3UT8A

Structural view of a non pfam singleton and crystal packing analysis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
TSLRDLIPKHKFDNSTIDQLCKLIDNEIEPIIFDLLKWLQDYNWPIAKDILPVVVLHQSIAMPHILTILQGNDIMWKYWVIKLMIPYLIYPNKQLVKSELERLSSLEIINEDIREIVNLSKDYLHFYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural view of a non pfam singleton and crystal packing analysis.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16804 DUF5071 Domain of unknown function (DUF5071)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.750 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ut8A00
3UT8A 3UT7A 3UT4A
chains in the Genus database with same CATH superfamily
3BEEA 4CZ2D 2BKGA 5DIZA 5ITZF 4ABNA 3U3WA 3OAWA 3AS5A 4L1BA 1N54A 3KAEA 2NC9A 1MQSA 3RU0A 3CHOA 2ZIRA 5AYWD 2PM6A 3SNXA 4MRUA 4BESA 4U0SA 3DEPA 4ACLA 3R7QA 4RG6A 2LAIA 3NQPA 3OXGA 1V54E 2AVPA 5FT9A 1K1BA 3GZ2A 5EIBE 2KZTA 2GGFA 2XGSA 2LO6A 4I43A 5LX8A 4BSZB 1N52A 4HNAD 3TG4A 4BX9A 3FEXA 5HKPA 5ENNA 4U96D 1PAQA 2AWIA 4HS2A 4J8SA 3ZYKA 3PE3A 3RRNB 3FUDA 3TL5A 1FVFA 3CHRA 1N94A 3MX3A 3WXXA 4GA0A 2RG8A 2EQXA 2RFAA 4RVBA 4H7XA 4MKTA 4GYWA 3V31A 3J5QB 2M63A 4NRHB 5BV1A 4XI0A 5FQ8A 3NOCD 2A4ZA 2A5EA 2UWJG 5EILA 4JXTA 3KEZA 5B1BE 4J7WA 2WVIA 1QQEA 4I1MA 4GZ3A 3EU5A 4IN3B 3AG3E 2P2CP 4X8QA 4LNUD 1N9AA 3HXEA 4YVQC 2VJ8A 3UQ3A 3DSSA 4HQDA 4J8EA 1ELRA 4U07A 2E2EA 3ABLE 5BV0A 1OCOE 5AQBA 1FT2A 5FQ4A 1HO8A 3LS8A 1X5BA 3HXDA 5EDSA 2CG3A 3ZNGA 3ONKA 1HZ4A 4I1AA 4ATZD 3NZUA 2IOLA 1JCRA 4N2QA 1IXVA 2H6GA 4O6FA 4GMJA 1QBQA 2OEVA 2WXQA 4UWLA 2P9IG 4LG6A 5FZRA 3N71A 4F53A 2L9BA 2GW1A 4CGWA 3VTYA 4IRUA 3LY7A 4GCOA 3T5VA 5G05J 3QDNA 3TAXA 2XPIA 3FHEA 3IXEA 2WMNA 4PH4B 2X6HA 3I5PA 1OXJA 2XGOA 3ZU7B 1E7UA 3AG1E 4OAUC 4GTMA 1XNFA 1YCSB 1E96B 2ZISA 2L6BA 2CG2A 2I2OA 4YVOA 1E8WA 3AU4A 2XS8A 3TWVA 4XEIG 3U4TA 4FLBA 4HFGA 5E75A 2PL2A 5FQ7A 5AARA 5JJTA 1A17A 3RJVA 3B7TA 4PDXA 3QB2A 4TUMA 3PNLB 3QARA 3IEGA 1D8DA 3AU5A 3QWVA 4B94A 3DBSA 2VGXA 3Q75A 2Y1LE 2R5SA 2J9QA 3E33A 3C3RA 4PUCA 3LKUA 2WMOA 5EKQD 2KM4A 2XHEA 3FY4A 1O1SA 1NA0A 3MGBA 3G2SA 5JHAA 1K3ZD 3IV0A 3QK0A 2PM7A 2HM8A 3R9AB 3ZHEB 3X2QE 3NB2A 2VSYA 4F7AA 3PE4A 4N2SA 4JA7A 1U3CA 3BU8A 1TNYA 4CDMA 3CVUA 1U2VG 3FEYA 4CT0A 4UQYA 2ETCA 4AOFA 1SA4A 2FF4A 4Z68A 5HQ8A 4JHRA 4HI8A 3ZXSA 5CCLA 4GTSA 4KBQA 1N4RA 3DRAA 3QC1A 5KNHD 3U64A 2UY1B 3CHMA 3OTNA 3LXUX 3ZGQA 4DX7D 2X6JA 2LUHA 3CSTA 1TJCA 3EJNA 4FHKA 5KJMA 4G8KA 3LDZA 4C0MA 4WWOA 3LVQE 2V5QC 4Y6CA 5ANRA 3IHYA 2QY7A 3HVEB 3EIJA 3CGHA 1O1TA 1BD8A 2I6HA 3UI2A 4B8AA 4EBAA 5BNWA 2ZU6B 2Y69E 3C3OA 2WQHA 3FUKA 3S7DA 3RRMB 3JYSA 3EHMA 2V8SE 1H6KA 2R05A 3T5XA 1JCQA 4A63B 4DX1A 1O1RA 2ZGDA 3EHRA 3U9WA 3PUKA 2AXVA 3LEWA 4EBAG 2CHZA 3ASGA 4L23A 3S7FA 2DIWA 3CQCB 3MA5A 2NSZA 3ZHEA 1TNZA 2P9UG 2YINA 4UWKA 3QJZA 5AENA 4U8VD 3BUAA 4JC8A 3ZKJA 2XCBA 1JWGA 2IY0C 1BLXB 3FULA 2J8SD 2P9KG 1MYOA 5D0QD 2LSUA 4LNGA 1JCSA 3PRZA 4GZCA 4N39A 3NAWA 3NF1A 4KZ0A 4XE0A 3CK8A 4J6IA 1TR4A 4I6JA 2WXJA 3MYVA 2X6KA 2FEZA 2WM9A 3D9PA 2IQCA 1OWNA 1UN8A 2C2LA 4OAVB 4F1SA 4JZYA 2GRLA 1GW6A 1JUQA 4A1SA 2I1KA 4FJYA 1OCRE 3FUFA 1UJJA 1HS6A 4Q69A 1WAO1 2R17C 1WG0A 3EDTB 4TXQA 1QYMA 5CHEE 3LPZA 2VYIA 2KZTB 3DEOA 5G05C 4MLPA 4GCNA 3W9GA 5T3RA 4GTTA 3WG7E 5FZQA 3ASOE 4BTAA 2NXPA 2IO3C 2LSVA 2DCPA 4UI9J 4CDNA 3RAUA 3T8KA 2GRMA 5BPPA 4HORA 2BTDA 3DXKG 3FTWA 2RKKA 4L7TA 3J5PA 4DI3A 3CKCA 4KXKB 4EZLA 3Q47B 1XGWA 4BEPA 2WXRA 2DVWA 4G25A 1INZA 3MV3B 3UM1A 4A3TA 3TWWA 2MYOA 1TN7A 1HG2A 5EX0A 3D9JA 1E7VA 1G3NB 5IY5E 5CBOA 3LJNA 2R59A 3UIPC 1UG3A 2KXPC 3VLEA 5BUZA 4UWHA 2V4HC 2P58C 3LCAA 2XEVA 3ZIMA 1WY6A 2HO1A 2XQ0A 3IKOB 3EIQC 1DC2A 4E85A 2L0IA 2EILE 2PQRA 2GROB 4AIFA 3AS8A 2R02A 3ZYLA 4R7LA 2LXMA 2FO1E 2Y0BG 3U66A 2J07A 4GZ6A 5D0OD 4BWRA 4U95D 3UIOC 4JB8P 3PEUB 2E0IA 2YNQA 2J09A 1KT1A 2OVBA 4A1GA 3TWTA 4P29A 5ANLA 3DSXA 3K9IA 2ETAA 1UW4B 3I4GA 2FULA 4AVXA 3SY2A 2IU1A 3L16A 4HOQA 4D10C 1KZPA 3UXGA 1H2UA 2KATA 1OT8A 3DSUA 4N5CA 3CHPA 4EHMA 2H6HA 3BQOA 4B8CB 4ANXA 3DSVA 2R03A 4XZ4A 4K03A 1OUVA 3EUVA 3ABKE 2FI7A 1S70B 2P9NG 5EX3A 1UN9A 4YNDA 2KBXA 5JJ6A 3G2VA 3APFA 4N5QA 1YA0A 5KBAA 3MKRA 3FU0A 1MX4A 4GAAA 4ILGA 1IQRA 1NA3A 3LYAA 3UT4A 4CEMA 4EPZA 1IQUA 3JQ0A 4ILHB 3D9NA 4JHKA 4YDOA 4UI9C 2VGEA 3TXMA 4BTBA 4GZDA 4U63A 3UM0A 4KYOB 5CRUA 2WXMA 3D3MA 4DX2A 3HHMA 3HG0D 1NL4A 3SFYA 4HOTA 1Z6TA 3ZN3A 1NI1A 4G11A 3VLFA 1DVPA 1YYHA 5CCMA 4UWGA 2VSOE 2QC9A 4C0EA 4CYMD 1LF8A 4K5CA 4GA1A 3APDA 4GTRA 4ZHBA 3URZA 2X38A 2EIKE 3HXCA 3FTZA 3FU6A 2DZOA 4Q96A 3ESKA 3B7UX 2XEEA 4WNDA 3GZSA 5D66A 3FTYA 4YDEA 5JHBA 2DYSE 1BI8B 3NOGD 4WAFA 3PREA 3E34A 4FA6A 4AP2A 5ARFA 3MJWA 2GRRB 1DCQA 2ZGGA 5KJKA 4I2ZA 1N4SA 2IO2C 3FDHA 5CERB 3FH7A 3CIAA 4V3IA 2F8XK 3ASDA 2MRIA 4GTPA 3P1UA 1FPPA 1B89A 1S63A 4GPMA 1KPSB 1OCCE 2IOSA 2XZTG 5AN8A 4I2WA 3ZYMA 1N0RA 5D2MC 2Y3AA 3CVXA 2YHCA 4LERA 4UI9K 1X81A 4GTOA 3SGHA 2MHKA 3W9FA 1H6OA 3AS4A 1U3DA 1K8KG 3QKYA 3QWWA 5AIJA 1N0QA 3PZ1A 3CVVA 3UINC 2EINE 4DX6D 1SVXA 3R7RA 4APFA 1JWFA 3T8MA 2L6JA 3G2WA 1W3BA 4KT6B 1HX8A 1FCHA 4YDYA 2XS1A 4U8HA 4H7YA 2WXLA 1KLXA 4QQIA 3L9TA 3FTVA 5T8IA 4G2VA 3L54A 3F6QA 4GU5A 4DPRA 4OYSA 2VTBB 1DCEA 3Q49B 3Q78A 5C2YA 5J90A 4TV3A 1YMPA 2WXKA 2IEJA 5HI7A 3Q73A 2H6IA 3TWRA 5LCWJ 1RW2A 1NZNA 3V79K 3PEVB 4GMRA 2KCKA 4I9EA 4MS6A 3ZW3A 3RSEG 2ONDA 3V2OA 5G55A 1A5EA 2OV8A 3LY9A 4C9BB 1N4PA 5FIOA 5ENSD 3FUHA 3FWVA 2DYRE 5EN5D 5FTPA 4XIFA 4FU3A 4ME2A 1OCZE 2XPZA 4GPKA 3MCXA 4J0UA 2WXHA 1S0PA 2WB2A 3CVYA 3ZPJA 1ZBPA 1Y8MA 4A55A 4JD2G 3G2UA 2GRNB 2P9SG 3ISMC 2JABA 5JMND 1Y6IA 4WNFA 2QYJA 2KCLA 3QNKA 5EIDA 1QNFA 4FHJA 1H6PA 1SW6A 3I4RB 2IJGX 4E6HA 3PZ2A 5HS0A 3D9OA 3D9KA 1HH8A 5CEAA 1OWLA 3RK6A 4FC8A 3D9IA 3FFLA 4TUUA 2V4LA 2VQ2A 4HB5A 4HXIA 3CKBA 4AY5A 3B7SA 2XZDG 4JL0A 3RIBA 3UT7A 3S7JA 2OCCE 2DBAA 3S7BA 3ZEFA 3FUNA 5CRVA 3C3QA 3E30A 3CVLA 4GYYA 1H19A 4ILIA 2J4BA 3ZYQA 2VSNA 1H2VC 3JUEA 4FP7A 4F3VA 3DXMG 2BKKB 3DWLG 2WXFA 3O48A 5JA4D 3Q5MA 1SQMA 3ASHA 1WDYA 3FTSA 2Y4TA 3B13A 3C5RA 2WXPA 4K5BA 4IYPA 5LCWC 5E76A 4AEZC 4NQ0A 4PS8A 3L13A 3KEAA 4BT8A 4DRXE 2QYUA 3TWUA 2WQ7A 3KD7A 5CMYA 4ATGA 5DBKA 1DNPA 2HR2A 1D9SA 4B89A 4LNBA 3V2XA 2CFUA 3KSQA 2BF0X 2QFCA 3CLJA 4TXRA 3RO3A 4U7EB 1E8XA 3HXBA 1LD8A 2VGYA 2XGMA 1Z3YA 2IF4A 5JJ7A 2PQNA 1TNUA 3HYMB 1O5MA 3AJIA 3CK9A 5BXOA 4BX8A 1P5QA 4XKBA 4UWFA 5ENQD 1L5JA 4TRQA 4JW1A 3PZDA 1AWCB 3FTXA 3ZFWA 3MV2B 4BY6A 3ML8A 2JLBA 3SQVA 3PH0C 4UUCA 3JUIA 3PVLA 4AY6A 3ESLA 3TWXA 3ZXPA 2A5UA 4K0RA 3L08A 4ZFHA 1AP7A 3EU9A 2XPYA 3VLDA 4LUNU 4I17A 5ENOD 3FH8A 4BT9A 1H2TC 3SD5A 4HLEA 1KT0A 2F8YA 4BETA 3CVPA 2EIJE 3GW4A 4CCAA 4URKA 4WUYA 3SHFA 1BU9A 1N4QA 4LCTA 1MJ0A 1SZAA 2ZXWE 3DSWA 2X3MA 2V0PA 2L0TB 5AQAA 4XKCA 3QAQA 2I9CA 4WWNA 2GRPB 4I1OB 5G04J 3OXFA 3DSTA 4WNGA 2J4DA 4KZCA 1FT1A 4QFVA 4U04A 3MEKA 3TWQA 5M72A 3Q9NC 5KJLA 2IFUA 5B3SE 1MX6A 3TGOA 3LVRE 1ZB1A 2WXOA 4HI9A 2RFMA 3B95A 4JHJA 3E4BA 4WNEA 3SF4A 1ELKA 3GZ1A 3FUIA 4CDRA 3D9MA 4KVOA 4RG9A 2UY1A 3ENEA 3ML9A 3Q79A 2BEDA 3E32A 5FZSA 1E90A 2V5FA 3TXNA 1HF8A 2OEWA 1UOHA 4PS7A 3JXJA 3C72A 4LSZE 5ENRD 3TWSA 1QZ2A 3CV0A 5B1AE 3HIZA 4XI9A 5AAOA 3FP3A 1EPUA 4BSXA 4EQFA 2HYZA 4W9RA 4F6RD 4EZJA 1MHQA 3FH5A 1HU3A 1OY3D 3E37A 5G04C 4HOUA 1IYGA 4DUIA 3Q7AA 1ELWA 4Q94A 4HRLA 3DPDA 1EYHA 2XENA 5CECB 5HRYA 2X6IA 2PZIA 4JA9A 3NBNB 4RLYA 4J8DA 4J8FA 4APOA 1Z5SC 1E8YA 2RD0A 1HXIA 1SZ9A 2EIME 2H6FA 3UPVA 3T9KA 3PNTB 4FADA 2FO7A 5T4YA 3PZ3A 3ULYA 3RO2A 3R9MA 4HBDA 1EF1C 4UQZA 2C0MA 1LTXA 4GTQA 3LJ3A 4EZKA 3G2TA 3CR3A 5LOZA 5C1DA 4KMOA 2CHXA 5FWQA 2FBNA 3Q9UC 4RSYA 1PY1A 2WXGA 3QOUA 3P2BA 3UKRG 3L22A 1SA5A 4DK5A 4HOSA 3B7BA 1N95A 4N3BA 2OOEA 5KCMA 2AXZA 3LY8A 4JVSA 4A3VA 1KZOA 5CMWA 2KC7A 1VDYA 3RRUA 4GA2A 4YDWA 4GZ5A 3Q15A 3SFZA 4C48B 3D9LA 4XX5A 4N3CA 4DLOA 2AW6A 3CHSA 3QWPA 4GMLA 4L2LA 1EDUA 3UUXA 2VSXE 5LP0A 2F0YA 1Z3XA 4B0ZA 2YQ8A 3ULEG 4B93B 2NYJA 3BG1B 4G26A 3UX4A 4L9PA 4CT4A 3FUJA 1BPOA 3ASNE 2WQ6A 3VTXA 4ACKA 1TNBA 2JEKA 4DI4A 2P9LG 4LEUA 5KWDA 1K1AA 5AQ9A 3KS2A 3APCA 3CEQA 3UM2A 2ILRA 5EYPF 1OWMA 3ABME 5H7PA 4EECA 3FTUA 3HRAA 3HDXA 1TYQG 1IHBA 4JEUA 4RQIA 3CSFA 1TN8A 2XEHA 3FUEA 4ANUA 4F1PA 3SI5A 3EHQA 2KCVA 1MZCA 3ONLA 4CGVA 5BXUA 4AV7A 5ENTD 3UT8A 3CQGB 3TJPA 4UQXA 4G8LA 1OWOA 5FQ6A 4K5AB 1TNOA 1V55E 4HLLA 3L6AA 3Q4AB 2WXIA 3PUJA 3ULQA 3PZ4A 3L82A 4MBGA 4HRMB 4JEHA 3SBSA 4OVUA 4IULA 4U0ZA 2J08A 3BG0B 3B7RL 2ETBA 3CVWA 3JQ1A 3RKVA 5EYLA 2B0OE 1TN6A 4DJAA 5J08A 4O1OA 5BT1A 1OWPA 5FJYA 1HFAA 3FU5A 4G24A 2VGXB 2XCCA 3ZVVA 4BERA 3KSLA 1NFIE 4DX5D 4NACA 4O1PA 3L17A 3PS6A 4NIKA 4GYOA 2MOWA 1MX2A 3MZLB 4GB9A 4OVVA 3SO8A 1FVHA 4G23A 3ZRHA 3JCKC 4U8YD 1IKND 1E8ZA 1WM5A 4NURA 4DLQA 3SZ7A 1LD7A 5FINA 5KJNA 1TEZA 5LFAA 3UTMA 2HE0A 3UM3A 2WXNA 5CEDB 4Y6WA 5ENPD 2WPVA 2Q7FA 3AG2E 5G2NA 4HRNA 4U0UA 4TXPA 4FULA 3IHVA 4KVMA 1PC2A 5A7DB 4G1TA 2I1JA 1JPLA 1ZU2A 4JPSA 4WWPA 1HG5A 5AJLA 5AQ7A 2Y4UA 5A6CA 3FU3A 2XRYA 2P9PG 4CRWA 3NZSA 3DPYA 1N11A 3ASFA 3Q7FA 4L2YA 2LNIA 3CHQA 4FLHA 2DWZA 3CVQA 2CFZA 2B6CA 5ARGA 3I3NA 1HE8A 4HVBA 1IHGA 2AJAA 4AJWA 2F37A 2LXLA 3C98A 3MKQA 3AG4E 1D8EA 4N3AA 4J8YA 4PS3A 2QZAA 5AJDA 2AXUA 3UMVA 2OVFA 2GRQB 2BUGA 4GTVA 3AAAC 3SBTB 1TJFA 1S64A 1BI7B 1RZ4A 3FUMA 4ANWA 2YHEA 5CBNA 1UJKA 3MKQB 2DZNA 2XRZA 3SFXA 4AXHA 2CHWA 4M3OA 3IBEA 3HXFA 3HVEA 1H0AA 3UKUG 3OXLA 5A23A 2LAHA 2X6FA 2J49A 3EHNA 4I6GA 3ZUVB 3O4ZA 3V30A 4I9CA 2VTBA 3S2AA 5KNGA 1NP7A 3JXIA 2R2LA 4BFRA 3D9HA 4LRZA 2C0LA 3PDNA 4ANVA 4I6EA 3CVNA 3GYZA 4O60A 3TG5A 5BW8C 2PNNA 4FJZA 2IONA 3CK7A 4M7CA 4AM9A 1Q2ZA
chains in the Genus database with same CATH topology
3PRZA 4GZCA 5T8IA 3BEEA 2RD0A 1HXIA 3L54A 1SZ9A 4G2VA 4GU5A 4DPRA 4OYSA 4N39A 2VTBB 5DIZA 4ABNA 3U3WA 3UPVA 3OAWA 3Q49B 3PNTB 3AS5A 4L1BA 1N54A 4FADA 2FO7A 5C2YA 3KAEA 2NC9A 5T4YA 5J90A 1MQSA 4TV3A 3CHOA 3RU0A 5AYWD 2WXKA 2PM6A 3NF1A 4KZ0A 4XE0A 5HI7A 3RO2A 3SNXA 4MRUA 1EF1C 4UQZA 4U0SA 2C0MA 3LJ3A 4EZKA 3G2TA 5LCWJ 3CK8A 3CR3A 5LOZA 4ACLA 4J6IA 5C1DA 1NZNA 4I6JA 4KMOA 2CHXA 5FWQA 3PEVB 3R7QA 4RG6A 2FBNA 2LAIA 2KCKA 2WXJA 3MYVA 3NQPA 3OXGA 2X6KA 2WM9A 2FEZA 4I9EA 4MS6A 3ZW3A 3D9PA 2ONDA 4RSYA 1PY1A 2IQCA 1OWNA 1UN8A 5G55A 2AVPA 2WXGA 2OV8A 2C2LA 5FT9A 3LY9A 3GZ2A 3QOUA 2KZTA 4C9BB 2GGFA 2XGSA 4F1SA 4JZYA 3P2BA 2GRLA 1GW6A 1JUQA 3L22A 4DK5A 2LO6A 3FUHA 4HOSA 4I43A 3FWVA 5LX8A 4N3BA 2OOEA 5KCMA 2AXZA 5FTPA 1N52A 3LY8A 4XIFA 4FU3A 4ME2A 4A1SA 2XPZA 4JVSA 4GPKA 2I1KA 4FJYA 3FUFA 1UJJA 3MCXA 3TG4A 1HS6A 4Q69A 1WAO1 4BX9A 2R17C 4J0UA 2WXHA 1S0PA 2WB2A 3FEXA 4A3VA 3CVYA 3EDTB 5ENNA 3ZPJA 1ZBPA 1Y8MA 4A55A 1PAQA 5CHEE 3G2UA 5CMWA 2KC7A 1VDYA 2AWIA 4HS2A 3RRUA 4GA2A 4J8SA 3ZYKA 3PE3A 4GZ5A 3RRNB 3Q15A 3LPZA 3SFZA 2VYIA 3D9LA 4XX5A 3FUDA 2KZTB 4N3CA 3TL5A 1FVFA 4DLOA 3CHSA 2AW6A 1Y6IA 4WNFA 3QWPA 4GMLA 5G05C 2KCLA 3QNKA 3CHRA 4GCNA 4L2LA 1EDUA 4MLPA 3UUXA 3MX3A 3WXXA 2VSXE 1QNFA 4GA0A 4FHJA 2RG8A 5T3RA 5LP0A 2EQXA 4RVBA 4H7XA 4MKTA 3I4RB 1Z3XA 4GYWA 4B0ZA 5FZQA 2IJGX 2M63A 4NRHB 2YQ8A 5BV1A 4XI0A 4E6HA 4BTAA 2NXPA 5FQ8A 3D9OA 2LSVA 3D9KA 1HH8A 2DCPA 4UI9J 4CDNA 3BG1B 1OWLA 3RK6A 4FC8A 2GRMA 2A4ZA 4G26A 3D9IA 2UWJG 3FFLA 3UX4A 5BPPA 4HORA 2BTDA 4TUUA 3FTWA 2V4LA 4CT4A 2VQ2A 3FUJA 4JXTA 3KEZA 1BPOA 4HXIA 4L7TA 3CKBA 4DI3A 4AY5A 2WQ6A 3VTXA 3B7SA 3CKCA 4KXKB 2WVIA 4ACKA 4EZLA 4JL0A 1QQEA 3Q47B 4GZ3A 4I1MA 4IN3B 1XGWA 3RIBA 2JEKA 4DI4A 3UT7A 3S7JA 2WXRA 4G25A 1INZA 3MV3B 4A3TA 4LEUA 2DBAA 4YVQC 3S7BA 3ZEFA 2VJ8A 3UQ3A 3FUNA 3CVLA 4GYYA 1H19A 1HG2A 4J8EA 3D9JA 5EX0A 4ILIA 1ELRA 3KS2A 2E2EA 3APCA 3CEQA 4U07A 2ILRA 5BV0A 1E7VA 1OWMA 2J4BA 3ZYQA 2VSNA 1H2VC 4FP7A 5FQ4A 4F3VA 4EECA 1HO8A 2R59A 1X5BA 1UG3A 3FTUA 3LS8A 5EDSA 2CG3A 2WXFA 3O48A 3ONKA 1HZ4A 3VLEA 4UWHA 4I1AA 5BUZA 3Q5MA 1SQMA 2P58C 3ASHA 3LCAA 2XEVA 3HDXA 3FTSA 3ZIMA 3NZUA 2IOLA 4JEUA 1WY6A 2Y4TA 3CSFA 3B13A 4N2QA 2HO1A 2XQ0A 3FUEA 4ANUA 4O6FA 2WXPA 3IKOB 3EIQC 3SI5A 4IYPA 5LCWC 2KCVA 5E76A 4GMJA 4AEZC 3ONLA 4NQ0A 4CGVA 4E85A 2L0IA 3L13A 4PS8A 2PQRA 4AV7A 2WXQA 3UT8A 4AIFA 4BT8A 3CQGB 3AS8A 4UWLA 3TJPA 3ZYLA 4R7LA 2WQ7A 4UQXA 3KD7A 5CMYA 4ATGA 5DBKA 1DNPA 2HR2A 3N71A 5FZRA 2L9BA 2GW1A 4F53A 4CGWA 1OWOA 5FQ6A 3U66A 3VTYA 2J07A 4GZ6A 5D0OD 4IRUA 3LY7A 4B89A 4BWRA 2CFUA 4GCOA 3T5VA 5G05J 3QDNA 3L6AA 2E0IA 3PEUB 2YNQA 3TAXA 2XPIA 3FHEA 2BF0X 2WXIA 2J09A 2QFCA 1KT1A 3CLJA 3PUJA 2OVBA 2WMNA 3Q4AB 3ULQA 4A1GA 3RO3A 4P29A 5ANLA 4PH4B 2X6HA 3I5PA 4JEHA 3SBSA 4OVUA 3K9IA 2XGOA 4IULA 1E7UA 1E8XA 4U0ZA 2J08A 2VGYA 2XGMA 3BG0B 1XNFA 3B7RL 1Z3YA 1UW4B 2IF4A 3I4GA 2FULA 4AVXA 5JJ7A 3CVWA 2IU1A 2PQNA 3JQ1A 3HYMB 3L16A 3CK9A 3RKVA 4HOQA 4D10C 1E96B 2CG2A 2I2OA 4DJAA 4YVOA 1E8WA 1H2UA 4BX8A 2KATA 5J08A 3AU4A 5BT1A 1OWPA 1P5QA 5FJYA 1HFAA 3CHPA 4N5CA 3U4TA 3FU5A 4FLBA 4HFGA 4B8CB 4ANXA 4G24A 5E75A 2VGXB 2XCCA 4XZ4A 2PL2A 4K03A 5FQ7A 3ZVVA 1OUVA 4XKBA 4UWFA 2FI7A 1L5JA 4NACA 3L17A 4TRQA 5JJTA 1A17A 3PS6A 4JW1A 3PZDA 3RJVA 3B7TA 4GYOA 2MOWA 3FTXA 4PDXA 5EX3A 3MZLB 3QB2A 1UN9A 3MV2B 4YNDA 3PNLB 3QARA 4GB9A 3ZFWA 4OVVA 4BY6A 3IEGA 3ML8A 2JLBA 1FVHA 5JJ6A 3G2VA 3APFA 3AU5A 3PH0C 4G23A 3ZRHA 3JCKC 1YA0A 3JUIA 3FU0A 3MKRA 1E8ZA 1WM5A 3QWVA 3PVLA 4B94A 4GAAA 4NURA 4AY6A 3DBSA 3ESLA 4ILGA 2VGXA 1IQRA 2R5SA 4DLQA 2A5UA 3SZ7A 1NA3A 3LYAA 4K0RA 3UT4A 3L08A 4CEMA 2J9QA 4EPZA 5KJNA 1IQUA 2XPYA 3JQ0A 4ILHB 1TEZA 3VLDA 4PUCA 3D9NA 5LFAA 3LKUA 4LUNU 2WMOA 5EKQD 4I17A 4JHKA 4UI9C 2WXNA 3FH8A 4BT9A 2KM4A 2XHEA 3FY4A 4Y6WA 1H2TC 3TXMA 3SD5A 2WPVA 1NA0A 3MGBA 3G2SA 4GZDA 4BTBA 4HLEA 4U63A 5JHAA 3IV0A 1KT0A 3QK0A 3CVPA 4KYOB 2PM7A 2Q7FA 2WXMA 3D3MA 3GW4A 3HHMA 2HM8A 5G2NA 3R9AB 4U0UA 3ZHEB 4CCAA 4URKA 4WUYA 4HOTA 2VSYA 3SHFA 1Z6TA 3ZN3A 4F7AA 4FULA 4G11A 3VLFA 3IHVA 3PE4A 4N2SA 1DVPA 4LCTA 1PC2A 4KVMA 5A7DB 4JA7A 1SZAA 1U3CA 5CCMA 4G1TA 4UWGA 2VSOE 4C0EA 2I1JA 2X3MA 4CDMA 2V0PA 1JPLA 2L0TB 3CVUA 1LF8A 1ZU2A 4GA1A 4JPSA 3APDA 3FEYA 4WWPA 4CT0A 4UQYA 4XKCA 4AOFA 3URZA 3QAQA 2X38A 1HG5A 2FF4A 5AJLA 2Y4UA 5HQ8A 2I9CA 4JHRA 5A6CA 3FTZA 3FU3A 4WWNA 3ZXSA 2XRYA 4CRWA 3FU6A 5CCLA 4I1OB 4Q96A 5G04J 3ESKA 3OXFA 4KBQA 3B7UX 4WNGA 4WNDA 3QC1A 3NZSA 2J4DA 3U64A 3GZSA 2UY1B 4KZCA 3ASFA 4QFVA 3CHMA 4U04A 4L2YA 3OTNA 3LXUX 3MEKA 3FTYA 3ZGQA 2LNIA 3CHQA 5JHBA 5M72A 4FLHA 2X6JA 3CVQA 2CFZA 3CSTA 5ARGA 3I3NA 4WAFA 1TJCA 3EJNA 4FHKA 3PREA 2IFUA 1HE8A 5KJLA 5KJMA 4HVBA 1IHGA 3TGOA 3LVRE 3LDZA 4AJWA 4FA6A 2WXOA 4AP2A 4C0MA 4WWOA 3C98A 3MKQA 5ARFA 4JHJA 3E4BA 3LVQE 4WNEA 3MJWA 3SF4A 4Y6CA 1ELKA 3GZ1A 3FUIA 4N3AA 5ANRA 4PS3A 3IHYA 4CDRA 3D9MA 5KJKA 2QY7A 4KVOA 5AJDA 3HVEB 3EIJA 4RG9A 2AXUA 2UY1A 3UMVA 4I2ZA 2OVFA 3ENEA 3CGHA 3ML9A 2BUGA 5FZSA 3FDHA 3SBTB 1E90A 2I6HA 2V5FA 3FH7A 1TJFA 3CIAA 4V3IA 3TXNA 3ASDA 2MRIA 4B8AA 1HF8A 4PS7A 3P1UA 3FUMA 1B89A 4EBAA 5BNWA 2ZU6B 4ANWA 2YHEA 1QZ2A 2IOSA 3CV0A 1UJKA 2WQHA 3FUKA 3HIZA 3MKQB 3S7DA 4XI9A 4I2WA 3ZYMA 3RRMB 3JYSA 3EHMA 2Y3AA 2XRZA 3CVXA 2YHCA 2V8SE 2CHWA 4LERA 4M3OA 3FP3A 4UI9K 1EPUA 3IBEA 4AXHA 4BSXA 1H6KA 3HVEA 4EQFA 2HYZA 3SGHA 3T5XA 4W9RA 2MHKA 1H0AA 4EZJA 1MHQA 3AS4A 3OXLA 3FH5A 1HU3A 1U3DA 3U9WA 3PUKA 3QKYA 5A23A 2AXVA 2LAHA 3LEWA 5G04C 4HOUA 1IYGA 4EBAG 3QWWA 2CHZA 2X6FA 5AIJA 2J49A 3ASGA 4L23A 3S7FA 3EHNA 3CVVA 4I6GA 3O4ZA 2VTBA 4I9CA 3S2AA 1ELWA 2DIWA 4Q94A 1NP7A 3CQCB 3DPDA 3R7RA 3MA5A 2NSZA 3ZHEA 4APFA 1EYHA 1JWFA 4BFRA 3T8MA 2X6IA 2L6JA 2PZIA 2YINA 4JA9A 4LRZA 2C0LA 4UWKA 3PDNA 4ANVA 3G2WA 1W3BA 3CVNA 3GYZA 3QJZA 4I6EA 4KT6B 5AENA 4JC8A 1HX8A 5BW8C 3TG5A 1FCHA 2XCBA 4J8DA 1JWGA 4J8FA 4U8HA 4H7YA 3FULA 4FJZA 2WXLA 1KLXA 4APOA 2IONA 5D0QD 3CK7A 4AM9A 2LSUA 3FTVA 1E8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT8 A;  3UT7 A;  3UT4 A; 
#chains in the Genus database with same CATH topology
 3BEE A;  4CZ2 D;  2BKG A;  5DIZ A;  5ITZ F;  4ABN A;  3U3W A;  3OAW A;  3AS5 A;  4L1B A;  1N54 A;  3KAE A;  2NC9 A;  1MQS A;  3RU0 A;  3CHO A;  2ZIR A;  5AYW D;  2PM6 A;  3SNX A;  4MRU A;  4BES A;  4U0S A;  3DEP A;  4ACL A;  3R7Q A;  4RG6 A;  2LAI A;  3NQP A;  3OXG A;  1V54 E;  2AVP A;  5FT9 A;  1K1B A;  3GZ2 A;  5EIB E;  2KZT A;  2GGF A;  2XGS A;  2LO6 A;  4I43 A;  5LX8 A;  4BSZ B;  1N52 A;  4HNA D;  3TG4 A;  4BX9 A;  3FEX A;  5HKP A;  5ENN A;  4U96 D;  1PAQ A;  2AWI A;  4HS2 A;  4J8S A;  3ZYK A;  3PE3 A;  3RRN B;  3FUD A;  3TL5 A;  1FVF A;  3CHR A;  1N94 A;  3MX3 A;  3WXX A;  4GA0 A;  2RG8 A;  2EQX A;  2RFA A;  4RVB A;  4H7X A;  4MKT A;  4GYW A;  3V31 A;  3J5Q B;  2M63 A;  4NRH B;  5BV1 A;  4XI0 A;  5FQ8 A;  3NOC D;  2A4Z A;  2A5E A;  2UWJ G;  5EIL A;  4JXT A;  3KEZ A;  5B1B E;  4J7W A;  2WVI A;  1QQE A;  4I1M A;  4GZ3 A;  3EU5 A;  4IN3 B;  3AG3 E;  2P2C P;  4X8Q A;  4LNU D;  1N9A A;  3HXE A;  4YVQ C;  2VJ8 A;  3UQ3 A;  3DSS A;  4HQD A;  4J8E A;  1ELR A;  4U07 A;  2E2E A;  3ABL E;  5BV0 A;  1OCO E;  5AQB A;  1FT2 A;  5FQ4 A;  1HO8 A;  3LS8 A;  1X5B A;  3HXD A;  5EDS A;  2CG3 A;  3ZNG A;  3ONK A;  1HZ4 A;  4I1A A;  4ATZ D;  3NZU A;  2IOL A;  1JCR A;  4N2Q A;  1IXV A;  2H6G A;  4O6F A;  4GMJ A;  1QBQ A;  2OEV A;  2WXQ A;  4UWL A;  2P9I G;  4LG6 A;  5FZR A;  3N71 A;  4F53 A;  2L9B A;  2GW1 A;  4CGW A;  3VTY A;  4IRU A;  3LY7 A;  4GCO A;  3T5V A;  5G05 J;  3QDN A;  3TAX A;  2XPI A;  3FHE A;  3IXE A;  2WMN A;  4PH4 B;  2X6H A;  3I5P A;  1OXJ A;  2XGO A;  3ZU7 B;  1E7U A;  3AG1 E;  4OAU C;  4GTM A;  1XNF A;  1YCS B;  1E96 B;  2ZIS A;  2L6B A;  2CG2 A;  2I2O A;  4YVO A;  1E8W A;  3AU4 A;  2XS8 A;  3TWV A;  4XEI G;  3U4T A;  4FLB A;  4HFG A;  5E75 A;  2PL2 A;  5FQ7 A;  5AAR A;  5JJT A;  1A17 A;  3RJV A;  3B7T A;  4PDX A;  3QB2 A;  4TUM A;  3PNL B;  3QAR A;  3IEG A;  1D8D A;  3AU5 A;  3QWV A;  4B94 A;  3DBS A;  2VGX A;  3Q75 A;  2Y1L E;  2R5S A;  2J9Q A;  3E33 A;  3C3R A;  4PUC A;  3LKU A;  2WMO A;  5EKQ D;  2KM4 A;  2XHE A;  3FY4 A;  1O1S A;  1NA0 A;  3MGB A;  3G2S A;  5JHA A;  1K3Z D;  3IV0 A;  3QK0 A;  2PM7 A;  2HM8 A;  3R9A B;  3ZHE B;  3X2Q E;  3NB2 A;  2VSY A;  4F7A A;  3PE4 A;  4N2S A;  4JA7 A;  1U3C A;  3BU8 A;  1TNY A;  4CDM A;  3CVU A;  1U2V G;  3FEY A;  4CT0 A;  4UQY A;  2ETC A;  4AOF A;  1SA4 A;  2FF4 A;  4Z68 A;  5HQ8 A;  4JHR A;  4HI8 A;  3ZXS A;  5CCL A;  4GTS A;  4KBQ A;  1N4R A;  3DRA A;  3QC1 A;  5KNH D;  3U64 A;  2UY1 B;  3CHM A;  3OTN A;  3LXU X;  3ZGQ A;  4DX7 D;  2X6J A;  2LUH A;  3CST A;  1TJC A;  3EJN A;  4FHK A;  5KJM A;  4G8K A;  3LDZ A;  4C0M A;  4WWO A;  3LVQ E;  2V5Q C;  4Y6C A;  5ANR A;  3IHY A;  2QY7 A;  3HVE B;  3EIJ A;  3CGH A;  1O1T A;  1BD8 A;  2I6H A;  3UI2 A;  4B8A A;  4EBA A;  5BNW A;  2ZU6 B;  2Y69 E;  3C3O A;  2WQH A;  3FUK A;  3S7D A;  3RRM B;  3JYS A;  3EHM A;  2V8S E;  1H6K A;  2R05 A;  3T5X A;  1JCQ A;  4A63 B;  4DX1 A;  1O1R A;  2ZGD A;  3EHR A;  3U9W A;  3PUK A;  2AXV A;  3LEW A;  4EBA G;  2CHZ A;  3ASG A;  4L23 A;  3S7F A;  2DIW A;  3CQC B;  3MA5 A;  2NSZ A;  3ZHE A;  1TNZ A;  2P9U G;  2YIN A;  4UWK A;  3QJZ A;  5AEN A;  4U8V D;  3BUA A;  4JC8 A;  3ZKJ A;  2XCB A;  1JWG A;  2IY0 C;  1BLX B;  3FUL A;  2J8S D;  2P9K G;  1MYO A;  5D0Q D;  2LSU A;  4LNG A;  1JCS A;  3PRZ A;  4GZC A;  4N39 A;  3NAW A;  3NF1 A;  4KZ0 A;  4XE0 A;  3CK8 A;  4J6I A;  1TR4 A;  4I6J A;  2WXJ A;  3MYV A;  2X6K A;  2FEZ A;  2WM9 A;  3D9P A;  2IQC A;  1OWN A;  1UN8 A;  2C2L A;  4OAV B;  4F1S A;  4JZY A;  2GRL A;  1GW6 A;  1JUQ A;  4A1S A;  2I1K A;  4FJY A;  1OCR E;  3FUF A;  1UJJ A;  1HS6 A;  4Q69 A;  1WAO 1;  2R17 C;  1WG0 A;  3EDT B;  4TXQ A;  1QYM A;  5CHE E;  3LPZ A;  2VYI A;  2KZT B;  3DEO A;  5G05 C;  4MLP A;  4GCN A;  3W9G A;  5T3R A;  4GTT A;  3WG7 E;  5FZQ A;  3ASO E;  4BTA A;  2NXP A;  2IO3 C;  2LSV A;  2DCP A;  4UI9 J;  4CDN A;  3RAU A;  3T8K A;  2GRM A;  5BPP A;  4HOR A;  2BTD A;  3DXK G;  3FTW A;  2RKK A;  4L7T A;  3J5P A;  4DI3 A;  3CKC A;  4KXK B;  4EZL A;  3Q47 B;  1XGW A;  4BEP A;  2WXR A;  2DVW A;  4G25 A;  1INZ A;  3MV3 B;  3UM1 A;  4A3T A;  3TWW A;  2MYO A;  1TN7 A;  1HG2 A;  5EX0 A;  3D9J A;  1E7V A;  1G3N B;  5IY5 E;  5CBO A;  3LJN A;  2R59 A;  3UIP C;  1UG3 A;  2KXP C;  3VLE A;  5BUZ A;  4UWH A;  2V4H C;  2P58 C;  3LCA A;  2XEV A;  3ZIM A;  1WY6 A;  2HO1 A;  2XQ0 A;  3IKO B;  3EIQ C;  1DC2 A;  4E85 A;  2L0I A;  2EIL E;  2PQR A;  2GRO B;  4AIF A;  3AS8 A;  2R02 A;  3ZYL A;  4R7L A;  2LXM A;  2FO1 E;  2Y0B G;  3U66 A;  2J07 A;  4GZ6 A;  5D0O D;  4BWR A;  4U95 D;  3UIO C;  4JB8 P;  3PEU B;  2E0I A;  2YNQ A;  2J09 A;  1KT1 A;  2OVB A;  4A1G A;  3TWT A;  4P29 A;  5ANL A;  3DSX A;  3K9I A;  2ETA A;  1UW4 B;  3I4G A;  2FUL A;  4AVX A;  3SY2 A;  2IU1 A;  3L16 A;  4HOQ A;  4D10 C;  1KZP A;  3UXG A;  1H2U A;  2KAT A;  1OT8 A;  3DSU A;  4N5C A;  3CHP A;  4EHM A;  2H6H A;  3BQO A;  4B8C B;  4ANX A;  3DSV A;  2R03 A;  4XZ4 A;  4K03 A;  1OUV A;  3EUV A;  3ABK E;  2FI7 A;  1S70 B;  2P9N G;  5EX3 A;  1UN9 A;  4YND A;  2KBX A;  5JJ6 A;  3G2V A;  3APF A;  4N5Q A;  1YA0 A;  5KBA A;  3MKR A;  3FU0 A;  1MX4 A;  4GAA A;  4ILG A;  1IQR A;  1NA3 A;  3LYA A;  3UT4 A;  4CEM A;  4EPZ A;  1IQU A;  3JQ0 A;  4ILH B;  3D9N A;  4JHK A;  4YDO A;  4UI9 C;  2VGE A;  3TXM A;  4BTB A;  4GZD A;  4U63 A;  3UM0 A;  4KYO B;  5CRU A;  2WXM A;  3D3M A;  4DX2 A;  3HHM A;  3HG0 D;  1NL4 A;  3SFY A;  4HOT A;  1Z6T A;  3ZN3 A;  1NI1 A;  4G11 A;  3VLF A;  1DVP A;  1YYH A;  5CCM A;  4UWG A;  2VSO E;  2QC9 A;  4C0E A;  4CYM D;  1LF8 A;  4K5C A;  4GA1 A;  3APD A;  4GTR A;  4ZHB A;  3URZ A;  2X38 A;  2EIK E;  3HXC A;  3FTZ A;  3FU6 A;  2DZO A;  4Q96 A;  3ESK A;  3B7U X;  2XEE A;  4WND A;  3GZS A;  5D66 A;  3FTY A;  4YDE A;  5JHB A;  2DYS E;  1BI8 B;  3NOG D;  4WAF A;  3PRE A;  3E34 A;  4FA6 A;  4AP2 A;  5ARF A;  3MJW A;  2GRR B;  1DCQ A;  2ZGG A;  5KJK A;  4I2Z A;  1N4S A;  2IO2 C;  3FDH A;  5CER B;  3FH7 A;  3CIA A;  4V3I A;  2F8X K;  3ASD A;  2MRI A;  4GTP A;  3P1U A;  1FPP A;  1B89 A;  1S63 A;  4GPM A;  1KPS B;  1OCC E;  2IOS A;  2XZT G;  5AN8 A;  4I2W A;  3ZYM A;  1N0R A;  5D2M C;  2Y3A A;  3CVX A;  2YHC A;  4LER A;  4UI9 K;  1X81 A;  4GTO A;  3SGH A;  2MHK A;  3W9F A;  1H6O A;  3AS4 A;  1U3D A;  1K8K G;  3QKY A;  3QWW A;  5AIJ A;  1N0Q A;  3PZ1 A;  3CVV A;  3UIN C;  2EIN E;  4DX6 D;  1SVX A;  3R7R A;  4APF A;  1JWF A;  3T8M A;  2L6J A;  3G2W A;  1W3B A;  4KT6 B;  1HX8 A;  1FCH A;  4YDY A;  2XS1 A;  4U8H A;  4H7Y A;  2WXL A;  1KLX A;  4QQI A;  3L9T A;  3FTV A;  5T8I A;  4G2V A;  3L54 A;  3F6Q A;  4GU5 A;  4DPR A;  4OYS A;  2VTB B;  1DCE A;  3Q49 B;  3Q78 A;  5C2Y A;  5J90 A;  4TV3 A;  1YMP A;  2WXK A;  2IEJ A;  5HI7 A;  3Q73 A;  2H6I A;  3TWR A;  5LCW J;  1RW2 A;  1NZN A;  3V79 K;  3PEV B;  4GMR A;  2KCK A;  4I9E A;  4MS6 A;  3ZW3 A;  3RSE G;  2OND A;  3V2O A;  5G55 A;  1A5E A;  2OV8 A;  3LY9 A;  4C9B B;  1N4P A;  5FIO A;  5ENS D;  3FUH A;  3FWV A;  2DYR E;  5EN5 D;  5FTP A;  4XIF A;  4FU3 A;  4ME2 A;  1OCZ E;  2XPZ A;  4GPK A;  3MCX A;  4J0U A;  2WXH A;  1S0P A;  2WB2 A;  3CVY A;  3ZPJ A;  1ZBP A;  1Y8M A;  4A55 A;  4JD2 G;  3G2U A;  2GRN B;  2P9S G;  3ISM C;  2JAB A;  5JMN D;  1Y6I A;  4WNF A;  2QYJ A;  2KCL A;  3QNK A;  5EID A;  1QNF A;  4FHJ A;  1H6P A;  1SW6 A;  3I4R B;  2IJG X;  4E6H A;  3PZ2 A;  5HS0 A;  3D9O A;  3D9K A;  1HH8 A;  5CEA A;  1OWL A;  3RK6 A;  4FC8 A;  3D9I A;  3FFL A;  4TUU A;  2V4L A;  2VQ2 A;  4HB5 A;  4HXI A;  3CKB A;  4AY5 A;  3B7S A;  2XZD G;  4JL0 A;  3RIB A;  3UT7 A;  3S7J A;  2OCC E;  2DBA A;  3S7B A;  3ZEF A;  3FUN A;  5CRV A;  3C3Q A;  3E30 A;  3CVL A;  4GYY A;  1H19 A;  4ILI A;  2J4B A;  3ZYQ A;  2VSN A;  1H2V C;  3JUE A;  4FP7 A;  4F3V A;  3DXM G;  2BKK B;  3DWL G;  2WXF A;  3O48 A;  5JA4 D;  3Q5M A;  1SQM A;  3ASH A;  1WDY A;  3FTS A;  2Y4T A;  3B13 A;  3C5R A;  2WXP A;  4K5B A;  4IYP A;  5LCW C;  5E76 A;  4AEZ C;  4NQ0 A;  4PS8 A;  3L13 A;  3KEA A;  4BT8 A;  4DRX E;  2QYU A;  3TWU A;  2WQ7 A;  3KD7 A;  5CMY A;  4ATG A;  5DBK A;  1DNP A;  2HR2 A;  1D9S A;  4B89 A;  4LNB A;  3V2X A;  2CFU A;  3KSQ A;  2BF0 X;  2QFC A;  3CLJ A;  4TXR A;  3RO3 A;  4U7E B;  1E8X A;  3HXB A;  1LD8 A;  2VGY A;  2XGM A;  1Z3Y A;  2IF4 A;  5JJ7 A;  2PQN A;  1TNU A;  3HYM B;  1O5M A;  3AJI A;  3CK9 A;  5BXO A;  4BX8 A;  1P5Q A;  4XKB A;  4UWF A;  5ENQ D;  1L5J A;  4TRQ A;  4JW1 A;  3PZD A;  1AWC B;  3FTX A;  3ZFW A;  3MV2 B;  4BY6 A;  3ML8 A;  2JLB A;  3SQV A;  3PH0 C;  4UUC A;  3JUI A;  3PVL A;  4AY6 A;  3ESL A;  3TWX A;  3ZXP A;  2A5U A;  4K0R A;  3L08 A;  4ZFH A;  1AP7 A;  3EU9 A;  2XPY A;  3VLD A;  4LUN U;  4I17 A;  5ENO D;  3FH8 A;  4BT9 A;  1H2T C;  3SD5 A;  4HLE A;  1KT0 A;  2F8Y A;  4BET A;  3CVP A;  2EIJ E;  3GW4 A;  4CCA A;  4URK A;  4WUY A;  3SHF A;  1BU9 A;  1N4Q A;  4LCT A;  1MJ0 A;  1SZA A;  2ZXW E;  3DSW A;  2X3M A;  2V0P A;  2L0T B;  5AQA A;  4XKC A;  3QAQ A;  2I9C A;  4WWN A;  2GRP B;  4I1O B;  5G04 J;  3OXF A;  3DST A;  4WNG A;  2J4D A;  4KZC A;  1FT1 A;  4QFV A;  4U04 A;  3MEK A;  3TWQ A;  5M72 A;  3Q9N C;  5KJL A;  2IFU A;  5B3S E;  1MX6 A;  3TGO A;  3LVR E;  1ZB1 A;  2WXO A;  4HI9 A;  2RFM A;  3B95 A;  4JHJ A;  3E4B A;  4WNE A;  3SF4 A;  1ELK A;  3GZ1 A;  3FUI A;  4CDR A;  3D9M A;  4KVO A;  4RG9 A;  2UY1 A;  3ENE A;  3ML9 A;  3Q79 A;  2BED A;  3E32 A;  5FZS A;  1E90 A;  2V5F A;  3TXN A;  1HF8 A;  2OEW A;  1UOH A;  4PS7 A;  3JXJ A;  3C72 A;  4LSZ E;  5ENR D;  3TWS A;  1QZ2 A;  3CV0 A;  5B1A E;  3HIZ A;  4XI9 A;  5AAO A;  3FP3 A;  1EPU A;  4BSX A;  4EQF A;  2HYZ A;  4W9R A;  4F6R D;  4EZJ A;  1MHQ A;  3FH5 A;  1HU3 A;  1OY3 D;  3E37 A;  5G04 C;  4HOU A;  1IYG A;  4DUI A;  3Q7A A;  1ELW A;  4Q94 A;  4HRL A;  3DPD A;  1EYH A;  2XEN A;  5CEC B;  5HRY A;  2X6I A;  2PZI A;  4JA9 A;  3NBN B;  4RLY A;  4J8D A;  4J8F A;  4APO A;  1Z5S C;  1E8Y A;  2RD0 A;  1HXI A;  1SZ9 A;  2EIM E;  2H6F A;  3UPV A;  3T9K A;  3PNT B;  4FAD A;  2FO7 A;  5T4Y A;  3PZ3 A;  3ULY A;  3RO2 A;  3R9M A;  4HBD A;  1EF1 C;  4UQZ A;  2C0M A;  1LTX A;  4GTQ A;  3LJ3 A;  4EZK A;  3G2T A;  3CR3 A;  5LOZ A;  5C1D A;  4KMO A;  2CHX A;  5FWQ A;  2FBN A;  3Q9U C;  4RSY A;  1PY1 A;  2WXG A;  3QOU A;  3P2B A;  3UKR G;  3L22 A;  1SA5 A;  4DK5 A;  4HOS A;  3B7B A;  1N95 A;  4N3B A;  2OOE A;  5KCM A;  2AXZ A;  3LY8 A;  4JVS A;  4A3V A;  1KZO A;  5CMW A;  2KC7 A;  1VDY A;  3RRU A;  4GA2 A;  4YDW A;  4GZ5 A;  3Q15 A;  3SFZ A;  4C48 B;  3D9L A;  4XX5 A;  4N3C A;  4DLO A;  2AW6 A;  3CHS A;  3QWP A;  4GML A;  4L2L A;  1EDU A;  3UUX A;  2VSX E;  5LP0 A;  2F0Y A;  1Z3X A;  4B0Z A;  2YQ8 A;  3ULE G;  4B93 B;  2NYJ A;  3BG1 B;  4G26 A;  3UX4 A;  4L9P A;  4CT4 A;  3FUJ A;  1BPO A;  3ASN E;  2WQ6 A;  3VTX A;  4ACK A;  1TNB A;  2JEK A;  4DI4 A;  2P9L G;  4LEU A;  5KWD A;  1K1A A;  5AQ9 A;  3KS2 A;  3APC A;  3CEQ A;  3UM2 A;  2ILR A;  5EYP F;  1OWM A;  3ABM E;  5H7P A;  4EEC A;  3FTU A;  3HRA A;  3HDX A;  1TYQ G;  1IHB A;  4JEU A;  4RQI A;  3CSF A;  1TN8 A;  2XEH A;  3FUE A;  4ANU A;  4F1P A;  3SI5 A;  3EHQ A;  2KCV A;  1MZC A;  3ONL A;  4CGV A;  5BXU A;  4AV7 A;  5ENT D;  3UT8 A;  3CQG B;  3TJP A;  4UQX A;  4G8L A;  1OWO A;  5FQ6 A;  4K5A B;  1TNO A;  1V55 E;  4HLL A;  3L6A A;  3Q4A B;  2WXI A;  3PUJ A;  3ULQ A;  3PZ4 A;  3L82 A;  4MBG A;  4HRM B;  4JEH A;  3SBS A;  4OVU A;  4IUL A;  4U0Z A;  2J08 A;  3BG0 B;  3B7R L;  2ETB A;  3CVW A;  3JQ1 A;  3RKV A;  5EYL A;  2B0O E;  1TN6 A;  4DJA A;  5J08 A;  4O1O A;  5BT1 A;  1OWP A;  5FJY A;  1HFA A;  3FU5 A;  4G24 A;  2VGX B;  2XCC A;  3ZVV A;  4BER A;  3KSL A;  1NFI E;  4DX5 D;  4NAC A;  4O1P A;  3L17 A;  3PS6 A;  4NIK A;  4GYO A;  2MOW A;  1MX2 A;  3MZL B;  4GB9 A;  4OVV A;  3SO8 A;  1FVH A;  4G23 A;  3ZRH A;  3JCK C;  4U8Y D;  1IKN D;  1E8Z A;  1WM5 A;  4NUR A;  4DLQ A;  3SZ7 A;  1LD7 A;  5FIN A;  5KJN A;  1TEZ A;  5LFA A;  3UTM A;  2HE0 A;  3UM3 A;  2WXN A;  5CED B;  4Y6W A;  5ENP D;  2WPV A;  2Q7F A;  3AG2 E;  5G2N A;  4HRN A;  4U0U A;  4TXP A;  4FUL A;  3IHV A;  4KVM A;  1PC2 A;  5A7D B;  4G1T A;  2I1J A;  1JPL A;  1ZU2 A;  4JPS A;  4WWP A;  1HG5 A;  5AJL A;  5AQ7 A;  2Y4U A;  5A6C A;  3FU3 A;  2XRY A;  2P9P G;  4CRW A;  3NZS A;  3DPY A;  1N11 A;  3ASF A;  3Q7F A;  4L2Y A;  2LNI A;  3CHQ A;  4FLH A;  2DWZ A;  3CVQ A;  2CFZ A;  2B6C A;  5ARG A;  3I3N A;  1HE8 A;  4HVB A;  1IHG A;  2AJA A;  4AJW A;  2F37 A;  2LXL A;  3C98 A;  3MKQ A;  3AG4 E;  1D8E A;  4N3A A;  4J8Y A;  4PS3 A;  2QZA A;  5AJD A;  2AXU A;  3UMV A;  2OVF A;  2GRQ B;  2BUG A;  4GTV A;  3AAA C;  3SBT B;  1TJF A;  1S64 A;  1BI7 B;  1RZ4 A;  3FUM A;  4ANW A;  2YHE A;  5CBN A;  1UJK A;  3MKQ B;  2DZN A;  2XRZ A;  3SFX A;  4AXH A;  2CHW A;  4M3O A;  3IBE A;  3HXF A;  3HVE A;  1H0A A;  3UKU G;  3OXL A;  5A23 A;  2LAH A;  2X6F A;  2J49 A;  3EHN A;  4I6G A;  3ZUV B;  3O4Z A;  3V30 A;  4I9C A;  2VTB A;  3S2A A;  5KNG A;  1NP7 A;  3JXI A;  2R2L A;  4BFR A;  3D9H A;  4LRZ A;  2C0L A;  3PDN A;  4ANV A;  4I6E A;  3CVN A;  3GYZ A;  4O60 A;  3TG5 A;  5BW8 C;  2PNN A;  4FJZ A;  2ION A;  3CK7 A;  4M7C A;  4AM9 A;  1Q2Z A; 
#chains in the Genus database with same CATH homology
 3PRZ A;  4GZC A;  5T8I A;  3BEE A;  2RD0 A;  1HXI A;  3L54 A;  1SZ9 A;  4G2V A;  4GU5 A;  4DPR A;  4OYS A;  4N39 A;  2VTB B;  5DIZ A;  4ABN A;  3U3W A;  3UPV A;  3OAW A;  3Q49 B;  3PNT B;  3AS5 A;  4L1B A;  1N54 A;  4FAD A;  2FO7 A;  5C2Y A;  3KAE A;  2NC9 A;  5T4Y A;  5J90 A;  1MQS A;  4TV3 A;  3CHO A;  3RU0 A;  5AYW D;  2WXK A;  2PM6 A;  3NF1 A;  4KZ0 A;  4XE0 A;  5HI7 A;  3RO2 A;  3SNX A;  4MRU A;  1EF1 C;  4UQZ A;  4U0S A;  2C0M A;  3LJ3 A;  4EZK A;  3G2T A;  5LCW J;  3CK8 A;  3CR3 A;  5LOZ A;  4ACL A;  4J6I A;  5C1D A;  1NZN A;  4I6J A;  4KMO A;  2CHX A;  5FWQ A;  3PEV B;  3R7Q A;  4RG6 A;  2FBN A;  2LAI A;  2KCK A;  2WXJ A;  3MYV A;  3NQP A;  3OXG A;  2X6K A;  2WM9 A;  2FEZ A;  4I9E A;  4MS6 A;  3ZW3 A;  3D9P A;  2OND A;  4RSY A;  1PY1 A;  2IQC A;  1OWN A;  1UN8 A;  5G55 A;  2AVP A;  2WXG A;  2OV8 A;  2C2L A;  5FT9 A;  3LY9 A;  3GZ2 A;  3QOU A;  2KZT A;  4C9B B;  2GGF A;  2XGS A;  4F1S A;  4JZY A;  3P2B A;  2GRL A;  1GW6 A;  1JUQ A;  3L22 A;  4DK5 A;  2LO6 A;  3FUH A;  4HOS A;  4I43 A;  3FWV A;  5LX8 A;  4N3B A;  2OOE A;  5KCM A;  2AXZ A;  5FTP A;  1N52 A;  3LY8 A;  4XIF A;  4FU3 A;  4ME2 A;  4A1S A;  2XPZ A;  4JVS A;  4GPK A;  2I1K A;  4FJY A;  3FUF A;  1UJJ A;  3MCX A;  3TG4 A;  1HS6 A;  4Q69 A;  1WAO 1;  4BX9 A;  2R17 C;  4J0U A;  2WXH A;  1S0P A;  2WB2 A;  3FEX A;  4A3V A;  3CVY A;  3EDT B;  5ENN A;  3ZPJ A;  1ZBP A;  1Y8M A;  4A55 A;  1PAQ A;  5CHE E;  3G2U A;  5CMW A;  2KC7 A;  1VDY A;  2AWI A;  4HS2 A;  3RRU A;  4GA2 A;  4J8S A;  3ZYK A;  3PE3 A;  4GZ5 A;  3RRN B;  3Q15 A;  3LPZ A;  3SFZ A;  2VYI A;  3D9L A;  4XX5 A;  3FUD A;  2KZT B;  4N3C A;  3TL5 A;  1FVF A;  4DLO A;  3CHS A;  2AW6 A;  1Y6I A;  4WNF A;  3QWP A;  4GML A;  5G05 C;  2KCL A;  3QNK A;  3CHR A;  4GCN A;  4L2L A;  1EDU A;  4MLP A;  3UUX A;  3MX3 A;  3WXX A;  2VSX E;  1QNF A;  4GA0 A;  4FHJ A;  2RG8 A;  5T3R A;  5LP0 A;  2EQX A;  4RVB A;  4H7X A;  4MKT A;  3I4R B;  1Z3X A;  4GYW A;  4B0Z A;  5FZQ A;  2IJG X;  2M63 A;  4NRH B;  2YQ8 A;  5BV1 A;  4XI0 A;  4E6H A;  4BTA A;  2NXP A;  5FQ8 A;  3D9O A;  2LSV A;  3D9K A;  1HH8 A;  2DCP A;  4UI9 J;  4CDN A;  3BG1 B;  1OWL A;  3RK6 A;  4FC8 A;  2GRM A;  2A4Z A;  4G26 A;  3D9I A;  2UWJ G;  3FFL A;  3UX4 A;  5BPP A;  4HOR A;  2BTD A;  4TUU A;  3FTW A;  2V4L A;  4CT4 A;  2VQ2 A;  3FUJ A;  4JXT A;  3KEZ A;  1BPO A;  4HXI A;  4L7T A;  3CKB A;  4DI3 A;  4AY5 A;  2WQ6 A;  3VTX A;  3B7S A;  3CKC A;  4KXK B;  2WVI A;  4ACK A;  4EZL A;  4JL0 A;  1QQE A;  3Q47 B;  4GZ3 A;  4I1M A;  4IN3 B;  1XGW A;  3RIB A;  2JEK A;  4DI4 A;  3UT7 A;  3S7J A;  2WXR A;  4G25 A;  1INZ A;  3MV3 B;  4A3T A;  4LEU A;  2DBA A;  4YVQ C;  3S7B A;  3ZEF A;  2VJ8 A;  3UQ3 A;  3FUN A;  3CVL A;  4GYY A;  1H19 A;  1HG2 A;  4J8E A;  3D9J A;  5EX0 A;  4ILI A;  1ELR A;  3KS2 A;  2E2E A;  3APC A;  3CEQ A;  4U07 A;  2ILR A;  5BV0 A;  1E7V A;  1OWM A;  2J4B A;  3ZYQ A;  2VSN A;  1H2V C;  4FP7 A;  5FQ4 A;  4F3V A;  4EEC A;  1HO8 A;  2R59 A;  1X5B A;  1UG3 A;  3FTU A;  3LS8 A;  5EDS A;  2CG3 A;  2WXF A;  3O48 A;  3ONK A;  1HZ4 A;  3VLE A;  4UWH A;  4I1A A;  5BUZ A;  3Q5M A;  1SQM A;  2P58 C;  3ASH A;  3LCA A;  2XEV A;  3HDX A;  3FTS A;  3ZIM A;  3NZU A;  2IOL A;  4JEU A;  1WY6 A;  2Y4T A;  3CSF A;  3B13 A;  4N2Q A;  2HO1 A;  2XQ0 A;  3FUE A;  4ANU A;  4O6F A;  2WXP A;  3IKO B;  3EIQ C;  3SI5 A;  4IYP A;  5LCW C;  2KCV A;  5E76 A;  4GMJ A;  4AEZ C;  3ONL A;  4NQ0 A;  4CGV A;  4E85 A;  2L0I A;  3L13 A;  4PS8 A;  2PQR A;  4AV7 A;  2WXQ A;  3UT8 A;  4AIF A;  4BT8 A;  3CQG B;  3AS8 A;  4UWL A;  3TJP A;  3ZYL A;  4R7L A;  2WQ7 A;  4UQX A;  3KD7 A;  5CMY A;  4ATG A;  5DBK A;  1DNP A;  2HR2 A;  3N71 A;  5FZR A;  2L9B A;  2GW1 A;  4F53 A;  4CGW A;  1OWO A;  5FQ6 A;  3U66 A;  3VTY A;  2J07 A;  4GZ6 A;  5D0O D;  4IRU A;  3LY7 A;  4B89 A;  4BWR A;  2CFU A;  4GCO A;  3T5V A;  5G05 J;  3QDN A;  3L6A A;  2E0I A;  3PEU B;  2YNQ A;  3TAX A;  2XPI A;  3FHE A;  2BF0 X;  2WXI A;  2J09 A;  2QFC A;  1KT1 A;  3CLJ A;  3PUJ A;  2OVB A;  2WMN A;  3Q4A B;  3ULQ A;  4A1G A;  3RO3 A;  4P29 A;  5ANL A;  4PH4 B;  2X6H A;  3I5P A;  4JEH A;  3SBS A;  4OVU A;  3K9I A;  2XGO A;  4IUL A;  1E7U A;  1E8X A;  4U0Z A;  2J08 A;  2VGY A;  2XGM A;  3BG0 B;  1XNF A;  3B7R L;  1Z3Y A;  1UW4 B;  2IF4 A;  3I4G A;  2FUL A;  4AVX A;  5JJ7 A;  3CVW A;  2IU1 A;  2PQN A;  3JQ1 A;  3HYM B;  3L16 A;  3CK9 A;  3RKV A;  4HOQ A;  4D10 C;  1E96 B;  2CG2 A;  2I2O A;  4DJA A;  4YVO A;  1E8W A;  1H2U A;  4BX8 A;  2KAT A;  5J08 A;  3AU4 A;  5BT1 A;  1OWP A;  1P5Q A;  5FJY A;  1HFA A;  3CHP A;  4N5C A;  3U4T A;  3FU5 A;  4FLB A;  4HFG A;  4B8C B;  4ANX A;  4G24 A;  5E75 A;  2VGX B;  2XCC A;  4XZ4 A;  2PL2 A;  4K03 A;  5FQ7 A;  3ZVV A;  1OUV A;  4XKB A;  4UWF A;  2FI7 A;  1L5J A;  4NAC A;  3L17 A;  4TRQ A;  5JJT A;  1A17 A;  3PS6 A;  4JW1 A;  3PZD A;  3RJV A;  3B7T A;  4GYO A;  2MOW A;  3FTX A;  4PDX A;  5EX3 A;  3MZL B;  3QB2 A;  1UN9 A;  3MV2 B;  4YND A;  3PNL B;  3QAR A;  4GB9 A;  3ZFW A;  4OVV A;  4BY6 A;  3IEG A;  3ML8 A;  2JLB A;  1FVH A;  5JJ6 A;  3G2V A;  3APF A;  3AU5 A;  3PH0 C;  4G23 A;  3ZRH A;  3JCK C;  1YA0 A;  3JUI A;  3FU0 A;  3MKR A;  1E8Z A;  1WM5 A;  3QWV A;  3PVL A;  4B94 A;  4GAA A;  4NUR A;  4AY6 A;  3DBS A;  3ESL A;  4ILG A;  2VGX A;  1IQR A;  2R5S A;  4DLQ A;  2A5U A;  3SZ7 A;  1NA3 A;  3LYA A;  4K0R A;  3UT4 A;  3L08 A;  4CEM A;  2J9Q A;  4EPZ A;  5KJN A;  1IQU A;  2XPY A;  3JQ0 A;  4ILH B;  1TEZ A;  3VLD A;  4PUC A;  3D9N A;  5LFA A;  3LKU A;  4LUN U;  2WMO A;  5EKQ D;  4I17 A;  4JHK A;  4UI9 C;  2WXN A;  3FH8 A;  4BT9 A;  2KM4 A;  2XHE A;  3FY4 A;  4Y6W A;  1H2T C;  3TXM A;  3SD5 A;  2WPV A;  1NA0 A;  3MGB A;  3G2S A;  4GZD A;  4BTB A;  4HLE A;  4U63 A;  5JHA A;  3IV0 A;  1KT0 A;  3QK0 A;  3CVP A;  4KYO B;  2PM7 A;  2Q7F A;  2WXM A;  3D3M A;  3GW4 A;  3HHM A;  2HM8 A;  5G2N A;  3R9A B;  4U0U A;  3ZHE B;  4CCA A;  4URK A;  4WUY A;  4HOT A;  2VSY A;  3SHF A;  1Z6T A;  3ZN3 A;  4F7A A;  4FUL A;  4G11 A;  3VLF A;  3IHV A;  3PE4 A;  4N2S A;  1DVP A;  4LCT A;  1PC2 A;  4KVM A;  5A7D B;  4JA7 A;  1SZA A;  1U3C A;  5CCM A;  4G1T A;  4UWG A;  2VSO E;  4C0E A;  2I1J A;  2X3M A;  4CDM A;  2V0P A;  1JPL A;  2L0T B;  3CVU A;  1LF8 A;  1ZU2 A;  4GA1 A;  4JPS A;  3APD A;  3FEY A;  4WWP A;  4CT0 A;  4UQY A;  4XKC A;  4AOF A;  3URZ A;  3QAQ A;  2X38 A;  1HG5 A;  2FF4 A;  5AJL A;  2Y4U A;  5HQ8 A;  2I9C A;  4JHR A;  5A6C A;  3FTZ A;  3FU3 A;  4WWN A;  3ZXS A;  2XRY A;  4CRW A;  3FU6 A;  5CCL A;  4I1O B;  4Q96 A;  5G04 J;  3ESK A;  3OXF A;  4KBQ A;  3B7U X;  4WNG A;  4WND A;  3QC1 A;  3NZS A;  2J4D A;  3U64 A;  3GZS A;  2UY1 B;  4KZC A;  3ASF A;  4QFV A;  3CHM A;  4U04 A;  4L2Y A;  3OTN A;  3LXU X;  3MEK A;  3FTY A;  3ZGQ A;  2LNI A;  3CHQ A;  5JHB A;  5M72 A;  4FLH A;  2X6J A;  3CVQ A;  2CFZ A;  3CST A;  5ARG A;  3I3N A;  4WAF A;  1TJC A;  3EJN A;  4FHK A;  3PRE A;  2IFU A;  1HE8 A;  5KJL A;  5KJM A;  4HVB A;  1IHG A;  3TGO A;  3LVR E;  3LDZ A;  4AJW A;  4FA6 A;  2WXO A;  4AP2 A;  4C0M A;  4WWO A;  3C98 A;  3MKQ A;  5ARF A;  4JHJ A;  3E4B A;  3LVQ E;  4WNE A;  3MJW A;  3SF4 A;  4Y6C A;  1ELK A;  3GZ1 A;  3FUI A;  4N3A A;  5ANR A;  4PS3 A;  3IHY A;  4CDR A;  3D9M A;  5KJK A;  2QY7 A;  4KVO A;  5AJD A;  3HVE B;  3EIJ A;  4RG9 A;  2AXU A;  2UY1 A;  3UMV A;  4I2Z A;  2OVF A;  3ENE A;  3CGH A;  3ML9 A;  2BUG A;  5FZS A;  3FDH A;  3SBT B;  1E90 A;  2I6H A;  2V5F A;  3FH7 A;  1TJF A;  3CIA A;  4V3I A;  3TXN A;  3ASD A;  2MRI A;  4B8A A;  1HF8 A;  4PS7 A;  3P1U A;  3FUM A;  1B89 A;  4EBA A;  5BNW A;  2ZU6 B;  4ANW A;  2YHE A;  1QZ2 A;  2IOS A;  3CV0 A;  1UJK A;  2WQH A;  3FUK A;  3HIZ A;  3MKQ B;  3S7D A;  4XI9 A;  4I2W A;  3ZYM A;  3RRM B;  3JYS A;  3EHM A;  2Y3A A;  2XRZ A;  3CVX A;  2YHC A;  2V8S E;  2CHW A;  4LER A;  4M3O A;  3FP3 A;  4UI9 K;  1EPU A;  3IBE A;  4AXH A;  4BSX A;  1H6K A;  3HVE A;  4EQF A;  2HYZ A;  3SGH A;  3T5X A;  4W9R A;  2MHK A;  1H0A A;  4EZJ A;  1MHQ A;  3AS4 A;  3OXL A;  3FH5 A;  1HU3 A;  1U3D A;  3U9W A;  3PUK A;  3QKY A;  5A23 A;  2AXV A;  2LAH A;  3LEW A;  5G04 C;  4HOU A;  1IYG A;  4EBA G;  3QWW A;  2CHZ A;  2X6F A;  5AIJ A;  2J49 A;  3ASG A;  4L23 A;  3S7F A;  3EHN A;  3CVV A;  4I6G A;  3O4Z A;  2VTB A;  4I9C A;  3S2A A;  1ELW A;  2DIW A;  4Q94 A;  1NP7 A;  3CQC B;  3DPD A;  3R7R A;  3MA5 A;  2NSZ A;  3ZHE A;  4APF A;  1EYH A;  1JWF A;  4BFR A;  3T8M A;  2X6I A;  2L6J A;  2PZI A;  2YIN A;  4JA9 A;  4LRZ A;  2C0L A;  4UWK A;  3PDN A;  4ANV A;  3G2W A;  1W3B A;  3CVN A;  3GYZ A;  3QJZ A;  4I6E A;  4KT6 B;  5AEN A;  4JC8 A;  1HX8 A;  5BW8 C;  3TG5 A;  1FCH A;  2XCB A;  4J8D A;  1JWG A;  4J8F A;  4U8H A;  4H7Y A;  3FUL A;  4FJZ A;  2WXL A;  1KLX A;  4APO A;  2ION A;  5D0Q D;  3CK7 A;  4AM9 A;  2LSU A;  3FTV A;  1E8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...