3ASNE

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3asnE00
3AG2E 1OCOE 3ASOE 2EIME 3X2QE 2DYRE 1OCZE 3AG1E 1OCRE 3AG4E 3ABME 3WG7E 5B3SE 2EILE 2Y69E 2OCCE 3ABKE 2ZXWE 5B1BE 1V54E 3ABLE 2EIJE 2EINE 1V55E 1OCCE 5IY5E 5B1AE 2DYSE 3AG3E 3ASNE 2EIKE
chains in the Genus database with same CATH superfamily
2KM4A 3ZU7B 2DZNA 3Q49B 3L22A 5EX0A 3AU5A 2CG3A 4JEHA 3EU9A 4L2LA 4HNAD 1NA0A 5EYPF 2NC9A 4J0UA 5ENPD 3PE3A 2WB2A 2P9LG 5H7PA 4YDWA 3FUDA 2MYOA 1TN7A 3Q75A 3L13A 3OXLA 4F6RD 3MKRA 5AQBA 4Y6WA 2CFUA 1IHGA 5JJ7A 3WG7E 2DVWA 3U4TA 3N71A 4IRUA 2M63A 2VGYA 2ZU6B 3EDTB 5AARA 1H2UA 4U63A 3LCAA 4OVVA 3KD7A 2FF4A 4AJWA 1H6KA 3APFA 4QQIA 2YNQA 1Z3XA 4DJAA 1OCRE 1MX4A 3SNXA 3ZPJA 4AV7A 5EILA 1FPPA 4F3VA 2X6JA 1JCSA 2LAIA 4CDNA 1EDUA 3DWLG 3TWTA 4A55A 4LERA 1N0QA 3NOGD 3SI5A 2V4HC 4F1SA 2F0YA 1NP7A 2BF0X 1ZB1A 3DBSA 2XENA 3B7RL 4UWKA 2Q7FA 1N0RA 5AJLA 2VSXE 2X6KA 3RSEG 2VGEA 3MV3B 2WXNA 1HX8A 3Q7FA 2HM8A 2L9BA 3T5VA 2WMOA 2AWIA 3D9HA 4ATZD 1E7UA 4DI4A 1Z5SC 3CVVA 3ML9A 3E30A 3UIPC 3FHEA 3ZVVA 4KZCA 3B7BA 1E8XA 1O1TA 1E90A 1LTXA 2XEEA 5A6CA 4CZ2D 1QBQA 5J90A 1K1BA 5G05J 3L17A 1U3DA 2I1KA 1VDYA 2AXZA 4FU3A 4O6FA 3I4GA 4RVBA 4AP2A 4GA2A 4TUMA 4N39A 2LSUA 4TXQA 1FVFA 2E2EA 4GZ5A 4YDYA 5G2NA 5KJKA 3JQ1A 3SF4A 4IN3B 3VLDA 2QYJA 4DX7D 1BD8A 3CVWA 4HI9A 1HO8A 3CEQA 1AWCB 4H7YA 1OT8A 4J8DA 4O1PA 4A63B 3L08A 3OAWA 4L7TA 4LNBA 2ZGDA 2R2LA 1TNZA 4EECA 3JXIA 4DK5A 1PY1A 4URKA 3FH5A 4EZKA 5EKQD 4B89A 2YHCA 2VTBB 3R7RA 4CGWA 1MX2A 1KPSB 3DPDA 3JUIA 2IY0C 3ONLA 4FHJA 4RQIA 4MLPA 4G2VA 1N52A 4KVOA 4UQXA 4EBAA 2L0TB 3DXKG 5KCMA 5FQ8A 3AJIA 3MZLB 1QZ2A 3T9KA 3D9JA 1K8KG 3QNKA 1TN6A 2AVPA 2V5FA 3S7JA 2IOSA 4G24A 5CRUA 1NZNA 3UXGA 2WXOA 5ENQD 3O48A 4BFRA 4ZFHA 1INZA 2ZXWE 4BEPA 3U9WA 1BU9A 1O1SA 4UUCA 2PL2A 3ZUVB 1OWPA 3C3RA 4EPZA 4HI8A 5LFAA 3SZ7A 1YYHA 3E33A 5FZSA 3FH8A 4L1BA 4GPKA 2V5QC 3HXEA 4APFA 4IULA 4Q69A 2P9NG 3FUMA 3RIBA 3CVLA 2XGSA 4ANUA 2MOWA 3SHFA 1P5QA 3KEAA 4AEZC 3EHMA 3DRAA 3C3OA 3VLEA 1V54E 3LYAA 4I6GA 2QY7A 2EINE 2HO1A 2F8XK 5AENA 2XEVA 5J08A 4APOA 1JWGA 3CQGB 2J49A 3MV2B 5ENRD 2WXJA 4PS7A 4FADA 3PZ2A 2VSYA 3E34A 3NZUA 3SFZA 1N4QA 1NFIE 4C48B 2MRIA 2J07A 3EUVA 3MYVA 2LO6A 1JCQA 1ELKA 1TNYA 4J8FA 4J6IA 4B0ZA 3ESKA 3HHMA 3UX4A 4OAUC 4GMLA 2IOLA 3ML8A 1HZ4A 5FTPA 4K5AB 1OCCE 2IO2C 2QFCA 4G11A 3W9FA 2E0IA 3BQOA 5DBKA 3LEWA 5AN8A 3IBEA 3LY7A 2X3MA 1WY6A 4YVOA 2A5UA 5JHBA 4JC8A 3SQVA 4AM9A 4B94A 2ETBA 3NOCD 4DLOA 2IQCA 3UI2A 5KJLA 3KSQA 4GU5A 3LS8A 5AAOA 5C1DA 3CHMA 4RLYA 2GW1A 1NI1A 3GZSA 5LP0A 3DPYA 2GGFA 4U95D 1V55E 4LNGA 2OOEA 1S0PA 3RRUA 2WXHA 3UIOC 3Q7AA 3FUFA 4UWFA 2OV8A 4WNFA 4GTTA 1SA4A 3UQ3A 3VLFA 1SZAA 3EIJA 4CEMA 2KZTB 1DCEA 3FTVA 1S70B 5KNHD 3F6QA 3PNTB 1DCQA 4FC8A 1FCHA 1NL4A 3D9OA 2P9UG 2KC7A 4MKTA 3AG1E 3V2XA 5CCMA 3ABME 1HG5A 4GTMA 3Q5MA 3Q73A 5ENTD 2CG2A 4Q96A 2ZGGA 3ZEFA 2UY1A 3D9LA 1LF8A 2QC9A 1YA0A 2LXLA 2YHEA 1IHBA 1HXIA 3PVLA 1XGWA 3QKYA 4AY6A 4G8LA 2BKKB 2LSVA 4BY6A 1N4SA 4N3CA 1BLXB 1WG0A 2BUGA 3G2VA 4TRQA 4U0ZA 4RG9A 2PQNA 3TAXA 3DSUA 4C0EA 2X6HA 5CECB 2ZIRA 3J5QB 4KVMA 2XS1A 4U0SA 4LNUD 3CLJA 1JWFA 4HORA 4F1PA 4U8HA 3V79K 1N95A 2P9KG 3LJ3A 2RKKA 5T8IA 4GTQA 2RD0A 4M3OA 3HDXA 3P2BA 2WXPA 5CBOA 5CHEE 4OAVB 1MYOA 3QAQA 3DSXA 3QOUA 2IF4A 5LCWJ 4ZHBA 4DX1A 4CCAA 4CDMA 2XQ0A 3HXFA 2LNIA 2OEWA 3L82A 3AG3E 4Z68A 5AJDA 3L16A 3SGHA 3BEEA 3TG5A 1N4RA 1N4PA 4ATGA 3X2QE 4LSZE 4UWHA 2H6IA 4WNDA 4YDEA 3CVYA 3UKUG 1FVHA 2J4BA 3SFYA 1B89A 4JHKA 3DSSA 3B7TA 3QARA 4ANVA 4AXHA 2IONA 1QYMA 3TXNA 2Y1LE 3FTWA 2HE0A 2QYUA 2C2LA 1OWMA 4LCTA 3UKRG 2LAHA 2V0PA 1SW6A 5BV1A 1ZU2A 3JCKC 5CEDB 2YQ8A 3LDZA 3MCXA 4EQFA 2VYIA 3ASGA 4JB8P 3TXMA 3CHQA 5ITZF 2R17C 3SY2A 3HYMB 3E4BA 4MRUA 3ASFA 4U07A 3I3NA 1UW4B 4BTBA 2LUHA 5HS0A 3RO2A 3FEXA 3RRMB 3PZ4A 4L9PA 3VTYA 3LJNA 1D8DA 3EJNA 1JCRA 3K9IA 3JQ0A 4KBQA 3FU3A 2FBNA 3D9PA 3CKBA 3T8MA 3MGBA 1FT2A 5BW8C 5G04J 3ONKA 4Q94A 4XX5A 3RK6A 1OUVA 4DPRA 3TGOA 3MKQB 4GZDA 4YNDA 3KEZA 3ZYKA 3FUKA 4TXPA 2RFAA 2A5EA 3FY4A 4XE0A 1Y6IA 3PDNA 2UY1B 5ARFA 2WQHA 1NA3A 4DX5D 5ENOD 4HBDA 4HRMB 4K0RA 2J8SD 3PE4A 4I17A 3KSLA 3ISMC 4XZ4A 2L6BA 1GW6A 1H2VC 2PZIA 4IYPA 4BERA 4O1OA 2OVFA 3APDA 3UINC 1DNPA 4I9EA 1QQEA 3HIZA 3RJVA 3UTMA 2OEVA 3L9TA 4I2WA 5CMWA 3IEGA 3D9KA 5B3SE 3NF1A 4BTAA 3DSVA 3CVQA 1K3ZD 5D66A 4GCOA 4J8YA 3FH7A 3AG2E 4GMRA 5FIOA 3HXBA 1HF8A 2AJAA 4BWRA 3ZHEB 1E7VA 3CHPA 2AW6A 3S7FA 2GRLA 2P9IG 4KYOB 4J8SA 2WXGA 1N54A 4K5CA 4G8KA 4HB5A 1MHQA 1QNFA 2KZTA 3CR3A 2BEDA 5G55A 4OVUA 3D9IA 4HXIA 2VGXB 5AYWD 2GRQB 3UM0A 2OVBA 5BXUA 3DEPA 3O4ZA 4LUNU 3CQCB 5FZQA 3R7QA 3NAWA 2KCLA 4JPSA 1WM5A 5G04C 3CSFA 4HS2A 5CMYA 3W9GA 3EHQA 3KS2A 4FHKA 2VSOE 4PS3A 5ANRA 5G05C 3D9MA 3V31A 4UI9K 2KCVA 3MJWA 5HQ8A 2FO1E 4HQDA 2FEZA 4JD2G 3PZDA 4BESA 2Y4UA 3CK7A 1ZBPA 1E96B 4HOTA 3ASHA 4AIFA 3ZXPA 5FINA 2P58C 3QJZA 3BG1B 5A7DB 1MX6A 1Q2ZA 2H6GA 3CSTA 3FEYA 2MHKA 1TYQG 1A17A 3AG4E 3UMVA 4B93B 2EILE 2WXIA 2I6HA 4M7CA 3CKCA 4GTSA 3T8KA 3UT7A 3PREA 3LKUA 5FQ6A 1SZ9A 4G25A 3FU5A 3TWSA 2YINA 4DX6D 3URZA 4E85A 1D9SA 1DC2A 3APCA 3PUJA 4P29A 4I6EA 1TR4A 2WVIA 5B1BE 4F7AA 2CHZA 2V4LA 1RZ4A 2XPYA 3SO8A 3FFLA 4H7XA 3P1UA 4K5BA 3SFXA 3C5RA 4RSYA 4L2YA 4ANXA 3CV0A 3ULEG 3DSTA 4GTRA 4NACA 3PZ3A 2ONDA 4WWNA 3EIQC 4N3BA 3L6AA 3PH0C 3J5PA 4PUCA 4HOSA 4KT6B 4FA6A 4JEUA 1L5JA 5BPPA 4DRXE 2EIKE 3CIAA 1UN9A 3GZ2A 3CK8A 2J08A 4W9RA 5AIJA 3UM2A 2AXUA 3QDNA 2XCBA 4AVXA 4XI0A 2ETCA 2GRRB 4J7WA 5KNGA 3S2AA 4YVQC 3AAAC 1IKND 3ASDA 3ESLA 1E8WA 1WAO1 2F37A 1RW2A 3PUKA 3TJPA 4XIFA 5AQAA 3TWXA 1OCOE 4ABNA 4BX8A 4OYSA 4L23A 2P9PG 3LVRE 2ETAA 2L6JA 1MQSA 3ULQA 4C0MA 3LY8A 2F8YA 3MX3A 4DI3A 3EU5A 3PZ1A 3NZSA 3EHNA 4GZ3A 4I43A 2ILRA 2WXMA 3KAEA 4JXTA 3R9AB 4C9BB 2WQ7A 2EIME 1SA5A 5A23A 2JEKA 4GCNA 5FQ7A 3JYSA 5FT9A 3C98A 4JA9A 3FTYA 5E76A 3CVUA 3MKQA 4HOUA 5FJYA 4DX2A 2X6FA 3CHRA 3NBNB 5M72A 3BU8A 4N5CA 3PS6A 3G2UA 3ZW3A 3U3WA 1TJFA 2XZTG 3U64A 4TV3A 2XPZA 4UQZA 4BX9A 5ENSD 4O60A 4N2SA 2XCCA 1HE8A 2RG8A 4FLHA 1G3NB 3JUEA 2XZDG 2WM9A 4B8CB 1FT1A 3T5XA 4JHJA 3S7BA 2VJ8A 3EHRA 3FUHA 1UJKA 1S63A 4GYWA 2KCKA 4UI9J 2CFZA 5JMND 3ZHEA 3AS8A 5BXOA 3G2WA 3QWPA 3D9NA 4GZCA 5D2MC 3NB2A 4N3AA 4TXRA 1HS6A 3V2OA 3MA5A 5BV0A 5BT1A 2VQ2A 2R05A 5EDSA 1YCSB 2GROB 3QC1A 5LOZA 1TEZA 1IYGA 3ASOE 4PDXA 2I9CA 5EN5D 2PQRA 4GYYA 2VGXA 3QB2A 3ZYLA 3Q9UC 2NYJA 3DEOA 5C2YA 4WAFA 2Y0BG 4U8YD 3PRZA 4F53A 1X5BA 4JZYA 4N5QA 4HLLA 2XRZA 2WXLA 4X8QA 1Z6TA 3ZNGA 3LY9A 4BSZB 5ARGA 2R02A 4EZJA 2CHWA 3UM1A 3UT8A 1KT1A 3G2SA 1KT0A 4FULA 5KJNA 1OY3D 2DWZA 5KBAA 1H0AA 4WUYA 2OCCE 2XHEA 4CT0A 1IXVA 4U8VD 2B6CA 1PC2A 1OWNA 4I2ZA 4HOQA 3RO3A 3UPVA 3R9MA 4WWPA 3TWUA 3FTUA 2V8SE 3GYZA 2KATA 4DUIA 2EIJE 2J9QA 4KMOA 5HI7A 3IV0A 3I4RB 3RKVA 1O1RA 2DBAA 4JHRA 4I9CA 4CGVA 1KZPA 4ME2A 3GW4A 4FLBA 4NURA 3B95A 4UWLA 1TNUA 1IQRA 4EZLA 4UI9C 3Q79A 3V30A 5HKPA 2EQXA 5LCWC 1D8EA 3LXUX 3ZGQA 3JXJA 1E8ZA 4GA1A 3SBTB 1OXJA 1HU3A 4U0UA 1HG2A 3RRNB 4A1GA 3B7SA 4JL0A 5JHAA 1HFAA 3DXMG 4HFGA 3PNLB 1JUQA 2XEHA 4GTPA 4NIKA 3AU4A 3HVEB 1IQUA 2KBXA 2XS8A 3L54A 3TWVA 5CEAA 2WXKA 1K1AA 2WPVA 3CGHA 3Q4AB 4GB9A 3ZYQA 5EIDA 2GRPB 3GZ1A 4GPMA 4UQYA 2GRMA 1HH8A 1U2VG 1YMPA 2WXQA 3IHVA 1PAQA 2DZOA 5FZRA 1MZCA 3PEVB 2P9SG 3Q47B 3ZRHA 5T3RA 3ASNE 3D3MA 1BPOA 5BUZA 3B7UX 1E8YA 2ZISA 4NRHB 1N94A 5D0OD 1ELRA 3TWWA 3TG4A 1A5EA 1WDYA 3QWVA 4ILGA 3ZXSA 3FULA 1LD7A 4V3IA 5ANLA 5AQ7A 4FJYA 1H2TC 2PM7A 4QFVA 5ENNA 5B1AE 3Q15A 5EX3A 3B13A 3I5PA 1UOHA 2LXMA 1BI7B 3NQPA 4MBGA 3AS4A 1UJJA 4BSXA 4BETA 3QK0A 3SD5A 1EPUA 3IKOB 3ZIMA 4PS8A 2R59A 4R7LA 3OTNA 5EYLA 4I1MA 4XI9A 1OWOA 2IO3C 3FTXA 3FUEA 2PM6A 2WXRA 3SBSA 3Q9NC 2PNNA 3FTZA 1W3BA 5CERB 3UT4A 4ANWA 4I1OB 4E6HA 3OXGA 2DYSE 4LG6A 4ACKA 4AOFA 3ULYA 5CCLA 3IHYA 4Y6CA 1U3CA 4A3TA 3LVQE 5AQ9A 4I6JA 5DIZA 4MS6A 2R5SA 3PEUB 4JA7A 1KLXA 1MJ0A 2J4DA 4PH4B 4EBAG 3ZKJA 1TN8A 3S7DA 4HRLA 5FWQA 2R03A 1H19A 3TWRA 4D10C 1OWLA 2RFMA 3FDHA 1EYHA 1Z3YA 1LD8A 2FULA 3TL5A 2VSNA 4GA0A 4B8AA 2XRYA 4YDOA 1S64A 5CBNA 4K03A 3BUAA 4A1SA 3C72A 2JLBA 3TWQA 2WXFA 3HG0D 4JW1A 3RU0A 2CHXA 3CVNA 4HVBA 4WWOA 2X38A 2NXPA 4U96D 4KXKB 2DYRE 2IU1A 3U66A 4BT9A 1N11A 5JJ6A 3RAUA 3FUNA 2Y3AA 3HXDA 4HLEA 3ABLE 2Y4TA 2JABA 2XPIA 2XGMA 3FU6A 3WXXA 5FQ4A 5EIBE 3AS5A 3Q78A 2IFUA 4U04A 2J09A 5JA4D 3HRAA 2QZAA 1X81A 2DIWA 4ACLA 4ILHB 4XKBA 1ELWA 1KZOA 4LRZA 2BTDA 5KWDA 3CK9A 1OCZE 4J8EA 2H6HA 4CDRA 2I1JA 1TNOA 3CVPA 2X6IA 4ILIA 2B0OE 1AP7A 1Y8MA 4WNGA 5CRVA 2HR2A 3IXEA 4KZ0A 2C0MA 4WNEA 4FP7A 4HRNA 2P2CP 3CHSA 3ZN3A 2BKGA 5BNWA 5HRYA 1SVXA 2KXPC 3FUJA 5KJMA 4G26A 4LEUA 5T4YA 5JJTA 4XKCA 4FJZA 1O5MA 3FP3A 3G2TA 2AXVA 4TUUA 3E32A 1TJCA 5LX8A 1H6PA 2IJGX 4AY5A 2WMNA 1TNBA 1UG3A 3UM3A 3QWWA 4GMJA 3CVXA 3FTSA 5IY5E 3HVEA 3FU0A 2H6FA 4CT4A 2A4ZA 4DLQA 4CRWA 2FO7A 3MEKA 1XNFA 4G1TA 2Y69E 4GTOA 3ABKE 4BT8A 4GYOA 2I2OA 4XEIG 3ENEA 2DCPA 3CHOA 5D0QD 2UWJG 3VTXA 4A3VA 5E75A 4G23A 2FI7A 4JVSA 1JPLA 4GZ6A 2XGOA 2GRNB 1SQMA 3HXCA 1DVPA 4RG6A 2IEJA 4EHMA 3OXFA 4N2QA 4GAAA 1N9AA 3E37A 3DSWA 1EF1C 3ZFWA 4U7EB 2L0IA 1UN8A 3ZYMA 1H6OA 3LPZA 4I1AA 3FWVA 4NQ0A 2VTBA 2NSZA 2C0LA 2HYZA 3BG0B 3FUIA 4UWGA 1BI8B 3UUXA 4CYMD 3C3QA 4GTVA 2WQ6A
chains in the Genus database with same CATH topology
3AG2E 1OCOE 3ASOE 2EIME 3X2QE 2DYRE 1OCZE 3AG1E 1OCRE 3AG4E 3ABME 3WG7E 5B3SE 2EILE 2Y69E 2OCCE 3ABKE 2ZXWE 5B1BE 1V54E 3ABLE 2EIJE 2EINE 1V55E 1OCCE 5IY5E 5B1AE 2DYSE 3AG3E 3ASNE 2EIKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG2 E;  1OCO E;  3ASO E;  2EIM E;  3X2Q E;  2DYR E;  1OCZ E;  3AG1 E;  1OCR E;  3AG4 E;  3ABM E;  3WG7 E;  5B3S E;  2EIL E;  2Y69 E;  2OCC E;  3ABK E;  2ZXW E;  5B1B E;  1V54 E;  3ABL E;  2EIJ E;  2EIN E;  1V55 E;  1OCC E;  5IY5 E;  5B1A E;  2DYS E;  3AG3 E;  3ASN E;  2EIK E; 
#chains in the Genus database with same CATH topology
 2KM4 A;  3ZU7 B;  2DZN A;  3Q49 B;  3L22 A;  5EX0 A;  3AU5 A;  2CG3 A;  4JEH A;  3EU9 A;  4L2L A;  4HNA D;  1NA0 A;  5EYP F;  2NC9 A;  4J0U A;  5ENP D;  3PE3 A;  2WB2 A;  2P9L G;  5H7P A;  4YDW A;  3FUD A;  2MYO A;  1TN7 A;  3Q75 A;  3L13 A;  3OXL A;  4F6R D;  3MKR A;  5AQB A;  4Y6W A;  2CFU A;  1IHG A;  5JJ7 A;  3WG7 E;  2DVW A;  3U4T A;  3N71 A;  4IRU A;  2M63 A;  2VGY A;  2ZU6 B;  3EDT B;  5AAR A;  1H2U A;  4U63 A;  3LCA A;  4OVV A;  3KD7 A;  2FF4 A;  4AJW A;  1H6K A;  3APF A;  4QQI A;  2YNQ A;  1Z3X A;  4DJA A;  1OCR E;  1MX4 A;  3SNX A;  3ZPJ A;  4AV7 A;  5EIL A;  1FPP A;  4F3V A;  2X6J A;  1JCS A;  2LAI A;  4CDN A;  1EDU A;  3DWL G;  3TWT A;  4A55 A;  4LER A;  1N0Q A;  3NOG D;  3SI5 A;  2V4H C;  4F1S A;  2F0Y A;  1NP7 A;  2BF0 X;  1ZB1 A;  3DBS A;  2XEN A;  3B7R L;  4UWK A;  2Q7F A;  1N0R A;  5AJL A;  2VSX E;  2X6K A;  3RSE G;  2VGE A;  3MV3 B;  2WXN A;  1HX8 A;  3Q7F A;  2HM8 A;  2L9B A;  3T5V A;  2WMO A;  2AWI A;  3D9H A;  4ATZ D;  1E7U A;  4DI4 A;  1Z5S C;  3CVV A;  3ML9 A;  3E30 A;  3UIP C;  3FHE A;  3ZVV A;  4KZC A;  3B7B A;  1E8X A;  1O1T A;  1E90 A;  1LTX A;  2XEE A;  5A6C A;  4CZ2 D;  1QBQ A;  5J90 A;  1K1B A;  5G05 J;  3L17 A;  1U3D A;  2I1K A;  1VDY A;  2AXZ A;  4FU3 A;  4O6F A;  3I4G A;  4RVB A;  4AP2 A;  4GA2 A;  4TUM A;  4N39 A;  2LSU A;  4TXQ A;  1FVF A;  2E2E A;  4GZ5 A;  4YDY A;  5G2N A;  5KJK A;  3JQ1 A;  3SF4 A;  4IN3 B;  3VLD A;  2QYJ A;  4DX7 D;  1BD8 A;  3CVW A;  4HI9 A;  1HO8 A;  3CEQ A;  1AWC B;  4H7Y A;  1OT8 A;  4J8D A;  4O1P A;  4A63 B;  3L08 A;  3OAW A;  4L7T A;  4LNB A;  2ZGD A;  2R2L A;  1TNZ A;  4EEC A;  3JXI A;  4DK5 A;  1PY1 A;  4URK A;  3FH5 A;  4EZK A;  5EKQ D;  4B89 A;  2YHC A;  2VTB B;  3R7R A;  4CGW A;  1MX2 A;  1KPS B;  3DPD A;  3JUI A;  2IY0 C;  3ONL A;  4FHJ A;  4RQI A;  4MLP A;  4G2V A;  1N52 A;  4KVO A;  4UQX A;  4EBA A;  2L0T B;  3DXK G;  5KCM A;  5FQ8 A;  3AJI A;  3MZL B;  1QZ2 A;  3T9K A;  3D9J A;  1K8K G;  3QNK A;  1TN6 A;  2AVP A;  2V5F A;  3S7J A;  2IOS A;  4G24 A;  5CRU A;  1NZN A;  3UXG A;  2WXO A;  5ENQ D;  3O48 A;  4BFR A;  4ZFH A;  1INZ A;  2ZXW E;  4BEP A;  3U9W A;  1BU9 A;  1O1S A;  4UUC A;  2PL2 A;  3ZUV B;  1OWP A;  3C3R A;  4EPZ A;  4HI8 A;  5LFA A;  3SZ7 A;  1YYH A;  3E33 A;  5FZS A;  3FH8 A;  4L1B A;  4GPK A;  2V5Q C;  3HXE A;  4APF A;  4IUL A;  4Q69 A;  2P9N G;  3FUM A;  3RIB A;  3CVL A;  2XGS A;  4ANU A;  2MOW A;  3SHF A;  1P5Q A;  3KEA A;  4AEZ C;  3EHM A;  3DRA A;  3C3O A;  3VLE A;  1V54 E;  3LYA A;  4I6G A;  2QY7 A;  2EIN E;  2HO1 A;  2F8X K;  5AEN A;  2XEV A;  5J08 A;  4APO A;  1JWG A;  3CQG B;  2J49 A;  3MV2 B;  5ENR D;  2WXJ A;  4PS7 A;  4FAD A;  3PZ2 A;  2VSY A;  3E34 A;  3NZU A;  3SFZ A;  1N4Q A;  1NFI E;  4C48 B;  2MRI A;  2J07 A;  3EUV A;  3MYV A;  2LO6 A;  1JCQ A;  1ELK A;  1TNY A;  4J8F A;  4J6I A;  4B0Z A;  3ESK A;  3HHM A;  3UX4 A;  4OAU C;  4GML A;  2IOL A;  3ML8 A;  1HZ4 A;  5FTP A;  4K5A B;  1OCC E;  2IO2 C;  2QFC A;  4G11 A;  3W9F A;  2E0I A;  3BQO A;  5DBK A;  3LEW A;  5AN8 A;  3IBE A;  3LY7 A;  2X3M A;  1WY6 A;  4YVO A;  2A5U A;  5JHB A;  4JC8 A;  3SQV A;  4AM9 A;  4B94 A;  2ETB A;  3NOC D;  4DLO A;  2IQC A;  3UI2 A;  5KJL A;  3KSQ A;  4GU5 A;  3LS8 A;  5AAO A;  5C1D A;  3CHM A;  4RLY A;  2GW1 A;  1NI1 A;  3GZS A;  5LP0 A;  3DPY A;  2GGF A;  4U95 D;  1V55 E;  4LNG A;  2OOE A;  1S0P A;  3RRU A;  2WXH A;  3UIO C;  3Q7A A;  3FUF A;  4UWF A;  2OV8 A;  4WNF A;  4GTT A;  1SA4 A;  3UQ3 A;  3VLF A;  1SZA A;  3EIJ A;  4CEM A;  2KZT B;  1DCE A;  3FTV A;  1S70 B;  5KNH D;  3F6Q A;  3PNT B;  1DCQ A;  4FC8 A;  1FCH A;  1NL4 A;  3D9O A;  2P9U G;  2KC7 A;  4MKT A;  3AG1 E;  3V2X A;  5CCM A;  3ABM E;  1HG5 A;  4GTM A;  3Q5M A;  3Q73 A;  5ENT D;  2CG2 A;  4Q96 A;  2ZGG A;  3ZEF A;  2UY1 A;  3D9L A;  1LF8 A;  2QC9 A;  1YA0 A;  2LXL A;  2YHE A;  1IHB A;  1HXI A;  3PVL A;  1XGW A;  3QKY A;  4AY6 A;  4G8L A;  2BKK B;  2LSV A;  4BY6 A;  1N4S A;  4N3C A;  1BLX B;  1WG0 A;  2BUG A;  3G2V A;  4TRQ A;  4U0Z A;  4RG9 A;  2PQN A;  3TAX A;  3DSU A;  4C0E A;  2X6H A;  5CEC B;  2ZIR A;  3J5Q B;  4KVM A;  2XS1 A;  4U0S A;  4LNU D;  3CLJ A;  1JWF A;  4HOR A;  4F1P A;  4U8H A;  3V79 K;  1N95 A;  2P9K G;  3LJ3 A;  2RKK A;  5T8I A;  4GTQ A;  2RD0 A;  4M3O A;  3HDX A;  3P2B A;  2WXP A;  5CBO A;  5CHE E;  4OAV B;  1MYO A;  3QAQ A;  3DSX A;  3QOU A;  2IF4 A;  5LCW J;  4ZHB A;  4DX1 A;  4CCA A;  4CDM A;  2XQ0 A;  3HXF A;  2LNI A;  2OEW A;  3L82 A;  3AG3 E;  4Z68 A;  5AJD A;  3L16 A;  3SGH A;  3BEE A;  3TG5 A;  1N4R A;  1N4P A;  4ATG A;  3X2Q E;  4LSZ E;  4UWH A;  2H6I A;  4WND A;  4YDE A;  3CVY A;  3UKU G;  1FVH A;  2J4B A;  3SFY A;  1B89 A;  4JHK A;  3DSS A;  3B7T A;  3QAR A;  4ANV A;  4AXH A;  2ION A;  1QYM A;  3TXN A;  2Y1L E;  3FTW A;  2HE0 A;  2QYU A;  2C2L A;  1OWM A;  4LCT A;  3UKR G;  2LAH A;  2V0P A;  1SW6 A;  5BV1 A;  1ZU2 A;  3JCK C;  5CED B;  2YQ8 A;  3LDZ A;  3MCX A;  4EQF A;  2VYI A;  3ASG A;  4JB8 P;  3TXM A;  3CHQ A;  5ITZ F;  2R17 C;  3SY2 A;  3HYM B;  3E4B A;  4MRU A;  3ASF A;  4U07 A;  3I3N A;  1UW4 B;  4BTB A;  2LUH A;  5HS0 A;  3RO2 A;  3FEX A;  3RRM B;  3PZ4 A;  4L9P A;  3VTY A;  3LJN A;  1D8D A;  3EJN A;  1JCR A;  3K9I A;  3JQ0 A;  4KBQ A;  3FU3 A;  2FBN A;  3D9P A;  3CKB A;  3T8M A;  3MGB A;  1FT2 A;  5BW8 C;  5G04 J;  3ONK A;  4Q94 A;  4XX5 A;  3RK6 A;  1OUV A;  4DPR A;  3TGO A;  3MKQ B;  4GZD A;  4YND A;  3KEZ A;  3ZYK A;  3FUK A;  4TXP A;  2RFA A;  2A5E A;  3FY4 A;  4XE0 A;  1Y6I A;  3PDN A;  2UY1 B;  5ARF A;  2WQH A;  1NA3 A;  4DX5 D;  5ENO D;  4HBD A;  4HRM B;  4K0R A;  2J8S D;  3PE4 A;  4I17 A;  3KSL A;  3ISM C;  4XZ4 A;  2L6B A;  1GW6 A;  1H2V C;  2PZI A;  4IYP A;  4BER A;  4O1O A;  2OVF A;  3APD A;  3UIN C;  1DNP A;  4I9E A;  1QQE A;  3HIZ A;  3RJV A;  3UTM A;  2OEV A;  3L9T A;  4I2W A;  5CMW A;  3IEG A;  3D9K A;  5B3S E;  3NF1 A;  4BTA A;  3DSV A;  3CVQ A;  1K3Z D;  5D66 A;  4GCO A;  4J8Y A;  3FH7 A;  3AG2 E;  4GMR A;  5FIO A;  3HXB A;  1HF8 A;  2AJA A;  4BWR A;  3ZHE B;  1E7V A;  3CHP A;  2AW6 A;  3S7F A;  2GRL A;  2P9I G;  4KYO B;  4J8S A;  2WXG A;  1N54 A;  4K5C A;  4G8K A;  4HB5 A;  1MHQ A;  1QNF A;  2KZT A;  3CR3 A;  2BED A;  5G55 A;  4OVU A;  3D9I A;  4HXI A;  2VGX B;  5AYW D;  2GRQ B;  3UM0 A;  2OVB A;  5BXU A;  3DEP A;  3O4Z A;  4LUN U;  3CQC B;  5FZQ A;  3R7Q A;  3NAW A;  2KCL A;  4JPS A;  1WM5 A;  5G04 C;  3CSF A;  4HS2 A;  5CMY A;  3W9G A;  3EHQ A;  3KS2 A;  4FHK A;  2VSO E;  4PS3 A;  5ANR A;  5G05 C;  3D9M A;  3V31 A;  4UI9 K;  2KCV A;  3MJW A;  5HQ8 A;  2FO1 E;  4HQD A;  2FEZ A;  4JD2 G;  3PZD A;  4BES A;  2Y4U A;  3CK7 A;  1ZBP A;  1E96 B;  4HOT A;  3ASH A;  4AIF A;  3ZXP A;  5FIN A;  2P58 C;  3QJZ A;  3BG1 B;  5A7D B;  1MX6 A;  1Q2Z A;  2H6G A;  3CST A;  3FEY A;  2MHK A;  1TYQ G;  1A17 A;  3AG4 E;  3UMV A;  4B93 B;  2EIL E;  2WXI A;  2I6H A;  4M7C A;  3CKC A;  4GTS A;  3T8K A;  3UT7 A;  3PRE A;  3LKU A;  5FQ6 A;  1SZ9 A;  4G25 A;  3FU5 A;  3TWS A;  2YIN A;  4DX6 D;  3URZ A;  4E85 A;  1D9S A;  1DC2 A;  3APC A;  3PUJ A;  4P29 A;  4I6E A;  1TR4 A;  2WVI A;  5B1B E;  4F7A A;  2CHZ A;  2V4L A;  1RZ4 A;  2XPY A;  3SO8 A;  3FFL A;  4H7X A;  3P1U A;  4K5B A;  3SFX A;  3C5R A;  4RSY A;  4L2Y A;  4ANX A;  3CV0 A;  3ULE G;  3DST A;  4GTR A;  4NAC A;  3PZ3 A;  2OND A;  4WWN A;  3EIQ C;  4N3B A;  3L6A A;  3PH0 C;  3J5P A;  4PUC A;  4HOS A;  4KT6 B;  4FA6 A;  4JEU A;  1L5J A;  5BPP A;  4DRX E;  2EIK E;  3CIA A;  1UN9 A;  3GZ2 A;  3CK8 A;  2J08 A;  4W9R A;  5AIJ A;  3UM2 A;  2AXU A;  3QDN A;  2XCB A;  4AVX A;  4XI0 A;  2ETC A;  2GRR B;  4J7W A;  5KNG A;  3S2A A;  4YVQ C;  3AAA C;  1IKN D;  3ASD A;  3ESL A;  1E8W A;  1WAO 1;  2F37 A;  1RW2 A;  3PUK A;  3TJP A;  4XIF A;  5AQA A;  3TWX A;  1OCO E;  4ABN A;  4BX8 A;  4OYS A;  4L23 A;  2P9P G;  3LVR E;  2ETA A;  2L6J A;  1MQS A;  3ULQ A;  4C0M A;  3LY8 A;  2F8Y A;  3MX3 A;  4DI3 A;  3EU5 A;  3PZ1 A;  3NZS A;  3EHN A;  4GZ3 A;  4I43 A;  2ILR A;  2WXM A;  3KAE A;  4JXT A;  3R9A B;  4C9B B;  2WQ7 A;  2EIM E;  1SA5 A;  5A23 A;  2JEK A;  4GCN A;  5FQ7 A;  3JYS A;  5FT9 A;  3C98 A;  4JA9 A;  3FTY A;  5E76 A;  3CVU A;  3MKQ A;  4HOU A;  5FJY A;  4DX2 A;  2X6F A;  3CHR A;  3NBN B;  5M72 A;  3BU8 A;  4N5C A;  3PS6 A;  3G2U A;  3ZW3 A;  3U3W A;  1TJF A;  2XZT G;  3U64 A;  4TV3 A;  2XPZ A;  4UQZ A;  4BX9 A;  5ENS D;  4O60 A;  4N2S A;  2XCC A;  1HE8 A;  2RG8 A;  4FLH A;  1G3N B;  3JUE A;  2XZD G;  2WM9 A;  4B8C B;  1FT1 A;  3T5X A;  4JHJ A;  3S7B A;  2VJ8 A;  3EHR A;  3FUH A;  1UJK A;  1S63 A;  4GYW A;  2KCK A;  4UI9 J;  2CFZ A;  5JMN D;  3ZHE A;  3AS8 A;  5BXO A;  3G2W A;  3QWP A;  3D9N A;  4GZC A;  5D2M C;  3NB2 A;  4N3A A;  4TXR A;  1HS6 A;  3V2O A;  3MA5 A;  5BV0 A;  5BT1 A;  2VQ2 A;  2R05 A;  5EDS A;  1YCS B;  2GRO B;  3QC1 A;  5LOZ A;  1TEZ A;  1IYG A;  3ASO E;  4PDX A;  2I9C A;  5EN5 D;  2PQR A;  4GYY A;  2VGX A;  3QB2 A;  3ZYL A;  3Q9U C;  2NYJ A;  3DEO A;  5C2Y A;  4WAF A;  2Y0B G;  4U8Y D;  3PRZ A;  4F53 A;  1X5B A;  4JZY A;  4N5Q A;  4HLL A;  2XRZ A;  2WXL A;  4X8Q A;  1Z6T A;  3ZNG A;  3LY9 A;  4BSZ B;  5ARG A;  2R02 A;  4EZJ A;  2CHW A;  3UM1 A;  3UT8 A;  1KT1 A;  3G2S A;  1KT0 A;  4FUL A;  5KJN A;  1OY3 D;  2DWZ A;  5KBA A;  1H0A A;  4WUY A;  2OCC E;  2XHE A;  4CT0 A;  1IXV A;  4U8V D;  2B6C A;  1PC2 A;  1OWN A;  4I2Z A;  4HOQ A;  3RO3 A;  3UPV A;  3R9M A;  4WWP A;  3TWU A;  3FTU A;  2V8S E;  3GYZ A;  2KAT A;  4DUI A;  2EIJ E;  2J9Q A;  4KMO A;  5HI7 A;  3IV0 A;  3I4R B;  3RKV A;  1O1R A;  2DBA A;  4JHR A;  4I9C A;  4CGV A;  1KZP A;  4ME2 A;  3GW4 A;  4FLB A;  4NUR A;  3B95 A;  4UWL A;  1TNU A;  1IQR A;  4EZL A;  4UI9 C;  3Q79 A;  3V30 A;  5HKP A;  2EQX A;  5LCW C;  1D8E A;  3LXU X;  3ZGQ A;  3JXJ A;  1E8Z A;  4GA1 A;  3SBT B;  1OXJ A;  1HU3 A;  4U0U A;  1HG2 A;  3RRN B;  4A1G A;  3B7S A;  4JL0 A;  5JHA A;  1HFA A;  3DXM G;  4HFG A;  3PNL B;  1JUQ A;  2XEH A;  4GTP A;  4NIK A;  3AU4 A;  3HVE B;  1IQU A;  2KBX A;  2XS8 A;  3L54 A;  3TWV A;  5CEA A;  2WXK A;  1K1A A;  2WPV A;  3CGH A;  3Q4A B;  4GB9 A;  3ZYQ A;  5EID A;  2GRP B;  3GZ1 A;  4GPM A;  4UQY A;  2GRM A;  1HH8 A;  1U2V G;  1YMP A;  2WXQ A;  3IHV A;  1PAQ A;  2DZO A;  5FZR A;  1MZC A;  3PEV B;  2P9S G;  3Q47 B;  3ZRH A;  5T3R A;  3ASN E;  3D3M A;  1BPO A;  5BUZ A;  3B7U X;  1E8Y A;  2ZIS A;  4NRH B;  1N94 A;  5D0O D;  1ELR A;  3TWW A;  3TG4 A;  1A5E A;  1WDY A;  3QWV A;  4ILG A;  3ZXS A;  3FUL A;  1LD7 A;  4V3I A;  5ANL A;  5AQ7 A;  4FJY A;  1H2T C;  2PM7 A;  4QFV A;  5ENN A;  5B1A E;  3Q15 A;  5EX3 A;  3B13 A;  3I5P A;  1UOH A;  2LXM A;  1BI7 B;  3NQP A;  4MBG A;  3AS4 A;  1UJJ A;  4BSX A;  4BET A;  3QK0 A;  3SD5 A;  1EPU A;  3IKO B;  3ZIM A;  4PS8 A;  2R59 A;  4R7L A;  3OTN A;  5EYL A;  4I1M A;  4XI9 A;  1OWO A;  2IO3 C;  3FTX A;  3FUE A;  2PM6 A;  2WXR A;  3SBS A;  3Q9N C;  2PNN A;  3FTZ A;  1W3B A;  5CER B;  3UT4 A;  4ANW A;  4I1O B;  4E6H A;  3OXG A;  2DYS E;  4LG6 A;  4ACK A;  4AOF A;  3ULY A;  5CCL A;  3IHY A;  4Y6C A;  1U3C A;  4A3T A;  3LVQ E;  5AQ9 A;  4I6J A;  5DIZ A;  4MS6 A;  2R5S A;  3PEU B;  4JA7 A;  1KLX A;  1MJ0 A;  2J4D A;  4PH4 B;  4EBA G;  3ZKJ A;  1TN8 A;  3S7D A;  4HRL A;  5FWQ A;  2R03 A;  1H19 A;  3TWR A;  4D10 C;  1OWL A;  2RFM A;  3FDH A;  1EYH A;  1Z3Y A;  1LD8 A;  2FUL A;  3TL5 A;  2VSN A;  4GA0 A;  4B8A A;  2XRY A;  4YDO A;  1S64 A;  5CBN A;  4K03 A;  3BUA A;  4A1S A;  3C72 A;  2JLB A;  3TWQ A;  2WXF A;  3HG0 D;  4JW1 A;  3RU0 A;  2CHX A;  3CVN A;  4HVB A;  4WWO A;  2X38 A;  2NXP A;  4U96 D;  4KXK B;  2DYR E;  2IU1 A;  3U66 A;  4BT9 A;  1N11 A;  5JJ6 A;  3RAU A;  3FUN A;  2Y3A A;  3HXD A;  4HLE A;  3ABL E;  2Y4T A;  2JAB A;  2XPI A;  2XGM A;  3FU6 A;  3WXX A;  5FQ4 A;  5EIB E;  3AS5 A;  3Q78 A;  2IFU A;  4U04 A;  2J09 A;  5JA4 D;  3HRA A;  2QZA A;  1X81 A;  2DIW A;  4ACL A;  4ILH B;  4XKB A;  1ELW A;  1KZO A;  4LRZ A;  2BTD A;  5KWD A;  3CK9 A;  1OCZ E;  4J8E A;  2H6H A;  4CDR A;  2I1J A;  1TNO A;  3CVP A;  2X6I A;  4ILI A;  2B0O E;  1AP7 A;  1Y8M A;  4WNG A;  5CRV A;  2HR2 A;  3IXE A;  4KZ0 A;  2C0M A;  4WNE A;  4FP7 A;  4HRN A;  2P2C P;  3CHS A;  3ZN3 A;  2BKG A;  5BNW A;  5HRY A;  1SVX A;  2KXP C;  3FUJ A;  5KJM A;  4G26 A;  4LEU A;  5T4Y A;  5JJT A;  4XKC A;  4FJZ A;  1O5M A;  3FP3 A;  3G2T A;  2AXV A;  4TUU A;  3E32 A;  1TJC A;  5LX8 A;  1H6P A;  2IJG X;  4AY5 A;  2WMN A;  1TNB A;  1UG3 A;  3UM3 A;  3QWW A;  4GMJ A;  3CVX A;  3FTS A;  5IY5 E;  3HVE A;  3FU0 A;  2H6F A;  4CT4 A;  2A4Z A;  4DLQ A;  4CRW A;  2FO7 A;  3MEK A;  1XNF A;  4G1T A;  2Y69 E;  4GTO A;  3ABK E;  4BT8 A;  4GYO A;  2I2O A;  4XEI G;  3ENE A;  2DCP A;  3CHO A;  5D0Q D;  2UWJ G;  3VTX A;  4A3V A;  5E75 A;  4G23 A;  2FI7 A;  4JVS A;  1JPL A;  4GZ6 A;  2XGO A;  2GRN B;  1SQM A;  3HXC A;  1DVP A;  4RG6 A;  2IEJ A;  4EHM A;  3OXF A;  4N2Q A;  4GAA A;  1N9A A;  3E37 A;  3DSW A;  1EF1 C;  3ZFW A;  4U7E B;  2L0I A;  1UN8 A;  3ZYM A;  1H6O A;  3LPZ A;  4I1A A;  3FWV A;  4NQ0 A;  2VTB A;  2NSZ A;  2C0L A;  2HYZ A;  3BG0 B;  3FUI A;  4UWG A;  1BI8 B;  3UUX A;  4CYM D;  3C3Q A;  4GTV A;  2WQ6 A; 
#chains in the Genus database with same CATH homology
 3AG2 E;  1OCO E;  3ASO E;  2EIM E;  3X2Q E;  2DYR E;  1OCZ E;  3AG1 E;  1OCR E;  3AG4 E;  3ABM E;  3WG7 E;  5B3S E;  2EIL E;  2Y69 E;  2OCC E;  3ABK E;  2ZXW E;  5B1B E;  1V54 E;  3ABL E;  2EIJ E;  2EIN E;  1V55 E;  1OCC E;  5IY5 E;  5B1A E;  2DYS E;  3AG3 E;  3ASN E;  2EIK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...