3UT8A

Structural view of a non pfam singleton and crystal packing analysis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
TSLRDLIPKHKFDNSTIDQLCKLIDNEIEPIIFDLLKWLQDYNWPIAKDILPVVVLHQSIAMPHILTILQGNDIMWKYWVIKLMIPYLIYPNKQLVKSELERLSSLEIINEDIREIVNLSKDYLHFYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural view of a non pfam singleton and crystal packing analysis.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Unknown function
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16804 DUF5071 Domain of unknown function (DUF5071)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.750 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ut8A00
3UT7A 3UT4A 3UT8A
chains in the Genus database with same CATH superfamily
2YQ8A 1E8WA 5FZQA 1IQUA 3TWTA 4GYYA 3ZHEB 1Z3XA 2WVIA 4MS6A 3Q5MA 2L6JA 1IXVA 4G24A 4ZHBA 2PL2A 1TN6A 2R02A 2DCPA 1YYHA 4EBAA 4JB8P 4APOA 2I1JA 3U66A 1A5EA 3RO2A 4BWRA 3PZDA 2XEEA 3PEUB 4U63A 4AEZC 3AS4A 3PEVB 2WXKA 1ELWA 1X5BA 5JMND 4UI9K 1XNFA 2WXFA 2XPZA 5DIZA 3AS8A 3CVXA 4GTTA 3HVEA 1OWMA 5KJKA 2CG2A 5EX0A 3UQ3A 1N4QA 4L2LA 3UX4A 3LJ3A 3FUNA 3Q75A 5ENTD 3Q73A 4Y6CA 3LY9A 4RQIA 2XGMA 1XGWA 3KEZA 4U8YD 3B7UX 1JCRA 4N3CA 1OWPA 2J4DA 4BTBA 3Q7FA 3FTSA 4N5CA 3D9JA 1WAO1 2L6BA 3EIQC 2P9KG 3CGHA 5AN8A 4B89A 3UM1A 4WWPA 5A7DB 1NA3A 2PZIA 3APFA 1N4SA 4GTVA 1VDYA 3PZ4A 3CHRA 3LEWA 1OCOE 3APDA 2DZNA 4C9BB 1TJFA 3E4BA 3ASOE 2FBNA 3SFXA 4YDEA 4DLOA 2FO1E 4HBDA 3P2BA 3IV0A 3EHMA 3VLFA 1EF1C 4HI9A 4UI9C 1UOHA 3ZXPA 3QARA 3SQVA 4NQ0A 2EIME 3CR3A 1DC2A 3BU8A 3DEOA 3U9WA 3UINC 3LJNA 4GYOA 5ENNA 4FJYA 3JYSA 2YNQA 3T8MA 3ZGQA 3FY4A 1DNPA 4GZCA 1D8DA 1WDYA 3FU0A 3ASFA 2UY1A 1UJJA 2B6CA 4EECA 3ZYLA 2ZISA 3V30A 2WPVA 1TEZA 1EPUA 2IO2C 5H7PA 4EZKA 2J07A 2ZGDA 4F7AA 2WQ7A 2V8SE 4G23A 3CSFA 1SW6A 1KT0A 1QYMA 1ZU2A 1MX4A 3P1UA 1N0QA 2BEDA 4GU5A 4ATZD 4GTPA 4G11A 2YHEA 4FHJA 4Q94A 4NURA 3CK7A 2LSUA 3ZU7B 3CVYA 5FJYA 4BX9A 4HXIA 3FULA 2PQNA 3JXJA 5EYPF 3FU5A 3PUKA 3ULEG 4U7EB 3D9IA 5CECB 2X6FA 4AM9A 3ZW3A 5JA4D 4A55A 1TYQG 3HXDA 3WG7E 5ARGA 4RSYA 3U3WA 4G8LA 4B0ZA 1MYOA 3Q4AB 5EDSA 2RG8A 1BLXB 3UM2A 1LD8A 4UWLA 1H6KA 2DBAA 1V54E 1ZBPA 1NL4A 3FH8A 1WY6A 1RW2A 4XKBA 2VSNA 3D9MA 3RSEG 1KLXA 1P5QA 4CEMA 4CRWA 4JHKA 1G3NB 1JWGA 4NIKA 5ENRD 5FZRA 5IY5E 3GW4A 2P9LG 4CT0A 1Q2ZA 1SZ9A 2X6IA 5CHEE 3QC1A 5ENPD 1JUQA 5D0OD 3ZN3A 5AQ9A 3MJWA 4E85A 4KT6B 3T5XA 1FT1A 4TXQA 3L08A 3O48A 2UWJG 1OCRE 2ONDA 4I1AA 2AXVA 4O1PA 3CIAA 5LCWC 3SFYA 1HX8A 5CMYA 4PS8A 2HE0A 1E90A 4LRZA 3QJZA 4TRQA 3HIZA 2V5FA 1L5JA 3B7SA 4LNUD 4KYOB 4AP2A 3LVQE 3L6AA 1O1SA 3B7BA 4MRUA 1HH8A 2ETCA 5ITZF 4J8EA 4O60A 3LY7A 3FUHA 4FJZA 2AXUA 5FWQA 2XRZA 4G1TA 2WXIA 3ENEA 4V3IA 3S7JA 3GZSA 3PS6A 3BEEA 3S7DA 4M7CA 2WXQA 2KCVA 5ANRA 1N94A 3EU5A 4U0UA 1Y8MA 2Y1LE 4FP7A 3VTYA 3ABME 1BI7B 3QNKA 3SFZA 1HZ4A 4GTSA 4OYSA 3ML9A 3T5VA 5AIJA 3CHQA 1E8XA 4BSZB 4XI0A 4IYPA 5EIDA 3SBTB 4UQYA 3W9GA 5ENQD 1LTXA 3MZLB 2V5QC 4JL0A 3I4RB 3HHMA 2WMNA 3DWLG 3HRAA 5G04J 4ANXA 1FPPA 3V2XA 2WXLA 1BPOA 3BQOA 2QFCA 2P9PG 4J8SA 2QY7A 3NOGD 2LSVA 4YVOA 3EU9A 5EX3A 2AXZA 4M3OA 3CQGB 3KAEA 4GB9A 4UWHA 5E75A 1SZAA 3EDTB 4A1SA 5JJTA 3ASHA 4I6JA 5BNWA 4ANUA 3TXMA 5BV1A 2BF0X 5JJ7A 4U0ZA 4I1OB 4QFVA 3NQPA 4AOFA 2RKKA 4F3VA 3IHVA 2XRYA 4UWFA 1N4PA 4J8FA 3RRUA 1U2VG 2LXLA 3RAUA 2WMOA 1OCZE 3CVQA 4TUMA 3ONLA 3OXGA 1O1RA 4J6IA 4YVQC 1UG3A 5A23A 4FHKA 1OXJA 3BUAA 3CHPA 1LF8A 4CCAA 4CT4A 2GW1A 3CK8A 3ZYQA 4UQXA 3FH7A 3IHYA 1NP7A 3VLDA 3MX3A 5CEAA 4JXTA 2WM9A 4A3VA 3MCXA 1H6OA 1H19A 5FIOA 3JCKC 1ZB1A 4DJAA 2XGOA 1AP7A 3UMVA 3SO8A 4N3AA 2KCLA 5HRYA 2VGEA 3CKCA 4DX7D 4TXPA 4DI4A 2XQ0A 5LX8A 2R03A 3C72A 4B8AA 3SHFA 5BXUA 2FF4A 4AJWA 4IN3B 3C3OA 3RJVA 3BG0B 3JXIA 3TWVA 1TNBA 4N3BA 1NA0A 3HDXA 1ELRA 2J49A 5KJNA 4F1PA 2CHXA 2GRRB 2OEWA 2VGXA 3UUXA 1UJKA 2GRQB 1HF8A 2XS1A 2XEVA 2E2EA 1E7VA 4GA0A 1UN9A 3MKQA 4KVMA 3ONKA 4JVSA 5AQBA 3DSWA 4Q69A 3MEKA 2LXMA 1KT1A 4DX1A 1IHGA 5BUZA 1QBQA 3FTWA 1K8KG 3TGOA 5EYLA 3QDNA 3TWRA 1IHBA 1O1TA 4O1OA 3KS2A 5CERB 4I9CA 4DI3A 3TWXA 3D9LA 4BT8A 5JHAA 2R5SA 3CHOA 4U8VD 2XGSA 5B1AE 2WXPA 4ANVA 1D8EA 4GPKA 3UIOC 4EQFA 5KNHD 5D2MC 4GTRA 3HXCA 4QQIA 3FFLA 3IKOB 3FUFA 4N2SA 3NBNB 4BX8A 2J09A 3LPZA 3CVNA 3RK6A 5ARFA 4U07A 1OT8A 3KSQA 2Y69E 3EHNA 1N95A 1N54A 2X6HA 3L9TA 2FEZA 4PS3A 2CHWA 3FTVA 3EUVA 5HS0A 5KJMA 3B95A 3SZ7A 4LCTA 5ANLA 1FVFA 2A5EA 2DVWA 4AY5A 1HG5A 5LP0A 3S7BA 2IFUA 3LYAA 2A4ZA 4GPMA 3HYMB 4KBQA 2HR2A 3O4ZA 3DSVA 4IRUA 2GRLA 3Q79A 4U04A 2C0MA 4I6EA 4YDWA 5LOZA 4WWOA 3VLEA 4ABNA 2ILRA 3C3RA 3N71A 5EKQD 1MZCA 2VSYA 4KMOA 4L1BA 2ETBA 2YHCA 2BTDA 4WAFA 3DBSA 4XE0A 3PRZA 4GAAA 3LCAA 3PZ2A 4YDOA 4JA9A 5AQ7A 2ZXWE 4BSXA 3B13A 4K5BA 4LNBA 3S2AA 2VSXE 2KZTB 3Q47B 2AVPA 2WXGA 2H6IA 4EZLA 1IQRA 3AG2E 4J7WA 3ZYMA 2JEKA 3DSXA 5HQ8A 2VTBB 2RFAA 2C2LA 3JQ0A 1AWCB 3I3NA 4XEIG 2ZU6B 2E0IA 3QKYA 4HRNA 2WXOA 4CDRA 4O6FA 2L0IA 4MKTA 1RZ4A 3I4GA 2QZAA 2VQ2A 5BXOA 4FU3A 3U4TA 3TG5A 1A17A 2KM4A 3ZHEA 2PQRA 4DPRA 2GGFA 5DBKA 2OV8A 1LD7A 5D0QD 2WB2A 3G2TA 4GMJA 3FDHA 4OVVA 4A63B 3Q15A 2KXPC 5FQ6A 5CBNA 2X38A 2H6HA 1U3CA 4AVXA 4CGWA 4WNDA 4G2VA 2BKKB 3X2QE 1QNFA 3EHQA 3NOCD 4JD2G 4EZJA 4DLQA 3FU3A 1MHQA 4HOTA 3CVLA 3EHRA 1MJ0A 3MV3B 2V4LA 2KCKA 3E34A 4H7XA 4N5QA 4A1GA 3PNLB 4JA7A 1TNYA 5AAOA 1SQMA 5FQ4A 1SA4A 4ATGA 2RFMA 4GTMA 3CVWA 1Z6TA 3GZ2A 3ZKJA 2J08A 1YA0A 2P9NG 5AJDA 1JPLA 4EHMA 1JCSA 1EDUA 3MV2B 3G2WA 4AIFA 4GZDA 2CHZA 3MKRA 4TUUA 4WNGA 5A6CA 3L16A 4ME2A 1WM5A 5BT1A 3GZ1A 3PE3A 3BG1B 4FADA 4EBAG 3ASNE 3S7FA 5J08A 2I1KA 4AXHA 4NRHB 3AJIA 2XENA 2V0PA 2WXJA 5FINA 3DXMG 3ZYKA 3HVEB 1TN8A 4C48B 4GZ3A 2OOEA 4I6GA 4BETA 4HOQA 3RRNB 4HNAD 1K3ZD 5AJLA 3UIPC 4PDXA 2DWZA 3AG1E 3KSLA 2HYZA 4B94A 2DZOA 4HLLA 1U3DA 3ZXSA 1H0AA 2I9CA 3ZEFA 5EIBE 4ACLA 4KZCA 2EIKE 4FLBA 4WUYA 3D9HA 3CVUA 4MBGA 1OWOA 2F8YA 3U64A 2EQXA 2X6JA 3APCA 1MQSA 1E7UA 4TXRA 3E33A 3QWVA 2XZDG 2IF4A 4ZFHA 5D66A 3J5PA 5BW8C 2XS8A 4BFRA 3LXUX 4HB5A 3NAWA 4RG9A 5CEDB 3ABLE 4XX5A 1FT2A 3TXNA 5C1DA 1H2TC 5AYWD 2F0YA 3D9OA 1OUVA 1IYGA 1OCCE 2P9IG 3NF1A 4LUNU 3AU5A 4I2ZA 4UI9J 3R9MA 1H2UA 4JEUA 3CHMA 1SA5A 2KBXA 4HVBA 4GMLA 4W9RA 3ZRHA 3V31A 1W3BA 1KZPA 4DUIA 4F1SA 3CVPA 3SGHA 3RO3A 4U96D 3D9KA 5CBOA 2BKGA 2WXHA 4R7LA 3FP3A 1IKND 3DSUA 3QK0A 2DIWA 4BERA 3KD7A 3ULYA 2UY1B 3LY8A 3L54A 3EJNA 2B0OE 3QOUA 5CCMA 3SY2A 3DPDA 1N52A 4OVUA 4G26A 2PNNA 3TWUA 3TWQA 3W9FA 2MHKA 2ETAA 1N0RA 4GA2A 4HQDA 4HLEA 3Q7AA 2HM8A 2P58C 1N11A 1HG2A 2OVFA 1Z5SC 3NZSA 1Y6IA 3VTXA 2IY0C 4CDNA 4FULA 1S63A 3PH0C 3PNTB 3L82A 3ML8A 3D9PA 1TNZA 2EIJE 4ACKA 4IULA 4ILIA 3LS8A 5T3RA 1HU3A 2WQHA 1DVPA 4UUCA 3UT8A 4DX6D 4JEHA 5T8IA 3FUMA 3Q49B 4JHJA 4HI8A 2XZTG 2F8XK 5CRUA 2A5UA 4E6HA 2AW6A 1BU9A 2M63A 3L13A 4CZ2D 5B3SE 1QQEA 1NI1A 2R17C 3DSSA 5T4YA 3AG3E 1H2VC 3HXEA 2EINE 1TR4A 1OWLA 3UI2A 4HOSA 2CFZA 2VSOE 5G05C 3B7TA 5CRVA 1V55E 4N2QA 4DX2A 1B89A 5C2YA 5ENOD 4CGVA 4HORA 4U8HA 2H6FA 2LAIA 4HOUA 3CVVA 2OVBA 1E8YA 4GYWA 2L9BA 4GZ6A 2DYSE 2Y0BG 1X81A 1E96B 2IU1A 2FULA 3G2UA 3IBEA 3DRAA 4U0SA 3UKRG 5KBAA 1K1AA 5LFAA 4B8CB 4UQZA 3LKUA 3JUIA 3CSTA 5LCWJ 3MGBA 4RVBA 3JQ1A 3ZNGA 4K0RA 4P29A 4JHRA 4FC8A 4HFGA 4LERA 4CDMA 2IOSA 2PM6A 4Q96A 2ZGGA 2R59A 2J9QA 3UT7A 2IEJA 2R2LA 1TNUA 2MYOA 3AS5A 4HS2A 1N4RA 3PUJA 2LAHA 5FQ7A 1BI8B 4JZYA 1JWFA 3Q9NC 2GRNB 4GMRA 3E30A 4XZ4A 2H6GA 3FTYA 4WNEA 5G04C 4LG6A 3WXXA 3D3MA 2QC9A 3CQCB 3ESKA 5FTPA 3ESLA 5BPPA 1N9AA 1PC2A 3FEYA 5FZSA 4AY6A 3OAWA 1TJCA 2MOWA 1FVHA 3FWVA 4F6RD 4A3TA 2I6HA 1DCEA 3G2VA 4YDYA 2NXPA 3TAXA 1INZA 4J8DA 1PY1A 1GW6A 3UM0A 4X8QA 1HFAA 5E76A 4L2YA 3TWWA 5KCMA 2XCCA 3QAQA 2BUGA 5HI7A 4K5AB 3L17A 1JCQA 3CHSA 2QYUA 4BY6A 2IQCA 2AJAA 1DCQA 3L22A 2NYJA 3PDNA 5JJ6A 4OAUC 2KATA 2VYIA 4NACA 4FLHA 2LUHA 2Y4UA 3ISMC 4ANWA 4ILGA 4C0EA 2OCCE 1MX6A 3ZIMA 1UN8A 2IONA 4PUCA 4I1MA 2KC7A 3CEQA 3EIJA 2WXNA 3FH5A 4HRMB 5FT9A 3C3QA 1MX2A 3FTUA 2VGYA 4OAVB 4KXKB 3PZ1A 2FI7A 3E32A 2XEHA 2F37A 5G2NA 3UTMA 3HXBA 4JPSA 2XCBA 1O5MA 1Z3YA 2CFUA 4K5CA 3T9KA 1YMPA 1S70B 4YNDA 2WQ6A 2C0LA 4URKA 2IJGX 3ZPJA 3DEPA 3FUIA 2EILE 2P9UG 2R05A 4L23A 1UW4B 4U95D 3HXFA 4HRLA 3SBSA 1PAQA 2XPIA 1OWNA 4Y6WA 2OEVA 1HO8A 2Q7FA 3TJPA 5KWDA 4D10C 4J8YA 2V4HC 3C5RA 3FEXA 3CKBA 4GCNA 1NZNA 4I43A 1YCSB 3TL5A 3R7RA 4BEPA 1NFIE 2GROB 3CK9A 4K03A 3E37A 3D9NA 5HKPA 2CG3A 3PZ3A 2PM7A 3GYZA 2X3MA 4APFA 2FO7A 3R9AB 3CV0A 2GRPB 4FA6A 2P9SG 4BTAA 2IOLA 1FCHA 4AV7A 3JUEA 5AQAA 5AARA 4LSZE 4RLYA 3NB2A 2AWIA 4LNGA 3J5QB 3OTNA 1QZ2A 3FTXA 2JABA 3C98A 3CLJA 3G2SA 3LVRE 3ULQA 3RU0A 4L9PA 2L0TB 2VGXB 2NSZA 3NZUA 3ASGA 4XI9A 5G05J 2I2OA 4GTOA 1TNOA 2VJ8A 3FUDA 2J8SD 4GZ5A 1BD8A 2Y3AA 1EYHA 2ZIRA 4DX5D 3MKQB 5KJLA 4I17A 3ZUVB 4DRXE 3V79K 3PE4A 4XIFA 1KZOA 2YINA 3F6QA 5AENA 3ASDA 3FU6A 4GTQA 2Y4TA 3HG0D 2LNIA 4PH4B 4I9EA 4N39A 1D9SA 1SVXA 2NC9A 2XPYA 4PS7A 3OXLA 5BV0A 1KPSB 2RD0A 2WXMA 3UM3A 5G55A 3RIBA 2LO6A 3Q9UC 5EILA 3QWWA 1K1BA 5M72A 3FUEA 3TWSA 3OXFA 3SF4A 3FUJA 2QYJA 3FHEA 2GRMA 4GCOA 3RRMB 4WNFA 4CYMD 3LDZA 4EPZA 4L7TA 4MLPA 4LEUA 4BESA 5FQ8A 4ILHB 3IEGA 4KVOA 3B7RL 4BT9A 1H6PA 3SNXA 2XHEA 3PVLA 3T8KA 3DSTA 4WWNA 1HXIA 4UWGA 4GA1A 1WG0A 3QWPA 1ELKA 2P2CP 2KZTA 3UT4A 3Q78A 2IO3C 4H7YA 4XKCA 1S64A 5ENSD 3DXKG 2VTBA 3UPVA 3AU4A 3SD5A 2DYRE 2MRIA 4KZ0A 2JLBA 2WXRA 4C0MA 3UKUG 1E8ZA 3IXEA 4G8KA 3FTZA 5KNGA 3QB2A 5J90A 1HE8A 4TV3A 3TG4A 4I2WA 3ZFWA 3UXGA 4DK5A 3RKVA 3K9IA 3FUKA 3ABKE 3AG4E 4G25A 4J0UA 4JW1A 3PREA 2J4BA 5EN5D 5CMWA 1HS6A 5JHBA 3ZVVA 3I5PA 4JC8A 2HO1A 4B93B 4RG6A 4Z68A 1OY3D 2X6KA 1S0PA 5CCLA 3URZA 3KEAA 3SI5A 1TN7A 4F53A 3DPYA 4UWKA 3V2OA 3AAAC 3MA5A 5B1BE 3MYVA 3R7QA
chains in the Genus database with same CATH topology
2YQ8A 3ESKA 1E8WA 5AIJA 5FTPA 3CHQA 3ESLA 1E8XA 5FZQA 5BPPA 1IQUA 1PC2A 3FEYA 4XI0A 4IYPA 4GYYA 1QNFA 5FZSA 1Z3XA 3ZHEB 4AY6A 3OAWA 1TJCA 3SBTB 4UQYA 2MOWA 2WVIA 4MS6A 4EZJA 1FVHA 4DLQA 3MZLB 3FWVA 3FU3A 3Q5MA 2L6JA 1MHQA 4A3TA 4JL0A 4HOTA 3CVLA 4G24A 2I6HA 2V4LA 2WMNA 2KCKA 3G2VA 3I4RB 3HHMA 3MV3B 5G04J 4ANXA 2NXPA 4H7XA 2WXLA 3TAXA 1INZA 1BPOA 4J8DA 1PY1A 2PL2A 4A1GA 3PNLB 4JA7A 2DCPA 4EBAA 1GW6A 2QFCA 4APOA 1HFAA 2I1JA 3U66A 1SQMA 4L2YA 5E76A 5FQ4A 3RO2A 4ATGA 4BWRA 5KCMA 4J8SA 2QY7A 2XCCA 3PZDA 3QAQA 3CVWA 3PEUB 1Z6TA 3GZ2A 2BUGA 2J08A 5HI7A 4U63A 1YA0A 2LSVA 4YVOA 3L17A 4AEZC 3CHSA 5EX3A 3AS4A 3PEVB 4BY6A 2WXKA 2IQCA 5AJDA 2AXZA 1ELWA 1X5BA 4M3OA 3CQGB 1JPLA 3L22A 4UI9K 1XNFA 3KAEA 1EDUA 3MV2B 4GB9A 3PDNA 4UWHA 2WXFA 2XPZA 5DIZA 3G2WA 3AS8A 5E75A 4AIFA 3CVXA 4GZDA 5JJ6A 1SZAA 2CHZA 3MKRA 4TUUA 3HVEA 4WNGA 1OWMA 3EDTB 5A6CA 3L16A 4ME2A 4A1SA 5KJKA 5JJTA 2CG2A 1WM5A 2KATA 5EX0A 5BT1A 3UQ3A 2VYIA 4NACA 3ASHA 4L2LA 4I6JA 3GZ1A 3PE3A 4FLHA 3UX4A 5BNWA 3BG1B 3LJ3A 4ANUA 3FUNA 3TXMA 4FADA 5BV1A 2Y4UA 4EBAG 2BF0X 5JJ7A 4ANWA 4ILGA 4Y6CA 4U0ZA 4I1OB 3LY9A 3NQPA 4QFVA 3S7FA 4C0EA 2I1KA 5J08A 2XGMA 4AOFA 3ZIMA 1XGWA 1UN8A 4F3VA 3KEZA 4AXHA 3IHVA 4NRHB 2XRYA 2IONA 4PUCA 4I1MA 2KC7A 3CEQA 2V0PA 2WXJA 4UWFA 4J8FA 3EIJA 2WXNA 3B7UX 3RRUA 3FH5A 3ZYKA 3HVEB 4N3CA 1OWPA 2WMOA 4GZ3A 2OOEA 2J4DA 5FT9A 4BTBA 3FTUA 3CVQA 3FTSA 4I6GA 4HOQA 3RRNB 2VGYA 4N5CA 3D9JA 1WAO1 4KXKB 3ONLA 3OXGA 2FI7A 4J6IA 5G2NA 3EIQC 5AJLA 4YVQC 1UG3A 5A23A 3CGHA 4FHKA 4B89A 3CHPA 4JPSA 1LF8A 4PDXA 2XCBA 4WWPA 4CCAA 5A7DB 4CT4A 1NA3A 2PZIA 3APFA 2GW1A 2HYZA 3CK8A 1Z3YA 2CFUA 3ZYQA 4B94A 4YNDA 1VDYA 1U3DA 2WQ6A 3CHRA 3LEWA 2C0LA 4UQXA 3ZXSA 1H0AA 2I9CA 3FH7A 3IHYA 1NP7A 3ZEFA 3APDA 3VLDA 4URKA 2IJGX 3ZPJA 3FUIA 4ACLA 4KZCA 4C9BB 3MX3A 1TJFA 4FLBA 1UW4B 4L23A 4WUYA 3CVUA 4JXTA 3E4BA 1OWOA 2WM9A 3MCXA 4A3VA 1H19A 3SBSA 2FBNA 3U64A 1PAQA 2XPIA 2EQXA 3JCKC 2X6JA 1OWNA 3APCA 4Y6WA 4DJAA 1MQSA 1E7UA 2XGOA 3UMVA 4DLOA 4CDMA 1HO8A 2Q7FA 3QWVA 3TJPA 4N3AA 3P2BA 2KCLA 3IV0A 3EHMA 3CKCA 2IF4A 4DI4A 3VLFA 2XQ0A 1EF1C 4D10C 4UI9C 5LX8A 5BW8C 4B8AA 3SHFA 3FEXA 3QARA 2FF4A 3CKBA 4GCNA 4NQ0A 4BFRA 1NZNA 3LXUX 4AJWA 3CR3A 4I43A 4IN3B 3RJVA 4RG9A 3U9WA 3BG0B 4XX5A 3R7RA 3TL5A 3CK9A 4K03A 4GYOA 4N3BA 5ENNA 3D9NA 1NA0A 4FJYA 3TXNA 5C1DA 3HDXA 3JYSA 1H2TC 1ELRA 2J49A 5AYWD 2YNQA 5KJNA 2CG3A 2PM7A 3D9OA 3GYZA 2X3MA 1OUVA 2CHXA 3T8MA 4APFA 2FO7A 3ZGQA 3R9AB 1IYGA 3CV0A 3FY4A 4LUNU 3NF1A 3AU5A 4FA6A 2VGXA 1DNPA 4I2ZA 4BTAA 4GZCA 3UUXA 1UJKA 4UI9J 2IOLA 1H2UA 4JEUA 3CHMA 1HF8A 1FCHA 3FU0A 2XEVA 3ASFA 4AV7A 2UY1A 1UJJA 4EECA 2E2EA 4HVBA 3ZYLA 4GMLA 4W9RA 3ZRHA 1W3BA 4F1SA 1E7VA 2WPVA 3CVPA 4GA0A 2AWIA 3SGHA 1TEZA 1EPUA 1UN9A 3RO3A 3MKQA 4EZKA 3D9KA 4KVMA 3ONKA 3OTNA 1QZ2A 2WXHA 2J07A 3FTXA 4JVSA 3C98A 3CLJA 3G2SA 4F7AA 3MEKA 4Q69A 3LVRE 4R7LA 2WQ7A 2V8SE 3ULQA 4G23A 1KT1A 3CSFA 3FP3A 2L0TB 3RU0A 1IHGA 2VGXB 1KT0A 3QK0A 2NSZA 2DIWA 5BUZA 3P1UA 1ZU2A 3NZUA 3ASGA 4XI9A 3KD7A 4GU5A 5G05J 2I2OA 2UY1B 4G11A 3FTWA 2VJ8A 2YHEA 3LY8A 3L54A 4FHJA 4Q94A 3EJNA 3FUDA 3TGOA 4NURA 3QOUA 4GZ5A 5CCMA 3CK7A 2Y3AA 1EYHA 3DPDA 3QDNA 1N52A 2LSUA 3CVYA 3MKQB 5FJYA 4HXIA 4BX9A 3FULA 4OVUA 5KJLA 4G26A 2PQNA 3KS2A 4I17A 4I9CA 4DI3A 3FU5A 3PUKA 2MHKA 3PE4A 3D9IA 3D9LA 4XIFA 2X6FA 4GA2A 4BT8A 2YINA 4AM9A 5JHAA 2R5SA 3CHOA 5AENA 2XGSA 3ZW3A 4HLEA 3ASDA 2WXPA 2HM8A 3FU6A 2P58C 2Y4TA 4ANVA 4A55A 1HG2A 4GPKA 2OVFA 5ARGA 4RSYA 2LNIA 4PH4B 4I9EA 4N39A 4EQFA 3U3WA 4B0ZA 3NZSA 1Y6IA 3VTXA 4CDNA 3Q4AB 2NC9A 4FULA 3FFLA 3IKOB 3PH0C 3PNTB 3FUFA 4N2SA 2XPYA 5EDSA 3ML8A 3D9PA 4PS7A 2RG8A 3OXLA 5BV0A 2RD0A 4ACKA 4IULA 4BX8A 4ILIA 2WXMA 2J09A 3LS8A 3LPZA 3CVNA 5G55A 3RIBA 3RK6A 2LO6A 4UWLA 1H6KA 2DBAA 1HU3A 1ZBPA 5T3RA 5ARFA 4U07A 2WQHA 3QWWA 3EHNA 3FH8A 1DVPA 3UT8A 1WY6A 1N54A 2X6HA 4JEHA 5M72A 4XKBA 3FUEA 2FEZA 2VSNA 2CHWA 3D9MA 4PS3A 5T8IA 3FTVA 3FUMA 3Q49B 4JHJA 5KJMA 3SZ7A 4LCTA 5ANLA 3OXFA 1FVFA 3SF4A 3FUJA 4AY5A 2A5UA 1KLXA 3FHEA 4E6HA 2AW6A 1P5QA 1HG5A 4CEMA 2M63A 3S7BA 4CRWA 2GRMA 4JHKA 3L13A 5LP0A 4GCOA 3RRMB 4WNFA 2IFUA 1JWGA 1QQEA 3LYAA 5FZRA 2A4ZA 2R17C 3GW4A 3LDZA 3HYMB 4L7TA 4MLPA 4EPZA 4KBQA 4LEUA 5T4YA 2HR2A 3O4ZA 5FQ8A 1H2VC 4ILHB 4IRUA 4CT0A 2GRLA 1SZ9A 2X6IA 3IEGA 4KVOA 4U04A 5CHEE 2C0MA 3QC1A 3B7RL 4I6EA 4BT9A 5LOZA 1OWLA 4WWOA 3VLEA 3SNXA 4ABNA 2XHEA 1JUQA 5D0OD 3ZN3A 3PVLA 4HOSA 2CFZA 2ILRA 2VSOE 3MJWA 3N71A 1HXIA 4WWNA 5EKQD 5G05C 4E85A 4UWGA 4GA1A 3B7TA 3QWPA 1ELKA 4N2QA 2KZTA 2VSYA 4KMOA 4L1BA 2YHCA 4KT6B 3T5XA 3UT4A 4H7YA 1B89A 2BTDA 4XKCA 4WAFA 5C2YA 3L08A 3O48A 2UWJG 3DBSA 4CGVA 4HORA 4U8HA 4XE0A 2VTBA 2LAIA 4HOUA 3PRZA 2ONDA 4I1AA 2AXVA 4GAAA 3UPVA 3CVVA 3AU4A 3CIAA 3LCAA 5LCWC 1HX8A 2OVBA 5CMYA 4PS8A 3SD5A 1E8YA 1E90A 2MRIA 4JA9A 4KZ0A 2JLBA 2WXRA 4GYWA 4LRZA 4BSXA 4C0MA 3QJZA 2L9BA 3B13A 1E8ZA 4GZ6A 4TRQA 3HIZA 2V5FA 1E96B 3FTZA 1L5JA 3S2AA 2IU1A 3B7SA 2FULA 2VSXE 3G2UA 3QB2A 5J90A 3IBEA 1HE8A 2KZTB 3Q47B 4KYOB 4TV3A 2AVPA 4AP2A 2WXGA 3LVQE 3L6AA 3TG4A 4U0SA 4I2WA 4EZLA 1IQRA 4MRUA 3R7QA 1HH8A 3ZYMA 2JEKA 5LFAA 3ZFWA 4B8CB 4J8EA 5HQ8A 2VTBB 4UQZA 4DK5A 3LKUA 3JUIA 3LY7A 3FUHA 2C2LA 3CSTA 3JQ0A 3I3NA 3K9IA 4FJZA 3FUKA 3RKVA 2AXUA 5LCWJ 2ZU6B 5FWQA 2E0IA 4G25A 3MGBA 3QKYA 4RVBA 2XRZA 3JQ1A 2WXOA 4G1TA 4K0RA 4P29A 4CDRA 4JHRA 4FC8A 4HFGA 3PREA 4J0UA 4JW1A 2IOSA 2PM6A 4LERA 2L0IA 2WXIA 3ENEA 4Q96A 2J4BA 4MKTA 4V3IA 3S7JA 2R59A 2J9QA 3GZSA 5CMWA 1HS6A 3I4GA 3UT7A 3PS6A 3BEEA 2VQ2A 3S7DA 4FU3A 2WXQA 3U4TA 3AS5A 5JHBA 3ZVVA 3TG5A 3I5PA 4HS2A 1A17A 2KCVA 2HO1A 4JC8A 5ANRA 2KM4A 4O6FA 3PUJA 2LAHA 4U0UA 3ZHEA 5FQ7A 2PQRA 1Y8MA 4RG6A 4DPRA 2GGFA 5DBKA 4FP7A 2OV8A 4JZYA 1JWFA 5D0QD 2X6KA 3VTYA 3QNKA 2WB2A 4XZ4A 1S0PA 3FTYA 4WNEA 5CCLA 3SFZA 3URZA 5G04C 3SI5A 4F53A 3G2TA 4GMJA 1HZ4A 3FDHA 4UWKA 4OYSA 4OVVA 3WXXA 3ML9A 3Q15A 3MA5A 3D3MA 5FQ6A 2X38A 3MYVA 1U3CA 3CQCB 4AVXA 4CGWA 4WNDA 4G2VA 3T5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT7 A;  3UT4 A;  3UT8 A; 
#chains in the Genus database with same CATH topology
 2YQ8 A;  1E8W A;  5FZQ A;  1IQU A;  3TWT A;  4GYY A;  3ZHE B;  1Z3X A;  2WVI A;  4MS6 A;  3Q5M A;  2L6J A;  1IXV A;  4G24 A;  4ZHB A;  2PL2 A;  1TN6 A;  2R02 A;  2DCP A;  1YYH A;  4EBA A;  4JB8 P;  4APO A;  2I1J A;  3U66 A;  1A5E A;  3RO2 A;  4BWR A;  3PZD A;  2XEE A;  3PEU B;  4U63 A;  4AEZ C;  3AS4 A;  3PEV B;  2WXK A;  1ELW A;  1X5B A;  5JMN D;  4UI9 K;  1XNF A;  2WXF A;  2XPZ A;  5DIZ A;  3AS8 A;  3CVX A;  4GTT A;  3HVE A;  1OWM A;  5KJK A;  2CG2 A;  5EX0 A;  3UQ3 A;  1N4Q A;  4L2L A;  3UX4 A;  3LJ3 A;  3FUN A;  3Q75 A;  5ENT D;  3Q73 A;  4Y6C A;  3LY9 A;  4RQI A;  2XGM A;  1XGW A;  3KEZ A;  4U8Y D;  3B7U X;  1JCR A;  4N3C A;  1OWP A;  2J4D A;  4BTB A;  3Q7F A;  3FTS A;  4N5C A;  3D9J A;  1WAO 1;  2L6B A;  3EIQ C;  2P9K G;  3CGH A;  5AN8 A;  4B89 A;  3UM1 A;  4WWP A;  5A7D B;  1NA3 A;  2PZI A;  3APF A;  1N4S A;  4GTV A;  1VDY A;  3PZ4 A;  3CHR A;  3LEW A;  1OCO E;  3APD A;  2DZN A;  4C9B B;  1TJF A;  3E4B A;  3ASO E;  2FBN A;  3SFX A;  4YDE A;  4DLO A;  2FO1 E;  4HBD A;  3P2B A;  3IV0 A;  3EHM A;  3VLF A;  1EF1 C;  4HI9 A;  4UI9 C;  1UOH A;  3ZXP A;  3QAR A;  3SQV A;  4NQ0 A;  2EIM E;  3CR3 A;  1DC2 A;  3BU8 A;  3DEO A;  3U9W A;  3UIN C;  3LJN A;  4GYO A;  5ENN A;  4FJY A;  3JYS A;  2YNQ A;  3T8M A;  3ZGQ A;  3FY4 A;  1DNP A;  4GZC A;  1D8D A;  1WDY A;  3FU0 A;  3ASF A;  2UY1 A;  1UJJ A;  2B6C A;  4EEC A;  3ZYL A;  2ZIS A;  3V30 A;  2WPV A;  1TEZ A;  1EPU A;  2IO2 C;  5H7P A;  4EZK A;  2J07 A;  2ZGD A;  4F7A A;  2WQ7 A;  2V8S E;  4G23 A;  3CSF A;  1SW6 A;  1KT0 A;  1QYM A;  1ZU2 A;  1MX4 A;  3P1U A;  1N0Q A;  2BED A;  4GU5 A;  4ATZ D;  4GTP A;  4G11 A;  2YHE A;  4FHJ A;  4Q94 A;  4NUR A;  3CK7 A;  2LSU A;  3ZU7 B;  3CVY A;  5FJY A;  4BX9 A;  4HXI A;  3FUL A;  2PQN A;  3JXJ A;  5EYP F;  3FU5 A;  3PUK A;  3ULE G;  4U7E B;  3D9I A;  5CEC B;  2X6F A;  4AM9 A;  3ZW3 A;  5JA4 D;  4A55 A;  1TYQ G;  3HXD A;  3WG7 E;  5ARG A;  4RSY A;  3U3W A;  4G8L A;  4B0Z A;  1MYO A;  3Q4A B;  5EDS A;  2RG8 A;  1BLX B;  3UM2 A;  1LD8 A;  4UWL A;  1H6K A;  2DBA A;  1V54 E;  1ZBP A;  1NL4 A;  3FH8 A;  1WY6 A;  1RW2 A;  4XKB A;  2VSN A;  3D9M A;  3RSE G;  1KLX A;  1P5Q A;  4CEM A;  4CRW A;  4JHK A;  1G3N B;  1JWG A;  4NIK A;  5ENR D;  5FZR A;  5IY5 E;  3GW4 A;  2P9L G;  4CT0 A;  1Q2Z A;  1SZ9 A;  2X6I A;  5CHE E;  3QC1 A;  5ENP D;  1JUQ A;  5D0O D;  3ZN3 A;  5AQ9 A;  3MJW A;  4E85 A;  4KT6 B;  3T5X A;  1FT1 A;  4TXQ A;  3L08 A;  3O48 A;  2UWJ G;  1OCR E;  2OND A;  4I1A A;  2AXV A;  4O1P A;  3CIA A;  5LCW C;  3SFY A;  1HX8 A;  5CMY A;  4PS8 A;  2HE0 A;  1E90 A;  4LRZ A;  3QJZ A;  4TRQ A;  3HIZ A;  2V5F A;  1L5J A;  3B7S A;  4LNU D;  4KYO B;  4AP2 A;  3LVQ E;  3L6A A;  1O1S A;  3B7B A;  4MRU A;  1HH8 A;  2ETC A;  5ITZ F;  4J8E A;  4O60 A;  3LY7 A;  3FUH A;  4FJZ A;  2AXU A;  5FWQ A;  2XRZ A;  4G1T A;  2WXI A;  3ENE A;  4V3I A;  3S7J A;  3GZS A;  3PS6 A;  3BEE A;  3S7D A;  4M7C A;  2WXQ A;  2KCV A;  5ANR A;  1N94 A;  3EU5 A;  4U0U A;  1Y8M A;  2Y1L E;  4FP7 A;  3VTY A;  3ABM E;  1BI7 B;  3QNK A;  3SFZ A;  1HZ4 A;  4GTS A;  4OYS A;  3ML9 A;  3T5V A;  5AIJ A;  3CHQ A;  1E8X A;  4BSZ B;  4XI0 A;  4IYP A;  5EID A;  3SBT B;  4UQY A;  3W9G A;  5ENQ D;  1LTX A;  3MZL B;  2V5Q C;  4JL0 A;  3I4R B;  3HHM A;  2WMN A;  3DWL G;  3HRA A;  5G04 J;  4ANX A;  1FPP A;  3V2X A;  2WXL A;  1BPO A;  3BQO A;  2QFC A;  2P9P G;  4J8S A;  2QY7 A;  3NOG D;  2LSV A;  4YVO A;  3EU9 A;  5EX3 A;  2AXZ A;  4M3O A;  3CQG B;  3KAE A;  4GB9 A;  4UWH A;  5E75 A;  1SZA A;  3EDT B;  4A1S A;  5JJT A;  3ASH A;  4I6J A;  5BNW A;  4ANU A;  3TXM A;  5BV1 A;  2BF0 X;  5JJ7 A;  4U0Z A;  4I1O B;  4QFV A;  3NQP A;  4AOF A;  2RKK A;  4F3V A;  3IHV A;  2XRY A;  4UWF A;  1N4P A;  4J8F A;  3RRU A;  1U2V G;  2LXL A;  3RAU A;  2WMO A;  1OCZ E;  3CVQ A;  4TUM A;  3ONL A;  3OXG A;  1O1R A;  4J6I A;  4YVQ C;  1UG3 A;  5A23 A;  4FHK A;  1OXJ A;  3BUA A;  3CHP A;  1LF8 A;  4CCA A;  4CT4 A;  2GW1 A;  3CK8 A;  3ZYQ A;  4UQX A;  3FH7 A;  3IHY A;  1NP7 A;  3VLD A;  3MX3 A;  5CEA A;  4JXT A;  2WM9 A;  4A3V A;  3MCX A;  1H6O A;  1H19 A;  5FIO A;  3JCK C;  1ZB1 A;  4DJA A;  2XGO A;  1AP7 A;  3UMV A;  3SO8 A;  4N3A A;  2KCL A;  5HRY A;  2VGE A;  3CKC A;  4DX7 D;  4TXP A;  4DI4 A;  2XQ0 A;  5LX8 A;  2R03 A;  3C72 A;  4B8A A;  3SHF A;  5BXU A;  2FF4 A;  4AJW A;  4IN3 B;  3C3O A;  3RJV A;  3BG0 B;  3JXI A;  3TWV A;  1TNB A;  4N3B A;  1NA0 A;  3HDX A;  1ELR A;  2J49 A;  5KJN A;  4F1P A;  2CHX A;  2GRR B;  2OEW A;  2VGX A;  3UUX A;  1UJK A;  2GRQ B;  1HF8 A;  2XS1 A;  2XEV A;  2E2E A;  1E7V A;  4GA0 A;  1UN9 A;  3MKQ A;  4KVM A;  3ONK A;  4JVS A;  5AQB A;  3DSW A;  4Q69 A;  3MEK A;  2LXM A;  1KT1 A;  4DX1 A;  1IHG A;  5BUZ A;  1QBQ A;  3FTW A;  1K8K G;  3TGO A;  5EYL A;  3QDN A;  3TWR A;  1IHB A;  1O1T A;  4O1O A;  3KS2 A;  5CER B;  4I9C A;  4DI3 A;  3TWX A;  3D9L A;  4BT8 A;  5JHA A;  2R5S A;  3CHO A;  4U8V D;  2XGS A;  5B1A E;  2WXP A;  4ANV A;  1D8E A;  4GPK A;  3UIO C;  4EQF A;  5KNH D;  5D2M C;  4GTR A;  3HXC A;  4QQI A;  3FFL A;  3IKO B;  3FUF A;  4N2S A;  3NBN B;  4BX8 A;  2J09 A;  3LPZ A;  3CVN A;  3RK6 A;  5ARF A;  4U07 A;  1OT8 A;  3KSQ A;  2Y69 E;  3EHN A;  1N95 A;  1N54 A;  2X6H A;  3L9T A;  2FEZ A;  4PS3 A;  2CHW A;  3FTV A;  3EUV A;  5HS0 A;  5KJM A;  3B95 A;  3SZ7 A;  4LCT A;  5ANL A;  1FVF A;  2A5E A;  2DVW A;  4AY5 A;  1HG5 A;  5LP0 A;  3S7B A;  2IFU A;  3LYA A;  2A4Z A;  4GPM A;  3HYM B;  4KBQ A;  2HR2 A;  3O4Z A;  3DSV A;  4IRU A;  2GRL A;  3Q79 A;  4U04 A;  2C0M A;  4I6E A;  4YDW A;  5LOZ A;  4WWO A;  3VLE A;  4ABN A;  2ILR A;  3C3R A;  3N71 A;  5EKQ D;  1MZC A;  2VSY A;  4KMO A;  4L1B A;  2ETB A;  2YHC A;  2BTD A;  4WAF A;  3DBS A;  4XE0 A;  3PRZ A;  4GAA A;  3LCA A;  3PZ2 A;  4YDO A;  4JA9 A;  5AQ7 A;  2ZXW E;  4BSX A;  3B13 A;  4K5B A;  4LNB A;  3S2A A;  2VSX E;  2KZT B;  3Q47 B;  2AVP A;  2WXG A;  2H6I A;  4EZL A;  1IQR A;  3AG2 E;  4J7W A;  3ZYM A;  2JEK A;  3DSX A;  5HQ8 A;  2VTB B;  2RFA A;  2C2L A;  3JQ0 A;  1AWC B;  3I3N A;  4XEI G;  2ZU6 B;  2E0I A;  3QKY A;  4HRN A;  2WXO A;  4CDR A;  4O6F A;  2L0I A;  4MKT A;  1RZ4 A;  3I4G A;  2QZA A;  2VQ2 A;  5BXO A;  4FU3 A;  3U4T A;  3TG5 A;  1A17 A;  2KM4 A;  3ZHE A;  2PQR A;  4DPR A;  2GGF A;  5DBK A;  2OV8 A;  1LD7 A;  5D0Q D;  2WB2 A;  3G2T A;  4GMJ A;  3FDH A;  4OVV A;  4A63 B;  3Q15 A;  2KXP C;  5FQ6 A;  5CBN A;  2X38 A;  2H6H A;  1U3C A;  4AVX A;  4CGW A;  4WND A;  4G2V A;  2BKK B;  3X2Q E;  1QNF A;  3EHQ A;  3NOC D;  4JD2 G;  4EZJ A;  4DLQ A;  3FU3 A;  1MHQ A;  4HOT A;  3CVL A;  3EHR A;  1MJ0 A;  3MV3 B;  2V4L A;  2KCK A;  3E34 A;  4H7X A;  4N5Q A;  4A1G A;  3PNL B;  4JA7 A;  1TNY A;  5AAO A;  1SQM A;  5FQ4 A;  1SA4 A;  4ATG A;  2RFM A;  4GTM A;  3CVW A;  1Z6T A;  3GZ2 A;  3ZKJ A;  2J08 A;  1YA0 A;  2P9N G;  5AJD A;  1JPL A;  4EHM A;  1JCS A;  1EDU A;  3MV2 B;  3G2W A;  4AIF A;  4GZD A;  2CHZ A;  3MKR A;  4TUU A;  4WNG A;  5A6C A;  3L16 A;  4ME2 A;  1WM5 A;  5BT1 A;  3GZ1 A;  3PE3 A;  3BG1 B;  4FAD A;  4EBA G;  3ASN E;  3S7F A;  5J08 A;  2I1K A;  4AXH A;  4NRH B;  3AJI A;  2XEN A;  2V0P A;  2WXJ A;  5FIN A;  3DXM G;  3ZYK A;  3HVE B;  1TN8 A;  4C48 B;  4GZ3 A;  2OOE A;  4I6G A;  4BET A;  4HOQ A;  3RRN B;  4HNA D;  1K3Z D;  5AJL A;  3UIP C;  4PDX A;  2DWZ A;  3AG1 E;  3KSL A;  2HYZ A;  4B94 A;  2DZO A;  4HLL A;  1U3D A;  3ZXS A;  1H0A A;  2I9C A;  3ZEF A;  5EIB E;  4ACL A;  4KZC A;  2EIK E;  4FLB A;  4WUY A;  3D9H A;  3CVU A;  4MBG A;  1OWO A;  2F8Y A;  3U64 A;  2EQX A;  2X6J A;  3APC A;  1MQS A;  1E7U A;  4TXR A;  3E33 A;  3QWV A;  2XZD G;  2IF4 A;  4ZFH A;  5D66 A;  3J5P A;  5BW8 C;  2XS8 A;  4BFR A;  3LXU X;  4HB5 A;  3NAW A;  4RG9 A;  5CED B;  3ABL E;  4XX5 A;  1FT2 A;  3TXN A;  5C1D A;  1H2T C;  5AYW D;  2F0Y A;  3D9O A;  1OUV A;  1IYG A;  1OCC E;  2P9I G;  3NF1 A;  4LUN U;  3AU5 A;  4I2Z A;  4UI9 J;  3R9M A;  1H2U A;  4JEU A;  3CHM A;  1SA5 A;  2KBX A;  4HVB A;  4GML A;  4W9R A;  3ZRH A;  3V31 A;  1W3B A;  1KZP A;  4DUI A;  4F1S A;  3CVP A;  3SGH A;  3RO3 A;  4U96 D;  3D9K A;  5CBO A;  2BKG A;  2WXH A;  4R7L A;  3FP3 A;  1IKN D;  3DSU A;  3QK0 A;  2DIW A;  4BER A;  3KD7 A;  3ULY A;  2UY1 B;  3LY8 A;  3L54 A;  3EJN A;  2B0O E;  3QOU A;  5CCM A;  3SY2 A;  3DPD A;  1N52 A;  4OVU A;  4G26 A;  2PNN A;  3TWU A;  3TWQ A;  3W9F A;  2MHK A;  2ETA A;  1N0R A;  4GA2 A;  4HQD A;  4HLE A;  3Q7A A;  2HM8 A;  2P58 C;  1N11 A;  1HG2 A;  2OVF A;  1Z5S C;  3NZS A;  1Y6I A;  3VTX A;  2IY0 C;  4CDN A;  4FUL A;  1S63 A;  3PH0 C;  3PNT B;  3L82 A;  3ML8 A;  3D9P A;  1TNZ A;  2EIJ E;  4ACK A;  4IUL A;  4ILI A;  3LS8 A;  5T3R A;  1HU3 A;  2WQH A;  1DVP A;  4UUC A;  3UT8 A;  4DX6 D;  4JEH A;  5T8I A;  3FUM A;  3Q49 B;  4JHJ A;  4HI8 A;  2XZT G;  2F8X K;  5CRU A;  2A5U A;  4E6H A;  2AW6 A;  1BU9 A;  2M63 A;  3L13 A;  4CZ2 D;  5B3S E;  1QQE A;  1NI1 A;  2R17 C;  3DSS A;  5T4Y A;  3AG3 E;  1H2V C;  3HXE A;  2EIN E;  1TR4 A;  1OWL A;  3UI2 A;  4HOS A;  2CFZ A;  2VSO E;  5G05 C;  3B7T A;  5CRV A;  1V55 E;  4N2Q A;  4DX2 A;  1B89 A;  5C2Y A;  5ENO D;  4CGV A;  4HOR A;  4U8H A;  2H6F A;  2LAI A;  4HOU A;  3CVV A;  2OVB A;  1E8Y A;  4GYW A;  2L9B A;  4GZ6 A;  2DYS E;  2Y0B G;  1X81 A;  1E96 B;  2IU1 A;  2FUL A;  3G2U A;  3IBE A;  3DRA A;  4U0S A;  3UKR G;  5KBA A;  1K1A A;  5LFA A;  4B8C B;  4UQZ A;  3LKU A;  3JUI A;  3CST A;  5LCW J;  3MGB A;  4RVB A;  3JQ1 A;  3ZNG A;  4K0R A;  4P29 A;  4JHR A;  4FC8 A;  4HFG A;  4LER A;  4CDM A;  2IOS A;  2PM6 A;  4Q96 A;  2ZGG A;  2R59 A;  2J9Q A;  3UT7 A;  2IEJ A;  2R2L A;  1TNU A;  2MYO A;  3AS5 A;  4HS2 A;  1N4R A;  3PUJ A;  2LAH A;  5FQ7 A;  1BI8 B;  4JZY A;  1JWF A;  3Q9N C;  2GRN B;  4GMR A;  3E30 A;  4XZ4 A;  2H6G A;  3FTY A;  4WNE A;  5G04 C;  4LG6 A;  3WXX A;  3D3M A;  2QC9 A;  3CQC B;  3ESK A;  5FTP A;  3ESL A;  5BPP A;  1N9A A;  1PC2 A;  3FEY A;  5FZS A;  4AY6 A;  3OAW A;  1TJC A;  2MOW A;  1FVH A;  3FWV A;  4F6R D;  4A3T A;  2I6H A;  1DCE A;  3G2V A;  4YDY A;  2NXP A;  3TAX A;  1INZ A;  4J8D A;  1PY1 A;  1GW6 A;  3UM0 A;  4X8Q A;  1HFA A;  5E76 A;  4L2Y A;  3TWW A;  5KCM A;  2XCC A;  3QAQ A;  2BUG A;  5HI7 A;  4K5A B;  3L17 A;  1JCQ A;  3CHS A;  2QYU A;  4BY6 A;  2IQC A;  2AJA A;  1DCQ A;  3L22 A;  2NYJ A;  3PDN A;  5JJ6 A;  4OAU C;  2KAT A;  2VYI A;  4NAC A;  4FLH A;  2LUH A;  2Y4U A;  3ISM C;  4ANW A;  4ILG A;  4C0E A;  2OCC E;  1MX6 A;  3ZIM A;  1UN8 A;  2ION A;  4PUC A;  4I1M A;  2KC7 A;  3CEQ A;  3EIJ A;  2WXN A;  3FH5 A;  4HRM B;  5FT9 A;  3C3Q A;  1MX2 A;  3FTU A;  2VGY A;  4OAV B;  4KXK B;  3PZ1 A;  2FI7 A;  3E32 A;  2XEH A;  2F37 A;  5G2N A;  3UTM A;  3HXB A;  4JPS A;  2XCB A;  1O5M A;  1Z3Y A;  2CFU A;  4K5C A;  3T9K A;  1YMP A;  1S70 B;  4YND A;  2WQ6 A;  2C0L A;  4URK A;  2IJG X;  3ZPJ A;  3DEP A;  3FUI A;  2EIL E;  2P9U G;  2R05 A;  4L23 A;  1UW4 B;  4U95 D;  3HXF A;  4HRL A;  3SBS A;  1PAQ A;  2XPI A;  1OWN A;  4Y6W A;  2OEV A;  1HO8 A;  2Q7F A;  3TJP A;  5KWD A;  4D10 C;  4J8Y A;  2V4H C;  3C5R A;  3FEX A;  3CKB A;  4GCN A;  1NZN A;  4I43 A;  1YCS B;  3TL5 A;  3R7R A;  4BEP A;  1NFI E;  2GRO B;  3CK9 A;  4K03 A;  3E37 A;  3D9N A;  5HKP A;  2CG3 A;  3PZ3 A;  2PM7 A;  3GYZ A;  2X3M A;  4APF A;  2FO7 A;  3R9A B;  3CV0 A;  2GRP B;  4FA6 A;  2P9S G;  4BTA A;  2IOL A;  1FCH A;  4AV7 A;  3JUE A;  5AQA A;  5AAR A;  4LSZ E;  4RLY A;  3NB2 A;  2AWI A;  4LNG A;  3J5Q B;  3OTN A;  1QZ2 A;  3FTX A;  2JAB A;  3C98 A;  3CLJ A;  3G2S A;  3LVR E;  3ULQ A;  3RU0 A;  4L9P A;  2L0T B;  2VGX B;  2NSZ A;  3NZU A;  3ASG A;  4XI9 A;  5G05 J;  2I2O A;  4GTO A;  1TNO A;  2VJ8 A;  3FUD A;  2J8S D;  4GZ5 A;  1BD8 A;  2Y3A A;  1EYH A;  2ZIR A;  4DX5 D;  3MKQ B;  5KJL A;  4I17 A;  3ZUV B;  4DRX E;  3V79 K;  3PE4 A;  4XIF A;  1KZO A;  2YIN A;  3F6Q A;  5AEN A;  3ASD A;  3FU6 A;  4GTQ A;  2Y4T A;  3HG0 D;  2LNI A;  4PH4 B;  4I9E A;  4N39 A;  1D9S A;  1SVX A;  2NC9 A;  2XPY A;  4PS7 A;  3OXL A;  5BV0 A;  1KPS B;  2RD0 A;  2WXM A;  3UM3 A;  5G55 A;  3RIB A;  2LO6 A;  3Q9U C;  5EIL A;  3QWW A;  1K1B A;  5M72 A;  3FUE A;  3TWS A;  3OXF A;  3SF4 A;  3FUJ A;  2QYJ A;  3FHE A;  2GRM A;  4GCO A;  3RRM B;  4WNF A;  4CYM D;  3LDZ A;  4EPZ A;  4L7T A;  4MLP A;  4LEU A;  4BES A;  5FQ8 A;  4ILH B;  3IEG A;  4KVO A;  3B7R L;  4BT9 A;  1H6P A;  3SNX A;  2XHE A;  3PVL A;  3T8K A;  3DST A;  4WWN A;  1HXI A;  4UWG A;  4GA1 A;  1WG0 A;  3QWP A;  1ELK A;  2P2C P;  2KZT A;  3UT4 A;  3Q78 A;  2IO3 C;  4H7Y A;  4XKC A;  1S64 A;  5ENS D;  3DXK G;  2VTB A;  3UPV A;  3AU4 A;  3SD5 A;  2DYR E;  2MRI A;  4KZ0 A;  2JLB A;  2WXR A;  4C0M A;  3UKU G;  1E8Z A;  3IXE A;  4G8K A;  3FTZ A;  5KNG A;  3QB2 A;  5J90 A;  1HE8 A;  4TV3 A;  3TG4 A;  4I2W A;  3ZFW A;  3UXG A;  4DK5 A;  3RKV A;  3K9I A;  3FUK A;  3ABK E;  3AG4 E;  4G25 A;  4J0U A;  4JW1 A;  3PRE A;  2J4B A;  5EN5 D;  5CMW A;  1HS6 A;  5JHB A;  3ZVV A;  3I5P A;  4JC8 A;  2HO1 A;  4B93 B;  4RG6 A;  4Z68 A;  1OY3 D;  2X6K A;  1S0P A;  5CCL A;  3URZ A;  3KEA A;  3SI5 A;  1TN7 A;  4F53 A;  3DPY A;  4UWK A;  3V2O A;  3AAA C;  3MA5 A;  5B1B E;  3MYV A;  3R7Q A; 
#chains in the Genus database with same CATH homology
 2YQ8 A;  3ESK A;  1E8W A;  5AIJ A;  5FTP A;  3CHQ A;  3ESL A;  1E8X A;  5FZQ A;  5BPP A;  1IQU A;  1PC2 A;  3FEY A;  4XI0 A;  4IYP A;  4GYY A;  1QNF A;  5FZS A;  1Z3X A;  3ZHE B;  4AY6 A;  3OAW A;  1TJC A;  3SBT B;  4UQY A;  2MOW A;  2WVI A;  4MS6 A;  4EZJ A;  1FVH A;  4DLQ A;  3MZL B;  3FWV A;  3FU3 A;  3Q5M A;  2L6J A;  1MHQ A;  4A3T A;  4JL0 A;  4HOT A;  3CVL A;  4G24 A;  2I6H A;  2V4L A;  2WMN A;  2KCK A;  3G2V A;  3I4R B;  3HHM A;  3MV3 B;  5G04 J;  4ANX A;  2NXP A;  4H7X A;  2WXL A;  3TAX A;  1INZ A;  1BPO A;  4J8D A;  1PY1 A;  2PL2 A;  4A1G A;  3PNL B;  4JA7 A;  2DCP A;  4EBA A;  1GW6 A;  2QFC A;  4APO A;  1HFA A;  2I1J A;  3U66 A;  1SQM A;  4L2Y A;  5E76 A;  5FQ4 A;  3RO2 A;  4ATG A;  4BWR A;  5KCM A;  4J8S A;  2QY7 A;  2XCC A;  3PZD A;  3QAQ A;  3CVW A;  3PEU B;  1Z6T A;  3GZ2 A;  2BUG A;  2J08 A;  5HI7 A;  4U63 A;  1YA0 A;  2LSV A;  4YVO A;  3L17 A;  4AEZ C;  3CHS A;  5EX3 A;  3AS4 A;  3PEV B;  4BY6 A;  2WXK A;  2IQC A;  5AJD A;  2AXZ A;  1ELW A;  1X5B A;  4M3O A;  3CQG B;  1JPL A;  3L22 A;  4UI9 K;  1XNF A;  3KAE A;  1EDU A;  3MV2 B;  4GB9 A;  3PDN A;  4UWH A;  2WXF A;  2XPZ A;  5DIZ A;  3G2W A;  3AS8 A;  5E75 A;  4AIF A;  3CVX A;  4GZD A;  5JJ6 A;  1SZA A;  2CHZ A;  3MKR A;  4TUU A;  3HVE A;  4WNG A;  1OWM A;  3EDT B;  5A6C A;  3L16 A;  4ME2 A;  4A1S A;  5KJK A;  5JJT A;  2CG2 A;  1WM5 A;  2KAT A;  5EX0 A;  5BT1 A;  3UQ3 A;  2VYI A;  4NAC A;  3ASH A;  4L2L A;  4I6J A;  3GZ1 A;  3PE3 A;  4FLH A;  3UX4 A;  5BNW A;  3BG1 B;  3LJ3 A;  4ANU A;  3FUN A;  3TXM A;  4FAD A;  5BV1 A;  2Y4U A;  4EBA G;  2BF0 X;  5JJ7 A;  4ANW A;  4ILG A;  4Y6C A;  4U0Z A;  4I1O B;  3LY9 A;  3NQP A;  4QFV A;  3S7F A;  4C0E A;  2I1K A;  5J08 A;  2XGM A;  4AOF A;  3ZIM A;  1XGW A;  1UN8 A;  4F3V A;  3KEZ A;  4AXH A;  3IHV A;  4NRH B;  2XRY A;  2ION A;  4PUC A;  4I1M A;  2KC7 A;  3CEQ A;  2V0P A;  2WXJ A;  4UWF A;  4J8F A;  3EIJ A;  2WXN A;  3B7U X;  3RRU A;  3FH5 A;  3ZYK A;  3HVE B;  4N3C A;  1OWP A;  2WMO A;  4GZ3 A;  2OOE A;  2J4D A;  5FT9 A;  4BTB A;  3FTU A;  3CVQ A;  3FTS A;  4I6G A;  4HOQ A;  3RRN B;  2VGY A;  4N5C A;  3D9J A;  1WAO 1;  4KXK B;  3ONL A;  3OXG A;  2FI7 A;  4J6I A;  5G2N A;  3EIQ C;  5AJL A;  4YVQ C;  1UG3 A;  5A23 A;  3CGH A;  4FHK A;  4B89 A;  3CHP A;  4JPS A;  1LF8 A;  4PDX A;  2XCB A;  4WWP A;  4CCA A;  5A7D B;  4CT4 A;  1NA3 A;  2PZI A;  3APF A;  2GW1 A;  2HYZ A;  3CK8 A;  1Z3Y A;  2CFU A;  3ZYQ A;  4B94 A;  4YND A;  1VDY A;  1U3D A;  2WQ6 A;  3CHR A;  3LEW A;  2C0L A;  4UQX A;  3ZXS A;  1H0A A;  2I9C A;  3FH7 A;  3IHY A;  1NP7 A;  3ZEF A;  3APD A;  3VLD A;  4URK A;  2IJG X;  3ZPJ A;  3FUI A;  4ACL A;  4KZC A;  4C9B B;  3MX3 A;  1TJF A;  4FLB A;  1UW4 B;  4L23 A;  4WUY A;  3CVU A;  4JXT A;  3E4B A;  1OWO A;  2WM9 A;  3MCX A;  4A3V A;  1H19 A;  3SBS A;  2FBN A;  3U64 A;  1PAQ A;  2XPI A;  2EQX A;  3JCK C;  2X6J A;  1OWN A;  3APC A;  4Y6W A;  4DJA A;  1MQS A;  1E7U A;  2XGO A;  3UMV A;  4DLO A;  4CDM A;  1HO8 A;  2Q7F A;  3QWV A;  3TJP A;  4N3A A;  3P2B A;  2KCL A;  3IV0 A;  3EHM A;  3CKC A;  2IF4 A;  4DI4 A;  3VLF A;  2XQ0 A;  1EF1 C;  4D10 C;  4UI9 C;  5LX8 A;  5BW8 C;  4B8A A;  3SHF A;  3FEX A;  3QAR A;  2FF4 A;  3CKB A;  4GCN A;  4NQ0 A;  4BFR A;  1NZN A;  3LXU X;  4AJW A;  3CR3 A;  4I43 A;  4IN3 B;  3RJV A;  4RG9 A;  3U9W A;  3BG0 B;  4XX5 A;  3R7R A;  3TL5 A;  3CK9 A;  4K03 A;  4GYO A;  4N3B A;  5ENN A;  3D9N A;  1NA0 A;  4FJY A;  3TXN A;  5C1D A;  3HDX A;  3JYS A;  1H2T C;  1ELR A;  2J49 A;  5AYW D;  2YNQ A;  5KJN A;  2CG3 A;  2PM7 A;  3D9O A;  3GYZ A;  2X3M A;  1OUV A;  2CHX A;  3T8M A;  4APF A;  2FO7 A;  3ZGQ A;  3R9A B;  1IYG A;  3CV0 A;  3FY4 A;  4LUN U;  3NF1 A;  3AU5 A;  4FA6 A;  2VGX A;  1DNP A;  4I2Z A;  4BTA A;  4GZC A;  3UUX A;  1UJK A;  4UI9 J;  2IOL A;  1H2U A;  4JEU A;  3CHM A;  1HF8 A;  1FCH A;  3FU0 A;  2XEV A;  3ASF A;  4AV7 A;  2UY1 A;  1UJJ A;  4EEC A;  2E2E A;  4HVB A;  3ZYL A;  4GML A;  4W9R A;  3ZRH A;  1W3B A;  4F1S A;  1E7V A;  2WPV A;  3CVP A;  4GA0 A;  2AWI A;  3SGH A;  1TEZ A;  1EPU A;  1UN9 A;  3RO3 A;  3MKQ A;  4EZK A;  3D9K A;  4KVM A;  3ONK A;  3OTN A;  1QZ2 A;  2WXH A;  2J07 A;  3FTX A;  4JVS A;  3C98 A;  3CLJ A;  3G2S A;  4F7A A;  3MEK A;  4Q69 A;  3LVR E;  4R7L A;  2WQ7 A;  2V8S E;  3ULQ A;  4G23 A;  1KT1 A;  3CSF A;  3FP3 A;  2L0T B;  3RU0 A;  1IHG A;  2VGX B;  1KT0 A;  3QK0 A;  2NSZ A;  2DIW A;  5BUZ A;  3P1U A;  1ZU2 A;  3NZU A;  3ASG A;  4XI9 A;  3KD7 A;  4GU5 A;  5G05 J;  2I2O A;  2UY1 B;  4G11 A;  3FTW A;  2VJ8 A;  2YHE A;  3LY8 A;  3L54 A;  4FHJ A;  4Q94 A;  3EJN A;  3FUD A;  3TGO A;  4NUR A;  3QOU A;  4GZ5 A;  5CCM A;  3CK7 A;  2Y3A A;  1EYH A;  3DPD A;  3QDN A;  1N52 A;  2LSU A;  3CVY A;  3MKQ B;  5FJY A;  4HXI A;  4BX9 A;  3FUL A;  4OVU A;  5KJL A;  4G26 A;  2PQN A;  3KS2 A;  4I17 A;  4I9C A;  4DI3 A;  3FU5 A;  3PUK A;  2MHK A;  3PE4 A;  3D9I A;  3D9L A;  4XIF A;  2X6F A;  4GA2 A;  4BT8 A;  2YIN A;  4AM9 A;  5JHA A;  2R5S A;  3CHO A;  5AEN A;  2XGS A;  3ZW3 A;  4HLE A;  3ASD A;  2WXP A;  2HM8 A;  3FU6 A;  2P58 C;  2Y4T A;  4ANV A;  4A55 A;  1HG2 A;  4GPK A;  2OVF A;  5ARG A;  4RSY A;  2LNI A;  4PH4 B;  4I9E A;  4N39 A;  4EQF A;  3U3W A;  4B0Z A;  3NZS A;  1Y6I A;  3VTX A;  4CDN A;  3Q4A B;  2NC9 A;  4FUL A;  3FFL A;  3IKO B;  3PH0 C;  3PNT B;  3FUF A;  4N2S A;  2XPY A;  5EDS A;  3ML8 A;  3D9P A;  4PS7 A;  2RG8 A;  3OXL A;  5BV0 A;  2RD0 A;  4ACK A;  4IUL A;  4BX8 A;  4ILI A;  2WXM A;  2J09 A;  3LS8 A;  3LPZ A;  3CVN A;  5G55 A;  3RIB A;  3RK6 A;  2LO6 A;  4UWL A;  1H6K A;  2DBA A;  1HU3 A;  1ZBP A;  5T3R A;  5ARF A;  4U07 A;  2WQH A;  3QWW A;  3EHN A;  3FH8 A;  1DVP A;  3UT8 A;  1WY6 A;  1N54 A;  2X6H A;  4JEH A;  5M72 A;  4XKB A;  3FUE A;  2FEZ A;  2VSN A;  2CHW A;  3D9M A;  4PS3 A;  5T8I A;  3FTV A;  3FUM A;  3Q49 B;  4JHJ A;  5KJM A;  3SZ7 A;  4LCT A;  5ANL A;  3OXF A;  1FVF A;  3SF4 A;  3FUJ A;  4AY5 A;  2A5U A;  1KLX A;  3FHE A;  4E6H A;  2AW6 A;  1P5Q A;  1HG5 A;  4CEM A;  2M63 A;  3S7B A;  4CRW A;  2GRM A;  4JHK A;  3L13 A;  5LP0 A;  4GCO A;  3RRM B;  4WNF A;  2IFU A;  1JWG A;  1QQE A;  3LYA A;  5FZR A;  2A4Z A;  2R17 C;  3GW4 A;  3LDZ A;  3HYM B;  4L7T A;  4MLP A;  4EPZ A;  4KBQ A;  4LEU A;  5T4Y A;  2HR2 A;  3O4Z A;  5FQ8 A;  1H2V C;  4ILH B;  4IRU A;  4CT0 A;  2GRL A;  1SZ9 A;  2X6I A;  3IEG A;  4KVO A;  4U04 A;  5CHE E;  2C0M A;  3QC1 A;  3B7R L;  4I6E A;  4BT9 A;  5LOZ A;  1OWL A;  4WWO A;  3VLE A;  3SNX A;  4ABN A;  2XHE A;  1JUQ A;  5D0O D;  3ZN3 A;  3PVL A;  4HOS A;  2CFZ A;  2ILR A;  2VSO E;  3MJW A;  3N71 A;  1HXI A;  4WWN A;  5EKQ D;  5G05 C;  4E85 A;  4UWG A;  4GA1 A;  3B7T A;  3QWP A;  1ELK A;  4N2Q A;  2KZT A;  2VSY A;  4KMO A;  4L1B A;  2YHC A;  4KT6 B;  3T5X A;  3UT4 A;  4H7Y A;  1B89 A;  2BTD A;  4XKC A;  4WAF A;  5C2Y A;  3L08 A;  3O48 A;  2UWJ G;  3DBS A;  4CGV A;  4HOR A;  4U8H A;  4XE0 A;  2VTB A;  2LAI A;  4HOU A;  3PRZ A;  2OND A;  4I1A A;  2AXV A;  4GAA A;  3UPV A;  3CVV A;  3AU4 A;  3CIA A;  3LCA A;  5LCW C;  1HX8 A;  2OVB A;  5CMY A;  4PS8 A;  3SD5 A;  1E8Y A;  1E90 A;  2MRI A;  4JA9 A;  4KZ0 A;  2JLB A;  2WXR A;  4GYW A;  4LRZ A;  4BSX A;  4C0M A;  3QJZ A;  2L9B A;  3B13 A;  1E8Z A;  4GZ6 A;  4TRQ A;  3HIZ A;  2V5F A;  1E96 B;  3FTZ A;  1L5J A;  3S2A A;  2IU1 A;  3B7S A;  2FUL A;  2VSX E;  3G2U A;  3QB2 A;  5J90 A;  3IBE A;  1HE8 A;  2KZT B;  3Q47 B;  4KYO B;  4TV3 A;  2AVP A;  4AP2 A;  2WXG A;  3LVQ E;  3L6A A;  3TG4 A;  4U0S A;  4I2W A;  4EZL A;  1IQR A;  4MRU A;  3R7Q A;  1HH8 A;  3ZYM A;  2JEK A;  5LFA A;  3ZFW A;  4B8C B;  4J8E A;  5HQ8 A;  2VTB B;  4UQZ A;  4DK5 A;  3LKU A;  3JUI A;  3LY7 A;  3FUH A;  2C2L A;  3CST A;  3JQ0 A;  3I3N A;  3K9I A;  4FJZ A;  3FUK A;  3RKV A;  2AXU A;  5LCW J;  2ZU6 B;  5FWQ A;  2E0I A;  4G25 A;  3MGB A;  3QKY A;  4RVB A;  2XRZ A;  3JQ1 A;  2WXO A;  4G1T A;  4K0R A;  4P29 A;  4CDR A;  4JHR A;  4FC8 A;  4HFG A;  3PRE A;  4J0U A;  4JW1 A;  2IOS A;  2PM6 A;  4LER A;  2L0I A;  2WXI A;  3ENE A;  4Q96 A;  2J4B A;  4MKT A;  4V3I A;  3S7J A;  2R59 A;  2J9Q A;  3GZS A;  5CMW A;  1HS6 A;  3I4G A;  3UT7 A;  3PS6 A;  3BEE A;  2VQ2 A;  3S7D A;  4FU3 A;  2WXQ A;  3U4T A;  3AS5 A;  5JHB A;  3ZVV A;  3TG5 A;  3I5P A;  4HS2 A;  1A17 A;  2KCV A;  2HO1 A;  4JC8 A;  5ANR A;  2KM4 A;  4O6F A;  3PUJ A;  2LAH A;  4U0U A;  3ZHE A;  5FQ7 A;  2PQR A;  1Y8M A;  4RG6 A;  4DPR A;  2GGF A;  5DBK A;  4FP7 A;  2OV8 A;  4JZY A;  1JWF A;  5D0Q D;  2X6K A;  3VTY A;  3QNK A;  2WB2 A;  4XZ4 A;  1S0P A;  3FTY A;  4WNE A;  5CCL A;  3SFZ A;  3URZ A;  5G04 C;  3SI5 A;  4F53 A;  3G2T A;  4GMJ A;  1HZ4 A;  3FDH A;  4UWK A;  4OYS A;  4OVV A;  3WXX A;  3ML9 A;  3Q15 A;  3MA5 A;  3D3M A;  5FQ6 A;  2X38 A;  3MYV A;  1U3C A;  3CQC B;  4AVX A;  4CGW A;  4WND A;  4G2V A;  3T5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...