2DZNA

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
226
structure length
226
Chain Sequence
NYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Structural basis for the recognition between the regulatory particles Nas6 and Rpt3 of the yeast 26S proteasome
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 70
structure length 226
sequence length 226
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2dznA00
4HBDA 3EHRA 5CBOA 3Q9UC 3V2XA 3V31A 5ENPD 3DEOA 2XENA 5AQBA 4HI9A 2A5EA 3Q9NC 4LSZE 3ZU7B 4BSZB 3NBNB 5KWDA 3TWUA 3DEPA 3TWXA 5ENRD 4A63B 1K1BA 1MX6A 2MYOA 1G3NB 1N0QA 2J8SD 2XEEA 3ZUVB 5ENSD 2BKGA 4OAUC 4J8YA 4B93B 1WG0A 3V2OA 1A5EA 4JB8P 2Y0BG 3ZKJA 2DVWA 4F1PA 2JABA 3HG0D 4HI8A 4O60A 4U8YD 3D9HA 4U96D 5AAOA 3IXEA 3AJIA 3F6QA 2QC9A 4LNUD 3W9FA 3EHQA 1BU9A 4DX1A 3JXJA 4K5CA 1DCQA 4ZFHA 4J7WA 4CZ2D 4BERA 4Z68A 5KNHD 3HRAA 2V4HC 3TWWA 4ZHBA 3B7BA 4OAVB 5HS0A 3JXIA 2ETAA 3W9GA 5AQAA 3TWVA 5ENTD 1SVXA 3KEAA 4YDWA 4YDYA 5CBNA 2XZDG 1DC2A 4ATZD 5EYPF 4U8VD 5HKPA 3TWQA 1QYMA 2VGEA 4O1PA 5ITZF 5KBAA 2AJAA 2Y1LE 5EYLA 4K5AB 3J5PA 5EN5D 1IXVA 3J5QB 5HRYA 4GMRA 1UOHA 5D66A 3B95A 5AQ7A 4NIKA 4QQIA 5EIDA 3V79K 5EIBE 2DZNA 4RLYA 3V30A 3UTMA 4BEPA 4F6RD 1YMPA 2BKKB 3NOGD 1MYOA 5CECB 5EILA 1AP7A 4QFVA 5AN8A 4DRXE 1IHBA 1OY3D 3LJNA 4DX5D 2DWZA 1OT8A 1BI8B 1BI7B 2NYJA 2P2CP 2F8YA 2HE0A 1YYHA 2XZTG 2ZGDA 1IKND 1WDYA 4HRLA 1MX4A 1BD8A 4HQDA 3UI2A 4U95D 4HRMB 2PNNA 4C48B 4DX2A 5KNGA 5CERB 2KBXA 5CEDB 4GPMA 2QYJA 4HLLA 1MJ0A 5AQ9A 4BETA 1N11A 1K1AA 4DUIA 4DX7D 4G8KA 4TUMA 4DX6D 3T9KA 2F37A 4HB5A 1K3ZD 3C5RA 2DZOA 2RFAA 3JUEA 1AWCB 3ZNGA 3EU9A 3AAAC 4CYMD 4UUCA 1TR4A 2ETCA 2L6BA 4K5BA 3NOCD 2ZGGA 1MX2A 1NFIE 5FINA 3T8KA 2RFMA 5BXOA 3TWSA 2B0OE 5JA4D 5CEAA 1SW6A 1D9SA 1YCSB 4LG6A 1S70B 5AARA 2XEHA 3SO8A 4BESA 1BLXB 4N5QA 5ENOD 5BXUA 2F8XK 4HNAD 5FIOA 3UXGA 4G8LA 4HRNA 5ENQD 5JMND 2V5QC 4O1OA 2KXPC 1N0RA 2FO1E 3TWRA 3TWTA 2ETBA
chains in the Genus database with same CATH superfamily
3MA5A 5EX3A 2OOEA 5BV1A 4UWKA 3RO2A 2J9QA 5AQBA 4I6EA 1W3BA 1ELWA 5DIZA 5E75A 2IJGX 2YQ8A 4UI9C 3D3MA 4IULA 4XE0A 4B93B 2X3MA 5A6CA 1O1SA 3ZYKA 1P5QA 3G2SA 5JHBA 4HOQA 4X8QA 1IQUA 1OWNA 3DSXA 4FHKA 4HOTA 2XS8A 4WWNA 2IQCA 3U3WA 5ITZF 3QARA 3JQ0A 2L0TB 3SZ7A 4GTQA 1Z3YA 2LAHA 2XCBA 4LERA 2GW1A 3MV3B 3E32A 1IHBA 4W9RA 2F8YA 3DSVA 4C48B 4G25A 4WNGA 2WXHA 3S7BA 4G11A 5BV0A 1FPPA 3AG3E 3ASHA 4UWFA 3AG2E 1TR4A 4EZKA 3RRNB 2XEHA 4L7TA 1Y6IA 2VTBB 3TWTA 3LY8A 2RD0A 2VTBA 1TNYA 2WB2A 2HO1A 2XENA 3LPZA 1S64A 3ESLA 1H0AA 4GA2A 1OCCE 1S63A 3APCA 3CVUA 3D9OA 4P29A 5HQ8A 4CT0A 4U0SA 4APFA 3FHEA 2X6HA 3AJIA 3BUAA 2VGXA 4DX1A 2LSVA 2RKKA 4ZHBA 2PQRA 5CCLA 5CHEE 2ZXWE 2A5UA 3DSUA 5FQ4A 3OAWA 1TNBA 3AU4A 2QYUA 2R05A 5T4YA 3L9TA 3I4RB 1PAQA 2DBAA 3JUIA 4TRQA 2PM6A 3TGOA 3CK8A 3FEXA 4NURA 3RK6A 4EZLA 4FADA 1OY3D 2XEVA 2LNIA 3ULEG 4L9PA 4HRLA 1FT2A 4HRMB 4UQZA 4DLOA 5CCMA 4N3CA 1MJ0A 4APOA 3PEVB 3D9NA 4DUIA 3ZN3A 4FC8A 3CSFA 1K3ZD 3TJPA 1LF8A 1OCOE 4CRWA 2OEVA 2LXMA 1V55E 4PH4B 2PQNA 2EIKE 3EHNA 3S7FA 2J4BA 4G8LA 5JMND 2YHEA 2P9LG 4HS2A 4HBDA 3FUKA 3PS6A 1Q2ZA 3E34A 4DI3A 5FTPA 4ME2A 2WM9A 4GYOA 4FLBA 1X81A 4YVOA 3CVPA 3EJNA 3DXKG 3K9IA 3ABLE 4GA0A 4F1PA 3CVVA 4KZCA 4CGWA 3ULYA 2P9UG 3MV2B 3MJWA 4GTTA 3RIBA 3SGHA 1H2VC 3KEAA 3CV0A 4JVSA 2XPYA 4N2SA 4AEZC 5EYLA 2AXUA 4ABNA 4J8DA 4E85A 1OWOA 1Z6TA 2BTDA 2XGSA 3AU5A 1AP7A 2V4LA 4N2QA 2M63A 4GCNA 3WXXA 1WDYA 2L6JA 2OEWA 4DPRA 3JQ1A 2KBXA 4XKCA 4GPMA 1E7VA 4C0EA 2WXPA 2IEJA 3ONLA 3ML8A 3FTUA 4PS3A 1HO8A 2HYZA 3RRUA 3Q15A 4GZDA 1OCZE 1NA0A 3FUDA 5JJTA 3FU3A 1EYHA 4F53A 5CEAA 2C0LA 1WAO1 4K03A 2BEDA 3UIOC 4F7AA 2GRQB 3DPDA 3Q9UC 3DSSA 4JW1A 4FJZA 3BG1B 3B7SA 2XGOA 2GROB 1H6PA 1L5JA 4YNDA 2XEEA 1N0QA 5AJLA 1E8XA 5ANLA 4XIFA 2JABA 1Z5SC 3B7BA 5KJLA 2FEZA 4EBAA 3DPYA 2AVPA 3HVEB 3LVQE 2CFUA 3SBSA 3N71A 3HVEA 5BW8C 1HG2A 4A55A 5IY5E 1EF1C 1IXVA 4NRHB 5HRYA 4U63A 3ZIMA 5D66A 3QJZA 3CR3A 2XHEA 5FQ7A 5KCMA 4GU5A 3ML9A 2FI7A 1H6KA 2LSUA 5M72A 1KPSB 4DX2A 4U95D 2ONDA 2GRRB 3TXMA 3PZ1A 5B1AE 3FEYA 4G8KA 3HHMA 3RRMB 1TN6A 2YHCA 1N94A 1B89A 1HZ4A 4EECA 4BX9A 5FZSA 4G24A 1D9SA 4PUCA 4LNGA 4L1BA 5AARA 4LEUA 2QZAA 5G04J 4WNFA 4WNEA 5LCWJ 2DYSE 4N3BA 1NI1A 4I17A 5CBOA 3KSQA 3ZRHA 2EILE 3ULQA 1EPUA 2JEKA 4BSZB 3E33A 1G3NB 2WXLA 3U64A 5ENSD 5T3RA 3SFYA 3B7RL 3LY7A 2DVWA 3R7RA 3SHFA 4HI8A 3ZGQA 5AIJA 2WXOA 2WXMA 4AY6A 2ZISA 1DCQA 3UIPC 4DI4A 3CKBA 2ILRA 3C3RA 3JXIA 2ETAA 5H7PA 3ZYQA 3MKQB 5CRUA 4ATZD 1IQRA 1PY1A 3MKQA 3FTVA 1DCEA 3CK9A 3SQVA 4HVBA 3I4GA 4QQIA 2DZNA 5EILA 1OCRE 4QFVA 3UUXA 3LJNA 3UX4A 3UKUG 5CERB 1FVHA 4I2ZA 1GW6A 3NZUA 4OVVA 2H6FA 4IRUA 4DX7D 4WUYA 4XI0A 4DX6D 3C5RA 4AXHA 2H6HA 1TNOA 3EU5A 2Y69E 1SW6A 3ZEFA 2PM7A 3QDNA 2X38A 5ARGA 4DLQA 3G2WA 4GAAA 4HLEA 4LUNU 2QY7A 3EDTB 4GA1A 4GZCA 4HI9A 4JA9A 4URKA 3R7QA 4TUUA 3MYVA 4KBQA 2R5SA 2R59A 1IYGA 3PZ3A 4GYYA 2XPZA 3ZXPA 4Q69A 2OVFA 1A5EA 4O60A 4YDEA 3G2UA 3W9FA 3C3OA 4UWLA 3UT4A 1TYQG 2OV8A 1DC2A 2AXVA 1Y8MA 5BT1A 1ELRA 3BG0B 3UPVA 2IOLA 1HG5A 5JJ6A 3QWVA 4C9BB 3CVLA 5DBKA 4RG9A 3LYAA 3CLJA 4JHKA 4ANUA 1U2VG 3I3NA 4BETA 3ASOE 1N11A 2X6JA 4GZ3A 5ENNA 1QZ2A 2F37A 4B94A 1KT1A 4EQFA 4ILIA 1H2TC 3LJ3A 2ZGGA 5FINA 5EDSA 2RFMA 3RAUA 4MKTA 3Q49B 4BTBA 2V5QC 3PRZA 1H2UA 4PS7A 4GZ6A 5EKQD 5EX0A 3SY2A 5ENPD 3PH0C 1ZU2A 3HYMB 4LSZE 1Z3XA 3TWXA 5ENRD 1K1BA 1MX6A 2IU1A 1KZPA 3MKRA 5T8IA 5CMWA 3PEUB 3AG4E 3CVYA 5D0QD 3FUIA 1YA0A 3FH8A 3D9HA 1N4QA 3Q7AA 1SZAA 1TNZA 3EHQA 3OTNA 4G26A 3GYZA 5AENA 3TG5A 5KJNA 3FTXA 3HXBA 2AXZA 2WXQA 1SVXA 4CGVA 3URZA 1QYMA 4GPKA 3MGBA 1KLXA 4Y6WA 5J90A 4TXPA 3VLFA 3V79K 5HI7A 1MYOA 4DRXE 3L17A 2DWZA 4EPZA 1VDYA 1BD8A 3FU6A 3ZHEB 3DRAA 3CHQA 3ISMC 3ZHEA 4IN3B 3G2VA 4M3OA 1SA5A 3JUEA 3APFA 4CYMD 3FH7A 4DK5A 4JPSA 1MX2A 3HDXA 4PS8A 3EIQC 4CDRA 4UWHA 2YINA 2ZIRA 1A17A 3UXGA 3LVRE 1N0RA 2P9PG 2P9SG 1TJFA 4TXQA 3PNTB 3EHRA 5CMYA 4H7YA 5LOZA 4Q96A 1ZB1A 2Y4TA 4B8AA 5JHAA 4JL0A 2Y4UA 4EHMA 4FLHA 1JCSA 4GTOA 4OAUC 4GYWA 4JB8P 5A7DB 3GZ2A 4UWGA 3DWLG 3SNXA 2B6CA 4CDMA 3RO3A 3ASDA 3AS8A 2V4HC 3FUMA 3U66A 3FTWA 4U07A 1H6OA 3ENEA 1LD8A 3D9IA 4YDWA 1MZCA 2XRYA 2VGEA 1RW2A 5CRVA 4AJWA 3ZVVA 3CHMA 4YDOA 1TJCA 2IO3C 3L82A 3Q5MA 4DX5D 3MEKA 3Q73A 2Y3AA 5FJYA 1NA3A 3KAEA 3DSWA 5G05J 1FCHA 2FULA 1UJJA 1K1AA 3CHOA 4Y6CA 3T5VA 4B0ZA 5G05C 4KVMA 3AAAC 3BU8A 2XQ0A 2XPIA 3D9KA 1NFIE 4XI9A 2KATA 3TWSA 2B0OE 3CQCB 4LG6A 3UKRG 4H7XA 2FO1E 4O1OA 2NC9A 3PNLB 3LDZA 1O5MA 2AW6A 4JD2G 3DEOA 2I1JA 4JHRA 3L54A 3D9LA 3Q9NC 2C2LA 3ZU7B 4NACA 2J8SD 5ARFA 3QWWA 4J8YA 1HFAA 3QK0A 3L22A 4U7EB 4ACLA 4BFRA 3D9MA 4GMLA 3CHRA 4F1SA 3AS5A 4LNUD 1SA4A 4GZ5A 4I6JA 3CVNA 4ANWA 4CZ2D 4ZFHA 4N39A 3SD5A 4GCOA 5AQAA 5ENTD 2VSXE 4ILGA 4AV7A 1FT1A 4XEIG 3PE3A 4A3VA 4BX8A 3HXDA 3J5QB 5KJMA 1UOHA 3T8MA 3UT7A 4Q94A 4GTPA 4N3AA 3QNKA 4CCAA 1RZ4A 4MS6A 3CVXA 3S2AA 1XGWA 2ZGDA 2KC7A 3MX3A 2DCPA 3C98A 2XGMA 2I2OA 2WMNA 1N9AA 4HLLA 2DZOA 4BT8A 1UN8A 3ZNGA 2MRIA 3Q47B 4RSYA 4TV3A 3O48A 4I2WA 4K5BA 3Q4AB 3T8KA 3SFXA 1JCQA 1YCSB 4BESA 1OWPA 2F8XK 4PDXA 3UQ3A 3FH5A 4J0UA 3Q79A 4F3VA 2E2EA 2MHKA 2X6KA 3TWUA 4XKBA 2WXKA 2QFCA 2XS1A 3KEZA 2WQ6A 3QOUA 3PZ2A 4NQ0A 5G04C 4RQIA 5LCWC 4ILHB 2XCCA 5HS0A 3JYSA 2WMOA 3E37A 2LUHA 1ZBPA 3CK7A 2Y1LE 1JWGA 4GMRA 4GTMA 4GTVA 2FBNA 5B1BE 3NOGD 2F0YA 4I1AA 1BI8B 4LCTA 4ANVA 3DXMG 2WXNA 4U0ZA 2Q7FA 3C3QA 2QYJA 4JA7A 5AQ9A 1NL4A 1OWMA 3OXGA 3CEQA 1LD7A 4TUMA 5FT9A 3VTYA 4UQXA 4RG6A 4FJYA 4LNBA 3C72A 1BLXB 4J6IA 2BF0X 1SZ9A 2PL2A 3CQGB 3PZDA 2IY0C 4RVBA 3ZYLA 3LY9A 4HORA 4FP7A 4YVQC 4N5CA 5LFAA 2R03A 4EBAG 2CG2A 3FU0A 4AIFA 3FUFA 2VSOE 3RU0A 2R02A 2BUGA 3Q7FA 4AY5A 4FA6A 4E6HA 4R7LA 5BPPA 5FQ6A 2J07A 2VSNA 4CT4A 4KYOB 4JEHA 2XZDG 5AJDA 4U04A 4A1GA 1XNFA 3QKYA 3HXCA 2GRLA 5G55A 2RG8A 5EIDA 2HR2A 3MZLB 2DIWA 4GTRA 3E30A 3TG4A 2KCVA 2IO2C 3OXFA 1NP7A 2HE0A 3ASFA 2A4ZA 2WXJA 2L9BA 1HX8A 5B3SE 2I1KA 1OUVA 1ELKA 4JXTA 1HH8A 4HB5A 1X5BA 3EHMA 1JWFA 3U9WA 4UUCA 4UI9J 2ETCA 3CSTA 3ONKA 1O1RA 5ENQD 3FY4A 1TEZA 4D10C 2LXLA 3KSLA 3V2XA 1UN9A 4WWPA 1HF8A 2WXFA 2HM8A 1HXIA 3ESKA 3NBNB 5JJ7A 2H6GA 3FTYA 4AVXA 5D0OD 4CDNA 2Y0BG 2J49A 4B8CB 2CFZA 4U8YD 3DSTA 5A23A 3QB2A 4K5CA 5FWQA 3CKCA 4J7WA 4BERA 3JCKC 1HE8A 3FUHA 2P9IG 2WVIA 3DBSA 3Q75A 1U3DA 4U8VD 3TWQA 4O1PA 3J5PA 2AWIA 5EN5D 3KS2A 3SF4A 5AQ7A 4NIKA 4XX5A 3TL5A 1WM5A 3GZSA 4RLYA 3BEEA 4F6RD 3HXFA 2I9CA 2BKKB 4UI9K 5ANRA 4I43A 1N54A 4JC8A 2P2CP 3S7DA 1TN8A 1MX4A 2PNNA 5J08A 3IHYA 1KZOA 2VGYA 1HU3A 3LKUA 3U4TA 3FU5A 2LO6A 1K8KG 2RFAA 3IKOB 4CEMA 1UW4B 3FTZA 3APDA 3GW4A 3LS8A 4U0UA 2IOSA 5BXOA 2OVBA 1N95A 3FDHA 2R17C 4HNAD 4G1TA 2VGXB 4LRZA 2KXPC 3TWRA 2CHXA 2E0IA 3HXEA 4EZJA 4I9CA 4L2LA 3CVWA 2A5EA 1E8ZA 3ZPJA 5BUZA 1E8YA 1TNUA 3O4ZA 5KWDA 1DNPA 3ZUVB 1D8EA 2P9KG 4J8SA 4JHJA 4BTAA 5FQ8A 3HG0D 2VJ8A 3FULA 2QC9A 3WG7E 3JXJA 5KNHD 4A3TA 2NXPA 3T5XA 3LXUX 3CGHA 4J8EA 3P1UA 3MCXA 1HS6A 3I5PA 4FHJA 3IV0A 3V30A 4M7CA 3CHSA 1UG3A 3Q78A 4HOSA 5E76A 1YYHA 3EUVA 3LCAA 4HQDA 4HFGA 3R9AB 1MQSA 3QC1A 4TXRA 2LAIA 3EIJA 3PUJA 5CEDB 1JUQA 3B7UX 3AG1E 2NSZA 3SBTB 2IONA 1NZNA 2I6HA 3ASNE 3P2BA 3FWVA 2UWJG 1N4PA 3S7JA 2DYRE 1FVFA 1S70B 3SO8A 3B7TA 3PE4A 2KM4A 1S0PA 3FUNA 2WQHA 3E4BA 2IF4A 3V31A 2EIJE 5LP0A 3VLDA 4HOUA 3HIZA 3IBEA 2KCLA 1N52A 4KZ0A 3L6AA 3ASGA 3UMVA 3IHVA 5AYWD 4I1MA 2OCCE 4U96D 2J09A 2WXRA 2R2LA 2CG3A 3NZSA 3NAWA 1OXJA 2L0IA 5LX8A 3NQPA 4GMJA 2UY1B 3TXNA 3B13A 2AJAA 4XZ4A 2CHZA 2UY1A 3NF1A 4A1SA 3R9MA 5FZQA 3B95A 3UTMA 2WQ7A 4BEPA 4HXIA 5CECB 1IHGA 1BI7B 3FUEA 4JEUA 2VQ2A 1N4RA 5KNGA 4WAFA 3ZFWA 5C1DA 3PDNA 4I6GA 1SQMA 3ABME 4BSXA 4B89A 1AWCB 2WPVA 3EU9A 3ZW3A 3CHPA 3UT8A 1DVPA 4FULA 4MLPA 1E96B 5JA4D 4N5QA 4L23A 5ENOD 4C0MA 1H19A 2ETBA 5KJKA 4ANXA 4UQYA 4V3IA 3SFZA 3UM0A 4JZYA 4MRUA 3RKVA 4AM9A 2X6FA 3LEWA 5BNWA 2V0PA 3UM3A 3FP3A 3V2OA 3ZKJA 4KMOA 5AAOA 1N4SA 3VLEA 2GRNB 4Z68A 3HRAA 4KVOA 4OVUA 2FO7A 3SI5A 2KZTB 3OXLA 1QBQA 1E7UA 4YDYA 5CBNA 5HKPA 4GB9A 2V8SE 3X2QE 2FF4A 5KBAA 2KZTA 1PC2A 3UM1A 2VSYA 4WNDA 5G2NA 1INZA 2MOWA 3G2TA 1YMPA 4KT6B 1OT8A 3KD7A 2J08A 2NYJA 4G23A 3GZ1A 1IKND 3PUKA 1JPLA 2C0MA 4FU3A 5C2YA 1E90A 3L16A 3PREA 4WWOA 4BWRA 4OYSA 4BY6A 3RJVA 4AOFA 4ACKA 2JLBA 3T9KA 1EDUA 2P58C 3PZ4A 4GTSA 4I9EA 4DJAA 1BPOA 4U8HA 4IYPA 3L13A 3PVLA 4ATGA 1E8WA 3FTSA 2IFUA 2EIME 2GRPB 2X6IA 2WXIA 4AP2A 2EINE 4HRNA 3CVQA 3RSEG 4BT9A 1V54E 2V5FA 4G2VA 4MBGA 3ZXSA 2WXGA 2GGFA 2H6IA 3DEPA 3BQOA 4A63B 2MYOA 5FZRA 2BKGA 1WG0A 1MHQA 3L08A 3IXEA 3F6QA 2J4DA 1BU9A 3VTXA 3TWWA 3FFLA 2EQXA 4I1OB 3W9GA 3TWVA 5EYPF 3FUJA 3ABKE 3UINC 2YNQA 3IEGA 1KT0A 4KXKB 4K5AB 4O6FA 5D2MC 1U3CA 2GRMA 3D9PA 5EIBE 3ZYMA 1JCRA 1LTXA 3NB2A 5AN8A 1QNFA 3D9JA 1D8DA 2XZTG 1UJKA 3UI2A 2KCKA 1WY6A 4K0RA 2PZIA 2XRZA 2ZU6B 3UM2A 2CHWA 2VYIA 3QWPA 1TN7A 1OWLA 3TAXA 4J8FA 2L6BA 2P9NG 3NOCD 1O1TA 3AS4A 5BXUA 1QQEA 4L2YA 5FIOA 4OAVB 3QAQA 3CIAA
chains in the Genus database with same CATH topology
4HBDA 3EHRA 5CBOA 3Q9UC 3V2XA 3V31A 5ENPD 3DEOA 2XENA 5AQBA 4HI9A 2A5EA 3Q9NC 4LSZE 3ZU7B 4BSZB 3NBNB 5KWDA 3TWUA 3DEPA 3TWXA 5ENRD 4A63B 1K1BA 1MX6A 2MYOA 1G3NB 1N0QA 2J8SD 2XEEA 3ZUVB 5ENSD 2BKGA 4OAUC 4J8YA 4B93B 1WG0A 3V2OA 1A5EA 4JB8P 2Y0BG 3ZKJA 2DVWA 4F1PA 2JABA 3HG0D 4HI8A 4O60A 4U8YD 3D9HA 4U96D 5AAOA 3IXEA 3AJIA 3F6QA 2QC9A 4LNUD 3W9FA 3EHQA 1BU9A 4DX1A 3JXJA 4K5CA 1DCQA 4ZFHA 4J7WA 4CZ2D 4BERA 4Z68A 5KNHD 3HRAA 2V4HC 3TWWA 4ZHBA 3B7BA 4OAVB 5HS0A 3JXIA 2ETAA 3W9GA 5AQAA 3TWVA 5ENTD 1SVXA 3KEAA 4YDWA 4YDYA 5CBNA 2XZDG 1DC2A 4ATZD 5EYPF 4U8VD 5HKPA 3TWQA 1QYMA 2VGEA 4O1PA 5ITZF 5KBAA 2AJAA 2Y1LE 5EYLA 4K5AB 3J5PA 5EN5D 1IXVA 3J5QB 5HRYA 4GMRA 1UOHA 5D66A 3B95A 5AQ7A 4NIKA 4QQIA 5EIDA 3V79K 5EIBE 2DZNA 4RLYA 3V30A 3UTMA 4BEPA 4F6RD 1YMPA 2BKKB 3NOGD 1MYOA 5CECB 5EILA 1AP7A 4QFVA 5AN8A 4DRXE 1IHBA 1OY3D 3LJNA 4DX5D 2DWZA 1OT8A 1BI8B 1BI7B 2NYJA 2P2CP 2F8YA 2HE0A 1YYHA 2XZTG 2ZGDA 1IKND 1WDYA 4HRLA 1MX4A 1BD8A 4HQDA 3UI2A 4U95D 4HRMB 2PNNA 4C48B 4DX2A 5KNGA 5CERB 2KBXA 5CEDB 4GPMA 2QYJA 4HLLA 1MJ0A 5AQ9A 4BETA 1N11A 1K1AA 4DUIA 4DX7D 4G8KA 4TUMA 4DX6D 3T9KA 2F37A 4HB5A 1K3ZD 3C5RA 2DZOA 2RFAA 3JUEA 1AWCB 3ZNGA 3EU9A 3AAAC 4CYMD 4UUCA 1TR4A 2ETCA 2L6BA 4K5BA 3NOCD 2ZGGA 1MX2A 1NFIE 5FINA 3T8KA 2RFMA 5BXOA 3TWSA 2B0OE 5JA4D 5CEAA 1SW6A 1D9SA 1YCSB 4LG6A 1S70B 5AARA 2XEHA 3SO8A 4BESA 1BLXB 4N5QA 5ENOD 5BXUA 2F8XK 4HNAD 5FIOA 3UXGA 4G8LA 4HRNA 5ENQD 5JMND 2V5QC 4O1OA 2KXPC 1N0RA 2FO1E 3TWRA 3TWTA 2ETBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBD A;  3EHR A;  5CBO A;  3Q9U C;  3V2X A;  3V31 A;  5ENP D;  3DEO A;  2XEN A;  5AQB A;  4HI9 A;  2A5E A;  3Q9N C;  4LSZ E;  3ZU7 B;  4BSZ B;  3NBN B;  5KWD A;  3TWU A;  3DEP A;  3TWX A;  5ENR D;  4A63 B;  1K1B A;  1MX6 A;  2MYO A;  1G3N B;  1N0Q A;  2J8S D;  2XEE A;  3ZUV B;  5ENS D;  2BKG A;  4OAU C;  4J8Y A;  4B93 B;  1WG0 A;  3V2O A;  1A5E A;  4JB8 P;  2Y0B G;  3ZKJ A;  2DVW A;  4F1P A;  2JAB A;  3HG0 D;  4HI8 A;  4O60 A;  4U8Y D;  3D9H A;  4U96 D;  5AAO A;  3IXE A;  3AJI A;  3F6Q A;  2QC9 A;  4LNU D;  3W9F A;  3EHQ A;  1BU9 A;  4DX1 A;  3JXJ A;  4K5C A;  1DCQ A;  4ZFH A;  4J7W A;  4CZ2 D;  4BER A;  4Z68 A;  5KNH D;  3HRA A;  2V4H C;  3TWW A;  4ZHB A;  3B7B A;  4OAV B;  5HS0 A;  3JXI A;  2ETA A;  3W9G A;  5AQA A;  3TWV A;  5ENT D;  1SVX A;  3KEA A;  4YDW A;  4YDY A;  5CBN A;  2XZD G;  1DC2 A;  4ATZ D;  5EYP F;  4U8V D;  5HKP A;  3TWQ A;  1QYM A;  2VGE A;  4O1P A;  5ITZ F;  5KBA A;  2AJA A;  2Y1L E;  5EYL A;  4K5A B;  3J5P A;  5EN5 D;  1IXV A;  3J5Q B;  5HRY A;  4GMR A;  1UOH A;  5D66 A;  3B95 A;  5AQ7 A;  4NIK A;  4QQI A;  5EID A;  3V79 K;  5EIB E;  2DZN A;  4RLY A;  3V30 A;  3UTM A;  4BEP A;  4F6R D;  1YMP A;  2BKK B;  3NOG D;  1MYO A;  5CEC B;  5EIL A;  1AP7 A;  4QFV A;  5AN8 A;  4DRX E;  1IHB A;  1OY3 D;  3LJN A;  4DX5 D;  2DWZ A;  1OT8 A;  1BI8 B;  1BI7 B;  2NYJ A;  2P2C P;  2F8Y A;  2HE0 A;  1YYH A;  2XZT G;  2ZGD A;  1IKN D;  1WDY A;  4HRL A;  1MX4 A;  1BD8 A;  4HQD A;  3UI2 A;  4U95 D;  4HRM B;  2PNN A;  4C48 B;  4DX2 A;  5KNG A;  5CER B;  2KBX A;  5CED B;  4GPM A;  2QYJ A;  4HLL A;  1MJ0 A;  5AQ9 A;  4BET A;  1N11 A;  1K1A A;  4DUI A;  4DX7 D;  4G8K A;  4TUM A;  4DX6 D;  3T9K A;  2F37 A;  4HB5 A;  1K3Z D;  3C5R A;  2DZO A;  2RFA A;  3JUE A;  1AWC B;  3ZNG A;  3EU9 A;  3AAA C;  4CYM D;  4UUC A;  1TR4 A;  2ETC A;  2L6B A;  4K5B A;  3NOC D;  2ZGG A;  1MX2 A;  1NFI E;  5FIN A;  3T8K A;  2RFM A;  5BXO A;  3TWS A;  2B0O E;  5JA4 D;  5CEA A;  1SW6 A;  1D9S A;  1YCS B;  4LG6 A;  1S70 B;  5AAR A;  2XEH A;  3SO8 A;  4BES A;  1BLX B;  4N5Q A;  5ENO D;  5BXU A;  2F8X K;  4HNA D;  5FIO A;  3UXG A;  4G8L A;  4HRN A;  5ENQ D;  5JMN D;  2V5Q C;  4O1O A;  2KXP C;  1N0R A;  2FO1 E;  3TWR A;  3TWT A;  2ETB A; 
#chains in the Genus database with same CATH topology
 3MA5 A;  5EX3 A;  2OOE A;  5BV1 A;  4UWK A;  3RO2 A;  2J9Q A;  5AQB A;  4I6E A;  1W3B A;  1ELW A;  5DIZ A;  5E75 A;  2IJG X;  2YQ8 A;  4UI9 C;  3D3M A;  4IUL A;  4XE0 A;  4B93 B;  2X3M A;  5A6C A;  1O1S A;  3ZYK A;  1P5Q A;  3G2S A;  5JHB A;  4HOQ A;  4X8Q A;  1IQU A;  1OWN A;  3DSX A;  4FHK A;  4HOT A;  2XS8 A;  4WWN A;  2IQC A;  3U3W A;  5ITZ F;  3QAR A;  3JQ0 A;  2L0T B;  3SZ7 A;  4GTQ A;  1Z3Y A;  2LAH A;  2XCB A;  4LER A;  2GW1 A;  3MV3 B;  3E32 A;  1IHB A;  4W9R A;  2F8Y A;  3DSV A;  4C48 B;  4G25 A;  4WNG A;  2WXH A;  3S7B A;  4G11 A;  5BV0 A;  1FPP A;  3AG3 E;  3ASH A;  4UWF A;  3AG2 E;  1TR4 A;  4EZK A;  3RRN B;  2XEH A;  4L7T A;  1Y6I A;  2VTB B;  3TWT A;  3LY8 A;  2RD0 A;  2VTB A;  1TNY A;  2WB2 A;  2HO1 A;  2XEN A;  3LPZ A;  1S64 A;  3ESL A;  1H0A A;  4GA2 A;  1OCC E;  1S63 A;  3APC A;  3CVU A;  3D9O A;  4P29 A;  5HQ8 A;  4CT0 A;  4U0S A;  4APF A;  3FHE A;  2X6H A;  3AJI A;  3BUA A;  2VGX A;  4DX1 A;  2LSV A;  2RKK A;  4ZHB A;  2PQR A;  5CCL A;  5CHE E;  2ZXW E;  2A5U A;  3DSU A;  5FQ4 A;  3OAW A;  1TNB A;  3AU4 A;  2QYU A;  2R05 A;  5T4Y A;  3L9T A;  3I4R B;  1PAQ A;  2DBA A;  3JUI A;  4TRQ A;  2PM6 A;  3TGO A;  3CK8 A;  3FEX A;  4NUR A;  3RK6 A;  4EZL A;  4FAD A;  1OY3 D;  2XEV A;  2LNI A;  3ULE G;  4L9P A;  4HRL A;  1FT2 A;  4HRM B;  4UQZ A;  4DLO A;  5CCM A;  4N3C A;  1MJ0 A;  4APO A;  3PEV B;  3D9N A;  4DUI A;  3ZN3 A;  4FC8 A;  3CSF A;  1K3Z D;  3TJP A;  1LF8 A;  1OCO E;  4CRW A;  2OEV A;  2LXM A;  1V55 E;  4PH4 B;  2PQN A;  2EIK E;  3EHN A;  3S7F A;  2J4B A;  4G8L A;  5JMN D;  2YHE A;  2P9L G;  4HS2 A;  4HBD A;  3FUK A;  3PS6 A;  1Q2Z A;  3E34 A;  4DI3 A;  5FTP A;  4ME2 A;  2WM9 A;  4GYO A;  4FLB A;  1X81 A;  4YVO A;  3CVP A;  3EJN A;  3DXK G;  3K9I A;  3ABL E;  4GA0 A;  4F1P A;  3CVV A;  4KZC A;  4CGW A;  3ULY A;  2P9U G;  3MV2 B;  3MJW A;  4GTT A;  3RIB A;  3SGH A;  1H2V C;  3KEA A;  3CV0 A;  4JVS A;  2XPY A;  4N2S A;  4AEZ C;  5EYL A;  2AXU A;  4ABN A;  4J8D A;  4E85 A;  1OWO A;  1Z6T A;  2BTD A;  2XGS A;  3AU5 A;  1AP7 A;  2V4L A;  4N2Q A;  2M63 A;  4GCN A;  3WXX A;  1WDY A;  2L6J A;  2OEW A;  4DPR A;  3JQ1 A;  2KBX A;  4XKC A;  4GPM A;  1E7V A;  4C0E A;  2WXP A;  2IEJ A;  3ONL A;  3ML8 A;  3FTU A;  4PS3 A;  1HO8 A;  2HYZ A;  3RRU A;  3Q15 A;  4GZD A;  1OCZ E;  1NA0 A;  3FUD A;  5JJT A;  3FU3 A;  1EYH A;  4F53 A;  5CEA A;  2C0L A;  1WAO 1;  4K03 A;  2BED A;  3UIO C;  4F7A A;  2GRQ B;  3DPD A;  3Q9U C;  3DSS A;  4JW1 A;  4FJZ A;  3BG1 B;  3B7S A;  2XGO A;  2GRO B;  1H6P A;  1L5J A;  4YND A;  2XEE A;  1N0Q A;  5AJL A;  1E8X A;  5ANL A;  4XIF A;  2JAB A;  1Z5S C;  3B7B A;  5KJL A;  2FEZ A;  4EBA A;  3DPY A;  2AVP A;  3HVE B;  3LVQ E;  2CFU A;  3SBS A;  3N71 A;  3HVE A;  5BW8 C;  1HG2 A;  4A55 A;  5IY5 E;  1EF1 C;  1IXV A;  4NRH B;  5HRY A;  4U63 A;  3ZIM A;  5D66 A;  3QJZ A;  3CR3 A;  2XHE A;  5FQ7 A;  5KCM A;  4GU5 A;  3ML9 A;  2FI7 A;  1H6K A;  2LSU A;  5M72 A;  1KPS B;  4DX2 A;  4U95 D;  2OND A;  2GRR B;  3TXM A;  3PZ1 A;  5B1A E;  3FEY A;  4G8K A;  3HHM A;  3RRM B;  1TN6 A;  2YHC A;  1N94 A;  1B89 A;  1HZ4 A;  4EEC A;  4BX9 A;  5FZS A;  4G24 A;  1D9S A;  4PUC A;  4LNG A;  4L1B A;  5AAR A;  4LEU A;  2QZA A;  5G04 J;  4WNF A;  4WNE A;  5LCW J;  2DYS E;  4N3B A;  1NI1 A;  4I17 A;  5CBO A;  3KSQ A;  3ZRH A;  2EIL E;  3ULQ A;  1EPU A;  2JEK A;  4BSZ B;  3E33 A;  1G3N B;  2WXL A;  3U64 A;  5ENS D;  5T3R A;  3SFY A;  3B7R L;  3LY7 A;  2DVW A;  3R7R A;  3SHF A;  4HI8 A;  3ZGQ A;  5AIJ A;  2WXO A;  2WXM A;  4AY6 A;  2ZIS A;  1DCQ A;  3UIP C;  4DI4 A;  3CKB A;  2ILR A;  3C3R A;  3JXI A;  2ETA A;  5H7P A;  3ZYQ A;  3MKQ B;  5CRU A;  4ATZ D;  1IQR A;  1PY1 A;  3MKQ A;  3FTV A;  1DCE A;  3CK9 A;  3SQV A;  4HVB A;  3I4G A;  4QQI A;  2DZN A;  5EIL A;  1OCR E;  4QFV A;  3UUX A;  3LJN A;  3UX4 A;  3UKU G;  5CER B;  1FVH A;  4I2Z A;  1GW6 A;  3NZU A;  4OVV A;  2H6F A;  4IRU A;  4DX7 D;  4WUY A;  4XI0 A;  4DX6 D;  3C5R A;  4AXH A;  2H6H A;  1TNO A;  3EU5 A;  2Y69 E;  1SW6 A;  3ZEF A;  2PM7 A;  3QDN A;  2X38 A;  5ARG A;  4DLQ A;  3G2W A;  4GAA A;  4HLE A;  4LUN U;  2QY7 A;  3EDT B;  4GA1 A;  4GZC A;  4HI9 A;  4JA9 A;  4URK A;  3R7Q A;  4TUU A;  3MYV A;  4KBQ A;  2R5S A;  2R59 A;  1IYG A;  3PZ3 A;  4GYY A;  2XPZ A;  3ZXP A;  4Q69 A;  2OVF A;  1A5E A;  4O60 A;  4YDE A;  3G2U A;  3W9F A;  3C3O A;  4UWL A;  3UT4 A;  1TYQ G;  2OV8 A;  1DC2 A;  2AXV A;  1Y8M A;  5BT1 A;  1ELR A;  3BG0 B;  3UPV A;  2IOL A;  1HG5 A;  5JJ6 A;  3QWV A;  4C9B B;  3CVL A;  5DBK A;  4RG9 A;  3LYA A;  3CLJ A;  4JHK A;  4ANU A;  1U2V G;  3I3N A;  4BET A;  3ASO E;  1N11 A;  2X6J A;  4GZ3 A;  5ENN A;  1QZ2 A;  2F37 A;  4B94 A;  1KT1 A;  4EQF A;  4ILI A;  1H2T C;  3LJ3 A;  2ZGG A;  5FIN A;  5EDS A;  2RFM A;  3RAU A;  4MKT A;  3Q49 B;  4BTB A;  2V5Q C;  3PRZ A;  1H2U A;  4PS7 A;  4GZ6 A;  5EKQ D;  5EX0 A;  3SY2 A;  5ENP D;  3PH0 C;  1ZU2 A;  3HYM B;  4LSZ E;  1Z3X A;  3TWX A;  5ENR D;  1K1B A;  1MX6 A;  2IU1 A;  1KZP A;  3MKR A;  5T8I A;  5CMW A;  3PEU B;  3AG4 E;  3CVY A;  5D0Q D;  3FUI A;  1YA0 A;  3FH8 A;  3D9H A;  1N4Q A;  3Q7A A;  1SZA A;  1TNZ A;  3EHQ A;  3OTN A;  4G26 A;  3GYZ A;  5AEN A;  3TG5 A;  5KJN A;  3FTX A;  3HXB A;  2AXZ A;  2WXQ A;  1SVX A;  4CGV A;  3URZ A;  1QYM A;  4GPK A;  3MGB A;  1KLX A;  4Y6W A;  5J90 A;  4TXP A;  3VLF A;  3V79 K;  5HI7 A;  1MYO A;  4DRX E;  3L17 A;  2DWZ A;  4EPZ A;  1VDY A;  1BD8 A;  3FU6 A;  3ZHE B;  3DRA A;  3CHQ A;  3ISM C;  3ZHE A;  4IN3 B;  3G2V A;  4M3O A;  1SA5 A;  3JUE A;  3APF A;  4CYM D;  3FH7 A;  4DK5 A;  4JPS A;  1MX2 A;  3HDX A;  4PS8 A;  3EIQ C;  4CDR A;  4UWH A;  2YIN A;  2ZIR A;  1A17 A;  3UXG A;  3LVR E;  1N0R A;  2P9P G;  2P9S G;  1TJF A;  4TXQ A;  3PNT B;  3EHR A;  5CMY A;  4H7Y A;  5LOZ A;  4Q96 A;  1ZB1 A;  2Y4T A;  4B8A A;  5JHA A;  4JL0 A;  2Y4U A;  4EHM A;  4FLH A;  1JCS A;  4GTO A;  4OAU C;  4GYW A;  4JB8 P;  5A7D B;  3GZ2 A;  4UWG A;  3DWL G;  3SNX A;  2B6C A;  4CDM A;  3RO3 A;  3ASD A;  3AS8 A;  2V4H C;  3FUM A;  3U66 A;  3FTW A;  4U07 A;  1H6O A;  3ENE A;  1LD8 A;  3D9I A;  4YDW A;  1MZC A;  2XRY A;  2VGE A;  1RW2 A;  5CRV A;  4AJW A;  3ZVV A;  3CHM A;  4YDO A;  1TJC A;  2IO3 C;  3L82 A;  3Q5M A;  4DX5 D;  3MEK A;  3Q73 A;  2Y3A A;  5FJY A;  1NA3 A;  3KAE A;  3DSW A;  5G05 J;  1FCH A;  2FUL A;  1UJJ A;  1K1A A;  3CHO A;  4Y6C A;  3T5V A;  4B0Z A;  5G05 C;  4KVM A;  3AAA C;  3BU8 A;  2XQ0 A;  2XPI A;  3D9K A;  1NFI E;  4XI9 A;  2KAT A;  3TWS A;  2B0O E;  3CQC B;  4LG6 A;  3UKR G;  4H7X A;  2FO1 E;  4O1O A;  2NC9 A;  3PNL B;  3LDZ A;  1O5M A;  2AW6 A;  4JD2 G;  3DEO A;  2I1J A;  4JHR A;  3L54 A;  3D9L A;  3Q9N C;  2C2L A;  3ZU7 B;  4NAC A;  2J8S D;  5ARF A;  3QWW A;  4J8Y A;  1HFA A;  3QK0 A;  3L22 A;  4U7E B;  4ACL A;  4BFR A;  3D9M A;  4GML A;  3CHR A;  4F1S A;  3AS5 A;  4LNU D;  1SA4 A;  4GZ5 A;  4I6J A;  3CVN A;  4ANW A;  4CZ2 D;  4ZFH A;  4N39 A;  3SD5 A;  4GCO A;  5AQA A;  5ENT D;  2VSX E;  4ILG A;  4AV7 A;  1FT1 A;  4XEI G;  3PE3 A;  4A3V A;  4BX8 A;  3HXD A;  3J5Q B;  5KJM A;  1UOH A;  3T8M A;  3UT7 A;  4Q94 A;  4GTP A;  4N3A A;  3QNK A;  4CCA A;  1RZ4 A;  4MS6 A;  3CVX A;  3S2A A;  1XGW A;  2ZGD A;  2KC7 A;  3MX3 A;  2DCP A;  3C98 A;  2XGM A;  2I2O A;  2WMN A;  1N9A A;  4HLL A;  2DZO A;  4BT8 A;  1UN8 A;  3ZNG A;  2MRI A;  3Q47 B;  4RSY A;  4TV3 A;  3O48 A;  4I2W A;  4K5B A;  3Q4A B;  3T8K A;  3SFX A;  1JCQ A;  1YCS B;  4BES A;  1OWP A;  2F8X K;  4PDX A;  3UQ3 A;  3FH5 A;  4J0U A;  3Q79 A;  4F3V A;  2E2E A;  2MHK A;  2X6K A;  3TWU A;  4XKB A;  2WXK A;  2QFC A;  2XS1 A;  3KEZ A;  2WQ6 A;  3QOU A;  3PZ2 A;  4NQ0 A;  5G04 C;  4RQI A;  5LCW C;  4ILH B;  2XCC A;  5HS0 A;  3JYS A;  2WMO A;  3E37 A;  2LUH A;  1ZBP A;  3CK7 A;  2Y1L E;  1JWG A;  4GMR A;  4GTM A;  4GTV A;  2FBN A;  5B1B E;  3NOG D;  2F0Y A;  4I1A A;  1BI8 B;  4LCT A;  4ANV A;  3DXM G;  2WXN A;  4U0Z A;  2Q7F A;  3C3Q A;  2QYJ A;  4JA7 A;  5AQ9 A;  1NL4 A;  1OWM A;  3OXG A;  3CEQ A;  1LD7 A;  4TUM A;  5FT9 A;  3VTY A;  4UQX A;  4RG6 A;  4FJY A;  4LNB A;  3C72 A;  1BLX B;  4J6I A;  2BF0 X;  1SZ9 A;  2PL2 A;  3CQG B;  3PZD A;  2IY0 C;  4RVB A;  3ZYL A;  3LY9 A;  4HOR A;  4FP7 A;  4YVQ C;  4N5C A;  5LFA A;  2R03 A;  4EBA G;  2CG2 A;  3FU0 A;  4AIF A;  3FUF A;  2VSO E;  3RU0 A;  2R02 A;  2BUG A;  3Q7F A;  4AY5 A;  4FA6 A;  4E6H A;  4R7L A;  5BPP A;  5FQ6 A;  2J07 A;  2VSN A;  4CT4 A;  4KYO B;  4JEH A;  2XZD G;  5AJD A;  4U04 A;  4A1G A;  1XNF A;  3QKY A;  3HXC A;  2GRL A;  5G55 A;  2RG8 A;  5EID A;  2HR2 A;  3MZL B;  2DIW A;  4GTR A;  3E30 A;  3TG4 A;  2KCV A;  2IO2 C;  3OXF A;  1NP7 A;  2HE0 A;  3ASF A;  2A4Z A;  2WXJ A;  2L9B A;  1HX8 A;  5B3S E;  2I1K A;  1OUV A;  1ELK A;  4JXT A;  1HH8 A;  4HB5 A;  1X5B A;  3EHM A;  1JWF A;  3U9W A;  4UUC A;  4UI9 J;  2ETC A;  3CST A;  3ONK A;  1O1R A;  5ENQ D;  3FY4 A;  1TEZ A;  4D10 C;  2LXL A;  3KSL A;  3V2X A;  1UN9 A;  4WWP A;  1HF8 A;  2WXF A;  2HM8 A;  1HXI A;  3ESK A;  3NBN B;  5JJ7 A;  2H6G A;  3FTY A;  4AVX A;  5D0O D;  4CDN A;  2Y0B G;  2J49 A;  4B8C B;  2CFZ A;  4U8Y D;  3DST A;  5A23 A;  3QB2 A;  4K5C A;  5FWQ A;  3CKC A;  4J7W A;  4BER A;  3JCK C;  1HE8 A;  3FUH A;  2P9I G;  2WVI A;  3DBS A;  3Q75 A;  1U3D A;  4U8V D;  3TWQ A;  4O1P A;  3J5P A;  2AWI A;  5EN5 D;  3KS2 A;  3SF4 A;  5AQ7 A;  4NIK A;  4XX5 A;  3TL5 A;  1WM5 A;  3GZS A;  4RLY A;  3BEE A;  4F6R D;  3HXF A;  2I9C A;  2BKK B;  4UI9 K;  5ANR A;  4I43 A;  1N54 A;  4JC8 A;  2P2C P;  3S7D A;  1TN8 A;  1MX4 A;  2PNN A;  5J08 A;  3IHY A;  1KZO A;  2VGY A;  1HU3 A;  3LKU A;  3U4T A;  3FU5 A;  2LO6 A;  1K8K G;  2RFA A;  3IKO B;  4CEM A;  1UW4 B;  3FTZ A;  3APD A;  3GW4 A;  3LS8 A;  4U0U A;  2IOS A;  5BXO A;  2OVB A;  1N95 A;  3FDH A;  2R17 C;  4HNA D;  4G1T A;  2VGX B;  4LRZ A;  2KXP C;  3TWR A;  2CHX A;  2E0I A;  3HXE A;  4EZJ A;  4I9C A;  4L2L A;  3CVW A;  2A5E A;  1E8Z A;  3ZPJ A;  5BUZ A;  1E8Y A;  1TNU A;  3O4Z A;  5KWD A;  1DNP A;  3ZUV B;  1D8E A;  2P9K G;  4J8S A;  4JHJ A;  4BTA A;  5FQ8 A;  3HG0 D;  2VJ8 A;  3FUL A;  2QC9 A;  3WG7 E;  3JXJ A;  5KNH D;  4A3T A;  2NXP A;  3T5X A;  3LXU X;  3CGH A;  4J8E A;  3P1U A;  3MCX A;  1HS6 A;  3I5P A;  4FHJ A;  3IV0 A;  3V30 A;  4M7C A;  3CHS A;  1UG3 A;  3Q78 A;  4HOS A;  5E76 A;  1YYH A;  3EUV A;  3LCA A;  4HQD A;  4HFG A;  3R9A B;  1MQS A;  3QC1 A;  4TXR A;  2LAI A;  3EIJ A;  3PUJ A;  5CED B;  1JUQ A;  3B7U X;  3AG1 E;  2NSZ A;  3SBT B;  2ION A;  1NZN A;  2I6H A;  3ASN E;  3P2B A;  3FWV A;  2UWJ G;  1N4P A;  3S7J A;  2DYR E;  1FVF A;  1S70 B;  3SO8 A;  3B7T A;  3PE4 A;  2KM4 A;  1S0P A;  3FUN A;  2WQH A;  3E4B A;  2IF4 A;  3V31 A;  2EIJ E;  5LP0 A;  3VLD A;  4HOU A;  3HIZ A;  3IBE A;  2KCL A;  1N52 A;  4KZ0 A;  3L6A A;  3ASG A;  3UMV A;  3IHV A;  5AYW D;  4I1M A;  2OCC E;  4U96 D;  2J09 A;  2WXR A;  2R2L A;  2CG3 A;  3NZS A;  3NAW A;  1OXJ A;  2L0I A;  5LX8 A;  3NQP A;  4GMJ A;  2UY1 B;  3TXN A;  3B13 A;  2AJA A;  4XZ4 A;  2CHZ A;  2UY1 A;  3NF1 A;  4A1S A;  3R9M A;  5FZQ A;  3B95 A;  3UTM A;  2WQ7 A;  4BEP A;  4HXI A;  5CEC B;  1IHG A;  1BI7 B;  3FUE A;  4JEU A;  2VQ2 A;  1N4R A;  5KNG A;  4WAF A;  3ZFW A;  5C1D A;  3PDN A;  4I6G A;  1SQM A;  3ABM E;  4BSX A;  4B89 A;  1AWC B;  2WPV A;  3EU9 A;  3ZW3 A;  3CHP A;  3UT8 A;  1DVP A;  4FUL A;  4MLP A;  1E96 B;  5JA4 D;  4N5Q A;  4L23 A;  5ENO D;  4C0M A;  1H19 A;  2ETB A;  5KJK A;  4ANX A;  4UQY A;  4V3I A;  3SFZ A;  3UM0 A;  4JZY A;  4MRU A;  3RKV A;  4AM9 A;  2X6F A;  3LEW A;  5BNW A;  2V0P A;  3UM3 A;  3FP3 A;  3V2O A;  3ZKJ A;  4KMO A;  5AAO A;  1N4S A;  3VLE A;  2GRN B;  4Z68 A;  3HRA A;  4KVO A;  4OVU A;  2FO7 A;  3SI5 A;  2KZT B;  3OXL A;  1QBQ A;  1E7U A;  4YDY A;  5CBN A;  5HKP A;  4GB9 A;  2V8S E;  3X2Q E;  2FF4 A;  5KBA A;  2KZT A;  1PC2 A;  3UM1 A;  2VSY A;  4WND A;  5G2N A;  1INZ A;  2MOW A;  3G2T A;  1YMP A;  4KT6 B;  1OT8 A;  3KD7 A;  2J08 A;  2NYJ A;  4G23 A;  3GZ1 A;  1IKN D;  3PUK A;  1JPL A;  2C0M A;  4FU3 A;  5C2Y A;  1E90 A;  3L16 A;  3PRE A;  4WWO A;  4BWR A;  4OYS A;  4BY6 A;  3RJV A;  4AOF A;  4ACK A;  2JLB A;  3T9K A;  1EDU A;  2P58 C;  3PZ4 A;  4GTS A;  4I9E A;  4DJA A;  1BPO A;  4U8H A;  4IYP A;  3L13 A;  3PVL A;  4ATG A;  1E8W A;  3FTS A;  2IFU A;  2EIM E;  2GRP B;  2X6I A;  2WXI A;  4AP2 A;  2EIN E;  4HRN A;  3CVQ A;  3RSE G;  4BT9 A;  1V54 E;  2V5F A;  4G2V A;  4MBG A;  3ZXS A;  2WXG A;  2GGF A;  2H6I A;  3DEP A;  3BQO A;  4A63 B;  2MYO A;  5FZR A;  2BKG A;  1WG0 A;  1MHQ A;  3L08 A;  3IXE A;  3F6Q A;  2J4D A;  1BU9 A;  3VTX A;  3TWW A;  3FFL A;  2EQX A;  4I1O B;  3W9G A;  3TWV A;  5EYP F;  3FUJ A;  3ABK E;  3UIN C;  2YNQ A;  3IEG A;  1KT0 A;  4KXK B;  4K5A B;  4O6F A;  5D2M C;  1U3C A;  2GRM A;  3D9P A;  5EIB E;  3ZYM A;  1JCR A;  1LTX A;  3NB2 A;  5AN8 A;  1QNF A;  3D9J A;  1D8D A;  2XZT G;  1UJK A;  3UI2 A;  2KCK A;  1WY6 A;  4K0R A;  2PZI A;  2XRZ A;  2ZU6 B;  3UM2 A;  2CHW A;  2VYI A;  3QWP A;  1TN7 A;  1OWL A;  3TAX A;  4J8F A;  2L6B A;  2P9N G;  3NOC D;  1O1T A;  3AS4 A;  5BXU A;  1QQE A;  4L2Y A;  5FIO A;  4OAV B;  3QAQ A;  3CIA A; 
#chains in the Genus database with same CATH homology
 4HBD A;  3EHR A;  5CBO A;  3Q9U C;  3V2X A;  3V31 A;  5ENP D;  3DEO A;  2XEN A;  5AQB A;  4HI9 A;  2A5E A;  3Q9N C;  4LSZ E;  3ZU7 B;  4BSZ B;  3NBN B;  5KWD A;  3TWU A;  3DEP A;  3TWX A;  5ENR D;  4A63 B;  1K1B A;  1MX6 A;  2MYO A;  1G3N B;  1N0Q A;  2J8S D;  2XEE A;  3ZUV B;  5ENS D;  2BKG A;  4OAU C;  4J8Y A;  4B93 B;  1WG0 A;  3V2O A;  1A5E A;  4JB8 P;  2Y0B G;  3ZKJ A;  2DVW A;  4F1P A;  2JAB A;  3HG0 D;  4HI8 A;  4O60 A;  4U8Y D;  3D9H A;  4U96 D;  5AAO A;  3IXE A;  3AJI A;  3F6Q A;  2QC9 A;  4LNU D;  3W9F A;  3EHQ A;  1BU9 A;  4DX1 A;  3JXJ A;  4K5C A;  1DCQ A;  4ZFH A;  4J7W A;  4CZ2 D;  4BER A;  4Z68 A;  5KNH D;  3HRA A;  2V4H C;  3TWW A;  4ZHB A;  3B7B A;  4OAV B;  5HS0 A;  3JXI A;  2ETA A;  3W9G A;  5AQA A;  3TWV A;  5ENT D;  1SVX A;  3KEA A;  4YDW A;  4YDY A;  5CBN A;  2XZD G;  1DC2 A;  4ATZ D;  5EYP F;  4U8V D;  5HKP A;  3TWQ A;  1QYM A;  2VGE A;  4O1P A;  5ITZ F;  5KBA A;  2AJA A;  2Y1L E;  5EYL A;  4K5A B;  3J5P A;  5EN5 D;  1IXV A;  3J5Q B;  5HRY A;  4GMR A;  1UOH A;  5D66 A;  3B95 A;  5AQ7 A;  4NIK A;  4QQI A;  5EID A;  3V79 K;  5EIB E;  2DZN A;  4RLY A;  3V30 A;  3UTM A;  4BEP A;  4F6R D;  1YMP A;  2BKK B;  3NOG D;  1MYO A;  5CEC B;  5EIL A;  1AP7 A;  4QFV A;  5AN8 A;  4DRX E;  1IHB A;  1OY3 D;  3LJN A;  4DX5 D;  2DWZ A;  1OT8 A;  1BI8 B;  1BI7 B;  2NYJ A;  2P2C P;  2F8Y A;  2HE0 A;  1YYH A;  2XZT G;  2ZGD A;  1IKN D;  1WDY A;  4HRL A;  1MX4 A;  1BD8 A;  4HQD A;  3UI2 A;  4U95 D;  4HRM B;  2PNN A;  4C48 B;  4DX2 A;  5KNG A;  5CER B;  2KBX A;  5CED B;  4GPM A;  2QYJ A;  4HLL A;  1MJ0 A;  5AQ9 A;  4BET A;  1N11 A;  1K1A A;  4DUI A;  4DX7 D;  4G8K A;  4TUM A;  4DX6 D;  3T9K A;  2F37 A;  4HB5 A;  1K3Z D;  3C5R A;  2DZO A;  2RFA A;  3JUE A;  1AWC B;  3ZNG A;  3EU9 A;  3AAA C;  4CYM D;  4UUC A;  1TR4 A;  2ETC A;  2L6B A;  4K5B A;  3NOC D;  2ZGG A;  1MX2 A;  1NFI E;  5FIN A;  3T8K A;  2RFM A;  5BXO A;  3TWS A;  2B0O E;  5JA4 D;  5CEA A;  1SW6 A;  1D9S A;  1YCS B;  4LG6 A;  1S70 B;  5AAR A;  2XEH A;  3SO8 A;  4BES A;  1BLX B;  4N5Q A;  5ENO D;  5BXU A;  2F8X K;  4HNA D;  5FIO A;  3UXG A;  4G8L A;  4HRN A;  5ENQ D;  5JMN D;  2V5Q C;  4O1O A;  2KXP C;  1N0R A;  2FO1 E;  3TWR A;  3TWT A;  2ETB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...