3UT8A

Structural view of a non pfam singleton and crystal packing analysis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
b'TSLRDLIPKHKFDNSTIDQLCKLIDNEIEPIIFDLLKWLQDYNWPIAKDILPVVVLHQSIAMPHILTILQGNDIMWKYWVIKLMIPYLIYPNKQLVKSELERLSSLEIINEDIREIVNLSKDYLHFYY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural view of a non pfam singleton and crystal packing analysis.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Unknown function
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16804 DUF5071 Domain of unknown function (DUF5071)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.750 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ut8A00
3UT4A 3UT8A 3UT7A
chains in the Genus database with same CATH superfamily
4KXKB 4GTMA 3PZDA 5FQ8A 2F8YA 5G04C 5ENNA 5C1DA 3EHRA 3CSFA 4HOQA 4YDYA 3QC1A 5JHBA 1N11A 3APFA 3JXJA 5EILA 4GYOA 5ANRA 4UWLA 3V2XA 2IO2C 3TWTA 4Y6WA 3HHMA 3NAWA 3EUVA 4QQIA 5KCMA 4JA9A 1QNFA 3ASOE 2EIME 2KCVA 2LAIA 1BU9A 4I1MA 3FUIA 1KT0A 2QC9A 4KZCA 2LSUA 4F3VA 1JPLA 3UT8A 1FT1A 2EINE 3P1UA 3EIQC 1DC2A 4WWNA 3B13A 2Y0BG 4DI3A 3D9NA 2YHEA 1HE8A 1IQUA 1TN8A 1KPSB 3FTSA 2NYJA 4BX8A 5BXUA 4EBAA 3C3OA 5FQ4A 2F0YA 4EHMA 5JMND 5FT9A 4PS3A 3CHQA 1OWLA 3PZ1A 4LRZA 3PUJA 4GZ6A 4K5BA 1RZ4A 3FU0A 3B7SA 2X38A 4Y6CA 3SI5A 3T5VA 2XGSA 3TL5A 1NL4A 5AARA 4HLEA 1O1SA 5HI7A 1HS6A 3C5RA 3I3NA 2PZIA 3SBTB 1Y8MA 1H19A 2KZTB 4BEPA 3ZN3A 2HO1A 3CHRA 3PEVB 4HOTA 3UUXA 2IF4A 2ZXWE 3QK0A 4FHJA 3ONKA 4ANWA 4C9BB 1S63A 5HKPA 3UT4A 3ZYQA 2Y3AA 2MYOA 3S7JA 2X6KA 3D9KA 3ULQA 5ENPD 2WB2A 3KSLA 4GAAA 2BTDA 3VTXA 4XEIG 3GYZA 1HG5A 3V30A 4H7YA 2QYJA 1E7VA 3D9MA 3P2BA 2WXMA 1BPOA 3Q7AA 2ZGDA 4EZLA 1MQSA 3RIBA 3ZW3A 2V5FA 3EHQA 2CHZA 2XENA 1VDYA 4I6GA 3AS4A 4LNGA 2XGMA 3CKBA 4R7LA 2IY0C 1IQRA 4XIFA 2Y4UA 1OUVA 4GU5A 4LNUD 3MZLB 3UIOC 4BY6A 1NA0A 4HI8A 1IHBA 1UJJA 4WNDA 2EIJE 3DSVA 2R02A 1N4SA 5J08A 4AXHA 5CMYA 1Z3YA 3MKQA 2OCCE 5FJYA 5KJMA 1O5MA 3PRZA 3ZHEA 4HORA 5AENA 4WWOA 3IBEA 4ILGA 3SFZA 4J7WA 4TXPA 4U8YD 1YYHA 4GTVA 4AY6A 2KM4A 4GB9A 1ELWA 1TN7A 1OXJA 2GRPB 4GA1A 4JHJA 3T8MA 5CCMA 2KC7A 4UQYA 3FTXA 5ENTD 3AG3E 1N54A 3QOUA 2P2CP 1N52A 3IKOB 3ZKJA 3PE4A 4J8SA 2P9NG 2XS1A 3Q9NC 4BT8A 2H6GA 4K0RA 4NQ0A 2F8XK 2CG3A 4PDXA 1JCQA 2WXIA 1KLXA 2BUGA 4EPZA 4A63B 3U66A 2RD0A 3FUKA 3CV0A 1O1TA 2AW6A 5M72A 1N9AA 4XKBA 4BTAA 3CK9A 3NF1A 3Q78A 2FO1E 2RFMA 1QYMA 3FEXA 3CVNA 2R03A 4DK5A 3CVYA 5BV1A 3HXCA 3PVLA 4GPMA 4O6FA 5BUZA 4UI9C 3G2UA 2ONDA 5KJNA 3SHFA 4GMRA 3S7FA 3PZ2A 3SY2A 3NOCD 5EX3A 2E2EA 1UN9A 2CFZA 2GRMA 2DWZA 3C98A 3F6QA 4L2YA 4FADA 4GZ5A 2GRQB 3C72A 4C0EA 2BKGA 2KZTA 2A5EA 1LTXA 4DX1A 4GPKA 2IU1A 3I4RB 5G05C 3BG1B 3CR3A 4A1GA 3NBNB 3C3QA 3L16A 3NZSA 3BEEA 4XX5A 5EIBE 2MHKA 4BT9A 3Q4AB 3Q49B 3FHEA 3HG0D 4UWFA 4DJAA 3ZYMA 3KEAA 1JWFA 3AJIA 1OCCE 4I9CA 4F1SA 3UTMA 1P5QA 3QARA 4HQDA 4DX7D 3FU5A 3OXLA 4G8KA 4GTSA 2P9UG 5KNHD 3FUFA 2OOEA 3IHVA 4UWHA 3D3MA 3FH7A 1K1AA 1MX6A 2WXGA 3B7TA 3QAQA 5T4YA 1DVPA 3QWPA 2NSZA 2XZDG 5LP0A 5LCWC 3CVWA 1NP7A 3RO2A 3J5PA 4GZDA 3DSXA 3MGBA 1A17A 3TXMA 3D9LA 4G25A 1OCZE 4U07A 4N2SA 4W9RA 1SZAA 3G2WA 3HYMB 2AXZA 4YDEA 5T8IA 3KEZA 3ZXSA 3UI2A 2H6HA 5FQ6A 1XNFA 3CVVA 2R05A 2ZISA 4I6EA 1N0RA 3DPYA 2R59A 4L23A 3AG1E 2ZU6B 2WXFA 4DRXE 4HRNA 5B1AE 4NURA 2I9CA 4EZKA 3PEUB 3ZYLA 5D66A 4JVSA 3ULYA 4LERA 4B8CB 4HNAD 4X8QA 4UQXA 3AU5A 3CLJA 2MOWA 5BV0A 2PNNA 3CHSA 4PS7A 1D9SA 4HOUA 1UJKA 5JHAA 2AWIA 3IHYA 3RU0A 3UM3A 1PC2A 1UW4B 3LY9A 2WMNA 1D8EA 1EYHA 1BD8A 1ZB1A 4ABNA 3FEYA 1OWPA 4GA0A 2AVPA 3EU9A 3Q9UC 3EIJA 2KCLA 4Q69A 2L0IA 3LY8A 2HR2A 5JJ7A 2EQXA 4WNGA 3ZPJA 4EZJA 4WWPA 2CHXA 1YA0A 1LD7A 3LJNA 1SW6A 4P29A 3D9OA 1OT8A 4URKA 1BI8B 3WXXA 3DEPA 3QJZA 3KS2A 4BX9A 4FJZA 5ENRD 4OAVB 1E7UA 3APCA 2ETCA 5D0OD 4UQZA 3D9PA 1HFAA 3CVQA 3FULA 2DZNA 2WXLA 1H0AA 3LJ3A 1JUQA 3CIAA 2WQHA 3KSQA 2L6BA 3ZFWA 3PREA 3UPVA 2VTBB 4TRQA 2L6JA 2LUHA 2JLBA 3L17A 4C48B 4N2QA 3OXGA 3Q47B 4J0UA 4GTQA 2UWJG 2LO6A 4RLYA 4V3IA 5AYWD 1ELRA 2QZAA 3B7UX 2WQ7A 4ATGA 1WAO1 4BSXA 4JA7A 4CGWA 5ENQD 2ETAA 2XQ0A 4AV7A 5JJTA 2HYZA 1INZA 3B7RL 5FIOA 3ML8A 4N3CA 4N3BA 2KCKA 3JUEA 5CBNA 1SVXA 4OYSA 3EJNA 3CK8A 3UT7A 4WNEA 4CT4A 1KT1A 1H6PA 3Q15A 3D9IA 4ZFHA 4JXTA 4BFRA 3Q75A 4UWKA 2PL2A 2GGFA 1ZU2A 2J49A 5LOZA 3CVXA 2AXUA 5IY5E 5EKQD 4ANXA 1SZ9A 1OWMA 3FWVA 1NI1A 2V5QC 1PY1A 4H7XA 3DRAA 3TWSA 1YCSB 2X6IA 2WXKA 1UN8A 3PNTB 2DVWA 3GZ2A 3FTUA 4GYWA 2J4BA 1K1BA 4XI0A 5BT1A 2J07A 4HBDA 2DCPA 5DBKA 3FU3A 1Y6IA 1TEZA 4WAFA 4KBQA 3MKRA 1JCSA 3TXNA 2V0PA 1TNUA 1DCQA 3U4TA 3APDA 2JEKA 4JZYA 2A4ZA 4YVOA 3IXEA 3L9TA 4G26A 2WXHA 3TJPA 3V31A 2I1JA 4HFGA 4EBAG 3EU5A 3TG4A 1X5BA 3CVPA 4I17A 5AQAA 2DIWA 2UY1B 2YQ8A 5EN5D 5E75A 3NB2A 1PAQA 4RSYA 2XEEA 1IXVA 3DEOA 4ATZD 1A5EA 2J8SD 4N3AA 2PM6A 3FDHA 5A7DB 3ZUVB 2XRYA 3SF4A 2KXPC 2PQRA 3FP3A 1HZ4A 1V54E 3HXFA 5LX8A 2BKKB 4NIKA 2Y69E 2JABA 1E8ZA 2FULA 3CHOA 1Q2ZA 3PUKA 4K5AB 1WY6A 4PS8A 3ZVVA 1H2TC 2LSVA 2LAHA 1HF8A 5AQ7A 2FO7A 3ZNGA 3UIPC 2R5SA 2XEHA 2YINA 3PDNA 4TXRA 3UM1A 4CT0A 4A3TA 3UQ3A 2WPVA 4DI4A 3Q7FA 3KD7A 1MX2A 4U96D 1BI7B 2ZIRA 1OCOE 3ZIMA 4O1PA 4AVXA 3SFYA 3ML9A 2X6HA 4HRLA 3MX3A 3SO8A 2NXPA 2XPZA 3FUNA 4BESA 3PZ4A 1JWGA 4FP7A 3TAXA 3T8KA 3UMVA 5BPPA 3QNKA 3BU8A 3E4BA 1B89A 4BETA 3B7BA 3SD5A 2E0IA 2KBXA 4M7CA 5FZQA 2VTBA 3FU6A 1H6KA 4HS2A 2X6JA 4CYMD 2P9KG 3I4GA 3JYSA 2IO3C 2FEZA 2B0OE 3L54A 4WNFA 5AAOA 3ABLE 2MRIA 4UI9J 3GW4A 2ILRA 4JW1A 3SGHA 5CCLA 3EDTB 2HM8A 2H6IA 4LCTA 3PNLB 4U63A 4CDRA 3ESLA 1H2UA 4GTPA 4CEMA 1GW6A 1JCRA 2EILE 3E32A 3PH0C 4KVOA 3FUJA 2VGXB 4APOA 3Q73A 4FULA 2Q7FA 3GZSA 4OVUA 1MHQA 3UM2A 4ZHBA 3W9FA 4B8AA 1V55E 3E30A 5G05J 4U95D 3CSTA 3LDZA 4OAUC 4J8FA 3RRNB 5DIZA 5EYPF 1FVFA 4L2LA 3Q5MA 3HXEA 4J8YA 1FPPA 3MV2B 3QKYA 4FU3A 1AWCB 3JQ1A 4B0ZA 3CK7A 4DX6D 3ESKA 1LF8A 3L82A 4U04A 4B93B 4O60A 5C2YA 4DPRA 2OEVA 3GZ1A 5KJLA 2OV8A 2WQ6A 5CEDB 5ENSD 4GYYA 3AAAC 2VSOE 2WVIA 4EQFA 3FTVA 1NFIE 2DYRE 3L22A 5J90A 5LCWJ 2RKKA 5FQ7A 4LEUA 3Q79A 3RKVA 5ITZF 3DWLG 2PQNA 4ILIA 3HVEB 3UKUG 5LFAA 5B3SE 4J6IA 2WXJA 3ONLA 1EDUA 2FI7A 5CRVA 5FTPA 4RG6A 2VYIA 1KZPA 2UY1A 1AP7A 2L0TB 3R7QA 3FUHA 5AQ9A 3DSSA 3FH8A 2VGYA 1RW2A 3LYAA 4FC8A 1N4RA 3MV3B 4I9EA 4YDOA 3CVUA 1Z6TA 1BLXB 4GTTA 4BSZB 3FTZA 4Q94A 3R9AB 5AJLA 1FT2A 4CDMA 1N95A 4APFA 4FHKA 5KWDA 2CG2A 1S70B 5D2MC 5KNGA 4I43A 4Z68A 4JEUA 3LXUX 3V2OA 1X81A 2WXNA 1ZBPA 5JJ6A 5CECB 3L08A 1O1RA 3G2VA 2BF0X 4ME2A 3FUDA 3NZUA 3ASHA 3MCXA 1H2VC 3SZ7A 4F1PA 3ZXPA 5E76A 5B1BE 1TNZA 3VTYA 2I1KA 1MYOA 3AG4E 2J09A 2RG8A 2XZTG 3V79K 1IYGA 1E8YA 1ELKA 1N4PA 4PUCA 4GTOA 3QWWA 3CGHA 4CRWA 4JB8P 4AIFA 4JPSA 1XGWA 3RO3A 2C0LA 4MBGA 1OWNA 1K3ZD 1QBQA 2WXRA 3R9MA 2CFUA 2OEWA 4HB5A 4A55A 3SQVA 1EF1C 3DSTA 4KT6B 4YNDA 4M3OA 3L6AA 4ACLA 1WG0A 3DXKG 2AXVA 3LVRE 4RG9A 4RVBA 1FVHA 3NQPA 2VGXA 4I1AA 3W9GA 5G2NA 3QWVA 3VLDA 1HU3A 2VSNA 2XCBA 1N0QA 3ZRHA 4AOFA 4ACKA 3EHNA 2L9BA 2J4DA 1TJCA 3D9JA 3CHPA 4ANVA 3OTNA 3BQOA 4LG6A 1K8KG 3CKCA 3FUEA 2H6FA 3HIZA 4RQIA 4I2ZA 4N5QA 5AJDA 2I6HA 3QDNA 4IYPA 4HOSA 2YNQA 5T3RA 4D10C 1HH8A 1QQEA 1S0PA 1SA4A 4XZ4A 4AM9A 3G2SA 3LS8A 3T9KA 3AG2E 3X2QE 5ARGA 2R2LA 5EYLA 3CQCB 3DBSA 3ZEFA 4KVMA 4JEHA 4HRMB 2DZOA 4PH4B 2OVFA 1WDYA 2RFAA 2R17C 4Q96A 3CHMA 5EIDA 4ILHB 1MZCA 3PZ3A 3RAUA 4DX2A 4JD2G 1HG2A 4A3VA 2GROB 2GRNB 4N39A 2XPIA 3HVEA 4IULA 1HXIA 3TWWA 3ZGQA 4G1TA 1OWOA 5CERB 3HXDA 3U9WA 3SBSA 3UKRG 4JL0A 2BEDA 3D9HA 4O1OA 3FFLA 3FUMA 4NACA 2A5UA 3UX4A 2WXOA 2IQCA 3S2AA 4G11A 4DLOA 4YVQC 4J8DA 2XCCA 1DCEA 5ARFA 3ULEG 4MLPA 1IHGA 2VSYA 3CVLA 1E96B 3ZYKA 3FTYA 4F7AA 1WM5A 3AU4A 2GRRB 3E33A 2PM7A 4U0ZA 2C0MA 4J8EA 3ASGA 4AP2A 3S7BA 4HVBA 4LUNU 5A23A 1MJ0A 4AJWA 4BWRA 2XEVA 3SFXA 3ENEA 3ASDA 3IEGA 4MS6A 2KATA 2QY7A 4CGVA 4GTRA 1E8XA 4AEZC 3OXFA 1H6OA 2P9LG 5FZRA 2B6CA 3CQGB 3N71A 1G3NB 4HXIA 4U7EB 1L5JA 4FLBA 3EHMA 4GMJA 2OVBA 3JQ0A 4LSZE 1OCRE 3URZA 3CEQA 4I6JA 1YMPA 3IV0A 5FWQA 1TR4A 3O48A 2VQ2A 4KMOA 3LEWA 3PS6A 2LXMA 4FLHA 4U0UA 1IKND 2ETBA 4GCOA 1QZ2A 3J5QB 4HLLA 3ZU7B 2EIKE 1HO8A 4FA6A 4BERA 3TWUA 3I5PA 3RRUA 4GA2A 1EPUA 5FZSA 4U8HA 1SQMA 1KZOA 5BW8C 1DNPA 2QYUA 4TXQA 3ASFA 4IRUA 3PE3A 2M63A 4K03A 4UUCA 4GCNA 4TUUA 3ABME 3JCKC 1UOHA 4MRUA 4CDNA 5HQ8A 5H7PA 5JA4D 2WM9A 3WG7E 2XS8A 1TNYA 4KZ0A 3MJWA 3TWXA 4UWGA 5FINA 2XPYA 2GRLA 3AS5A 4OVVA 4A1SA 3K9IA 2YHCA 1TNBA 4IN3B 3HXBA 4XI9A 3DSWA 4TV3A 2LXLA 3UINC 1Z3XA 4L9PA 4G2VA 1E8WA 4K5CA 2P9IG 4G23A 4TUMA 4WUYA 1FCHA 4FJYA 4HI9A 2J08A 3BG0B 3TWVA 4CCAA 5BNWA 3B95A 2Y1LE 3RK6A 1LD8A 3O4ZA 2LNIA 3S7DA 5BXOA 1D8DA 5HS0A 2IJGX 2QFCA 4DUIA 2HE0A 1OY3D 1TN6A 3ABKE 5HRYA 3TGOA 1U3CA 3NOGD 2FBNA 4GZCA 5AN8A 3OAWA 1TJFA 3R7RA 2IOSA 3LCAA 4DX5D 3JXIA 4JC8A 4I2WA 4XE0A 4L1BA 3ASNE 3T5XA 3LY7A 2WXPA 3KAEA 4F53A 3TWQA 4E6HA 1NA3A 3DPDA 5CHEE 4QFVA 3TWRA 3UM0A 1N94A 2J9QA 4DLQA 4MKTA 3QB2A 3HDXA 2XRZA 1HX8A 2VSXE 3E34A 4E85A 3ISMC 3AS8A 4G8LA 2WXQA 3SNXA 4F6RD 5CBOA 1TYQG 3LVQE 4L7TA 2ZGGA 2XGOA 5ENOD 3G2TA 5G55A 1UG3A 2WMOA 2V4LA 2FF4A 4GZ3A 4U0SA 4ANUA 3FH5A 4YDWA 2F37A 4C0MA 3LKUA 4XKCA 5ANLA 2XHEA 3RSEG 3DSUA 2AJAA 4I1OB 3RRMB 4KYOB 5CRUA 4CZ2D 2CHWA 3BUAA 3U64A 5AIJA 4BTBA 1U3DA 2V4HC 3JUIA 5EX0A 3C3RA 2X6FA 3L13A 3TG5A 4AY5A 5CEAA 5EDSA 2IONA 2VJ8A 5CMWA 3LPZA 4B89A 1TNOA 1U2VG 2DYSE 3U3WA 1NZNA 2IOLA 4N5CA 2I2OA 1E90A 2IEJA 2DBAA 3FTWA 3RJVA 2P9PG 3HRAA 1Z5SC 2P58C 2C2LA 2X3MA 3UXGA 4LNBA 4G24A 4GMLA 3MYVA 4JHRA 1MX4A 4B94A 4U8VD 3MEKA 3VLFA 1SA5A 5AQBA 2P9SG 5D0QD 4UI9K 2IFUA 3FY4A 3MKQB 5KBAA 5KJKA 2NC9A 5G04J 3VLEA 1W3BA 3ZHEB 1N4QA 3MA5A 1S64A 4EECA 4NRHB 4JHKA 3E37A 2Y4TA 2GW1A 3DXMG 5A6CA 2VGEA 2V8SE
chains in the Genus database with same CATH topology
2FEZA 4KXKB 4MLPA 1IHGA 3L54A 3PZDA 5FQ8A 5G04C 2VSYA 3CVLA 4WNFA 5ENNA 1E96B 2MRIA 2NSZA 5C1DA 4UI9J 5LP0A 3GW4A 2ILRA 5LCWC 3CVWA 3CSFA 1NP7A 3FTYA 4HOQA 3ZYKA 4JW1A 3RO2A 1WM5A 3SGHA 4F7AA 3QC1A 4GZDA 5CCLA 5JHBA 3EDTB 2HM8A 3APFA 3MGBA 1A17A 3AU4A 4GYOA 5ANRA 4LCTA 3PNLB 4U63A 3TXMA 3D9LA 4UWLA 2PM7A 4G25A 4U0ZA 4CDRA 3ESLA 2C0MA 4Y6WA 4J8EA 1H2UA 4U07A 3ASGA 4CEMA 3HHMA 4N2SA 1GW6A 5KCMA 4JA9A 1QNFA 1SZAA 4W9RA 4AP2A 3G2WA 3S7BA 3HYMB 4HVBA 2AXZA 4LUNU 2KCVA 5T8IA 2LAIA 3PH0C 5A23A 3KEZA 4KVOA 3FUJA 3ZXSA 2VGXB 4AJWA 4APOA 4BWRA 2XEVA 5FQ6A 4FULA 2Q7FA 3GZSA 1XNFA 4I1MA 4OVUA 3ENEA 3ASDA 3IEGA 4MS6A 3FUIA 3CVVA 1KT0A 1MHQA 2KATA 2QY7A 4I6EA 4CGVA 2R59A 4KZCA 4L23A 2LSUA 4B8AA 1E8XA 4AEZC 2ZU6B 2WXFA 4F3VA 3OXFA 5G05J 4NURA 1JPLA 2I9CA 3CSTA 3LDZA 3UT8A 4EZKA 3PEUB 3ZYLA 5FZRA 3CQGB 4J8FA 3N71A 3RRNB 3P1UA 4JVSA 3EIQC 5DIZA 1FVFA 4LERA 4B8CB 4WWNA 3B13A 4HXIA 4UQXA 4DI3A 4L2LA 3Q5MA 1L5JA 3D9NA 4FLBA 3EHMA 3AU5A 3CLJA 2MOWA 4GMJA 2YHEA 1HE8A 2OVBA 1IQUA 3JQ0A 3MV2B 5BV0A 3QKYA 3FTSA 3URZA 3CHSA 4FU3A 3CEQA 4BX8A 4PS7A 3JQ1A 4EBAA 4B0ZA 4I6JA 4HOUA 5FQ4A 1UJKA 5JHAA 2AWIA 3IHYA 3RU0A 3CK7A 1PC2A 1UW4B 3IV0A 5FT9A 4PS3A 3CHQA 3LY9A 2WMNA 5FWQA 1OWLA 3ESKA 3O48A 1LF8A 2VQ2A 4LRZA 3PUJA 4U04A 4KMOA 1EYHA 3LEWA 4GZ6A 4ABNA 3FEYA 5C2YA 1OWPA 3FU0A 4DPRA 4GA0A 3B7SA 3GZ1A 2AVPA 5KJLA 2X38A 4Y6CA 3SI5A 3T5VA 2XGSA 3PS6A 4FLHA 2OV8A 3TL5A 2WQ6A 3EIJA 4U0UA 4GYYA 2KCLA 2VSOE 2WVIA 4HLEA 4EQFA 5HI7A 4Q69A 1HS6A 2L0IA 3LY8A 3I3NA 2HR2A 3FTVA 4GCOA 5JJ7A 1QZ2A 2EQXA 2PZIA 3L22A 4WNGA 3ZPJA 4EZJA 4WWPA 2CHXA 1Y8MA 1YA0A 3SBTB 1H19A 5J90A 5LCWJ 2KZTB 4P29A 1HO8A 3D9OA 4URKA 3WXXA 3ZN3A 4FA6A 2HO1A 3QJZA 3CHRA 5FQ7A 4LEUA 3PEVB 3RKVA 4HOTA 3KS2A 3I5PA 3UUXA 3RRUA 4GA2A 2PQNA 2IF4A 3HVEB 3QK0A 4ILIA 5LFAA 4J6IA 4FHJA 2WXJA 1EPUA 5FZSA 4BX9A 3ONLA 4FJZA 1EDUA 4U8HA 2FI7A 1E7UA 3APCA 3ONKA 5D0OD 5FTPA 4RG6A 4ANWA 1SQMA 2VYIA 3D9PA 1HFAA 4UQZA 4C9BB 3CVQA 2UY1A 3FULA 2L0TB 5BW8C 1DNPA 3R7QA 3FUHA 3UT4A 2WXLA 3FH8A 2VGYA 1H0AA 3LJ3A 3ASFA 4IRUA 3ZYQA 1JUQA 3LYAA 3PE3A 2Y3AA 4FC8A 3MV3B 2M63A 4I9EA 4K03A 3S7JA 2X6KA 3CIAA 2WQHA 4GCNA 3D9KA 1Z6TA 3CVUA 4TUUA 3ULQA 2WB2A 3ZFWA 4GAAA 2BTDA 3JCKC 3PREA 3VTXA 3UPVA 3FTZA 3GYZA 4MRUA 4CDNA 5HQ8A 4Q94A 2VTBB 3R9AB 1HG5A 4H7YA 5AJLA 4TRQA 2WM9A 1E7VA 2L6JA 3D9MA 4CDMA 3P2BA 2WXMA 1BPOA 2JLBA 3L17A 4APFA 4KZ0A 4N2QA 3MJWA 4EZLA 1MQSA 4FHKA 3RIBA 4UWGA 2CG2A 3ZW3A 2XPYA 3OXGA 2GRLA 2V5FA 3AS5A 4OVVA 3Q47B 4J0UA 4I43A 4A1SA 2UWJG 2CHZA 3K9IA 1VDYA 2YHCA 2LO6A 4JEUA 4I6GA 3AS4A 3LXUX 4V3IA 4IN3B 5AYWD 2XGMA 3CKBA 4XI9A 1ELRA 4R7LA 4TV3A 1Z3XA 1IQRA 2WXNA 1ZBPA 4XIFA 3B7UX 2Y4UA 5JJ6A 4G2VA 1E8WA 1OUVA 4ATGA 2WQ7A 4GU5A 1WAO1 3L08A 4BSXA 3MZLB 3G2VA 4G23A 4JA7A 4CGWA 4BY6A 2BF0X 1NA0A 1FCHA 4FJYA 2XQ0A 4WUYA 4AV7A 5JJTA 4ME2A 2HYZA 2J08A 3BG0B 3FUDA 3B7RL 1UJJA 4CCAA 4WNDA 1INZA 3NZUA 3ASHA 3MCXA 3ML8A 4N3CA 5BNWA 3RK6A 5J08A 4AXHA 1H2VC 4N3BA 3SZ7A 2KCKA 3O4ZA 2LNIA 5CMYA 1Z3YA 3S7DA 3MKQA 5E76A 4OYSA 3EJNA 3CK8A 3UT7A 3VTYA 2IJGX 2QFCA 5FJYA 5KJMA 3PRZA 3ZHEA 4WNEA 2I1KA 4CT4A 2J09A 2RG8A 1KT1A 4HORA 3Q15A 5AENA 1IYGA 3D9IA 4WWOA 1E8YA 3IBEA 4JXTA 4ILGA 3SFZA 3TGOA 1ELKA 1U3CA 4PUCA 4BFRA 4UWKA 2PL2A 3QWWA 2FBNA 4GZCA 2GGFA 1ZU2A 4AY6A 2KM4A 3CGHA 3OAWA 4GB9A 1TJFA 3R7RA 4CRWA 2J49A 5LOZA 1ELWA 2AXUA 3CVXA 2IOSA 4AIFA 5EKQD 4ANXA 3LCAA 1SZ9A 1OWMA 3FWVA 4JPSA 1XGWA 4JC8A 1PY1A 4I2WA 4XE0A 4JHJA 4GA1A 4L1BA 4H7XA 3RO3A 2C0LA 3T5XA 1OWNA 3LY7A 3T8MA 2X6IA 5CCMA 2KC7A 2WXKA 4UQYA 1UN8A 2WXPA 3KAEA 3FTXA 2WXRA 4F53A 3PNTB 2CFUA 3GZ2A 4E6HA 3FTUA 4A55A 4GYWA 1NA3A 3DPDA 2J4BA 4XI0A 5BT1A 5CHEE 2J07A 1N54A 3QOUA 4QFVA 2J9QA 1EF1C 4DLQA 2DCPA 4KT6B 5DBKA 3FU3A 4YNDA 1N52A 1Y6IA 4MKTA 1TEZA 3IKOB 4M3OA 3QB2A 4WAFA 3L6AA 3HDXA 2XRZA 1HX8A 4ACLA 4KBQA 3PE4A 2VSXE 4E85A 3MKRA 3TXNA 2AXVA 3AS8A 4J8SA 2V0PA 3LVRE 2WXQA 4RG9A 3SNXA 4RVBA 3U4TA 3APDA 1FVHA 2JEKA 4BT8A 3NQPA 2VGXA 4K0RA 4I1AA 4NQ0A 5G2NA 4JZYA 3LVQE 4L7TA 3QWVA 3VLDA 1HU3A 2CG3A 2A4ZA 2VSNA 4YVOA 2XCBA 4PDXA 3ZRHA 2WXIA 2XGOA 4AOFA 1KLXA 4ACKA 3EHNA 3G2TA 2BUGA 5G55A 4EPZA 2L9BA 4G26A 2J4DA 1UG3A 1TJCA 2WMOA 3CHPA 2WXHA 2V4LA 3D9JA 3TJPA 3OTNA 2I1JA 4ANVA 4HFGA 3U66A 4EBAG 2FF4A 4GZ3A 4U0SA 3TG4A 4ANUA 3FH5A 2RD0A 3FUKA 3CV0A 3CKCA 1X5BA 4C0MA 3LKUA 4XKCA 5ANLA 3CVPA 4I17A 3FUEA 2AW6A 3HIZA 5M72A 2XHEA 4I2ZA 5AJDA 2DIWA 4XKBA 4BTAA 2I6HA 3CK9A 2UY1B 3NF1A 2YQ8A 3QDNA 4IYPA 4I1OB 2YNQA 4KYOB 3RRMB 5E75A 5T3RA 2CHWA 1PAQA 4D10C 3FEXA 3CVNA 1HH8A 1QQEA 1S0PA 4DK5A 3CVYA 5BV1A 3U64A 4RSYA 4HOSA 5AIJA 4BTBA 4XZ4A 1U3DA 4AM9A 3G2SA 4N3AA 2PM6A 3JUIA 3PVLA 5EX0A 3LS8A 3FDHA 2X6FA 4O6FA 5A7DB 2XRYA 5BUZA 3SF4A 3FP3A 2PQRA 5ARGA 1HZ4A 3L13A 3G2UA 2ONDA 4UI9C 3TG5A 5KJNA 4AY5A 5LX8A 3SHFA 3CQCB 3DBSA 5EDSA 2IONA 3S7FA 3ZEFA 5EX3A 1E8ZA 2E2EA 2VJ8A 1UN9A 4KVMA 2FULA 3CHOA 2CFZA 4JEHA 5CMWA 3LPZA 2GRMA 4B89A 3PUKA 3C98A 4L2YA 3U3WA 1WY6A 4PS8A 1NZNA 4FADA 4PH4B 2OVFA 4GZ5A 2IOLA 4N5CA 3ZVVA 1H2TC 2I2OA 1E90A 2R17C 2LSVA 2LAHA 1HF8A 4Q96A 2DBAA 3CHMA 4C0EA 2FO7A 3FTWA 3RJVA 2KZTA 4ILHB 2P58C 2R5SA 2YINA 3PDNA 4CT0A 2C2LA 2X3MA 4A3TA 4GPKA 2IU1A 3UQ3A 2WPVA 1HG2A 4DI4A 3KD7A 4G24A 4A3VA 3I4RB 5G05C 4GMLA 3BG1B 3CR3A 3MYVA 4N39A 2XPIA 4A1GA 3HVEA 4JHRA 4IULA 3L16A 1HXIA 3NZSA 3ZGQA 4B94A 3BEEA 4G1TA 4XX5A 3MEKA 3ZIMA 1OWOA 2MHKA 4AVXA 3VLFA 3U9WA 3ML9A 2X6HA 3SBSA 4BT9A 3MX3A 3Q4AB 3Q49B 2NXPA 3FHEA 2XPZA 3FUNA 4JL0A 4UWFA 4UI9K 2IFUA 5D0QD 3FY4A 3ZYMA 4DJAA 1JWGA 3MKQB 4FP7A 3TAXA 2NC9A 5KJKA 1JWFA 3UMVA 5BPPA 3QNKA 4I9CA 3FFLA 5G04J 3FUMA 3VLEA 4F1SA 3E4BA 4NACA 1B89A 1W3BA 1P5QA 3QARA 3ZHEB 3MA5A 2A5UA 3SD5A 3FU5A 2E0IA 3OXLA 3UX4A 2WXOA 2IQCA 3FUFA 4G11A 4NRHB 3S2AA 4EECA 2OOEA 4DLOA 3IHVA 4UWHA 4YVQC 5FZQA 2VTBA 4J8DA 2XCCA 3D3MA 3FU6A 1H6KA 4HS2A 2X6JA 4JHKA 3FH7A 2Y4TA 2GW1A 5ARFA 5A6CA 2WXGA 3B7TA 3QAQA 2V8SE 3I4GA 5T4YA 1DVPA 3QWPA 3JYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT4 A;  3UT8 A;  3UT7 A; 
#chains in the Genus database with same CATH topology
 4KXK B;  4GTM A;  3PZD A;  5FQ8 A;  2F8Y A;  5G04 C;  5ENN A;  5C1D A;  3EHR A;  3CSF A;  4HOQ A;  4YDY A;  3QC1 A;  5JHB A;  1N11 A;  3APF A;  3JXJ A;  5EIL A;  4GYO A;  5ANR A;  4UWL A;  3V2X A;  2IO2 C;  3TWT A;  4Y6W A;  3HHM A;  3NAW A;  3EUV A;  4QQI A;  5KCM A;  4JA9 A;  1QNF A;  3ASO E;  2EIM E;  2KCV A;  2LAI A;  1BU9 A;  4I1M A;  3FUI A;  1KT0 A;  2QC9 A;  4KZC A;  2LSU A;  4F3V A;  1JPL A;  3UT8 A;  1FT1 A;  2EIN E;  3P1U A;  3EIQ C;  1DC2 A;  4WWN A;  3B13 A;  2Y0B G;  4DI3 A;  3D9N A;  2YHE A;  1HE8 A;  1IQU A;  1TN8 A;  1KPS B;  3FTS A;  2NYJ A;  4BX8 A;  5BXU A;  4EBA A;  3C3O A;  5FQ4 A;  2F0Y A;  4EHM A;  5JMN D;  5FT9 A;  4PS3 A;  3CHQ A;  1OWL A;  3PZ1 A;  4LRZ A;  3PUJ A;  4GZ6 A;  4K5B A;  1RZ4 A;  3FU0 A;  3B7S A;  2X38 A;  4Y6C A;  3SI5 A;  3T5V A;  2XGS A;  3TL5 A;  1NL4 A;  5AAR A;  4HLE A;  1O1S A;  5HI7 A;  1HS6 A;  3C5R A;  3I3N A;  2PZI A;  3SBT B;  1Y8M A;  1H19 A;  2KZT B;  4BEP A;  3ZN3 A;  2HO1 A;  3CHR A;  3PEV B;  4HOT A;  3UUX A;  2IF4 A;  2ZXW E;  3QK0 A;  4FHJ A;  3ONK A;  4ANW A;  4C9B B;  1S63 A;  5HKP A;  3UT4 A;  3ZYQ A;  2Y3A A;  2MYO A;  3S7J A;  2X6K A;  3D9K A;  3ULQ A;  5ENP D;  2WB2 A;  3KSL A;  4GAA A;  2BTD A;  3VTX A;  4XEI G;  3GYZ A;  1HG5 A;  3V30 A;  4H7Y A;  2QYJ A;  1E7V A;  3D9M A;  3P2B A;  2WXM A;  1BPO A;  3Q7A A;  2ZGD A;  4EZL A;  1MQS A;  3RIB A;  3ZW3 A;  2V5F A;  3EHQ A;  2CHZ A;  2XEN A;  1VDY A;  4I6G A;  3AS4 A;  4LNG A;  2XGM A;  3CKB A;  4R7L A;  2IY0 C;  1IQR A;  4XIF A;  2Y4U A;  1OUV A;  4GU5 A;  4LNU D;  3MZL B;  3UIO C;  4BY6 A;  1NA0 A;  4HI8 A;  1IHB A;  1UJJ A;  4WND A;  2EIJ E;  3DSV A;  2R02 A;  1N4S A;  5J08 A;  4AXH A;  5CMY A;  1Z3Y A;  3MKQ A;  2OCC E;  5FJY A;  5KJM A;  1O5M A;  3PRZ A;  3ZHE A;  4HOR A;  5AEN A;  4WWO A;  3IBE A;  4ILG A;  3SFZ A;  4J7W A;  4TXP A;  4U8Y D;  1YYH A;  4GTV A;  4AY6 A;  2KM4 A;  4GB9 A;  1ELW A;  1TN7 A;  1OXJ A;  2GRP B;  4GA1 A;  4JHJ A;  3T8M A;  5CCM A;  2KC7 A;  4UQY A;  3FTX A;  5ENT D;  3AG3 E;  1N54 A;  3QOU A;  2P2C P;  1N52 A;  3IKO B;  3ZKJ A;  3PE4 A;  4J8S A;  2P9N G;  2XS1 A;  3Q9N C;  4BT8 A;  2H6G A;  4K0R A;  4NQ0 A;  2F8X K;  2CG3 A;  4PDX A;  1JCQ A;  2WXI A;  1KLX A;  2BUG A;  4EPZ A;  4A63 B;  3U66 A;  2RD0 A;  3FUK A;  3CV0 A;  1O1T A;  2AW6 A;  5M72 A;  1N9A A;  4XKB A;  4BTA A;  3CK9 A;  3NF1 A;  3Q78 A;  2FO1 E;  2RFM A;  1QYM A;  3FEX A;  3CVN A;  2R03 A;  4DK5 A;  3CVY A;  5BV1 A;  3HXC A;  3PVL A;  4GPM A;  4O6F A;  5BUZ A;  4UI9 C;  3G2U A;  2OND A;  5KJN A;  3SHF A;  4GMR A;  3S7F A;  3PZ2 A;  3SY2 A;  3NOC D;  5EX3 A;  2E2E A;  1UN9 A;  2CFZ A;  2GRM A;  2DWZ A;  3C98 A;  3F6Q A;  4L2Y A;  4FAD A;  4GZ5 A;  2GRQ B;  3C72 A;  4C0E A;  2BKG A;  2KZT A;  2A5E A;  1LTX A;  4DX1 A;  4GPK A;  2IU1 A;  3I4R B;  5G05 C;  3BG1 B;  3CR3 A;  4A1G A;  3NBN B;  3C3Q A;  3L16 A;  3NZS A;  3BEE A;  4XX5 A;  5EIB E;  2MHK A;  4BT9 A;  3Q4A B;  3Q49 B;  3FHE A;  3HG0 D;  4UWF A;  4DJA A;  3ZYM A;  3KEA A;  1JWF A;  3AJI A;  1OCC E;  4I9C A;  4F1S A;  3UTM A;  1P5Q A;  3QAR A;  4HQD A;  4DX7 D;  3FU5 A;  3OXL A;  4G8K A;  4GTS A;  2P9U G;  5KNH D;  3FUF A;  2OOE A;  3IHV A;  4UWH A;  3D3M A;  3FH7 A;  1K1A A;  1MX6 A;  2WXG A;  3B7T A;  3QAQ A;  5T4Y A;  1DVP A;  3QWP A;  2NSZ A;  2XZD G;  5LP0 A;  5LCW C;  3CVW A;  1NP7 A;  3RO2 A;  3J5P A;  4GZD A;  3DSX A;  3MGB A;  1A17 A;  3TXM A;  3D9L A;  4G25 A;  1OCZ E;  4U07 A;  4N2S A;  4W9R A;  1SZA A;  3G2W A;  3HYM B;  2AXZ A;  4YDE A;  5T8I A;  3KEZ A;  3ZXS A;  3UI2 A;  2H6H A;  5FQ6 A;  1XNF A;  3CVV A;  2R05 A;  2ZIS A;  4I6E A;  1N0R A;  3DPY A;  2R59 A;  4L23 A;  3AG1 E;  2ZU6 B;  2WXF A;  4DRX E;  4HRN A;  5B1A E;  4NUR A;  2I9C A;  4EZK A;  3PEU B;  3ZYL A;  5D66 A;  4JVS A;  3ULY A;  4LER A;  4B8C B;  4HNA D;  4X8Q A;  4UQX A;  3AU5 A;  3CLJ A;  2MOW A;  5BV0 A;  2PNN A;  3CHS A;  4PS7 A;  1D9S A;  4HOU A;  1UJK A;  5JHA A;  2AWI A;  3IHY A;  3RU0 A;  3UM3 A;  1PC2 A;  1UW4 B;  3LY9 A;  2WMN A;  1D8E A;  1EYH A;  1BD8 A;  1ZB1 A;  4ABN A;  3FEY A;  1OWP A;  4GA0 A;  2AVP A;  3EU9 A;  3Q9U C;  3EIJ A;  2KCL A;  4Q69 A;  2L0I A;  3LY8 A;  2HR2 A;  5JJ7 A;  2EQX A;  4WNG A;  3ZPJ A;  4EZJ A;  4WWP A;  2CHX A;  1YA0 A;  1LD7 A;  3LJN A;  1SW6 A;  4P29 A;  3D9O A;  1OT8 A;  4URK A;  1BI8 B;  3WXX A;  3DEP A;  3QJZ A;  3KS2 A;  4BX9 A;  4FJZ A;  5ENR D;  4OAV B;  1E7U A;  3APC A;  2ETC A;  5D0O D;  4UQZ A;  3D9P A;  1HFA A;  3CVQ A;  3FUL A;  2DZN A;  2WXL A;  1H0A A;  3LJ3 A;  1JUQ A;  3CIA A;  2WQH A;  3KSQ A;  2L6B A;  3ZFW A;  3PRE A;  3UPV A;  2VTB B;  4TRQ A;  2L6J A;  2LUH A;  2JLB A;  3L17 A;  4C48 B;  4N2Q A;  3OXG A;  3Q47 B;  4J0U A;  4GTQ A;  2UWJ G;  2LO6 A;  4RLY A;  4V3I A;  5AYW D;  1ELR A;  2QZA A;  3B7U X;  2WQ7 A;  4ATG A;  1WAO 1;  4BSX A;  4JA7 A;  4CGW A;  5ENQ D;  2ETA A;  2XQ0 A;  4AV7 A;  5JJT A;  2HYZ A;  1INZ A;  3B7R L;  5FIO A;  3ML8 A;  4N3C A;  4N3B A;  2KCK A;  3JUE A;  5CBN A;  1SVX A;  4OYS A;  3EJN A;  3CK8 A;  3UT7 A;  4WNE A;  4CT4 A;  1KT1 A;  1H6P A;  3Q15 A;  3D9I A;  4ZFH A;  4JXT A;  4BFR A;  3Q75 A;  4UWK A;  2PL2 A;  2GGF A;  1ZU2 A;  2J49 A;  5LOZ A;  3CVX A;  2AXU A;  5IY5 E;  5EKQ D;  4ANX A;  1SZ9 A;  1OWM A;  3FWV A;  1NI1 A;  2V5Q C;  1PY1 A;  4H7X A;  3DRA A;  3TWS A;  1YCS B;  2X6I A;  2WXK A;  1UN8 A;  3PNT B;  2DVW A;  3GZ2 A;  3FTU A;  4GYW A;  2J4B A;  1K1B A;  4XI0 A;  5BT1 A;  2J07 A;  4HBD A;  2DCP A;  5DBK A;  3FU3 A;  1Y6I A;  1TEZ A;  4WAF A;  4KBQ A;  3MKR A;  1JCS A;  3TXN A;  2V0P A;  1TNU A;  1DCQ A;  3U4T A;  3APD A;  2JEK A;  4JZY A;  2A4Z A;  4YVO A;  3IXE A;  3L9T A;  4G26 A;  2WXH A;  3TJP A;  3V31 A;  2I1J A;  4HFG A;  4EBA G;  3EU5 A;  3TG4 A;  1X5B A;  3CVP A;  4I17 A;  5AQA A;  2DIW A;  2UY1 B;  2YQ8 A;  5EN5 D;  5E75 A;  3NB2 A;  1PAQ A;  4RSY A;  2XEE A;  1IXV A;  3DEO A;  4ATZ D;  1A5E A;  2J8S D;  4N3A A;  2PM6 A;  3FDH A;  5A7D B;  3ZUV B;  2XRY A;  3SF4 A;  2KXP C;  2PQR A;  3FP3 A;  1HZ4 A;  1V54 E;  3HXF A;  5LX8 A;  2BKK B;  4NIK A;  2Y69 E;  2JAB A;  1E8Z A;  2FUL A;  3CHO A;  1Q2Z A;  3PUK A;  4K5A B;  1WY6 A;  4PS8 A;  3ZVV A;  1H2T C;  2LSV A;  2LAH A;  1HF8 A;  5AQ7 A;  2FO7 A;  3ZNG A;  3UIP C;  2R5S A;  2XEH A;  2YIN A;  3PDN A;  4TXR A;  3UM1 A;  4CT0 A;  4A3T A;  3UQ3 A;  2WPV A;  4DI4 A;  3Q7F A;  3KD7 A;  1MX2 A;  4U96 D;  1BI7 B;  2ZIR A;  1OCO E;  3ZIM A;  4O1P A;  4AVX A;  3SFY A;  3ML9 A;  2X6H A;  4HRL A;  3MX3 A;  3SO8 A;  2NXP A;  2XPZ A;  3FUN A;  4BES A;  3PZ4 A;  1JWG A;  4FP7 A;  3TAX A;  3T8K A;  3UMV A;  5BPP A;  3QNK A;  3BU8 A;  3E4B A;  1B89 A;  4BET A;  3B7B A;  3SD5 A;  2E0I A;  2KBX A;  4M7C A;  5FZQ A;  2VTB A;  3FU6 A;  1H6K A;  4HS2 A;  2X6J A;  4CYM D;  2P9K G;  3I4G A;  3JYS A;  2IO3 C;  2FEZ A;  2B0O E;  3L54 A;  4WNF A;  5AAO A;  3ABL E;  2MRI A;  4UI9 J;  3GW4 A;  2ILR A;  4JW1 A;  3SGH A;  5CCL A;  3EDT B;  2HM8 A;  2H6I A;  4LCT A;  3PNL B;  4U63 A;  4CDR A;  3ESL A;  1H2U A;  4GTP A;  4CEM A;  1GW6 A;  1JCR A;  2EIL E;  3E32 A;  3PH0 C;  4KVO A;  3FUJ A;  2VGX B;  4APO A;  3Q73 A;  4FUL A;  2Q7F A;  3GZS A;  4OVU A;  1MHQ A;  3UM2 A;  4ZHB A;  3W9F A;  4B8A A;  1V55 E;  3E30 A;  5G05 J;  4U95 D;  3CST A;  3LDZ A;  4OAU C;  4J8F A;  3RRN B;  5DIZ A;  5EYP F;  1FVF A;  4L2L A;  3Q5M A;  3HXE A;  4J8Y A;  1FPP A;  3MV2 B;  3QKY A;  4FU3 A;  1AWC B;  3JQ1 A;  4B0Z A;  3CK7 A;  4DX6 D;  3ESK A;  1LF8 A;  3L82 A;  4U04 A;  4B93 B;  4O60 A;  5C2Y A;  4DPR A;  2OEV A;  3GZ1 A;  5KJL A;  2OV8 A;  2WQ6 A;  5CED B;  5ENS D;  4GYY A;  3AAA C;  2VSO E;  2WVI A;  4EQF A;  3FTV A;  1NFI E;  2DYR E;  3L22 A;  5J90 A;  5LCW J;  2RKK A;  5FQ7 A;  4LEU A;  3Q79 A;  3RKV A;  5ITZ F;  3DWL G;  2PQN A;  4ILI A;  3HVE B;  3UKU G;  5LFA A;  5B3S E;  4J6I A;  2WXJ A;  3ONL A;  1EDU A;  2FI7 A;  5CRV A;  5FTP A;  4RG6 A;  2VYI A;  1KZP A;  2UY1 A;  1AP7 A;  2L0T B;  3R7Q A;  3FUH A;  5AQ9 A;  3DSS A;  3FH8 A;  2VGY A;  1RW2 A;  3LYA A;  4FC8 A;  1N4R A;  3MV3 B;  4I9E A;  4YDO A;  3CVU A;  1Z6T A;  1BLX B;  4GTT A;  4BSZ B;  3FTZ A;  4Q94 A;  3R9A B;  5AJL A;  1FT2 A;  4CDM A;  1N95 A;  4APF A;  4FHK A;  5KWD A;  2CG2 A;  1S70 B;  5D2M C;  5KNG A;  4I43 A;  4Z68 A;  4JEU A;  3LXU X;  3V2O A;  1X81 A;  2WXN A;  1ZBP A;  5JJ6 A;  5CEC B;  3L08 A;  1O1R A;  3G2V A;  2BF0 X;  4ME2 A;  3FUD A;  3NZU A;  3ASH A;  3MCX A;  1H2V C;  3SZ7 A;  4F1P A;  3ZXP A;  5E76 A;  5B1B E;  1TNZ A;  3VTY A;  2I1K A;  1MYO A;  3AG4 E;  2J09 A;  2RG8 A;  2XZT G;  3V79 K;  1IYG A;  1E8Y A;  1ELK A;  1N4P A;  4PUC A;  4GTO A;  3QWW A;  3CGH A;  4CRW A;  4JB8 P;  4AIF A;  4JPS A;  1XGW A;  3RO3 A;  2C0L A;  4MBG A;  1OWN A;  1K3Z D;  1QBQ A;  2WXR A;  3R9M A;  2CFU A;  2OEW A;  4HB5 A;  4A55 A;  3SQV A;  1EF1 C;  3DST A;  4KT6 B;  4YND A;  4M3O A;  3L6A A;  4ACL A;  1WG0 A;  3DXK G;  2AXV A;  3LVR E;  4RG9 A;  4RVB A;  1FVH A;  3NQP A;  2VGX A;  4I1A A;  3W9G A;  5G2N A;  3QWV A;  3VLD A;  1HU3 A;  2VSN A;  2XCB A;  1N0Q A;  3ZRH A;  4AOF A;  4ACK A;  3EHN A;  2L9B A;  2J4D A;  1TJC A;  3D9J A;  3CHP A;  4ANV A;  3OTN A;  3BQO A;  4LG6 A;  1K8K G;  3CKC A;  3FUE A;  2H6F A;  3HIZ A;  4RQI A;  4I2Z A;  4N5Q A;  5AJD A;  2I6H A;  3QDN A;  4IYP A;  4HOS A;  2YNQ A;  5T3R A;  4D10 C;  1HH8 A;  1QQE A;  1S0P A;  1SA4 A;  4XZ4 A;  4AM9 A;  3G2S A;  3LS8 A;  3T9K A;  3AG2 E;  3X2Q E;  5ARG A;  2R2L A;  5EYL A;  3CQC B;  3DBS A;  3ZEF A;  4KVM A;  4JEH A;  4HRM B;  2DZO A;  4PH4 B;  2OVF A;  1WDY A;  2RFA A;  2R17 C;  4Q96 A;  3CHM A;  5EID A;  4ILH B;  1MZC A;  3PZ3 A;  3RAU A;  4DX2 A;  4JD2 G;  1HG2 A;  4A3V A;  2GRO B;  2GRN B;  4N39 A;  2XPI A;  3HVE A;  4IUL A;  1HXI A;  3TWW A;  3ZGQ A;  4G1T A;  1OWO A;  5CER B;  3HXD A;  3U9W A;  3SBS A;  3UKR G;  4JL0 A;  2BED A;  3D9H A;  4O1O A;  3FFL A;  3FUM A;  4NAC A;  2A5U A;  3UX4 A;  2WXO A;  2IQC A;  3S2A A;  4G11 A;  4DLO A;  4YVQ C;  4J8D A;  2XCC A;  1DCE A;  5ARF A;  3ULE G;  4MLP A;  1IHG A;  2VSY A;  3CVL A;  1E96 B;  3ZYK A;  3FTY A;  4F7A A;  1WM5 A;  3AU4 A;  2GRR B;  3E33 A;  2PM7 A;  4U0Z A;  2C0M A;  4J8E A;  3ASG A;  4AP2 A;  3S7B A;  4HVB A;  4LUN U;  5A23 A;  1MJ0 A;  4AJW A;  4BWR A;  2XEV A;  3SFX A;  3ENE A;  3ASD A;  3IEG A;  4MS6 A;  2KAT A;  2QY7 A;  4CGV A;  4GTR A;  1E8X A;  4AEZ C;  3OXF A;  1H6O A;  2P9L G;  5FZR A;  2B6C A;  3CQG B;  3N71 A;  1G3N B;  4HXI A;  4U7E B;  1L5J A;  4FLB A;  3EHM A;  4GMJ A;  2OVB A;  3JQ0 A;  4LSZ E;  1OCR E;  3URZ A;  3CEQ A;  4I6J A;  1YMP A;  3IV0 A;  5FWQ A;  1TR4 A;  3O48 A;  2VQ2 A;  4KMO A;  3LEW A;  3PS6 A;  2LXM A;  4FLH A;  4U0U A;  1IKN D;  2ETB A;  4GCO A;  1QZ2 A;  3J5Q B;  4HLL A;  3ZU7 B;  2EIK E;  1HO8 A;  4FA6 A;  4BER A;  3TWU A;  3I5P A;  3RRU A;  4GA2 A;  1EPU A;  5FZS A;  4U8H A;  1SQM A;  1KZO A;  5BW8 C;  1DNP A;  2QYU A;  4TXQ A;  3ASF A;  4IRU A;  3PE3 A;  2M63 A;  4K03 A;  4UUC A;  4GCN A;  4TUU A;  3ABM E;  3JCK C;  1UOH A;  4MRU A;  4CDN A;  5HQ8 A;  5H7P A;  5JA4 D;  2WM9 A;  3WG7 E;  2XS8 A;  1TNY A;  4KZ0 A;  3MJW A;  3TWX A;  4UWG A;  5FIN A;  2XPY A;  2GRL A;  3AS5 A;  4OVV A;  4A1S A;  3K9I A;  2YHC A;  1TNB A;  4IN3 B;  3HXB A;  4XI9 A;  3DSW A;  4TV3 A;  2LXL A;  3UIN C;  1Z3X A;  4L9P A;  4G2V A;  1E8W A;  4K5C A;  2P9I G;  4G23 A;  4TUM A;  4WUY A;  1FCH A;  4FJY A;  4HI9 A;  2J08 A;  3BG0 B;  3TWV A;  4CCA A;  5BNW A;  3B95 A;  2Y1L E;  3RK6 A;  1LD8 A;  3O4Z A;  2LNI A;  3S7D A;  5BXO A;  1D8D A;  5HS0 A;  2IJG X;  2QFC A;  4DUI A;  2HE0 A;  1OY3 D;  1TN6 A;  3ABK E;  5HRY A;  3TGO A;  1U3C A;  3NOG D;  2FBN A;  4GZC A;  5AN8 A;  3OAW A;  1TJF A;  3R7R A;  2IOS A;  3LCA A;  4DX5 D;  3JXI A;  4JC8 A;  4I2W A;  4XE0 A;  4L1B A;  3ASN E;  3T5X A;  3LY7 A;  2WXP A;  3KAE A;  4F53 A;  3TWQ A;  4E6H A;  1NA3 A;  3DPD A;  5CHE E;  4QFV A;  3TWR A;  3UM0 A;  1N94 A;  2J9Q A;  4DLQ A;  4MKT A;  3QB2 A;  3HDX A;  2XRZ A;  1HX8 A;  2VSX E;  3E34 A;  4E85 A;  3ISM C;  3AS8 A;  4G8L A;  2WXQ A;  3SNX A;  4F6R D;  5CBO A;  1TYQ G;  3LVQ E;  4L7T A;  2ZGG A;  2XGO A;  5ENO D;  3G2T A;  5G55 A;  1UG3 A;  2WMO A;  2V4L A;  2FF4 A;  4GZ3 A;  4U0S A;  4ANU A;  3FH5 A;  4YDW A;  2F37 A;  4C0M A;  3LKU A;  4XKC A;  5ANL A;  2XHE A;  3RSE G;  3DSU A;  2AJA A;  4I1O B;  3RRM B;  4KYO B;  5CRU A;  4CZ2 D;  2CHW A;  3BUA A;  3U64 A;  5AIJ A;  4BTB A;  1U3D A;  2V4H C;  3JUI A;  5EX0 A;  3C3R A;  2X6F A;  3L13 A;  3TG5 A;  4AY5 A;  5CEA A;  5EDS A;  2ION A;  2VJ8 A;  5CMW A;  3LPZ A;  4B89 A;  1TNO A;  1U2V G;  2DYS E;  3U3W A;  1NZN A;  2IOL A;  4N5C A;  2I2O A;  1E90 A;  2IEJ A;  2DBA A;  3FTW A;  3RJV A;  2P9P G;  3HRA A;  1Z5S C;  2P58 C;  2C2L A;  2X3M A;  3UXG A;  4LNB A;  4G24 A;  4GML A;  3MYV A;  4JHR A;  1MX4 A;  4B94 A;  4U8V D;  3MEK A;  3VLF A;  1SA5 A;  5AQB A;  2P9S G;  5D0Q D;  4UI9 K;  2IFU A;  3FY4 A;  3MKQ B;  5KBA A;  5KJK A;  2NC9 A;  5G04 J;  3VLE A;  1W3B A;  3ZHE B;  1N4Q A;  3MA5 A;  1S64 A;  4EEC A;  4NRH B;  4JHK A;  3E37 A;  2Y4T A;  2GW1 A;  3DXM G;  5A6C A;  2VGE A;  2V8S E; 
#chains in the Genus database with same CATH homology
 2FEZ A;  4KXK B;  4MLP A;  1IHG A;  3L54 A;  3PZD A;  5FQ8 A;  5G04 C;  2VSY A;  3CVL A;  4WNF A;  5ENN A;  1E96 B;  2MRI A;  2NSZ A;  5C1D A;  4UI9 J;  5LP0 A;  3GW4 A;  2ILR A;  5LCW C;  3CVW A;  3CSF A;  1NP7 A;  3FTY A;  4HOQ A;  3ZYK A;  4JW1 A;  3RO2 A;  1WM5 A;  3SGH A;  4F7A A;  3QC1 A;  4GZD A;  5CCL A;  5JHB A;  3EDT B;  2HM8 A;  3APF A;  3MGB A;  1A17 A;  3AU4 A;  4GYO A;  5ANR A;  4LCT A;  3PNL B;  4U63 A;  3TXM A;  3D9L A;  4UWL A;  2PM7 A;  4G25 A;  4U0Z A;  4CDR A;  3ESL A;  2C0M A;  4Y6W A;  4J8E A;  1H2U A;  4U07 A;  3ASG A;  4CEM A;  3HHM A;  4N2S A;  1GW6 A;  5KCM A;  4JA9 A;  1QNF A;  1SZA A;  4W9R A;  4AP2 A;  3G2W A;  3S7B A;  3HYM B;  4HVB A;  2AXZ A;  4LUN U;  2KCV A;  5T8I A;  2LAI A;  3PH0 C;  5A23 A;  3KEZ A;  4KVO A;  3FUJ A;  3ZXS A;  2VGX B;  4AJW A;  4APO A;  4BWR A;  2XEV A;  5FQ6 A;  4FUL A;  2Q7F A;  3GZS A;  1XNF A;  4I1M A;  4OVU A;  3ENE A;  3ASD A;  3IEG A;  4MS6 A;  3FUI A;  3CVV A;  1KT0 A;  1MHQ A;  2KAT A;  2QY7 A;  4I6E A;  4CGV A;  2R59 A;  4KZC A;  4L23 A;  2LSU A;  4B8A A;  1E8X A;  4AEZ C;  2ZU6 B;  2WXF A;  4F3V A;  3OXF A;  5G05 J;  4NUR A;  1JPL A;  2I9C A;  3CST A;  3LDZ A;  3UT8 A;  4EZK A;  3PEU B;  3ZYL A;  5FZR A;  3CQG B;  4J8F A;  3N71 A;  3RRN B;  3P1U A;  4JVS A;  3EIQ C;  5DIZ A;  1FVF A;  4LER A;  4B8C B;  4WWN A;  3B13 A;  4HXI A;  4UQX A;  4DI3 A;  4L2L A;  3Q5M A;  1L5J A;  3D9N A;  4FLB A;  3EHM A;  3AU5 A;  3CLJ A;  2MOW A;  4GMJ A;  2YHE A;  1HE8 A;  2OVB A;  1IQU A;  3JQ0 A;  3MV2 B;  5BV0 A;  3QKY A;  3FTS A;  3URZ A;  3CHS A;  4FU3 A;  3CEQ A;  4BX8 A;  4PS7 A;  3JQ1 A;  4EBA A;  4B0Z A;  4I6J A;  4HOU A;  5FQ4 A;  1UJK A;  5JHA A;  2AWI A;  3IHY A;  3RU0 A;  3CK7 A;  1PC2 A;  1UW4 B;  3IV0 A;  5FT9 A;  4PS3 A;  3CHQ A;  3LY9 A;  2WMN A;  5FWQ A;  1OWL A;  3ESK A;  3O48 A;  1LF8 A;  2VQ2 A;  4LRZ A;  3PUJ A;  4U04 A;  4KMO A;  1EYH A;  3LEW A;  4GZ6 A;  4ABN A;  3FEY A;  5C2Y A;  1OWP A;  3FU0 A;  4DPR A;  4GA0 A;  3B7S A;  3GZ1 A;  2AVP A;  5KJL A;  2X38 A;  4Y6C A;  3SI5 A;  3T5V A;  2XGS A;  3PS6 A;  4FLH A;  2OV8 A;  3TL5 A;  2WQ6 A;  3EIJ A;  4U0U A;  4GYY A;  2KCL A;  2VSO E;  2WVI A;  4HLE A;  4EQF A;  5HI7 A;  4Q69 A;  1HS6 A;  2L0I A;  3LY8 A;  3I3N A;  2HR2 A;  3FTV A;  4GCO A;  5JJ7 A;  1QZ2 A;  2EQX A;  2PZI A;  3L22 A;  4WNG A;  3ZPJ A;  4EZJ A;  4WWP A;  2CHX A;  1Y8M A;  1YA0 A;  3SBT B;  1H19 A;  5J90 A;  5LCW J;  2KZT B;  4P29 A;  1HO8 A;  3D9O A;  4URK A;  3WXX A;  3ZN3 A;  4FA6 A;  2HO1 A;  3QJZ A;  3CHR A;  5FQ7 A;  4LEU A;  3PEV B;  3RKV A;  4HOT A;  3KS2 A;  3I5P A;  3UUX A;  3RRU A;  4GA2 A;  2PQN A;  2IF4 A;  3HVE B;  3QK0 A;  4ILI A;  5LFA A;  4J6I A;  4FHJ A;  2WXJ A;  1EPU A;  5FZS A;  4BX9 A;  3ONL A;  4FJZ A;  1EDU A;  4U8H A;  2FI7 A;  1E7U A;  3APC A;  3ONK A;  5D0O D;  5FTP A;  4RG6 A;  4ANW A;  1SQM A;  2VYI A;  3D9P A;  1HFA A;  4UQZ A;  4C9B B;  3CVQ A;  2UY1 A;  3FUL A;  2L0T B;  5BW8 C;  1DNP A;  3R7Q A;  3FUH A;  3UT4 A;  2WXL A;  3FH8 A;  2VGY A;  1H0A A;  3LJ3 A;  3ASF A;  4IRU A;  3ZYQ A;  1JUQ A;  3LYA A;  3PE3 A;  2Y3A A;  4FC8 A;  3MV3 B;  2M63 A;  4I9E A;  4K03 A;  3S7J A;  2X6K A;  3CIA A;  2WQH A;  4GCN A;  3D9K A;  1Z6T A;  3CVU A;  4TUU A;  3ULQ A;  2WB2 A;  3ZFW A;  4GAA A;  2BTD A;  3JCK C;  3PRE A;  3VTX A;  3UPV A;  3FTZ A;  3GYZ A;  4MRU A;  4CDN A;  5HQ8 A;  4Q94 A;  2VTB B;  3R9A B;  1HG5 A;  4H7Y A;  5AJL A;  4TRQ A;  2WM9 A;  1E7V A;  2L6J A;  3D9M A;  4CDM A;  3P2B A;  2WXM A;  1BPO A;  2JLB A;  3L17 A;  4APF A;  4KZ0 A;  4N2Q A;  3MJW A;  4EZL A;  1MQS A;  4FHK A;  3RIB A;  4UWG A;  2CG2 A;  3ZW3 A;  2XPY A;  3OXG A;  2GRL A;  2V5F A;  3AS5 A;  4OVV A;  3Q47 B;  4J0U A;  4I43 A;  4A1S A;  2UWJ G;  2CHZ A;  3K9I A;  1VDY A;  2YHC A;  2LO6 A;  4JEU A;  4I6G A;  3AS4 A;  3LXU X;  4V3I A;  4IN3 B;  5AYW D;  2XGM A;  3CKB A;  4XI9 A;  1ELR A;  4R7L A;  4TV3 A;  1Z3X A;  1IQR A;  2WXN A;  1ZBP A;  4XIF A;  3B7U X;  2Y4U A;  5JJ6 A;  4G2V A;  1E8W A;  1OUV A;  4ATG A;  2WQ7 A;  4GU5 A;  1WAO 1;  3L08 A;  4BSX A;  3MZL B;  3G2V A;  4G23 A;  4JA7 A;  4CGW A;  4BY6 A;  2BF0 X;  1NA0 A;  1FCH A;  4FJY A;  2XQ0 A;  4WUY A;  4AV7 A;  5JJT A;  4ME2 A;  2HYZ A;  2J08 A;  3BG0 B;  3FUD A;  3B7R L;  1UJJ A;  4CCA A;  4WND A;  1INZ A;  3NZU A;  3ASH A;  3MCX A;  3ML8 A;  4N3C A;  5BNW A;  3RK6 A;  5J08 A;  4AXH A;  1H2V C;  4N3B A;  3SZ7 A;  2KCK A;  3O4Z A;  2LNI A;  5CMY A;  1Z3Y A;  3S7D A;  3MKQ A;  5E76 A;  4OYS A;  3EJN A;  3CK8 A;  3UT7 A;  3VTY A;  2IJG X;  2QFC A;  5FJY A;  5KJM A;  3PRZ A;  3ZHE A;  4WNE A;  2I1K A;  4CT4 A;  2J09 A;  2RG8 A;  1KT1 A;  4HOR A;  3Q15 A;  5AEN A;  1IYG A;  3D9I A;  4WWO A;  1E8Y A;  3IBE A;  4JXT A;  4ILG A;  3SFZ A;  3TGO A;  1ELK A;  1U3C A;  4PUC A;  4BFR A;  4UWK A;  2PL2 A;  3QWW A;  2FBN A;  4GZC A;  2GGF A;  1ZU2 A;  4AY6 A;  2KM4 A;  3CGH A;  3OAW A;  4GB9 A;  1TJF A;  3R7R A;  4CRW A;  2J49 A;  5LOZ A;  1ELW A;  2AXU A;  3CVX A;  2IOS A;  4AIF A;  5EKQ D;  4ANX A;  3LCA A;  1SZ9 A;  1OWM A;  3FWV A;  4JPS A;  1XGW A;  4JC8 A;  1PY1 A;  4I2W A;  4XE0 A;  4JHJ A;  4GA1 A;  4L1B A;  4H7X A;  3RO3 A;  2C0L A;  3T5X A;  1OWN A;  3LY7 A;  3T8M A;  2X6I A;  5CCM A;  2KC7 A;  2WXK A;  4UQY A;  1UN8 A;  2WXP A;  3KAE A;  3FTX A;  2WXR A;  4F53 A;  3PNT B;  2CFU A;  3GZ2 A;  4E6H A;  3FTU A;  4A55 A;  4GYW A;  1NA3 A;  3DPD A;  2J4B A;  4XI0 A;  5BT1 A;  5CHE E;  2J07 A;  1N54 A;  3QOU A;  4QFV A;  2J9Q A;  1EF1 C;  4DLQ A;  2DCP A;  4KT6 B;  5DBK A;  3FU3 A;  4YND A;  1N52 A;  1Y6I A;  4MKT A;  1TEZ A;  3IKO B;  4M3O A;  3QB2 A;  4WAF A;  3L6A A;  3HDX A;  2XRZ A;  1HX8 A;  4ACL A;  4KBQ A;  3PE4 A;  2VSX E;  4E85 A;  3MKR A;  3TXN A;  2AXV A;  3AS8 A;  4J8S A;  2V0P A;  3LVR E;  2WXQ A;  4RG9 A;  3SNX A;  4RVB A;  3U4T A;  3APD A;  1FVH A;  2JEK A;  4BT8 A;  3NQP A;  2VGX A;  4K0R A;  4I1A A;  4NQ0 A;  5G2N A;  4JZY A;  3LVQ E;  4L7T A;  3QWV A;  3VLD A;  1HU3 A;  2CG3 A;  2A4Z A;  2VSN A;  4YVO A;  2XCB A;  4PDX A;  3ZRH A;  2WXI A;  2XGO A;  4AOF A;  1KLX A;  4ACK A;  3EHN A;  3G2T A;  2BUG A;  5G55 A;  4EPZ A;  2L9B A;  4G26 A;  2J4D A;  1UG3 A;  1TJC A;  2WMO A;  3CHP A;  2WXH A;  2V4L A;  3D9J A;  3TJP A;  3OTN A;  2I1J A;  4ANV A;  4HFG A;  3U66 A;  4EBA G;  2FF4 A;  4GZ3 A;  4U0S A;  3TG4 A;  4ANU A;  3FH5 A;  2RD0 A;  3FUK A;  3CV0 A;  3CKC A;  1X5B A;  4C0M A;  3LKU A;  4XKC A;  5ANL A;  3CVP A;  4I17 A;  3FUE A;  2AW6 A;  3HIZ A;  5M72 A;  2XHE A;  4I2Z A;  5AJD A;  2DIW A;  4XKB A;  4BTA A;  2I6H A;  3CK9 A;  2UY1 B;  3NF1 A;  2YQ8 A;  3QDN A;  4IYP A;  4I1O B;  2YNQ A;  4KYO B;  3RRM B;  5E75 A;  5T3R A;  2CHW A;  1PAQ A;  4D10 C;  3FEX A;  3CVN A;  1HH8 A;  1QQE A;  1S0P A;  4DK5 A;  3CVY A;  5BV1 A;  3U64 A;  4RSY A;  4HOS A;  5AIJ A;  4BTB A;  4XZ4 A;  1U3D A;  4AM9 A;  3G2S A;  4N3A A;  2PM6 A;  3JUI A;  3PVL A;  5EX0 A;  3LS8 A;  3FDH A;  2X6F A;  4O6F A;  5A7D B;  2XRY A;  5BUZ A;  3SF4 A;  3FP3 A;  2PQR A;  5ARG A;  1HZ4 A;  3L13 A;  3G2U A;  2OND A;  4UI9 C;  3TG5 A;  5KJN A;  4AY5 A;  5LX8 A;  3SHF A;  3CQC B;  3DBS A;  5EDS A;  2ION A;  3S7F A;  3ZEF A;  5EX3 A;  1E8Z A;  2E2E A;  2VJ8 A;  1UN9 A;  4KVM A;  2FUL A;  3CHO A;  2CFZ A;  4JEH A;  5CMW A;  3LPZ A;  2GRM A;  4B89 A;  3PUK A;  3C98 A;  4L2Y A;  3U3W A;  1WY6 A;  4PS8 A;  1NZN A;  4FAD A;  4PH4 B;  2OVF A;  4GZ5 A;  2IOL A;  4N5C A;  3ZVV A;  1H2T C;  2I2O A;  1E90 A;  2R17 C;  2LSV A;  2LAH A;  1HF8 A;  4Q96 A;  2DBA A;  3CHM A;  4C0E A;  2FO7 A;  3FTW A;  3RJV A;  2KZT A;  4ILH B;  2P58 C;  2R5S A;  2YIN A;  3PDN A;  4CT0 A;  2C2L A;  2X3M A;  4A3T A;  4GPK A;  2IU1 A;  3UQ3 A;  2WPV A;  1HG2 A;  4DI4 A;  3KD7 A;  4G24 A;  4A3V A;  3I4R B;  5G05 C;  4GML A;  3BG1 B;  3CR3 A;  3MYV A;  4N39 A;  2XPI A;  4A1G A;  3HVE A;  4JHR A;  4IUL A;  3L16 A;  1HXI A;  3NZS A;  3ZGQ A;  4B94 A;  3BEE A;  4G1T A;  4XX5 A;  3MEK A;  3ZIM A;  1OWO A;  2MHK A;  4AVX A;  3VLF A;  3U9W A;  3ML9 A;  2X6H A;  3SBS A;  4BT9 A;  3MX3 A;  3Q4A B;  3Q49 B;  2NXP A;  3FHE A;  2XPZ A;  3FUN A;  4JL0 A;  4UWF A;  4UI9 K;  2IFU A;  5D0Q D;  3FY4 A;  3ZYM A;  4DJA A;  1JWG A;  3MKQ B;  4FP7 A;  3TAX A;  2NC9 A;  5KJK A;  1JWF A;  3UMV A;  5BPP A;  3QNK A;  4I9C A;  3FFL A;  5G04 J;  3FUM A;  3VLE A;  4F1S A;  3E4B A;  4NAC A;  1B89 A;  1W3B A;  1P5Q A;  3QAR A;  3ZHE B;  3MA5 A;  2A5U A;  3SD5 A;  3FU5 A;  2E0I A;  3OXL A;  3UX4 A;  2WXO A;  2IQC A;  3FUF A;  4G11 A;  4NRH B;  3S2A A;  4EEC A;  2OOE A;  4DLO A;  3IHV A;  4UWH A;  4YVQ C;  5FZQ A;  2VTB A;  4J8D A;  2XCC A;  3D3M A;  3FU6 A;  1H6K A;  4HS2 A;  2X6J A;  4JHK A;  3FH7 A;  2Y4T A;  2GW1 A;  5ARF A;  5A6C A;  2WXG A;  3B7T A;  3QAQ A;  2V8S E;  3I4G A;  5T4Y A;  1DVP A;  3QWP A;  3JYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...