3ASNE

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
b'HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3asnE00
3AG4E 3X2QE 2EIJE 3AG2E 3WG7E 1V54E 1OCOE 5B1BE 3ASOE 2EIKE 2OCCE 3ABLE 5B1AE 1OCRE 3ASNE 2ZXWE 2DYSE 3AG1E 1V55E 3ABME 2EINE 2Y69E 5B3SE 1OCZE 3ABKE 2EILE 2EIME 3AG3E 1OCCE 2DYRE 5IY5E
chains in the Genus database with same CATH superfamily
2WQHA 3C3OA 4GCOA 1D8DA 2GW1A 4U0UA 1QQEA 5D0OD 4I6JA 1SA5A 3FH8A 2KM4A 3NB2A 4Y6WA 1U3CA 1HH8A 5FQ8A 3FTUA 4MBGA 2WB2A 4BTBA 3UT4A 3SNXA 4WNGA 4BSXA 2WM9A 1YYHA 3FP3A 3LYAA 3KS2A 5AENA 2E2EA 3FDHA 1YCSB 3B13A 3EDTB 3PUJA 2RKKA 1IKND 4G11A 3FUHA 3OAWA 4I2WA 1IXVA 5FQ7A 3HXCA 2C0MA 3CVPA 3MZLB 2OCCE 2XPIA 3RAUA 3AG1E 4OAUC 4DUIA 4I6GA 3ABKE 4WWNA 1FT1A 3UM2A 1N52A 4EBAA 3SY2A 4DX6D 1MYOA 2I1KA 3FH7A 3EU5A 2Y1LE 4JA9A 2VTBA 4FC8A 2J4BA 2VGYA 1NA0A 3T9KA 1H2TC 2JEKA 2VGXA 4CDMA 3BU8A 1P5QA 3QC1A 1JCQA 3TWRA 4O1PA 2JABA 2X6KA 5FT9A 1KPSB 3IEGA 5G05J 1A5EA 3B7TA 5KJMA 4ANWA 3CHPA 3SI5A 2GGFA 2B0OE 4TUMA 3ZIMA 1NP7A 5CHEE 4YVOA 4NACA 4U7EB 4APOA 3PNTB 2MOWA 3ZPJA 3DRAA 4DLOA 2VSYA 3ASOE 4ZHBA 1TR4A 3Q9NC 3KSLA 4GZCA 4BFRA 2IO3C 4WWPA 4RQIA 2YNQA 1O1RA 2HR2A 4ILIA 5CCMA 2Y3AA 4NURA 1ELWA 3Q75A 4DX2A 4C0EA 5JHBA 2IF4A 3E32A 5ENTD 3FH5A 4NRHB 3ESKA 3EHNA 4KYOB 3TWSA 3RU0A 1BLXB 3CK7A 2P9NG 3GZSA 3UINC 5G2NA 2IO2C 4L9PA 4UI9C 1E90A 1E8ZA 1HX8A 2AVPA 3D9MA 2V0PA 3ULYA 3HIZA 4TXQA 2IQCA 3TJPA 1Z6TA 2C2LA 1WM5A 5G04C 3HG0D 1MX4A 4PUCA 1QBQA 4A1GA 2QY7A 3IHVA 3ZHEA 3DEPA 2XENA 4N2SA 1INZA 4BT9A 2WPVA 2XS1A 5AAOA 3LXUX 4ANVA 4GTQA 4CYMD 1Y6IA 4DX1A 4UWFA 4ANUA 1SW6A 4NQ0A 1DC2A 3FUJA 4I43A 2NSZA 3VTYA 4ME2A 2V5QC 3SHFA 2R05A 2RG8A 3UT8A 5C1DA 4BWRA 4N3BA 2OVFA 2ZXWE 2OVBA 5FQ6A 4HRLA 3L9TA 5KCMA 3E34A 1NL4A 4F6RD 3UI2A 4TXPA 4KVOA 5BPPA 2AXUA 4O60A 2HM8A 3WXXA 1HXIA 1TNBA 2LNIA 4HRNA 4U8HA 4G23A 3HVEA 3P2BA 1LTXA 2OV8A 3ISMC 3SD5A 3V30A 3V31A 4UQXA 1DVPA 4PDXA 2H6GA 2VTBB 2I6HA 3VLEA 4FADA 5LOZA 2V8SE 3VLFA 2FO7A 2VGXB 3SBSA 3RIBA 4F1SA 4AIFA 2ONDA 2P9IG 1D9SA 4KMOA 2J09A 3PS6A 2AXVA 4QQIA 4QFVA 2GRNB 2J49A 5T3RA 3TL5A 3MV3B 3DWLG 2XHEA 4DJAA 3MA5A 1OCCE 4GU5A 4FLHA 3TG4A 1K1AA 5FJYA 2B6CA 4I9EA 4U95D 2IOLA 2X6FA 1TNUA 3AS4A 2ZGGA 3TWWA 2IONA 2GRMA 4IRUA 1LD8A 1NI1A 4GZ5A 1N0QA 3QB2A 3PEUB 2CHZA 5ENOD 3SF4A 3C5RA 2WXNA 3ZUVB 4U8VD 1UN9A 3S7FA 4E85A 2A5UA 2L0TB 1WDYA 2PM6A 5DBKA 4JZYA 5FIOA 5HI7A 4CGVA 2XGOA 3FUDA 3RO2A 5KBAA 3D9HA 3IHYA 4L1BA 4ATZD 2AJAA 3D3MA 1U2VG 2HO1A 2XEVA 3MCXA 2XEHA 2Y0BG 3Q78A 3UUXA 3NZSA 4U96D 1H2VC 5CRUA 1BD8A 3Q9UC 3TWUA 4XX5A 1ELRA 4UQZA 4RSYA 1UOHA 3Q5MA 3FFLA 3G2VA 2PNNA 1S63A 1N95A 3ZYMA 4AOFA 3ZHEB 4I17A 1NA3A 3Q47B 5CERB 4G25A 3T5VA 3AAAC 2PQRA 1QZ2A 2XPYA 3CK9A 3U64A 3JQ1A 3PVLA 4OVUA 3FUFA 2LXMA 2OEVA 3AS5A 3SZ7A 3PRZA 2C0LA 2AXZA 1O5MA 3ABME 3V2OA 1S64A 3QWPA 4ABNA 1IYGA 4UWLA 4BSZB 1OCOE 2OEWA 2X6JA 4F1PA 2P9PG 2WXKA 2LSVA 1SZ9A 3G2UA 3QARA 3ML8A 2WXOA 2P9SG 4HLEA 2EIME 4YDOA 5EN5D 5FTPA 4OAVB 3HVEB 4HVBA 4Q94A 2E0IA 2V4LA 1U3DA 3KSQA 3ASNE 4GZ6A 4FHKA 4LG6A 2CG2A 3LKUA 3JXJA 2BF0X 3I4RB 3SFZA 3N71A 4Z68A 2UWJG 2Q7FA 3QKYA 4C9BB 4BETA 4TRQA 4LNUD 5H7PA 4K5AB 3I4GA 5ENNA 1NZNA 1SZAA 1G3NB 5JJ7A 4N5CA 2P58C 3JCKC 3D9PA 3ENEA 3MJWA 4Q96A 4JPSA 2XPZA 3QWVA 3J5QB 4I1AA 4AP2A 2R02A 1N54A 4MLPA 5G55A 3T8KA 1SVXA 1E7VA 2NXPA 4EZLA 5EDSA 5A23A 3NOCD 2CFZA 4ACLA 3FUNA 3UT7A 3G2SA 1NFIE 1TNOA 3FU0A 1N4RA 2IY0C 3CK8A 1OWMA 3W9GA 3CHSA 4IN3B 4O6FA 3Q4AB 3LEWA 2DZNA 5JA4D 3FHEA 4RVBA 4B0ZA 1K8KG 4BX8A 1UJJA 2L6BA 2V4HC 3CVLA 1Z5SC 2FEZA 4J8YA 5KNHD 3NAWA 5CECB 3MGBA 2DCPA 3FTXA 4OYSA 3ULEG 4PS3A 3ASGA 5HS0A 1OWNA 2KZTB 4YDYA 4RLYA 3E37A 3EIQC 4JA7A 1KT1A 2R59A 4HXIA 4GA2A 3QWWA 4LSZE 4WUYA 3ML9A 4ANXA 1RZ4A 1YMPA 4UUCA 4GMRA 5T8IA 4XI0A 3RSEG 4ILHB 4I2ZA 4DI4A 3ZXPA 2WXMA 3CVUA 4AEZC 1HG5A 2EILE 1JPLA 4WNFA 3Q7AA 3RO3A 4HOSA 2WMOA 3PZ3A 4GYOA 4GTTA 4YDEA 1N4SA 3URZA 2J07A 1O1SA 4MRUA 4N39A 5EX3A 2KBXA 1FCHA 3EIJA 2QYUA 1XNFA 3PDNA 4HS2A 4DPRA 2FULA 1UW4B 5AARA 5JJTA 1UJKA 1XGWA 2L9BA 3KD7A 4JHRA 4BERA 4RG9A 3T8MA 4AXHA 1QNFA 4PS8A 4I1OB 4KT6B 1TN6A 3CVNA 1Y8MA 3ZKJA 4FJZA 2J4DA 3U66A 3UIPC 4UWKA 4E6HA 2YINA 3HRAA 1HS6A 2P9UG 4LUNU 4M7CA 4KBQA 3D9IA 3DSTA 3FULA 4BY6A 3NF1A 3CSFA 4U8YD 4FJYA 3HXBA 4DK5A 1MZCA 3CSTA 3RJVA 3U4TA 4N3CA 3Q79A 2XZTG 2R03A 2J08A 2KATA 1K3ZD 1H6PA 3CIAA 3HXEA 5CEAA 3U9WA 3LCAA 4HLLA 4FU3A 3E33A 3ASDA 2LSUA 3VTXA 2HE0A 3FU3A 4CDNA 3E4BA 2DZOA 1Z3YA 3UM3A 3LPZA 4JEUA 4U04A 4F3VA 4HNAD 4BX9A 1OY3D 3QK0A 4AY5A 1OXJA 4B94A 2JLBA 5FZSA 4HBDA 4FA6A 2DBAA 4FHJA 4GAAA 3AU5A 1TYQG 3F6QA 3LJNA 3EU9A 4FLBA 1WAO1 5J90A 4U0ZA 4XI9A 3Q73A 1SA4A 3PUKA 1HO8A 3ONKA 4JW1A 4I9CA 5AIJA 2CG3A 2A5EA 2WVIA 4G26A 5BXOA 2PL2A 3MKQA 4EBAG 2I2OA 3CVYA 5KNGA 5AQAA 1FVHA 2MHKA 5BXUA 2Y4TA 4M3OA 2XGSA 3LDZA 2KXPC 5CMYA 4GPKA 4L2YA 2IU1A 3DXMG 4J8DA 3I3NA 2CFUA 3GZ1A 3KAEA 3C72A 3UIOC 3TXMA 4CT0A 2QZAA 1LF8A 4UI9K 1YA0A 1FPPA 1HU3A 3V79K 2KCVA 4WNDA 2V5FA 3PZ1A 3NZUA 3CLJA 1IQRA 1TJCA 1A17A 3X2QE 3AG2E 1H6KA 1IHGA 5ARGA 2EQXA 4K5CA 3CHMA 2L0IA 3UXGA 2DYSE 3LY7A 2R17C 1S0PA 3JYSA 3L13A 1TJFA 1S70B 4LNBA 3CVWA 1MHQA 5JHAA 3CHQA 2WMNA 1X5BA 3PEVB 3RKVA 3L82A 2R5SA 4OVVA 4U07A 5CBNA 1ZB1A 4GMLA 1EF1C 3APDA 2VQ2A 3L17A 1H6OA 1KT0A 1IHBA 1N9AA 4ACKA 4K5BA 3BQOA 3I5PA 5BNWA 3ZEFA 1VDYA 3PZ2A 2PQNA 1PC2A 1EYHA 2FBNA 3MYVA 5KJNA 3ABLE 4BTAA 4HI9A 3LY9A 1OT8A 3Q49B 5A6CA 3KEAA 2KZTA 3HHMA 5EYPF 4BESA 3FTZA 3B7BA 4AV7A 5ENPD 3EHRA 3ZU7B 3SFYA 3PREA 3C3QA 3CHRA 3W9FA 1D8EA 4JHKA 4DX7D 4B8AA 3PZDA 4LNGA 2R2LA 2VSOE 1AP7A 2KC7A 1N4QA 2FF4A 5B3SE 2YHCA 1QYMA 3OXLA 3CKBA 2RD0A 3NOGD 3SQVA 1N11A 4EHMA 5J08A 1SQMA 5DIZA 3S2AA 3MEKA 2XQ0A 4H7XA 2P9KG 4R7LA 5LP0A 3PNLB 4L7TA 1HG2A 5FINA 2BEDA 3ZXSA 3ZYKA 3QNKA 3HDXA 5LCWJ 4EPZA 4URKA 1AWCB 3B7UX 4J0UA 3IBEA 4XEIG 4GYWA 3VLDA 5CEDB 2A4ZA 5KJLA 1V55E 5G05C 2DWZA 2Y69E 4CEMA 1Z3XA 4HQDA 3AG3E 4TUUA 3MKQB 1V54E 2X6HA 3LS8A 2LAIA 3ZRHA 2ZGDA 1X81A 4KXKB 4XIFA 5LX8A 5AQBA 2ZISA 2GRQB 1OUVA 3SGHA 5EILA 2AWIA 3R9AB 1KZOA 2WQ6A 4UQYA 2YQ8A 4D10C 3PH0C 5E76A 4GTSA 1H2UA 4GB9A 4AVXA 3UM0A 3FUMA 3O48A 3FTSA 4FP7A 3R9MA 2XEEA 3QDNA 1MX2A 2I1JA 3WG7E 3B7RL 4NIKA 3UQ3A 3DSWA 4UWGA 1IQUA 4TXRA 1JCSA 4CRWA 2H6IA 3L6AA 3FTWA 4EZJA 2WXQA 2ETCA 2VJ8A 4K0RA 2WXPA 5EIBE 4MKTA 2P9LG 4Q69A 3JUEA 2J9QA 1ZBPA 2WXFA 4B93B 5BW8C 5ENSD 4CDRA 4HI8A 4U63A 3PZ4A 4H7YA 3RRMB 4F53A 3D9LA 4HOQA 3ESLA 4G8KA 4XKCA 2BKGA 5IY5E 2LO6A 3ZN3A 5HKPA 3EHMA 1MJ0A 2X38A 3UM1A 1OWOA 1UG3A 3O4ZA 3JUIA 5ITZF 5BT1A 1JUQA 3LVQE 5C2YA 4AM9A 2XGMA 4J6IA 4BT8A 4GA0A 1JWGA 5ARFA 2KCKA 4PS7A 4HORA 4XE0A 2MRIA 2LXLA 3L22A 3D9KA 3TXNA 3APFA 4XKBA 4HB5A 1RW2A 2GRRB 1UN8A 4V3IA 3CQCB 4J8SA 3ZNGA 5ANRA 2DIWA 2FI7A 2XRYA 1H0AA 3UPVA 1OCRE 3HXFA 2VGEA 3IXEA 3GZ2A 5AJDA 2ETAA 4TV3A 1MQSA 3ASFA 3TWQA 4C0MA 3AG4E 3OXGA 1HFAA 4CT4A 1TNYA 2PZIA 4CGWA 4XZ4A 2XRZA 4B8CB 3ONLA 1HE8A 2VSXE 2WXIA 4X8QA 4U0SA 4L23A 3K9IA 5CRVA 4DLQA 2VYIA 2RFAA 1BU9A 5T4YA 1MX6A 2XCBA 3LY8A 2F0YA 2EIJE 1L5JA 4MS6A 4WNEA 5E75A 4GTRA 4RG6A 3D9OA 3AJIA 3CQGB 2CHWA 4I1MA 3ZVVA 3D9NA 2P2CP 2X6IA 3C98A 4W9RA 4JC8A 3FUEA 1KZPA 2PM7A 3DBSA 2GRLA 4B89A 3UTMA 1DCQA 4JEHA 1OWLA 1TN7A 4ZFHA 2DVWA 4HRMB 2WXRA 5EX0A 3ZYQA 3QAQA 5EIDA 3P1UA 4KZCA 1TNZA 3CKCA 2DYRE 4O1OA 1DNPA 4YVQC 3V2XA 3FTYA 5M72A 2NYJA 3L08A 3BUAA 4G2VA 4AJWA 4P29A 4JL0A 1H19A 3FY4A 3TWVA 2ZU6B 1K1BA 5BV1A 3S7JA 5FZQA 3EJNA 5JJ6A 4IYPA 4LCTA 2FO1E 4L2LA 3LJ3A 4A3TA 2Y4UA 5B1AE 4EQFA 3OTNA 4CCAA 1HZ4A 3CR3A 3HXDA 1HF8A 4HOUA 4DX5D 5ENQD 2LAHA 4C48B 2UY1A 4APFA 4KZ0A 1E8XA 3IKOB 3GYZA 5BV0A 3PE3A 4HOTA 1WG0A 5D66A 3S7DA 2HYZA 2IOSA 3QJZA 3NBNB 2IFUA 2EINE 1FVFA 3RRNB 2WXGA 3DXKG 5KJKA 3MKRA 3GW4A 3SFXA 2RFMA 2M63A 4FULA 2F8YA 5EKQD 1E8WA 5LCWC 5AJLA 2J8SD 4G1TA 4GTOA 2VSNA 3UX4A 4IULA 3Q15A 4JHJA 4WAFA 4N3AA 5AN8A 1DCEA 1N94A 5AQ7A 3DSVA 4HFGA 3ZGQA 3FTVA 5FWQA 2QC9A 4ILGA 3ASHA 3BG1B 2QFCA 1WY6A 2AW6A 3UKRG 3R7RA 4A3VA 5CMWA 5D2MC 3BEEA 2KCLA 3PE4A 1GW6A 4CZ2D 4GZDA 1FT2A 3SO8A 1JCRA 1ZU2A 4GTVA 3NQPA 2CHXA 3FWVA 4GCNA 2LUHA 1N0RA 3FU6A 3CV0A 3FEXA 5JMND 5AYWD 2ZIRA 3FEYA 3UMVA 4A55A 5ENRD 4DRXE 5B1BE 1PY1A 4YDWA 1E8YA 3DSUA 3DPDA 3ULQA 3T5XA 3DEOA 2WQ7A 3AS8A 4N5QA 4LEUA 2H6FA 3B95A 1PAQA 5CCLA 4J8FA 4LERA 2L6JA 3FUKA 4UI9J 5A7DB 1LD7A 2QYJA 3MX3A 4ATGA 5FZRA 2IJGX 3MV2B 3FUIA 5EYLA 5G04J 3JXIA 3EHQA 5FQ4A 1BI8B 2X3MA 4AY6A 4K03A 4GTPA 1BPOA 4GA1A 3CHOA 3U3WA 3SBTB 2XZDG 2GROB 2IEJA 5LFAA 2ILRA 3Q7FA 3TWXA 5CBOA 2XCCA 2BUGA 1JWFA 5D0QD 5BUZA 3OXFA 1EDUA 4GTMA 1N4PA 2XS8A 3E30A 4Y6CA 3DSXA 4GMJA 4JXTA 1O1TA 3CVVA 1KLXA 4I6EA 4GZ3A 1ELKA 3CVQA 1E96B 2F37A 1W3BA 3L16A 3TWTA 3APCA 4EZKA 1OCZE 2YHEA 5HQ8A 4BEPA 3CVXA 3AU4A 4G8LA 5KWDA 4N2QA 2UY1B 3RK6A 4F7AA 3RRUA 4JVSA 4PH4B 1EPUA 4KVMA 4LRZA 4WWOA 3CEQA 3ZFWA 3QOUA 4YNDA 3JQ0A 2I9CA 3G2WA 3TGOA 4DI3A 1BI7B 3ZW3A 3LVRE 2MYOA 1E7UA 4JD2G 3TAXA 2ETBA 1Q2ZA 4A63B 5HRYA 3S7BA 3DPYA 1B89A 2H6HA 1TN8A 3UKUG 3L54A 4JB8P 3HYMB 3G2TA 2NC9A 2WXHA 3J5PA 4EECA 2OOEA 4J7WA 4GPMA 4G24A 3TG5A 1TEZA 2GRPB 3KEZA 3ZYLA 3DSSA 3EUVA 3D9JA 4UWHA 3CGHA 3B7SA 2BKKB 2EIKE 3BG0B 2BTDA 1OWPA 3FU5A 3R7QA 5AQ9A 2F8XK 3C3RA 4GYYA 4J8EA 3IV0A 2WXJA 4A1SA 5ANLA 2WXLA
chains in the Genus database with same CATH topology
3AG4E 3X2QE 2EIJE 3AG2E 3WG7E 1V54E 1OCOE 5B1BE 3ASOE 2EIKE 2OCCE 3ABLE 5B1AE 1OCRE 3ASNE 2ZXWE 2DYSE 3AG1E 1V55E 3ABME 2EINE 2Y69E 5B3SE 1OCZE 3ABKE 2EILE 2EIME 3AG3E 1OCCE 2DYRE 5IY5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG4 E;  3X2Q E;  2EIJ E;  3AG2 E;  3WG7 E;  1V54 E;  1OCO E;  5B1B E;  3ASO E;  2EIK E;  2OCC E;  3ABL E;  5B1A E;  1OCR E;  3ASN E;  2ZXW E;  2DYS E;  3AG1 E;  1V55 E;  3ABM E;  2EIN E;  2Y69 E;  5B3S E;  1OCZ E;  3ABK E;  2EIL E;  2EIM E;  3AG3 E;  1OCC E;  2DYR E;  5IY5 E; 
#chains in the Genus database with same CATH topology
 2WQH A;  3C3O A;  4GCO A;  1D8D A;  2GW1 A;  4U0U A;  1QQE A;  5D0O D;  4I6J A;  1SA5 A;  3FH8 A;  2KM4 A;  3NB2 A;  4Y6W A;  1U3C A;  1HH8 A;  5FQ8 A;  3FTU A;  4MBG A;  2WB2 A;  4BTB A;  3UT4 A;  3SNX A;  4WNG A;  4BSX A;  2WM9 A;  1YYH A;  3FP3 A;  3LYA A;  3KS2 A;  5AEN A;  2E2E A;  3FDH A;  1YCS B;  3B13 A;  3EDT B;  3PUJ A;  2RKK A;  1IKN D;  4G11 A;  3FUH A;  3OAW A;  4I2W A;  1IXV A;  5FQ7 A;  3HXC A;  2C0M A;  3CVP A;  3MZL B;  2OCC E;  2XPI A;  3RAU A;  3AG1 E;  4OAU C;  4DUI A;  4I6G A;  3ABK E;  4WWN A;  1FT1 A;  3UM2 A;  1N52 A;  4EBA A;  3SY2 A;  4DX6 D;  1MYO A;  2I1K A;  3FH7 A;  3EU5 A;  2Y1L E;  4JA9 A;  2VTB A;  4FC8 A;  2J4B A;  2VGY A;  1NA0 A;  3T9K A;  1H2T C;  2JEK A;  2VGX A;  4CDM A;  3BU8 A;  1P5Q A;  3QC1 A;  1JCQ A;  3TWR A;  4O1P A;  2JAB A;  2X6K A;  5FT9 A;  1KPS B;  3IEG A;  5G05 J;  1A5E A;  3B7T A;  5KJM A;  4ANW A;  3CHP A;  3SI5 A;  2GGF A;  2B0O E;  4TUM A;  3ZIM A;  1NP7 A;  5CHE E;  4YVO A;  4NAC A;  4U7E B;  4APO A;  3PNT B;  2MOW A;  3ZPJ A;  3DRA A;  4DLO A;  2VSY A;  3ASO E;  4ZHB A;  1TR4 A;  3Q9N C;  3KSL A;  4GZC A;  4BFR A;  2IO3 C;  4WWP A;  4RQI A;  2YNQ A;  1O1R A;  2HR2 A;  4ILI A;  5CCM A;  2Y3A A;  4NUR A;  1ELW A;  3Q75 A;  4DX2 A;  4C0E A;  5JHB A;  2IF4 A;  3E32 A;  5ENT D;  3FH5 A;  4NRH B;  3ESK A;  3EHN A;  4KYO B;  3TWS A;  3RU0 A;  1BLX B;  3CK7 A;  2P9N G;  3GZS A;  3UIN C;  5G2N A;  2IO2 C;  4L9P A;  4UI9 C;  1E90 A;  1E8Z A;  1HX8 A;  2AVP A;  3D9M A;  2V0P A;  3ULY A;  3HIZ A;  4TXQ A;  2IQC A;  3TJP A;  1Z6T A;  2C2L A;  1WM5 A;  5G04 C;  3HG0 D;  1MX4 A;  4PUC A;  1QBQ A;  4A1G A;  2QY7 A;  3IHV A;  3ZHE A;  3DEP A;  2XEN A;  4N2S A;  1INZ A;  4BT9 A;  2WPV A;  2XS1 A;  5AAO A;  3LXU X;  4ANV A;  4GTQ A;  4CYM D;  1Y6I A;  4DX1 A;  4UWF A;  4ANU A;  1SW6 A;  4NQ0 A;  1DC2 A;  3FUJ A;  4I43 A;  2NSZ A;  3VTY A;  4ME2 A;  2V5Q C;  3SHF A;  2R05 A;  2RG8 A;  3UT8 A;  5C1D A;  4BWR A;  4N3B A;  2OVF A;  2ZXW E;  2OVB A;  5FQ6 A;  4HRL A;  3L9T A;  5KCM A;  3E34 A;  1NL4 A;  4F6R D;  3UI2 A;  4TXP A;  4KVO A;  5BPP A;  2AXU A;  4O60 A;  2HM8 A;  3WXX A;  1HXI A;  1TNB A;  2LNI A;  4HRN A;  4U8H A;  4G23 A;  3HVE A;  3P2B A;  1LTX A;  2OV8 A;  3ISM C;  3SD5 A;  3V30 A;  3V31 A;  4UQX A;  1DVP A;  4PDX A;  2H6G A;  2VTB B;  2I6H A;  3VLE A;  4FAD A;  5LOZ A;  2V8S E;  3VLF A;  2FO7 A;  2VGX B;  3SBS A;  3RIB A;  4F1S A;  4AIF A;  2OND A;  2P9I G;  1D9S A;  4KMO A;  2J09 A;  3PS6 A;  2AXV A;  4QQI A;  4QFV A;  2GRN B;  2J49 A;  5T3R A;  3TL5 A;  3MV3 B;  3DWL G;  2XHE A;  4DJA A;  3MA5 A;  1OCC E;  4GU5 A;  4FLH A;  3TG4 A;  1K1A A;  5FJY A;  2B6C A;  4I9E A;  4U95 D;  2IOL A;  2X6F A;  1TNU A;  3AS4 A;  2ZGG A;  3TWW A;  2ION A;  2GRM A;  4IRU A;  1LD8 A;  1NI1 A;  4GZ5 A;  1N0Q A;  3QB2 A;  3PEU B;  2CHZ A;  5ENO D;  3SF4 A;  3C5R A;  2WXN A;  3ZUV B;  4U8V D;  1UN9 A;  3S7F A;  4E85 A;  2A5U A;  2L0T B;  1WDY A;  2PM6 A;  5DBK A;  4JZY A;  5FIO A;  5HI7 A;  4CGV A;  2XGO A;  3FUD A;  3RO2 A;  5KBA A;  3D9H A;  3IHY A;  4L1B A;  4ATZ D;  2AJA A;  3D3M A;  1U2V G;  2HO1 A;  2XEV A;  3MCX A;  2XEH A;  2Y0B G;  3Q78 A;  3UUX A;  3NZS A;  4U96 D;  1H2V C;  5CRU A;  1BD8 A;  3Q9U C;  3TWU A;  4XX5 A;  1ELR A;  4UQZ A;  4RSY A;  1UOH A;  3Q5M A;  3FFL A;  3G2V A;  2PNN A;  1S63 A;  1N95 A;  3ZYM A;  4AOF A;  3ZHE B;  4I17 A;  1NA3 A;  3Q47 B;  5CER B;  4G25 A;  3T5V A;  3AAA C;  2PQR A;  1QZ2 A;  2XPY A;  3CK9 A;  3U64 A;  3JQ1 A;  3PVL A;  4OVU A;  3FUF A;  2LXM A;  2OEV A;  3AS5 A;  3SZ7 A;  3PRZ A;  2C0L A;  2AXZ A;  1O5M A;  3ABM E;  3V2O A;  1S64 A;  3QWP A;  4ABN A;  1IYG A;  4UWL A;  4BSZ B;  1OCO E;  2OEW A;  2X6J A;  4F1P A;  2P9P G;  2WXK A;  2LSV A;  1SZ9 A;  3G2U A;  3QAR A;  3ML8 A;  2WXO A;  2P9S G;  4HLE A;  2EIM E;  4YDO A;  5EN5 D;  5FTP A;  4OAV B;  3HVE B;  4HVB A;  4Q94 A;  2E0I A;  2V4L A;  1U3D A;  3KSQ A;  3ASN E;  4GZ6 A;  4FHK A;  4LG6 A;  2CG2 A;  3LKU A;  3JXJ A;  2BF0 X;  3I4R B;  3SFZ A;  3N71 A;  4Z68 A;  2UWJ G;  2Q7F A;  3QKY A;  4C9B B;  4BET A;  4TRQ A;  4LNU D;  5H7P A;  4K5A B;  3I4G A;  5ENN A;  1NZN A;  1SZA A;  1G3N B;  5JJ7 A;  4N5C A;  2P58 C;  3JCK C;  3D9P A;  3ENE A;  3MJW A;  4Q96 A;  4JPS A;  2XPZ A;  3QWV A;  3J5Q B;  4I1A A;  4AP2 A;  2R02 A;  1N54 A;  4MLP A;  5G55 A;  3T8K A;  1SVX A;  1E7V A;  2NXP A;  4EZL A;  5EDS A;  5A23 A;  3NOC D;  2CFZ A;  4ACL A;  3FUN A;  3UT7 A;  3G2S A;  1NFI E;  1TNO A;  3FU0 A;  1N4R A;  2IY0 C;  3CK8 A;  1OWM A;  3W9G A;  3CHS A;  4IN3 B;  4O6F A;  3Q4A B;  3LEW A;  2DZN A;  5JA4 D;  3FHE A;  4RVB A;  4B0Z A;  1K8K G;  4BX8 A;  1UJJ A;  2L6B A;  2V4H C;  3CVL A;  1Z5S C;  2FEZ A;  4J8Y A;  5KNH D;  3NAW A;  5CEC B;  3MGB A;  2DCP A;  3FTX A;  4OYS A;  3ULE G;  4PS3 A;  3ASG A;  5HS0 A;  1OWN A;  2KZT B;  4YDY A;  4RLY A;  3E37 A;  3EIQ C;  4JA7 A;  1KT1 A;  2R59 A;  4HXI A;  4GA2 A;  3QWW A;  4LSZ E;  4WUY A;  3ML9 A;  4ANX A;  1RZ4 A;  1YMP A;  4UUC A;  4GMR A;  5T8I A;  4XI0 A;  3RSE G;  4ILH B;  4I2Z A;  4DI4 A;  3ZXP A;  2WXM A;  3CVU A;  4AEZ C;  1HG5 A;  2EIL E;  1JPL A;  4WNF A;  3Q7A A;  3RO3 A;  4HOS A;  2WMO A;  3PZ3 A;  4GYO A;  4GTT A;  4YDE A;  1N4S A;  3URZ A;  2J07 A;  1O1S A;  4MRU A;  4N39 A;  5EX3 A;  2KBX A;  1FCH A;  3EIJ A;  2QYU A;  1XNF A;  3PDN A;  4HS2 A;  4DPR A;  2FUL A;  1UW4 B;  5AAR A;  5JJT A;  1UJK A;  1XGW A;  2L9B A;  3KD7 A;  4JHR A;  4BER A;  4RG9 A;  3T8M A;  4AXH A;  1QNF A;  4PS8 A;  4I1O B;  4KT6 B;  1TN6 A;  3CVN A;  1Y8M A;  3ZKJ A;  4FJZ A;  2J4D A;  3U66 A;  3UIP C;  4UWK A;  4E6H A;  2YIN A;  3HRA A;  1HS6 A;  2P9U G;  4LUN U;  4M7C A;  4KBQ A;  3D9I A;  3DST A;  3FUL A;  4BY6 A;  3NF1 A;  3CSF A;  4U8Y D;  4FJY A;  3HXB A;  4DK5 A;  1MZC A;  3CST A;  3RJV A;  3U4T A;  4N3C A;  3Q79 A;  2XZT G;  2R03 A;  2J08 A;  2KAT A;  1K3Z D;  1H6P A;  3CIA A;  3HXE A;  5CEA A;  3U9W A;  3LCA A;  4HLL A;  4FU3 A;  3E33 A;  3ASD A;  2LSU A;  3VTX A;  2HE0 A;  3FU3 A;  4CDN A;  3E4B A;  2DZO A;  1Z3Y A;  3UM3 A;  3LPZ A;  4JEU A;  4U04 A;  4F3V A;  4HNA D;  4BX9 A;  1OY3 D;  3QK0 A;  4AY5 A;  1OXJ A;  4B94 A;  2JLB A;  5FZS A;  4HBD A;  4FA6 A;  2DBA A;  4FHJ A;  4GAA A;  3AU5 A;  1TYQ G;  3F6Q A;  3LJN A;  3EU9 A;  4FLB A;  1WAO 1;  5J90 A;  4U0Z A;  4XI9 A;  3Q73 A;  1SA4 A;  3PUK A;  1HO8 A;  3ONK A;  4JW1 A;  4I9C A;  5AIJ A;  2CG3 A;  2A5E A;  2WVI A;  4G26 A;  5BXO A;  2PL2 A;  3MKQ A;  4EBA G;  2I2O A;  3CVY A;  5KNG A;  5AQA A;  1FVH A;  2MHK A;  5BXU A;  2Y4T A;  4M3O A;  2XGS A;  3LDZ A;  2KXP C;  5CMY A;  4GPK A;  4L2Y A;  2IU1 A;  3DXM G;  4J8D A;  3I3N A;  2CFU A;  3GZ1 A;  3KAE A;  3C72 A;  3UIO C;  3TXM A;  4CT0 A;  2QZA A;  1LF8 A;  4UI9 K;  1YA0 A;  1FPP A;  1HU3 A;  3V79 K;  2KCV A;  4WND A;  2V5F A;  3PZ1 A;  3NZU A;  3CLJ A;  1IQR A;  1TJC A;  1A17 A;  3X2Q E;  3AG2 E;  1H6K A;  1IHG A;  5ARG A;  2EQX A;  4K5C A;  3CHM A;  2L0I A;  3UXG A;  2DYS E;  3LY7 A;  2R17 C;  1S0P A;  3JYS A;  3L13 A;  1TJF A;  1S70 B;  4LNB A;  3CVW A;  1MHQ A;  5JHA A;  3CHQ A;  2WMN A;  1X5B A;  3PEV B;  3RKV A;  3L82 A;  2R5S A;  4OVV A;  4U07 A;  5CBN A;  1ZB1 A;  4GML A;  1EF1 C;  3APD A;  2VQ2 A;  3L17 A;  1H6O A;  1KT0 A;  1IHB A;  1N9A A;  4ACK A;  4K5B A;  3BQO A;  3I5P A;  5BNW A;  3ZEF A;  1VDY A;  3PZ2 A;  2PQN A;  1PC2 A;  1EYH A;  2FBN A;  3MYV A;  5KJN A;  3ABL E;  4BTA A;  4HI9 A;  3LY9 A;  1OT8 A;  3Q49 B;  5A6C A;  3KEA A;  2KZT A;  3HHM A;  5EYP F;  4BES A;  3FTZ A;  3B7B A;  4AV7 A;  5ENP D;  3EHR A;  3ZU7 B;  3SFY A;  3PRE A;  3C3Q A;  3CHR A;  3W9F A;  1D8E A;  4JHK A;  4DX7 D;  4B8A A;  3PZD A;  4LNG A;  2R2L A;  2VSO E;  1AP7 A;  2KC7 A;  1N4Q A;  2FF4 A;  5B3S E;  2YHC A;  1QYM A;  3OXL A;  3CKB A;  2RD0 A;  3NOG D;  3SQV A;  1N11 A;  4EHM A;  5J08 A;  1SQM A;  5DIZ A;  3S2A A;  3MEK A;  2XQ0 A;  4H7X A;  2P9K G;  4R7L A;  5LP0 A;  3PNL B;  4L7T A;  1HG2 A;  5FIN A;  2BED A;  3ZXS A;  3ZYK A;  3QNK A;  3HDX A;  5LCW J;  4EPZ A;  4URK A;  1AWC B;  3B7U X;  4J0U A;  3IBE A;  4XEI G;  4GYW A;  3VLD A;  5CED B;  2A4Z A;  5KJL A;  1V55 E;  5G05 C;  2DWZ A;  2Y69 E;  4CEM A;  1Z3X A;  4HQD A;  3AG3 E;  4TUU A;  3MKQ B;  1V54 E;  2X6H A;  3LS8 A;  2LAI A;  3ZRH A;  2ZGD A;  1X81 A;  4KXK B;  4XIF A;  5LX8 A;  5AQB A;  2ZIS A;  2GRQ B;  1OUV A;  3SGH A;  5EIL A;  2AWI A;  3R9A B;  1KZO A;  2WQ6 A;  4UQY A;  2YQ8 A;  4D10 C;  3PH0 C;  5E76 A;  4GTS A;  1H2U A;  4GB9 A;  4AVX A;  3UM0 A;  3FUM A;  3O48 A;  3FTS A;  4FP7 A;  3R9M A;  2XEE A;  3QDN A;  1MX2 A;  2I1J A;  3WG7 E;  3B7R L;  4NIK A;  3UQ3 A;  3DSW A;  4UWG A;  1IQU A;  4TXR A;  1JCS A;  4CRW A;  2H6I A;  3L6A A;  3FTW A;  4EZJ A;  2WXQ A;  2ETC A;  2VJ8 A;  4K0R A;  2WXP A;  5EIB E;  4MKT A;  2P9L G;  4Q69 A;  3JUE A;  2J9Q A;  1ZBP A;  2WXF A;  4B93 B;  5BW8 C;  5ENS D;  4CDR A;  4HI8 A;  4U63 A;  3PZ4 A;  4H7Y A;  3RRM B;  4F53 A;  3D9L A;  4HOQ A;  3ESL A;  4G8K A;  4XKC A;  2BKG A;  5IY5 E;  2LO6 A;  3ZN3 A;  5HKP A;  3EHM A;  1MJ0 A;  2X38 A;  3UM1 A;  1OWO A;  1UG3 A;  3O4Z A;  3JUI A;  5ITZ F;  5BT1 A;  1JUQ A;  3LVQ E;  5C2Y A;  4AM9 A;  2XGM A;  4J6I A;  4BT8 A;  4GA0 A;  1JWG A;  5ARF A;  2KCK A;  4PS7 A;  4HOR A;  4XE0 A;  2MRI A;  2LXL A;  3L22 A;  3D9K A;  3TXN A;  3APF A;  4XKB A;  4HB5 A;  1RW2 A;  2GRR B;  1UN8 A;  4V3I A;  3CQC B;  4J8S A;  3ZNG A;  5ANR A;  2DIW A;  2FI7 A;  2XRY A;  1H0A A;  3UPV A;  1OCR E;  3HXF A;  2VGE A;  3IXE A;  3GZ2 A;  5AJD A;  2ETA A;  4TV3 A;  1MQS A;  3ASF A;  3TWQ A;  4C0M A;  3AG4 E;  3OXG A;  1HFA A;  4CT4 A;  1TNY A;  2PZI A;  4CGW A;  4XZ4 A;  2XRZ A;  4B8C B;  3ONL A;  1HE8 A;  2VSX E;  2WXI A;  4X8Q A;  4U0S A;  4L23 A;  3K9I A;  5CRV A;  4DLQ A;  2VYI A;  2RFA A;  1BU9 A;  5T4Y A;  1MX6 A;  2XCB A;  3LY8 A;  2F0Y A;  2EIJ E;  1L5J A;  4MS6 A;  4WNE A;  5E75 A;  4GTR A;  4RG6 A;  3D9O A;  3AJI A;  3CQG B;  2CHW A;  4I1M A;  3ZVV A;  3D9N A;  2P2C P;  2X6I A;  3C98 A;  4W9R A;  4JC8 A;  3FUE A;  1KZP A;  2PM7 A;  3DBS A;  2GRL A;  4B89 A;  3UTM A;  1DCQ A;  4JEH A;  1OWL A;  1TN7 A;  4ZFH A;  2DVW A;  4HRM B;  2WXR A;  5EX0 A;  3ZYQ A;  3QAQ A;  5EID A;  3P1U A;  4KZC A;  1TNZ A;  3CKC A;  2DYR E;  4O1O A;  1DNP A;  4YVQ C;  3V2X A;  3FTY A;  5M72 A;  2NYJ A;  3L08 A;  3BUA A;  4G2V A;  4AJW A;  4P29 A;  4JL0 A;  1H19 A;  3FY4 A;  3TWV A;  2ZU6 B;  1K1B A;  5BV1 A;  3S7J A;  5FZQ A;  3EJN A;  5JJ6 A;  4IYP A;  4LCT A;  2FO1 E;  4L2L A;  3LJ3 A;  4A3T A;  2Y4U A;  5B1A E;  4EQF A;  3OTN A;  4CCA A;  1HZ4 A;  3CR3 A;  3HXD A;  1HF8 A;  4HOU A;  4DX5 D;  5ENQ D;  2LAH A;  4C48 B;  2UY1 A;  4APF A;  4KZ0 A;  1E8X A;  3IKO B;  3GYZ A;  5BV0 A;  3PE3 A;  4HOT A;  1WG0 A;  5D66 A;  3S7D A;  2HYZ A;  2IOS A;  3QJZ A;  3NBN B;  2IFU A;  2EIN E;  1FVF A;  3RRN B;  2WXG A;  3DXK G;  5KJK A;  3MKR A;  3GW4 A;  3SFX A;  2RFM A;  2M63 A;  4FUL A;  2F8Y A;  5EKQ D;  1E8W A;  5LCW C;  5AJL A;  2J8S D;  4G1T A;  4GTO A;  2VSN A;  3UX4 A;  4IUL A;  3Q15 A;  4JHJ A;  4WAF A;  4N3A A;  5AN8 A;  1DCE A;  1N94 A;  5AQ7 A;  3DSV A;  4HFG A;  3ZGQ A;  3FTV A;  5FWQ A;  2QC9 A;  4ILG A;  3ASH A;  3BG1 B;  2QFC A;  1WY6 A;  2AW6 A;  3UKR G;  3R7R A;  4A3V A;  5CMW A;  5D2M C;  3BEE A;  2KCL A;  3PE4 A;  1GW6 A;  4CZ2 D;  4GZD A;  1FT2 A;  3SO8 A;  1JCR A;  1ZU2 A;  4GTV A;  3NQP A;  2CHX A;  3FWV A;  4GCN A;  2LUH A;  1N0R A;  3FU6 A;  3CV0 A;  3FEX A;  5JMN D;  5AYW D;  2ZIR A;  3FEY A;  3UMV A;  4A55 A;  5ENR D;  4DRX E;  5B1B E;  1PY1 A;  4YDW A;  1E8Y A;  3DSU A;  3DPD A;  3ULQ A;  3T5X A;  3DEO A;  2WQ7 A;  3AS8 A;  4N5Q A;  4LEU A;  2H6F A;  3B95 A;  1PAQ A;  5CCL A;  4J8F A;  4LER A;  2L6J A;  3FUK A;  4UI9 J;  5A7D B;  1LD7 A;  2QYJ A;  3MX3 A;  4ATG A;  5FZR A;  2IJG X;  3MV2 B;  3FUI A;  5EYL A;  5G04 J;  3JXI A;  3EHQ A;  5FQ4 A;  1BI8 B;  2X3M A;  4AY6 A;  4K03 A;  4GTP A;  1BPO A;  4GA1 A;  3CHO A;  3U3W A;  3SBT B;  2XZD G;  2GRO B;  2IEJ A;  5LFA A;  2ILR A;  3Q7F A;  3TWX A;  5CBO A;  2XCC A;  2BUG A;  1JWF A;  5D0Q D;  5BUZ A;  3OXF A;  1EDU A;  4GTM A;  1N4P A;  2XS8 A;  3E30 A;  4Y6C A;  3DSX A;  4GMJ A;  4JXT A;  1O1T A;  3CVV A;  1KLX A;  4I6E A;  4GZ3 A;  1ELK A;  3CVQ A;  1E96 B;  2F37 A;  1W3B A;  3L16 A;  3TWT A;  3APC A;  4EZK A;  1OCZ E;  2YHE A;  5HQ8 A;  4BEP A;  3CVX A;  3AU4 A;  4G8L A;  5KWD A;  4N2Q A;  2UY1 B;  3RK6 A;  4F7A A;  3RRU A;  4JVS A;  4PH4 B;  1EPU A;  4KVM A;  4LRZ A;  4WWO A;  3CEQ A;  3ZFW A;  3QOU A;  4YND A;  3JQ0 A;  2I9C A;  3G2W A;  3TGO A;  4DI3 A;  1BI7 B;  3ZW3 A;  3LVR E;  2MYO A;  1E7U A;  4JD2 G;  3TAX A;  2ETB A;  1Q2Z A;  4A63 B;  5HRY A;  3S7B A;  3DPY A;  1B89 A;  2H6H A;  1TN8 A;  3UKU G;  3L54 A;  4JB8 P;  3HYM B;  3G2T A;  2NC9 A;  2WXH A;  3J5P A;  4EEC A;  2OOE A;  4J7W A;  4GPM A;  4G24 A;  3TG5 A;  1TEZ A;  2GRP B;  3KEZ A;  3ZYL A;  3DSS A;  3EUV A;  3D9J A;  4UWH A;  3CGH A;  3B7S A;  2BKK B;  2EIK E;  3BG0 B;  2BTD A;  1OWP A;  3FU5 A;  3R7Q A;  5AQ9 A;  2F8X K;  3C3R A;  4GYY A;  4J8E A;  3IV0 A;  2WXJ A;  4A1S A;  5ANL A;  2WXL A; 
#chains in the Genus database with same CATH homology
 3AG4 E;  3X2Q E;  2EIJ E;  3AG2 E;  3WG7 E;  1V54 E;  1OCO E;  5B1B E;  3ASO E;  2EIK E;  2OCC E;  3ABL E;  5B1A E;  1OCR E;  3ASN E;  2ZXW E;  2DYS E;  3AG1 E;  1V55 E;  3ABM E;  2EIN E;  2Y69 E;  5B3S E;  1OCZ E;  3ABK E;  2EIL E;  2EIM E;  3AG3 E;  1OCC E;  2DYR E;  5IY5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...