1HFAA

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, pi(4,5)p2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
total genus 100
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hfaA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hfaA01
1EDUA 1SZ9A 4HFGA 3RRUA 1HX8A 1VDYA 4AVXA 1INZA 4FLBA 1UJJA 3ZYMA 5CMWA 3ZYKA 3D9OA 3ONKA 2BF0X 3D9IA 3LDZA 3ZYQA 5CMYA 4Q94A 1UJKA 1X5BA 3G2TA 4Q96A 3ZYLA 3G2SA 4NACA 1EYHA 2L0IA 3CLJA 1JUQA 2LO6A 4GZDA 2DCPA 3D9LA 1DVPA 1H0AA 2KM4A 1HF8A 2V8SE 1JWGA 3D9JA 2MOWA 4JXTA 5LOZA 3G2UA 3D9PA 2L0TB 3ONLA 5LP0A 1PY1A 2DIWA 1HG5A 3G2VA 3D9NA 1LF8A 3G2WA 1MHQA 4GZCA 4FU3A 1JPLA 1SZAA 2QY7A 5J08A 3D9MA 1JWFA 1ELKA 3D9KA 1HG2A 1XGWA 1HFAA
chains in the Genus database with same CATH superfamily
3SFDA 2UUCT 3NWIA 4DO0A 1O5MA 3TLTA 3Q47B 5AQMB 4LF4T 3CMLA 5AARA 2IAKA 3RQUA 2B1EA 4ILBA 3RHWA 2XGOA 2K24A 5AQGB 2ZM8A 5AQ9A 3I9WA 1KT1A 1O1RA 3Q9UC 3UQ3A 3RIUA 4IDNA 3AS4A 1JCSA 3VTYA 3RKGA 2JABA 1WCRA 2P9BA 4PK6A 2P9KG 2YNQA 3PUXF 5FT9A 1T98A 2VSNA 3DPYA 1TNBA 1EDUA 5C1DA 3FXDB 3HG0D 2UUAT 1FT2A 3UUBA 2HM8A 2H6IA 2JLBA 2KC7A 3BK9A 3AE6A 3CHPA 4OAUC 5AQRB 5JDHA 3ZMVB 5IY5E 2J08A 3ZLIA 4GZ3A 2JMKA 4AKHA 3E33A 4LERA 4YVOA 4DJAA 3PS6A 4A1GA 5AQVB 5D0OD 4GMLA 5FY7A 4C48B 3AECA 5BNWA 3V5UA 3PJAJ 5T4YA 5LGNB 1BI8B 2Y3AA 1IHGA 3SHFA 3P50A 1MX2A 5EYPF 2FBWA 4H9RC 2M6BA 2XRYA 3BQKA 3KEZA 1HNXT 5CBOA 4ZEYA 4PH4B 2BVLA 5EK2A 1EYHA 3FU6A 5KMGP 4UUCA 2K9AA 5KCMA 1MX4A 2MYSA 3FU5A 1TNUA 4F53A 3V2XA 4ZZBA 4DV3T 2EILE 3ABLE 2HO1A 5LGUB 4GTRA 1OCOE 5ABEA 2XM1A 3PUSA 4FU3A 2KZTB 2JQKA 4UVAB 4CGWA 4J8EA 1E8ZA 3CVXA 3BU8A 3SBSA 5JJ7A 4P29A 3B13A 4AEZC 4FJZA 1S94A 4JI0T 4NURA 5HXRA 4J8FA 2H7OA 3FEXA 4GPMA 3UU6A 4TRQA 4DV0T 4EZHA 3LCAA 2R59A 1OWLA 5BXOA 3PNLB 3JXIA 3T9KA 3FU3A 3U78A 4OYJA 1MZCA 1QUUA 5CFBA 4EYYR 5IUXA 3B7TA 4URKA 4HQDA 4X20E 2LM2A 3CVNA 3PDYA 3D9OA 4G63A 4AQFA 3DSVA 3ASNE 4F3VA 1OXZA 2FJBA 2WY2A 1K8KG 3AU5A 4WBOA 1Z0PA 3AXJA 4TWDA 1D9SA 2ETCA 2CE7A 1VOMA 4JEHB 1HNWT 2KM4A 3HVEA 3C50A 5AQQB 2MRIA 3FTSA 1KNPA 3QARA 4YSXA 1MMAA 4EHMA 2VGXA 2X0YA 2C5KT 5HEUA 2YEVC 3UUXA 2XPKA 2DI4A 5J08A 3D9KA 3KDSE 3C64A 3L3PA 3I0OA 1XMQT 3FZMB 2I59A 5C8YE 3EDUA 3PDNA 5ANRA 2M67A 4YSZA 2XQ4A 4WBNE 3FFLA 3B5MA 1H0AA 2YK0A 4GZ6A 3OAWA 4ILHB 5AJDA 3E08A 5FJYA 1NA3A 4G23A 3RSEG 2XQ8A 1LF8A 5L3GB 2DWGA 1ELKA 1H2TC 2CEAA 4E7SA 2VTBA 4EIWA 4K0KT 4GTPA 1HH8A 3FXEB 5E0OA 3L6AA 3FH5A 4QX8B 2LXMA 4MS6A 5AQOB 3HXDA 2LSKA 1U3CA 4FP7A 1O3XA 4F7AA 4CYMD 4H63V 5FY0A 2X68A 3LFMA 4U8HA 3S7BA 3HKEE 2WMNA 5B3SE 4A5XA 4GYSA 3UM0A 2GRPB 5KJKA 2HHHT 4B3MT 2QY7A 4NIKA 5FXVA 4O4HE 1W09A 5LOVE 2CLYC 3FDHA 2LSVA 5KNHD 4NPPA 4MHCA 2GRNB 2XQ6A 3RIBA 3PURA 5BV0A 3G06A 5ABFB 3FBLA 4XKCA 2L9QA 2UXDT 4APOA 5CA1E 4HTEA 2UXBT 2IEJA 2XRZA 3AVSA 1K1BA 2FO7A 5CHEE 3OJAA 1ZHCA 4GK5E 4PJMA 4TWHA 4ISTA 2KCKA 3LS8A 2WWVA 1N0RA 2EQXA 3N9OA 2RFMA 4LNBA 3DP7A 2MYOA 5FXXA 4L2YA 2W61A 3FB2A 3CK9A 1NWMX 3RLFF 3JQ1A 1N4SA 3CHSA 2WU5A 4GTMA 2FJEA 3CKBA 4FULA 3AEGA 3D0TA 3UIPC 1UG3A 4AKIA 2VVSA 3LY7A 3ZW3A 2BG9C 1DVPA 3NBNB 3ZJ1A 3ULYA 1N9AA 1JWGA 4TV9E 3GN5B 4QHOA 4PS3A 3UT8A 2L0TB 4ZI2C 2FJDA 1H2VC 4GTSA 5HXEA 5LFAA 4JV5T 4ATZD 3NRXA 4AXHA 3AE9A 4UI9C 4IGUA 3CK7A 1DC2A 3G2TA 2ONDA 3FTZA 5LB7B 4U96D 2ZIRA 3ZCJA 3P4PA 1BR2A 4ADZA 2WQYA 2Y48B 2CHXA 1OY3D 2LKHA 4CRWA 3RX6A 5IHYA 3HR0A 2W63A 3EUVA 3CHMA 4EBAG 3P8CD 4TWFA 5ABHA 2C0MA 5EK4A 3AAIA 2P9LG 2DZOA 4G11A 4ZHBA 3R9MA 1DCQA 3CX6B 5JHBA 3CHOA 3CGHA 1T7SA 3RRCA 2H6GA 4FADA 1Y8MA 2DYSE 3IA3A 4MBGA 2ZGGA 2KWIB 3MKDA 4QXBB 4CZ2D 2RPAA 5JVDE 3UU4A 1OWOA 3EU5A 4K5CA 3BG0B 4JEUA 3KV4A 3LVQE 3PNTB 3RK6A 1JWFA 3RO2A 4X66T 3ANWB 1Z8UA 2V5QC 2LLYA 1UJJA 4MKTA 3L13A 3ZPOA 3JQ0A 5HEJA 3LXUX 4PW8A 4W9RA 4HXIA 4QH4A 3RC3A 3DXKG 3FUHA 1XZYA 3TXNA 5IYZE 1N36T 3LK2B 1WDYA 2NW7A 3AU4A 4N78D 4UXNB 3IHVA 3N2OA 4GA2A 4BWRA 5EILA 4TN7B 4E7ZA 4WYVA 5T3RA 4I43B 1IQUA 1H2UA 4YFSA 4R7LA 4CDMA 5FXWA 4X64T 3PE0A 2IO3C 3ONKA 4YDOA 1UGOA 1N34T 3ZFWA 4NRHB 2JPFA 1TN7A 5G05C 1DU2A 3VKGA 3CR3A 5JR9C 4O4JE 2A5EA 2DBAA 2F8YA 3TKLB 2Y1LE 3RQWA 2X6HA 4XIFA 5AQTB 2Y69E 3Q73A 4DUZT 4TV3A 5H7PA 2XS8A 4ZI2D 2GK9A 4I9EA 3NQPA 2XQ9A 3VTXA 3CQCB 3T8OA 5JREA 4JD2G 3NZQA 3DJBA 3ZC1A 1KT0A 1YKEB 5ENOD 4PS8A 4QX7B 4KVOA 1N32T 2HH7A 4DIDB 3GWHA 2ZM6T 1NFIE 1OWNA 2XM2A 3L08A 2XENA 4JPSA 3FZHB 4O1PA 2J4GA 4B6XA 3PU3A 1E8WA 4PFOA 2VB6A 4O6FA 5ENSD 1Q2ZA 5DABA 1OUVA 4AKGA 3A8YC 4TX5A 3CSTA 5F5WA 5LG4A 1EZ3A 4ILUA 2PZIA 5B1BE 3ZKRA 1N4QA 2YU2A 2HE0A 4O4IE 2XY8B 2BG9B 3PREA 5CGMA 1YCSB 2L9BA 3KV5A 3ASOE 4LG6A 4FLHA 5T8IA 3BG1B 3UFEA 4IREA 2LAIA 4JHKA 2IHR1 4HB5A 3EHRA 1SE7A 3LBXA 5KJMA 4JB8P 4JBWF 4OX9T 2IONA 3ZYKA 2V5FA 2KATA 3FUIA 4DX1A 4PJLA 4Q94A 2C0LA 3PUQA 1EPUA 2BKPA 3HXCA 4NUUA 4X1KE 2AE9A 3P4WA 5AQUB 4BY6A 3RRMB 3UIOC 4GB9A 3QWWA 3IEEA 5KDMC 4GMRA 2N2NA 4TUUA 5L3FB 1W0BA 4HORA 2I2OA 2DNXA 4ZI3C 3ZVVA 4F8HA 4AOFA 5AQKB 1YD8G 5FL1A 3Q49B 2Q9QB 4TNWA 4ZHQE 3WAJA 4OHFA 3U9WA 5LG3A 3RRUA 1SW6A 4GYWA 2CHWA 2P9PG 2VSYA 1W3BA 1I6ZA 4OYKA 4HFEA 2BKKB 4O2AE 3AE2A 1VCSA 2X9XA 3ZPJA 3Q9NC 4HKAA 1U5PA 1JUQA 2BS3A 4H9SE 3RAUA 3PE4A 4PK4A 3T1HT 4TXQA 3ZEFB 4HRMB 2QYJA 4HOSA 1QZ2A 4C91A 3NF1A 1MNDA 5F8PA 3CHRA 2KXPB 4YXDA 3O1JA 5D66A 1HG2A 3Q5MA 3ASDA 4HWCA 5JR9A 5J0ZA 3LDZA 4IE7A 2CBIA 1OCRE 2AVPA 3TLWA 4ZFHA 2YOEA 4FA6A 2VL8A 3IKOB 4QKNA 4EEDA 3PZ1A 2LHNA 3ZXPA 2A2FX 3UULA 3GMIA 2B6CA 4AKRB 1HXIA 2C5IT 4B3RT 2V7JA 4I55E 3HKBE 1MX6A 3S7DA 1WM5A 1LRZA 4H9OC 1OEDB 3TWUA 2LXLA 3F6QA 3DSUA 4G24A 3PJAA 2JIWA 4U33A 5ENPD 3L09A 4ERRA 4IL4A 4XEIG 4A55A 1TNZA 2VKOA 1YW0A 2P9NG 4YTMA 4AQGA 4PDXA 1OCCE 3CVQA 1UJKA 5FZSA 5FZRA 2XGMA 4DV5T 3D9LA 2NOXA 3PVLA 4YT0A 3N2KE 3SOLA 4P0BA 2W0GA 3ESKA 3LVRE 2YDSA 4KP3C 2X9HA 2E9XA 3UU8A 3FUFA 4LCTA 1ZP0A 4JZYA 1NA0A 3Q2MA 3HHMA 2W00A 4GYYA 4UI9K 1KNRA 2XPIA 4KMOA 1TJCA 2VYIA 1E7PA 2ACXA 5LMUT 4LMKA 1L5JA 3QNUA 1AJ3A 4FJOA 3HKDE 3CIRA 3E34A 2YU1A 3IBPA 3FULA 3C4XA 2CM0A 4DRXE 4ZI3D 2ZMAA 3AJIA 4G8KA 3TWXA 3O4XE 4HWIB 3JC6C 3W15B 3AEAA 3CPZA 4AY6A 3Q9DA 3MZKB 2EIJE 4AIFA 2PM6A 1WAO1 5JQGE 5KNGA 1B7TA 4XZCA 4KXKB 2V5CA 1R8IA 4FC8A 3D9HA 5JMND 4AQFC 4UF0B 2X67A 3RYHE 2VQFT 4I2WA 4JHRA 5LHHB 3TG4A 4B3TT 5KBAA 1V55E 3J5PA 3WAKA 2CG2A 3KINB 1NP7A 2P9SG 3X1DA 4BTAA 4AY5A 3SWHA 4ZOLE 5J2UE 4GKKT 4U63A 2AXUA 3APFA 1FVHA 1N4PA 2OLTA 1N54A 5E76A 3RU0A 1UX5A 3DTOA 2PG8A 1IBKT 4CN4A 1TN6A 3BQLA 3Q75A 4DVDA 4DV6T 5KX5E 3MKQB 3TLVA 5JH7E 3V2OA 1H19A 5AQIB 3J5QB 1HR0T 2DVWA 3E22E 1HTJF 1KFYA 5AQPB 1W0AA 3OTOT 1S0PA 1Z3XA 3DSXA 2V6XA 1N4RA 5J90A 2FULA 1NL4A 4GOUA 1FMVA 3MA5A 3PZ4A 5LCWJ 2MOZA 2EHOB 4IE0A 2DYRE 3AB3B 2CWYA 2YDRA 3HA4A 4HN9A 4X1YE 4GZDA 4KVMA 4CXYA 3AE4A 5LYJE 3LJCA 2XQ5A 3AE5A 1NI1A 2V7LA 3AE7A 4HEAA 3ZT6A 3TWRA 4U72A 4UVCB 5AQAA 2XASB 1WR6A 3Q5EA 4N3CA 3ESLA 3ZU7B 1XNRT 4H7YA 4JUYA 3JUIA 5G05J 2HN2A 1SZAA 4DMVA 2IIUA 2YKSA 3AAEB 3SNXA 2QC9A 2M6IA 3L54A 3ZYQA 3GW4A 2X0LB 4N39A 2KZTA 3FHNA 2OEVA 2L3LA 2IC6A 4HBDA 3TWVA 3VLFA 4L23A 3P7IA 2H7VC 1OCZE 4U74A 2DZNA 5HWYA 2E2EA 5HAXA 4HLLA 2Y6XA 4DR2T 2AXDS 4C9BB 3EAMA 5ENNA 3BEEA 3I1AA 3L39A 1HCIA 2C5JA 2LT3A 1IBLT 3OVUA 2L6BA 2IO2C 3JC6D 4A97A 3ETUA 2LRLA 3FTWA 3S7FA 1EF1C 4KYOB 4DMWA 3FTUA 4HGAA 2ZU6B 3FWVA 4XAXB 2CFUA 1ZB1A 4H63H 1IYGA 1D1AA 2Y0BG 1TNOA 1YQ4A 1K3ZD 4QFVA 3HL6A 2X6IA 2LSIA 4NUVA 2VASA 3AE3A 2WP9A 4DUIA 3FUMA 1YMPA 4PAGA 2FJAA 4IYPA 4JI1T 3V79K 4O2BE 2NSZA 2KCLA 3EHNA 3RI5A 3FZKB 3P2BA 2GGFA 2JQ9A 3TG5A 4AXPA 4YJ2E 5G04C 4Y6WA 3E37A 4JL0A 4QWNB 3NB2A 3P1UA 4HNAD 2IFUA 2WSSV 2XSBA 3UT5E 3RPUA 1CHUA 4HWDA 4U8YD 5JDQA 3N9NA 3GZ1A 4DPRA 4EXTA 2VURA 5HKPA 1FIOA 2Y4TA 3FTYA 3FBZA 3RJVA 1HF8A 3A7MA 3ETVA 3UTKA 4I0UA 1A17A 5C2TA 3GYZA 1N52A 2XAJB 5JRCA 4HOUA 4GYRA 4P09A 1NEKA 2K5BB 3AXJB 2WM9A 3MACA 4LF9T 3I4GA 3Q5XA 1WG0A 3ONLC 3Q5DA 1KZOA 4N5QA 5EX0A 3TLSA 1HX1B 1FPPA 5HS0A 2VGXB 2CG3A 1QBQA 1PAQA 3UUXB 5A1LA 4GZ5A 2QVAA 4WNEA 2XS1A 3QDNA 2ZM2A 1DCEA 1BR4A 3C72A 1GW6A 4Z68A 5EX3A 4IE6A 3ABME 3AAAC 2BBJA 3HXEA 3UI2A 3OBVE 3C98B 2LSUA 3SFXA 2YDQA 1LTXA 4DR3T 2E0IA 3OXFA 2X6JA 3PZDA 1US7B 5C3JA 2JRKA 5JDGA 3RGLA 1ZEEA 4DLOA 1SA0E 4GCOA 2UU9T 2OVBA 1XWMA 4H9QC 3ZSTA 1WFDA 3ZGQA 1OWAA 4L1BA 3KBUA 2VTBB 4TV8E 2NW8A 2UY1A 4GK0E 2I6HA 3NVOA 4FHKA 4LMLA 3KAEA 4ZS3A 4CDNA 3SD5A 1D0ZA 4COFA 3UX4A 3UMVA 3CKCA 4EECA 3ZJ2A 5FNVE 2KNDA 2V7KA 2BUGA 4HI9A 2WZHA 4HFGA 5FZQA 2AXVA 3M3ZB 3I3NA 2UXNB 2KT9A 3UKUG 1MJ0A 2XQ0A 1H6PA 1QQEA 2GRRB 2V8SV 5FY1A 1XNFA 4O1OA 2N9DA 4XI9A 3UINC 3ASHA 2YN6A 3TLUA 1Y6IA 4EV6A 2D5UA 3O1IA 4P1NA 4H7XA 4ILCA 2XAHB 3N5LA 4BX8A 2H88A 5AFUL 5CJ5A 5LA6E 4ZS2A 3MV3B 3ULQA 4EZJA 4UR9A 4DR4T 5D2MC 3DEOA 4IDOA 5H6RB 2M63A 2BZBA 3EVYA 5L4HA 1AP7A 3L22A 2RA1A 4RG9A 5TAOA 3ZMSB 4N3BA 2CHOA 2FEZA 2V26A 5FKYA 2ZLYA 1W9RA 5HCJA 2R03A 4HFBA 4X65T 4NQ0A 5ENQD 5J2TE 4A3VA 5HCMA 2V8SE 3FUKA 3AA1B 3EHMA 4YLHA 5LHGB 2GRLA 5JDMA 2D9DA 5F3JA 1O1TA 4YHJA 1Z3YA 3Q5WA 2F0YA 3P4QA 1TR4A 2LOPA 3D9IA 1B89A 3L9TA 4KZCA 3BQIA 3UU3A 4CXWA 2J4BA 3ANWA 4EZLA 4AKLA 1V54E 3ZHEA 3NAWA 5FIOA 5FL0A 3ONLA 1H6KA 4N5CA 2IQCA 3G2VA 2MHKA 5HXSA 3ONJA 3LKUA 3LEWA 2A4ZA 1TJFA 4DR7T 3Q15A 5FQ8A 4HRLA 3S2AA 2CHNA 4X8QA 4CEMA 4IDQA 4I43A 2VSXE 2J4DA 4X62T 5KJLA 2VL0A 3AA7B 3HI2A 3SS1A 3MYVA 4DBRA 4XE0A 4KZ0A 2IUBA 2IJGX 4B0ZA 4JI5T 4JYAT 1PY1A 2DCFA 4J0UA 3MX3A 4CN6A 2LEHA 2JMHA 3VLDA 1SZ9A 3PZ2A 2FBNA 3APDA 2PL2A 3B7SA 4JEUB 3PE3A 1OWMA 3H3AA 5FQ4A 4J8SA 4IE4A 3HKCE 1ELRA 1SA4A 5HEHA 2DCPA 4N2SA 2BKOA 4UWLA 2K48A 2KMFA 4Q25A 3EHZA 1AWCB 1LD8A 3V31A 3FEYA 4JI4T 4U0UA 1HG5A 2XQYA 3PUAA 3PUVF 1M7KA 1UOHA 4U0ZA 4UWKA 1IBMT 4F1PA 2X3MA 3QWPA 3ABVA 2ETBA 2GRQB 3KS2A 5FP3A 4JI3T 5JDFA 3MZLB 3LPZA 2CLYB 1WRDA 3PZ3A 3KSQA 3IHRA 4GTOA 1X5BA 3H37A 3N9MA 3N71A 4WWOA 2Q7FA 3EDTB 3EIQC 2YHCA 3IXEA 4I1OB 3I4RB 3CX8B 3UM1A 5HWXA 4DR1T 2KINB 4L9IA 4I6JA 1D1CA 1LVFA 2VWAA 4WWNA 4XX5A 2BDEA 1X9BA 3CHQA 4RLYA 3OYZA 2W66A 4JHJA 1Y01A 5ARFA 4C90A 4GMJA 1I94T 5CEDB 2WAUA 2XSAA 2P9UG 1INZA 1G8XA 3DSWA 4V3IA 1TEZA 3APCA 2E9XC 4HRNA 1UCUA 3AE1A 5GONE 4KMCA 3AA6B 3BUAA 2CWOA 4G8LA 3Q7FA 3CEQA 2JQQA 3PUKA 2Y8DA 2XAGB 1BR0A 2MOWA 5LOZA 2PM7A 3J7Yq 2R05A 1BD8A 2EIME 4H9PC 2X9YA 3D9MA 1KPSB 2AXZA 2WXMA 2F8XK 3OPCA 3QNKA 4HWFA 3E4BA 2AWIA 2V6YA 4U2ZA 4WNFA 5BV1A 1SUMB 2XHEA 2XZDG 1O1SA 1G73A 1FCHA 4B3ST 5AQSB 1N33T 4LFCT 3S4UA 3D3MA 2NC9A 4DBQA 1MMGA 4L0RA 2LE8A 3L8RA 1KEYA 4TXRA 4CN1A 2MPKA 3RYFE 1KNZA 2DWKA 2GW1A 3ZEFA 4ILGA 1SQMA 5LCYA 2QYUA 3KD7A 4BX9A 1CUNA 3VKHA 2EINE 4UVBB 4BSXA 4MALA 2VQ2A 3I9YA 3LBXB 3ZUVB 2WXLA 3N2GE 2NTYA 3MKRA 5BPPA 3FZFB 2WDRA 4LSZE 2X38A 1ZOYA 3ZCIA 2XZEA 4LFAT 2Y4UA 3G2WA 3F57A 4TXPA 4IE5A 4DX2A 1U2VG 2CHZA 3KVBA 4YY3T 1HFAA 2CXLA 2WXJA 5DQVA 1E2AA 3ZT7A 2J09A 5CBNA 1FMWA 1ZU2A 4I17A 3U3IA 4HFHA 3AS8A 2XEEA 4N3AA 1UN8A 4PS7A 2R02A 4OFZA 5FQ7A 2ACZA 3K3OA 4JA7A 3P4SA 1UN9A 3SZ7A 2NXPA 2CBJA 2W62A 1OT8A 4JVSA 2A72A 2H6HA 3C3RA 2X0HA 4UV8B 3ZMTB 4IT4A 4X1IE 4XBFB 3FUEA 5L3CB 4BJMA 1BLXB 4EB6E 3LY8A 2CMRA 3CQXC 3QC1A 1IHBA 5EZYE 1VDYA 1ZV4X 2WXQA 3JAFA 4DR6T 1KF6A 3DRAA 3TXMA 5AQFB 4HVBA 2E9XD 2QRXA 2V4LA 1H6OA 4UWFA 3PUYF 5CCLA 3P4RA 1YKHB 5JR9B 1D8DA 3ZN3A 2B0OE 3HXFA 2ODVA 2WS3A 4IL9A 2WZIA 5FQ6A 3AS5A 3RRNB 2WPVA 4A63B 2BVMA 4IHJE 5CEAA 4GA0A 2IDOB 4K03A 4GU5A 4M3OA 4DV4T 3RO3A 2CPTA 3NOGD 2WXRA 5L4EA 1FVFA 4EZ4A 1E7VA 1D1BA 2JJ9A 2IC9A 2XCCA 3ASGA 3FU0A 4EQFA 4BT9A 2FI7A 4HOQA 5ITZF 2I1JA 3L82A 4FHJA 5LXTE 4UQXA 2RD0A 4UI9J 3ZT5A 2D0TA 3IBEA 1LVKA 4DUYT 2VGYA 3GZ2A 4XI0A 1MIWA 2WQHA 2CXDA 2LSJA 1E96B 3HYMB 2KWHA 4IULA 4OVUA 3TWTA 3KSLA 3B95A 4YDWA 3ULEG 3SI5A 5FMNA 4UWGA 3CVYA 1OXJA 3ZMZB 4NXMT 4HFCA 4LF8T 2BKNA 2BKGA 4MRUA 4CCAA 3C5RA 5CRVA 2IY0C 5BT1A 2WB5A 1LKXA 5BXUA 3UU5A 2CXFA 5FVKA 2LAHA 3VR9A 4DK5A 2C2LA 2XQAA 5HXHA 3K1SA 4DV7T 1IKND 2WU2A 3IF8B 1D0XA 4YDEA 3UXGA 4GTVA 1HX8A 4PJJA 1IXVA 3UM3A 2G0UA 3ZRHA 4J6IA 3VR8A 4UIGA 3RIAA 2I9CA 3AG1E 2OA5A 3RH3A 2QFCA 2VSOE 5AQHB 4JI8T 4ZZCA 5FTPA 2XQ3A 4B8CB 2BBHA 3DEPA 3F31A 4KBMB 3MXZA 4DX6D 2UWJG 3KFWX 2WXNA 2EHOA 5AQLB 3AEDA 2WXGA 3DXMG 4B89A 5LGTB 1D8EA 3UFGA 3CKDA 4PFPA 4TUYE 4EOZB 1XMOT 5JDLA 2W67A 1P5QA 4IDZA 4P0AA 2RP4A 4ABNA 2XGSA 1WYBA 1IAPA 2J47A 1HS7A 2GRMA 3AA0B 3R7QA 4JI7T 3VU7H 1BR1A 2WXIA 4LRZA 1HE8A 5G2NA 4RSYA 4YVQC 3Q7AA 2H89A 3N9LA 4KHZF 2ZXWE 3KEAA 1HU3A 1QYMA 4I6EA 3DSSA 3RIFA 1N11A 5AYWD 4A1SA 2XPZA 1G3NB 2P9IG 3HRAA 4CQIA 3HDXA 1NZNA 3R9AB 4NACA 1U4QA 3IHYA 3JAEA 2EIKE 2NWBA 5HRYA 2XTLA 2J9QA 2NR4A 3BQOA 2KBXA 3AEEA 1MNEA 4V1Av 3N9QA 4BJNA 4I9CA 2WXHA 3EU9A 3E0ZA 4WZXA 3S7JA 4QH5A 4LEUA 5LHIB 2VQET 5DIZA 4EPZA 4JC8A 3CQGB 2XJ7A 4G2VA 1J5WA 3LJNA 2LSYA 4U7IA 1RW2A 1E7UA 4Q96A 4UEMA 4DX5D 2XUEA 5EN5D 5DJQC 2VVNA 3K3NA 4JLEA 3Q79A 3D9JA 2QGSA 3OKQA 1IJ6A 3K3QC 4YHHT 3QUJA 3PH0C 4U3CA 3CVLA 4LMJA 3ISMC 3PRZA 4J7WA 1D0YA 2XPYA 3ML9A 4NIQA 4FJYA 5FXZA 1X79A 3K8PC 4JEHA 1A5EA 3ZYMA 1WY6A 3J9X1 2R6GF 4LF5T 3CVVA 2B76A 3ZYLA 2I1KA 3FUJA 3MV2B 2E5LT 4EAHA 4MFRA 4CI3B 3ZXSA 3MEKA 3PTRB 3X2QE 4JI6T 3ZN0B 2V7IA 3EIJA 4Z91A 4YTPA 2XEVA 3MJWA 3RF1A 2K3WA 2W4XA 3IV0A 5CMWA 3AG2E 3QB2A 1RZ4A 1N95A 4OYSA 2AJAA 4U8VD 3AG3E 3FY4A 2ZISA 5CCMA 1X81A 1H7CA 3UT4A 2NP9A 3NOCD 3RYCE 4TUMA 3UKRG 3AVRA 2LO6A 2QZAA 4O60A 5AN8A 5HI7A 5ADXL 1Z5SC 5HYAA 5JHAA 2H3RA 2WDQA 2OV8A 4YNDA 5KXJA 1E8XA 2VJ8A 2J49A 3NZUA 3CVUA 3DWLG 3QC9A 5EK3A 5KWDA 4L9PA 3NZPA 4HE8A 5A6CA 3MJXA 3MA9A 2BEDA 4K5BA 4ME2A 1IQRA 4I6GA 4FLBA 3C98A 5H6QB 3HVEB 5KJNA 5HXCA 3LY9A 2QA7A 3T8KA 2PFVA 5JJTA 2WQ6A 3UUNA 1TN8A 5FVLA 3O9XA 1LD7A 2LNIA 1UURA 3LG7A 3FTXA 2XAQB 4ANJA 2YHEA 4CT0A 2RG8A 4EBAA 3QOUA 4L7TA 3C4ZA 3CWZB 2HYZA 3G2UA 5ABFA 2C0SA 3QOFA 1XNQT 3F2EA 4GZCA 4ILAA 4NXNT 2R5SA 4DR5T 3CK8A 5AIJA 3JADA 1WR0A 3UPVA 4YTNA 3QB5A 4N2QA 4QH1A 4RG6A 4E6HA 4UWHA 4J8DA 5JRCB 4HFIA 5JTGA 2PTFA 4EYUA 1UX4A 4BETA 4TNVA 2KCVA 3MGBA 3U64A 4A98A 1HZ4A 4OAVB 4CZZB 4MLKA 5EKQD 1U3DA 1SVXA 5FYMA 1JCQA 3CSFA 2DHRA 4HWHA 1XDPA 1N94A 3EDVA 3GN5A 4UQYA 3M65A 4IRUA 2CA5A 2V0PA 3QJZA 3ONXA 4L2LA 1KZPA 3CIAA 4AJWA 4C0MA 5FINA 3TWSA 3QK0A 3V5SA 4I4TE 1J5ET 4XZ4A 5BR8T 3UUMA 5EYLA 4KX6A 5LP6E 4H9NC 4IDPA 3ZMUB 1VRBA 5CERB 3UT7A 4QXHB 2DIWA 4Z8XA 5M4YA 3QWVA 4CGVA 4G25A 5ETWA 3RKOA 4O8SA 3EHQA 4BTBA 2V4HC 2HN1A 2UY1B 3PUGA 3KVAA 1HO8A 3DPDA 1NENA 3T5VA 5BMVE 1WYCA 1MIYA 5AENA 4ILIA 2W2UA 2NTXA 2XAFB 4O4LE 2V5DA 1HNZT 2VGEA 2LHRA 3NBXX 3UTMA 2WDVA 4WAFA 4HFDA 3ASFA 3O48A 2L6JA 3T8MA 2IU1A 4GIWA 3CK6A 3O1HA 3PV0F 4PK5A 5A23A 2IOLA 4DV1T 1SA5A 3C4WA 4K5AB 3C51A 4KHPT 2AW6A 2WXOA 3AE8A 4BEPA 1Z6TA 4U07A 4AP2A 3RRWA 2MAWA 4D10C 4TZ4C 1K1AA 3SFYA 5J1GA 4GTTA 1JCRA 4LFBT 3G2SA 3OYXA 2PQNA 2BG9E 3RYIE 4KBQA 4GPKA 2PBIA 3ZC0A 4G1TA 4PJNA 2UXXB 3NKZA 5BUZA 4WNGA 2UUBT 2I0MA 3PUZF 1E90A 3CV0A 2A3DA 4ATGA 2Q9QC 3R84B 4YSYA 4YDYA 4U7YA 5G55A 4LF7T 4Q69A 3PEUB 2DWZA 2ES0A 4DI3A 2D2SA 5CA0E 4U04A 3FH8A 5M72A 3SF4A 4L5GA 5HEGA 2NYJA 2KZ7B 1DNPA 4A56A 1UW4B 4A3TA 3EI0A 2BTDA 3DBSA 3SO8A 1IZNB 3SBTB 3TAXA 3KV6A 2LSGA 4ANUA 5A7DB 4KUMB 3LDQB 2PJQA 1TYQG 2KXPC 3FP3A 5LP0A 3D9PA 4CXXA 1QLBA 4AQYT 5CECB 5CB4E 4CDRA 5HQ8A 2XZTG 2WQ7A 5BW8C 3FUDA 3K9IA 1GQEA 3PU8A 1XGWA 1E1HB 4AVXA 3ZHEB 4DNDA 1PC2A 4WNDA 5LNKA 1QNFA 2OEWA 4Z90A 3GA8A 4HFVA 2PQRA 3JXJA 2L8KA 3I0QA 2ILRA 4U31A 1KLXA 1S63A 1E8YA 3QB5K 3ENEA 2WXFA 2DLRA 1OEDC 2RKKA 4LNGA 1BU9A 3T5XA 5LCWC 2CRBA 3AAAB 2OVFA 4RQIA 3CVRA 2WXKA 4BERA 2RFAA 4B94A 1J1JA 4MLPA 2R17C 3ZNGA 1UK5A 3ZKJA 2Z6EA 3SFEA 5DBKA 2V1DB 5AQJB 2LKGA 4I1MA 4MBQA 4AIUA 1OEDE 2DL1A 5EIDA 4KT6B 3U4TA 2XEHA 1TNYA 4HS2A 3QKYA 4UELA 4JXTA 4WWPA 2OV9A 2KLQA 4GYOA 4HOTA 3PUJA 4OK0A 5JJ6A 4U95D 5CRUA 5L2LA 2E2AA 2WB2A 4IIJE 1N0QA 4U0SA 1OWPA 3LSVA 3UQ4A 2X6KA 4QQIA 4DX7D 2BG9A 3T1YT 2IOSA 4BFRA 2BF0X 4JI2T 3MCXA 2J62A 2WBLA 3SFZA 2X9WA 1MIVA 4OVVA 2CFZA 4LNUD 4K0RA 2LJLA 3OTNA 2LM9A 5ENTD 2HPJA 2N1GA 3SGHA 1MQSA 2A5UA 4EGWA 3QK6A 2YINA 3TWWA 3AEBA 2Q9QD 4DV2T 2F37A 3CVPA 3E30A 1SHZC 3TWQA 2P2CP 3OXLA 4BA9A 3B7BA 4C0EA 4ACLA 2LOSA 2SPCA 4XKBA 4Y6CA 4GKJT 3FHEA 5G04J 4UV9B 2PNNA 4CT4A 1FT1A 2QYWA 4B8AA 2WVIA 2Q9QA 1ZBPA 3GZSA 2VKDA 2JEKA 1NAFA 3VRBA 2GROB 3JYSA 3E32A 3LJ3A 4F6RC 4BSZB 4LUNU 4JW1A 3D9NA 4RVBA 4AM9A 4I1AA 2ZM0A 3SRZA 1BPOA 3EABA 4IN3B 3FTVA 3CVWA 3IEGA 4UQZA 5L3EB 2E5VA 3B57A 2XQ7A 2VK9A 3HIZA 2MTQA 5LBMA 1ELWA 5AQ7A 2FO1E 1HS6A 4BESA 1FJGT 4APFA 4G26A 3R6NA 5D0QD 2V6YB 3A5XA 1XDOA 4KI0F 4X5TA 3TGOA 3JCKC 2V7MA 2XHEB 4I50E 4LF6T 4YJ3E 3I5PA 4JA9A 3AEFA 2A9UA 4DI4A 2FUPA 3WI3A 3NRYA 3QAQA 3WG7E 2E8IA 2P58C 2EHOC 1OEDA 2WMOA 3LK3B 2D0UA 3Q78A 4J8YA 4ZI7E 5AJLA 2JQHA 4GTQA 4WUYA 3VRAA 4EZKA 3TJPA 5HEOA 3ZIMA 4AV7A 3UQ7A 5E75A 1YXRA 3TL5A 3CX7B 2J8SD 3EUHA 3SQVA 2NW9A 3RC8A 2FF4A 2J07A 3U3WA 1T72A 4ZXLA 2X51A 1S64A 5LJMA 3PEVB 3RIUC 3DSTA 3L17A 5L3BB 3LK42 5ARGA 4EEBA 1M62A 3MK7C 3KV9A 3ZN1B 4PUCA 2OCCE 3O4ZA 4CI2B 2MBGA 2X66A 2LUHA 3B7RL 5ABGA 3VLEA 3KBTA 1BI7B 2XCBA 3FZLB 5AQNB 5JA4D 5ANLA 3H3MA 5DQWA 2H6FA 2VKHA 2R2LA 1ZKEA 3ML8A 3N9PA 4ANXA 2WCAA 4GA1A 4I2ZA 4G2AA 3PUWF 4M1PA 2ETAA 1MMNA 1YYHA 1QSDA 2L0IA 3RKVA 3CLJA 1MYOA 3C3OA 3SY2A 3C3QA 4F1SA 5EDSA 4FI5A 4ASKA 4M7CA 2BS2A 3U66A 4GCNA 4WW0A 3R7RA 2VKJA 3AG4E 1L0VA 2X6FA 3W9GA 4F6RD 1JNRA 4U7EB 1JPLA 5B1AE 3UM2A 2J1DG 4WNKA 2ZGDA 3Q4AB 2IMLA 2BS4A 3V30A 2ODUA 1YQ3A 4UF0A 1YA0A 5CMYA 5ENRD 2KSRA 1S70B 3L16A 4CI1B 2E9XB 4AISA 5AQBA 2CCQA 2IF4A 5C2YA 5EIBE 5LX8A 1IJ5A 1S35A 3HXBA 4DLQA 4HLEA 4U2YA 3NZSA 4ACKA 1WLXA 1KK7A 4HI8A 4B93B 4BT8A 4QXCB 5LBQB 5LMNT 2HR2A 5L47A 2WWUA 4E85A 4AI6A 1MHQA 3B7UX 1UUSA 5IWAT 3ZSSA 2OOEA 1Y64B 5L3DB 4ANWA 3MKQA 5FWQA 4PNIA 5AAOA 2EHOD 2YQ8A 1VCTA 2IW5B 1MMDA 2WXPA 3VHLA 3OXGA 1T8BA 3EJNA 4ISSA 3JCFA 5JDNA 5LJNA 3FH7A 1V9DA 2F4VT 3WXXA 4GAAA 4ANVA 4J2CA 3LYAA 2UXCT 3W9FA 1FEWA 3JUEA 3URZA 2HPLA 1JNZA 2LRKA 4K0UA 4BAYB 3FUNA 3ABKE
chains in the Genus database with same CATH topology
4DO0A 3Q47B 3CMLA 2IAKA 2B1EA 2XGOA 2K24A 2ZM8A 3I9WA 1KT1A 3UQ3A 3AS4A 3VTYA 2P9BA 4PK6A 2YNQA 5FT9A 1T98A 2VSNA 1EDUA 5C1DA 3FXDB 3CHPA 2HM8A 2KC7A 2JLBA 3BK9A 5JDHA 3ZMVB 2J08A 3ZLIA 4GZ3A 2JMKA 4AKHA 4LERA 4YVOA 4DJAA 3PS6A 4A1GA 5D0OD 4GMLA 5FY7A 5BNWA 3V5UA 5T4YA 5LGNB 2Y3AA 1IHGA 3SHFA 4H9RC 2XRYA 3BQKA 3KEZA 4PH4B 2BVLA 5EK2A 1EYHA 3FU6A 5KMGP 2K9AA 5KCMA 2MYSA 3FU5A 4F53A 2HO1A 5LGUB 3PUSA 4FU3A 2KZTB 4UVAB 4CGWA 4J8EA 1E8ZA 3CVXA 3SBSA 5JJ7A 4P29A 3B13A 4AEZC 4FJZA 1S94A 4NURA 5HXRA 4J8FA 2H7OA 3FEXA 4TRQA 4EZHA 3LCAA 2R59A 1OWLA 3PNLB 3FU3A 3U78A 4OYJA 1QUUA 4URKA 4EYYR 3B7TA 4X20E 3CVNA 3PDYA 3D9OA 4G63A 4AQFA 4F3VA 1OXZA 3AU5A 4WBOA 1Z0PA 2CE7A 1VOMA 4JEHB 2KM4A 3HVEA 3C50A 3QARA 2MRIA 3FTSA 1MMAA 2VGXA 2C5KT 3UUXA 2YEVC 2DI4A 5J08A 3D9KA 3KDSE 3C64A 3L3PA 3I0OA 2I59A 5C8YE 3EDUA 3PDNA 5ANRA 2M67A 4WBNE 3FFLA 1H0AA 2YK0A 4GZ6A 3OAWA 4ILHB 5AJDA 3E08A 5FJYA 1NA3A 4G23A 1LF8A 5L3GB 2DWGA 1ELKA 1H2TC 2CEAA 4E7SA 2VTBA 4EIWA 1HH8A 3FXEB 5E0OA 3L6AA 3FH5A 4QX8B 4MS6A 2LSKA 1U3CA 4FP7A 1O3XA 4F7AA 4H63V 5FY0A 2X68A 3LFMA 4U8HA 3S7BA 3HKEE 2WMNA 4GYSA 5KJKA 2QY7A 5FXVA 4O4HE 5LOVE 2CLYC 3FDHA 2LSVA 4MHCA 3RIBA 3PURA 5BV0A 3FBLA 4XKCA 2L9QA 4APOA 5CA1E 4HTEA 2XRZA 3AVSA 2FO7A 5CHEE 3OJAA 1ZHCA 4GK5E 4PJMA 4ISTA 2KCKA 3LS8A 2EQXA 3N9OA 3DP7A 5FXXA 4L2YA 2W61A 3FB2A 3CK9A 1NWMX 3JQ1A 3CHSA 3CKBA 4FULA 3D0TA 1UG3A 4AKIA 3LY7A 3ZW3A 1DVPA 3ZJ1A 1JWGA 4TV9E 3GN5B 4QHOA 4PS3A 3UT8A 2L0TB 4ZI2C 1H2VC 5HXEA 5LFAA 3NRXA 4AXHA 4UI9C 4IGUA 3CK7A 3G2TA 2ONDA 3FTZA 3ZCJA 1BR2A 4ADZA 2Y48B 2CHXA 4CRWA 3RX6A 5IHYA 3HR0A 2W63A 3CHMA 4EBAG 3P8CD 2C0MA 5EK4A 3AAIA 4G11A 3CX6B 5JHBA 3CHOA 3CGHA 3RRCA 4FADA 1Y8MA 2KWIB 3MKDA 4QXBB 5JVDE 1OWOA 3BG0B 4JEUA 3KV4A 3LVQE 3PNTB 3RK6A 1JWFA 3RO2A 3ANWB 1UJJA 4MKTA 3L13A 3ZPOA 3JQ0A 3LXUX 4PW8A 4W9RA 4HXIA 3RC3A 3FUHA 3TXNA 5IYZE 3LK2B 2NW7A 3AU4A 4N78D 4UXNB 3IHVA 3N2OA 4GA2A 4BWRA 4TN7B 4E7ZA 5T3RA 4I43B 1IQUA 1H2UA 4YFSA 4R7LA 4CDMA 5FXWA 3PE0A 3ONKA 3ZFWA 4NRHB 2JPFA 5G05C 3VKGA 3CR3A 5JR9C 4O4JE 2DBAA 3TKLB 2X6HA 4XIFA 4TV3A 4ZI2D 2GK9A 4I9EA 3NQPA 3VTXA 3CQCB 3T8OA 5JREA 3NZQA 3DJBA 3ZC1A 1KT0A 1YKEB 4PS8A 4QX7B 4KVOA 2HH7A 3GWHA 1OWNA 3L08A 4JPSA 4B6XA 3PU3A 1E8WA 4PFOA 2VB6A 4O6FA 5DABA 1OUVA 4AKGA 4TX5A 3CSTA 5LG4A 1EZ3A 4ILUA 2PZIA 2YU2A 4O4IE 3PREA 2L9BA 3KV5A 5T8IA 4FLHA 3BG1B 3UFEA 2LAIA 4JHKA 3LBXA 5KJMA 3FUIA 2IONA 3ZYKA 2V5FA 2KATA 4PJLA 4Q94A 2C0LA 3PUQA 1EPUA 4NUUA 4X1KE 4BY6A 3RRMB 4GB9A 3QWWA 3IEEA 5KDMC 2N2NA 4TUUA 5L3FB 4HORA 2I2OA 2DNXA 4ZI3C 3ZVVA 4AOFA 1YD8G 3Q49B 2Q9QB 4ZHQE 3WAJA 4OHFA 3U9WA 3RRUA 4GYWA 2CHWA 2VSYA 1W3BA 4OYKA 4O2AE 2X9XA 3ZPJA 4HKAA 1U5PA 1JUQA 4H9SE 3PE4A 4PK4A 3ZEFB 4HOSA 1QZ2A 4C91A 3NF1A 1MNDA 5F8PA 3CHRA 2KXPB 3O1JA 1HG2A 3Q5MA 3ASDA 5JR9A 3LDZA 4IE7A 2AVPA 4FA6A 2VL8A 3IKOB 4QKNA 2LHNA 2A2FX 3UULA 3GMIA 4AKRB 1HXIA 2C5IT 2V7JA 4I55E 3HKBE 3S7DA 1WM5A 1LRZA 4H9OC 4G24A 3L09A 4ERRA 4A55A 2VKOA 1YW0A 4AQGA 4PDXA 3CVQA 1UJKA 5FZSA 5FZRA 2XGMA 3D9LA 2NOXA 3PVLA 3N2KE 3SOLA 4P0BA 2W0GA 3ESKA 3LVRE 4KP3C 2X9HA 2E9XA 3FUFA 4LCTA 4JZYA 1NA0A 3Q2MA 3HHMA 2W00A 4GYYA 4UI9K 2XPIA 4KMOA 1TJCA 2VYIA 2ACXA 1L5JA 1AJ3A 4FJOA 3HKDE 2YU1A 3IBPA 3FULA 3C4XA 2CM0A 4ZI3D 2ZMAA 3O4XE 3JC6C 3W15B 3CPZA 4AY6A 3Q9DA 3MZKB 4AIFA 2PM6A 1WAO1 5JQGE 1B7TA 4XZCA 4KXKB 4FC8A 4AQFC 4UF0B 2X67A 3RYHE 4I2WA 4JHRA 5LHHB 3TG4A 3WAKA 2CG2A 3KINB 1NP7A 4BTAA 4AY5A 3SWHA 4ZOLE 5J2UE 4U63A 2AXUA 3APFA 1FVHA 5E76A 1N54A 3RU0A 1UX5A 3DTOA 2PG8A 3BQLA 4DVDA 5KX5E 3MKQB 5JH7E 1H19A 3E22E 1HTJF 1S0PA 1Z3XA 5J90A 2FULA 4GOUA 1FMVA 3MA5A 5LCWJ 2MOZA 2EHOB 4IE0A 3AB3B 2CWYA 4X1YE 3HA4A 4HN9A 4GZDA 4KVMA 4CXYA 5LYJE 3LJCA 2V7LA 4HEAA 4U72A 4UVCB 2XASB 1WR6A 4N3CA 3ESLA 4H7YA 4JUYA 3JUIA 5G05J 1SZAA 4DMVA 3AAEB 3SNXA 3L54A 3ZYQA 3GW4A 2X0LB 4N39A 2KZTA 3FHNA 2L3LA 2IC6A 3VLFA 4L23A 3P7IA 2H7VC 4U74A 5HWYA 2E2EA 5HAXA 2Y6XA 4C9BB 5ENNA 3BEEA 3I1AA 1HCIA 2C5JA 2LT3A 3JC6D 3ETUA 3FTWA 3S7FA 1EF1C 4KYOB 4DMWA 3FTUA 4HGAA 2ZU6B 3FWVA 4XAXB 2CFUA 4H63H 1IYGA 1D1AA 4QFVA 3HL6A 2X6IA 2LSIA 4NUVA 2VASA 3FUMA 4PAGA 4IYPA 4O2BE 2NSZA 2KCLA 3EHNA 3P2BA 2GGFA 3TG5A 4AXPA 4YJ2E 5G04C 4Y6WA 4JL0A 4QWNB 3P1UA 2IFUA 2WSSV 3UT5E 3RPUA 5JDQA 3N9NA 3GZ1A 4DPRA 4EXTA 1FIOA 2Y4TA 3FTYA 3FBZA 3RJVA 1HF8A 3ETVA 3UTKA 1A17A 3GYZA 1N52A 2XAJB 5JRCA 4HOUA 4GYRA 4P09A 2K5BB 2WM9A 3MACA 3I4GA 3Q5XA 5EX0A 2VGXB 2CG3A 1PAQA 3UUXB 5A1LA 4GZ5A 4WNEA 3QDNA 2ZM2A 1BR4A 1GW6A 5EX3A 4IE6A 3OBVE 3C98B 2LSUA 2E0IA 3OXFA 2X6JA 3PZDA 1US7B 2JRKA 5JDGA 1ZEEA 4DLOA 1SA0E 4GCOA 2OVBA 4H9QC 3ZGQA 1OWAA 4L1BA 3KBUA 2VTBB 4TV8E 2NW8A 2UY1A 4GK0E 2I6HA 4FHKA 3KAEA 4ZS3A 4CDNA 3SD5A 1D0ZA 3UX4A 3UMVA 3CKCA 4EECA 3ZJ2A 5FNVE 2KNDA 2V7KA 2BUGA 4HFGA 5FZQA 2AXVA 3I3NA 2UXNB 2KT9A 2XQ0A 1QQEA 5FY1A 1XNFA 4XI9A 2N9DA 3ASHA 1Y6IA 2D5UA 3O1IA 4H7XA 2XAHB 3N5LA 4BX8A 4EZJA 5AFUL 5LA6E 4ZS2A 3MV3B 3ULQA 5H6RB 2M63A 2BZBA 3EVYA 3L22A 2RA1A 4RG9A 5TAOA 3ZMSB 4N3BA 2FEZA 2V26A 2ZLYA 4NQ0A 5J2TE 4A3VA 2V8SE 3FUKA 3AA1B 3EHMA 4YLHA 5LHGB 2GRLA 5JDMA 5F3JA 4YHJA 1Z3YA 3Q5WA 2LOPA 3D9IA 1B89A 4KZCA 3BQIA 4CXWA 2J4BA 3ANWA 4EZLA 4AKLA 3ZHEA 3ONLA 1H6KA 4N5CA 2IQCA 3G2VA 2MHKA 5HXSA 3LKUA 3LEWA 2A4ZA 1TJFA 3Q15A 5FQ8A 3S2AA 4CEMA 4I43A 2VSXE 2J4DA 5KJLA 3AA7B 3HI2A 3SS1A 3MYVA 4DBRA 4XE0A 4KZ0A 2IJGX 4B0ZA 1PY1A 2DCFA 4J0UA 3MX3A 2LEHA 2JMHA 3VLDA 1SZ9A 2FBNA 3APDA 2PL2A 3B7SA 4JEUB 3PE3A 1OWMA 3H3AA 5FQ4A 4J8SA 4IE4A 3HKCE 1ELRA 2DCPA 4N2SA 4UWLA 2K48A 2KMFA 3FEYA 4U0UA 4U0ZA 1HG5A 2XQYA 3PUAA 4UWKA 2X3MA 3QWPA 3KS2A 5FP3A 3MZLB 5JDFA 3LPZA 2CLYB 1WRDA 3IHRA 1X5BA 3H37A 3N9MA 3N71A 4WWOA 2Q7FA 3EDTB 3EIQC 2YHCA 4I1OB 3I4RB 3CX8B 5HWXA 2KINB 4L9IA 4I6JA 1D1CA 1LVFA 2VWAA 4WWNA 4XX5A 2BDEA 3CHQA 3OYZA 4JHJA 5ARFA 4C90A 4GMJA 2WAUA 1INZA 1G8XA 4V3IA 1TEZA 3APCA 2E9XC 1UCUA 5GONE 4KMCA 3AA6B 2CWOA 3CEQA 2JQQA 3PUKA 2Y8DA 2XAGB 1BR0A 2MOWA 5LOZA 2PM7A 3J7Yq 4H9PC 2X9YA 3D9MA 2AXZA 2WXMA 3QNKA 3E4BA 2AWIA 4WNFA 5BV1A 2XHEA 1G73A 1FCHA 3S4UA 3D3MA 2NC9A 4DBQA 1MMGA 4L0RA 2LE8A 3RYFE 1KNZA 2DWKA 2GW1A 3ZEFA 4ILGA 1SQMA 5LCYA 3KD7A 4BX9A 1CUNA 3VKHA 4UVBB 4BSXA 4MALA 2VQ2A 3I9YA 3LBXB 2WXLA 3N2GE 2NTYA 3MKRA 5BPPA 2X38A 3ZCIA 2Y4UA 3G2WA 3F57A 4IE5A 2CHZA 3KVBA 1HFAA 2CXLA 2WXJA 5DQVA 2J09A 1FMWA 1ZU2A 4I17A 3U3IA 3AS8A 4N3AA 1UN8A 4PS7A 4OFZA 5FQ7A 3K3OA 4JA7A 1UN9A 3SZ7A 2NXPA 2W62A 4JVSA 2A72A 4UV8B 3ZMTB 4XBFB 3FUEA 4X1IE 5L3CB 4BJMA 4EB6E 3LY8A 2CMRA 3CQXC 3QC1A 5EZYE 1VDYA 1ZV4X 2WXQA 3TXMA 4HVBA 2E9XD 2V4LA 4UWFA 5CCLA 1YKHB 5JR9B 3ZN3A 2ODVA 5FQ6A 3AS5A 3RRNB 2WPVA 2BVMA 4IHJE 4GA0A 4K03A 4GU5A 4M3OA 3RO3A 2WXRA 1FVFA 4EZ4A 1E7VA 1D1BA 2JJ9A 2IC9A 2XCCA 3ASGA 3FU0A 4EQFA 4BT9A 2FI7A 4HOQA 2I1JA 4UQXA 4FHJA 5LXTE 2RD0A 4UI9J 2D0TA 3IBEA 1LVKA 2VGYA 3GZ2A 4XI0A 1MIWA 2WQHA 2CXDA 2LSJA 1E96B 3HYMB 2KWHA 4IULA 4OVUA 3SI5A 5FMNA 4UWGA 3CVYA 3ZMZB 4CCAA 4MRUA 5BT1A 1LKXA 2CXFA 2LAHA 4DK5A 2C2LA 5HXHA 3IF8B 1D0XA 1HX8A 4PJJA 3ZRHA 2G0UA 4J6IA 4UIGA 2I9CA 2OA5A 3RH3A 2QFCA 2VSOE 5FTPA 4B8CB 3F31A 4KBMB 3MXZA 2UWJG 3KFWX 2WXNA 2EHOA 2WXGA 4B89A 5LGTB 4EOZB 3CKDA 4PFPA 4TUYE 5JDLA 1P5QA 4IDZA 4P0AA 2RP4A 4ABNA 2XGSA 1WYBA 1IAPA 1HS7A 2GRMA 3AA0B 3R7QA 2WXIA 3VU7H 1BR1A 4LRZA 5G2NA 1HE8A 4RSYA 4YVQC 3N9LA 1HU3A 4I6EA 5AYWD 4A1SA 2XPZA 4CQIA 3HDXA 1NZNA 3R9AB 4NACA 1U4QA 3IHYA 2NWBA 2XTLA 2J9QA 1MNEA 4V1Av 3N9QA 4BJNA 4I9CA 2WXHA 3E0ZA 3S7JA 4LEUA 5LHIB 5DIZA 4EPZA 4JC8A 3CQGB 4G2VA 2LSYA 1E7UA 4Q96A 4UEMA 2XUEA 5DJQC 3K3NA 4JLEA 3D9JA 2QGSA 3OKQA 1IJ6A 3K3QC 3QUJA 3PH0C 3CVLA 3PRZA 1D0YA 2XPYA 3ML9A 4FJYA 5FXZA 1X79A 3K8PC 4JEHA 3ZYMA 1WY6A 3J9X1 3CVVA 2I1KA 3ZYLA 3FUJA 3MV2B 4EAHA 4MFRA 4CI3B 3ZXSA 3MEKA 3PTRB 3ZN0B 2V7IA 3EIJA 2XEVA 3MJWA 3IV0A 5CMWA 3QB2A 4OYSA 3FY4A 5CCMA 1H7CA 3UT4A 2NP9A 3RYCE 3AVRA 2LO6A 5HI7A 5ADXL 5HYAA 5JHAA 2H3RA 2OV8A 4YNDA 1E8XA 2VJ8A 2J49A 3NZUA 3CVUA 3QC9A 5EK3A 5A6CA 3NZPA 4HE8A 3MJXA 3MA9A 4ME2A 1IQRA 4I6GA 4FLBA 3C98A 5H6QB 3HVEB 5KJNA 5HXCA 3LY9A 2QA7A 2PFVA 5JJTA 2WQ6A 3UUNA 3O9XA 2LNIA 3LG7A 3FTXA 2XAQB 4ANJA 2YHEA 4CT0A 2RG8A 4EBAA 3QOUA 4L7TA 3C4ZA 3CWZB 2HYZA 3G2UA 2C0SA 3F2EA 4GZCA 2R5SA 3CK8A 5AIJA 3UPVA 4N2QA 4RG6A 4E6HA 4UWHA 4J8DA 5JRCB 4EYUA 1UX4A 2KCVA 3MGBA 3U64A 1HZ4A 4CZZB 4MLKA 5EKQD 1U3DA 5FYMA 3CSFA 2DHRA 3EDVA 3GN5A 4UQYA 3M65A 4IRUA 2CA5A 2V0PA 3QJZA 3ONXA 4L2LA 3CIAA 4AJWA 4C0MA 3QK0A 3V5SA 4I4TE 4XZ4A 3UUMA 5LP6E 4H9NC 3ZMUB 1VRBA 3UT7A 4QXHB 2DIWA 4Z8XA 5M4YA 3QWVA 4CGVA 4G25A 5ETWA 3RKOA 4O8SA 4BTBA 2UY1B 3PUGA 3KVAA 1HO8A 3DPDA 3T5VA 5BMVE 1WYCA 1MIYA 5AENA 4ILIA 2NTXA 2XAFB 4O4LE 2LHRA 3NBXX 4WAFA 3ASFA 3O48A 2L6JA 3T8MA 2IU1A 4GIWA 3O1HA 4PK5A 5A23A 2IOLA 3C4WA 3C51A 2AW6A 2WXOA 1Z6TA 4U07A 4AP2A 3RRWA 4D10C 4TZ4C 5J1GA 3G2SA 3OYXA 2PQNA 3RYIE 4KBQA 4GPKA 2PBIA 3ZC0A 4G1TA 4PJNA 2UXXB 5BUZA 4WNGA 1E90A 3CV0A 2A3DA 4ATGA 2Q9QC 3R84B 5G55A 4Q69A 3PEUB 2ES0A 4DI3A 2D2SA 5CA0E 4U04A 3FH8A 5M72A 3SF4A 4L5GA 2KZ7B 1DNPA 4A56A 1UW4B 4A3TA 3DBSA 2BTDA 1IZNB 3SBTB 3TAXA 3KV6A 2LSGA 4ANUA 5A7DB 4KUMB 2PJQA 3FP3A 5LP0A 3D9PA 4CXXA 5CB4E 4CDRA 5HQ8A 2WQ7A 5BW8C 3FUDA 3K9IA 1XGWA 3PU8A 1E1HB 4AVXA 3ZHEB 4DNDA 1PC2A 4WNDA 5LNKA 1QNFA 3GA8A 4HFVA 2PQRA 2L8KA 3I0QA 2ILRA 1KLXA 1E8YA 3ENEA 2WXFA 2DLRA 3T5XA 5LCWC 3AAAB 2OVFA 3CVRA 2WXKA 4B94A 4MLPA 2R17C 2Z6EA 5DBKA 2V1DB 4I1MA 4MBQA 3U4TA 4KT6B 4HS2A 3QKYA 4UELA 4JXTA 4WWPA 4GYOA 2KLQA 4HOTA 3PUJA 4OK0A 5JJ6A 5L2LA 2WB2A 4IIJE 4U0SA 1OWPA 2X6KA 2IOSA 4BFRA 2BF0X 3MCXA 2WBLA 3SFZA 2X9WA 1MIVA 4OVVA 2CFZA 4K0RA 2LJLA 3OTNA 2LM9A 2HPJA 2N1GA 3SGHA 1MQSA 2A5UA 3QK6A 2YINA 2Q9QD 3CVPA 1SHZC 3OXLA 4BA9A 4C0EA 4ACLA 2LOSA 2SPCA 4XKBA 4Y6CA 3FHEA 5G04J 4CT4A 4UV9B 4B8AA 2WVIA 2Q9QA 1ZBPA 3GZSA 2VKDA 2JEKA 1NAFA 3JYSA 3LJ3A 4F6RC 4LUNU 4JW1A 3D9NA 4RVBA 4AM9A 4I1AA 2ZM0A 3SRZA 1BPOA 4IN3B 3FTVA 3CVWA 3IEGA 4UQZA 5L3EB 3B57A 2VK9A 3HIZA 2MTQA 5LBMA 1ELWA 1HS6A 4APFA 4G26A 3R6NA 5D0QD 3A5XA 3TGOA 3JCKC 2V7MA 2XHEB 4I50E 4YJ3E 3I5PA 4JA9A 4DI4A 3WI3A 3NRYA 3QAQA 2E8IA 2P58C 2EHOC 2WMOA 3LK3B 2D0UA 4ZI7E 5AJLA 4WUYA 4EZKA 3TJPA 3ZIMA 4AV7A 5E75A 3TL5A 3CX7B 3EUHA 2NW9A 3RC8A 2FF4A 2J07A 3U3WA 2X51A 5LJMA 3PEVB 3L17A 5L3BB 3LK42 5ARGA 3MK7C 3KV9A 3ZN1B 4PUCA 3O4ZA 4CI2B 2MBGA 2X66A 3B7RL 3VLEA 3KBTA 2XCBA 5ANLA 5DQWA 2VKHA 1ZKEA 3ML8A 3N9PA 4ANXA 4GA1A 4I2ZA 4G2AA 4M1PA 1MMNA 1QSDA 2L0IA 3RKVA 3CLJA 4F1SA 5EDSA 4FI5A 4ASKA 3U66A 4GCNA 4WW0A 3R7RA 2VKJA 2X6FA 1JPLA 2J1DG 4WNKA 3Q4AB 2ODUA 4UF0A 1YA0A 5CMYA 3L16A 4CI1B 2E9XB 5C2YA 2CCQA 2IF4A 5LX8A 1IJ5A 1S35A 4DLQA 4HLEA 3NZSA 4ACKA 1WLXA 1KK7A 4BT8A 4QXCB 5LBQB 2HR2A 2WWUA 4E85A 4AI6A 1MHQA 3B7UX 2OOEA 1Y64B 5L3DB 4ANWA 3MKQA 5FWQA 4PNIA 2EHOD 2YQ8A 2IW5B 1MMDA 2WXPA 3VHLA 3OXGA 3EJNA 4ISSA 5JDNA 5LJNA 3FH7A 1V9DA 3WXXA 4GAAA 4ANVA 4J2CA 3LYAA 1FEWA 3URZA 2HPLA 4K0UA 4BAYB 3FUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDU A;  1SZ9 A;  4HFG A;  3RRU A;  1HX8 A;  1VDY A;  4AVX A;  1INZ A;  4FLB A;  1UJJ A;  3ZYM A;  5CMW A;  3ZYK A;  3D9O A;  3ONK A;  2BF0 X;  3D9I A;  3LDZ A;  3ZYQ A;  5CMY A;  4Q94 A;  1UJK A;  1X5B A;  3G2T A;  4Q96 A;  3ZYL A;  3G2S A;  4NAC A;  1EYH A;  2L0I A;  3CLJ A;  1JUQ A;  2LO6 A;  4GZD A;  2DCP A;  3D9L A;  1DVP A;  1H0A A;  2KM4 A;  1HF8 A;  2V8S E;  1JWG A;  3D9J A;  2MOW A;  4JXT A;  5LOZ A;  3G2U A;  3D9P A;  2L0T B;  3ONL A;  5LP0 A;  1PY1 A;  2DIW A;  1HG5 A;  3G2V A;  3D9N A;  1LF8 A;  3G2W A;  1MHQ A;  4GZC A;  4FU3 A;  1JPL A;  1SZA A;  2QY7 A;  5J08 A;  3D9M A;  1JWF A;  1ELK A;  3D9K A;  1HG2 A;  1XGW A;  1HFA A; 
#chains in the Genus database with same CATH topology
 3SFD A;  2UUC T;  3NWI A;  4DO0 A;  1O5M A;  3TLT A;  3Q47 B;  5AQM B;  4LF4 T;  3CML A;  5AAR A;  2IAK A;  3RQU A;  2B1E A;  4ILB A;  3RHW A;  2XGO A;  2K24 A;  5AQG B;  2ZM8 A;  5AQ9 A;  3I9W A;  1KT1 A;  1O1R A;  3Q9U C;  3UQ3 A;  3RIU A;  4IDN A;  3AS4 A;  1JCS A;  3VTY A;  3RKG A;  2JAB A;  1WCR A;  2P9B A;  4PK6 A;  2P9K G;  2YNQ A;  3PUX F;  5FT9 A;  1T98 A;  2VSN A;  3DPY A;  1TNB A;  1EDU A;  5C1D A;  3FXD B;  3HG0 D;  2UUA T;  1FT2 A;  3UUB A;  2HM8 A;  2H6I A;  2JLB A;  2KC7 A;  3BK9 A;  3AE6 A;  3CHP A;  4OAU C;  5AQR B;  5JDH A;  3ZMV B;  5IY5 E;  2J08 A;  3ZLI A;  4GZ3 A;  2JMK A;  4AKH A;  3E33 A;  4LER A;  4YVO A;  4DJA A;  3PS6 A;  4A1G A;  5AQV B;  5D0O D;  4GML A;  5FY7 A;  4C48 B;  3AEC A;  5BNW A;  3V5U A;  3PJA J;  5T4Y A;  5LGN B;  1BI8 B;  2Y3A A;  1IHG A;  3SHF A;  3P50 A;  1MX2 A;  5EYP F;  2FBW A;  4H9R C;  2M6B A;  2XRY A;  3BQK A;  3KEZ A;  1HNX T;  5CBO A;  4ZEY A;  4PH4 B;  2BVL A;  5EK2 A;  1EYH A;  3FU6 A;  5KMG P;  4UUC A;  2K9A A;  5KCM A;  1MX4 A;  2MYS A;  3FU5 A;  1TNU A;  4F53 A;  3V2X A;  4ZZB A;  4DV3 T;  2EIL E;  3ABL E;  2HO1 A;  5LGU B;  4GTR A;  1OCO E;  5ABE A;  2XM1 A;  3PUS A;  4FU3 A;  2KZT B;  2JQK A;  4UVA B;  4CGW A;  4J8E A;  1E8Z A;  3CVX A;  3BU8 A;  3SBS A;  5JJ7 A;  4P29 A;  3B13 A;  4AEZ C;  4FJZ A;  1S94 A;  4JI0 T;  4NUR A;  5HXR A;  4J8F A;  2H7O A;  3FEX A;  4GPM A;  3UU6 A;  4TRQ A;  4DV0 T;  4EZH A;  3LCA A;  2R59 A;  1OWL A;  5BXO A;  3PNL B;  3JXI A;  3T9K A;  3FU3 A;  3U78 A;  4OYJ A;  1MZC A;  1QUU A;  5CFB A;  4EYY R;  5IUX A;  3B7T A;  4URK A;  4HQD A;  4X20 E;  2LM2 A;  3CVN A;  3PDY A;  3D9O A;  4G63 A;  4AQF A;  3DSV A;  3ASN E;  4F3V A;  1OXZ A;  2FJB A;  2WY2 A;  1K8K G;  3AU5 A;  4WBO A;  1Z0P A;  3AXJ A;  4TWD A;  1D9S A;  2ETC A;  2CE7 A;  1VOM A;  4JEH B;  1HNW T;  2KM4 A;  3HVE A;  3C50 A;  5AQQ B;  2MRI A;  3FTS A;  1KNP A;  3QAR A;  4YSX A;  1MMA A;  4EHM A;  2VGX A;  2X0Y A;  2C5K T;  5HEU A;  2YEV C;  3UUX A;  2XPK A;  2DI4 A;  5J08 A;  3D9K A;  3KDS E;  3C64 A;  3L3P A;  3I0O A;  1XMQ T;  3FZM B;  2I59 A;  5C8Y E;  3EDU A;  3PDN A;  5ANR A;  2M67 A;  4YSZ A;  2XQ4 A;  4WBN E;  3FFL A;  3B5M A;  1H0A A;  2YK0 A;  4GZ6 A;  3OAW A;  4ILH B;  5AJD A;  3E08 A;  5FJY A;  1NA3 A;  4G23 A;  3RSE G;  2XQ8 A;  1LF8 A;  5L3G B;  2DWG A;  1ELK A;  1H2T C;  2CEA A;  4E7S A;  2VTB A;  4EIW A;  4K0K T;  4GTP A;  1HH8 A;  3FXE B;  5E0O A;  3L6A A;  3FH5 A;  4QX8 B;  2LXM A;  4MS6 A;  5AQO B;  3HXD A;  2LSK A;  1U3C A;  4FP7 A;  1O3X A;  4F7A A;  4CYM D;  4H63 V;  5FY0 A;  2X68 A;  3LFM A;  4U8H A;  3S7B A;  3HKE E;  2WMN A;  5B3S E;  4A5X A;  4GYS A;  3UM0 A;  2GRP B;  5KJK A;  2HHH T;  4B3M T;  2QY7 A;  4NIK A;  5FXV A;  4O4H E;  1W09 A;  5LOV E;  2CLY C;  3FDH A;  2LSV A;  5KNH D;  4NPP A;  4MHC A;  2GRN B;  2XQ6 A;  3RIB A;  3PUR A;  5BV0 A;  3G06 A;  5ABF B;  3FBL A;  4XKC A;  2L9Q A;  2UXD T;  4APO A;  5CA1 E;  4HTE A;  2UXB T;  2IEJ A;  2XRZ A;  3AVS A;  1K1B A;  2FO7 A;  5CHE E;  3OJA A;  1ZHC A;  4GK5 E;  4PJM A;  4TWH A;  4IST A;  2KCK A;  3LS8 A;  2WWV A;  1N0R A;  2EQX A;  3N9O A;  2RFM A;  4LNB A;  3DP7 A;  2MYO A;  5FXX A;  4L2Y A;  2W61 A;  3FB2 A;  3CK9 A;  1NWM X;  3RLF F;  3JQ1 A;  1N4S A;  3CHS A;  2WU5 A;  4GTM A;  2FJE A;  3CKB A;  4FUL A;  3AEG A;  3D0T A;  3UIP C;  1UG3 A;  4AKI A;  2VVS A;  3LY7 A;  3ZW3 A;  2BG9 C;  1DVP A;  3NBN B;  3ZJ1 A;  3ULY A;  1N9A A;  1JWG A;  4TV9 E;  3GN5 B;  4QHO A;  4PS3 A;  3UT8 A;  2L0T B;  4ZI2 C;  2FJD A;  1H2V C;  4GTS A;  5HXE A;  5LFA A;  4JV5 T;  4ATZ D;  3NRX A;  4AXH A;  3AE9 A;  4UI9 C;  4IGU A;  3CK7 A;  1DC2 A;  3G2T A;  2OND A;  3FTZ A;  5LB7 B;  4U96 D;  2ZIR A;  3ZCJ A;  3P4P A;  1BR2 A;  4ADZ A;  2WQY A;  2Y48 B;  2CHX A;  1OY3 D;  2LKH A;  4CRW A;  3RX6 A;  5IHY A;  3HR0 A;  2W63 A;  3EUV A;  3CHM A;  4EBA G;  3P8C D;  4TWF A;  5ABH A;  2C0M A;  5EK4 A;  3AAI A;  2P9L G;  2DZO A;  4G11 A;  4ZHB A;  3R9M A;  1DCQ A;  3CX6 B;  5JHB A;  3CHO A;  3CGH A;  1T7S A;  3RRC A;  2H6G A;  4FAD A;  1Y8M A;  2DYS E;  3IA3 A;  4MBG A;  2ZGG A;  2KWI B;  3MKD A;  4QXB B;  4CZ2 D;  2RPA A;  5JVD E;  3UU4 A;  1OWO A;  3EU5 A;  4K5C A;  3BG0 B;  4JEU A;  3KV4 A;  3LVQ E;  3PNT B;  3RK6 A;  1JWF A;  3RO2 A;  4X66 T;  3ANW B;  1Z8U A;  2V5Q C;  2LLY A;  1UJJ A;  4MKT A;  3L13 A;  3ZPO A;  3JQ0 A;  5HEJ A;  3LXU X;  4PW8 A;  4W9R A;  4HXI A;  4QH4 A;  3RC3 A;  3DXK G;  3FUH A;  1XZY A;  3TXN A;  5IYZ E;  1N36 T;  3LK2 B;  1WDY A;  2NW7 A;  3AU4 A;  4N78 D;  4UXN B;  3IHV A;  3N2O A;  4GA2 A;  4BWR A;  5EIL A;  4TN7 B;  4E7Z A;  4WYV A;  5T3R A;  4I43 B;  1IQU A;  1H2U A;  4YFS A;  4R7L A;  4CDM A;  5FXW A;  4X64 T;  3PE0 A;  2IO3 C;  3ONK A;  4YDO A;  1UGO A;  1N34 T;  3ZFW A;  4NRH B;  2JPF A;  1TN7 A;  5G05 C;  1DU2 A;  3VKG A;  3CR3 A;  5JR9 C;  4O4J E;  2A5E A;  2DBA A;  2F8Y A;  3TKL B;  2Y1L E;  3RQW A;  2X6H A;  4XIF A;  5AQT B;  2Y69 E;  3Q73 A;  4DUZ T;  4TV3 A;  5H7P A;  2XS8 A;  4ZI2 D;  2GK9 A;  4I9E A;  3NQP A;  2XQ9 A;  3VTX A;  3CQC B;  3T8O A;  5JRE A;  4JD2 G;  3NZQ A;  3DJB A;  3ZC1 A;  1KT0 A;  1YKE B;  5ENO D;  4PS8 A;  4QX7 B;  4KVO A;  1N32 T;  2HH7 A;  4DID B;  3GWH A;  2ZM6 T;  1NFI E;  1OWN A;  2XM2 A;  3L08 A;  2XEN A;  4JPS A;  3FZH B;  4O1P A;  2J4G A;  4B6X A;  3PU3 A;  1E8W A;  4PFO A;  2VB6 A;  4O6F A;  5ENS D;  1Q2Z A;  5DAB A;  1OUV A;  4AKG A;  3A8Y C;  4TX5 A;  3CST A;  5F5W A;  5LG4 A;  1EZ3 A;  4ILU A;  2PZI A;  5B1B E;  3ZKR A;  1N4Q A;  2YU2 A;  2HE0 A;  4O4I E;  2XY8 B;  2BG9 B;  3PRE A;  5CGM A;  1YCS B;  2L9B A;  3KV5 A;  3ASO E;  4LG6 A;  4FLH A;  5T8I A;  3BG1 B;  3UFE A;  4IRE A;  2LAI A;  4JHK A;  2IHR 1;  4HB5 A;  3EHR A;  1SE7 A;  3LBX A;  5KJM A;  4JB8 P;  4JBW F;  4OX9 T;  2ION A;  3ZYK A;  2V5F A;  2KAT A;  3FUI A;  4DX1 A;  4PJL A;  4Q94 A;  2C0L A;  3PUQ A;  1EPU A;  2BKP A;  3HXC A;  4NUU A;  4X1K E;  2AE9 A;  3P4W A;  5AQU B;  4BY6 A;  3RRM B;  3UIO C;  4GB9 A;  3QWW A;  3IEE A;  5KDM C;  4GMR A;  2N2N A;  4TUU A;  5L3F B;  1W0B A;  4HOR A;  2I2O A;  2DNX A;  4ZI3 C;  3ZVV A;  4F8H A;  4AOF A;  5AQK B;  1YD8 G;  5FL1 A;  3Q49 B;  2Q9Q B;  4TNW A;  4ZHQ E;  3WAJ A;  4OHF A;  3U9W A;  5LG3 A;  3RRU A;  1SW6 A;  4GYW A;  2CHW A;  2P9P G;  2VSY A;  1W3B A;  1I6Z A;  4OYK A;  4HFE A;  2BKK B;  4O2A E;  3AE2 A;  1VCS A;  2X9X A;  3ZPJ A;  3Q9N C;  4HKA A;  1U5P A;  1JUQ A;  2BS3 A;  4H9S E;  3RAU A;  3PE4 A;  4PK4 A;  3T1H T;  4TXQ A;  3ZEF B;  4HRM B;  2QYJ A;  4HOS A;  1QZ2 A;  4C91 A;  3NF1 A;  1MND A;  5F8P A;  3CHR A;  2KXP B;  4YXD A;  3O1J A;  5D66 A;  1HG2 A;  3Q5M A;  3ASD A;  4HWC A;  5JR9 A;  5J0Z A;  3LDZ A;  4IE7 A;  2CBI A;  1OCR E;  2AVP A;  3TLW A;  4ZFH A;  2YOE A;  4FA6 A;  2VL8 A;  3IKO B;  4QKN A;  4EED A;  3PZ1 A;  2LHN A;  3ZXP A;  2A2F X;  3UUL A;  3GMI A;  2B6C A;  4AKR B;  1HXI A;  2C5I T;  4B3R T;  2V7J A;  4I55 E;  3HKB E;  1MX6 A;  3S7D A;  1WM5 A;  1LRZ A;  4H9O C;  1OED B;  3TWU A;  2LXL A;  3F6Q A;  3DSU A;  4G24 A;  3PJA A;  2JIW A;  4U33 A;  5ENP D;  3L09 A;  4ERR A;  4IL4 A;  4XEI G;  4A55 A;  1TNZ A;  2VKO A;  1YW0 A;  2P9N G;  4YTM A;  4AQG A;  4PDX A;  1OCC E;  3CVQ A;  1UJK A;  5FZS A;  5FZR A;  2XGM A;  4DV5 T;  3D9L A;  2NOX A;  3PVL A;  4YT0 A;  3N2K E;  3SOL A;  4P0B A;  2W0G A;  3ESK A;  3LVR E;  2YDS A;  4KP3 C;  2X9H A;  2E9X A;  3UU8 A;  3FUF A;  4LCT A;  1ZP0 A;  4JZY A;  1NA0 A;  3Q2M A;  3HHM A;  2W00 A;  4GYY A;  4UI9 K;  1KNR A;  2XPI A;  4KMO A;  1TJC A;  2VYI A;  1E7P A;  2ACX A;  5LMU T;  4LMK A;  1L5J A;  3QNU A;  1AJ3 A;  4FJO A;  3HKD E;  3CIR A;  3E34 A;  2YU1 A;  3IBP A;  3FUL A;  3C4X A;  2CM0 A;  4DRX E;  4ZI3 D;  2ZMA A;  3AJI A;  4G8K A;  3TWX A;  3O4X E;  4HWI B;  3JC6 C;  3W15 B;  3AEA A;  3CPZ A;  4AY6 A;  3Q9D A;  3MZK B;  2EIJ E;  4AIF A;  2PM6 A;  1WAO 1;  5JQG E;  5KNG A;  1B7T A;  4XZC A;  4KXK B;  2V5C A;  1R8I A;  4FC8 A;  3D9H A;  5JMN D;  4AQF C;  4UF0 B;  2X67 A;  3RYH E;  2VQF T;  4I2W A;  4JHR A;  5LHH B;  3TG4 A;  4B3T T;  5KBA A;  1V55 E;  3J5P A;  3WAK A;  2CG2 A;  3KIN B;  1NP7 A;  2P9S G;  3X1D A;  4BTA A;  4AY5 A;  3SWH A;  4ZOL E;  5J2U E;  4GKK T;  4U63 A;  2AXU A;  3APF A;  1FVH A;  1N4P A;  2OLT A;  1N54 A;  5E76 A;  3RU0 A;  1UX5 A;  3DTO A;  2PG8 A;  1IBK T;  4CN4 A;  1TN6 A;  3BQL A;  3Q75 A;  4DVD A;  4DV6 T;  5KX5 E;  3MKQ B;  3TLV A;  5JH7 E;  3V2O A;  1H19 A;  5AQI B;  3J5Q B;  1HR0 T;  2DVW A;  3E22 E;  1HTJ F;  1KFY A;  5AQP B;  1W0A A;  3OTO T;  1S0P A;  1Z3X A;  3DSX A;  2V6X A;  1N4R A;  5J90 A;  2FUL A;  1NL4 A;  4GOU A;  1FMV A;  3MA5 A;  3PZ4 A;  5LCW J;  2MOZ A;  2EHO B;  4IE0 A;  2DYR E;  3AB3 B;  2CWY A;  2YDR A;  3HA4 A;  4HN9 A;  4X1Y E;  4GZD A;  4KVM A;  4CXY A;  3AE4 A;  5LYJ E;  3LJC A;  2XQ5 A;  3AE5 A;  1NI1 A;  2V7L A;  3AE7 A;  4HEA A;  3ZT6 A;  3TWR A;  4U72 A;  4UVC B;  5AQA A;  2XAS B;  1WR6 A;  3Q5E A;  4N3C A;  3ESL A;  3ZU7 B;  1XNR T;  4H7Y A;  4JUY A;  3JUI A;  5G05 J;  2HN2 A;  1SZA A;  4DMV A;  2IIU A;  2YKS A;  3AAE B;  3SNX A;  2QC9 A;  2M6I A;  3L54 A;  3ZYQ A;  3GW4 A;  2X0L B;  4N39 A;  2KZT A;  3FHN A;  2OEV A;  2L3L A;  2IC6 A;  4HBD A;  3TWV A;  3VLF A;  4L23 A;  3P7I A;  2H7V C;  1OCZ E;  4U74 A;  2DZN A;  5HWY A;  2E2E A;  5HAX A;  4HLL A;  2Y6X A;  4DR2 T;  2AXD S;  4C9B B;  3EAM A;  5ENN A;  3BEE A;  3I1A A;  3L39 A;  1HCI A;  2C5J A;  2LT3 A;  1IBL T;  3OVU A;  2L6B A;  2IO2 C;  3JC6 D;  4A97 A;  3ETU A;  2LRL A;  3FTW A;  3S7F A;  1EF1 C;  4KYO B;  4DMW A;  3FTU A;  4HGA A;  2ZU6 B;  3FWV A;  4XAX B;  2CFU A;  1ZB1 A;  4H63 H;  1IYG A;  1D1A A;  2Y0B G;  1TNO A;  1YQ4 A;  1K3Z D;  4QFV A;  3HL6 A;  2X6I A;  2LSI A;  4NUV A;  2VAS A;  3AE3 A;  2WP9 A;  4DUI A;  3FUM A;  1YMP A;  4PAG A;  2FJA A;  4IYP A;  4JI1 T;  3V79 K;  4O2B E;  2NSZ A;  2KCL A;  3EHN A;  3RI5 A;  3FZK B;  3P2B A;  2GGF A;  2JQ9 A;  3TG5 A;  4AXP A;  4YJ2 E;  5G04 C;  4Y6W A;  3E37 A;  4JL0 A;  4QWN B;  3NB2 A;  3P1U A;  4HNA D;  2IFU A;  2WSS V;  2XSB A;  3UT5 E;  3RPU A;  1CHU A;  4HWD A;  4U8Y D;  5JDQ A;  3N9N A;  3GZ1 A;  4DPR A;  4EXT A;  2VUR A;  5HKP A;  1FIO A;  2Y4T A;  3FTY A;  3FBZ A;  3RJV A;  1HF8 A;  3A7M A;  3ETV A;  3UTK A;  4I0U A;  1A17 A;  5C2T A;  3GYZ A;  1N52 A;  2XAJ B;  5JRC A;  4HOU A;  4GYR A;  4P09 A;  1NEK A;  2K5B B;  3AXJ B;  2WM9 A;  3MAC A;  4LF9 T;  3I4G A;  3Q5X A;  1WG0 A;  3ONL C;  3Q5D A;  1KZO A;  4N5Q A;  5EX0 A;  3TLS A;  1HX1 B;  1FPP A;  5HS0 A;  2VGX B;  2CG3 A;  1QBQ A;  1PAQ A;  3UUX B;  5A1L A;  4GZ5 A;  2QVA A;  4WNE A;  2XS1 A;  3QDN A;  2ZM2 A;  1DCE A;  1BR4 A;  3C72 A;  1GW6 A;  4Z68 A;  5EX3 A;  4IE6 A;  3ABM E;  3AAA C;  2BBJ A;  3HXE A;  3UI2 A;  3OBV E;  3C98 B;  2LSU A;  3SFX A;  2YDQ A;  1LTX A;  4DR3 T;  2E0I A;  3OXF A;  2X6J A;  3PZD A;  1US7 B;  5C3J A;  2JRK A;  5JDG A;  3RGL A;  1ZEE A;  4DLO A;  1SA0 E;  4GCO A;  2UU9 T;  2OVB A;  1XWM A;  4H9Q C;  3ZST A;  1WFD A;  3ZGQ A;  1OWA A;  4L1B A;  3KBU A;  2VTB B;  4TV8 E;  2NW8 A;  2UY1 A;  4GK0 E;  2I6H A;  3NVO A;  4FHK A;  4LML A;  3KAE A;  4ZS3 A;  4CDN A;  3SD5 A;  1D0Z A;  4COF A;  3UX4 A;  3UMV A;  3CKC A;  4EEC A;  3ZJ2 A;  5FNV E;  2KND A;  2V7K A;  2BUG A;  4HI9 A;  2WZH A;  4HFG A;  5FZQ A;  2AXV A;  3M3Z B;  3I3N A;  2UXN B;  2KT9 A;  3UKU G;  1MJ0 A;  2XQ0 A;  1H6P A;  1QQE A;  2GRR B;  2V8S V;  5FY1 A;  1XNF A;  4O1O A;  2N9D A;  4XI9 A;  3UIN C;  3ASH A;  2YN6 A;  3TLU A;  1Y6I A;  4EV6 A;  2D5U A;  3O1I A;  4P1N A;  4H7X A;  4ILC A;  2XAH B;  3N5L A;  4BX8 A;  2H88 A;  5AFU L;  5CJ5 A;  5LA6 E;  4ZS2 A;  3MV3 B;  3ULQ A;  4EZJ A;  4UR9 A;  4DR4 T;  5D2M C;  3DEO A;  4IDO A;  5H6R B;  2M63 A;  2BZB A;  3EVY A;  5L4H A;  1AP7 A;  3L22 A;  2RA1 A;  4RG9 A;  5TAO A;  3ZMS B;  4N3B A;  2CHO A;  2FEZ A;  2V26 A;  5FKY A;  2ZLY A;  1W9R A;  5HCJ A;  2R03 A;  4HFB A;  4X65 T;  4NQ0 A;  5ENQ D;  5J2T E;  4A3V A;  5HCM A;  2V8S E;  3FUK A;  3AA1 B;  3EHM A;  4YLH A;  5LHG B;  2GRL A;  5JDM A;  2D9D A;  5F3J A;  1O1T A;  4YHJ A;  1Z3Y A;  3Q5W A;  2F0Y A;  3P4Q A;  1TR4 A;  2LOP A;  3D9I A;  1B89 A;  3L9T A;  4KZC A;  3BQI A;  3UU3 A;  4CXW A;  2J4B A;  3ANW A;  4EZL A;  4AKL A;  1V54 E;  3ZHE A;  3NAW A;  5FIO A;  5FL0 A;  3ONL A;  1H6K A;  4N5C A;  2IQC A;  3G2V A;  2MHK A;  5HXS A;  3ONJ A;  3LKU A;  3LEW A;  2A4Z A;  1TJF A;  4DR7 T;  3Q15 A;  5FQ8 A;  4HRL A;  3S2A A;  2CHN A;  4X8Q A;  4CEM A;  4IDQ A;  4I43 A;  2VSX E;  2J4D A;  4X62 T;  5KJL A;  2VL0 A;  3AA7 B;  3HI2 A;  3SS1 A;  3MYV A;  4DBR A;  4XE0 A;  4KZ0 A;  2IUB A;  2IJG X;  4B0Z A;  4JI5 T;  4JYA T;  1PY1 A;  2DCF A;  4J0U A;  3MX3 A;  4CN6 A;  2LEH A;  2JMH A;  3VLD A;  1SZ9 A;  3PZ2 A;  2FBN A;  3APD A;  2PL2 A;  3B7S A;  4JEU B;  3PE3 A;  1OWM A;  3H3A A;  5FQ4 A;  4J8S A;  4IE4 A;  3HKC E;  1ELR A;  1SA4 A;  5HEH A;  2DCP A;  4N2S A;  2BKO A;  4UWL A;  2K48 A;  2KMF A;  4Q25 A;  3EHZ A;  1AWC B;  1LD8 A;  3V31 A;  3FEY A;  4JI4 T;  4U0U A;  1HG5 A;  2XQY A;  3PUA A;  3PUV F;  1M7K A;  1UOH A;  4U0Z A;  4UWK A;  1IBM T;  4F1P A;  2X3M A;  3QWP A;  3ABV A;  2ETB A;  2GRQ B;  3KS2 A;  5FP3 A;  4JI3 T;  5JDF A;  3MZL B;  3LPZ A;  2CLY B;  1WRD A;  3PZ3 A;  3KSQ A;  3IHR A;  4GTO A;  1X5B A;  3H37 A;  3N9M A;  3N71 A;  4WWO A;  2Q7F A;  3EDT B;  3EIQ C;  2YHC A;  3IXE A;  4I1O B;  3I4R B;  3CX8 B;  3UM1 A;  5HWX A;  4DR1 T;  2KIN B;  4L9I A;  4I6J A;  1D1C A;  1LVF A;  2VWA A;  4WWN A;  4XX5 A;  2BDE A;  1X9B A;  3CHQ A;  4RLY A;  3OYZ A;  2W66 A;  4JHJ A;  1Y01 A;  5ARF A;  4C90 A;  4GMJ A;  1I94 T;  5CED B;  2WAU A;  2XSA A;  2P9U G;  1INZ A;  1G8X A;  3DSW A;  4V3I A;  1TEZ A;  3APC A;  2E9X C;  4HRN A;  1UCU A;  3AE1 A;  5GON E;  4KMC A;  3AA6 B;  3BUA A;  2CWO A;  4G8L A;  3Q7F A;  3CEQ A;  2JQQ A;  3PUK A;  2Y8D A;  2XAG B;  1BR0 A;  2MOW A;  5LOZ A;  2PM7 A;  3J7Y q;  2R05 A;  1BD8 A;  2EIM E;  4H9P C;  2X9Y A;  3D9M A;  1KPS B;  2AXZ A;  2WXM A;  2F8X K;  3OPC A;  3QNK A;  4HWF A;  3E4B A;  2AWI A;  2V6Y A;  4U2Z A;  4WNF A;  5BV1 A;  1SUM B;  2XHE A;  2XZD G;  1O1S A;  1G73 A;  1FCH A;  4B3S T;  5AQS B;  1N33 T;  4LFC T;  3S4U A;  3D3M A;  2NC9 A;  4DBQ A;  1MMG A;  4L0R A;  2LE8 A;  3L8R A;  1KEY A;  4TXR A;  4CN1 A;  2MPK A;  3RYF E;  1KNZ A;  2DWK A;  2GW1 A;  3ZEF A;  4ILG A;  1SQM A;  5LCY A;  2QYU A;  3KD7 A;  4BX9 A;  1CUN A;  3VKH A;  2EIN E;  4UVB B;  4BSX A;  4MAL A;  2VQ2 A;  3I9Y A;  3LBX B;  3ZUV B;  2WXL A;  3N2G E;  2NTY A;  3MKR A;  5BPP A;  3FZF B;  2WDR A;  4LSZ E;  2X38 A;  1ZOY A;  3ZCI A;  2XZE A;  4LFA T;  2Y4U A;  3G2W A;  3F57 A;  4TXP A;  4IE5 A;  4DX2 A;  1U2V G;  2CHZ A;  3KVB A;  4YY3 T;  1HFA A;  2CXL A;  2WXJ A;  5DQV A;  1E2A A;  3ZT7 A;  2J09 A;  5CBN A;  1FMW A;  1ZU2 A;  4I17 A;  3U3I A;  4HFH A;  3AS8 A;  2XEE A;  4N3A A;  1UN8 A;  4PS7 A;  2R02 A;  4OFZ A;  5FQ7 A;  2ACZ A;  3K3O A;  4JA7 A;  3P4S A;  1UN9 A;  3SZ7 A;  2NXP A;  2CBJ A;  2W62 A;  1OT8 A;  4JVS A;  2A72 A;  2H6H A;  3C3R A;  2X0H A;  4UV8 B;  3ZMT B;  4IT4 A;  4X1I E;  4XBF B;  3FUE A;  5L3C B;  4BJM A;  1BLX B;  4EB6 E;  3LY8 A;  2CMR A;  3CQX C;  3QC1 A;  1IHB A;  5EZY E;  1VDY A;  1ZV4 X;  2WXQ A;  3JAF A;  4DR6 T;  1KF6 A;  3DRA A;  3TXM A;  5AQF B;  4HVB A;  2E9X D;  2QRX A;  2V4L A;  1H6O A;  4UWF A;  3PUY F;  5CCL A;  3P4R A;  1YKH B;  5JR9 B;  1D8D A;  3ZN3 A;  2B0O E;  3HXF A;  2ODV A;  2WS3 A;  4IL9 A;  2WZI A;  5FQ6 A;  3AS5 A;  3RRN B;  2WPV A;  4A63 B;  2BVM A;  4IHJ E;  5CEA A;  4GA0 A;  2IDO B;  4K03 A;  4GU5 A;  4M3O A;  4DV4 T;  3RO3 A;  2CPT A;  3NOG D;  2WXR A;  5L4E A;  1FVF A;  4EZ4 A;  1E7V A;  1D1B A;  2JJ9 A;  2IC9 A;  2XCC A;  3ASG A;  3FU0 A;  4EQF A;  4BT9 A;  2FI7 A;  4HOQ A;  5ITZ F;  2I1J A;  3L82 A;  4FHJ A;  5LXT E;  4UQX A;  2RD0 A;  4UI9 J;  3ZT5 A;  2D0T A;  3IBE A;  1LVK A;  4DUY T;  2VGY A;  3GZ2 A;  4XI0 A;  1MIW A;  2WQH A;  2CXD A;  2LSJ A;  1E96 B;  3HYM B;  2KWH A;  4IUL A;  4OVU A;  3TWT A;  3KSL A;  3B95 A;  4YDW A;  3ULE G;  3SI5 A;  5FMN A;  4UWG A;  3CVY A;  1OXJ A;  3ZMZ B;  4NXM T;  4HFC A;  4LF8 T;  2BKN A;  2BKG A;  4MRU A;  4CCA A;  3C5R A;  5CRV A;  2IY0 C;  5BT1 A;  2WB5 A;  1LKX A;  5BXU A;  3UU5 A;  2CXF A;  5FVK A;  2LAH A;  3VR9 A;  4DK5 A;  2C2L A;  2XQA A;  5HXH A;  3K1S A;  4DV7 T;  1IKN D;  2WU2 A;  3IF8 B;  1D0X A;  4YDE A;  3UXG A;  4GTV A;  1HX8 A;  4PJJ A;  1IXV A;  3UM3 A;  2G0U A;  3ZRH A;  4J6I A;  3VR8 A;  4UIG A;  3RIA A;  2I9C A;  3AG1 E;  2OA5 A;  3RH3 A;  2QFC A;  2VSO E;  5AQH B;  4JI8 T;  4ZZC A;  5FTP A;  2XQ3 A;  4B8C B;  2BBH A;  3DEP A;  3F31 A;  4KBM B;  3MXZ A;  4DX6 D;  2UWJ G;  3KFW X;  2WXN A;  2EHO A;  5AQL B;  3AED A;  2WXG A;  3DXM G;  4B89 A;  5LGT B;  1D8E A;  3UFG A;  3CKD A;  4PFP A;  4TUY E;  4EOZ B;  1XMO T;  5JDL A;  2W67 A;  1P5Q A;  4IDZ A;  4P0A A;  2RP4 A;  4ABN A;  2XGS A;  1WYB A;  1IAP A;  2J47 A;  1HS7 A;  2GRM A;  3AA0 B;  3R7Q A;  4JI7 T;  3VU7 H;  1BR1 A;  2WXI A;  4LRZ A;  1HE8 A;  5G2N A;  4RSY A;  4YVQ C;  3Q7A A;  2H89 A;  3N9L A;  4KHZ F;  2ZXW E;  3KEA A;  1HU3 A;  1QYM A;  4I6E A;  3DSS A;  3RIF A;  1N11 A;  5AYW D;  4A1S A;  2XPZ A;  1G3N B;  2P9I G;  3HRA A;  4CQI A;  3HDX A;  1NZN A;  3R9A B;  4NAC A;  1U4Q A;  3IHY A;  3JAE A;  2EIK E;  2NWB A;  5HRY A;  2XTL A;  2J9Q A;  2NR4 A;  3BQO A;  2KBX A;  3AEE A;  1MNE A;  4V1A v;  3N9Q A;  4BJN A;  4I9C A;  2WXH A;  3EU9 A;  3E0Z A;  4WZX A;  3S7J A;  4QH5 A;  4LEU A;  5LHI B;  2VQE T;  5DIZ A;  4EPZ A;  4JC8 A;  3CQG B;  2XJ7 A;  4G2V A;  1J5W A;  3LJN A;  2LSY A;  4U7I A;  1RW2 A;  1E7U A;  4Q96 A;  4UEM A;  4DX5 D;  2XUE A;  5EN5 D;  5DJQ C;  2VVN A;  3K3N A;  4JLE A;  3Q79 A;  3D9J A;  2QGS A;  3OKQ A;  1IJ6 A;  3K3Q C;  4YHH T;  3QUJ A;  3PH0 C;  4U3C A;  3CVL A;  4LMJ A;  3ISM C;  3PRZ A;  4J7W A;  1D0Y A;  2XPY A;  3ML9 A;  4NIQ A;  4FJY A;  5FXZ A;  1X79 A;  3K8P C;  4JEH A;  1A5E A;  3ZYM A;  1WY6 A;  3J9X 1;  2R6G F;  4LF5 T;  3CVV A;  2B76 A;  3ZYL A;  2I1K A;  3FUJ A;  3MV2 B;  2E5L T;  4EAH A;  4MFR A;  4CI3 B;  3ZXS A;  3MEK A;  3PTR B;  3X2Q E;  4JI6 T;  3ZN0 B;  2V7I A;  3EIJ A;  4Z91 A;  4YTP A;  2XEV A;  3MJW A;  3RF1 A;  2K3W A;  2W4X A;  3IV0 A;  5CMW A;  3AG2 E;  3QB2 A;  1RZ4 A;  1N95 A;  4OYS A;  2AJA A;  4U8V D;  3AG3 E;  3FY4 A;  2ZIS A;  5CCM A;  1X81 A;  1H7C A;  3UT4 A;  2NP9 A;  3NOC D;  3RYC E;  4TUM A;  3UKR G;  3AVR A;  2LO6 A;  2QZA A;  4O60 A;  5AN8 A;  5HI7 A;  5ADX L;  1Z5S C;  5HYA A;  5JHA A;  2H3R A;  2WDQ A;  2OV8 A;  4YND A;  5KXJ A;  1E8X A;  2VJ8 A;  2J49 A;  3NZU A;  3CVU A;  3DWL G;  3QC9 A;  5EK3 A;  5KWD A;  4L9P A;  3NZP A;  4HE8 A;  5A6C A;  3MJX A;  3MA9 A;  2BED A;  4K5B A;  4ME2 A;  1IQR A;  4I6G A;  4FLB A;  3C98 A;  5H6Q B;  3HVE B;  5KJN A;  5HXC A;  3LY9 A;  2QA7 A;  3T8K A;  2PFV A;  5JJT A;  2WQ6 A;  3UUN A;  1TN8 A;  5FVL A;  3O9X A;  1LD7 A;  2LNI A;  1UUR A;  3LG7 A;  3FTX A;  2XAQ B;  4ANJ A;  2YHE A;  4CT0 A;  2RG8 A;  4EBA A;  3QOU A;  4L7T A;  3C4Z A;  3CWZ B;  2HYZ A;  3G2U A;  5ABF A;  2C0S A;  3QOF A;  1XNQ T;  3F2E A;  4GZC A;  4ILA A;  4NXN T;  2R5S A;  4DR5 T;  3CK8 A;  5AIJ A;  3JAD A;  1WR0 A;  3UPV A;  4YTN A;  3QB5 A;  4N2Q A;  4QH1 A;  4RG6 A;  4E6H A;  4UWH A;  4J8D A;  5JRC B;  4HFI A;  5JTG A;  2PTF A;  4EYU A;  1UX4 A;  4BET A;  4TNV A;  2KCV A;  3MGB A;  3U64 A;  4A98 A;  1HZ4 A;  4OAV B;  4CZZ B;  4MLK A;  5EKQ D;  1U3D A;  1SVX A;  5FYM A;  1JCQ A;  3CSF A;  2DHR A;  4HWH A;  1XDP A;  1N94 A;  3EDV A;  3GN5 A;  4UQY A;  3M65 A;  4IRU A;  2CA5 A;  2V0P A;  3QJZ A;  3ONX A;  4L2L A;  1KZP A;  3CIA A;  4AJW A;  4C0M A;  5FIN A;  3TWS A;  3QK0 A;  3V5S A;  4I4T E;  1J5E T;  4XZ4 A;  5BR8 T;  3UUM A;  5EYL A;  4KX6 A;  5LP6 E;  4H9N C;  4IDP A;  3ZMU B;  1VRB A;  5CER B;  3UT7 A;  4QXH B;  2DIW A;  4Z8X A;  5M4Y A;  3QWV A;  4CGV A;  4G25 A;  5ETW A;  3RKO A;  4O8S A;  3EHQ A;  4BTB A;  2V4H C;  2HN1 A;  2UY1 B;  3PUG A;  3KVA A;  1HO8 A;  3DPD A;  1NEN A;  3T5V A;  5BMV E;  1WYC A;  1MIY A;  5AEN A;  4ILI A;  2W2U A;  2NTX A;  2XAF B;  4O4L E;  2V5D A;  1HNZ T;  2VGE A;  2LHR A;  3NBX X;  3UTM A;  2WDV A;  4WAF A;  4HFD A;  3ASF A;  3O48 A;  2L6J A;  3T8M A;  2IU1 A;  4GIW A;  3CK6 A;  3O1H A;  3PV0 F;  4PK5 A;  5A23 A;  2IOL A;  4DV1 T;  1SA5 A;  3C4W A;  4K5A B;  3C51 A;  4KHP T;  2AW6 A;  2WXO A;  3AE8 A;  4BEP A;  1Z6T A;  4U07 A;  4AP2 A;  3RRW A;  2MAW A;  4D10 C;  4TZ4 C;  1K1A A;  3SFY A;  5J1G A;  4GTT A;  1JCR A;  4LFB T;  3G2S A;  3OYX A;  2PQN A;  2BG9 E;  3RYI E;  4KBQ A;  4GPK A;  2PBI A;  3ZC0 A;  4G1T A;  4PJN A;  2UXX B;  3NKZ A;  5BUZ A;  4WNG A;  2UUB T;  2I0M A;  3PUZ F;  1E90 A;  3CV0 A;  2A3D A;  4ATG A;  2Q9Q C;  3R84 B;  4YSY A;  4YDY A;  4U7Y A;  5G55 A;  4LF7 T;  4Q69 A;  3PEU B;  2DWZ A;  2ES0 A;  4DI3 A;  2D2S A;  5CA0 E;  4U04 A;  3FH8 A;  5M72 A;  3SF4 A;  4L5G A;  5HEG A;  2NYJ A;  2KZ7 B;  1DNP A;  4A56 A;  1UW4 B;  4A3T A;  3EI0 A;  2BTD A;  3DBS A;  3SO8 A;  1IZN B;  3SBT B;  3TAX A;  3KV6 A;  2LSG A;  4ANU A;  5A7D B;  4KUM B;  3LDQ B;  2PJQ A;  1TYQ G;  2KXP C;  3FP3 A;  5LP0 A;  3D9P A;  4CXX A;  1QLB A;  4AQY T;  5CEC B;  5CB4 E;  4CDR A;  5HQ8 A;  2XZT G;  2WQ7 A;  5BW8 C;  3FUD A;  3K9I A;  1GQE A;  3PU8 A;  1XGW A;  1E1H B;  4AVX A;  3ZHE B;  4DND A;  1PC2 A;  4WND A;  5LNK A;  1QNF A;  2OEW A;  4Z90 A;  3GA8 A;  4HFV A;  2PQR A;  3JXJ A;  2L8K A;  3I0Q A;  2ILR A;  4U31 A;  1KLX A;  1S63 A;  1E8Y A;  3QB5 K;  3ENE A;  2WXF A;  2DLR A;  1OED C;  2RKK A;  4LNG A;  1BU9 A;  3T5X A;  5LCW C;  2CRB A;  3AAA B;  2OVF A;  4RQI A;  3CVR A;  2WXK A;  4BER A;  2RFA A;  4B94 A;  1J1J A;  4MLP A;  2R17 C;  3ZNG A;  1UK5 A;  3ZKJ A;  2Z6E A;  3SFE A;  5DBK A;  2V1D B;  5AQJ B;  2LKG A;  4I1M A;  4MBQ A;  4AIU A;  1OED E;  2DL1 A;  5EID A;  4KT6 B;  3U4T A;  2XEH A;  1TNY A;  4HS2 A;  3QKY A;  4UEL A;  4JXT A;  4WWP A;  2OV9 A;  2KLQ A;  4GYO A;  4HOT A;  3PUJ A;  4OK0 A;  5JJ6 A;  4U95 D;  5CRU A;  5L2L A;  2E2A A;  2WB2 A;  4IIJ E;  1N0Q A;  4U0S A;  1OWP A;  3LSV A;  3UQ4 A;  2X6K A;  4QQI A;  4DX7 D;  2BG9 A;  3T1Y T;  2IOS A;  4BFR A;  2BF0 X;  4JI2 T;  3MCX A;  2J62 A;  2WBL A;  3SFZ A;  2X9W A;  1MIV A;  4OVV A;  2CFZ A;  4LNU D;  4K0R A;  2LJL A;  3OTN A;  2LM9 A;  5ENT D;  2HPJ A;  2N1G A;  3SGH A;  1MQS A;  2A5U A;  4EGW A;  3QK6 A;  2YIN A;  3TWW A;  3AEB A;  2Q9Q D;  4DV2 T;  2F37 A;  3CVP A;  3E30 A;  1SHZ C;  3TWQ A;  2P2C P;  3OXL A;  4BA9 A;  3B7B A;  4C0E A;  4ACL A;  2LOS A;  2SPC A;  4XKB A;  4Y6C A;  4GKJ T;  3FHE A;  5G04 J;  4UV9 B;  2PNN A;  4CT4 A;  1FT1 A;  2QYW A;  4B8A A;  2WVI A;  2Q9Q A;  1ZBP A;  3GZS A;  2VKD A;  2JEK A;  1NAF A;  3VRB A;  2GRO B;  3JYS A;  3E32 A;  3LJ3 A;  4F6R C;  4BSZ B;  4LUN U;  4JW1 A;  3D9N A;  4RVB A;  4AM9 A;  4I1A A;  2ZM0 A;  3SRZ A;  1BPO A;  3EAB A;  4IN3 B;  3FTV A;  3CVW A;  3IEG A;  4UQZ A;  5L3E B;  2E5V A;  3B57 A;  2XQ7 A;  2VK9 A;  3HIZ A;  2MTQ A;  5LBM A;  1ELW A;  5AQ7 A;  2FO1 E;  1HS6 A;  4BES A;  1FJG T;  4APF A;  4G26 A;  3R6N A;  5D0Q D;  2V6Y B;  3A5X A;  1XDO A;  4KI0 F;  4X5T A;  3TGO A;  3JCK C;  2V7M A;  2XHE B;  4I50 E;  4LF6 T;  4YJ3 E;  3I5P A;  4JA9 A;  3AEF A;  2A9U A;  4DI4 A;  2FUP A;  3WI3 A;  3NRY A;  3QAQ A;  3WG7 E;  2E8I A;  2P58 C;  2EHO C;  1OED A;  2WMO A;  3LK3 B;  2D0U A;  3Q78 A;  4J8Y A;  4ZI7 E;  5AJL A;  2JQH A;  4GTQ A;  4WUY A;  3VRA A;  4EZK A;  3TJP A;  5HEO A;  3ZIM A;  4AV7 A;  3UQ7 A;  5E75 A;  1YXR A;  3TL5 A;  3CX7 B;  2J8S D;  3EUH A;  3SQV A;  2NW9 A;  3RC8 A;  2FF4 A;  2J07 A;  3U3W A;  1T72 A;  4ZXL A;  2X51 A;  1S64 A;  5LJM A;  3PEV B;  3RIU C;  3DST A;  3L17 A;  5L3B B;  3LK4 2;  5ARG A;  4EEB A;  1M62 A;  3MK7 C;  3KV9 A;  3ZN1 B;  4PUC A;  2OCC E;  3O4Z A;  4CI2 B;  2MBG A;  2X66 A;  2LUH A;  3B7R L;  5ABG A;  3VLE A;  3KBT A;  1BI7 B;  2XCB A;  3FZL B;  5AQN B;  5JA4 D;  5ANL A;  3H3M A;  5DQW A;  2H6F A;  2VKH A;  2R2L A;  1ZKE A;  3ML8 A;  3N9P A;  4ANX A;  2WCA A;  4GA1 A;  4I2Z A;  4G2A A;  3PUW F;  4M1P A;  2ETA A;  1MMN A;  1YYH A;  1QSD A;  2L0I A;  3RKV A;  3CLJ A;  1MYO A;  3C3O A;  3SY2 A;  3C3Q A;  4F1S A;  5EDS A;  4FI5 A;  4ASK A;  4M7C A;  2BS2 A;  3U66 A;  4GCN A;  4WW0 A;  3R7R A;  2VKJ A;  3AG4 E;  1L0V A;  2X6F A;  3W9G A;  4F6R D;  1JNR A;  4U7E B;  1JPL A;  5B1A E;  3UM2 A;  2J1D G;  4WNK A;  2ZGD A;  3Q4A B;  2IML A;  2BS4 A;  3V30 A;  2ODU A;  1YQ3 A;  4UF0 A;  1YA0 A;  5CMY A;  5ENR D;  2KSR A;  1S70 B;  3L16 A;  4CI1 B;  2E9X B;  4AIS A;  5AQB A;  2CCQ A;  2IF4 A;  5C2Y A;  5EIB E;  5LX8 A;  1IJ5 A;  1S35 A;  3HXB A;  4DLQ A;  4HLE A;  4U2Y A;  3NZS A;  4ACK A;  1WLX A;  1KK7 A;  4HI8 A;  4B93 B;  4BT8 A;  4QXC B;  5LBQ B;  5LMN T;  2HR2 A;  5L47 A;  2WWU A;  4E85 A;  4AI6 A;  1MHQ A;  3B7U X;  1UUS A;  5IWA T;  3ZSS A;  2OOE A;  1Y64 B;  5L3D B;  4ANW A;  3MKQ A;  5FWQ A;  4PNI A;  5AAO A;  2EHO D;  2YQ8 A;  1VCT A;  2IW5 B;  1MMD A;  2WXP A;  3VHL A;  3OXG A;  1T8B A;  3EJN A;  4ISS A;  3JCF A;  5JDN A;  5LJN A;  3FH7 A;  1V9D A;  2F4V T;  3WXX A;  4GAA A;  4ANV A;  4J2C A;  3LYA A;  2UXC T;  3W9F A;  1FEW A;  3JUE A;  3URZ A;  2HPL A;  1JNZ A;  2LRK A;  4K0U A;  4BAY B;  3FUN A;  3ABK E; 
#chains in the Genus database with same CATH homology
 4DO0 A;  3Q47 B;  3CML A;  2IAK A;  2B1E A;  2XGO A;  2K24 A;  2ZM8 A;  3I9W A;  1KT1 A;  3UQ3 A;  3AS4 A;  3VTY A;  2P9B A;  4PK6 A;  2YNQ A;  5FT9 A;  1T98 A;  2VSN A;  1EDU A;  5C1D A;  3FXD B;  3CHP A;  2HM8 A;  2KC7 A;  2JLB A;  3BK9 A;  5JDH A;  3ZMV B;  2J08 A;  3ZLI A;  4GZ3 A;  2JMK A;  4AKH A;  4LER A;  4YVO A;  4DJA A;  3PS6 A;  4A1G A;  5D0O D;  4GML A;  5FY7 A;  5BNW A;  3V5U A;  5T4Y A;  5LGN B;  2Y3A A;  1IHG A;  3SHF A;  4H9R C;  2XRY A;  3BQK A;  3KEZ A;  4PH4 B;  2BVL A;  5EK2 A;  1EYH A;  3FU6 A;  5KMG P;  2K9A A;  5KCM A;  2MYS A;  3FU5 A;  4F53 A;  2HO1 A;  5LGU B;  3PUS A;  4FU3 A;  2KZT B;  4UVA B;  4CGW A;  4J8E A;  1E8Z A;  3CVX A;  3SBS A;  5JJ7 A;  4P29 A;  3B13 A;  4AEZ C;  4FJZ A;  1S94 A;  4NUR A;  5HXR A;  4J8F A;  2H7O A;  3FEX A;  4TRQ A;  4EZH A;  3LCA A;  2R59 A;  1OWL A;  3PNL B;  3FU3 A;  3U78 A;  4OYJ A;  1QUU A;  4URK A;  4EYY R;  3B7T A;  4X20 E;  3CVN A;  3PDY A;  3D9O A;  4G63 A;  4AQF A;  4F3V A;  1OXZ A;  3AU5 A;  4WBO A;  1Z0P A;  2CE7 A;  1VOM A;  4JEH B;  2KM4 A;  3HVE A;  3C50 A;  3QAR A;  2MRI A;  3FTS A;  1MMA A;  2VGX A;  2C5K T;  3UUX A;  2YEV C;  2DI4 A;  5J08 A;  3D9K A;  3KDS E;  3C64 A;  3L3P A;  3I0O A;  2I59 A;  5C8Y E;  3EDU A;  3PDN A;  5ANR A;  2M67 A;  4WBN E;  3FFL A;  1H0A A;  2YK0 A;  4GZ6 A;  3OAW A;  4ILH B;  5AJD A;  3E08 A;  5FJY A;  1NA3 A;  4G23 A;  1LF8 A;  5L3G B;  2DWG A;  1ELK A;  1H2T C;  2CEA A;  4E7S A;  2VTB A;  4EIW A;  1HH8 A;  3FXE B;  5E0O A;  3L6A A;  3FH5 A;  4QX8 B;  4MS6 A;  2LSK A;  1U3C A;  4FP7 A;  1O3X A;  4F7A A;  4H63 V;  5FY0 A;  2X68 A;  3LFM A;  4U8H A;  3S7B A;  3HKE E;  2WMN A;  4GYS A;  5KJK A;  2QY7 A;  5FXV A;  4O4H E;  5LOV E;  2CLY C;  3FDH A;  2LSV A;  4MHC A;  3RIB A;  3PUR A;  5BV0 A;  3FBL A;  4XKC A;  2L9Q A;  4APO A;  5CA1 E;  4HTE A;  2XRZ A;  3AVS A;  2FO7 A;  5CHE E;  3OJA A;  1ZHC A;  4GK5 E;  4PJM A;  4IST A;  2KCK A;  3LS8 A;  2EQX A;  3N9O A;  3DP7 A;  5FXX A;  4L2Y A;  2W61 A;  3FB2 A;  3CK9 A;  1NWM X;  3JQ1 A;  3CHS A;  3CKB A;  4FUL A;  3D0T A;  1UG3 A;  4AKI A;  3LY7 A;  3ZW3 A;  1DVP A;  3ZJ1 A;  1JWG A;  4TV9 E;  3GN5 B;  4QHO A;  4PS3 A;  3UT8 A;  2L0T B;  4ZI2 C;  1H2V C;  5HXE A;  5LFA A;  3NRX A;  4AXH A;  4UI9 C;  4IGU A;  3CK7 A;  3G2T A;  2OND A;  3FTZ A;  3ZCJ A;  1BR2 A;  4ADZ A;  2Y48 B;  2CHX A;  4CRW A;  3RX6 A;  5IHY A;  3HR0 A;  2W63 A;  3CHM A;  4EBA G;  3P8C D;  2C0M A;  5EK4 A;  3AAI A;  4G11 A;  3CX6 B;  5JHB A;  3CHO A;  3CGH A;  3RRC A;  4FAD A;  1Y8M A;  2KWI B;  3MKD A;  4QXB B;  5JVD E;  1OWO A;  3BG0 B;  4JEU A;  3KV4 A;  3LVQ E;  3PNT B;  3RK6 A;  1JWF A;  3RO2 A;  3ANW B;  1UJJ A;  4MKT A;  3L13 A;  3ZPO A;  3JQ0 A;  3LXU X;  4PW8 A;  4W9R A;  4HXI A;  3RC3 A;  3FUH A;  3TXN A;  5IYZ E;  3LK2 B;  2NW7 A;  3AU4 A;  4N78 D;  4UXN B;  3IHV A;  3N2O A;  4GA2 A;  4BWR A;  4TN7 B;  4E7Z A;  5T3R A;  4I43 B;  1IQU A;  1H2U A;  4YFS A;  4R7L A;  4CDM A;  5FXW A;  3PE0 A;  3ONK A;  3ZFW A;  4NRH B;  2JPF A;  5G05 C;  3VKG A;  3CR3 A;  5JR9 C;  4O4J E;  2DBA A;  3TKL B;  2X6H A;  4XIF A;  4TV3 A;  4ZI2 D;  2GK9 A;  4I9E A;  3NQP A;  3VTX A;  3CQC B;  3T8O A;  5JRE A;  3NZQ A;  3DJB A;  3ZC1 A;  1KT0 A;  1YKE B;  4PS8 A;  4QX7 B;  4KVO A;  2HH7 A;  3GWH A;  1OWN A;  3L08 A;  4JPS A;  4B6X A;  3PU3 A;  1E8W A;  4PFO A;  2VB6 A;  4O6F A;  5DAB A;  1OUV A;  4AKG A;  4TX5 A;  3CST A;  5LG4 A;  1EZ3 A;  4ILU A;  2PZI A;  2YU2 A;  4O4I E;  3PRE A;  2L9B A;  3KV5 A;  5T8I A;  4FLH A;  3BG1 B;  3UFE A;  2LAI A;  4JHK A;  3LBX A;  5KJM A;  3FUI A;  2ION A;  3ZYK A;  2V5F A;  2KAT A;  4PJL A;  4Q94 A;  2C0L A;  3PUQ A;  1EPU A;  4NUU A;  4X1K E;  4BY6 A;  3RRM B;  4GB9 A;  3QWW A;  3IEE A;  5KDM C;  2N2N A;  4TUU A;  5L3F B;  4HOR A;  2I2O A;  2DNX A;  4ZI3 C;  3ZVV A;  4AOF A;  1YD8 G;  3Q49 B;  2Q9Q B;  4ZHQ E;  3WAJ A;  4OHF A;  3U9W A;  3RRU A;  4GYW A;  2CHW A;  2VSY A;  1W3B A;  4OYK A;  4O2A E;  2X9X A;  3ZPJ A;  4HKA A;  1U5P A;  1JUQ A;  4H9S E;  3PE4 A;  4PK4 A;  3ZEF B;  4HOS A;  1QZ2 A;  4C91 A;  3NF1 A;  1MND A;  5F8P A;  3CHR A;  2KXP B;  3O1J A;  1HG2 A;  3Q5M A;  3ASD A;  5JR9 A;  3LDZ A;  4IE7 A;  2AVP A;  4FA6 A;  2VL8 A;  3IKO B;  4QKN A;  2LHN A;  2A2F X;  3UUL A;  3GMI A;  4AKR B;  1HXI A;  2C5I T;  2V7J A;  4I55 E;  3HKB E;  3S7D A;  1WM5 A;  1LRZ A;  4H9O C;  4G24 A;  3L09 A;  4ERR A;  4A55 A;  2VKO A;  1YW0 A;  4AQG A;  4PDX A;  3CVQ A;  1UJK A;  5FZS A;  5FZR A;  2XGM A;  3D9L A;  2NOX A;  3PVL A;  3N2K E;  3SOL A;  4P0B A;  2W0G A;  3ESK A;  3LVR E;  4KP3 C;  2X9H A;  2E9X A;  3FUF A;  4LCT A;  4JZY A;  1NA0 A;  3Q2M A;  3HHM A;  2W00 A;  4GYY A;  4UI9 K;  2XPI A;  4KMO A;  1TJC A;  2VYI A;  2ACX A;  1L5J A;  1AJ3 A;  4FJO A;  3HKD E;  2YU1 A;  3IBP A;  3FUL A;  3C4X A;  2CM0 A;  4ZI3 D;  2ZMA A;  3O4X E;  3JC6 C;  3W15 B;  3CPZ A;  4AY6 A;  3Q9D A;  3MZK B;  4AIF A;  2PM6 A;  1WAO 1;  5JQG E;  1B7T A;  4XZC A;  4KXK B;  4FC8 A;  4AQF C;  4UF0 B;  2X67 A;  3RYH E;  4I2W A;  4JHR A;  5LHH B;  3TG4 A;  3WAK A;  2CG2 A;  3KIN B;  1NP7 A;  4BTA A;  4AY5 A;  3SWH A;  4ZOL E;  5J2U E;  4U63 A;  2AXU A;  3APF A;  1FVH A;  5E76 A;  1N54 A;  3RU0 A;  1UX5 A;  3DTO A;  2PG8 A;  3BQL A;  4DVD A;  5KX5 E;  3MKQ B;  5JH7 E;  1H19 A;  3E22 E;  1HTJ F;  1S0P A;  1Z3X A;  5J90 A;  2FUL A;  4GOU A;  1FMV A;  3MA5 A;  5LCW J;  2MOZ A;  2EHO B;  4IE0 A;  3AB3 B;  2CWY A;  4X1Y E;  3HA4 A;  4HN9 A;  4GZD A;  4KVM A;  4CXY A;  5LYJ E;  3LJC A;  2V7L A;  4HEA A;  4U72 A;  4UVC B;  2XAS B;  1WR6 A;  4N3C A;  3ESL A;  4H7Y A;  4JUY A;  3JUI A;  5G05 J;  1SZA A;  4DMV A;  3AAE B;  3SNX A;  3L54 A;  3ZYQ A;  3GW4 A;  2X0L B;  4N39 A;  2KZT A;  3FHN A;  2L3L A;  2IC6 A;  3VLF A;  4L23 A;  3P7I A;  2H7V C;  4U74 A;  5HWY A;  2E2E A;  5HAX A;  2Y6X A;  4C9B B;  5ENN A;  3BEE A;  3I1A A;  1HCI A;  2C5J A;  2LT3 A;  3JC6 D;  3ETU A;  3FTW A;  3S7F A;  1EF1 C;  4KYO B;  4DMW A;  3FTU A;  4HGA A;  2ZU6 B;  3FWV A;  4XAX B;  2CFU A;  4H63 H;  1IYG A;  1D1A A;  4QFV A;  3HL6 A;  2X6I A;  2LSI A;  4NUV A;  2VAS A;  3FUM A;  4PAG A;  4IYP A;  4O2B E;  2NSZ A;  2KCL A;  3EHN A;  3P2B A;  2GGF A;  3TG5 A;  4AXP A;  4YJ2 E;  5G04 C;  4Y6W A;  4JL0 A;  4QWN B;  3P1U A;  2IFU A;  2WSS V;  3UT5 E;  3RPU A;  5JDQ A;  3N9N A;  3GZ1 A;  4DPR A;  4EXT A;  1FIO A;  2Y4T A;  3FTY A;  3FBZ A;  3RJV A;  1HF8 A;  3ETV A;  3UTK A;  1A17 A;  3GYZ A;  1N52 A;  2XAJ B;  5JRC A;  4HOU A;  4GYR A;  4P09 A;  2K5B B;  2WM9 A;  3MAC A;  3I4G A;  3Q5X A;  5EX0 A;  2VGX B;  2CG3 A;  1PAQ A;  3UUX B;  5A1L A;  4GZ5 A;  4WNE A;  3QDN A;  2ZM2 A;  1BR4 A;  1GW6 A;  5EX3 A;  4IE6 A;  3OBV E;  3C98 B;  2LSU A;  2E0I A;  3OXF A;  2X6J A;  3PZD A;  1US7 B;  2JRK A;  5JDG A;  1ZEE A;  4DLO A;  1SA0 E;  4GCO A;  2OVB A;  4H9Q C;  3ZGQ A;  1OWA A;  4L1B A;  3KBU A;  2VTB B;  4TV8 E;  2NW8 A;  2UY1 A;  4GK0 E;  2I6H A;  4FHK A;  3KAE A;  4ZS3 A;  4CDN A;  3SD5 A;  1D0Z A;  3UX4 A;  3UMV A;  3CKC A;  4EEC A;  3ZJ2 A;  5FNV E;  2KND A;  2V7K A;  2BUG A;  4HFG A;  5FZQ A;  2AXV A;  3I3N A;  2UXN B;  2KT9 A;  2XQ0 A;  1QQE A;  5FY1 A;  1XNF A;  4XI9 A;  2N9D A;  3ASH A;  1Y6I A;  2D5U A;  3O1I A;  4H7X A;  2XAH B;  3N5L A;  4BX8 A;  4EZJ A;  5AFU L;  5LA6 E;  4ZS2 A;  3MV3 B;  3ULQ A;  5H6R B;  2M63 A;  2BZB A;  3EVY A;  3L22 A;  2RA1 A;  4RG9 A;  5TAO A;  3ZMS B;  4N3B A;  2FEZ A;  2V26 A;  2ZLY A;  4NQ0 A;  5J2T E;  4A3V A;  2V8S E;  3FUK A;  3AA1 B;  3EHM A;  4YLH A;  5LHG B;  2GRL A;  5JDM A;  5F3J A;  4YHJ A;  1Z3Y A;  3Q5W A;  2LOP A;  3D9I A;  1B89 A;  4KZC A;  3BQI A;  4CXW A;  2J4B A;  3ANW A;  4EZL A;  4AKL A;  3ZHE A;  3ONL A;  1H6K A;  4N5C A;  2IQC A;  3G2V A;  2MHK A;  5HXS A;  3LKU A;  3LEW A;  2A4Z A;  1TJF A;  3Q15 A;  5FQ8 A;  3S2A A;  4CEM A;  4I43 A;  2VSX E;  2J4D A;  5KJL A;  3AA7 B;  3HI2 A;  3SS1 A;  3MYV A;  4DBR A;  4XE0 A;  4KZ0 A;  2IJG X;  4B0Z A;  1PY1 A;  2DCF A;  4J0U A;  3MX3 A;  2LEH A;  2JMH A;  3VLD A;  1SZ9 A;  2FBN A;  3APD A;  2PL2 A;  3B7S A;  4JEU B;  3PE3 A;  1OWM A;  3H3A A;  5FQ4 A;  4J8S A;  4IE4 A;  3HKC E;  1ELR A;  2DCP A;  4N2S A;  4UWL A;  2K48 A;  2KMF A;  3FEY A;  4U0U A;  4U0Z A;  1HG5 A;  2XQY A;  3PUA A;  4UWK A;  2X3M A;  3QWP A;  3KS2 A;  5FP3 A;  3MZL B;  5JDF A;  3LPZ A;  2CLY B;  1WRD A;  3IHR A;  1X5B A;  3H37 A;  3N9M A;  3N71 A;  4WWO A;  2Q7F A;  3EDT B;  3EIQ C;  2YHC A;  4I1O B;  3I4R B;  3CX8 B;  5HWX A;  2KIN B;  4L9I A;  4I6J A;  1D1C A;  1LVF A;  2VWA A;  4WWN A;  4XX5 A;  2BDE A;  3CHQ A;  3OYZ A;  4JHJ A;  5ARF A;  4C90 A;  4GMJ A;  2WAU A;  1INZ A;  1G8X A;  4V3I A;  1TEZ A;  3APC A;  2E9X C;  1UCU A;  5GON E;  4KMC A;  3AA6 B;  2CWO A;  3CEQ A;  2JQQ A;  3PUK A;  2Y8D A;  2XAG B;  1BR0 A;  2MOW A;  5LOZ A;  2PM7 A;  3J7Y q;  4H9P C;  2X9Y A;  3D9M A;  2AXZ A;  2WXM A;  3QNK A;  3E4B A;  2AWI A;  4WNF A;  5BV1 A;  2XHE A;  1G73 A;  1FCH A;  3S4U A;  3D3M A;  2NC9 A;  4DBQ A;  1MMG A;  4L0R A;  2LE8 A;  3RYF E;  1KNZ A;  2DWK A;  2GW1 A;  3ZEF A;  4ILG A;  1SQM A;  5LCY A;  3KD7 A;  4BX9 A;  1CUN A;  3VKH A;  4UVB B;  4BSX A;  4MAL A;  2VQ2 A;  3I9Y A;  3LBX B;  2WXL A;  3N2G E;  2NTY A;  3MKR A;  5BPP A;  2X38 A;  3ZCI A;  2Y4U A;  3G2W A;  3F57 A;  4IE5 A;  2CHZ A;  3KVB A;  1HFA A;  2CXL A;  2WXJ A;  5DQV A;  2J09 A;  1FMW A;  1ZU2 A;  4I17 A;  3U3I A;  3AS8 A;  4N3A A;  1UN8 A;  4PS7 A;  4OFZ A;  5FQ7 A;  3K3O A;  4JA7 A;  1UN9 A;  3SZ7 A;  2NXP A;  2W62 A;  4JVS A;  2A72 A;  4UV8 B;  3ZMT B;  4XBF B;  3FUE A;  4X1I E;  5L3C B;  4BJM A;  4EB6 E;  3LY8 A;  2CMR A;  3CQX C;  3QC1 A;  5EZY E;  1VDY A;  1ZV4 X;  2WXQ A;  3TXM A;  4HVB A;  2E9X D;  2V4L A;  4UWF A;  5CCL A;  1YKH B;  5JR9 B;  3ZN3 A;  2ODV A;  5FQ6 A;  3AS5 A;  3RRN B;  2WPV A;  2BVM A;  4IHJ E;  4GA0 A;  4K03 A;  4GU5 A;  4M3O A;  3RO3 A;  2WXR A;  1FVF A;  4EZ4 A;  1E7V A;  1D1B A;  2JJ9 A;  2IC9 A;  2XCC A;  3ASG A;  3FU0 A;  4EQF A;  4BT9 A;  2FI7 A;  4HOQ A;  2I1J A;  4UQX A;  4FHJ A;  5LXT E;  2RD0 A;  4UI9 J;  2D0T A;  3IBE A;  1LVK A;  2VGY A;  3GZ2 A;  4XI0 A;  1MIW A;  2WQH A;  2CXD A;  2LSJ A;  1E96 B;  3HYM B;  2KWH A;  4IUL A;  4OVU A;  3SI5 A;  5FMN A;  4UWG A;  3CVY A;  3ZMZ B;  4CCA A;  4MRU A;  5BT1 A;  1LKX A;  2CXF A;  2LAH A;  4DK5 A;  2C2L A;  5HXH A;  3IF8 B;  1D0X A;  1HX8 A;  4PJJ A;  3ZRH A;  2G0U A;  4J6I A;  4UIG A;  2I9C A;  2OA5 A;  3RH3 A;  2QFC A;  2VSO E;  5FTP A;  4B8C B;  3F31 A;  4KBM B;  3MXZ A;  2UWJ G;  3KFW X;  2WXN A;  2EHO A;  2WXG A;  4B89 A;  5LGT B;  4EOZ B;  3CKD A;  4PFP A;  4TUY E;  5JDL A;  1P5Q A;  4IDZ A;  4P0A A;  2RP4 A;  4ABN A;  2XGS A;  1WYB A;  1IAP A;  1HS7 A;  2GRM A;  3AA0 B;  3R7Q A;  2WXI A;  3VU7 H;  1BR1 A;  4LRZ A;  5G2N A;  1HE8 A;  4RSY A;  4YVQ C;  3N9L A;  1HU3 A;  4I6E A;  5AYW D;  4A1S A;  2XPZ A;  4CQI A;  3HDX A;  1NZN A;  3R9A B;  4NAC A;  1U4Q A;  3IHY A;  2NWB A;  2XTL A;  2J9Q A;  1MNE A;  4V1A v;  3N9Q A;  4BJN A;  4I9C A;  2WXH A;  3E0Z A;  3S7J A;  4LEU A;  5LHI B;  5DIZ A;  4EPZ A;  4JC8 A;  3CQG B;  4G2V A;  2LSY A;  1E7U A;  4Q96 A;  4UEM A;  2XUE A;  5DJQ C;  3K3N A;  4JLE A;  3D9J A;  2QGS A;  3OKQ A;  1IJ6 A;  3K3Q C;  3QUJ A;  3PH0 C;  3CVL A;  3PRZ A;  1D0Y A;  2XPY A;  3ML9 A;  4FJY A;  5FXZ A;  1X79 A;  3K8P C;  4JEH A;  3ZYM A;  1WY6 A;  3J9X 1;  3CVV A;  2I1K A;  3ZYL A;  3FUJ A;  3MV2 B;  4EAH A;  4MFR A;  4CI3 B;  3ZXS A;  3MEK A;  3PTR B;  3ZN0 B;  2V7I A;  3EIJ A;  2XEV A;  3MJW A;  3IV0 A;  5CMW A;  3QB2 A;  4OYS A;  3FY4 A;  5CCM A;  1H7C A;  3UT4 A;  2NP9 A;  3RYC E;  3AVR A;  2LO6 A;  5HI7 A;  5ADX L;  5HYA A;  5JHA A;  2H3R A;  2OV8 A;  4YND A;  1E8X A;  2VJ8 A;  2J49 A;  3NZU A;  3CVU A;  3QC9 A;  5EK3 A;  5A6C A;  3NZP A;  4HE8 A;  3MJX A;  3MA9 A;  4ME2 A;  1IQR A;  4I6G A;  4FLB A;  3C98 A;  5H6Q B;  3HVE B;  5KJN A;  5HXC A;  3LY9 A;  2QA7 A;  2PFV A;  5JJT A;  2WQ6 A;  3UUN A;  3O9X A;  2LNI A;  3LG7 A;  3FTX A;  2XAQ B;  4ANJ A;  2YHE A;  4CT0 A;  2RG8 A;  4EBA A;  3QOU A;  4L7T A;  3C4Z A;  3CWZ B;  2HYZ A;  3G2U A;  2C0S A;  3F2E A;  4GZC A;  2R5S A;  3CK8 A;  5AIJ A;  3UPV A;  4N2Q A;  4RG6 A;  4E6H A;  4UWH A;  4J8D A;  5JRC B;  4EYU A;  1UX4 A;  2KCV A;  3MGB A;  3U64 A;  1HZ4 A;  4CZZ B;  4MLK A;  5EKQ D;  1U3D A;  5FYM A;  3CSF A;  2DHR A;  3EDV A;  3GN5 A;  4UQY A;  3M65 A;  4IRU A;  2CA5 A;  2V0P A;  3QJZ A;  3ONX A;  4L2L A;  3CIA A;  4AJW A;  4C0M A;  3QK0 A;  3V5S A;  4I4T E;  4XZ4 A;  3UUM A;  5LP6 E;  4H9N C;  3ZMU B;  1VRB A;  3UT7 A;  4QXH B;  2DIW A;  4Z8X A;  5M4Y A;  3QWV A;  4CGV A;  4G25 A;  5ETW A;  3RKO A;  4O8S A;  4BTB A;  2UY1 B;  3PUG A;  3KVA A;  1HO8 A;  3DPD A;  3T5V A;  5BMV E;  1WYC A;  1MIY A;  5AEN A;  4ILI A;  2NTX A;  2XAF B;  4O4L E;  2LHR A;  3NBX X;  4WAF A;  3ASF A;  3O48 A;  2L6J A;  3T8M A;  2IU1 A;  4GIW A;  3O1H A;  4PK5 A;  5A23 A;  2IOL A;  3C4W A;  3C51 A;  2AW6 A;  2WXO A;  1Z6T A;  4U07 A;  4AP2 A;  3RRW A;  4D10 C;  4TZ4 C;  5J1G A;  3G2S A;  3OYX A;  2PQN A;  3RYI E;  4KBQ A;  4GPK A;  2PBI A;  3ZC0 A;  4G1T A;  4PJN A;  2UXX B;  5BUZ A;  4WNG A;  1E90 A;  3CV0 A;  2A3D A;  4ATG A;  2Q9Q C;  3R84 B;  5G55 A;  4Q69 A;  3PEU B;  2ES0 A;  4DI3 A;  2D2S A;  5CA0 E;  4U04 A;  3FH8 A;  5M72 A;  3SF4 A;  4L5G A;  2KZ7 B;  1DNP A;  4A56 A;  1UW4 B;  4A3T A;  3DBS A;  2BTD A;  1IZN B;  3SBT B;  3TAX A;  3KV6 A;  2LSG A;  4ANU A;  5A7D B;  4KUM B;  2PJQ A;  3FP3 A;  5LP0 A;  3D9P A;  4CXX A;  5CB4 E;  4CDR A;  5HQ8 A;  2WQ7 A;  5BW8 C;  3FUD A;  3K9I A;  1XGW A;  3PU8 A;  1E1H B;  4AVX A;  3ZHE B;  4DND A;  1PC2 A;  4WND A;  5LNK A;  1QNF A;  3GA8 A;  4HFV A;  2PQR A;  2L8K A;  3I0Q A;  2ILR A;  1KLX A;  1E8Y A;  3ENE A;  2WXF A;  2DLR A;  3T5X A;  5LCW C;  3AAA B;  2OVF A;  3CVR A;  2WXK A;  4B94 A;  4MLP A;  2R17 C;  2Z6E A;  5DBK A;  2V1D B;  4I1M A;  4MBQ A;  3U4T A;  4KT6 B;  4HS2 A;  3QKY A;  4UEL A;  4JXT A;  4WWP A;  4GYO A;  2KLQ A;  4HOT A;  3PUJ A;  4OK0 A;  5JJ6 A;  5L2L A;  2WB2 A;  4IIJ E;  4U0S A;  1OWP A;  2X6K A;  2IOS A;  4BFR A;  2BF0 X;  3MCX A;  2WBL A;  3SFZ A;  2X9W A;  1MIV A;  4OVV A;  2CFZ A;  4K0R A;  2LJL A;  3OTN A;  2LM9 A;  2HPJ A;  2N1G A;  3SGH A;  1MQS A;  2A5U A;  3QK6 A;  2YIN A;  2Q9Q D;  3CVP A;  1SHZ C;  3OXL A;  4BA9 A;  4C0E A;  4ACL A;  2LOS A;  2SPC A;  4XKB A;  4Y6C A;  3FHE A;  5G04 J;  4CT4 A;  4UV9 B;  4B8A A;  2WVI A;  2Q9Q A;  1ZBP A;  3GZS A;  2VKD A;  2JEK A;  1NAF A;  3JYS A;  3LJ3 A;  4F6R C;  4LUN U;  4JW1 A;  3D9N A;  4RVB A;  4AM9 A;  4I1A A;  2ZM0 A;  3SRZ A;  1BPO A;  4IN3 B;  3FTV A;  3CVW A;  3IEG A;  4UQZ A;  5L3E B;  3B57 A;  2VK9 A;  3HIZ A;  2MTQ A;  5LBM A;  1ELW A;  1HS6 A;  4APF A;  4G26 A;  3R6N A;  5D0Q D;  3A5X A;  3TGO A;  3JCK C;  2V7M A;  2XHE B;  4I50 E;  4YJ3 E;  3I5P A;  4JA9 A;  4DI4 A;  3WI3 A;  3NRY A;  3QAQ A;  2E8I A;  2P58 C;  2EHO C;  2WMO A;  3LK3 B;  2D0U A;  4ZI7 E;  5AJL A;  4WUY A;  4EZK A;  3TJP A;  3ZIM A;  4AV7 A;  5E75 A;  3TL5 A;  3CX7 B;  3EUH A;  2NW9 A;  3RC8 A;  2FF4 A;  2J07 A;  3U3W A;  2X51 A;  5LJM A;  3PEV B;  3L17 A;  5L3B B;  3LK4 2;  5ARG A;  3MK7 C;  3KV9 A;  3ZN1 B;  4PUC A;  3O4Z A;  4CI2 B;  2MBG A;  2X66 A;  3B7R L;  3VLE A;  3KBT A;  2XCB A;  5ANL A;  5DQW A;  2VKH A;  1ZKE A;  3ML8 A;  3N9P A;  4ANX A;  4GA1 A;  4I2Z A;  4G2A A;  4M1P A;  1MMN A;  1QSD A;  2L0I A;  3RKV A;  3CLJ A;  4F1S A;  5EDS A;  4FI5 A;  4ASK A;  3U66 A;  4GCN A;  4WW0 A;  3R7R A;  2VKJ A;  2X6F A;  1JPL A;  2J1D G;  4WNK A;  3Q4A B;  2ODU A;  4UF0 A;  1YA0 A;  5CMY A;  3L16 A;  4CI1 B;  2E9X B;  5C2Y A;  2CCQ A;  2IF4 A;  5LX8 A;  1IJ5 A;  1S35 A;  4DLQ A;  4HLE A;  3NZS A;  4ACK A;  1WLX A;  1KK7 A;  4BT8 A;  4QXC B;  5LBQ B;  2HR2 A;  2WWU A;  4E85 A;  4AI6 A;  1MHQ A;  3B7U X;  2OOE A;  1Y64 B;  5L3D B;  4ANW A;  3MKQ A;  5FWQ A;  4PNI A;  2EHO D;  2YQ8 A;  2IW5 B;  1MMD A;  2WXP A;  3VHL A;  3OXG A;  3EJN A;  4ISS A;  5JDN A;  5LJN A;  3FH7 A;  1V9D A;  3WXX A;  4GAA A;  4ANV A;  4J2C A;  3LYA A;  1FEW A;  3URZ A;  2HPL A;  4K0U A;  4BAY B;  3FUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...