3MKR A;  3T5X A;  2VGY A;  4YVO A;  4AVX A;  2XGO A;  3ZHE A;  4OAV B;  5D2M C;  1N54 A;  5T3R A;  2LAH A;  3CHQ A;  3PUK A;  3AU5 A;  5LOZ A;  3K9I A;  3VLD A;  1H6O A;  3CKB A;  1X81 A;  3JXI A;  1N4P A;  4BTB A;  3UIO C;  3DPY A;  3HYM B;  5FIN A;  4A3V A;  1Z3Y A;  4WNE A;  2WXQ A;  5BT1 A;  4HLE A;  4DI3 A;  1TNZ A;  2NC9 A;  4M7C A;  2KXP C;  3MEK A;  3VTY A;  5EKQ D;  2UY1 B;  1BI8 B;  4J8Y A;  3T9K A;  2I2O A;  3B13 A;  4N5Q A;  4JC8 A;  2F8X K;  3JQ1 A;  5KNH D;  4XI0 A;  4GTT A;  4U07 A;  3IHV A;  3QDN A;  4BT8 A;  1E8Y A;  5A7D B;  3APD A;  4FA6 A;  3ZYQ A;  3NOC D;  2OVB A;  2FF4 A;  3CVY A;  1HF8 A;  4A3T A;  3HG0 D;  4OVU A;  3C3R A;  3GW4 A;  4O60 A;  3I4G A;  5LCW J;  2AVP A;  4BFR A;  2KBX A;  4KZ0 A;  4N2Q A;  2VGX A;  3D9P A;  1JCS A;  2QYU A;  3UM2 A;  4C48 B;  2H6H A;  3ASH A;  2R17 C;  3NBN B;  1EDU A;  3ZPJ A;  2R5S A;  4I9E A;  5JJ7 A;  3CHS A;  4HFG A;  2MYO A;  5A23 A;  4MS6 A;  4JHK A;  4N5C A;  4N2S A;  4GU5 A;  3ASN E;  2YIN A;  4JXT A;  3UI2 A;  3LEW A;  1FPP A;  1D8E A;  2JEK A;  3HIZ A;  2GRL A;  1E8W A;  3IEG A;  2ION A;  1IQU A;  4KVO A;  3FEY A;  3VLE A;  5E75 A;  5EYP F;  2IFU A;  2B6C A;  2J08 A;  4I1A A;  4U8H A;  1U3D A;  2VSY A;  2P9I G;  3LYA A;  4QQI A;  4I9C A;  4UI9 K;  4FLH A;  4GAA A;  3FY4 A;  3RIB A;  1PAQ A;  1H6K A;  3AJI A;  2H6G A;  3PEV B;  4Z68 A;  1TN6 A;  1N94 A;  2P9K G;  3V2O A;  3EHQ A;  3B7S A;  3EHN A;  4AOF A;  4CGW A;  5CHE E;  1ELW A;  3AG1 E;  4H7X A;  3S7D A;  3GZ1 A;  5FWQ A;  3AG3 E;  1SZ9 A;  3JUE A;  2PL2 A;  1UN9 A;  3TWX A;  5FTP A;  4L1B A;  4UQY A;  4URK A;  3VTX A;  5BV1 A;  2KZT A;  4PS8 A;  1TR4 A;  1HU3 A;  4EZJ A;  1O5M A;  3EDT B;  2XPI A;  2DVW A;  1EPU A;  4HQD A;  5A6C A;  5KBA A;  1KZO A;  3O48 A;  1FVF A;  4BER A;  3CSF A;  3Q9N C;  3ZUV B;  4GYW A;  3DWL G;  2NYJ A;  4HXI A;  3FDH A;  3U66 A;  3WG7 E;  3UT4 A;  4N3C A;  4B94 A;  2L6J A;  3FUN A;  4L2L A;  4GZC A;  1FCH A;  2OOE A;  5AAO A;  1O1R A;  4B8A A;  2IOS A;  5KJK A;  3KSL A;  3NB2 A;  3FUD A;  5AJL A;  2GRM A;  4HBD A;  5EIB E;  2E2E A;  1KT1 A;  1HXI A;  1TNU A;  1A5E A;  1WG0 A;  1PC2 A;  3R7R A;  3ULY A;  3CK9 A;  2IO2 C;  4UWG A;  4G8K A;  1ELR A;  5AJD A;  2Y69 E;  2P2C P;  4K5A B;  3UXG A;  4MKT A;  5EIL A;  3D3M A;  5IY5 E;  3FH5 A;  3D9O A;  2LSV A;  4ATZ D;  4AXH A;  4M3O A;  3E4B A;  1AWC B;  2WB2 A;  3PNT B;  1N9A A;  3MX3 A;  2VSO E;  4DJA A;  4WWO A;  3X2Q E;  3L08 A;  1OT8 A;  1DCE A;  1B89 A;  4HRN A;  3N71 A;  2C0L A;  5AQ7 A;  4DX6 D;  4CDM A;  3PNL B;  3QWP A;  3CHO A;  2E0I A;  1LF8 A;  3TWT A;  3L22 A;  2ETC A;  3ZW3 A;  3PZ3 A;  5FQ4 A;  3ESK A;  5CRU A;  4XKB A;  3PE3 A;  4GZ3 A;  3B7T A;  2WXN A;  4JVS A;  2FBN A;  5JJT A;  4IRU A;  4UUC A;  2J4D A;  4XX5 A;  3RRN B;  2BED A;  3JUI A;  3Q9U C;  1TJF A;  3CQC B;  1QQE A;  1YA0 A;  2AWI A;  3AS8 A;  4ILH B;  3C3Q A;  4FP7 A;  2X6K A;  3FHE A;  4A63 B;  2Y4T A;  4CDN A;  3R9M A;  3DSS A;  3ULQ A;  4L23 A;  3CVN A;  2LSU A;  4KMO A;  4J8E A;  3LKU A;  4GMR A;  2XRZ A;  4CZ2 D;  3RU0 A;  4Q69 A;  4TRQ A;  1O1T A;  4CYM D;  3AU4 A;  3PVL A;  4UQX A;  3TJP A;  4NQ0 A;  1WAO 1;  4HNA D;  1Z3X A;  3LVR E;  3RK6 A;  4GZ6 A;  3ZNG A;  3PH0 C;  3FTU A;  3S7F A;  3L54 A;  1LD8 A;  3RO3 A;  4EQF A;  2XS8 A;  2LXM A;  2ZIR A;  5CEA A;  4GCO A;  5ENN A;  2ZGG A;  4G25 A;  5AQA A;  3S2A A;  1XGW A;  2PM6 A;  4E6H A;  2RFA A;  5CBO A;  2EIJ E;  5KWD A;  2ETA A;  3JXJ A;  3LS8 A;  3FTV A;  4XI9 A;  3FEX A;  3LVQ E;  5BNW A;  1HE8 A;  5B3S E;  3NOG D;  4JEU A;  3RJV A;  3CK8 A;  2EIM E;  2Y4U A;  3ABM E;  2DBA A;  4ILG A;  4A1S A;  4GCN A;  3PDN A;  3G2W A;  1BU9 A;  1VDY A;  2ETB A;  5CEC B;  3NZS A;  3B95 A;  4JHR A;  2C0M A;  1NI1 A;  2OEW A;  2KM4 A;  2C2L A;  3LY8 A;  2EIK E;  2KCL A;  3D9K A;  4U7E B;  3MYV A;  1UN8 A;  4W9R A;  1N4S A;  3KS2 A;  3IV0 A;  1N0Q A;  3ASD A;  4DRX E;  1QBQ A;  4GB9 A;  3TAX A;  3FH7 A;  1HFA A;  1KT0 A;  4K03 A;  2FUL A;  4UWH A;  1MJ0 A;  1TJC A;  3AS5 A;  5ANL A;  2Y3A A;  3CIA A;  1SVX A;  1N11 A;  2OND A;  2KCK A;  3Q15 A;  4MBG A;  2VSN A;  3LXU X;  1Y8M A;  3W9F A;  4HI9 A;  2A4Z A;  2NSZ A;  2KC7 A;  4CEM A;  5HRY A;  4NAC A;  5EYL A;  3MJW A;  3SBT B;  2LNI A;  3DRA A;  2XS1 A;  3ZXS A;  2V4H C;  4BSZ B;  3MKQ B;  3OXG A;  3UQ3 A;  4ABN A;  3ZFW A;  4N3B A;  2RG8 A;  1H6P A;  2IF4 A;  1E8X A;  3QB2 A;  2OV8 A;  2CHW A;  1JCQ A;  4GTS A;  3ABK E;  3OXF A;  1PY1 A;  1UJJ A;  2YNQ A;  4KYO B;  3MZL B;  3U9W A;  3TWU A;  4GTQ A;  3D9H A;  5DIZ A;  5HKP A;  4HS2 A;  4GA2 A;  3G2V A;  4ANW A;  3FUI A;  5ENP D;  3MKQ A;  2EIN E;  2ZXW E;  5G04 J;  1IHG A;  2WXF A;  2L6B A;  4L7T A;  2WXL A;  4UWL A;  3PZD A;  4F1P A;  2XPZ A;  4J7W A;  2XEN A;  4GA1 A;  1HG2 A;  3SY2 A;  3UT8 A;  3FUL A;  5G04 C;  1YYH A;  3D9I A;  4TUM A;  2XGM A;  3FU6 A;  3EHM A;  2AJA A;  4UI9 J;  4U63 A;  3CHM A;  1AP7 A;  3Q49 B;  5FQ7 A;  5AYW D;  1K3Z D;  4BX9 A;  4AM9 A;  2CFU A;  2GRQ B;  3UIP C;  2VGX B;  3PZ1 A;  3ZRH A;  4BX8 A;  2WQ6 A;  3AG4 E;  3G2S A;  1OCC E;  5ENO D;  3SD5 A;  3SO8 A;  3DSU A;  1N0R A;  4IN3 B;  4LNU D;  1H2U A;  2XPY A;  3SBS A;  2EQX A;  3UM0 A;  3ASF A;  1E90 A;  1N52 A;  3Q7A A;  3MGB A;  4Q96 A;  5FJY A;  4O6F A;  4GMJ A;  4ANU A;  3FWV A;  4H7Y A;  1EYH A;  2CFZ A;  3CVQ A;  4GPK A;  3TXN A;  4D10 C;  4GYO A;  5DBK A;  1HO8 A;  5LCW C;  2GGF A;  3FUF A;  5D0Q D;  5B1B E;  5T8I A;  5EDS A;  1NP7 A;  3IXE A;  3UM3 A;  1HG5 A;  4ANX A;  3U64 A;  5FQ6 A;  2V4L A;  1TYQ G;  2WXI A;  2F0Y A;  2HE0 A;  2PQR A;  2WMO A;  1OWP A;  5CBN A;  1XNF A;  5C1D A;  2PZI A;  4U96 D;  3FH8 A;  4YDW A;  3FUM A;  2IO3 C;  2J4B A;  2V5Q C;  4CDR A;  3LPZ A;  3U4T A;  4FJY A;  4IUL A;  2Q7F A;  4DPR A;  4JL0 A;  1TNY A;  3TGO A;  4HI8 A;  5FZQ A;  3APC A;  4J6I A;  5JJ6 A;  2WQ7 A;  4PS7 A;  4XE0 A;  4RG9 A;  2HO1 A;  4ME2 A;  4HOU A;  2F37 A;  4I6E A;  2AXU A;  3DPD A;  2V5F A;  2R02 A;  2WXG A;  2KZT B;  4EBA A;  1OUV A;  3O4Z A;  5LP0 A;  4K5C A;  3UT7 A;  3TXM A;  1A17 A;  3UIN C;  1ZU2 A;  2WXR A;  4XIF A;  5HQ8 A;  2XCC A;  2XHE A;  3GYZ A;  4X8Q A;  2YQ8 A;  3CVV A;  3QAR A;  4JW1 A;  3HXE A;  1Y6I A;  5HS0 A;  2GRO B;  4LNG A;  3U3W A;  3DEO A;  4I43 A;  1Z6T A;  4GZ5 A;  3CVW A;  1YMP A;  3Q78 A;  4LRZ A;  3ISM C;  3T5V A;  5ANR A;  4U0U A;  3NZU A;  4U04 A;  4AIF A;  3ASO E;  5AQB A;  1H2T C;  2PQN A;  2VYI A;  3E37 A;  4J0U A;  4U0Z A;  1OWM A;  1HS6 A;  3IBE A;  4BSX A;  2M63 A;  2LO6 A;  3V31 A;  2P9S G;  4WNG A;  4C0E A;  1WM5 A;  4GTO A;  3ESL A;  3B7R L;  3KD7 A;  3CEQ A;  1P5Q A;  3I5P A;  4WUY A;  3NF1 A;  3R9A B;  4EHM A;  3TWV A;  5ARF A;  3FUE A;  4FLB A;  3PS6 A;  1SW6 A;  3SQV A;  2ZIS A;  3E33 A;  4HOR A;  3CVL A;  4G8L A;  4FU3 A;  1IXV A;  3Q4A B;  2J07 A;  1SZA A;  4PUC A;  4JA9 A;  5FT9 A;  1IKN D;  4AY6 A;  3SZ7 A;  3VLF A;  2QY7 A;  4LER A;  4WND A;  1BPO A;  1H0A A;  1UJK A;  2WXP A;  2CHZ A;  5G05 J;  5LX8 A;  5KNG A;  5AN8 A;  2L0I A;  3OXL A;  4F3V A;  3V30 A;  3GZ2 A;  3W9G A;  1K1B A;  3ML9 A;  3SHF A;  2ZGD A;  4AP2 A;  5G05 C;  1V55 E;  4Y6C A;  2P9L G;  1SQM A;  4V3I A;  5ITZ F;  1NFI E;  3JCK C;  3QK0 A;  1TN7 A;  2EIL E;  4LG6 A;  5JHB A;  1QNF A;  4BT9 A;  3Q7F A;  5BPP A;  3FFL A;  3TG5 A;  2VJ8 A;  3V2X A;  2I9C A;  4G11 A;  3L82 A;  4JD2 G;  2CG2 A;  3T8M A;  4YVQ C;  3UX4 A;  3FTX A;  4DX1 A;  4APF A;  3QC1 A;  3L16 A;  3P1U A;  4RG6 A;  4QFV A;  4PH4 B;  2FO7 A;  1E8Z A;  3QNK A;  1MHQ A;  1Q2Z A;  3TWS A;  1DNP A;  3L9T A;  3UKR G;  2J8S D;  5JHA A;  3C5R A;  3DSX A;  4FC8 A;  5ENS D;  3L17 A;  4F7A A;  2WXH A;  3J5Q B;  1WY6 A;  3J5P A;  5B1A E;  3QWW A;  3AG2 E;  3DEP A;  3KSQ A;  3SNX A;  3CVX A;  2RFM A;  1H2V C;  2P9P G;  2DYR E;  3ZVV A;  3QJZ A;  1OWO A;  3PE4 A;  3HXB A;  1ZBP A;  2WM9 A;  3EU5 A;  1G3N B;  2VTB B;  1OCZ E;  4EPZ A;  3HXC A;  4I6J A;  2PNN A;  1HX8 A;  4J8S A;  3HRA A;  2Y0B G;  3TG4 A;  4XKC A;  4F1S A;  1V54 E;  4LNB A;  1GW6 A;  2XEH A;  2IY0 C;  3ULE G;  4HRL A;  2OVF A;  1SA4 A;  4U8V D;  2V0P A;  4WAF A;  4GZD A;  2VTB A;  3ML8 A;  3PRE A;  2H6F A;  3LCA A;  3B7B A;  4BWR A;  5T4Y A;  3SF4 A;  3FTZ A;  4LUN U;  2X3M A;  4MRU A;  4GTV A;  3BG1 B;  3LJN A;  3KEA A;  2DWZ A;  4HOT A;  1JCR A;  4FUL A;  4GYY A;  3QOU A;  3DBS A;  3D9L A;  3EU9 A;  3SFZ A;  1Z5S C;  1INZ A;  4CRW A;  2QFC A;  3GZS A;  4KVM A;  3HVE B;  3G2U A;  4I1M A;  4RVB A;  3Q75 A;  2X6I A;  1MX4 A;  3TWQ A;  5AQ9 A;  3TWW A;  5KJL A;  4G24 A;  3C98 A;  2KAT A;  2LUH A;  3JYS A;  3SFX A;  4I6G A;  1YCS B;  4BTA A;  2HM8 A;  4EBA G;  3HVE A;  5KJM A;  1U2V G;  3ZIM A;  3FUH A;  3L6A A;  5D0O D;  4G23 A;  3NQP A;  3RKV A;  3QKY A;  3I4R B;  3CVU A;  2IQC A;  2QC9 A;  3TWR A;  1MQS A;  1WDY A;  1SA5 A;  1N4R A;  2GRP B;  4JA7 A;  1NA0 A;  5AAR A;  2LAI A;  1JWG A;  5EX0 A;  5FZR A;  4Q94 A;  1D8D A;  2I6H A;  3ZYK A;  1JPL A;  5AEN A;  5CRV A;  2WQH A;  4L2Y A;  5FQ8 A;  1OCR E;  1KZP A;  4AY5 A;  3HXF A;  1FT1 A;  3QWV A;  2MRI A;  2Y1L E;  3FU5 A;  4ACL A;  2XEV A;  4WWP A;  2DIW A;  1FT2 A;  2HYZ A;  2VQ2 A;  2F8Y A;  1NZN A;  3FUK A;  2A5E A;  3PZ2 A;  4UI9 C;  2WMN A;  1IQR A;  4A1G A;  4N39 A;  3IHY A;  4I1O B;  4K0R A;  2VGE A;  4JB8 P;  3CQG B;  5C2Y A;  4BES A;  5CMW A;  3DST A;  4FHJ A;  4UWK A;  1O1S A;  3E32 A;  3MA5 A;  2H6I A;  2RKK A;  4GTM A;  2UY1 A;  2ILR A;  4B0Z A;  2DZO A;  4FHK A;  4JHJ A;  1HZ4 A;  3L13 A;  2WXK A;  3SGH A;  4DX5 D;  2V8S E;  4R7L A;  3AS4 A;  3FU0 A;  3I3N A;  3ONK A;  2J9Q A;  4PDX A;  3JQ0 A;  5EID A;  3ZYM A;  3DSW A;  5CCL A;  4P29 A;  1BI7 B;  5KCM A;  1MX6 A;  3DSV A;  5G55 A;  4NUR A;  1W3B A;  2FO1 E;  4N3A A;  1NA3 A;  2P9U G;  1K1A A;  2IJG X;  4KT6 B;  2B0O E;  1OY3 D;  4G26 A;  3RAU A;  3D9J A;  4HOQ A;  3CR3 A;  4TXQ A;  2J49 A;  4ZHB A;  4BEP A;  4B89 A;  2DYS E;  3WXX A;  3EUV A;  4DX2 A;  4YDO A;  3TL5 A;  3Q47 B;  2X38 A;  1UOH A;  3FU3 A;  1IYG A;  4U8Y D;  3URZ A;  2AXZ A;  1X5B A;  3CGH A;  3PUJ A;  4DX7 D;  3CLJ A;  3EIQ C;  4FAD A;  1TNO A;  5LFA A;  3BUA A;  3ABL E;  2P58 C;  3B7U X;  4TXR A;  4JZY A;  3S7J A;  4KZC A;  1TNB A;  3R7Q A;  4CCA A;  4CGV A;  2XEE A;  4XZ4 A;  5KJN A;  3CV0 A;  4HRM B;  4RQI A;  2VSX E;  3Q79 A;  3UTM A;  4O1P A;  3C72 A;  5FIO A;  2I1K A;  3CHR A;  2OCC E;  3UKU G;  5BV0 A;  4DUI A;  4APO A;  1TN8 A;  3UM1 A;  1OWL A;  1UG3 A;  4B93 B;  5FZS A;  3S7B A;  4B8C B;  2ZU6 B;  5ENT D;  3G2T A;  2BTD A;  4EZL A;  3OTN A;  4CT4 A;  2BUG A;  3LY7 A;  1S0P A;  4LEU A;  3EJN A;  4K5B A;  1U3C A;  4L9P A;  3APF A;  3RO2 A;  3MV3 B;  4ANV A; 
#chains in the Genus database with same CATH homology
 1OY3 D;  2Y1L E;  5CED B;  2V4H C;  3C5R A;  3TWT A;  5ENS D;  4BSZ B;  2RFA A;  4O1O A;  2ETC A;  5CBO A;  4ZHB A;  4BEP A;  4GPM A;  2XZT G;  4BER A;  2MYO A;  5KWD A;  3Q9N C;  3ZUV B;  5D66 A;  2ETA A;  3JXJ A;  2NYJ A;  2F8Y A;  3JXI A;  4DX2 A;  5JA4 D;  2A5E A;  3J5Q B;  5KNG A;  3J5P A;  5AN8 A;  1UOH A;  3DEP A;  1MX4 A;  1IHB A;  5JMN D;  3TWQ A;  5AQ9 A;  3TWW A;  3NOG D;  4U8Y D;  2RFM A;  3UI2 A;  5EN5 D;  5FIN A;  3V30 A;  4UUC A;  3ZU7 B;  4DX7 D;  5HS0 A;  3W9G A;  1K1B A;  3TWU A;  2VGE A;  4JB8 P;  3ZKJ A;  1BD8 A;  2ZGD A;  3Q9U C;  3DEO A;  3D9H A;  5EYP F;  2DZN A;  5AAO A;  3EHR A;  1MX2 A;  5HKP A;  4BES A;  5ENR D;  1G3N B;  1YMP A;  3IXE A;  5ENP D;  1YCS B;  5ITZ F;  1BU9 A;  1DCQ A;  2ETB A;  2KXP C;  2PNN A;  5CEC B;  1NFI E;  3HRA A;  3B95 A;  2Y0B G;  4HBD A;  4NIK A;  2HE0 A;  2QYJ A;  4QQI A;  4A63 B;  5AQB A;  2L6B A;  5EIB E;  1BI8 B;  4J8Y A;  3T9K A;  5CBN A;  4LG6 A;  2XEE A;  2XZD G;  3AJI A;  4F1P A;  4ZFH A;  2DZO A;  1D9S A;  4J7W A;  4Z68 A;  2XEN A;  4N5Q A;  4U96 D;  4YDW A;  1A5E A;  1WG0 A;  2XEH A;  2F8X K;  4HRM B;  5KNH D;  3V2O A;  3EHQ A;  3V31 A;  3UTM A;  2V5Q C;  4HRL A;  4G8K A;  4DX5 D;  4U8V D;  4O1P A;  4LSZ E;  3V2X A;  3F6Q A;  4DRX E;  1N0Q A;  5FIO A;  4YDY A;  4OAU C;  1YYH A;  4GMR A;  2BKK B;  2P2C P;  4K5A B;  4CZ2 D;  4TUM A;  3UXG A;  2QC9 A;  5EIL A;  4HI8 A;  2AJA A;  3T8K A;  3TWR A;  3NOC D;  4CYM D;  2BKG A;  1MJ0 A;  3B7B A;  4DUI A;  5EID A;  5ENQ D;  2JAB A;  3HG0 D;  1WDY A;  1AP7 A;  1DC2 A;  4ATZ D;  4BET A;  1K3Z D;  4O60 A;  1BI7 B;  1N11 A;  1SVX A;  5AAR A;  3TWV A;  4HNA D;  1BLX B;  1MYO A;  4U95 D;  4B93 B;  3JUE A;  4DX1 A;  1MX6 A;  5BXU A;  2F37 A;  2KBX A;  3ZNG A;  3TWX A;  5ENT D;  1S70 B;  1SW6 A;  3W9F A;  3AAA C;  4HI9 A;  4F6R D;  5BXO A;  4RLY A;  2FO1 E;  4QFV A;  4HLL A;  4G8L A;  5CER B;  3LJN A;  5HRY A;  5ENO D;  3SO8 A;  3V79 K;  1OT8 A;  4K5B A;  3KEA A;  1IXV A;  2DWZ A;  1QYM A;  5EYL A;  4C48 B;  4HRN A;  4K5C A;  1TR4 A;  5CEA A;  1N0R A;  1K1A A;  3TWS A;  4LNU D;  5AQ7 A;  2DVW A;  4DX6 D;  2ZGG A;  3NBN B;  5AQA A;  2B0O E;  1AWC B;  1IKN D;  2J8S D;  3EU9 A;  4OAV B;  4HB5 A;  4HQD A;  5KBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...