3ASNE

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3asnE00
2EINE 3X2QE 5B3SE 5B1BE 2EIKE 2OCCE 5IY5E 1OCRE 3ABLE 1OCCE 2EILE 3AG4E 1OCZE 1V55E 2EIME 1OCOE 3WG7E 2EIJE 3ABKE 2ZXWE 2DYSE 2Y69E 3AG2E 3ASNE 3ABME 3AG1E 2DYRE 1V54E 5B1AE 3AG3E 3ASOE
chains in the Genus database with same CATH superfamily
5AARA 2KZTA 3PUKA 3TG5A 5KBAA 3R9MA 4GTMA 3L54A 5T8IA 2XRZA 4N5QA 1DCEA 2Y3AA 3SNXA 1LD7A 4F6RD 5KNGA 2I1KA 4G1TA 3ZIMA 4PDXA 4NRHB 3O4ZA 4HOTA 4TUMA 4HVBA 1E8XA 5FTPA 3DSTA 1E90A 2CHWA 4F7AA 3FUIA 4U04A 1K1AA 3HVEA 4TXQA 3PS6A 4L1BA 4NIKA 3SF4A 1FT2A 1OWNA 5BUZA 1ELWA 2L6BA 3D9NA 4WNFA 5LP0A 1KPSB 2AJAA 4GMLA 2MYOA 2LXLA 4KBQA 3UTMA 3V31A 4BETA 3C3OA 2XS1A 1N4PA 1B89A 4KVOA 4HRMB 4J7WA 1KT0A 2WXKA 4AVXA 2F37A 3QNKA 1N95A 2KC7A 3PREA 2RD0A 2QC9A 3QARA 5C2YA 2A5UA 5FQ8A 4N39A 1KT1A 1MX6A 2J9QA 3PDNA 4FJYA 3TWVA 3Q75A 4AIFA 4G8LA 4I6JA 3LVRE 2WMNA 4BSXA 3VTYA 1OWMA 2AXUA 2KM4A 1SZ9A 5HS0A 5A23A 1DVPA 1IYGA 2WB2A 3BG0B 2MRIA 2VTBB 1FVHA 3FUDA 4UI9K 3CIAA 2IU1A 4J8EA 4GYWA 3BQOA 4B89A 3V30A 1O1RA 4GZDA 4CGVA 1W3BA 2L6JA 2NSZA 1Q2ZA 1QBQA 3ZU7B 4OVUA 5ANLA 3DRAA 5JJ7A 4UUCA 3SHFA 3CHRA 1RW2A 4A3TA 1BI8B 2WXGA 4KMOA 1QYMA 2WXJA 5G2NA 3NF1A 3BUAA 2QYJA 4YDWA 3EHMA 3OTNA 4LERA 4UQYA 4RQIA 5FIOA 3CEQA 4CDMA 3AS5A 2PZIA 3ASFA 1G3NB 3UT4A 5IY5E 2V4LA 1NL4A 3IXEA 4ACLA 2X38A 3OXFA 4UQXA 3EU9A 1NZNA 3E37A 1TNYA 2XPYA 3W9GA 1Z6TA 2E0IA 2WMOA 5CRUA 1WM5A 3UUXA 1UG3A 2ONDA 4JL0A 1E8WA 2QYUA 4FC8A 4LUNU 4KXKB 4N3BA 4CYMD 5JJTA 4AM9A 1AP7A 1O1SA 1IQRA 5CEAA 4IULA 1LTXA 3BEEA 3V2OA 4GTRA 3D3MA 1OT8A 3TWUA 1OY3D 3ZHEB 5B1BE 4DRXE 3CVYA 1N4SA 3B7BA 4UQZA 5AQ7A 1ELKA 4OVVA 2H6FA 3IKOB 2KXPC 3QKYA 3ASOE 3RU0A 5LFAA 1Y6IA 3FH5A 3CHPA 5FZQA 3F6QA 4PUCA 2ZIRA 3FEYA 3NZUA 2ETBA 4I2ZA 4F1SA 2J8SD 3HIZA 3JCKC 2EINE 3FH7A 3L13A 5ENRD 4GB9A 3UKUG 5FQ4A 2VSOE 3DSXA 4ILIA 3ABKE 2ZGGA 2Y4UA 5KNHD 5T4YA 3ESKA 1IHBA 4XE0A 3DSUA 3LJ3A 5LX8A 5ENSD 4LCTA 1TN8A 4DUIA 2UWJG 1N0RA 1HG5A 3HXEA 3KSQA 5G55A 3PH0C 3MV2B 4GTVA 2EIME 4G2VA 3FTWA 5FZRA 4FULA 4A1GA 1SZAA 5H7PA 2ETAA 2MHKA 3QJZA 3LDZA 3OXGA 5HQ8A 3AG1E 1ZU2A 3B13A 4MRUA 1UJKA 2R05A 5AENA 3FUJA 4WNDA 3EHQA 4Y6CA 3CV0A 3CVXA 4NURA 4UI9C 2GRPB 4A63B 5G04C 4W9RA 2IF4A 3CVUA 4D10C 3T9KA 5D0QD 3DEPA 3KS2A 3U64A 3APFA 4HFGA 4DJAA 2BUGA 1BU9A 3LEWA 2VSXE 1D8DA 4GA2A 1TR4A 1O5MA 2LAHA 1X5BA 4BSZB 4GTSA 3ZYKA 3LYAA 4U8YD 2L0TB 3SQVA 4BWRA 4RSYA 3DSSA 1JWFA 2AXZA 1ZB1A 2XZTG 1OXJA 2B0OE 1FPPA 1TNUA 4AV7A 1A5EA 3EIJA 2DWZA 4GMJA 5B1AE 3CHQA 5KJNA 3NZSA 3QWVA 3ZNGA 2OEWA 3AS4A 4GCOA 4DLQA 2OCCE 3Q15A 4I1AA 4U8HA 2YNQA 1UN8A 5AN8A 3ULQA 1H19A 5ENTD 1N54A 4F53A 3Q9NC 5ENNA 2Y4TA 4JD2G 4DX1A 1MX4A 4JB8P 1EYHA 5BXUA 4WUYA 4FADA 5AQBA 4TXPA 1L5JA 3MEKA 3JXJA 3SI5A 3D9HA 5LCWJ 3CK9A 1XNFA 3KEZA 1DCQA 4JA9A 2EILE 2BTDA 4JXTA 3EDTB 1TEZA 2DZNA 2NC9A 3Q78A 3ZEFA 1WAO1 4GPKA 1S70B 3I4RB 3EHRA 2B6CA 3BG1B 3P2BA 5HRYA 3FUKA 3E4BA 3UQ3A 1AWCB 1UOHA 4WNGA 4HLLA 3FUNA 1NI1A 4ANWA 3MZLB 4U8VD 2YHEA 4ABNA 1H0AA 4EBAA 3Q4AB 5BV1A 2YHCA 3JQ1A 3KEAA 2A5EA 4MS6A 4ZFHA 1MYOA 3PZ2A 3VLFA 4Q96A 4GU5A 4M7CA 2WQ7A 2I9CA 1HX8A 1HE8A 3TL5A 2A4ZA 1A17A 3ML9A 1ELRA 4YNDA 1FT1A 3IBEA 5ARGA 2HR2A 4WWNA 4XI0A 4DLOA 4I17A 4RG9A 3X2QE 1N4QA 2EIKE 3CK7A 2X3MA 3UIOC 3RSEG 3MA5A 3J5QB 2DIWA 3S7DA 3ASNE 2DCPA 2XGSA 2V5FA 3CLJA 3SBTB 4B94A 2R03A 2OVFA 2VGXA 1NA0A 1OCRE 3CKCA 3C98A 3UM0A 3S7FA 5C1DA 4YVQC 3G2VA 3SO8A 4IRUA 3PZ1A 4GA1A 4GTTA 1HH8A 1DC2A 4ANVA 2GRQB 2ILRA 4YVOA 3UKRG 3RKVA 1INZA 5J08A 3MKQA 1YA0A 2UY1A 5ARFA 2LNIA 2P9SG 2FF4A 3FEXA 4IYPA 5A7DB 4ANXA 4OAUC 2LSVA 5KCMA 3KD7A 3AS8A 1N9AA 2PM6A 3CVNA 1D8EA 3LXUX 3QDNA 1UJJA 4JC8A 4BFRA 3CVWA 4ATGA 1HU3A 3S2AA 4HI9A 3I5PA 4AP2A 3PNLB 2WPVA 3CVVA 3UT8A 3TXMA 3TJPA 4XX5A 5CBNA 2P9UG 2PNNA 3EUVA 5AYWD 2ZXWE 2WXMA 4UWHA 2P2CP 1YYHA 2J4DA 4UI9J 4GMRA 3D9LA 3SGHA 3UPVA 4I2WA 4J8SA 2X6FA 4O60A 4MKTA 3ZHEA 4DX5D 3JUIA 3QAQA 3LY9A 3DBSA 3QK0A 3UMVA 4PS7A 1EDUA 4B8AA 1Z5SC 1RZ4A 2ZU6B 3L08A 2LAIA 4LNGA 3EU5A 4TRQA 4XZ4A 3UT7A 3JQ0A 4I1MA 4DI3A 3MGBA 3QOUA 5E75A 3TWXA 4EZLA 2HE0A 1UW4B 2IONA 3B7RL 1TNBA 2WM9A 3FP3A 3NB2A 3J5PA 2JLBA 4YDYA 3B95A 5KJLA 3ZXPA 1OCZE 1V55E 2ETCA 2OV8A 3EJNA 2WXLA 2QFCA 2HYZA 3PZDA 3Q7FA 3D9OA 2WXOA 3GW4A 3TWRA 3PZ4A 4X8QA 2LUHA 3D9IA 3RRNB 4A1SA 2XPIA 3HG0D 4KZCA 3LJNA 1BLXB 3PZ3A 5EYLA 2P9KG 4JHRA 2VTBA 2PQNA 4FU3A 2Y1LE 1JWGA 4PS8A 2XPZA 5CRVA 4Q94A 1WDYA 5CHEE 3FUEA 1HXIA 2RG8A 5LCWC 4FHJA 5JHBA 3AJIA 3T8MA 1HF8A 4DX7D 5CEDB 3SFXA 2FULA 1OWPA 4KT6B 4U95D 2WXNA 3U4TA 3MYVA 3FU0A 5CCLA 3E34A 2GRRB 4FHKA 4V3IA 5FT9A 1E7VA 3S7JA 1HS6A 4O1OA 3FTSA 1S63A 1U3DA 3MJWA 4I6EA 3IHYA 4HI8A 1TNZA 2CFUA 4LEUA 2XEEA 5FQ6A 2IOSA 2FI7A 4JHJA 3Q73A 5CMYA 2KCVA 4RLYA 2V8SE 5EN5D 1U3CA 3MCXA 4HLEA 4YDOA 3VTXA 3D9JA 3CGHA 4UWKA 4J8DA 5EKQD 4ACKA 3SBSA 4WAFA 3G2TA 2YINA 3UIPC 4C48B 1PY1A 2KCLA 1TJCA 1P5QA 3HVEB 4FA6A 1LF8A 2V5QC 3FH8A 1N94A 3CSFA 4HNAD 3CQGB 2CG2A 1D9SA 4N2QA 1TYQG 3JYSA 3APCA 2CHXA 4WNEA 4RG6A 4I9EA 1FCHA 2E2EA 4GZ5A 4LG6A 5BNWA 1QQEA 4BEPA 1TNOA 2IOLA 3FTXA 4R7LA 2FEZA 2RKKA 4A3VA 1JPLA 4U07A 3FU3A 3G2SA 2FBNA 3DPYA 5CMWA 3JXIA 3PE4A 5ENQD 1JUQA 3L6AA 2R5SA 4CCAA 3W9FA 4CDNA 5AJDA 4BY6A 4GTPA 4U0SA 2RFAA 3T5XA 2M63A 1OCCE 2OEVA 3HDXA 1S64A 3CQCB 5KJKA 2UY1B 2IY0C 4HOQA 1IXVA 4BT9A 2GROB 3P1UA 1N4RA 4JA7A 3TWQA 3JUEA 4L2LA 3SFZA 5T3RA 5M72A 4FJZA 4HQDA 4JHKA 3ZYMA 2X6JA 4CEMA 3OXLA 4E6HA 4J8YA 2XHEA 3MV3B 1K8KG 3FTYA 3U9WA 3C72A 4P29A 3NOCD 4LRZA 1SA5A 2IEJA 2P9IG 1X81A 3LY8A 1KZOA 3L9TA 4GZ3A 2AW6A 1K1BA 3G2UA 4HORA 5DBKA 3ABLE 3UX4A 3NBNB 3WG7E 3V79K 3FULA 3ULEG 5BPPA 3FU6A 3CR3A 1H2TC 2BF0X 3FWVA 2GRMA 2Y69E 4L7TA 2P9PG 5FJYA 5EDSA 1OWOA 5KWDA 3ISMC 5G05J 1JCSA 2NYJA 1HZ4A 4OYSA 1H2UA 4EPZA 3RO2A 2GW1A 3NAWA 1E8YA 2P9LG 3L22A 2VGYA 2FO1E 2GRLA 4DX6D 3D9MA 3LS8A 1DNPA 2PM7A 3R9AB 2XS8A 5CECB 5EYPF 4KVMA 3C3RA 3FTZA 3KAEA 4L2YA 2VYIA 2F0YA 4RVBA 2IO3C 3IV0A 3ESLA 3C3QA 2XENA 2PQRA 4GZCA 2GRNB 2R2LA 3E30A 2XGMA 4JEUA 5FWQA 5AJLA 1PC2A 3FHEA 3L16A 4HRNA 4JEHA 5FINA 5J90A 4L9PA 3SFYA 2VJ8A 4URKA 2LO6A 1XGWA 2OOEA 4EHMA 2HO1A 4EBAG 4HS2A 2ZGDA 1BPOA 1QZ2A 4ZHBA 3LY7A 2KZTB 3BU8A 4CRWA 2J4BA 3DEOA 2WQ6A 1E7UA 3PE3A 2WXFA 2ZISA 3LPZA 3PUJA 1Z3YA 2WQHA 3CK8A 2WXQA 3R7QA 2KBXA 4DX2A 4ANUA 5JHAA 4AY5A 5D66A 3I4GA 2J49A 4KYOB 1MX2A 3MKRA 3ZKJA 1IKND 1S0PA 2RFMA 3HXDA 4FLHA 4BTAA 4GTQA 3L17A 4LSZE 5G05C 3ZYQA 2C0LA 1HFAA 4QFVA 4B93B 3MKQB 5CBOA 3HRAA 1H2VC 4EZKA 2V4HC 3LCAA 3UXGA 1QNFA 5BT1A 4GCNA 3O48A 4CT4A 3AG4E 4N5CA 4JPSA 2Q7FA 2VGEA 3E32A 3CVLA 3UM2A 4YDEA 3IEGA 4XIFA 2VSYA 1HO8A 4FLBA 2CHZA 1Y8MA 4OAVB 3SZ7A 2AWIA 4J8FA 2P58C 3QWPA 3VLEA 4C9BB 4I43A 3RK6A 4I6GA 3ZYLA 3HHMA 3DWLG 3ASDA 3ZN3A 5AQAA 4XI9A 3QC1A 4G11A 4K5AB 2L9BA 3PNTB 2X6IA 3GZ2A 2DVWA 2EIJE 4I1OB 2XEVA 2AVPA 5BV0A 3ZUVB 2AXVA 3K9IA 3RIBA 4NQ0A 1N52A 5G04J 2GGFA 2DBAA 2WXHA 5LOZA 4TV3A 3TG4A 3FY4A 4A55A 4EZJA 1OCOE 3V2XA 2JEKA 4U0ZA 3ZVVA 1GW6A 4ATZD 3ABME 1H6OA 2DYRE 2HM8A 3KSLA 4G25A 2X6HA 4TXRA 2VGXB 1UN9A 4PS3A 4H7YA 5BW8C 2Y0BG 5HKPA 3ZXSA 3RJVA 1NP7A 3VLDA 1JCQA 1NA3A 3UI2A 2IJGX 4HRLA 1NFIE 3SD5A 3FTVA 2LXMA 4F1PA 4JZYA 2H6GA 1YCSB 3T8KA 5ITZF 1KLXA 2C2LA 3GYZA 1WY6A 3Q9UC 4GPMA 3EIQC 3FDHA 2OVBA 1FVFA 1YMPA 2H6IA 4AEZC 3B7SA 3ZW3A 2J08A 2J09A 1IQUA 3ONLA 3FTUA 1EF1C 3QB2A 3T5VA 5DIZA 3ZRHA 1TN7A 3LVQE 3B7UX 3ENEA 5D0OD 3TWSA 4BERA 4G8KA 4CDRA 5JA4D 2XGOA 3GZ1A 2WXIA 4NACA 5EIBE 5EX0A 3HXCA 3AU5A 4HXIA 4GZ6A 3PEUB 3HXBA 4WWPA 4O6FA 3OAWA 3PVLA 3CVPA 3TWTA 3UINC 2I6HA 4XEIG 3Q47B 1SA4A 5A6CA 2C0MA 4G23A 3DXMG 4B0ZA 5EIDA 4BT8A 1IHGA 4GAAA 1TN6A 4N3AA 2MOWA 4UWGA 1WG0A 1N0QA 3CHOA 4E85A 1TJFA 5FZSA 4UWFA 4U0UA 3Q49B 4GYYA 2KCKA 1U2VG 2F8YA 3D9PA 4J6IA 1OWLA 3CKBA 3AAAC 2I2OA 1H6PA 4DK5A 2WVIA 3DXKG 1MQSA 2VSNA 3CHMA 3CSTA 4G26A 4N3CA 1MJ0A 2EQXA 3G2WA 3ZGQA 3TWWA 1OUVA 4KZ0A 1MHQA 2KATA 5CCMA 4U7EB 4XKBA 3GZSA 3RRUA 4LNUD 3TXNA 3DSVA 2BKKB 5ENPD 4G24A 3APDA 3ULYA 4AOFA 5HI7A 3CHSA 5B3SE 4C0EA 2BKGA 2P9NG 2DZOA 3CVQA 3U66A 3U3WA 5AAOA 5BXOA 3NOGD 3C5RA 3L82A 2CG3A 3FUFA 2JABA 5FQ7A 3UM3A 2H6HA 4I9CA 4QQIA 3EHNA 4BTBA 2PL2A 3UM1A 3DSWA 4J0UA 2V0PA 1ZBPA 1O1TA 3QWWA 4MBGA 3RO3A 3AG2E 4APOA 1H6KA 3B7TA 4H7XA 1BI7B 2XZDG 3ZFWA 1E96B 3ASHA 5ENOD 4F3VA 4DI4A 4N2SA 1EPUA 4ILGA 4PH4B 4CGWA 3FU5A 2I1JA 4HBDA 2J07A 4WWOA 3WXXA 2X6KA 4JVSA 5CERB 4U96D 5EX3A 4TUUA 3FUMA 1JCRA 4O1PA 2L0IA 4K03A 1K3ZD 2R02A 2IFUA 3AU4A 2XCCA 2XQ0A 3DPDA 1SQMA 3MX3A 1SVXA 2XEHA 1KZPA 3NQPA 4FP7A 2WXPA 3PEVB 4AJWA 4GYOA 4K0RA 5JMND 4IN3B 4B8CB 4HB5A 3FFLA 5EILA 4LNBA 4BX8A 4AXHA 4EQFA 2WXRA 1N11A 4APFA 3Q7AA 3HYMB 4HOUA 4XKCA 3Q79A 3ZPJA 3TAXA 3Q5MA 2R17C 2QZAA 4GA0A 2FO7A 3AG3E 3URZA 3TGOA 4EECA 4ME2A 4CT0A 5KJMA 3SY2A 2NXPA 4BESA 1VDYA 3ASGA 4JW1A 1PAQA 4K5CA 1HG2A 5JJ6A 4GTOA 3RAUA 4UWLA 3RRMB 5ANRA 4Y6WA 1Z3XA 2XRYA 3FUHA 3I3NA 2CFZA 1LD8A 2IO2C 1E8ZA 4ILHB 1MZCA 3D9KA 4Z68A 5AQ9A 4K5BA 3LKUA 1SW6A 2VQ2A 3IHVA 4Q69A 2BEDA 3ML8A 3PRZA 1V54E 4L23A 5E76A 3ONKA 4M3OA 3HXFA 2F8XK 4U63A 1BD8A 4DPRA 4BX9A 2LSUA 3S7BA 4CZ2D 4AY6A 2DYSE 3E33A 4HOSA 2R59A 3R7RA 3N71A 2YQ8A 2QY7A 4C0MA 4MLPA 2XCBA 2IQCA 5AIJA 5D2MC
chains in the Genus database with same CATH topology
2EINE 3X2QE 5B3SE 5B1BE 2EIKE 2OCCE 5IY5E 1OCRE 3ABLE 1OCCE 2EILE 3AG4E 1OCZE 1V55E 2EIME 1OCOE 3WG7E 2EIJE 3ABKE 2ZXWE 2DYSE 2Y69E 3AG2E 3ASNE 3ABME 3AG1E 2DYRE 1V54E 5B1AE 3AG3E 3ASOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN E;  3X2Q E;  5B3S E;  5B1B E;  2EIK E;  2OCC E;  5IY5 E;  1OCR E;  3ABL E;  1OCC E;  2EIL E;  3AG4 E;  1OCZ E;  1V55 E;  2EIM E;  1OCO E;  3WG7 E;  2EIJ E;  3ABK E;  2ZXW E;  2DYS E;  2Y69 E;  3AG2 E;  3ASN E;  3ABM E;  3AG1 E;  2DYR E;  1V54 E;  5B1A E;  3AG3 E;  3ASO E; 
#chains in the Genus database with same CATH topology
 5AAR A;  2KZT A;  3PUK A;  3TG5 A;  5KBA A;  3R9M A;  4GTM A;  3L54 A;  5T8I A;  2XRZ A;  4N5Q A;  1DCE A;  2Y3A A;  3SNX A;  1LD7 A;  4F6R D;  5KNG A;  2I1K A;  4G1T A;  3ZIM A;  4PDX A;  4NRH B;  3O4Z A;  4HOT A;  4TUM A;  4HVB A;  1E8X A;  5FTP A;  3DST A;  1E90 A;  2CHW A;  4F7A A;  3FUI A;  4U04 A;  1K1A A;  3HVE A;  4TXQ A;  3PS6 A;  4L1B A;  4NIK A;  3SF4 A;  1FT2 A;  1OWN A;  5BUZ A;  1ELW A;  2L6B A;  3D9N A;  4WNF A;  5LP0 A;  1KPS B;  2AJA A;  4GML A;  2MYO A;  2LXL A;  4KBQ A;  3UTM A;  3V31 A;  4BET A;  3C3O A;  2XS1 A;  1N4P A;  1B89 A;  4KVO A;  4HRM B;  4J7W A;  1KT0 A;  2WXK A;  4AVX A;  2F37 A;  3QNK A;  1N95 A;  2KC7 A;  3PRE A;  2RD0 A;  2QC9 A;  3QAR A;  5C2Y A;  2A5U A;  5FQ8 A;  4N39 A;  1KT1 A;  1MX6 A;  2J9Q A;  3PDN A;  4FJY A;  3TWV A;  3Q75 A;  4AIF A;  4G8L A;  4I6J A;  3LVR E;  2WMN A;  4BSX A;  3VTY A;  1OWM A;  2AXU A;  2KM4 A;  1SZ9 A;  5HS0 A;  5A23 A;  1DVP A;  1IYG A;  2WB2 A;  3BG0 B;  2MRI A;  2VTB B;  1FVH A;  3FUD A;  4UI9 K;  3CIA A;  2IU1 A;  4J8E A;  4GYW A;  3BQO A;  4B89 A;  3V30 A;  1O1R A;  4GZD A;  4CGV A;  1W3B A;  2L6J A;  2NSZ A;  1Q2Z A;  1QBQ A;  3ZU7 B;  4OVU A;  5ANL A;  3DRA A;  5JJ7 A;  4UUC A;  3SHF A;  3CHR A;  1RW2 A;  4A3T A;  1BI8 B;  2WXG A;  4KMO A;  1QYM A;  2WXJ A;  5G2N A;  3NF1 A;  3BUA A;  2QYJ A;  4YDW A;  3EHM A;  3OTN A;  4LER A;  4UQY A;  4RQI A;  5FIO A;  3CEQ A;  4CDM A;  3AS5 A;  2PZI A;  3ASF A;  1G3N B;  3UT4 A;  5IY5 E;  2V4L A;  1NL4 A;  3IXE A;  4ACL A;  2X38 A;  3OXF A;  4UQX A;  3EU9 A;  1NZN A;  3E37 A;  1TNY A;  2XPY A;  3W9G A;  1Z6T A;  2E0I A;  2WMO A;  5CRU A;  1WM5 A;  3UUX A;  1UG3 A;  2OND A;  4JL0 A;  1E8W A;  2QYU A;  4FC8 A;  4LUN U;  4KXK B;  4N3B A;  4CYM D;  5JJT A;  4AM9 A;  1AP7 A;  1O1S A;  1IQR A;  5CEA A;  4IUL A;  1LTX A;  3BEE A;  3V2O A;  4GTR A;  3D3M A;  1OT8 A;  3TWU A;  1OY3 D;  3ZHE B;  5B1B E;  4DRX E;  3CVY A;  1N4S A;  3B7B A;  4UQZ A;  5AQ7 A;  1ELK A;  4OVV A;  2H6F A;  3IKO B;  2KXP C;  3QKY A;  3ASO E;  3RU0 A;  5LFA A;  1Y6I A;  3FH5 A;  3CHP A;  5FZQ A;  3F6Q A;  4PUC A;  2ZIR A;  3FEY A;  3NZU A;  2ETB A;  4I2Z A;  4F1S A;  2J8S D;  3HIZ A;  3JCK C;  2EIN E;  3FH7 A;  3L13 A;  5ENR D;  4GB9 A;  3UKU G;  5FQ4 A;  2VSO E;  3DSX A;  4ILI A;  3ABK E;  2ZGG A;  2Y4U A;  5KNH D;  5T4Y A;  3ESK A;  1IHB A;  4XE0 A;  3DSU A;  3LJ3 A;  5LX8 A;  5ENS D;  4LCT A;  1TN8 A;  4DUI A;  2UWJ G;  1N0R A;  1HG5 A;  3HXE A;  3KSQ A;  5G55 A;  3PH0 C;  3MV2 B;  4GTV A;  2EIM E;  4G2V A;  3FTW A;  5FZR A;  4FUL A;  4A1G A;  1SZA A;  5H7P A;  2ETA A;  2MHK A;  3QJZ A;  3LDZ A;  3OXG A;  5HQ8 A;  3AG1 E;  1ZU2 A;  3B13 A;  4MRU A;  1UJK A;  2R05 A;  5AEN A;  3FUJ A;  4WND A;  3EHQ A;  4Y6C A;  3CV0 A;  3CVX A;  4NUR A;  4UI9 C;  2GRP B;  4A63 B;  5G04 C;  4W9R A;  2IF4 A;  3CVU A;  4D10 C;  3T9K A;  5D0Q D;  3DEP A;  3KS2 A;  3U64 A;  3APF A;  4HFG A;  4DJA A;  2BUG A;  1BU9 A;  3LEW A;  2VSX E;  1D8D A;  4GA2 A;  1TR4 A;  1O5M A;  2LAH A;  1X5B A;  4BSZ B;  4GTS A;  3ZYK A;  3LYA A;  4U8Y D;  2L0T B;  3SQV A;  4BWR A;  4RSY A;  3DSS A;  1JWF A;  2AXZ A;  1ZB1 A;  2XZT G;  1OXJ A;  2B0O E;  1FPP A;  1TNU A;  4AV7 A;  1A5E A;  3EIJ A;  2DWZ A;  4GMJ A;  5B1A E;  3CHQ A;  5KJN A;  3NZS A;  3QWV A;  3ZNG A;  2OEW A;  3AS4 A;  4GCO A;  4DLQ A;  2OCC E;  3Q15 A;  4I1A A;  4U8H A;  2YNQ A;  1UN8 A;  5AN8 A;  3ULQ A;  1H19 A;  5ENT D;  1N54 A;  4F53 A;  3Q9N C;  5ENN A;  2Y4T A;  4JD2 G;  4DX1 A;  1MX4 A;  4JB8 P;  1EYH A;  5BXU A;  4WUY A;  4FAD A;  5AQB A;  4TXP A;  1L5J A;  3MEK A;  3JXJ A;  3SI5 A;  3D9H A;  5LCW J;  3CK9 A;  1XNF A;  3KEZ A;  1DCQ A;  4JA9 A;  2EIL E;  2BTD A;  4JXT A;  3EDT B;  1TEZ A;  2DZN A;  2NC9 A;  3Q78 A;  3ZEF A;  1WAO 1;  4GPK A;  1S70 B;  3I4R B;  3EHR A;  2B6C A;  3BG1 B;  3P2B A;  5HRY A;  3FUK A;  3E4B A;  3UQ3 A;  1AWC B;  1UOH A;  4WNG A;  4HLL A;  3FUN A;  1NI1 A;  4ANW A;  3MZL B;  4U8V D;  2YHE A;  4ABN A;  1H0A A;  4EBA A;  3Q4A B;  5BV1 A;  2YHC A;  3JQ1 A;  3KEA A;  2A5E A;  4MS6 A;  4ZFH A;  1MYO A;  3PZ2 A;  3VLF A;  4Q96 A;  4GU5 A;  4M7C A;  2WQ7 A;  2I9C A;  1HX8 A;  1HE8 A;  3TL5 A;  2A4Z A;  1A17 A;  3ML9 A;  1ELR A;  4YND A;  1FT1 A;  3IBE A;  5ARG A;  2HR2 A;  4WWN A;  4XI0 A;  4DLO A;  4I17 A;  4RG9 A;  3X2Q E;  1N4Q A;  2EIK E;  3CK7 A;  2X3M A;  3UIO C;  3RSE G;  3MA5 A;  3J5Q B;  2DIW A;  3S7D A;  3ASN E;  2DCP A;  2XGS A;  2V5F A;  3CLJ A;  3SBT B;  4B94 A;  2R03 A;  2OVF A;  2VGX A;  1NA0 A;  1OCR E;  3CKC A;  3C98 A;  3UM0 A;  3S7F A;  5C1D A;  4YVQ C;  3G2V A;  3SO8 A;  4IRU A;  3PZ1 A;  4GA1 A;  4GTT A;  1HH8 A;  1DC2 A;  4ANV A;  2GRQ B;  2ILR A;  4YVO A;  3UKR G;  3RKV A;  1INZ A;  5J08 A;  3MKQ A;  1YA0 A;  2UY1 A;  5ARF A;  2LNI A;  2P9S G;  2FF4 A;  3FEX A;  4IYP A;  5A7D B;  4ANX A;  4OAU C;  2LSV A;  5KCM A;  3KD7 A;  3AS8 A;  1N9A A;  2PM6 A;  3CVN A;  1D8E A;  3LXU X;  3QDN A;  1UJJ A;  4JC8 A;  4BFR A;  3CVW A;  4ATG A;  1HU3 A;  3S2A A;  4HI9 A;  3I5P A;  4AP2 A;  3PNL B;  2WPV A;  3CVV A;  3UT8 A;  3TXM A;  3TJP A;  4XX5 A;  5CBN A;  2P9U G;  2PNN A;  3EUV A;  5AYW D;  2ZXW E;  2WXM A;  4UWH A;  2P2C P;  1YYH A;  2J4D A;  4UI9 J;  4GMR A;  3D9L A;  3SGH A;  3UPV A;  4I2W A;  4J8S A;  2X6F A;  4O60 A;  4MKT A;  3ZHE A;  4DX5 D;  3JUI A;  3QAQ A;  3LY9 A;  3DBS A;  3QK0 A;  3UMV A;  4PS7 A;  1EDU A;  4B8A A;  1Z5S C;  1RZ4 A;  2ZU6 B;  3L08 A;  2LAI A;  4LNG A;  3EU5 A;  4TRQ A;  4XZ4 A;  3UT7 A;  3JQ0 A;  4I1M A;  4DI3 A;  3MGB A;  3QOU A;  5E75 A;  3TWX A;  4EZL A;  2HE0 A;  1UW4 B;  2ION A;  3B7R L;  1TNB A;  2WM9 A;  3FP3 A;  3NB2 A;  3J5P A;  2JLB A;  4YDY A;  3B95 A;  5KJL A;  3ZXP A;  1OCZ E;  1V55 E;  2ETC A;  2OV8 A;  3EJN A;  2WXL A;  2QFC A;  2HYZ A;  3PZD A;  3Q7F A;  3D9O A;  2WXO A;  3GW4 A;  3TWR A;  3PZ4 A;  4X8Q A;  2LUH A;  3D9I A;  3RRN B;  4A1S A;  2XPI A;  3HG0 D;  4KZC A;  3LJN A;  1BLX B;  3PZ3 A;  5EYL A;  2P9K G;  4JHR A;  2VTB A;  2PQN A;  4FU3 A;  2Y1L E;  1JWG A;  4PS8 A;  2XPZ A;  5CRV A;  4Q94 A;  1WDY A;  5CHE E;  3FUE A;  1HXI A;  2RG8 A;  5LCW C;  4FHJ A;  5JHB A;  3AJI A;  3T8M A;  1HF8 A;  4DX7 D;  5CED B;  3SFX A;  2FUL A;  1OWP A;  4KT6 B;  4U95 D;  2WXN A;  3U4T A;  3MYV A;  3FU0 A;  5CCL A;  3E34 A;  2GRR B;  4FHK A;  4V3I A;  5FT9 A;  1E7V A;  3S7J A;  1HS6 A;  4O1O A;  3FTS A;  1S63 A;  1U3D A;  3MJW A;  4I6E A;  3IHY A;  4HI8 A;  1TNZ A;  2CFU A;  4LEU A;  2XEE A;  5FQ6 A;  2IOS A;  2FI7 A;  4JHJ A;  3Q73 A;  5CMY A;  2KCV A;  4RLY A;  2V8S E;  5EN5 D;  1U3C A;  3MCX A;  4HLE A;  4YDO A;  3VTX A;  3D9J A;  3CGH A;  4UWK A;  4J8D A;  5EKQ D;  4ACK A;  3SBS A;  4WAF A;  3G2T A;  2YIN A;  3UIP C;  4C48 B;  1PY1 A;  2KCL A;  1TJC A;  1P5Q A;  3HVE B;  4FA6 A;  1LF8 A;  2V5Q C;  3FH8 A;  1N94 A;  3CSF A;  4HNA D;  3CQG B;  2CG2 A;  1D9S A;  4N2Q A;  1TYQ G;  3JYS A;  3APC A;  2CHX A;  4WNE A;  4RG6 A;  4I9E A;  1FCH A;  2E2E A;  4GZ5 A;  4LG6 A;  5BNW A;  1QQE A;  4BEP A;  1TNO A;  2IOL A;  3FTX A;  4R7L A;  2FEZ A;  2RKK A;  4A3V A;  1JPL A;  4U07 A;  3FU3 A;  3G2S A;  2FBN A;  3DPY A;  5CMW A;  3JXI A;  3PE4 A;  5ENQ D;  1JUQ A;  3L6A A;  2R5S A;  4CCA A;  3W9F A;  4CDN A;  5AJD A;  4BY6 A;  4GTP A;  4U0S A;  2RFA A;  3T5X A;  2M63 A;  1OCC E;  2OEV A;  3HDX A;  1S64 A;  3CQC B;  5KJK A;  2UY1 B;  2IY0 C;  4HOQ A;  1IXV A;  4BT9 A;  2GRO B;  3P1U A;  1N4R A;  4JA7 A;  3TWQ A;  3JUE A;  4L2L A;  3SFZ A;  5T3R A;  5M72 A;  4FJZ A;  4HQD A;  4JHK A;  3ZYM A;  2X6J A;  4CEM A;  3OXL A;  4E6H A;  4J8Y A;  2XHE A;  3MV3 B;  1K8K G;  3FTY A;  3U9W A;  3C72 A;  4P29 A;  3NOC D;  4LRZ A;  1SA5 A;  2IEJ A;  2P9I G;  1X81 A;  3LY8 A;  1KZO A;  3L9T A;  4GZ3 A;  2AW6 A;  1K1B A;  3G2U A;  4HOR A;  5DBK A;  3ABL E;  3UX4 A;  3NBN B;  3WG7 E;  3V79 K;  3FUL A;  3ULE G;  5BPP A;  3FU6 A;  3CR3 A;  1H2T C;  2BF0 X;  3FWV A;  2GRM A;  2Y69 E;  4L7T A;  2P9P G;  5FJY A;  5EDS A;  1OWO A;  5KWD A;  3ISM C;  5G05 J;  1JCS A;  2NYJ A;  1HZ4 A;  4OYS A;  1H2U A;  4EPZ A;  3RO2 A;  2GW1 A;  3NAW A;  1E8Y A;  2P9L G;  3L22 A;  2VGY A;  2FO1 E;  2GRL A;  4DX6 D;  3D9M A;  3LS8 A;  1DNP A;  2PM7 A;  3R9A B;  2XS8 A;  5CEC B;  5EYP F;  4KVM A;  3C3R A;  3FTZ A;  3KAE A;  4L2Y A;  2VYI A;  2F0Y A;  4RVB A;  2IO3 C;  3IV0 A;  3ESL A;  3C3Q A;  2XEN A;  2PQR A;  4GZC A;  2GRN B;  2R2L A;  3E30 A;  2XGM A;  4JEU A;  5FWQ A;  5AJL A;  1PC2 A;  3FHE A;  3L16 A;  4HRN A;  4JEH A;  5FIN A;  5J90 A;  4L9P A;  3SFY A;  2VJ8 A;  4URK A;  2LO6 A;  1XGW A;  2OOE A;  4EHM A;  2HO1 A;  4EBA G;  4HS2 A;  2ZGD A;  1BPO A;  1QZ2 A;  4ZHB A;  3LY7 A;  2KZT B;  3BU8 A;  4CRW A;  2J4B A;  3DEO A;  2WQ6 A;  1E7U A;  3PE3 A;  2WXF A;  2ZIS A;  3LPZ A;  3PUJ A;  1Z3Y A;  2WQH A;  3CK8 A;  2WXQ A;  3R7Q A;  2KBX A;  4DX2 A;  4ANU A;  5JHA A;  4AY5 A;  5D66 A;  3I4G A;  2J49 A;  4KYO B;  1MX2 A;  3MKR A;  3ZKJ A;  1IKN D;  1S0P A;  2RFM A;  3HXD A;  4FLH A;  4BTA A;  4GTQ A;  3L17 A;  4LSZ E;  5G05 C;  3ZYQ A;  2C0L A;  1HFA A;  4QFV A;  4B93 B;  3MKQ B;  5CBO A;  3HRA A;  1H2V C;  4EZK A;  2V4H C;  3LCA A;  3UXG A;  1QNF A;  5BT1 A;  4GCN A;  3O48 A;  4CT4 A;  3AG4 E;  4N5C A;  4JPS A;  2Q7F A;  2VGE A;  3E32 A;  3CVL A;  3UM2 A;  4YDE A;  3IEG A;  4XIF A;  2VSY A;  1HO8 A;  4FLB A;  2CHZ A;  1Y8M A;  4OAV B;  3SZ7 A;  2AWI A;  4J8F A;  2P58 C;  3QWP A;  3VLE A;  4C9B B;  4I43 A;  3RK6 A;  4I6G A;  3ZYL A;  3HHM A;  3DWL G;  3ASD A;  3ZN3 A;  5AQA A;  4XI9 A;  3QC1 A;  4G11 A;  4K5A B;  2L9B A;  3PNT B;  2X6I A;  3GZ2 A;  2DVW A;  2EIJ E;  4I1O B;  2XEV A;  2AVP A;  5BV0 A;  3ZUV B;  2AXV A;  3K9I A;  3RIB A;  4NQ0 A;  1N52 A;  5G04 J;  2GGF A;  2DBA A;  2WXH A;  5LOZ A;  4TV3 A;  3TG4 A;  3FY4 A;  4A55 A;  4EZJ A;  1OCO E;  3V2X A;  2JEK A;  4U0Z A;  3ZVV A;  1GW6 A;  4ATZ D;  3ABM E;  1H6O A;  2DYR E;  2HM8 A;  3KSL A;  4G25 A;  2X6H A;  4TXR A;  2VGX B;  1UN9 A;  4PS3 A;  4H7Y A;  5BW8 C;  2Y0B G;  5HKP A;  3ZXS A;  3RJV A;  1NP7 A;  3VLD A;  1JCQ A;  1NA3 A;  3UI2 A;  2IJG X;  4HRL A;  1NFI E;  3SD5 A;  3FTV A;  2LXM A;  4F1P A;  4JZY A;  2H6G A;  1YCS B;  3T8K A;  5ITZ F;  1KLX A;  2C2L A;  3GYZ A;  1WY6 A;  3Q9U C;  4GPM A;  3EIQ C;  3FDH A;  2OVB A;  1FVF A;  1YMP A;  2H6I A;  4AEZ C;  3B7S A;  3ZW3 A;  2J08 A;  2J09 A;  1IQU A;  3ONL A;  3FTU A;  1EF1 C;  3QB2 A;  3T5V A;  5DIZ A;  3ZRH A;  1TN7 A;  3LVQ E;  3B7U X;  3ENE A;  5D0O D;  3TWS A;  4BER A;  4G8K A;  4CDR A;  5JA4 D;  2XGO A;  3GZ1 A;  2WXI A;  4NAC A;  5EIB E;  5EX0 A;  3HXC A;  3AU5 A;  4HXI A;  4GZ6 A;  3PEU B;  3HXB A;  4WWP A;  4O6F A;  3OAW A;  3PVL A;  3CVP A;  3TWT A;  3UIN C;  2I6H A;  4XEI G;  3Q47 B;  1SA4 A;  5A6C A;  2C0M A;  4G23 A;  3DXM G;  4B0Z A;  5EID A;  4BT8 A;  1IHG A;  4GAA A;  1TN6 A;  4N3A A;  2MOW A;  4UWG A;  1WG0 A;  1N0Q A;  3CHO A;  4E85 A;  1TJF A;  5FZS A;  4UWF A;  4U0U A;  3Q49 B;  4GYY A;  2KCK A;  1U2V G;  2F8Y A;  3D9P A;  4J6I A;  1OWL A;  3CKB A;  3AAA C;  2I2O A;  1H6P A;  4DK5 A;  2WVI A;  3DXK G;  1MQS A;  2VSN A;  3CHM A;  3CST A;  4G26 A;  4N3C A;  1MJ0 A;  2EQX A;  3G2W A;  3ZGQ A;  3TWW A;  1OUV A;  4KZ0 A;  1MHQ A;  2KAT A;  5CCM A;  4U7E B;  4XKB A;  3GZS A;  3RRU A;  4LNU D;  3TXN A;  3DSV A;  2BKK B;  5ENP D;  4G24 A;  3APD A;  3ULY A;  4AOF A;  5HI7 A;  3CHS A;  5B3S E;  4C0E A;  2BKG A;  2P9N G;  2DZO A;  3CVQ A;  3U66 A;  3U3W A;  5AAO A;  5BXO A;  3NOG D;  3C5R A;  3L82 A;  2CG3 A;  3FUF A;  2JAB A;  5FQ7 A;  3UM3 A;  2H6H A;  4I9C A;  4QQI A;  3EHN A;  4BTB A;  2PL2 A;  3UM1 A;  3DSW A;  4J0U A;  2V0P A;  1ZBP A;  1O1T A;  3QWW A;  4MBG A;  3RO3 A;  3AG2 E;  4APO A;  1H6K A;  3B7T A;  4H7X A;  1BI7 B;  2XZD G;  3ZFW A;  1E96 B;  3ASH A;  5ENO D;  4F3V A;  4DI4 A;  4N2S A;  1EPU A;  4ILG A;  4PH4 B;  4CGW A;  3FU5 A;  2I1J A;  4HBD A;  2J07 A;  4WWO A;  3WXX A;  2X6K A;  4JVS A;  5CER B;  4U96 D;  5EX3 A;  4TUU A;  3FUM A;  1JCR A;  4O1P A;  2L0I A;  4K03 A;  1K3Z D;  2R02 A;  2IFU A;  3AU4 A;  2XCC A;  2XQ0 A;  3DPD A;  1SQM A;  3MX3 A;  1SVX A;  2XEH A;  1KZP A;  3NQP A;  4FP7 A;  2WXP A;  3PEV B;  4AJW A;  4GYO A;  4K0R A;  5JMN D;  4IN3 B;  4B8C B;  4HB5 A;  3FFL A;  5EIL A;  4LNB A;  4BX8 A;  4AXH A;  4EQF A;  2WXR A;  1N11 A;  4APF A;  3Q7A A;  3HYM B;  4HOU A;  4XKC A;  3Q79 A;  3ZPJ A;  3TAX A;  3Q5M A;  2R17 C;  2QZA A;  4GA0 A;  2FO7 A;  3AG3 E;  3URZ A;  3TGO A;  4EEC A;  4ME2 A;  4CT0 A;  5KJM A;  3SY2 A;  2NXP A;  4BES A;  1VDY A;  3ASG A;  4JW1 A;  1PAQ A;  4K5C A;  1HG2 A;  5JJ6 A;  4GTO A;  3RAU A;  4UWL A;  3RRM B;  5ANR A;  4Y6W A;  1Z3X A;  2XRY A;  3FUH A;  3I3N A;  2CFZ A;  1LD8 A;  2IO2 C;  1E8Z A;  4ILH B;  1MZC A;  3D9K A;  4Z68 A;  5AQ9 A;  4K5B A;  3LKU A;  1SW6 A;  2VQ2 A;  3IHV A;  4Q69 A;  2BED A;  3ML8 A;  3PRZ A;  1V54 E;  4L23 A;  5E76 A;  3ONK A;  4M3O A;  3HXF A;  2F8X K;  4U63 A;  1BD8 A;  4DPR A;  4BX9 A;  2LSU A;  3S7B A;  4CZ2 D;  4AY6 A;  2DYS E;  3E33 A;  4HOS A;  2R59 A;  3R7R A;  3N71 A;  2YQ8 A;  2QY7 A;  4C0M A;  4MLP A;  2XCB A;  2IQC A;  5AIJ A;  5D2M C; 
#chains in the Genus database with same CATH homology
 2EIN E;  3X2Q E;  5B3S E;  5B1B E;  2EIK E;  2OCC E;  5IY5 E;  1OCR E;  3ABL E;  1OCC E;  2EIL E;  3AG4 E;  1OCZ E;  1V55 E;  2EIM E;  1OCO E;  3WG7 E;  2EIJ E;  3ABK E;  2ZXW E;  2DYS E;  2Y69 E;  3AG2 E;  3ASN E;  3ABM E;  3AG1 E;  2DYR E;  1V54 E;  5B1A E;  3AG3 E;  3ASO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...