3UT8A

Structural view of a non pfam singleton and crystal packing analysis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
TSLRDLIPKHKFDNSTIDQLCKLIDNEIEPIIFDLLKWLQDYNWPIAKDILPVVVLHQSIAMPHILTILQGNDIMWKYWVIKLMIPYLIYPNKQLVKSELERLSSLEIINEDIREIVNLSKDYLHFYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Structural view of a non pfam singleton and crystal packing analysis.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16804 DUF5071 Domain of unknown function (DUF5071)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.750 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ut8A00
3UT7A 3UT4A 3UT8A
chains in the Genus database with same CATH superfamily
4J8DA 4LRZA 2J8SD 3DEPA 3V79K 4MLPA 2E0IA 4CT0A 3ABLE 3ONLA 4UI9K 5FJYA 1PY1A 1EDUA 3S7JA 4A55A 4JHKA 1IXVA 3CHRA 1XGWA 3C3RA 4FHJA 3Q4AB 4JVSA 4K03A 2R02A 2AVPA 3MKRA 4GTSA 3ASFA 3UT7A 1HXIA 2BF0X 2V0PA 2BTDA 1N94A 4GTTA 5CRVA 4JZYA 5AJDA 1WY6A 2P9NG 5CMWA 3E34A 4DRXE 4EHMA 4WUYA 3KSQA 3MGBA 4XI9A 2AJAA 4N2QA 3D9OA 2L0TB 3FUMA 5JHAA 2H6FA 5FQ8A 1U3DA 2VGXA 4IYPA 4AEZC 3TWTA 4ZHBA 3OXFA 3D9NA 3G2VA 4F1SA 2IU1A 4NIKA 5KJKA 2XENA 3ZPJA 4WWPA 4LEUA 4Q69A 4UQZA 2GRRB 4AVXA 1E8ZA 5G55A 4GA0A 1MJ0A 3DEOA 4D10C 2VQ2A 3QAQA 3AU4A 2VSNA 3FDHA 3PS6A 3AAAC 4JA7A 1OWPA 4CDMA 2XS1A 3ZFWA 2HM8A 4O1OA 5CEAA 3EHMA 4HQDA 5AIJA 2X6JA 2GRLA 1UOHA 3DSSA 4LG6A 2IJGX 1JCQA 1TJCA 4JB8P 2V8SE 5LFAA 1BLXB 4DPRA 3ENEA 4ABNA 3NZSA 1TNZA 4GYYA 4WNFA 3CSFA 2AW6A 4TXRA 3FTUA 3QB2A 1LTXA 1Y8MA 4GZ5A 3HDXA 3SZ7A 3UKRG 3UI2A 3ABKE 2XS8A 5CEDB 3MA5A 3ZHEA 2RG8A 1HG5A 3PEUB 3SFZA 1H19A 4GTOA 4HOSA 2XHEA 3L6AA 2V4LA 2CHWA 4WNDA 4B8CB 3UUXA 4PH4B 3TWVA 3GZ2A 2WXNA 3APCA 4I6EA 3V31A 1SVXA 3ML9A 3RRNB 2IOLA 2UY1B 4L23A 2DYRE 4TRQA 1TN6A 3AG4E 4GMRA 4FJZA 2R2LA 4N3CA 2E2EA 5AN8A 1E7VA 3IKOB 3E37A 2J4BA 1X5BA 2OEWA 1OT8A 3PVLA 3VTYA 4B0ZA 1OXJA 4JW1A 3Q47B 5C2YA 5CCMA 2WMNA 3MJWA 2C2LA 3PH0C 3J5PA 2DIWA 4ACLA 4O6FA 3CQCB 3TL5A 4BERA 3L16A 4CEMA 3FTSA 3MV2B 3NB2A 1U2VG 4JD2G 1GW6A 4RVBA 3U66A 1MX4A 5AJLA 4E85A 5G04C 2CG2A 5BT1A 4K5AB 3FUNA 3G2UA 2MYOA 1N52A 5H7PA 3D9MA 2LAIA 5ENPD 4Q94A 4GTVA 1HH8A 3PZ1A 2JABA 2WXRA 3X2QE 3D9IA 3HXDA 4OAUC 1ELKA 2OEVA 5EX3A 3ULQA 1NFIE 2XGOA 3ASOE 3Q75A 2F8XK 3B7RL 4GPKA 2RD0A 5FQ7A 3NQPA 1E96B 3V30A 3FULA 2QFCA 3FTZA 4U7EB 4NACA 2GRPB 2VSYA 4U07A 3AJIA 1IHGA 4M3OA 4KVMA 3T5XA 2HYZA 5EX0A 2R59A 2DCPA 1UJKA 3CK7A 2YHEA 3Q73A 2LXLA 5BXOA 3L22A 4GZCA 5BXUA 4W9RA 4C48B 3LVRE 4EZKA 2PQRA 1SA4A 4JC8A 1OCOE 1OUVA 3JQ1A 3TWRA 2VJ8A 3S2AA 1FVHA 4WWNA 3UQ3A 3QARA 5A23A 3DPDA 4B8AA 2R5SA 2RFAA 3FU3A 1OCZE 1DNPA 4X8QA 3S7DA 2KATA 1H6KA 1HE8A 3QNKA 3GZ1A 3KAEA 4GAAA 3SO8A 3L13A 3DSVA 3CHMA 2FBNA 3LYAA 3SI5A 5KJLA 2HR2A 2KZTB 2J07A 3T9KA 3RJVA 4CRWA 4BWRA 2ZGDA 2EIJE 3LY8A 3I5PA 1IHBA 4TUUA 4CYMD 2XCBA 4HFGA 2A4ZA 3FY4A 3C3OA 4GU5A 4DI3A 2VGEA 4A3VA 2QY7A 3HXFA 1AP7A 3D9JA 2FF4A 3ZIMA 5AARA 5LP0A 3Q9UC 5ENTD 4CT4A 5BV0A 2X3MA 4OVVA 1UW4B 5CERB 3MZLB 4BSZB 3PRZA 3NOGD 2MRIA 1N4QA 5JHBA 2LUHA 3MKQB 4U63A 4FU3A 2NSZA 4YDWA 4U8YD 3CVWA 5KNHD 3PZDA 3CLJA 2GROB 5T3RA 4F6RD 3SF4A 1S0PA 4L1BA 1TR4A 5EN5D 5FIOA 3L54A 3KEAA 3ASNE 2XGMA 3L17A 2PNNA 2ETCA 4ANVA 3R9AB 2V5FA 4YVOA 2WB2A 2I6HA 4DK5A 3ZYLA 4AIFA 4ZFHA 3FUJA 1YYHA 2M63A 1KZOA 3JQ0A 4F1PA 1E8YA 2WXQA 3K9IA 3DPYA 1MYOA 4MS6A 4BFRA 4GA1A 4ILIA 4GTPA 4UWFA 4GZ3A 2IFUA 3IBEA 3ZGQA 5JMND 4DLQA 2ZGGA 4TXPA 4DJAA 3LCAA 4U95D 3UT4A 5C1DA 3EHNA 3EU9A 4AY6A 3NAWA 2R05A 3AG2E 3AS5A 2CG3A 1K8KG 4LNGA 3BG0B 4UUCA 3EHRA 1MX2A 1W3BA 1BI7B 4I2WA 2C0LA 2XZTG 2Y4TA 4UWGA 3TWUA 2KXPC 3DSWA 3HYMB 3P2BA 3VLFA 3T5VA 3VLDA 3KSLA 3I3NA 4C0MA 3RO3A 1OWOA 3P1UA 2LO6A 4K5BA 4EECA 4KBQA 2WXHA 1G3NB 1H0AA 3AS8A 4HB5A 4MRUA 4HS2A 3UM3A 1OWMA 2WQ6A 2EIKE 3U4TA 1N95A 1HZ4A 1N0QA 2L6JA 2HO1A 4GTQA 4BY6A 1MQSA 4BX9A 1IYGA 4KYOB 2EILE 1YA0A 1PAQA 4KZCA 2VTBB 5BPPA 1MZCA 4HOTA 4I6JA 4KXKB 3LVQE 1SW6A 2ZIRA 4G26A 5CBOA 2CHXA 1Q2ZA 3LJ3A 3CKCA 2J49A 1BU9A 3ZRHA 1K3ZD 3PNLB 1KPSB 2X6IA 2Y4UA 3G2TA 3B95A 1KT0A 1Z5SC 4HRMB 4AP2A 1HFAA 2YNQA 3FUIA 3TXMA 3RRUA 2GRNB 2IONA 5BW8C 5FZRA 3GYZA 5FQ6A 5G05J 4U0UA 5G05C 4WNGA 5E75A 3DSTA 4G23A 2H6GA 3UIOC 5FQ4A 3KEZA 4DLOA 2P9LG 1HG2A 5LOZA 1LD7A 1RW2A 2VGYA 2XPZA 3APDA 3DRAA 2UY1A 5J90A 2KM4A 4YVQC 1N4PA 4L2LA 1Z3YA 2ETAA 2PQNA 1EF1C 3ZEFA 1TYQG 5HQ8A 3C98A 5E76A 3DXKG 3TXNA 4AY5A 2OVBA 2MHKA 3S7FA 3FU6A 3ISMC 4RSYA 3ZUVB 4UWHA 3MYVA 2DVWA 1BI8B 1O1TA 3PZ4A 4HOQA 2PZIA 2WXFA 3AS4A 3TWSA 2BEDA 4N3AA 5BNWA 2A5UA 4OVUA 4DUIA 1N4RA 2ILRA 3O4ZA 1LF8A 4EBAG 4GA2A 3TJPA 2GW1A 3JYSA 3HVEB 1HU3A 5B1BE 1N11A 2V5QC 4L2YA 3OXLA 3CHOA 1JCRA 2VGXB 2J9QA 3CHQA 4N5CA 3PEVB 3QDNA 4U0SA 4FADA 4I43A 1E7UA 2LSUA 2OV8A 4XX5A 1V55E 1XNFA 3ONKA 4YDOA 4G11A 4HOUA 2PL2A 2GRMA 3ZU7B 5J08A 3IHVA 2IO3C 4IRUA 3F6QA 2WXIA 3FTVA 3UM2A 3SHFA 3UM0A 4BTBA 1YCSB 2P9SG 3ZYMA 3Q78A 4JA9A 4KMOA 3D3MA 2P9UG 4PDXA 3T8MA 3CKBA 2J08A 2Y69E 3FEXA 3QC1A 1NZNA 4WAFA 3NF1A 4BTAA 2AXZA 4DI4A 4XKCA 3SBSA 1H6PA 5EYPF 5AQ7A 2V4HC 3LXUX 4I9CA 3MV3B 2AXVA 3CIAA 3WG7E 1S63A 5IY5E 3G2WA 4RG9A 5LCWJ 5LCWC 2I2OA 5ENNA 3ZHEB 2WPVA 5D66A 1AWCB 5KWDA 3CV0A 2WXLA 1N9AA 4HI9A 2VSXE 3U3WA 5KJNA 1WG0A 2MOWA 2P9IG 2X6KA 1JUQA 2XEEA 2RFMA 4FP7A 5T4YA 3DSXA 3D9LA 2XPIA 4GZ6A 2KBXA 3Q9NC 5DIZA 3T8KA 4XZ4A 2PM7A 2Q7FA 2IEJA 3TWWA 1IQRA 4FC8A 4ATZD 2XRZA 4G8LA 4JL0A 1N4SA 4TUMA 5FZSA 5KJMA 1FT1A 4U8VD 5AQAA 2DZNA 4B89A 2DZOA 2EIME 4UQXA 2GGFA 1K1AA 2WXPA 4BESA 2Y1LE 3SGHA 3SFYA 4GCOA 2VSOE 4PS7A 3PUJA 3UPVA 4NRHB 2NYJA 3FP3A 3LS8A 5HKPA 4Q96A 3HXCA 3BEEA 4JEHA 4GCNA 4BT9A 1HS6A 4G2VA 4XKBA 2FI7A 4URKA 4I6GA 4BX8A 4KVOA 2WQ7A 4HXIA 1KT1A 3TWQA 4BSXA 1Z6TA 3SQVA 3EIJA 4GMLA 3PE3A 3KD7A 2DBAA 3ABME 2JEKA 2ZU6B 3J5QB 1Z3XA 3CVLA 4O60A 2I1KA 5CECB 4BETA 2WM9A 1LD8A 1DC2A 2F0YA 3DBSA 5JJ7A 3CHPA 2KCKA 4LERA 2L0IA 3ESKA 4Y6CA 2IQCA 3D9HA 4JHJA 3OXGA 2KC7A 2YHCA 2J09A 5ITZF 3ASDA 4UWLA 1BPOA 3FUEA 3QOUA 2XGSA 1U3CA 5JJ6A 3Q15A 4R7LA 2WXMA 5CRUA 3FUKA 4EBAA 3LPZA 3RIBA 2PM6A 3R7QA 4HI8A 4LCTA 4O1PA 1HF8A 1D9SA 2WQHA 4CDRA 3W9GA 2FEZA 3ESLA 1QYMA 2XPYA 3RKVA 1A5EA 3CVVA 1X81A 3ZVVA 5M72A 3UT8A 3HHMA 3Q7AA 1TNBA 2LAHA 3FTXA 3W9FA 4U96D 2FO7A 3DWLG 2WVIA 3MCXA 3FU5A 1ELWA 1MX6A 5B3SE 3RRMB 5CMYA 1WAO1 4BEPA 5JA4D 4CZ2D 3L08A 5CBNA 3UMVA 3ULYA 4NQ0A 2VTBA 3PREA 4ANUA 4M7CA 3WXXA 4JEUA 5EIBE 3CVNA 3IV0A 5EIDA 4GTMA 4F3VA 1N0RA 2WMOA 2QYJA 4Z68A 1O5MA 1TN8A 5FTPA 4GZDA 3GZSA 4FHKA 3FU0A 3D9PA 4V3IA 3E33A 1TNYA 2P9PG 2C0MA 3CVUA 2WXJA 1E8WA 4P29A 4HRLA 2XEVA 3FH5A 1N54A 2AWIA 3NBNB 1E8XA 1FVFA 5AAOA 4C0EA 4ANWA 1NI1A 4YNDA 3CGHA 5HI7A 3R9MA 4B93B 1EYHA 3EUVA 4HBDA 1NA0A 5FWQA 3CK9A 3ZN3A 4ATGA 4UQYA 3Q49B 4AJWA 3FEYA 1L5JA 5ARFA 3RAUA 5EILA 3PUKA 1D8EA 1JWGA 3CR3A 2OOEA 2LNIA 2RKKA 2CHZA 3B7TA 3CQGB 3FTWA 3LEWA 4XE0A 4G1TA 1H2TC 1IQUA 3DXMG 3SNXA 3PZ2A 2Y3AA 4GYOA 4PUCA 2X38A 4KZ0A 4ILGA 2BKGA 3LY7A 1FPPA 3SY2A 4DX7D 1A17A 3FUDA 4PS3A 4RLYA 1ELRA 2X6HA 2B0OE 5AENA 4U04A 1QNFA 2CFUA 4F53A 4FJYA 3ML8A 2A5EA 1H6OA 3HVEA 1DCQA 2JLBA 4AM9A 4HRNA 3ZNGA 1MHQA 1ZBPA 4GMJA 3TGOA 3E4BA 1Y6IA 1NP7A 4FLBA 5AQBA 4XEIG 1B89A 2I1JA 2KCLA 5ENOD 1ZU2A 2XEHA 3LDZA 3EDTB 2XCCA 5G2NA 3U64A 3UINC 5HRYA 4N5QA 4AOFA 3HXEA 5D0OD 3VTXA 3TAXA 2NXPA 2LXMA 1SQMA 3APFA 2R17C 5ARGA 3NZUA 3UXGA 3TG5A 5JJTA 4DX6D 1VDYA 3B13A 4RG6A 4XI0A 5A6CA 3AU5A 4IN3B 4Y6WA 5B1AE 2L6BA 2L9BA 3RU0A 4NURA 2QC9A 4HLLA 1H2VC 4HVBA 2LSVA 3VLEA 3ZYKA 3CHSA 3FHEA 3B7SA 3FH7A 4J6IA 5ENRD 3V2OA 1S70B 3BQOA 1TNUA 4DX5D 3IHYA 2XQ0A 3ZXPA 1KZPA 1FCHA 3EIQC 4J8YA 2FO1E 5AQ9A 2OVFA 4U0ZA 1WM5A 3B7UX 2CFZA 3E30A 4APFA 2ZXWE 5BUZA 4YDYA 1HO8A 3TWXA 2UWJG 3NOCD 2X6FA 4CGVA 3O48A 1OWLA 3C3QA 4F7AA 5AYWD 2YQ8A 4J8EA 2XZDG 3CSTA 3U9WA 1V54E 2DYSE 1OY3D 2Y0BG 4L9PA 2IY0C 4UWKA 1OCRE 2F37A 2EINE 1BD8A 3MEKA 4KT6B 2XRYA 3QWPA 2HE0A 2P58C 3TG4A 2ONDA 1SZAA 3LJNA 2H6HA 2IO2C 5ANRA 4N3BA 4J8SA 3BUAA 3RO2A 3RSEG 4J8FA 5EDSA 4N2SA 4A1SA 3JUIA 4EZJA 2ETBA 4H7XA 3JXIA 1KLXA 3KS2A 1NA3A 2I9CA 4MBGA 4LSZE 2BKKB 3IXEA 3Q79A 5G04J 3RK6A 3LKUA 3PZ3A 3FH8A 3HIZA 3C5RA 2IF4A 3JXJA 3L82A 4FA6A 3OTNA 3FFLA 3PDNA 5KNGA 3URZA 1SA5A 4JHRA 2P2CP 1UN9A 3Q7FA 2KZTA 3BG1B 1INZA 1TJFA 2H6IA 2IOSA 2WXKA 2AXUA 2DWZA 4A1GA 3V2XA 2YINA 5FINA 4QQIA 4OYSA 1OCCE 3UIPC 3Q5MA 4CGWA 4U8HA 3QWVA 4FLHA 4A3TA 2KCVA 3FUHA 1H2UA 3D9KA 3UTMA 1SZ9A 4N39A 3ASGA 4J7WA 4G24A 5ENQD 4XIFA 3ZW3A 5FT9A 1TEZA 4QFVA 4A63B 4LNBA 1K1BA 1NL4A 1JPLA 3MKQA 1EPUA 1UN8A 1ZB1A 5ENSD 4GB9A 1S64A 3QJZA 4E6HA 5A7DB 2P9KG 4OAVB 1JWFA 4EPZA 3QWWA 4I17A 5DBKA 3GW4A 4K5CA 3G2SA 3I4RB 3AG1E 4GPMA 3CK8A 4JXTA 2EQXA 5ANLA 1RZ4A 2NC9A 4MKTA 4TXQA 1TNOA 5FZQA 1QQEA 1JCSA 4LUNU 1FT2A 1O1RA 4HNAD 4HLEA 5KCMA 4TV3A 4L7TA 4FULA 3R7RA 3CVQA 3S7BA 4WNEA 2OCCE 1E90A 4CCAA 1DCEA 2WXGA 3FWVA 1DVPA 4B94A 4GYWA 2BUGA 3EJNA 4G25A 1PC2A 5EYLA 3ULEG 4BT8A 4C9BB 4ACKA 3FUFA 3B7BA 5T8IA 2F8YA 2FULA 4I1AA 3ZXSA 1OWNA 3JCKC 4PS8A 4RQIA 1HX8A 4DX1A 3CVPA 3CEQA 3ZKJA 3PE4A 5CCLA 5LX8A 3SBTB 4ILHB 3N71A 3UKUG 2VYIA 3JUEA 4UI9J 1YMPA 4H7YA 4UI9C 4DX2A 3HXBA 3C72A 1UG3A 4EQFA 2R03A 3UM1A 1P5QA 2B6CA 4J0UA 1TN7A 2WXOA 3LY9A 4APOA 2ZISA 3L9TA 2GRQB 2J4DA 4LNUD 4K0RA 1QBQA 4ME2A 3CVXA 4ANXA 1IKND 5BV1A 3I4GA 1QZ2A 3SD5A 3QK0A 2QYUA 3PNTB 5D0QD 2QZAA 3CVYA 3AG3E 1D8DA 3QKYA 4I9EA 3E32A 4G8KA 4WWOA 3EU5A 4AV7A 4I2ZA 3ZYQA 4EZLA 1UJJA 4JPSA 3UX4A 3MX3A 5HS0A 4CDNA 5KBAA 3OAWA 1WDYA 3IEGA 5D2MC 5EKQD 4IULA 3SFXA 4I1OB 3HRAA 3ASHA 4YDEA 5CHEE 3BU8A 4HORA 4AXHA 4I1MA 3HG0D 3FTYA 1O1SA 3EHQA 4GTRA 3DSUA
chains in the Genus database with same CATH topology
4HVBA 2LSVA 2MOWA 2X6KA 1JUQA 1UW4B 4J8DA 3VLEA 3ZYKA 3CHSA 4FP7A 4LRZA 5T4YA 3MZLB 3FHEA 3B7SA 3PRZA 3D9LA 3FH7A 4J6IA 2XPIA 4MLPA 2E0IA 4GZ6A 2MRIA 5DIZA 5JHBA 4XZ4A 4CT0A 2PM7A 2Q7FA 3MKQB 4U63A 4FU3A 2NSZA 3IHYA 2XQ0A 1IQRA 3ONLA 3CVWA 3PZDA 4FC8A 4UI9K 5FJYA 2XRZA 1FCHA 1EDUA 1PY1A 3CLJA 3EIQC 3S7JA 4A55A 4JHKA 3CHRA 5T3RA 1XGWA 4JL0A 4FHJA 3Q4AB 4JVSA 2OVFA 1S0PA 4L1BA 4U0ZA 5FZSA 3SF4A 1WM5A 5KJMA 4K03A 3B7UX 2AVPA 3L54A 2CFZA 4B89A 4APFA 3MKRA 2XGMA 3ASFA 3L17A 3UT7A 4UQXA 2GGFA 5BUZA 1HXIA 2WXPA 1HO8A 2BF0X 2V0PA 2BTDA 2UWJG 3SGHA 2X6FA 4ANVA 3R9AB 4CGVA 2V5FA 3O48A 4YVOA 4GCOA 1OWLA 2WB2A 2VSOE 4PS7A 4F7AA 2I6HA 5AYWD 3PUJA 4DK5A 2YQ8A 4J8EA 4JZYA 5AJDA 3ZYLA 4AIFA 3UPVA 4NRHB 1WY6A 3FUJA 3CSTA 3FP3A 3U9WA 5CMWA 3LS8A 4WUYA 2M63A 3MGBA 4Q96A 4XI9A 3JQ0A 4N2QA 3D9OA 4UWKA 2L0TB 3BEEA 3FUMA 4JEHA 5JHAA 5FQ8A 4GCNA 1E8YA 1U3DA 2VGXA 4IYPA 4AEZC 2WXQA 3K9IA 3OXFA 3D9NA 3G2VA 4F1SA 4BT9A 2IU1A 1HS6A 4MS6A 4BFRA 4GA1A 4ILIA 3MEKA 4G2VA 4KT6B 4XKBA 2XRYA 2FI7A 4UWFA 3QWPA 4URKA 4I6GA 4GZ3A 5KJKA 4BX8A 2IFUA 2P58C 3IBEA 4KVOA 3TG4A 3ZGQA 2WQ7A 2ONDA 4HXIA 1KT1A 4DLQA 4BSXA 1SZAA 3ZPJA 4WWPA 4LEUA 1Z6TA 4Q69A 4DJAA 3EIJA 4UQZA 3LCAA 4AVXA 4GMLA 3PE3A 3UT4A 5ANRA 4N3BA 4J8SA 3RO2A 1E8ZA 3KD7A 2DBAA 5C1DA 4J8FA 5EDSA 2JEKA 5G55A 4GA0A 2ZU6B 3EHNA 4A1SA 4N2SA 3JUIA 4EZJA 1Z3XA 3CVLA 2I1KA 4D10C 2VQ2A 4H7XA 4AY6A 3QAQA 3AU4A 1KLXA 2VSNA 3KS2A 1NA3A 3FDHA 2I9CA 2WM9A 3PS6A 4JA7A 1OWPA 4CDMA 3DBSA 3AS5A 5G04J 2CG3A 3RK6A 3BG0B 5JJ7A 3ZFWA 3CHPA 2KCKA 3LKUA 3FH8A 2HM8A 1W3BA 3EHMA 3HIZA 4LERA 5AIJA 2X6JA 2L0IA 2IF4A 2GRLA 4I2WA 4FA6A 2C0LA 3ESKA 2IJGX 1TJCA 4Y6CA 2IQCA 2Y4TA 2V8SE 3OTNA 4UWGA 5LFAA 3FFLA 3HYMB 4DPRA 3VLFA 3PDNA 3P2BA 3T5VA 3VLDA 3ENEA 3URZA 4ABNA 4JHJA 4JHRA 3NZSA 3I3NA 1UN9A 3OXGA 2KC7A 4C0MA 2KZTA 4GYYA 4WNFA 3CSFA 3RO3A 2AW6A 2YHCA 1OWOA 2J09A 3FTUA 3BG1B 3P1UA 1INZA 1TJFA 2LO6A 3ASDA 4UWLA 3QB2A 4EECA 2IOSA 1Y8MA 1BPOA 2WXKA 4GZ5A 4KBQA 2AXUA 3FUEA 3QOUA 2XGSA 3HDXA 2WXHA 3SZ7A 1H0AA 1U3CA 3AS8A 4A1GA 5JJ6A 4MRUA 3Q15A 4HS2A 2YINA 4R7LA 2WXMA 1OWMA 2WQ6A 3FUKA 4EBAA 3LPZA 3RIBA 3U4TA 4OYSA 2PM6A 3R7QA 3Q5MA 4LCTA 4CGWA 1HZ4A 1HF8A 4U8HA 3MA5A 3ZHEA 2L6JA 2RG8A 2HO1A 1HG5A 3QWVA 2WQHA 3PEUB 4CDRA 4BY6A 1MQSA 4FLHA 4BX9A 3SFZA 1IYGA 1H19A 2FEZA 2KCVA 3FUHA 1H2UA 3D9KA 3ESLA 4A3TA 1SZ9A 4HOSA 4KYOB 4N39A 2XHEA 3ASGA 3L6AA 1YA0A 1PAQA 2XPYA 4KZCA 2V4LA 2CHWA 4G24A 3RKVA 4WNDA 4B8CB 2VTBB 5BPPA 3CVVA 4XIFA 3UUXA 3ZW3A 4HOTA 3ZVVA 4PH4B 5FT9A 5M72A 1TEZA 4QFVA 3GZ2A 2WXNA 3APCA 4I6JA 4KXKB 3UT8A 3HHMA 4I6EA 3LVQE 4G26A 1JPLA 2CHXA 3MKQA 3ML9A 3RRNB 2LAHA 1EPUA 2IOLA 3FTXA 3LJ3A 2UY1B 4L23A 1UN8A 3CKCA 4TRQA 4FJZA 4N3CA 2J49A 2E2EA 3ZRHA 2FO7A 3PNLB 2WVIA 3MCXA 2X6IA 2Y4UA 3G2TA 1E7VA 3FU5A 3IKOB 4GB9A 1KT0A 2J4BA 1ELWA 1X5BA 3RRMB 3QJZA 4AP2A 4E6HA 1HFAA 3PVLA 5A7DB 2YNQA 3FUIA 5CMYA 3TXMA 3VTYA 3RRUA 1WAO1 1JWFA 4B0ZA 4EPZA 4JW1A 3QWWA 4I17A 5DBKA 3GW4A 2IONA 3Q47B 5C2YA 3L08A 5BW8C 5CCMA 5FZRA 3GYZA 2WMNA 5FQ6A 5G05J 4U0UA 3UMVA 3MJWA 5G05C 3G2SA 4NQ0A 2C2LA 4WNGA 3I4RB 2VTBA 3PREA 3PH0C 3CK8A 5E75A 4JXTA 2EQXA 2DIWA 5ANLA 4G23A 4ACLA 4ANUA 4O6FA 5FQ4A 3KEZA 3WXXA 4JEUA 4DLOA 3CQCB 3CVNA 3TL5A 3L16A 2NC9A 4CEMA 4MKTA 3FTSA 3IV0A 3MV2B 1HG2A 5LOZA 1QQEA 5FZQA 4F3VA 2VGYA 1GW6A 2XPZA 4RVBA 3APDA 2WMOA 3U66A 4LUNU 2UY1A 5AJLA 4E85A 5J90A 4HLEA 2KM4A 5G04C 2CG2A 4YVQC 5KCMA 4TV3A 4L7TA 4FULA 1Z3YA 4L2LA 3R7RA 5BT1A 2PQNA 3FUNA 4GZDA 5FTPA 3G2UA 1EF1C 1N52A 3GZSA 3ZEFA 3CVQA 4FHKA 3FU0A 3D9MA 3S7BA 3D9PA 2LAIA 5HQ8A 3C98A 5E76A 3TXNA 4WNEA 4Q94A 4AY5A 4V3IA 1HH8A 1E90A 4CCAA 2WXGA 3FWVA 2C0MA 3CVUA 1DVPA 2WXJA 1E8WA 2OVBA 4P29A 4B94A 2MHKA 2WXRA 3S7FA 2XEVA 3FH5A 3FU6A 1N54A 4GYWA 3D9IA 4RSYA 2AWIA 2BUGA 3EJNA 1ELKA 4G25A 1E8XA 4UWHA 1PC2A 3MYVA 1FVFA 5EX3A 4BT8A 3ULQA 4C0EA 4C9BB 4ANWA 4YNDA 4ACKA 2XGOA 3CGHA 5HI7A 3B7RL 4GPKA 1EYHA 4HOQA 3FUFA 1NA0A 5T8IA 2RD0A 2PZIA 5FWQA 3CK9A 2WXFA 3ZN3A 3AS4A 5FQ7A 3NQPA 2FULA 4I1AA 3ZXSA 4UQYA 4ATGA 1E96B 1OWNA 3JCKC 3Q49B 4PS8A 1HX8A 4N3AA 3CVPA 2QFCA 3CEQA 3FTZA 2A5UA 3FULA 4AJWA 5BNWA 3FEYA 4OVUA 1L5JA 2ILRA 3O4ZA 3PE4A 5ARFA 5CCLA 1LF8A 5LX8A 3SBTB 4ILHB 3N71A 4EBAG 4GA2A 3PUKA 3TJPA 4NACA 4U07A 2VSYA 2GW1A 2VYIA 3JYSA 1JWGA 3CR3A 1IHGA 2OOEA 3HVEB 4M3OA 1HU3A 4UI9J 2LNIA 4KVMA 4H7YA 4UI9C 3T5XA 2HYZA 5EX0A 2R59A 2CHZA 2DCPA 3OXLA 4L2YA 3B7TA 1UJKA 3CQGB 3CHOA 3FTWA 3CK7A 3LEWA 4XE0A 1UG3A 2YHEA 2VGXB 2J9QA 3CHQA 4N5CA 3PEVB 4G1TA 3QDNA 3L22A 4U0SA 4GZCA 1H2TC 4EQFA 1IQUA 1P5QA 4FADA 4I43A 1E7UA 2LSUA 4W9RA 3SNXA 3LVRE 4J0UA 2OV8A 4XX5A 1XNFA 2WXOA 4EZKA 2Y3AA 4GYOA 2PQRA 4PUCA 2X38A 3LY9A 4APOA 3ONKA 4ILGA 4JC8A 4KZ0A 1OUVA 3JQ1A 3LY7A 4G11A 4HOUA 1A17A 3FUDA 4PS3A 1ELRA 2VJ8A 2PL2A 2GRMA 3S2AA 2X6HA 5J08A 3IHVA 1FVHA 2J4DA 5AENA 4U04A 4WWNA 1QNFA 4IRUA 2CFUA 4F53A 4FJYA 3UQ3A 3ML8A 3QARA 5A23A 4K0RA 3DPDA 4B8AA 2R5SA 3HVEA 4ME2A 2WXIA 3FTVA 3FU3A 3CVXA 3SHFA 4ANXA 4BTBA 1DNPA 2JLBA 5BV1A 3S7DA 2KATA 1H6KA 1HE8A 3I4GA 3GZ1A 3KAEA 3QNKA 4GAAA 3ZYMA 4JA9A 4AM9A 1QZ2A 1MHQA 3SD5A 3L13A 4KMOA 3D3MA 3QK0A 3CHMA 2FBNA 3LYAA 3PNTB 4PDXA 3SI5A 1ZBPA 5D0QD 4GMJA 3TGOA 3CVYA 3T8MA 3CKBA 3E4BA 1Y6IA 1NP7A 4FLBA 3QKYA 2J08A 3FEXA 3QC1A 4I9EA 1NZNA 4WAFA 3NF1A 4BTAA 5KJLA 2HR2A 2AXZA 4WWOA 1B89A 2KZTB 4DI4A 2I1JA 2J07A 4XKCA 4AV7A 2KCLA 1ZU2A 3RJVA 3SBSA 4CRWA 4I2ZA 3LDZA 3ZYQA 4EZLA 4BWRA 1UJJA 3EDTB 2XCCA 4JPSA 3LY8A 3UX4A 3I5PA 4TUUA 3MX3A 3LXUX 5G2NA 4I9CA 4CDNA 3OAWA 3MV3B 3IEGA 3U64A 2XCBA 5EKQD 4IULA 2AXVA 4HFGA 4I1OB 4AOFA 3CIAA 3G2WA 2A4ZA 3FY4A 4GU5A 4RG9A 5D0OD 5LCWJ 3VTXA 4DI3A 3TAXA 2NXPA 4A3VA 5LCWC 1SQMA 3APFA 2I2OA 2QY7A 3ASHA 2R17C 5ARGA 3D9JA 3NZUA 5ENNA 3TG5A 5CHEE 3ZHEB 5JJTA 1VDYA 2WPVA 2FF4A 3B13A 4AXHA 3ZIMA 4HORA 4RG6A 4XI0A 4I1MA 5A6CA 5LP0A 3FTYA 3AU5A 4IN3B 3CV0A 4Y6WA 2WXLA 2L9BA 3RU0A 4NURA 4CT4A 5BV0A 2VSXE 3U3WA 2X3MA 4OVVA 5KJNA 1H2VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT7 A;  3UT4 A;  3UT8 A; 
#chains in the Genus database with same CATH topology
 4J8D A;  4LRZ A;  2J8S D;  3DEP A;  3V79 K;  4MLP A;  2E0I A;  4CT0 A;  3ABL E;  3ONL A;  4UI9 K;  5FJY A;  1PY1 A;  1EDU A;  3S7J A;  4A55 A;  4JHK A;  1IXV A;  3CHR A;  1XGW A;  3C3R A;  4FHJ A;  3Q4A B;  4JVS A;  4K03 A;  2R02 A;  2AVP A;  3MKR A;  4GTS A;  3ASF A;  3UT7 A;  1HXI A;  2BF0 X;  2V0P A;  2BTD A;  1N94 A;  4GTT A;  5CRV A;  4JZY A;  5AJD A;  1WY6 A;  2P9N G;  5CMW A;  3E34 A;  4DRX E;  4EHM A;  4WUY A;  3KSQ A;  3MGB A;  4XI9 A;  2AJA A;  4N2Q A;  3D9O A;  2L0T B;  3FUM A;  5JHA A;  2H6F A;  5FQ8 A;  1U3D A;  2VGX A;  4IYP A;  4AEZ C;  3TWT A;  4ZHB A;  3OXF A;  3D9N A;  3G2V A;  4F1S A;  2IU1 A;  4NIK A;  5KJK A;  2XEN A;  3ZPJ A;  4WWP A;  4LEU A;  4Q69 A;  4UQZ A;  2GRR B;  4AVX A;  1E8Z A;  5G55 A;  4GA0 A;  1MJ0 A;  3DEO A;  4D10 C;  2VQ2 A;  3QAQ A;  3AU4 A;  2VSN A;  3FDH A;  3PS6 A;  3AAA C;  4JA7 A;  1OWP A;  4CDM A;  2XS1 A;  3ZFW A;  2HM8 A;  4O1O A;  5CEA A;  3EHM A;  4HQD A;  5AIJ A;  2X6J A;  2GRL A;  1UOH A;  3DSS A;  4LG6 A;  2IJG X;  1JCQ A;  1TJC A;  4JB8 P;  2V8S E;  5LFA A;  1BLX B;  4DPR A;  3ENE A;  4ABN A;  3NZS A;  1TNZ A;  4GYY A;  4WNF A;  3CSF A;  2AW6 A;  4TXR A;  3FTU A;  3QB2 A;  1LTX A;  1Y8M A;  4GZ5 A;  3HDX A;  3SZ7 A;  3UKR G;  3UI2 A;  3ABK E;  2XS8 A;  5CED B;  3MA5 A;  3ZHE A;  2RG8 A;  1HG5 A;  3PEU B;  3SFZ A;  1H19 A;  4GTO A;  4HOS A;  2XHE A;  3L6A A;  2V4L A;  2CHW A;  4WND A;  4B8C B;  3UUX A;  4PH4 B;  3TWV A;  3GZ2 A;  2WXN A;  3APC A;  4I6E A;  3V31 A;  1SVX A;  3ML9 A;  3RRN B;  2IOL A;  2UY1 B;  4L23 A;  2DYR E;  4TRQ A;  1TN6 A;  3AG4 E;  4GMR A;  4FJZ A;  2R2L A;  4N3C A;  2E2E A;  5AN8 A;  1E7V A;  3IKO B;  3E37 A;  2J4B A;  1X5B A;  2OEW A;  1OT8 A;  3PVL A;  3VTY A;  4B0Z A;  1OXJ A;  4JW1 A;  3Q47 B;  5C2Y A;  5CCM A;  2WMN A;  3MJW A;  2C2L A;  3PH0 C;  3J5P A;  2DIW A;  4ACL A;  4O6F A;  3CQC B;  3TL5 A;  4BER A;  3L16 A;  4CEM A;  3FTS A;  3MV2 B;  3NB2 A;  1U2V G;  4JD2 G;  1GW6 A;  4RVB A;  3U66 A;  1MX4 A;  5AJL A;  4E85 A;  5G04 C;  2CG2 A;  5BT1 A;  4K5A B;  3FUN A;  3G2U A;  2MYO A;  1N52 A;  5H7P A;  3D9M A;  2LAI A;  5ENP D;  4Q94 A;  4GTV A;  1HH8 A;  3PZ1 A;  2JAB A;  2WXR A;  3X2Q E;  3D9I A;  3HXD A;  4OAU C;  1ELK A;  2OEV A;  5EX3 A;  3ULQ A;  1NFI E;  2XGO A;  3ASO E;  3Q75 A;  2F8X K;  3B7R L;  4GPK A;  2RD0 A;  5FQ7 A;  3NQP A;  1E96 B;  3V30 A;  3FUL A;  2QFC A;  3FTZ A;  4U7E B;  4NAC A;  2GRP B;  2VSY A;  4U07 A;  3AJI A;  1IHG A;  4M3O A;  4KVM A;  3T5X A;  2HYZ A;  5EX0 A;  2R59 A;  2DCP A;  1UJK A;  3CK7 A;  2YHE A;  3Q73 A;  2LXL A;  5BXO A;  3L22 A;  4GZC A;  5BXU A;  4W9R A;  4C48 B;  3LVR E;  4EZK A;  2PQR A;  1SA4 A;  4JC8 A;  1OCO E;  1OUV A;  3JQ1 A;  3TWR A;  2VJ8 A;  3S2A A;  1FVH A;  4WWN A;  3UQ3 A;  3QAR A;  5A23 A;  3DPD A;  4B8A A;  2R5S A;  2RFA A;  3FU3 A;  1OCZ E;  1DNP A;  4X8Q A;  3S7D A;  2KAT A;  1H6K A;  1HE8 A;  3QNK A;  3GZ1 A;  3KAE A;  4GAA A;  3SO8 A;  3L13 A;  3DSV A;  3CHM A;  2FBN A;  3LYA A;  3SI5 A;  5KJL A;  2HR2 A;  2KZT B;  2J07 A;  3T9K A;  3RJV A;  4CRW A;  4BWR A;  2ZGD A;  2EIJ E;  3LY8 A;  3I5P A;  1IHB A;  4TUU A;  4CYM D;  2XCB A;  4HFG A;  2A4Z A;  3FY4 A;  3C3O A;  4GU5 A;  4DI3 A;  2VGE A;  4A3V A;  2QY7 A;  3HXF A;  1AP7 A;  3D9J A;  2FF4 A;  3ZIM A;  5AAR A;  5LP0 A;  3Q9U C;  5ENT D;  4CT4 A;  5BV0 A;  2X3M A;  4OVV A;  1UW4 B;  5CER B;  3MZL B;  4BSZ B;  3PRZ A;  3NOG D;  2MRI A;  1N4Q A;  5JHB A;  2LUH A;  3MKQ B;  4U63 A;  4FU3 A;  2NSZ A;  4YDW A;  4U8Y D;  3CVW A;  5KNH D;  3PZD A;  3CLJ A;  2GRO B;  5T3R A;  4F6R D;  3SF4 A;  1S0P A;  4L1B A;  1TR4 A;  5EN5 D;  5FIO A;  3L54 A;  3KEA A;  3ASN E;  2XGM A;  3L17 A;  2PNN A;  2ETC A;  4ANV A;  3R9A B;  2V5F A;  4YVO A;  2WB2 A;  2I6H A;  4DK5 A;  3ZYL A;  4AIF A;  4ZFH A;  3FUJ A;  1YYH A;  2M63 A;  1KZO A;  3JQ0 A;  4F1P A;  1E8Y A;  2WXQ A;  3K9I A;  3DPY A;  1MYO A;  4MS6 A;  4BFR A;  4GA1 A;  4ILI A;  4GTP A;  4UWF A;  4GZ3 A;  2IFU A;  3IBE A;  3ZGQ A;  5JMN D;  4DLQ A;  2ZGG A;  4TXP A;  4DJA A;  3LCA A;  4U95 D;  3UT4 A;  5C1D A;  3EHN A;  3EU9 A;  4AY6 A;  3NAW A;  2R05 A;  3AG2 E;  3AS5 A;  2CG3 A;  1K8K G;  4LNG A;  3BG0 B;  4UUC A;  3EHR A;  1MX2 A;  1W3B A;  1BI7 B;  4I2W A;  2C0L A;  2XZT G;  2Y4T A;  4UWG A;  3TWU A;  2KXP C;  3DSW A;  3HYM B;  3P2B A;  3VLF A;  3T5V A;  3VLD A;  3KSL A;  3I3N A;  4C0M A;  3RO3 A;  1OWO A;  3P1U A;  2LO6 A;  4K5B A;  4EEC A;  4KBQ A;  2WXH A;  1G3N B;  1H0A A;  3AS8 A;  4HB5 A;  4MRU A;  4HS2 A;  3UM3 A;  1OWM A;  2WQ6 A;  2EIK E;  3U4T A;  1N95 A;  1HZ4 A;  1N0Q A;  2L6J A;  2HO1 A;  4GTQ A;  4BY6 A;  1MQS A;  4BX9 A;  1IYG A;  4KYO B;  2EIL E;  1YA0 A;  1PAQ A;  4KZC A;  2VTB B;  5BPP A;  1MZC A;  4HOT A;  4I6J A;  4KXK B;  3LVQ E;  1SW6 A;  2ZIR A;  4G26 A;  5CBO A;  2CHX A;  1Q2Z A;  3LJ3 A;  3CKC A;  2J49 A;  1BU9 A;  3ZRH A;  1K3Z D;  3PNL B;  1KPS B;  2X6I A;  2Y4U A;  3G2T A;  3B95 A;  1KT0 A;  1Z5S C;  4HRM B;  4AP2 A;  1HFA A;  2YNQ A;  3FUI A;  3TXM A;  3RRU A;  2GRN B;  2ION A;  5BW8 C;  5FZR A;  3GYZ A;  5FQ6 A;  5G05 J;  4U0U A;  5G05 C;  4WNG A;  5E75 A;  3DST A;  4G23 A;  2H6G A;  3UIO C;  5FQ4 A;  3KEZ A;  4DLO A;  2P9L G;  1HG2 A;  5LOZ A;  1LD7 A;  1RW2 A;  2VGY A;  2XPZ A;  3APD A;  3DRA A;  2UY1 A;  5J90 A;  2KM4 A;  4YVQ C;  1N4P A;  4L2L A;  1Z3Y A;  2ETA A;  2PQN A;  1EF1 C;  3ZEF A;  1TYQ G;  5HQ8 A;  3C98 A;  5E76 A;  3DXK G;  3TXN A;  4AY5 A;  2OVB A;  2MHK A;  3S7F A;  3FU6 A;  3ISM C;  4RSY A;  3ZUV B;  4UWH A;  3MYV A;  2DVW A;  1BI8 B;  1O1T A;  3PZ4 A;  4HOQ A;  2PZI A;  2WXF A;  3AS4 A;  3TWS A;  2BED A;  4N3A A;  5BNW A;  2A5U A;  4OVU A;  4DUI A;  1N4R A;  2ILR A;  3O4Z A;  1LF8 A;  4EBA G;  4GA2 A;  3TJP A;  2GW1 A;  3JYS A;  3HVE B;  1HU3 A;  5B1B E;  1N11 A;  2V5Q C;  4L2Y A;  3OXL A;  3CHO A;  1JCR A;  2VGX B;  2J9Q A;  3CHQ A;  4N5C A;  3PEV B;  3QDN A;  4U0S A;  4FAD A;  4I43 A;  1E7U A;  2LSU A;  2OV8 A;  4XX5 A;  1V55 E;  1XNF A;  3ONK A;  4YDO A;  4G11 A;  4HOU A;  2PL2 A;  2GRM A;  3ZU7 B;  5J08 A;  3IHV A;  2IO3 C;  4IRU A;  3F6Q A;  2WXI A;  3FTV A;  3UM2 A;  3SHF A;  3UM0 A;  4BTB A;  1YCS B;  2P9S G;  3ZYM A;  3Q78 A;  4JA9 A;  4KMO A;  3D3M A;  2P9U G;  4PDX A;  3T8M A;  3CKB A;  2J08 A;  2Y69 E;  3FEX A;  3QC1 A;  1NZN A;  4WAF A;  3NF1 A;  4BTA A;  2AXZ A;  4DI4 A;  4XKC A;  3SBS A;  1H6P A;  5EYP F;  5AQ7 A;  2V4H C;  3LXU X;  4I9C A;  3MV3 B;  2AXV A;  3CIA A;  3WG7 E;  1S63 A;  5IY5 E;  3G2W A;  4RG9 A;  5LCW J;  5LCW C;  2I2O A;  5ENN A;  3ZHE B;  2WPV A;  5D66 A;  1AWC B;  5KWD A;  3CV0 A;  2WXL A;  1N9A A;  4HI9 A;  2VSX E;  3U3W A;  5KJN A;  1WG0 A;  2MOW A;  2P9I G;  2X6K A;  1JUQ A;  2XEE A;  2RFM A;  4FP7 A;  5T4Y A;  3DSX A;  3D9L A;  2XPI A;  4GZ6 A;  2KBX A;  3Q9N C;  5DIZ A;  3T8K A;  4XZ4 A;  2PM7 A;  2Q7F A;  2IEJ A;  3TWW A;  1IQR A;  4FC8 A;  4ATZ D;  2XRZ A;  4G8L A;  4JL0 A;  1N4S A;  4TUM A;  5FZS A;  5KJM A;  1FT1 A;  4U8V D;  5AQA A;  2DZN A;  4B89 A;  2DZO A;  2EIM E;  4UQX A;  2GGF A;  1K1A A;  2WXP A;  4BES A;  2Y1L E;  3SGH A;  3SFY A;  4GCO A;  2VSO E;  4PS7 A;  3PUJ A;  3UPV A;  4NRH B;  2NYJ A;  3FP3 A;  3LS8 A;  5HKP A;  4Q96 A;  3HXC A;  3BEE A;  4JEH A;  4GCN A;  4BT9 A;  1HS6 A;  4G2V A;  4XKB A;  2FI7 A;  4URK A;  4I6G A;  4BX8 A;  4KVO A;  2WQ7 A;  4HXI A;  1KT1 A;  3TWQ A;  4BSX A;  1Z6T A;  3SQV A;  3EIJ A;  4GML A;  3PE3 A;  3KD7 A;  2DBA A;  3ABM E;  2JEK A;  2ZU6 B;  3J5Q B;  1Z3X A;  3CVL A;  4O60 A;  2I1K A;  5CEC B;  4BET A;  2WM9 A;  1LD8 A;  1DC2 A;  2F0Y A;  3DBS A;  5JJ7 A;  3CHP A;  2KCK A;  4LER A;  2L0I A;  3ESK A;  4Y6C A;  2IQC A;  3D9H A;  4JHJ A;  3OXG A;  2KC7 A;  2YHC A;  2J09 A;  5ITZ F;  3ASD A;  4UWL A;  1BPO A;  3FUE A;  3QOU A;  2XGS A;  1U3C A;  5JJ6 A;  3Q15 A;  4R7L A;  2WXM A;  5CRU A;  3FUK A;  4EBA A;  3LPZ A;  3RIB A;  2PM6 A;  3R7Q A;  4HI8 A;  4LCT A;  4O1P A;  1HF8 A;  1D9S A;  2WQH A;  4CDR A;  3W9G A;  2FEZ A;  3ESL A;  1QYM A;  2XPY A;  3RKV A;  1A5E A;  3CVV A;  1X81 A;  3ZVV A;  5M72 A;  3UT8 A;  3HHM A;  3Q7A A;  1TNB A;  2LAH A;  3FTX A;  3W9F A;  4U96 D;  2FO7 A;  3DWL G;  2WVI A;  3MCX A;  3FU5 A;  1ELW A;  1MX6 A;  5B3S E;  3RRM B;  5CMY A;  1WAO 1;  4BEP A;  5JA4 D;  4CZ2 D;  3L08 A;  5CBN A;  3UMV A;  3ULY A;  4NQ0 A;  2VTB A;  3PRE A;  4ANU A;  4M7C A;  3WXX A;  4JEU A;  5EIB E;  3CVN A;  3IV0 A;  5EID A;  4GTM A;  4F3V A;  1N0R A;  2WMO A;  2QYJ A;  4Z68 A;  1O5M A;  1TN8 A;  5FTP A;  4GZD A;  3GZS A;  4FHK A;  3FU0 A;  3D9P A;  4V3I A;  3E33 A;  1TNY A;  2P9P G;  2C0M A;  3CVU A;  2WXJ A;  1E8W A;  4P29 A;  4HRL A;  2XEV A;  3FH5 A;  1N54 A;  2AWI A;  3NBN B;  1E8X A;  1FVF A;  5AAO A;  4C0E A;  4ANW A;  1NI1 A;  4YND A;  3CGH A;  5HI7 A;  3R9M A;  4B93 B;  1EYH A;  3EUV A;  4HBD A;  1NA0 A;  5FWQ A;  3CK9 A;  3ZN3 A;  4ATG A;  4UQY A;  3Q49 B;  4AJW A;  3FEY A;  1L5J A;  5ARF A;  3RAU A;  5EIL A;  3PUK A;  1D8E A;  1JWG A;  3CR3 A;  2OOE A;  2LNI A;  2RKK A;  2CHZ A;  3B7T A;  3CQG B;  3FTW A;  3LEW A;  4XE0 A;  4G1T A;  1H2T C;  1IQU A;  3DXM G;  3SNX A;  3PZ2 A;  2Y3A A;  4GYO A;  4PUC A;  2X38 A;  4KZ0 A;  4ILG A;  2BKG A;  3LY7 A;  1FPP A;  3SY2 A;  4DX7 D;  1A17 A;  3FUD A;  4PS3 A;  4RLY A;  1ELR A;  2X6H A;  2B0O E;  5AEN A;  4U04 A;  1QNF A;  2CFU A;  4F53 A;  4FJY A;  3ML8 A;  2A5E A;  1H6O A;  3HVE A;  1DCQ A;  2JLB A;  4AM9 A;  4HRN A;  3ZNG A;  1MHQ A;  1ZBP A;  4GMJ A;  3TGO A;  3E4B A;  1Y6I A;  1NP7 A;  4FLB A;  5AQB A;  4XEI G;  1B89 A;  2I1J A;  2KCL A;  5ENO D;  1ZU2 A;  2XEH A;  3LDZ A;  3EDT B;  2XCC A;  5G2N A;  3U64 A;  3UIN C;  5HRY A;  4N5Q A;  4AOF A;  3HXE A;  5D0O D;  3VTX A;  3TAX A;  2NXP A;  2LXM A;  1SQM A;  3APF A;  2R17 C;  5ARG A;  3NZU A;  3UXG A;  3TG5 A;  5JJT A;  4DX6 D;  1VDY A;  3B13 A;  4RG6 A;  4XI0 A;  5A6C A;  3AU5 A;  4IN3 B;  4Y6W A;  5B1A E;  2L6B A;  2L9B A;  3RU0 A;  4NUR A;  2QC9 A;  4HLL A;  1H2V C;  4HVB A;  2LSV A;  3VLE A;  3ZYK A;  3CHS A;  3FHE A;  3B7S A;  3FH7 A;  4J6I A;  5ENR D;  3V2O A;  1S70 B;  3BQO A;  1TNU A;  4DX5 D;  3IHY A;  2XQ0 A;  3ZXP A;  1KZP A;  1FCH A;  3EIQ C;  4J8Y A;  2FO1 E;  5AQ9 A;  2OVF A;  4U0Z A;  1WM5 A;  3B7U X;  2CFZ A;  3E30 A;  4APF A;  2ZXW E;  5BUZ A;  4YDY A;  1HO8 A;  3TWX A;  2UWJ G;  3NOC D;  2X6F A;  4CGV A;  3O48 A;  1OWL A;  3C3Q A;  4F7A A;  5AYW D;  2YQ8 A;  4J8E A;  2XZD G;  3CST A;  3U9W A;  1V54 E;  2DYS E;  1OY3 D;  2Y0B G;  4L9P A;  2IY0 C;  4UWK A;  1OCR E;  2F37 A;  2EIN E;  1BD8 A;  3MEK A;  4KT6 B;  2XRY A;  3QWP A;  2HE0 A;  2P58 C;  3TG4 A;  2OND A;  1SZA A;  3LJN A;  2H6H A;  2IO2 C;  5ANR A;  4N3B A;  4J8S A;  3BUA A;  3RO2 A;  3RSE G;  4J8F A;  5EDS A;  4N2S A;  4A1S A;  3JUI A;  4EZJ A;  2ETB A;  4H7X A;  3JXI A;  1KLX A;  3KS2 A;  1NA3 A;  2I9C A;  4MBG A;  4LSZ E;  2BKK B;  3IXE A;  3Q79 A;  5G04 J;  3RK6 A;  3LKU A;  3PZ3 A;  3FH8 A;  3HIZ A;  3C5R A;  2IF4 A;  3JXJ A;  3L82 A;  4FA6 A;  3OTN A;  3FFL A;  3PDN A;  5KNG A;  3URZ A;  1SA5 A;  4JHR A;  2P2C P;  1UN9 A;  3Q7F A;  2KZT A;  3BG1 B;  1INZ A;  1TJF A;  2H6I A;  2IOS A;  2WXK A;  2AXU A;  2DWZ A;  4A1G A;  3V2X A;  2YIN A;  5FIN A;  4QQI A;  4OYS A;  1OCC E;  3UIP C;  3Q5M A;  4CGW A;  4U8H A;  3QWV A;  4FLH A;  4A3T A;  2KCV A;  3FUH A;  1H2U A;  3D9K A;  3UTM A;  1SZ9 A;  4N39 A;  3ASG A;  4J7W A;  4G24 A;  5ENQ D;  4XIF A;  3ZW3 A;  5FT9 A;  1TEZ A;  4QFV A;  4A63 B;  4LNB A;  1K1B A;  1NL4 A;  1JPL A;  3MKQ A;  1EPU A;  1UN8 A;  1ZB1 A;  5ENS D;  4GB9 A;  1S64 A;  3QJZ A;  4E6H A;  5A7D B;  2P9K G;  4OAV B;  1JWF A;  4EPZ A;  3QWW A;  4I17 A;  5DBK A;  3GW4 A;  4K5C A;  3G2S A;  3I4R B;  3AG1 E;  4GPM A;  3CK8 A;  4JXT A;  2EQX A;  5ANL A;  1RZ4 A;  2NC9 A;  4MKT A;  4TXQ A;  1TNO A;  5FZQ A;  1QQE A;  1JCS A;  4LUN U;  1FT2 A;  1O1R A;  4HNA D;  4HLE A;  5KCM A;  4TV3 A;  4L7T A;  4FUL A;  3R7R A;  3CVQ A;  3S7B A;  4WNE A;  2OCC E;  1E90 A;  4CCA A;  1DCE A;  2WXG A;  3FWV A;  1DVP A;  4B94 A;  4GYW A;  2BUG A;  3EJN A;  4G25 A;  1PC2 A;  5EYL A;  3ULE G;  4BT8 A;  4C9B B;  4ACK A;  3FUF A;  3B7B A;  5T8I A;  2F8Y A;  2FUL A;  4I1A A;  3ZXS A;  1OWN A;  3JCK C;  4PS8 A;  4RQI A;  1HX8 A;  4DX1 A;  3CVP A;  3CEQ A;  3ZKJ A;  3PE4 A;  5CCL A;  5LX8 A;  3SBT B;  4ILH B;  3N71 A;  3UKU G;  2VYI A;  3JUE A;  4UI9 J;  1YMP A;  4H7Y A;  4UI9 C;  4DX2 A;  3HXB A;  3C72 A;  1UG3 A;  4EQF A;  2R03 A;  3UM1 A;  1P5Q A;  2B6C A;  4J0U A;  1TN7 A;  2WXO A;  3LY9 A;  4APO A;  2ZIS A;  3L9T A;  2GRQ B;  2J4D A;  4LNU D;  4K0R A;  1QBQ A;  4ME2 A;  3CVX A;  4ANX A;  1IKN D;  5BV1 A;  3I4G A;  1QZ2 A;  3SD5 A;  3QK0 A;  2QYU A;  3PNT B;  5D0Q D;  2QZA A;  3CVY A;  3AG3 E;  1D8D A;  3QKY A;  4I9E A;  3E32 A;  4G8K A;  4WWO A;  3EU5 A;  4AV7 A;  4I2Z A;  3ZYQ A;  4EZL A;  1UJJ A;  4JPS A;  3UX4 A;  3MX3 A;  5HS0 A;  4CDN A;  5KBA A;  3OAW A;  1WDY A;  3IEG A;  5D2M C;  5EKQ D;  4IUL A;  3SFX A;  4I1O B;  3HRA A;  3ASH A;  4YDE A;  5CHE E;  3BU8 A;  4HOR A;  4AXH A;  4I1M A;  3HG0 D;  3FTY A;  1O1S A;  3EHQ A;  4GTR A;  3DSU A; 
#chains in the Genus database with same CATH homology
 4HVB A;  2LSV A;  2MOW A;  2X6K A;  1JUQ A;  1UW4 B;  4J8D A;  3VLE A;  3ZYK A;  3CHS A;  4FP7 A;  4LRZ A;  5T4Y A;  3MZL B;  3FHE A;  3B7S A;  3PRZ A;  3D9L A;  3FH7 A;  4J6I A;  2XPI A;  4MLP A;  2E0I A;  4GZ6 A;  2MRI A;  5DIZ A;  5JHB A;  4XZ4 A;  4CT0 A;  2PM7 A;  2Q7F A;  3MKQ B;  4U63 A;  4FU3 A;  2NSZ A;  3IHY A;  2XQ0 A;  1IQR A;  3ONL A;  3CVW A;  3PZD A;  4FC8 A;  4UI9 K;  5FJY A;  2XRZ A;  1FCH A;  1EDU A;  1PY1 A;  3CLJ A;  3EIQ C;  3S7J A;  4A55 A;  4JHK A;  3CHR A;  5T3R A;  1XGW A;  4JL0 A;  4FHJ A;  3Q4A B;  4JVS A;  2OVF A;  1S0P A;  4L1B A;  4U0Z A;  5FZS A;  3SF4 A;  1WM5 A;  5KJM A;  4K03 A;  3B7U X;  2AVP A;  3L54 A;  2CFZ A;  4B89 A;  4APF A;  3MKR A;  2XGM A;  3ASF A;  3L17 A;  3UT7 A;  4UQX A;  2GGF A;  5BUZ A;  1HXI A;  2WXP A;  1HO8 A;  2BF0 X;  2V0P A;  2BTD A;  2UWJ G;  3SGH A;  2X6F A;  4ANV A;  3R9A B;  4CGV A;  2V5F A;  3O48 A;  4YVO A;  4GCO A;  1OWL A;  2WB2 A;  2VSO E;  4PS7 A;  4F7A A;  2I6H A;  5AYW D;  3PUJ A;  4DK5 A;  2YQ8 A;  4J8E A;  4JZY A;  5AJD A;  3ZYL A;  4AIF A;  3UPV A;  4NRH B;  1WY6 A;  3FUJ A;  3CST A;  3FP3 A;  3U9W A;  5CMW A;  3LS8 A;  4WUY A;  2M63 A;  3MGB A;  4Q96 A;  4XI9 A;  3JQ0 A;  4N2Q A;  3D9O A;  4UWK A;  2L0T B;  3BEE A;  3FUM A;  4JEH A;  5JHA A;  5FQ8 A;  4GCN A;  1E8Y A;  1U3D A;  2VGX A;  4IYP A;  4AEZ C;  2WXQ A;  3K9I A;  3OXF A;  3D9N A;  3G2V A;  4F1S A;  4BT9 A;  2IU1 A;  1HS6 A;  4MS6 A;  4BFR A;  4GA1 A;  4ILI A;  3MEK A;  4G2V A;  4KT6 B;  4XKB A;  2XRY A;  2FI7 A;  4UWF A;  3QWP A;  4URK A;  4I6G A;  4GZ3 A;  5KJK A;  4BX8 A;  2IFU A;  2P58 C;  3IBE A;  4KVO A;  3TG4 A;  3ZGQ A;  2WQ7 A;  2OND A;  4HXI A;  1KT1 A;  4DLQ A;  4BSX A;  1SZA A;  3ZPJ A;  4WWP A;  4LEU A;  1Z6T A;  4Q69 A;  4DJA A;  3EIJ A;  4UQZ A;  3LCA A;  4AVX A;  4GML A;  3PE3 A;  3UT4 A;  5ANR A;  4N3B A;  4J8S A;  3RO2 A;  1E8Z A;  3KD7 A;  2DBA A;  5C1D A;  4J8F A;  5EDS A;  2JEK A;  5G55 A;  4GA0 A;  2ZU6 B;  3EHN A;  4A1S A;  4N2S A;  3JUI A;  4EZJ A;  1Z3X A;  3CVL A;  2I1K A;  4D10 C;  2VQ2 A;  4H7X A;  4AY6 A;  3QAQ A;  3AU4 A;  1KLX A;  2VSN A;  3KS2 A;  1NA3 A;  3FDH A;  2I9C A;  2WM9 A;  3PS6 A;  4JA7 A;  1OWP A;  4CDM A;  3DBS A;  3AS5 A;  5G04 J;  2CG3 A;  3RK6 A;  3BG0 B;  5JJ7 A;  3ZFW A;  3CHP A;  2KCK A;  3LKU A;  3FH8 A;  2HM8 A;  1W3B A;  3EHM A;  3HIZ A;  4LER A;  5AIJ A;  2X6J A;  2L0I A;  2IF4 A;  2GRL A;  4I2W A;  4FA6 A;  2C0L A;  3ESK A;  2IJG X;  1TJC A;  4Y6C A;  2IQC A;  2Y4T A;  2V8S E;  3OTN A;  4UWG A;  5LFA A;  3FFL A;  3HYM B;  4DPR A;  3VLF A;  3PDN A;  3P2B A;  3T5V A;  3VLD A;  3ENE A;  3URZ A;  4ABN A;  4JHJ A;  4JHR A;  3NZS A;  3I3N A;  1UN9 A;  3OXG A;  2KC7 A;  4C0M A;  2KZT A;  4GYY A;  4WNF A;  3CSF A;  3RO3 A;  2AW6 A;  2YHC A;  1OWO A;  2J09 A;  3FTU A;  3BG1 B;  3P1U A;  1INZ A;  1TJF A;  2LO6 A;  3ASD A;  4UWL A;  3QB2 A;  4EEC A;  2IOS A;  1Y8M A;  1BPO A;  2WXK A;  4GZ5 A;  4KBQ A;  2AXU A;  3FUE A;  3QOU A;  2XGS A;  3HDX A;  2WXH A;  3SZ7 A;  1H0A A;  1U3C A;  3AS8 A;  4A1G A;  5JJ6 A;  4MRU A;  3Q15 A;  4HS2 A;  2YIN A;  4R7L A;  2WXM A;  1OWM A;  2WQ6 A;  3FUK A;  4EBA A;  3LPZ A;  3RIB A;  3U4T A;  4OYS A;  2PM6 A;  3R7Q A;  3Q5M A;  4LCT A;  4CGW A;  1HZ4 A;  1HF8 A;  4U8H A;  3MA5 A;  3ZHE A;  2L6J A;  2RG8 A;  2HO1 A;  1HG5 A;  3QWV A;  2WQH A;  3PEU B;  4CDR A;  4BY6 A;  1MQS A;  4FLH A;  4BX9 A;  3SFZ A;  1IYG A;  1H19 A;  2FEZ A;  2KCV A;  3FUH A;  1H2U A;  3D9K A;  3ESL A;  4A3T A;  1SZ9 A;  4HOS A;  4KYO B;  4N39 A;  2XHE A;  3ASG A;  3L6A A;  1YA0 A;  1PAQ A;  2XPY A;  4KZC A;  2V4L A;  2CHW A;  4G24 A;  3RKV A;  4WND A;  4B8C B;  2VTB B;  5BPP A;  3CVV A;  4XIF A;  3UUX A;  3ZW3 A;  4HOT A;  3ZVV A;  4PH4 B;  5FT9 A;  5M72 A;  1TEZ A;  4QFV A;  3GZ2 A;  2WXN A;  3APC A;  4I6J A;  4KXK B;  3UT8 A;  3HHM A;  4I6E A;  3LVQ E;  4G26 A;  1JPL A;  2CHX A;  3MKQ A;  3ML9 A;  3RRN B;  2LAH A;  1EPU A;  2IOL A;  3FTX A;  3LJ3 A;  2UY1 B;  4L23 A;  1UN8 A;  3CKC A;  4TRQ A;  4FJZ A;  4N3C A;  2J49 A;  2E2E A;  3ZRH A;  2FO7 A;  3PNL B;  2WVI A;  3MCX A;  2X6I A;  2Y4U A;  3G2T A;  1E7V A;  3FU5 A;  3IKO B;  4GB9 A;  1KT0 A;  2J4B A;  1ELW A;  1X5B A;  3RRM B;  3QJZ A;  4AP2 A;  4E6H A;  1HFA A;  3PVL A;  5A7D B;  2YNQ A;  3FUI A;  5CMY A;  3TXM A;  3VTY A;  3RRU A;  1WAO 1;  1JWF A;  4B0Z A;  4EPZ A;  4JW1 A;  3QWW A;  4I17 A;  5DBK A;  3GW4 A;  2ION A;  3Q47 B;  5C2Y A;  3L08 A;  5BW8 C;  5CCM A;  5FZR A;  3GYZ A;  2WMN A;  5FQ6 A;  5G05 J;  4U0U A;  3UMV A;  3MJW A;  5G05 C;  3G2S A;  4NQ0 A;  2C2L A;  4WNG A;  3I4R B;  2VTB A;  3PRE A;  3PH0 C;  3CK8 A;  5E75 A;  4JXT A;  2EQX A;  2DIW A;  5ANL A;  4G23 A;  4ACL A;  4ANU A;  4O6F A;  5FQ4 A;  3KEZ A;  3WXX A;  4JEU A;  4DLO A;  3CQC B;  3CVN A;  3TL5 A;  3L16 A;  2NC9 A;  4CEM A;  4MKT A;  3FTS A;  3IV0 A;  3MV2 B;  1HG2 A;  5LOZ A;  1QQE A;  5FZQ A;  4F3V A;  2VGY A;  1GW6 A;  2XPZ A;  4RVB A;  3APD A;  2WMO A;  3U66 A;  4LUN U;  2UY1 A;  5AJL A;  4E85 A;  5J90 A;  4HLE A;  2KM4 A;  5G04 C;  2CG2 A;  4YVQ C;  5KCM A;  4TV3 A;  4L7T A;  4FUL A;  1Z3Y A;  4L2L A;  3R7R A;  5BT1 A;  2PQN A;  3FUN A;  4GZD A;  5FTP A;  3G2U A;  1EF1 C;  1N52 A;  3GZS A;  3ZEF A;  3CVQ A;  4FHK A;  3FU0 A;  3D9M A;  3S7B A;  3D9P A;  2LAI A;  5HQ8 A;  3C98 A;  5E76 A;  3TXN A;  4WNE A;  4Q94 A;  4AY5 A;  4V3I A;  1HH8 A;  1E90 A;  4CCA A;  2WXG A;  3FWV A;  2C0M A;  3CVU A;  1DVP A;  2WXJ A;  1E8W A;  2OVB A;  4P29 A;  4B94 A;  2MHK A;  2WXR A;  3S7F A;  2XEV A;  3FH5 A;  3FU6 A;  1N54 A;  4GYW A;  3D9I A;  4RSY A;  2AWI A;  2BUG A;  3EJN A;  1ELK A;  4G25 A;  1E8X A;  4UWH A;  1PC2 A;  3MYV A;  1FVF A;  5EX3 A;  4BT8 A;  3ULQ A;  4C0E A;  4C9B B;  4ANW A;  4YND A;  4ACK A;  2XGO A;  3CGH A;  5HI7 A;  3B7R L;  4GPK A;  1EYH A;  4HOQ A;  3FUF A;  1NA0 A;  5T8I A;  2RD0 A;  2PZI A;  5FWQ A;  3CK9 A;  2WXF A;  3ZN3 A;  3AS4 A;  5FQ7 A;  3NQP A;  2FUL A;  4I1A A;  3ZXS A;  4UQY A;  4ATG A;  1E96 B;  1OWN A;  3JCK C;  3Q49 B;  4PS8 A;  1HX8 A;  4N3A A;  3CVP A;  2QFC A;  3CEQ A;  3FTZ A;  2A5U A;  3FUL A;  4AJW A;  5BNW A;  3FEY A;  4OVU A;  1L5J A;  2ILR A;  3O4Z A;  3PE4 A;  5ARF A;  5CCL A;  1LF8 A;  5LX8 A;  3SBT B;  4ILH B;  3N71 A;  4EBA G;  4GA2 A;  3PUK A;  3TJP A;  4NAC A;  4U07 A;  2VSY A;  2GW1 A;  2VYI A;  3JYS A;  1JWG A;  3CR3 A;  1IHG A;  2OOE A;  3HVE B;  4M3O A;  1HU3 A;  4UI9 J;  2LNI A;  4KVM A;  4H7Y A;  4UI9 C;  3T5X A;  2HYZ A;  5EX0 A;  2R59 A;  2CHZ A;  2DCP A;  3OXL A;  4L2Y A;  3B7T A;  1UJK A;  3CQG B;  3CHO A;  3FTW A;  3CK7 A;  3LEW A;  4XE0 A;  1UG3 A;  2YHE A;  2VGX B;  2J9Q A;  3CHQ A;  4N5C A;  3PEV B;  4G1T A;  3QDN A;  3L22 A;  4U0S A;  4GZC A;  1H2T C;  4EQF A;  1IQU A;  1P5Q A;  4FAD A;  4I43 A;  1E7U A;  2LSU A;  4W9R A;  3SNX A;  3LVR E;  4J0U A;  2OV8 A;  4XX5 A;  1XNF A;  2WXO A;  4EZK A;  2Y3A A;  4GYO A;  2PQR A;  4PUC A;  2X38 A;  3LY9 A;  4APO A;  3ONK A;  4ILG A;  4JC8 A;  4KZ0 A;  1OUV A;  3JQ1 A;  3LY7 A;  4G11 A;  4HOU A;  1A17 A;  3FUD A;  4PS3 A;  1ELR A;  2VJ8 A;  2PL2 A;  2GRM A;  3S2A A;  2X6H A;  5J08 A;  3IHV A;  1FVH A;  2J4D A;  5AEN A;  4U04 A;  4WWN A;  1QNF A;  4IRU A;  2CFU A;  4F53 A;  4FJY A;  3UQ3 A;  3ML8 A;  3QAR A;  5A23 A;  4K0R A;  3DPD A;  4B8A A;  2R5S A;  3HVE A;  4ME2 A;  2WXI A;  3FTV A;  3FU3 A;  3CVX A;  3SHF A;  4ANX A;  4BTB A;  1DNP A;  2JLB A;  5BV1 A;  3S7D A;  2KAT A;  1H6K A;  1HE8 A;  3I4G A;  3GZ1 A;  3KAE A;  3QNK A;  4GAA A;  3ZYM A;  4JA9 A;  4AM9 A;  1QZ2 A;  1MHQ A;  3SD5 A;  3L13 A;  4KMO A;  3D3M A;  3QK0 A;  3CHM A;  2FBN A;  3LYA A;  3PNT B;  4PDX A;  3SI5 A;  1ZBP A;  5D0Q D;  4GMJ A;  3TGO A;  3CVY A;  3T8M A;  3CKB A;  3E4B A;  1Y6I A;  1NP7 A;  4FLB A;  3QKY A;  2J08 A;  3FEX A;  3QC1 A;  4I9E A;  1NZN A;  4WAF A;  3NF1 A;  4BTA A;  5KJL A;  2HR2 A;  2AXZ A;  4WWO A;  1B89 A;  2KZT B;  4DI4 A;  2I1J A;  2J07 A;  4XKC A;  4AV7 A;  2KCL A;  1ZU2 A;  3RJV A;  3SBS A;  4CRW A;  4I2Z A;  3LDZ A;  3ZYQ A;  4EZL A;  4BWR A;  1UJJ A;  3EDT B;  2XCC A;  4JPS A;  3LY8 A;  3UX4 A;  3I5P A;  4TUU A;  3MX3 A;  3LXU X;  5G2N A;  4I9C A;  4CDN A;  3OAW A;  3MV3 B;  3IEG A;  3U64 A;  2XCB A;  5EKQ D;  4IUL A;  2AXV A;  4HFG A;  4I1O B;  4AOF A;  3CIA A;  3G2W A;  2A4Z A;  3FY4 A;  4GU5 A;  4RG9 A;  5D0O D;  5LCW J;  3VTX A;  4DI3 A;  3TAX A;  2NXP A;  4A3V A;  5LCW C;  1SQM A;  3APF A;  2I2O A;  2QY7 A;  3ASH A;  2R17 C;  5ARG A;  3D9J A;  3NZU A;  5ENN A;  3TG5 A;  5CHE E;  3ZHE B;  5JJT A;  1VDY A;  2WPV A;  2FF4 A;  3B13 A;  4AXH A;  3ZIM A;  4HOR A;  4RG6 A;  4XI0 A;  4I1M A;  5A6C A;  5LP0 A;  3FTY A;  3AU5 A;  4IN3 B;  3CV0 A;  4Y6W A;  2WXL A;  2L9B A;  3RU0 A;  4NUR A;  4CT4 A;  5BV0 A;  2VSX E;  3U3W A;  2X3M A;  4OVV A;  5KJN A;  1H2V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...