1HFAA

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, pi(4,5)p2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
b'GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 100
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hfaA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hfaA01
1LF8A 1JUQA 4Q94A 1SZ9A 1HF8A 1HG2A 5LOZA 2LO6A 1JWGA 4FU3A 1ELKA 3G2SA 5CMYA 4FLBA 3RRUA 1EDUA 1UJKA 3D9IA 1HX8A 5CMWA 3ONLA 3G2TA 1UJJA 1JWFA 3CLJA 1VDYA 3G2UA 3LDZA 4Q96A 3ZYLA 2BF0X 1X5BA 2L0TB 1INZA 2QY7A 3D9KA 3D9NA 3ONKA 1MHQA 4JXTA 2L0IA 4GZCA 4NACA 1H0AA 1PY1A 1DVPA 3ZYQA 1XGWA 3ZYMA 5J08A 5LP0A 4AVXA 2MOWA 3G2WA 1HG5A 3D9OA 3D9JA 2DIWA 3D9LA 3D9MA 3G2VA 1HFAA 3ZYKA 4GZDA 2V8SE 1EYHA 3D9PA 4HFGA 2DCPA 2KM4A 1JPLA 1SZAA
chains in the Genus database with same CATH superfamily
3V5SA 4F6RD 4CXYA 4UV9B 5H6QB 2PTFA 1D1AA 2JJ9A 4HN9A 3IHVA 5FINA 2XM2A 1HX8A 2P2CP 3ZMVB 4ADZA 1ELRA 2LSJA 5L3DB 3QB5A 5FKYA 4AKRB 2ZM0A 2M67A 2XSBA 4QFVA 4ILCA 2Y1LE 2A2FX 5EX3A 1AP7A 3RJVA 2XAQB 2HPLA 3DPYA 1FIOA 4ZXLA 1DVPA 3WI3A 3RSEG 1K1AA 2A5EA 2XS8A 2K48A 5ENSD 3VTXA 3ULQA 1MX6A 5FP3A 3RHWA 1B89A 5G05C 4U0UA 5EDSA 3Q5MA 4APOA 1S64A 2H89A 1E96B 3UPVA 4AQGA 2J1DG 5FQ7A 2K3WA 2CG2A 3TG4A 2V5QC 2LSKA 2JQKA 4U04A 5ABHA 2QYUA 2MYOA 4BTBA 2KZ7B 3Q15A 5HXSA 4HI8A 5D0OD 4A1GA 2A72A 3Q73A 2LT3A 1HG5A 3H3MA 4TXRA 3CVXA 1D8DA 4X8QA 1Z6TA 2XQ6A 3FTWA 3EHMA 3L39A 2IJGX 3A8YC 4G63A 5CMYA 2WVIA 3SFZA 3OBVE 3Q9UC 3C50A 5C8YE 4RSYA 4WUYA 3CLJA 4L5GA 4PJLA 2I6HA 2XPYA 4U96D 4GTOA 1X5BA 4LCTA 3FUIA 5ENRD 1N36T 2WCAA 4NURA 1IQUA 3N2KE 3FP3A 3PUKA 4GA0A 3AXJB 5D0QD 1BR4A 4IDPA 5J0ZA 3NZUA 4ISTA 2NYJA 3FBLA 3RYIE 4QXCB 2XZEA 4H63H 4TWDA 4DX1A 3WXXA 5L3EB 4Q94A 2V4HC 1YYHA 4XIFA 1FEWA 2LLYA 2HE0A 2VKHA 4DV7T 1FT1A 2IF4A 5CBNA 5CEDB 2XQ9A 3Q4AB 4KX6A 3MX3A 2IO3C 4CGVA 3AXJA 3CK9A 2ES0A 2JQQA 2X6HA 2WS3A 1E8YA 3OAWA 2LSUA 3VRAA 1UGOA 5HI7A 4CI2B 4ZS3A 4FC8A 4X65T 4LFBT 4OK0A 4WNFA 3RGLA 2GK9A 3P4WA 3JUIA 3EHRA 2IQCA 3D9KA 4ZI2C 2V26A 4I1MA 1UX5A 4I6JA 3IXEA 5LMUT 3R84B 2P9SG 2IU1A 2XY8B 3JQ0A 4HXIA 3N71A 5CERB 1YW0A 1LF8A 4GMRA 3B7RL 4YHJA 5JMND 2UXNB 4A56A 3I4GA 1KNRA 1M62A 2GROB 3KDSE 5C3JA 4KI0F 3IHRA 5CA0E 4I1AA 4F8HA 3SFYA 3UU8A 3ASNE 4MBQA 3O1JA 2M6IA 5G55A 4J8FA 2NWBA 2VASA 3K3QC 3QJZA 1JUQA 1SZ9A 3ZC0A 3PZ1A 4EXTA 4LG6A 3OXLA 5LCWJ 3SY2A 4DV3T 2CXLA 4Z91A 2CHOA 5HXCA 2GRQB 4HWHA 1WLXA 5BMVE 4F3VA 1HH8A 2XS1A 1IZNB 1NP7A 5CFBA 5LP0A 1WRDA 2XQ8A 4PFOA 2P9LG 1KPSB 1NFIE 3UM0A 4M1PA 3D9MA 2P9KG 4JHRA 3CK8A 2BBJA 4HB5A 3ZCIA 4LUNU 2I9CA 2VSNA 4OVVA 3LJ3A 5HKPA 3AEAA 4QKNA 3VR8A 3Q5WA 3ZN0B 3NBNB 2OV9A 4WNDA 3Q79A 1MX2A 2IHR1 5CHEE 1OEDB 4DUIA 2W2UA 2D0TA 1HCIA 1FPPA 4WNGA 2OVBA 3FHEA 3D9LA 2KCKA 3O1IA 1E8XA 5FL0A 4IDNA 3EI0A 5JHAA 4IE6A 3KBTA 1KF6A 5BR8T 1O1TA 4DBQA 2G0UA 4DMVA 1UJKA 2W0GA 5A1LA 4KZ0A 2WZHA 3FH8A 4I4TE 1OEDA 4QHOA 4B93B 2CCQA 2XQ3A 2UUAT 2IAKA 2ODUA 3O1HA 1NI1A 2AXUA 4L23A 4EECA 4JEUB 3E32A 5G04C 4GZ3A 2VGXB 1HS6A 4UI9C 3EVYA 2FBWA 3L3PA 3HL6A 2IC6A 4ZZCA 4UWKA 3IF8B 3NZPA 4X5TA 4WNEA 2RD0A 4JI3T 5FZQA 2VVSA 2XPZA 4HTEA 4K0RA 5JJ6A 2KBXA 3FDHA 3NQPA 5EIBE 1V9DA 2VGXA 2CBJA 5AQUB 2SPCA 2CG3A 2E0IA 3UM3A 1Z5SC 4JA7A 2BS3A 3ZYMA 3WG7E 4WW0A 3V5UA 3UQ7A 1QSDA 3AU4A 4PS7A 3JC6D 4CYMD 4UXNB 1MIVA 1IQRA 4LF5T 1H2TC 2KWIB 1P5QA 5LOZA 5KWDA 2PFVA 3LK3B 3AA6B 5T3RA 2DZNA 4ATGA 3RI5A 3AE6A 3C3QA 3K9IA 2BG9B 4I2ZA 5CMWA 5KJMA 2L9QA 3FULA 1LKXA 5LA6E 3FUNA 2LXMA 3E33A 4WZXA 2IONA 4Y6WA 2K24A 3H37A 4QQIA 5FQ8A 4AIFA 3HXCA 3C4WA 4ABNA 2BKNA 4CEMA 4U33A 2FBNA 4CXWA 2NW8A 1DC2A 1WR0A 3KINB 1HFAA 2BG9A 1ZB1A 4PK6A 4DPRA 4TNWA 4DIDB 3L13A 2QGSA 4JHKA 3CVNA 1JWGA 3PZ4A 2D5UA 5EN5D 2J4DA 5CECB 1TYQG 2J62A 4KUMB 1YD8G 4ILIA 2CHZA 2ACZA 3P7IA 1VDYA 2E5VA 1W0BA 2WXNA 1TNZA 2XCCA 4H7XA 5L4EA 3SI5A 4F1PA 5AQAA 5CCMA 1RW2A 3ZCJA 1FVFA 3CX7B 3KSQA 5HCMA 2V7LA 2XQYA 1HXIA 4L2YA 1OEDE 4EGWA 2V7IA 3MK7C 2ZMAA 2VB6A 1HG2A 2OOEA 4GB9A 4CT4A 2V6YB 2V4LA 4JZYA 4CN1A 4BAYB 4COFA 2L8KA 3T8MA 2NTYA 2YKSA 2K5BB 2XEVA 4OAUC 3LYAA 3AA0B 2WPVA 3DWLG 3FHNA 3L9TA 2E5LT 4J8YA 4XZ4A 3ZEFB 2V8SV 2P9PG 3FUEA 4N39A 2WXJA 4KYOB 3W9GA 3PDYA 2V6YA 3B7BA 4MFRA 3TL5A 3ASFA 2BDEA 3CSFA 2JPFA 5EYPF 2R2LA 4JPSA 3MJWA 2BG9C 4F53A 5HEUA 4Q25A 3ZYLA 3S7BA 3ZEFA 5L3CB 1S70B 2LSVA 4JC8A 4O8SA 4GCNA 4CDNA 4YJ2E 4DUZT 4BX8A 4RQIA 3C51A 3R9AB 3C3OA 4J8SA 5DABA 4A3TA 4LMLA 4HBDA 2ACXA 4JLEA 3ASDA 4EAHA 4KMCA 3RF1A 2CFUA 3KD7A 3ZPOA 1LD8A 5JDFA 5JH7E 1TNUA 3V2XA 3L22A 1E1HB 2BG9E 2IDOB 2YN6A 2PBIA 3B95A 4CCAA 5AQMB 4EBAA 2IY0C 3QAQA 1PAQA 4OAVB 3T8KA 4BY6A 3U9WA 3ISMC 2J08A 3CIRA 3QOFA 1HZ4A 2H6FA 2JEKA 2LM9A 4GTQA 4NQ0A 3ENEA 2R5SA 3KVAA 2HO1A 4AIUA 3ONLA 2JLBA 4GKKT 3RAUA 1MMGA 4JI1T 2YK0A 4PAGA 1MNEA 2QY7A 3FBZA 4JVSA 4K03A 3U64A 4BERA 3RO2A 5EILA 1YMPA 3P8CD 4HFEA 4AJWA 2W61A 1WM5A 3EU5A 4DV1T 3AE9A 2OEVA 5CJ5A 4IHJE 3VLDA 1O1RA 2H6IA 4G11A 3ML9A 1YCSB 3CK7A 5AQKB 3AA7B 4PNIA 3ETVA 3UM2A 1HNWT 4Q69A 5IWAT 4CXXA 4QH5A 4ILGA 4DX6D 1E8WA 4KT6B 2V0PA 5LFAA 4XI9A 4GA2A 5C2YA 3TWXA 3LDQB 5M4YA 2Q9QD 3RKGA 4MLPA 1IHGA 3O9XA 5BXUA 3VR9A 5TAOA 1Y6IA 5JDHA 5ABFB 3B7SA 5FTPA 2V5DA 2BEDA 1WY6A 2X6FA 3L16A 2CMRA 4I55E 3J5PA 4GTPA 2F4VT 4HE8A 3GZ2A 3EHNA 5JVDE 2VKJA 4LNUD 2JIWA 4BJMA 4E6HA 5HCJA 1DNPA 2WB5A 3V2OA 3FEXA 2ZISA 1X9BA 5JA4D 4MALA 2Y0BG 4IN3B 4NACA 4CN6A 2UXDT 2LHRA 3PUVF 3UU3A 2IFUA 5ABFA 1IXVA 2PG8A 2AW6A 3MKRA 4UQYA 5ANRA 4U07A 5LCWC 5LXTE 4PH4B 5AQQB 3F31A 3AU5A 4HRMB 2J09A 3JXJA 4U7YA 4I2WA 1IBKT 3CEQA 3PUXF 4BWRA 2R03A 4K0KT 1EPUA 3O48A 2XQ5A 2L3LA 1HU3A 5HWXA 3Q75A 4OVUA 4DO0A 1N95A 3QC1A 3AAAB 4JXTA 1KLXA 1SW6A 1MIYA 2LOSA 2N1GA 4IYPA 1N9AA 3RIUA 2B6CA 3CVVA 5AQBA 3FZMB 4PJMA 3SFXA 3UUNA 3NF1A 4UWFA 1WG0A 2FJDA 1NAFA 4L2LA 4ILBA 3OTOT 1HF8A 3QWVA 5AQTB 4GYRA 2XTLA 4FHKA 4IULA 2QYJA 3FU3A 4B0ZA 4TN7B 4KZCA 3ZHEB 3NOGD 1HO8A 1DU2A 4Z68A 2AXDS 2B76A 3U3WA 3JUEA 3KV9A 3PDNA 3RC8A 4IGUA 2X6IA 5JDGA 4TZ4C 3TWVA 4B6XA 4OHFA 3FUKA 3EUHA 4LF9T 5AYWD 2RKKA 3UFGA 3LBXB 3PTRB 4GMLA 4LEUA 1TNBA 4TV9E 3KEZA 4MBGA 3MV3B 3ZHEA 2WAUA 1S94A 1UW4B 2X6JA 4ILAA 3KEAA 2UUCT 3I9YA 4G8KA 4AISA 1OXZA 4JA9A 3CVRA 5HQ8A 1VRBA 3LBXA 5BPPA 3ZT7A 2J4BA 2D2SA 1FMWA 2WMOA 1D8EA 3C98B 4F6RC 3FTVA 1NWMX 4URKA 1KFYA 2QC9A 4IL9A 4KVOA 3LFMA 2GGFA 3RIUC 1ZKEA 3NRYA 5LHGB 5HEGA 4HRNA 3Q5XA 4UEMA 2AXZA 1IKND 2WU2A 3RRWA 1KT1A 4FJZA 2WQ7A 1CUNA 3PUWF 3A7MA 4X66T 1S35A 2N9DA 4YLHA 1NZNA 3C98A 4YDYA 1OCZE 1D1BA 4RG6A 3QC9A 2RG8A 3AAAC 1LTXA 4GTVA 1RZ4A 5ENPD 4OYKA 1BPOA 2IC9A 3URZA 4YT0A 2WWUA 1H6OA 3IEGA 3ZXPA 5HS0A 5L3GB 3FZKB 2FJEA 3ZW3A 4LF8T 1OCOE 5KNHD 4DX7D 3GA8A 2WXMA 1U3CA 3AECA 1O5MA 4KP3C 2W62A 4H9NC 3NVOA 4I0UA 1MNDA 2KSRA 4QX7B 1TJFA 3JAEA 4ILHB 2V1DB 3RQWA 3ZN1B 3JCFA 3U3IA 3TGOA 4FA6A 4JI4T 3TLTA 2HR2A 3UT4A 1N54A 4K0UA 4ZZBA 3E34A 2GRRB 3QARA 3IKOB 5FY0A 3SFEA 5F3JA 4YTNA 2CA5A 2IO2C 4AXHA 1WR6A 2V8SE 3FU0A 3E08A 1SZAA 2WBLA 3K3OA 5LHIB 1WFDA 4X1KE 3CGHA 3CV0A 4PUCA 3DSXA 4O4HE 5ENTD 2KWHA 1U3DA 4N2QA 2WXIA 2R05A 3DJBA 5EZYE 5FT9A 4EIWA 2RPAA 4B3TT 2F37A 3J9X1 3QWWA 1OWMA 3AE5A 1BI7B 2DZOA 4GZ6A 4HFIA 4GYWA 4BTAA 4CN4A 1J5ET 4CZZB 1I6ZA 2UU9T 3PURA 3ZJ1A 3CX6B 2W63A 2V7MA 4JEHB 4U3CA 3PS6A 2LO6A 4I6EA 3WAKA 3FUDA 4A55A 1H7CA 3BEEA 3VRBA 4BJNA 4UVAB 5HEJA 3AEFA 1MHQA 3ZMUB 3HXFA 2ZXWE 2MPKA 2D0UA 4QH1A 4MLKA 4JEHA 3AE8A 1Z8UA 4HFHA 3VTYA 1YA0A 2WM9A 1Z3XA 3I5PA 3DSUA 4P29A 5HEHA 2VQFT 3ZVVA 1TN8A 4H9SE 2PNNA 2YNQA 3LY9A 4JW1A 5IHYA 4X62T 1SQMA 1A5EA 3ASHA 5ENNA 3JXIA 4GOUA 3S7JA 2OCCE 2EIME 3QUJA 4GKJT 3LVRE 1TJCA 2WWVA 3TWTA 3HI2A 4TUMA 3HIZA 3VLFA 2DWZA 2CFZA 1KNZA 2DWKA 2NW7A 3DP7A 3LK2B 3AVRA 2J07A 2KCVA 3LJNA 1AJ3A 3RX6A 2IOSA 3GZSA 4N5CA 3EDVA 5JRCB 4EB6E 3EDUA 3O4XE 3UIOC 4KVMA 2WB2A 4J8DA 1HS7A 4HFDA 2AE9A 3CKDA 3LJCA 2C5KT 4K5AB 3UT5E 4IIJE 5FY7A 1XDPA 5HAXA 3PNTB 3EAMA 3M65A 4WYVA 3CMLA 4EQFA 5BXOA 4TNVA 3H3AA 5JRCA 1OWOA 5AQNB 1MMNA 4HLLA 2QVAA 3KV4A 4HLEA 1JPLA 3ZMZB 4GMJA 5AARA 4IT4A 2P9NG 4BFRA 3UU5A 4UQXA 2ETAA 4UVCB 2JABA 5L4HA 3NWIA 2ZM6T 3APDA 3CR3A 3Q49B 2WQYA 3ONKA 4MHCA 2QRXA 5EK2A 1OWAA 2QYWA 2H88A 4JI7T 4EZLA 3M3ZB 2D9DA 3DRAA 4TWFA 4ANJA 4X64T 5CBOA 2VYIA 1XNFA 2X9HA 4JUYA 4TUYE 4GZCA 1BU9A 1HTJF 5LGNB 2A4ZA 1D0ZA 2DI4A 3CVYA 3TAXA 2X51A 3N9QA 1EDUA 3D9IA 3RC3A 3PU8A 3CVWA 3UU4A 3APCA 3HKBE 3AAEB 4TV8E 3KBUA 1TNOA 5FY1A 5E75A 3HYMB 5FVKA 3TLVA 3UUMA 3CK6A 3TLUA 1FJGT 3AA1B 4TRQA 3ZKJA 4IE7A 2DNXA 4EYYR 2J47A 1N52A 3DEOA 5LBQB 3BK9A 2L9BA 2W4XA 2X67A 4HWIB 3ABKE 3QK0A 4YVOA 1EF1C 2WSSV 2WXQA 1G73A 3B13A 5DQWA 4CI3B 3EIQC 4X20E 2WQHA 3MGBA 5DIZA 3Q2MA 3ONJA 3UULA 2LXLA 2VJ8A 1WYBA 4BETA 4N3AA 3AS8A 4LMKA 3T8OA 5HXRA 5JR9B 4C0MA 2YU1A 5C2TA 2C0LA 1KEYA 4HRLA 3PJAJ 1V55E 3SNXA 3OKQA 3HG0D 2BS2A 5AQRB 2KM4A 5FXZA 4V3IA 1MJ0A 1YQ3A 3E37A 2YDQA 2J8SD 4GTSA 4HEAA 2WXGA 3MEKA 1X79A 2I0MA 4JEUA 4DR5T 4C48B 3P4SA 4TV3A 2BVMA 4ZOLE 2C0MA 3JC6C 3KAEA 4F7AA 1PY1A 3QKYA 4LSZE 3J7Yq 1N4SA 2X3MA 3ABME 3G2WA 1IJ6A 3ZIMA 3U4TA 4TWHA 3D9JA 3ZPJA 2QFCA 5JJ7A 2FJBA 2IUBA 4HFGA 4NUUA 3FB2A 3Q5EA 1MZCA 3L82A 2BKPA 2IEJA 3FU6A 1W09A 3QDNA 3TWRA 2KNDA 2ZU6B 4F1SA 3RH3A 2VWAA 1JCRA 2XHEB 1J5WA 4EZJA 3LY8A 2F0YA 2IMLA 3B57A 3ULYA 4JI6T 1SE7A 2WDQA 2YINA 2WY2A 4ILUA 3PH0C 2OV8A 3JYSA 5ABGA 2ONDA 4DJAA 3CX8B 4H7YA 4IDOA 2XHEA 4BSZB 3UKUG 2ODVA 2EQXA 3IHYA 2L0TB 4L9PA 3AEBA 3HRAA 1IAPA 2LNIA 1L0VA 1ZBPA 1N11A 5H6RB 4DX5D 1VOMA 5H7PA 3VU7H 3PVLA 2VQET 4AEZC 5JR9C 2ZGDA 4ME2A 4HOSA 4DI4A 2E8IA 2I1JA 3CKBA 3N9MA 4WWOA 1LVFA 1WYCA 3AEEA 4PJNA 3Q78A 2KZTB 1QNFA 4NUVA 1MIWA 2EINE 4J6IA 4G2AA 2XM1A 2BS4A 1OT8A 5KCMA 5BT1A 2C5IT 3AE1A 2NR4A 5AQHB 4OYSA 4BT8A 4I17A 3N2OA 1D0XA 3RYCE 2X0LB 3P2BA 3HKDE 4EPZA 3TWUA 2M6BA 4JL0A 2H7OA 4PK5A 1N34T 5JJTA 2WXPA 4A1SA 3R6NA 2YDRA 2KZTA 4J2CA 4IDZA 3C4XA 2CEAA 3R9MA 2B1EA 2JQHA 4PJJA 2RFAA 3N9LA 3PUGA 4PK4A 3CHRA 2X0YA 4D10C 1WDYA 5FYMA 3RRUA 1TEZA 3FXDB 1K3ZD 3AVSA 2AWIA 3LPZA 4H9QC 4B8AA 2FF4A 3ONXA 3FTXA 2CXFA 1YKHB 1U2VG 2MRIA 3P4QA 5AQGB 1OWLA 5B1AE 2Y4UA 5GONE 1YQ4A 3ZFWA 5KMGP 3ZT6A 1XNQT 3CHSA 3ESKA 4B89A 4LRZA 4HORA 4I9EA 4HFCA 2UXBT 3S4UA 4JI5T 4ANXA 3EABA 3L08A 3QK6A 1SA0E 2L6JA 4YTMA 3UKRG 4Q96A 4HWCA 3LVQE 4V1Av 4XI0A 2BKOA 5FIOA 4LERA 1H0AA 5FZRA 4G23A 1QZ2A 3CHQA 4ZI3D 4H63V 5E0OA 3HDXA 5J2UE 3HHMA 3R7RA 2JMKA 4OYJA 5AN8A 2LRKA 5FL1A 2MHKA 3PZ2A 1H6PA 3NZSA 4MRUA 3QNUA 4X1YE 5LHHB 2Y48B 3FXEB 4U74A 1KT0A 2WP9A 4FHJA 2CLYB 2J49A 4G25A 5FQ6A 2V5CA 2E9XD 1D1CA 2VKOA 1N0QA 2LKHA 1XMQT 3C64A 4L1BA 2XASB 4AY6A 2LE8A 4DI3A 4L0RA 1Q2ZA 3SZ7A 3NBXX 5JDLA 4A97A 4AVXA 1FVHA 2X68A 2XGMA 2NOXA 3HKEE 3E0ZA 4N3BA 2MBGA 4XAXB 3B7UX 1ELWA 3AEGA 4ZHBA 5ARFA 4DR4T 2JQ9A 2Y6XA 3F6QA 4C9BB 3HR0A 4I9CA 4GYSA 4YSZA 2FO1E 4CT0A 1BR1A 1KNPA 3KS2A 4CDRA 3TLSA 1IBLT 3N5LA 2CHXA 2XQ0A 3PE4A 4DMWA 1N4RA 4ATZD 2Q9QC 4WWPA 4YHHT 2Y8DA 3NZQA 1JNZA 3FZLB 4BSXA 4ERRA 3VKGA 5J08A 3LCAA 3OXFA 3C3RA 3FEYA 3Q47B 4XKBA 3X1DA 3UMVA 2XPKA 2XUEA 3G06A 3GN5B 3SBTB 4XX5A 2UWJG 3I3NA 1GW6A 1PC2A 3CSTA 1UN8A 2MAWA 5IUXA 3AJIA 3WAJA 1ZV4X 4N5QA 5CCLA 5ETWA 5FVLA 3MKDA 5KDMC 5FMNA 5B1BE 2LKGA 3LY7A 4RLYA 4O2BE 3GN5A 5HYAA 3ZYQA 2EHOD 3OVUA 5ARGA 2XCBA 3FTSA 1HNXT 1YXRA 2ZGGA 1W3BA 3MACA 1IYGA 4ZFHA 3CIAA 4LF4T 3RIBA 3P50A 5IYZE 3PJAA 1OCRE 3VLEA 2WZIA 2HM8A 4YDWA 4DR3T 3BQOA 2GRPB 5CA1E 3UX4A 3PE3A 5JREA 1US7B 2CLYC 2CXDA 2KCLA 3D3MA 2LSGA 3FUJA 1O3XA 4P0BA 2AVPA 3FH5A 4W9RA 3E30A 4X1IE 4U0SA 3EIJA 1DCEA 2DBAA 4BX9A 3D9NA 3AE2A 2P9UG 3TWQA 4B94A 1WAO1 2XJ7A 5G2NA 4IE5A 4ANWA 3NKZA 2H3RA 4DVDA 2YU2A 3MXZA 3G2VA 5EIDA 4K5BA 4YJ3E 3IV0A 2X6KA 2HHHT 4YTPA 1D0YA 2NTXA 1S63A 4R7LA 4B3MT 4OX9T 5FNVE 1SA5A 2IOLA 2GRLA 2Y69E 3TJPA 4DR2T 2LRLA 2A3DA 2PJQA 2HPJA 4L7TA 3PUAA 2KLQA 2FULA 3IBPA 2DLRA 4MS6A 2C0SA 5F5WA 3NAWA 3C5RA 3DBSA 4O6FA 3ZT5A 2PZIA 3ZUVB 4O4JE 1Z0PA 4AI6A 3DTOA 3UQ4A 3FUHA 4FJOA 3ABLE 3T9KA 3I0OA 2XRZA 4I50E 2DCFA 1E2AA 4FU3A 3VKHA 4JHJA 2ZM2A 3GWHA 4XZCA 3L6AA 3LKUA 1ZEEA 4XE0A 4N3CA 4U31A 4U95D 3CVUA 1R8IA 4C91A 1BR2A 3AS4A 1HNZT 5C1DA 3DSTA 1NA3A 4TUUA 4UF0B 5A7DB 5LCYA 3SFDA 3PNLB 3JQ1A 3DXMG 4GU5A 3OYZA 4OFZA 4U7EB 2DCPA 3RPUA 5AAOA 2MTQA 2YEVC 4AQFA 4RVBA 5AQIB 2M63A 4IE4A 2RA1A 5E76A 3EHQA 3ZRHA 5EK3A 3EDTB 4UF0A 1OXJA 1OUVA 1U5PA 3TKLB 4O60A 4N78D 2XENA 3K3NA 1UCUA 3GZ1A 3AEDA 1XDOA 3BQKA 3RRNB 5EK4A 3QNKA 4UWLA 1VCSA 2X9WA 4KMOA 4PS3A 3D0TA 3ULEG 4Z8XA 1QLBA 2WQ6A 4UR9A 1SVXA 4FADA 3PUQA 3PE0A 4DNDA 3Q5DA 2VL0A 3TLWA 3RU0A 4LF6T 5EX0A 3EUVA 4FLBA 4UQZA 2BBHA 2R02A 5LNKA 4XEIG 3BUAA 1CHUA 2YHEA 2CWYA 1E7PA 3P1UA 4FI5A 3JADA 5AQFB 3AE3A 1LRZA 1E7VA 2WXFA 2E2AA 4WWNA 5LJNA 4HNAD 2H6GA 3KVBA 3PREA 2Q7FA 3AAIA 3MYVA 4YNDA 2VTBB 2I1KA 2DL1A 5EKQD 4RG9A 4DX2A 2NSZA 4IDQA 2VGEA 4HKAA 4BESA 4E7ZA 4G2VA 4ISSA 3GYZA 2VSYA 3AS5A 2DYRE 3Q9NC 5D66A 3UU6A 3L8RA 5L2LA 3QWPA 3FTYA 4AQFC 3ZXSA 4DLOA 1FT2A 4A3VA 4HFVA 4HFBA 1XGWA 3T5XA 2VTBA 3APFA 2X38A 5KJLA 3NB2A 5F8PA 4TX5A 3PUSA 3PEUB 4LMJA 1MX4A 5CRUA 2EIJE 1LD7A 4DV0T 1X81A 2CWOA 3G2TA 1UJJA 3F2EA 3UQ3A 4AKLA 1HR0T 4C90A 1ZP0A 2KMFA 2HN2A 3Q9DA 1GQEA 2DHRA 3ZMSB 3SOLA 3RO3A 3PUZF 3MZKB 2X9YA 4JYAT 2WU5A 3CHMA 4JI2T 1K1BA 4FP7A 3TWSA 2BKKB 2XAJB 5HXHA 4NPPA 2J4GA 4DK5A 4NIKA 4YVQC 4WAFA 1YKEB 2KT9A 5ABEA 4B3ST 4LNGA 4AM9A 5JHBA 2KINB 3PZ3A 3BU8A 1H6KA 2L0IA 3LG7A 5FWQA 3SQVA 2LSYA 2C2LA 2CHNA 1T8BA 4HWFA 2XEHA 5ITZF 2B0OE 2Y4TA 3OTNA 3ETUA 3ZSSA 2HYZA 3L09A 2NC9A 2HN1A 2JMHA 1ZU2A 2CBIA 3UT7A 3CQGB 1N32T 4H9RC 3MCXA 4ZI7E 5AQPB 2FO7A 4JV5T 3DSVA 3LXUX 2CPTA 1XNRT 2LAHA 4K5CA 4YSXA 3S7DA 3GMIA 2VK9A 4E7SA 5LBMA 1N4PA 2J9QA 4AKIA 4ZI2D 1TNYA 3ZGQA 4M3OA 3V30A 3HXBA 3NOCD 3FUMA 3SWHA 4E85A 3K8PC 4GTRA 2MYSA 2PM7A 3PUJA 4GIWA 1UURA 1UK5A 2DVWA 5ADXL 4JD2G 4J7WA 2GRMA 3SHFA 4WBOA 2W66A 1V54E 3ZJ2A 3GW4A 2P9IG 1BR0A 3AG3E 5CRVA 5AQVB 3RKOA 4B3RT 3EJNA 4EEBA 1OY3D 1MMAA 3ASOE 4DRXE 3UTMA 4DV5T 4GYYA 4J8EA 1E7UA 3FTUA 4CGWA 5BUZA 4YFSA 1ZHCA 5J2TE 2KC7A 3G2UA 2GW1A 2R17C 2CE7A 2YQ8A 3I9WA 4H9OC 3C72A 3V31A 1H2UA 2UY1B 3TXMA 3SD5A 2E2EA 4U8YD 4JBWF 4DR6T 3TWWA 3ZSTA 4XBFB 5JDQA 1NEKA 1Y8MA 2LUHA 5ANLA 5BV1A 3D9OA 4NRHB 4KHZF 1N0RA 4U8VD 3CHPA 2ZLYA 1ELKA 1FMVA 5FZSA 2UY1A 4GZ5A 4LFAT 1KZPA 4WNKA 5AQJB 2X66A 2YDSA 3DPDA 4UWHA 5T8IA 3UT8A 5FJYA 1E90A 3U78A 2OA5A 3RRCA 4DR7T 1MYOA 1Z3YA 2KXPB 2X0HA 1BLXB 1G8XA 5AJLA 4BA9A 4UIGA 2WXOA 3D9HA 4MKTA 2HH7A 2XAFB 3B7TA 4UELA 4YDEA 3ZKRA 3RQUA 1T7SA 2ETBA 4Z90A 1ZOYA 5AFUL 2ILRA 3V79K 3UUBA 2V5FA 2CM0A 1N33T 5BW8C 5AQSB 4GK0E 1HX1B 2LJLA 5LG3A 5JR9A 5LJMA 3HXEA 4EZ4A 2H6HA 5L3FB 3J5QB 4ASKA 3AG1E 5LGUB 3UFEA 3CVLA 3QB2A 4I1OB 4GTMA 2XZTG 4ZHQE 4IRUA 1OCCE 1NL4A 3ZMTB 2VSOE 5B3SE 4GAAA 3G2SA 2YHCA 3CKCA 4QXHB 4WBNE 3ZU7B 4PFPA 2OLTA 4YSYA 4U8HA 4IE0A 4QH4A 1UN9A 3AE7A 5DJQC 1KZOA 4U0ZA 3MJXA 2RFMA 4ANUA 2LSIA 4AKGA 4EV6A 4AKHA 3ML8A 2VL8A 2VKDA 5ENQD 4C0EA 3W15B 4CQIA 5KX5E 3RRMB 4HI9A 5JTGA 2XAGB 3OYXA 1NA0A 3RK6A 4EZHA 4G8LA 5G05J 3BQLA 3CQXC 3EHZA 3FFLA 5IY5E 4LF7T 2VGYA 2FJAA 2FEZA 3LS8A 1UX4A 2W67A 2UUBT 1A17A 4FULA 1OEDC 2KXPC 4PDXA 4P1NA 4TXQA 5JDMA 1DCQA 4H9PC 2BUGA 2WXLA 4IL4A 2E9XB 4YY3T 5M72A 2XSAA 3OJAA 4AOFA 3Q7AA 2OEWA 1FCHA 1T72A 4HVBA 1JCSA 3S7FA 3RYHE 4P0AA 4EHMA 1JWFA 4QX8B 1TN6A 3IEEA 1INZA 2Z6EA 1QUUA 4P09A 4U2ZA 4AY5A 3FY4A 4HOQA 2PM6A 2E9XA 5L47A 1IBMT 3O4ZA 4EBAG 4GYOA 4JI0T 4EOZB 3SBSA 4B8CB 4HWDA 4GZDA 4UWGA 3S2AA 4U72A 4A63B 5DQVA 1BI8B 1IJ5A 3KSLA 1I94T 2UXCT 4HGAA 1H19A 5ENOD 4KBQA 2F8XK 2NP9A 2VURA 3KV5A 3E4BA 2L6BA 2Q9QB 3B5MA 3KV6A 3AG2E 4I43B 4L9IA 3PU3A 1QQEA 4A98A 3F57A 3UIPC 1QYMA 3TG5A 2PQRA 4EEDA 1M7KA 1VCTA 2WXKA 4NXNT 5FQ4A 4TXPA 2C5JA 4LNBA 5LMNT 1BD8A 5A23A 4O4LE 1JNRA 1SA4A 4U7IA 2MOZA 2Q9QA 4DV4T 3BG0B 3QB5K 5BV0A 2EHOB 1H2VC 4I43A 4ZI3C 3T5VA 2AXVA 1J1JA 2FI7A 3DSWA 4N2SA 5HXEA 3RIFA 4UUCA 5JDNA 3NRXA 3JAFA 3AG4E 3SRZA 3FU5A 2WXRA 4HOTA 2N2NA 2BKGA 4G1TA 2V7KA 3RKVA 1QBQA 1XMOT 1EYHA 3K1SA 2EHOA 5EYLA 2LEHA 4O1PA 2E9XC 4DV6T 4YDOA 3QOUA 4A5XA 4EYUA 4XKCA 4NXMT 4AQYT 3CQCB 4G26A 1N94A 3BG1B 2W00A 2NXPA 2EILE 2CHWA 3ZC1A 4PS8A 1UOHA 4J0UA 1L5JA 5LP6E 4AP2A 4EZKA 2XEEA 1TN7A 5HWYA 2VSXE 2Y3AA 4UVBB 4DUYT 2LM2A 3LK42 5CGMA 4U63A 2XAHB 2BZBA 2IIUA 3UUXB 3MV2B 4KHPT 5DBKA 3ESLA 4APFA 1XZYA 2XGSA 2LHNA 3P4RA 4KBMB 3PRZA 3HVEB 3MA5A 2IW5B 3JCKC 5J1GA 2DYSE 1UG3A 5LB7B 2R59A 3ABVA 3N2GE 3ZNGA 3RLFF 3DEPA 5A6CA 3T1HT 2V7JA 5L3BB 1E8ZA 1XWMA 5JQGE 4O2AE 3UUXA 5FXXA 3FTZA 1Y64B 3CVQA 1S0PA 3HVEA 3RYFE 5KJKA 2XQ7A 3MA9A 5AQOB 2JRKA 2XQAA 3ZYKA 3I4RB 5AENA 4BEPA 5CB4E 3LEWA 3E22E 5AIJA 3FZHB 3N9OA 5LG4A 4I6GA 3TXNA 4QWNB 3I1AA 2WDRA 3BQIA 2QA7A 3HKCE 3UXGA 2EHOC 3AE4A 4DBRA 5KBAA 4M7CA 5LX8A 2A5UA 2ETCA 1B7TA 4GPMA 2WMNA 4Y6CA 4KXKB 4CRWA 3CVPA 5LGTB 4NIQA 1KK7A 1OWNA 4GTTA 3Q7FA 1UUSA 3FUFA 4PW8A 2DWGA 2X9XA 5BNWA 5HRYA 3HXDA 2LOPA 2I2OA 4FJYA 2FUPA 3ASGA 1SUMB 3D9PA 5KNGA 1IHBA 3X2QE 2EIKE 2XZDG 4U2YA 4O4IE 4GPKA 3UM1A 3IA3A 5LOVE 4ANVA 1W0AA 3R7QA 4ACLA 3C4ZA 2H7VC 2PL2A 3PUYF 4CZ2D 1N4QA 3FZFB 2F8YA 3L54A 1NENA 5AQLB 1K8KG 5J90A 1D9SA 2UXXB 5LYJE 4UV8B 3ONLC 3SS1A 3L17A 3UTKA 2P58C 2BVLA 3SF4A 4FLHA 4CI1B 4BT9A 3CPZA 2YOEA 3PV0F 4GCOA 2PQNA 4G24A 1MMDA 3UINC 5G04J 2WXHA 5AQ7A 3VHLA 3SO8A 5HEOA 2KATA 2XRYA 4UI9J 2RP4A 1OWPA 3P4PA 4ACKA 1U4QA 1MQSA 2P9BA 2GRNB 2R6GF 3DSSA 3A5XA 2QZAA 2ZIRA 4DLQA 4HS2A 2NW9A 3KFWX 5CEAA 2K9AA 3PZDA 4AXPA 2AJAA 5D2MC 3N9NA 4JI8T 1T98A 3LSVA 4QXBB 3OXGA 1JCQA 3W9FA 2I59A 2XPIA 3FH7A 4JB8P 3PEVB 4UI9K 2CRBA 5T4YA 3EU9A 3CWZB 1TR4A 3LDZA 3AB3B 3N9PA 2XQ4A 4YXDA 2VQ2A 2BF0X 4IREA 5KXJA 5KJNA 3MKQB 3OPCA 3MZLB 3ZLIA 4LFCT 2OVFA 2BTDA 3ANWB 4ZS2A 4GA1A 2V6XA 1W9RA 5FXWA 3T1YT 2WDVA 3RIAA 4DV2T 3U66A 5AQ9A 5FXVA 3CHOA 2VVNA 4ZEYA 1G3NB 2XGOA 3DXKG 1LVKA 4HQDA 4DR1T 1EZ3A 5AJDA 3MKQA 3FWVA 1Y01A 3I0QA 1SHZC 3IBEA 1O1SA 3ANWA 3ZN3A 4CDMA 2ZM8A 3HA4A 1HE8A 2LAIA 4AV7A 2MOWA 1AWCB 4HOUA 1WCRA 3UI2A 4O1OA 2DIWA 3SGHA 2A9UA 4GK5E
chains in the Genus database with same CATH topology
3V5SA 4CXYA 4UV9B 5H6QB 1D1AA 2JJ9A 4HN9A 3IHVA 1HX8A 3ZMVB 4ADZA 1ELRA 2LSJA 5L3DB 4AKRB 2ZM0A 2M67A 4QFVA 5EX3A 2A2FX 3RJVA 2XAQB 2HPLA 1FIOA 1DVPA 3WI3A 2K48A 3VTXA 3ULQA 5FP3A 1B89A 5G05C 4U0UA 5EDSA 3Q5MA 4APOA 1E96B 3UPVA 4AQGA 2J1DG 5FQ7A 2CG2A 3TG4A 2LSKA 4U04A 4BTBA 2KZ7B 3Q15A 5HXSA 5D0OD 4A1GA 2A72A 2LT3A 1HG5A 3CVXA 1Z6TA 3FTWA 3EHMA 2IJGX 4G63A 5CMYA 2WVIA 3SFZA 3OBVE 3C50A 5C8YE 4RSYA 4WUYA 3CLJA 4L5GA 4PJLA 2I6HA 2XPYA 1X5BA 4LCTA 3FUIA 4NURA 1IQUA 3N2KE 3FP3A 3PUKA 4GA0A 5D0QD 1BR4A 3NZUA 4ISTA 3FBLA 3RYIE 4QXCB 4H63H 3WXXA 5L3EB 4Q94A 4XIFA 1FEWA 2VKHA 2IF4A 3Q4AB 3MX3A 4CGVA 3CK9A 2ES0A 2JQQA 2X6HA 1E8YA 3OAWA 2LSUA 5HI7A 4CI2B 4ZS3A 4FC8A 4OK0A 4WNFA 2GK9A 3JUIA 2IQCA 3D9KA 4ZI2C 2V26A 4I1MA 1UX5A 4I6JA 3R84B 2IU1A 3JQ0A 4HXIA 3N71A 1YW0A 1LF8A 3B7RL 4YHJA 2UXNB 4A56A 3I4GA 3KDSE 4I1AA 3IHRA 5CA0E 4MBQA 3O1JA 5G55A 4J8FA 2NWBA 2VASA 3K3QC 3QJZA 1JUQA 1SZ9A 3ZC0A 4EXTA 3OXLA 5LCWJ 2CXLA 5HXCA 1WLXA 5BMVE 4F3VA 1HH8A 1IZNB 1NP7A 5LP0A 1WRDA 4PFOA 4M1PA 3D9MA 4JHRA 3CK8A 3ZCIA 4LUNU 2I9CA 2VSNA 4OVVA 3LJ3A 4QKNA 3Q5WA 3ZN0B 4WNDA 5CHEE 2D0TA 1HCIA 4WNGA 2OVBA 3FHEA 3D9LA 2KCKA 3O1IA 1E8XA 5JHAA 4IE6A 3KBTA 4DBQA 2G0UA 4DMVA 1UJKA 2W0GA 5A1LA 4KZ0A 3FH8A 4I4TE 4QHOA 2CCQA 2IAKA 2ODUA 3O1HA 4L23A 2AXUA 4EECA 4JEUB 5G04C 4GZ3A 2VGXB 1HS6A 4UI9C 3EVYA 3L3PA 3HL6A 2IC6A 4UWKA 3IF8B 3NZPA 4WNEA 2RD0A 5FZQA 2XPZA 4HTEA 4K0RA 5JJ6A 3FDHA 3NQPA 1V9DA 2VGXA 2SPCA 2CG3A 2E0IA 4JA7A 3ZYMA 4WW0A 3V5UA 3AU4A 1QSDA 4PS7A 3JC6D 4UXNB 1MIVA 1IQRA 1H2TC 2KWIB 1P5QA 5LOZA 2PFVA 3LK3B 3AA6B 5T3RA 4ATGA 3K9IA 4I2ZA 5CMWA 5KJMA 2L9QA 3FULA 1LKXA 5LA6E 3FUNA 4Y6WA 2IONA 2K24A 3H37A 5FQ8A 4AIFA 3C4WA 4ABNA 4CEMA 2FBNA 4CXWA 2NW8A 3KINB 1HFAA 4PK6A 4DPRA 3L13A 2QGSA 4JHKA 3CVNA 1JWGA 2D5UA 2J4DA 4KUMB 1YD8G 4ILIA 2CHZA 3P7IA 1VDYA 2WXNA 2XCCA 4H7XA 3SI5A 5CCMA 3ZCJA 1FVFA 3CX7B 2V7LA 2XQYA 1HXIA 4L2YA 2V7IA 3MK7C 2ZMAA 2VB6A 1HG2A 2OOEA 4GB9A 4CT4A 2V4LA 4JZYA 4BAYB 2L8KA 3T8MA 2NTYA 2K5BB 2XEVA 3LYAA 3AA0B 2WPVA 3FHNA 4XZ4A 3ZEFB 3FUEA 4N39A 2WXJA 4KYOB 3PDYA 4MFRA 3TL5A 3ASFA 2BDEA 3CSFA 2JPFA 4JPSA 3MJWA 4F53A 3ZYLA 3S7BA 3ZEFA 5L3CB 2LSVA 4JC8A 4O8SA 4GCNA 4CDNA 4YJ2E 4BX8A 3C51A 3R9AB 4J8SA 5DABA 4A3TA 2ACXA 4JLEA 3ASDA 4EAHA 4KMCA 2CFUA 3KD7A 3ZPOA 5JDFA 5JH7E 3L22A 1E1HB 2PBIA 4CCAA 4EBAA 3QAQA 1PAQA 4BY6A 3U9WA 2J08A 1HZ4A 2JEKA 2LM9A 4NQ0A 3ENEA 2R5SA 3KVAA 2HO1A 3ONLA 2JLBA 1MMGA 2YK0A 4PAGA 1MNEA 2QY7A 3FBZA 4JVSA 4K03A 3U64A 3RO2A 3P8CD 4AJWA 2W61A 1WM5A 4IHJE 3VLDA 4G11A 3ML9A 3CK7A 3AA7B 4PNIA 3ETVA 4Q69A 4CXXA 4ILGA 1E8WA 4KT6B 2V0PA 5LFAA 4XI9A 4GA2A 5C2YA 5M4YA 2Q9QD 4MLPA 1IHGA 3O9XA 3B7SA 5TAOA 1Y6IA 5JDHA 5FTPA 2X6FA 3L16A 1WY6A 2CMRA 4I55E 4HE8A 3GZ2A 3EHNA 5JVDE 2VKJA 4BJMA 4E6HA 1DNPA 3FEXA 4MALA 4IN3B 4NACA 2LHRA 2IFUA 2PG8A 2AW6A 3MKRA 4UQYA 5ANRA 4U07A 5LCWC 5LXTE 4PH4B 3F31A 3AU5A 2J09A 4I2WA 3CEQA 4BWRA 1EPUA 3O48A 2L3LA 1HU3A 5HWXA 4OVUA 4DO0A 3QC1A 3AAAB 4JXTA 1KLXA 1MIYA 2LOSA 2N1GA 4IYPA 3CVVA 4PJMA 3UUNA 3NF1A 4UWFA 1NAFA 4L2LA 1HF8A 3QWVA 4GYRA 2XTLA 4FHKA 4IULA 3FU3A 4B0ZA 4TN7B 4KZCA 3ZHEB 1HO8A 3U3WA 3KV9A 3PDNA 3RC8A 4IGUA 2X6IA 5JDGA 4TZ4C 4B6XA 4OHFA 3FUKA 3EUHA 5AYWD 3LBXB 3PTRB 4GMLA 4LEUA 4TV9E 3KEZA 3MV3B 3ZHEA 2WAUA 1S94A 1UW4B 2X6JA 3I9YA 1OXZA 4JA9A 3CVRA 5HQ8A 1VRBA 3LBXA 5BPPA 2J4BA 2D2SA 1FMWA 2WMOA 3C98B 4F6RC 3FTVA 1NWMX 4URKA 4KVOA 3LFMA 2GGFA 1ZKEA 3NRYA 5LHGB 3Q5XA 4UEMA 2AXZA 3RRWA 1KT1A 4FJZA 2WQ7A 1CUNA 1S35A 2N9DA 4YLHA 1NZNA 3C98A 1D1BA 4RG6A 3QC9A 2RG8A 4OYKA 1BPOA 2IC9A 3URZA 3IEGA 2WWUA 5L3GB 3ZW3A 3GA8A 2WXMA 1U3CA 4KP3C 2W62A 4H9NC 1MNDA 4QX7B 1TJFA 4ILHB 2V1DB 3ZN1B 3U3IA 3TGOA 4FA6A 2HR2A 3UT4A 1N54A 4K0UA 3QARA 3IKOB 5FY0A 5F3JA 2CA5A 4AXHA 1WR6A 2V8SE 3FU0A 3E08A 1SZAA 2WBLA 3K3OA 5LHIB 4X1KE 3CGHA 3CV0A 4PUCA 4O4HE 2KWHA 1U3DA 4N2QA 2WXIA 3DJBA 5EZYE 5FT9A 4EIWA 3J9X1 3QWWA 1OWMA 4GZ6A 4GYWA 4BTAA 4CZZB 3PURA 3CX6B 3ZJ1A 2W63A 2V7MA 4JEHB 4I6EA 3PS6A 2LO6A 3WAKA 3FUDA 4A55A 1H7CA 3BEEA 4BJNA 4UVAB 1MHQA 3ZMUB 2D0UA 4MLKA 4JEHA 3VTYA 1YA0A 2WM9A 1Z3XA 3I5PA 4P29A 3ZVVA 4JW1A 4H9SE 2YNQA 3LY9A 5IHYA 1SQMA 3ASHA 5ENNA 4GOUA 3S7JA 3QUJA 3LVRE 1TJCA 3HI2A 3HIZA 3VLFA 2CFZA 1KNZA 2DWKA 2NW7A 3DP7A 3LK2B 3AVRA 2J07A 2KCVA 1AJ3A 3RX6A 2IOSA 3GZSA 4N5CA 3EDVA 5JRCB 4EB6E 3EDUA 3O4XE 4KVMA 2WB2A 4J8DA 1HS7A 3CKDA 3LJCA 2C5KT 4IIJE 5FY7A 3UT5E 5HAXA 3PNTB 3M65A 4EQFA 3CMLA 3H3AA 5JRCA 1OWOA 4HLEA 1MMNA 3KV4A 1JPLA 3ZMZB 4GMJA 4BFRA 4UQXA 4UVCB 3APDA 3CR3A 3Q49B 3ONKA 4MHCA 5EK2A 1OWAA 4EZLA 4ANJA 2VYIA 1XNFA 2X9HA 4JUYA 4TUYE 4GZCA 1HTJF 5LGNB 2A4ZA 1D0ZA 2DI4A 3CVYA 3TAXA 2X51A 3N9QA 1EDUA 3D9IA 3RC3A 3PU8A 3CVWA 3APCA 3HKBE 3AAEB 4TV8E 3KBUA 5FY1A 5E75A 3HYMB 3UUMA 3AA1B 4TRQA 4IE7A 2DNXA 4EYYR 1N52A 5LBQB 3BK9A 2L9BA 2X67A 3QK0A 4YVOA 3EIQC 2WXQA 1EF1C 2WSSV 1G73A 3B13A 5DQWA 4CI3B 4X20E 2WQHA 3MGBA 5DIZA 3Q2MA 3UULA 2VJ8A 1WYBA 4N3AA 3AS8A 3T8OA 5HXRA 5JR9B 4C0MA 2YU1A 2C0LA 3SNXA 3OKQA 2KM4A 5FXZA 4V3IA 4HEAA 2WXGA 3MEKA 1X79A 4JEUA 4TV3A 2BVMA 4ZOLE 2C0MA 3JC6C 3KAEA 4F7AA 1PY1A 3QKYA 3J7Yq 2X3MA 3G2WA 1IJ6A 3ZIMA 3U4TA 3D9JA 3ZPJA 2QFCA 5JJ7A 4HFGA 4NUUA 3FB2A 3FU6A 3QDNA 2KNDA 2ZU6B 4F1SA 3RH3A 2VWAA 2XHEB 4EZJA 3LY8A 3B57A 2YINA 4ILUA 3PH0C 2OV8A 3JYSA 2ONDA 4DJAA 3CX8B 4H7YA 2XHEA 2ODVA 2EQXA 3IHYA 2L0TB 1IAPA 2LNIA 1ZBPA 5H6RB 1VOMA 3VU7H 3PVLA 4AEZC 5JR9C 4ME2A 4HOSA 4DI4A 2E8IA 2I1JA 3CKBA 3N9MA 4WWOA 1WYCA 1LVFA 4PJNA 2KZTB 1QNFA 4NUVA 1MIWA 4J6IA 4G2AA 5KCMA 5BT1A 2C5IT 4OYSA 4BT8A 4I17A 3N2OA 1D0XA 3RYCE 2X0LB 3P2BA 3HKDE 4EPZA 4JL0A 5JJTA 2H7OA 4PK5A 2WXPA 4A1SA 3R6NA 2KZTA 4J2CA 4IDZA 3C4XA 2CEAA 2B1EA 4PJJA 3N9LA 3PUGA 4PK4A 3CHRA 4D10C 5FYMA 3RRUA 1TEZA 3FXDB 3AVSA 2AWIA 3LPZA 4H9QC 4B8AA 2FF4A 3ONXA 3FTXA 2CXFA 1YKHB 2MRIA 1OWLA 2Y4UA 5GONE 3ZFWA 5KMGP 3CHSA 3ESKA 4B89A 4LRZA 4HORA 4I9EA 3S4UA 4ANXA 3L08A 3QK6A 1SA0E 2L6JA 4Q96A 3LVQE 4V1Av 4XI0A 4LERA 1H0AA 5FZRA 4G23A 1QZ2A 3CHQA 4ZI3D 4H63V 5E0OA 3HDXA 5J2UE 3HHMA 3R7RA 2JMKA 4OYJA 2MHKA 4MRUA 3NZSA 4X1YE 5LHHB 2Y48B 3FXEB 4U74A 1KT0A 4FHJA 2CLYB 2J49A 4G25A 5FQ6A 2E9XD 1D1CA 2VKOA 3C64A 4L1BA 2XASB 4AY6A 2LE8A 4DI3A 4L0RA 3SZ7A 3NBXX 5JDLA 4AVXA 1FVHA 2X68A 2XGMA 2NOXA 3HKEE 3E0ZA 4N3BA 2MBGA 4XAXB 3B7UX 1ELWA 5ARFA 2Y6XA 4C9BB 3HR0A 4I9CA 4GYSA 4CT0A 1BR1A 3KS2A 4CDRA 3N5LA 2CHXA 2XQ0A 3PE4A 4DMWA 2Q9QC 4WWPA 2Y8DA 3NZQA 4BSXA 4ERRA 3VKGA 5J08A 3LCAA 3OXFA 3FEYA 3Q47B 4XKBA 3UMVA 2XUEA 3GN5B 3SBTB 4XX5A 2UWJG 3I3NA 1GW6A 1PC2A 3CSTA 1UN8A 3WAJA 1ZV4X 5CCLA 5ETWA 3MKDA 5KDMC 5FMNA 3LY7A 4O2BE 3GN5A 5HYAA 3ZYQA 2EHOD 5ARGA 2XCBA 3FTSA 1W3BA 3MACA 1IYGA 3CIAA 3RIBA 5IYZE 3VLEA 2HM8A 5CA1E 3UX4A 3PE3A 5JREA 1US7B 2CLYC 2CXDA 2KCLA 3D3MA 2LSGA 3FUJA 1O3XA 4P0BA 2AVPA 3FH5A 4W9RA 4X1IE 4U0SA 3EIJA 4BX9A 2DBAA 3D9NA 4B94A 1WAO1 5G2NA 4IE5A 4ANWA 2H3RA 4DVDA 2YU2A 3MXZA 3G2VA 4YJ3E 3IV0A 2X6KA 1D0YA 2NTXA 4R7LA 5FNVE 2IOLA 2GRLA 3TJPA 2A3DA 2PJQA 2HPJA 4L7TA 3PUAA 2KLQA 2FULA 3IBPA 2DLRA 4MS6A 2C0SA 3DBSA 4O6FA 2PZIA 4O4JE 1Z0PA 4AI6A 3DTOA 3FUHA 4FJOA 3I0OA 2XRZA 4I50E 2DCFA 4FU3A 3VKHA 4JHJA 2ZM2A 3GWHA 4XZCA 3L6AA 3LKUA 1ZEEA 4XE0A 4N3CA 3CVUA 4C91A 1BR2A 3AS4A 5C1DA 1NA3A 4TUUA 4UF0B 5A7DB 5LCYA 3PNLB 3JQ1A 4GU5A 3OYZA 4OFZA 2DCPA 3RPUA 2MTQA 2YEVC 4AQFA 4RVBA 2M63A 4IE4A 2RA1A 5E76A 3ZRHA 5EK3A 3EDTB 4UF0A 1OUVA 1U5PA 3TKLB 4N78D 3K3NA 1UCUA 3GZ1A 3BQKA 3RRNB 5EK4A 3QNKA 4UWLA 2X9WA 4KMOA 4PS3A 3D0TA 4Z8XA 2WQ6A 4FADA 3PUQA 3PE0A 4DNDA 3RU0A 5EX0A 4FLBA 4UQZA 5LNKA 2YHEA 2CWYA 3P1UA 4FI5A 1LRZA 1E7VA 2WXFA 4WWNA 5LJNA 3KVBA 3PREA 2Q7FA 3AAIA 3MYVA 4YNDA 2VTBB 2I1KA 5EKQD 4RG9A 2NSZA 4HKAA 4E7ZA 4G2VA 4ISSA 3GYZA 2VSYA 3AS5A 5L2LA 3QWPA 3FTYA 4AQFC 3ZXSA 4DLOA 4A3VA 4HFVA 1XGWA 3T5XA 2VTBA 3APFA 2X38A 5KJLA 5F8PA 4TX5A 3PUSA 3PEUB 2CWOA 3G2TA 1UJJA 3F2EA 3UQ3A 4AKLA 4C90A 2KMFA 3Q9DA 2DHRA 3ZMSB 3SOLA 3RO3A 3MZKB 2X9YA 3CHMA 4FP7A 2XAJB 5HXHA 4DK5A 4YVQC 4WAFA 1YKEB 2KT9A 4AM9A 5JHBA 2KINB 1H6KA 2L0IA 3LG7A 5FWQA 2LSYA 2C2LA 2Y4TA 3OTNA 3ETUA 2HYZA 3L09A 2NC9A 2JMHA 1ZU2A 3UT7A 3CQGB 4H9RC 3MCXA 4ZI7E 2FO7A 3LXUX 2LAHA 3S7DA 3GMIA 2VK9A 4E7SA 5LBMA 2J9QA 4AKIA 4ZI2D 3ZGQA 4M3OA 3FUMA 3SWHA 4E85A 3K8PC 2MYSA 2PM7A 3PUJA 4GIWA 5ADXL 2GRMA 3SHFA 4WBOA 3ZJ2A 3GW4A 1BR0A 3RKOA 3EJNA 1MMAA 4GYYA 4J8EA 1E7UA 3FTUA 4CGWA 5BUZA 4YFSA 1ZHCA 5J2TE 2KC7A 3G2UA 2GW1A 2R17C 2CE7A 2YQ8A 3I9WA 4H9OC 1H2UA 2UY1B 3TXMA 3SD5A 2E2EA 4XBFB 5JDQA 1Y8MA 5ANLA 5BV1A 3D9OA 4NRHB 3CHPA 2ZLYA 1ELKA 1FMVA 5FZSA 2UY1A 4GZ5A 4WNKA 2X66A 4UWHA 3DPDA 5T8IA 3UT8A 5FJYA 1E90A 3U78A 2OA5A 3RRCA 1Z3YA 2KXPB 1G8XA 5AJLA 4BA9A 4UIGA 2WXOA 4MKTA 2HH7A 2XAFB 3B7TA 4UELA 2ILRA 5AFUL 2V5FA 2CM0A 5BW8C 4GK0E 2LJLA 5JR9A 5LJMA 4EZ4A 5L3FB 4ASKA 5LGUB 3UFEA 3CVLA 3QB2A 4I1OB 4ZHQE 4IRUA 3ZMTB 2VSOE 4GAAA 3G2SA 2YHCA 3CKCA 4QXHB 4WBNE 4PFPA 4U8HA 4IE0A 1UN9A 5DJQC 4U0ZA 3MJXA 4ANUA 2LSIA 4AKGA 4AKHA 4C0EA 3ML8A 2VL8A 2VKDA 3W15B 4CQIA 5KX5E 3RRMB 2XAGB 3OYXA 1NA0A 3RK6A 4EZHA 5G05J 3BQLA 3CQXC 3FFLA 2VGYA 2FEZA 3LS8A 1UX4A 1A17A 4FULA 4PDXA 5JDMA 4H9PC 2BUGA 2WXLA 2E9XB 5M72A 3OJAA 4AOFA 1FCHA 4HVBA 3S7FA 3RYHE 4P0AA 1JWFA 4QX8B 3IEEA 1INZA 2Z6EA 1QUUA 4P09A 4AY5A 3FY4A 4HOQA 2PM6A 2E9XA 3O4ZA 4EBAG 4GYOA 4EOZB 3SBSA 4B8CB 4GZDA 4UWGA 3S2AA 4U72A 5DQVA 1IJ5A 4HGAA 1H19A 4KBQA 2NP9A 3KV5A 3E4BA 2Q9QB 3KV6A 4I43B 4L9IA 3PU3A 1QQEA 3F57A 3TG5A 2PQRA 5FQ4A 2WXKA 2C5JA 5A23A 4O4LE 2MOZA 2Q9QA 3BG0B 5BV0A 2EHOB 1H2VC 4I43A 4ZI3C 3T5VA 2AXVA 2FI7A 4N2SA 5HXEA 5JDNA 3NRXA 3SRZA 3FU5A 2WXRA 4HOTA 2N2NA 4G1TA 2V7KA 3RKVA 1EYHA 2EHOA 2LEHA 2E9XC 3QOUA 4EYUA 4XKCA 3CQCB 4G26A 3BG1B 2W00A 2NXPA 2CHWA 3ZC1A 4PS8A 4J0UA 1L5JA 5LP6E 4AP2A 4EZKA 5HWYA 2VSXE 2Y3AA 4UVBB 3LK42 4U63A 2XAHB 2BZBA 3MV2B 3UUXB 5DBKA 3ESLA 4APFA 2XGSA 2LHNA 4KBMB 3PRZA 3HVEB 3MA5A 2IW5B 3JCKC 5J1GA 1UG3A 2R59A 3N2GE 5A6CA 2V7JA 5L3BB 1E8ZA 5JQGE 4O2AE 3UUXA 5FXXA 3FTZA 1Y64B 3CVQA 1S0PA 3HVEA 3RYFE 5KJKA 3MA9A 2JRKA 3ZYKA 3I4RB 5AENA 5CB4E 3LEWA 3E22E 5AIJA 3N9OA 5LG4A 4I6GA 3TXNA 4QWNB 3I1AA 3BQIA 2QA7A 3HKCE 2EHOC 4DBRA 5LX8A 2A5UA 1B7TA 2WMNA 4Y6CA 4KXKB 4CRWA 3CVPA 5LGTB 1KK7A 1OWNA 3FUFA 4PW8A 2DWGA 2X9XA 5BNWA 2LOPA 2I2OA 4FJYA 3ASGA 3D9PA 4O4IE 4GPKA 5LOVE 4ANVA 4ACLA 3R7QA 3C4ZA 2H7VC 2PL2A 3L54A 5J90A 2UXXB 5LYJE 4UV8B 3SS1A 3L17A 3UTKA 2P58C 2BVLA 3SF4A 4FLHA 4CI1B 4BT9A 3CPZA 4GCOA 2PQNA 4G24A 1MMDA 5G04J 2WXHA 3VHLA 2KATA 2XRYA 4UI9J 2RP4A 1OWPA 4ACKA 1U4QA 1MQSA 2P9BA 3A5XA 4DLQA 4HS2A 2NW9A 3KFWX 2K9AA 3PZDA 4AXPA 3N9NA 1T98A 4QXBB 3OXGA 2I59A 2XPIA 3FH7A 3PEVB 4UI9K 5T4YA 3CWZB 3LDZA 3AB3B 3N9PA 2VQ2A 2BF0X 5KJNA 3MKQB 3MZLB 3ZLIA 2OVFA 2BTDA 3ANWB 4ZS2A 4GA1A 5FXWA 3U66A 5FXVA 3CHOA 2XGOA 1LVKA 1EZ3A 5AJDA 3MKQA 3FWVA 3I0QA 1SHZC 3IBEA 3ANWA 3ZN3A 4CDMA 2ZM8A 3HA4A 1HE8A 2LAIA 4AV7A 2MOWA 4HOUA 2DIWA 3SGHA 4GK5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LF8 A;  1JUQ A;  4Q94 A;  1SZ9 A;  1HF8 A;  1HG2 A;  5LOZ A;  2LO6 A;  1JWG A;  4FU3 A;  1ELK A;  3G2S A;  5CMY A;  4FLB A;  3RRU A;  1EDU A;  1UJK A;  3D9I A;  1HX8 A;  5CMW A;  3ONL A;  3G2T A;  1UJJ A;  1JWF A;  3CLJ A;  1VDY A;  3G2U A;  3LDZ A;  4Q96 A;  3ZYL A;  2BF0 X;  1X5B A;  2L0T B;  1INZ A;  2QY7 A;  3D9K A;  3D9N A;  3ONK A;  1MHQ A;  4JXT A;  2L0I A;  4GZC A;  4NAC A;  1H0A A;  1PY1 A;  1DVP A;  3ZYQ A;  1XGW A;  3ZYM A;  5J08 A;  5LP0 A;  4AVX A;  2MOW A;  3G2W A;  1HG5 A;  3D9O A;  3D9J A;  2DIW A;  3D9L A;  3D9M A;  3G2V A;  1HFA A;  3ZYK A;  4GZD A;  2V8S E;  1EYH A;  3D9P A;  4HFG A;  2DCP A;  2KM4 A;  1JPL A;  1SZA A; 
#chains in the Genus database with same CATH topology
 3V5S A;  4F6R D;  4CXY A;  4UV9 B;  5H6Q B;  2PTF A;  1D1A A;  2JJ9 A;  4HN9 A;  3IHV A;  5FIN A;  2XM2 A;  1HX8 A;  2P2C P;  3ZMV B;  4ADZ A;  1ELR A;  2LSJ A;  5L3D B;  3QB5 A;  5FKY A;  4AKR B;  2ZM0 A;  2M67 A;  2XSB A;  4QFV A;  4ILC A;  2Y1L E;  2A2F X;  5EX3 A;  1AP7 A;  3RJV A;  2XAQ B;  2HPL A;  3DPY A;  1FIO A;  4ZXL A;  1DVP A;  3WI3 A;  3RSE G;  1K1A A;  2A5E A;  2XS8 A;  2K48 A;  5ENS D;  3VTX A;  3ULQ A;  1MX6 A;  5FP3 A;  3RHW A;  1B89 A;  5G05 C;  4U0U A;  5EDS A;  3Q5M A;  4APO A;  1S64 A;  2H89 A;  1E96 B;  3UPV A;  4AQG A;  2J1D G;  5FQ7 A;  2K3W A;  2CG2 A;  3TG4 A;  2V5Q C;  2LSK A;  2JQK A;  4U04 A;  5ABH A;  2QYU A;  2MYO A;  4BTB A;  2KZ7 B;  3Q15 A;  5HXS A;  4HI8 A;  5D0O D;  4A1G A;  2A72 A;  3Q73 A;  2LT3 A;  1HG5 A;  3H3M A;  4TXR A;  3CVX A;  1D8D A;  4X8Q A;  1Z6T A;  2XQ6 A;  3FTW A;  3EHM A;  3L39 A;  2IJG X;  3A8Y C;  4G63 A;  5CMY A;  2WVI A;  3SFZ A;  3OBV E;  3Q9U C;  3C50 A;  5C8Y E;  4RSY A;  4WUY A;  3CLJ A;  4L5G A;  4PJL A;  2I6H A;  2XPY A;  4U96 D;  4GTO A;  1X5B A;  4LCT A;  3FUI A;  5ENR D;  1N36 T;  2WCA A;  4NUR A;  1IQU A;  3N2K E;  3FP3 A;  3PUK A;  4GA0 A;  3AXJ B;  5D0Q D;  1BR4 A;  4IDP A;  5J0Z A;  3NZU A;  4IST A;  2NYJ A;  3FBL A;  3RYI E;  4QXC B;  2XZE A;  4H63 H;  4TWD A;  4DX1 A;  3WXX A;  5L3E B;  4Q94 A;  2V4H C;  1YYH A;  4XIF A;  1FEW A;  2LLY A;  2HE0 A;  2VKH A;  4DV7 T;  1FT1 A;  2IF4 A;  5CBN A;  5CED B;  2XQ9 A;  3Q4A B;  4KX6 A;  3MX3 A;  2IO3 C;  4CGV A;  3AXJ A;  3CK9 A;  2ES0 A;  2JQQ A;  2X6H A;  2WS3 A;  1E8Y A;  3OAW A;  2LSU A;  3VRA A;  1UGO A;  5HI7 A;  4CI2 B;  4ZS3 A;  4FC8 A;  4X65 T;  4LFB T;  4OK0 A;  4WNF A;  3RGL A;  2GK9 A;  3P4W A;  3JUI A;  3EHR A;  2IQC A;  3D9K A;  4ZI2 C;  2V26 A;  4I1M A;  1UX5 A;  4I6J A;  3IXE A;  5LMU T;  3R84 B;  2P9S G;  2IU1 A;  2XY8 B;  3JQ0 A;  4HXI A;  3N71 A;  5CER B;  1YW0 A;  1LF8 A;  4GMR A;  3B7R L;  4YHJ A;  5JMN D;  2UXN B;  4A56 A;  3I4G A;  1KNR A;  1M62 A;  2GRO B;  3KDS E;  5C3J A;  4KI0 F;  3IHR A;  5CA0 E;  4I1A A;  4F8H A;  3SFY A;  3UU8 A;  3ASN E;  4MBQ A;  3O1J A;  2M6I A;  5G55 A;  4J8F A;  2NWB A;  2VAS A;  3K3Q C;  3QJZ A;  1JUQ A;  1SZ9 A;  3ZC0 A;  3PZ1 A;  4EXT A;  4LG6 A;  3OXL A;  5LCW J;  3SY2 A;  4DV3 T;  2CXL A;  4Z91 A;  2CHO A;  5HXC A;  2GRQ B;  4HWH A;  1WLX A;  5BMV E;  4F3V A;  1HH8 A;  2XS1 A;  1IZN B;  1NP7 A;  5CFB A;  5LP0 A;  1WRD A;  2XQ8 A;  4PFO A;  2P9L G;  1KPS B;  1NFI E;  3UM0 A;  4M1P A;  3D9M A;  2P9K G;  4JHR A;  3CK8 A;  2BBJ A;  4HB5 A;  3ZCI A;  4LUN U;  2I9C A;  2VSN A;  4OVV A;  3LJ3 A;  5HKP A;  3AEA A;  4QKN A;  3VR8 A;  3Q5W A;  3ZN0 B;  3NBN B;  2OV9 A;  4WND A;  3Q79 A;  1MX2 A;  2IHR 1;  5CHE E;  1OED B;  4DUI A;  2W2U A;  2D0T A;  1HCI A;  1FPP A;  4WNG A;  2OVB A;  3FHE A;  3D9L A;  2KCK A;  3O1I A;  1E8X A;  5FL0 A;  4IDN A;  3EI0 A;  5JHA A;  4IE6 A;  3KBT A;  1KF6 A;  5BR8 T;  1O1T A;  4DBQ A;  2G0U A;  4DMV A;  1UJK A;  2W0G A;  5A1L A;  4KZ0 A;  2WZH A;  3FH8 A;  4I4T E;  1OED A;  4QHO A;  4B93 B;  2CCQ A;  2XQ3 A;  2UUA T;  2IAK A;  2ODU A;  3O1H A;  1NI1 A;  2AXU A;  4L23 A;  4EEC A;  4JEU B;  3E32 A;  5G04 C;  4GZ3 A;  2VGX B;  1HS6 A;  4UI9 C;  3EVY A;  2FBW A;  3L3P A;  3HL6 A;  2IC6 A;  4ZZC A;  4UWK A;  3IF8 B;  3NZP A;  4X5T A;  4WNE A;  2RD0 A;  4JI3 T;  5FZQ A;  2VVS A;  2XPZ A;  4HTE A;  4K0R A;  5JJ6 A;  2KBX A;  3FDH A;  3NQP A;  5EIB E;  1V9D A;  2VGX A;  2CBJ A;  5AQU B;  2SPC A;  2CG3 A;  2E0I A;  3UM3 A;  1Z5S C;  4JA7 A;  2BS3 A;  3ZYM A;  3WG7 E;  4WW0 A;  3V5U A;  3UQ7 A;  1QSD A;  3AU4 A;  4PS7 A;  3JC6 D;  4CYM D;  4UXN B;  1MIV A;  1IQR A;  4LF5 T;  1H2T C;  2KWI B;  1P5Q A;  5LOZ A;  5KWD A;  2PFV A;  3LK3 B;  3AA6 B;  5T3R A;  2DZN A;  4ATG A;  3RI5 A;  3AE6 A;  3C3Q A;  3K9I A;  2BG9 B;  4I2Z A;  5CMW A;  5KJM A;  2L9Q A;  3FUL A;  1LKX A;  5LA6 E;  3FUN A;  2LXM A;  3E33 A;  4WZX A;  2ION A;  4Y6W A;  2K24 A;  3H37 A;  4QQI A;  5FQ8 A;  4AIF A;  3HXC A;  3C4W A;  4ABN A;  2BKN A;  4CEM A;  4U33 A;  2FBN A;  4CXW A;  2NW8 A;  1DC2 A;  1WR0 A;  3KIN B;  1HFA A;  2BG9 A;  1ZB1 A;  4PK6 A;  4DPR A;  4TNW A;  4DID B;  3L13 A;  2QGS A;  4JHK A;  3CVN A;  1JWG A;  3PZ4 A;  2D5U A;  5EN5 D;  2J4D A;  5CEC B;  1TYQ G;  2J62 A;  4KUM B;  1YD8 G;  4ILI A;  2CHZ A;  2ACZ A;  3P7I A;  1VDY A;  2E5V A;  1W0B A;  2WXN A;  1TNZ A;  2XCC A;  4H7X A;  5L4E A;  3SI5 A;  4F1P A;  5AQA A;  5CCM A;  1RW2 A;  3ZCJ A;  1FVF A;  3CX7 B;  3KSQ A;  5HCM A;  2V7L A;  2XQY A;  1HXI A;  4L2Y A;  1OED E;  4EGW A;  2V7I A;  3MK7 C;  2ZMA A;  2VB6 A;  1HG2 A;  2OOE A;  4GB9 A;  4CT4 A;  2V6Y B;  2V4L A;  4JZY A;  4CN1 A;  4BAY B;  4COF A;  2L8K A;  3T8M A;  2NTY A;  2YKS A;  2K5B B;  2XEV A;  4OAU C;  3LYA A;  3AA0 B;  2WPV A;  3DWL G;  3FHN A;  3L9T A;  2E5L T;  4J8Y A;  4XZ4 A;  3ZEF B;  2V8S V;  2P9P G;  3FUE A;  4N39 A;  2WXJ A;  4KYO B;  3W9G A;  3PDY A;  2V6Y A;  3B7B A;  4MFR A;  3TL5 A;  3ASF A;  2BDE A;  3CSF A;  2JPF A;  5EYP F;  2R2L A;  4JPS A;  3MJW A;  2BG9 C;  4F53 A;  5HEU A;  4Q25 A;  3ZYL A;  3S7B A;  3ZEF A;  5L3C B;  1S70 B;  2LSV A;  4JC8 A;  4O8S A;  4GCN A;  4CDN A;  4YJ2 E;  4DUZ T;  4BX8 A;  4RQI A;  3C51 A;  3R9A B;  3C3O A;  4J8S A;  5DAB A;  4A3T A;  4LML A;  4HBD A;  2ACX A;  4JLE A;  3ASD A;  4EAH A;  4KMC A;  3RF1 A;  2CFU A;  3KD7 A;  3ZPO A;  1LD8 A;  5JDF A;  5JH7 E;  1TNU A;  3V2X A;  3L22 A;  1E1H B;  2BG9 E;  2IDO B;  2YN6 A;  2PBI A;  3B95 A;  4CCA A;  5AQM B;  4EBA A;  2IY0 C;  3QAQ A;  1PAQ A;  4OAV B;  3T8K A;  4BY6 A;  3U9W A;  3ISM C;  2J08 A;  3CIR A;  3QOF A;  1HZ4 A;  2H6F A;  2JEK A;  2LM9 A;  4GTQ A;  4NQ0 A;  3ENE A;  2R5S A;  3KVA A;  2HO1 A;  4AIU A;  3ONL A;  2JLB A;  4GKK T;  3RAU A;  1MMG A;  4JI1 T;  2YK0 A;  4PAG A;  1MNE A;  2QY7 A;  3FBZ A;  4JVS A;  4K03 A;  3U64 A;  4BER A;  3RO2 A;  5EIL A;  1YMP A;  3P8C D;  4HFE A;  4AJW A;  2W61 A;  1WM5 A;  3EU5 A;  4DV1 T;  3AE9 A;  2OEV A;  5CJ5 A;  4IHJ E;  3VLD A;  1O1R A;  2H6I A;  4G11 A;  3ML9 A;  1YCS B;  3CK7 A;  5AQK B;  3AA7 B;  4PNI A;  3ETV A;  3UM2 A;  1HNW T;  4Q69 A;  5IWA T;  4CXX A;  4QH5 A;  4ILG A;  4DX6 D;  1E8W A;  4KT6 B;  2V0P A;  5LFA A;  4XI9 A;  4GA2 A;  5C2Y A;  3TWX A;  3LDQ B;  5M4Y A;  2Q9Q D;  3RKG A;  4MLP A;  1IHG A;  3O9X A;  5BXU A;  3VR9 A;  5TAO A;  1Y6I A;  5JDH A;  5ABF B;  3B7S A;  5FTP A;  2V5D A;  2BED A;  1WY6 A;  2X6F A;  3L16 A;  2CMR A;  4I55 E;  3J5P A;  4GTP A;  2F4V T;  4HE8 A;  3GZ2 A;  3EHN A;  5JVD E;  2VKJ A;  4LNU D;  2JIW A;  4BJM A;  4E6H A;  5HCJ A;  1DNP A;  2WB5 A;  3V2O A;  3FEX A;  2ZIS A;  1X9B A;  5JA4 D;  4MAL A;  2Y0B G;  4IN3 B;  4NAC A;  4CN6 A;  2UXD T;  2LHR A;  3PUV F;  3UU3 A;  2IFU A;  5ABF A;  1IXV A;  2PG8 A;  2AW6 A;  3MKR A;  4UQY A;  5ANR A;  4U07 A;  5LCW C;  5LXT E;  4PH4 B;  5AQQ B;  3F31 A;  3AU5 A;  4HRM B;  2J09 A;  3JXJ A;  4U7Y A;  4I2W A;  1IBK T;  3CEQ A;  3PUX F;  4BWR A;  2R03 A;  4K0K T;  1EPU A;  3O48 A;  2XQ5 A;  2L3L A;  1HU3 A;  5HWX A;  3Q75 A;  4OVU A;  4DO0 A;  1N95 A;  3QC1 A;  3AAA B;  4JXT A;  1KLX A;  1SW6 A;  1MIY A;  2LOS A;  2N1G A;  4IYP A;  1N9A A;  3RIU A;  2B6C A;  3CVV A;  5AQB A;  3FZM B;  4PJM A;  3SFX A;  3UUN A;  3NF1 A;  4UWF A;  1WG0 A;  2FJD A;  1NAF A;  4L2L A;  4ILB A;  3OTO T;  1HF8 A;  3QWV A;  5AQT B;  4GYR A;  2XTL A;  4FHK A;  4IUL A;  2QYJ A;  3FU3 A;  4B0Z A;  4TN7 B;  4KZC A;  3ZHE B;  3NOG D;  1HO8 A;  1DU2 A;  4Z68 A;  2AXD S;  2B76 A;  3U3W A;  3JUE A;  3KV9 A;  3PDN A;  3RC8 A;  4IGU A;  2X6I A;  5JDG A;  4TZ4 C;  3TWV A;  4B6X A;  4OHF A;  3FUK A;  3EUH A;  4LF9 T;  5AYW D;  2RKK A;  3UFG A;  3LBX B;  3PTR B;  4GML A;  4LEU A;  1TNB A;  4TV9 E;  3KEZ A;  4MBG A;  3MV3 B;  3ZHE A;  2WAU A;  1S94 A;  1UW4 B;  2X6J A;  4ILA A;  3KEA A;  2UUC T;  3I9Y A;  4G8K A;  4AIS A;  1OXZ A;  4JA9 A;  3CVR A;  5HQ8 A;  1VRB A;  3LBX A;  5BPP A;  3ZT7 A;  2J4B A;  2D2S A;  1FMW A;  2WMO A;  1D8E A;  3C98 B;  4F6R C;  3FTV A;  1NWM X;  4URK A;  1KFY A;  2QC9 A;  4IL9 A;  4KVO A;  3LFM A;  2GGF A;  3RIU C;  1ZKE A;  3NRY A;  5LHG B;  5HEG A;  4HRN A;  3Q5X A;  4UEM A;  2AXZ A;  1IKN D;  2WU2 A;  3RRW A;  1KT1 A;  4FJZ A;  2WQ7 A;  1CUN A;  3PUW F;  3A7M A;  4X66 T;  1S35 A;  2N9D A;  4YLH A;  1NZN A;  3C98 A;  4YDY A;  1OCZ E;  1D1B A;  4RG6 A;  3QC9 A;  2RG8 A;  3AAA C;  1LTX A;  4GTV A;  1RZ4 A;  5ENP D;  4OYK A;  1BPO A;  2IC9 A;  3URZ A;  4YT0 A;  2WWU A;  1H6O A;  3IEG A;  3ZXP A;  5HS0 A;  5L3G B;  3FZK B;  2FJE A;  3ZW3 A;  4LF8 T;  1OCO E;  5KNH D;  4DX7 D;  3GA8 A;  2WXM A;  1U3C A;  3AEC A;  1O5M A;  4KP3 C;  2W62 A;  4H9N C;  3NVO A;  4I0U A;  1MND A;  2KSR A;  4QX7 B;  1TJF A;  3JAE A;  4ILH B;  2V1D B;  3RQW A;  3ZN1 B;  3JCF A;  3U3I A;  3TGO A;  4FA6 A;  4JI4 T;  3TLT A;  2HR2 A;  3UT4 A;  1N54 A;  4K0U A;  4ZZB A;  3E34 A;  2GRR B;  3QAR A;  3IKO B;  5FY0 A;  3SFE A;  5F3J A;  4YTN A;  2CA5 A;  2IO2 C;  4AXH A;  1WR6 A;  2V8S E;  3FU0 A;  3E08 A;  1SZA A;  2WBL A;  3K3O A;  5LHI B;  1WFD A;  4X1K E;  3CGH A;  3CV0 A;  4PUC A;  3DSX A;  4O4H E;  5ENT D;  2KWH A;  1U3D A;  4N2Q A;  2WXI A;  2R05 A;  3DJB A;  5EZY E;  5FT9 A;  4EIW A;  2RPA A;  4B3T T;  2F37 A;  3J9X 1;  3QWW A;  1OWM A;  3AE5 A;  1BI7 B;  2DZO A;  4GZ6 A;  4HFI A;  4GYW A;  4BTA A;  4CN4 A;  1J5E T;  4CZZ B;  1I6Z A;  2UU9 T;  3PUR A;  3ZJ1 A;  3CX6 B;  2W63 A;  2V7M A;  4JEH B;  4U3C A;  3PS6 A;  2LO6 A;  4I6E A;  3WAK A;  3FUD A;  4A55 A;  1H7C A;  3BEE A;  3VRB A;  4BJN A;  4UVA B;  5HEJ A;  3AEF A;  1MHQ A;  3ZMU B;  3HXF A;  2ZXW E;  2MPK A;  2D0U A;  4QH1 A;  4MLK A;  4JEH A;  3AE8 A;  1Z8U A;  4HFH A;  3VTY A;  1YA0 A;  2WM9 A;  1Z3X A;  3I5P A;  3DSU A;  4P29 A;  5HEH A;  2VQF T;  3ZVV A;  1TN8 A;  4H9S E;  2PNN A;  2YNQ A;  3LY9 A;  4JW1 A;  5IHY A;  4X62 T;  1SQM A;  1A5E A;  3ASH A;  5ENN A;  3JXI A;  4GOU A;  3S7J A;  2OCC E;  2EIM E;  3QUJ A;  4GKJ T;  3LVR E;  1TJC A;  2WWV A;  3TWT A;  3HI2 A;  4TUM A;  3HIZ A;  3VLF A;  2DWZ A;  2CFZ A;  1KNZ A;  2DWK A;  2NW7 A;  3DP7 A;  3LK2 B;  3AVR A;  2J07 A;  2KCV A;  3LJN A;  1AJ3 A;  3RX6 A;  2IOS A;  3GZS A;  4N5C A;  3EDV A;  5JRC B;  4EB6 E;  3EDU A;  3O4X E;  3UIO C;  4KVM A;  2WB2 A;  4J8D A;  1HS7 A;  4HFD A;  2AE9 A;  3CKD A;  3LJC A;  2C5K T;  4K5A B;  3UT5 E;  4IIJ E;  5FY7 A;  1XDP A;  5HAX A;  3PNT B;  3EAM A;  3M65 A;  4WYV A;  3CML A;  4EQF A;  5BXO A;  4TNV A;  3H3A A;  5JRC A;  1OWO A;  5AQN B;  1MMN A;  4HLL A;  2QVA A;  3KV4 A;  4HLE A;  1JPL A;  3ZMZ B;  4GMJ A;  5AAR A;  4IT4 A;  2P9N G;  4BFR A;  3UU5 A;  4UQX A;  2ETA A;  4UVC B;  2JAB A;  5L4H A;  3NWI A;  2ZM6 T;  3APD A;  3CR3 A;  3Q49 B;  2WQY A;  3ONK A;  4MHC A;  2QRX A;  5EK2 A;  1OWA A;  2QYW A;  2H88 A;  4JI7 T;  4EZL A;  3M3Z B;  2D9D A;  3DRA A;  4TWF A;  4ANJ A;  4X64 T;  5CBO A;  2VYI A;  1XNF A;  2X9H A;  4JUY A;  4TUY E;  4GZC A;  1BU9 A;  1HTJ F;  5LGN B;  2A4Z A;  1D0Z A;  2DI4 A;  3CVY A;  3TAX A;  2X51 A;  3N9Q A;  1EDU A;  3D9I A;  3RC3 A;  3PU8 A;  3CVW A;  3UU4 A;  3APC A;  3HKB E;  3AAE B;  4TV8 E;  3KBU A;  1TNO A;  5FY1 A;  5E75 A;  3HYM B;  5FVK A;  3TLV A;  3UUM A;  3CK6 A;  3TLU A;  1FJG T;  3AA1 B;  4TRQ A;  3ZKJ A;  4IE7 A;  2DNX A;  4EYY R;  2J47 A;  1N52 A;  3DEO A;  5LBQ B;  3BK9 A;  2L9B A;  2W4X A;  2X67 A;  4HWI B;  3ABK E;  3QK0 A;  4YVO A;  1EF1 C;  2WSS V;  2WXQ A;  1G73 A;  3B13 A;  5DQW A;  4CI3 B;  3EIQ C;  4X20 E;  2WQH A;  3MGB A;  5DIZ A;  3Q2M A;  3ONJ A;  3UUL A;  2LXL A;  2VJ8 A;  1WYB A;  4BET A;  4N3A A;  3AS8 A;  4LMK A;  3T8O A;  5HXR A;  5JR9 B;  4C0M A;  2YU1 A;  5C2T A;  2C0L A;  1KEY A;  4HRL A;  3PJA J;  1V55 E;  3SNX A;  3OKQ A;  3HG0 D;  2BS2 A;  5AQR B;  2KM4 A;  5FXZ A;  4V3I A;  1MJ0 A;  1YQ3 A;  3E37 A;  2YDQ A;  2J8S D;  4GTS A;  4HEA A;  2WXG A;  3MEK A;  1X79 A;  2I0M A;  4JEU A;  4DR5 T;  4C48 B;  3P4S A;  4TV3 A;  2BVM A;  4ZOL E;  2C0M A;  3JC6 C;  3KAE A;  4F7A A;  1PY1 A;  3QKY A;  4LSZ E;  3J7Y q;  1N4S A;  2X3M A;  3ABM E;  3G2W A;  1IJ6 A;  3ZIM A;  3U4T A;  4TWH A;  3D9J A;  3ZPJ A;  2QFC A;  5JJ7 A;  2FJB A;  2IUB A;  4HFG A;  4NUU A;  3FB2 A;  3Q5E A;  1MZC A;  3L82 A;  2BKP A;  2IEJ A;  3FU6 A;  1W09 A;  3QDN A;  3TWR A;  2KND A;  2ZU6 B;  4F1S A;  3RH3 A;  2VWA A;  1JCR A;  2XHE B;  1J5W A;  4EZJ A;  3LY8 A;  2F0Y A;  2IML A;  3B57 A;  3ULY A;  4JI6 T;  1SE7 A;  2WDQ A;  2YIN A;  2WY2 A;  4ILU A;  3PH0 C;  2OV8 A;  3JYS A;  5ABG A;  2OND A;  4DJA A;  3CX8 B;  4H7Y A;  4IDO A;  2XHE A;  4BSZ B;  3UKU G;  2ODV A;  2EQX A;  3IHY A;  2L0T B;  4L9P A;  3AEB A;  3HRA A;  1IAP A;  2LNI A;  1L0V A;  1ZBP A;  1N11 A;  5H6R B;  4DX5 D;  1VOM A;  5H7P A;  3VU7 H;  3PVL A;  2VQE T;  4AEZ C;  5JR9 C;  2ZGD A;  4ME2 A;  4HOS A;  4DI4 A;  2E8I A;  2I1J A;  3CKB A;  3N9M A;  4WWO A;  1LVF A;  1WYC A;  3AEE A;  4PJN A;  3Q78 A;  2KZT B;  1QNF A;  4NUV A;  1MIW A;  2EIN E;  4J6I A;  4G2A A;  2XM1 A;  2BS4 A;  1OT8 A;  5KCM A;  5BT1 A;  2C5I T;  3AE1 A;  2NR4 A;  5AQH B;  4OYS A;  4BT8 A;  4I17 A;  3N2O A;  1D0X A;  3RYC E;  2X0L B;  3P2B A;  3HKD E;  4EPZ A;  3TWU A;  2M6B A;  4JL0 A;  2H7O A;  4PK5 A;  1N34 T;  5JJT A;  2WXP A;  4A1S A;  3R6N A;  2YDR A;  2KZT A;  4J2C A;  4IDZ A;  3C4X A;  2CEA A;  3R9M A;  2B1E A;  2JQH A;  4PJJ A;  2RFA A;  3N9L A;  3PUG A;  4PK4 A;  3CHR A;  2X0Y A;  4D10 C;  1WDY A;  5FYM A;  3RRU A;  1TEZ A;  3FXD B;  1K3Z D;  3AVS A;  2AWI A;  3LPZ A;  4H9Q C;  4B8A A;  2FF4 A;  3ONX A;  3FTX A;  2CXF A;  1YKH B;  1U2V G;  2MRI A;  3P4Q A;  5AQG B;  1OWL A;  5B1A E;  2Y4U A;  5GON E;  1YQ4 A;  3ZFW A;  5KMG P;  3ZT6 A;  1XNQ T;  3CHS A;  3ESK A;  4B89 A;  4LRZ A;  4HOR A;  4I9E A;  4HFC A;  2UXB T;  3S4U A;  4JI5 T;  4ANX A;  3EAB A;  3L08 A;  3QK6 A;  1SA0 E;  2L6J A;  4YTM A;  3UKR G;  4Q96 A;  4HWC A;  3LVQ E;  4V1A v;  4XI0 A;  2BKO A;  5FIO A;  4LER A;  1H0A A;  5FZR A;  4G23 A;  1QZ2 A;  3CHQ A;  4ZI3 D;  4H63 V;  5E0O A;  3HDX A;  5J2U E;  3HHM A;  3R7R A;  2JMK A;  4OYJ A;  5AN8 A;  2LRK A;  5FL1 A;  2MHK A;  3PZ2 A;  1H6P A;  3NZS A;  4MRU A;  3QNU A;  4X1Y E;  5LHH B;  2Y48 B;  3FXE B;  4U74 A;  1KT0 A;  2WP9 A;  4FHJ A;  2CLY B;  2J49 A;  4G25 A;  5FQ6 A;  2V5C A;  2E9X D;  1D1C A;  2VKO A;  1N0Q A;  2LKH A;  1XMQ T;  3C64 A;  4L1B A;  2XAS B;  4AY6 A;  2LE8 A;  4DI3 A;  4L0R A;  1Q2Z A;  3SZ7 A;  3NBX X;  5JDL A;  4A97 A;  4AVX A;  1FVH A;  2X68 A;  2XGM A;  2NOX A;  3HKE E;  3E0Z A;  4N3B A;  2MBG A;  4XAX B;  3B7U X;  1ELW A;  3AEG A;  4ZHB A;  5ARF A;  4DR4 T;  2JQ9 A;  2Y6X A;  3F6Q A;  4C9B B;  3HR0 A;  4I9C A;  4GYS A;  4YSZ A;  2FO1 E;  4CT0 A;  1BR1 A;  1KNP A;  3KS2 A;  4CDR A;  3TLS A;  1IBL T;  3N5L A;  2CHX A;  2XQ0 A;  3PE4 A;  4DMW A;  1N4R A;  4ATZ D;  2Q9Q C;  4WWP A;  4YHH T;  2Y8D A;  3NZQ A;  1JNZ A;  3FZL B;  4BSX A;  4ERR A;  3VKG A;  5J08 A;  3LCA A;  3OXF A;  3C3R A;  3FEY A;  3Q47 B;  4XKB A;  3X1D A;  3UMV A;  2XPK A;  2XUE A;  3G06 A;  3GN5 B;  3SBT B;  4XX5 A;  2UWJ G;  3I3N A;  1GW6 A;  1PC2 A;  3CST A;  1UN8 A;  2MAW A;  5IUX A;  3AJI A;  3WAJ A;  1ZV4 X;  4N5Q A;  5CCL A;  5ETW A;  5FVL A;  3MKD A;  5KDM C;  5FMN A;  5B1B E;  2LKG A;  3LY7 A;  4RLY A;  4O2B E;  3GN5 A;  5HYA A;  3ZYQ A;  2EHO D;  3OVU A;  5ARG A;  2XCB A;  3FTS A;  1HNX T;  1YXR A;  2ZGG A;  1W3B A;  3MAC A;  1IYG A;  4ZFH A;  3CIA A;  4LF4 T;  3RIB A;  3P50 A;  5IYZ E;  3PJA A;  1OCR E;  3VLE A;  2WZI A;  2HM8 A;  4YDW A;  4DR3 T;  3BQO A;  2GRP B;  5CA1 E;  3UX4 A;  3PE3 A;  5JRE A;  1US7 B;  2CLY C;  2CXD A;  2KCL A;  3D3M A;  2LSG A;  3FUJ A;  1O3X A;  4P0B A;  2AVP A;  3FH5 A;  4W9R A;  3E30 A;  4X1I E;  4U0S A;  3EIJ A;  1DCE A;  2DBA A;  4BX9 A;  3D9N A;  3AE2 A;  2P9U G;  3TWQ A;  4B94 A;  1WAO 1;  2XJ7 A;  5G2N A;  4IE5 A;  4ANW A;  3NKZ A;  2H3R A;  4DVD A;  2YU2 A;  3MXZ A;  3G2V A;  5EID A;  4K5B A;  4YJ3 E;  3IV0 A;  2X6K A;  2HHH T;  4YTP A;  1D0Y A;  2NTX A;  1S63 A;  4R7L A;  4B3M T;  4OX9 T;  5FNV E;  1SA5 A;  2IOL A;  2GRL A;  2Y69 E;  3TJP A;  4DR2 T;  2LRL A;  2A3D A;  2PJQ A;  2HPJ A;  4L7T A;  3PUA A;  2KLQ A;  2FUL A;  3IBP A;  2DLR A;  4MS6 A;  2C0S A;  5F5W A;  3NAW A;  3C5R A;  3DBS A;  4O6F A;  3ZT5 A;  2PZI A;  3ZUV B;  4O4J E;  1Z0P A;  4AI6 A;  3DTO A;  3UQ4 A;  3FUH A;  4FJO A;  3ABL E;  3T9K A;  3I0O A;  2XRZ A;  4I50 E;  2DCF A;  1E2A A;  4FU3 A;  3VKH A;  4JHJ A;  2ZM2 A;  3GWH A;  4XZC A;  3L6A A;  3LKU A;  1ZEE A;  4XE0 A;  4N3C A;  4U31 A;  4U95 D;  3CVU A;  1R8I A;  4C91 A;  1BR2 A;  3AS4 A;  1HNZ T;  5C1D A;  3DST A;  1NA3 A;  4TUU A;  4UF0 B;  5A7D B;  5LCY A;  3SFD A;  3PNL B;  3JQ1 A;  3DXM G;  4GU5 A;  3OYZ A;  4OFZ A;  4U7E B;  2DCP A;  3RPU A;  5AAO A;  2MTQ A;  2YEV C;  4AQF A;  4RVB A;  5AQI B;  2M63 A;  4IE4 A;  2RA1 A;  5E76 A;  3EHQ A;  3ZRH A;  5EK3 A;  3EDT B;  4UF0 A;  1OXJ A;  1OUV A;  1U5P A;  3TKL B;  4O60 A;  4N78 D;  2XEN A;  3K3N A;  1UCU A;  3GZ1 A;  3AED A;  1XDO A;  3BQK A;  3RRN B;  5EK4 A;  3QNK A;  4UWL A;  1VCS A;  2X9W A;  4KMO A;  4PS3 A;  3D0T A;  3ULE G;  4Z8X A;  1QLB A;  2WQ6 A;  4UR9 A;  1SVX A;  4FAD A;  3PUQ A;  3PE0 A;  4DND A;  3Q5D A;  2VL0 A;  3TLW A;  3RU0 A;  4LF6 T;  5EX0 A;  3EUV A;  4FLB A;  4UQZ A;  2BBH A;  2R02 A;  5LNK A;  4XEI G;  3BUA A;  1CHU A;  2YHE A;  2CWY A;  1E7P A;  3P1U A;  4FI5 A;  3JAD A;  5AQF B;  3AE3 A;  1LRZ A;  1E7V A;  2WXF A;  2E2A A;  4WWN A;  5LJN A;  4HNA D;  2H6G A;  3KVB A;  3PRE A;  2Q7F A;  3AAI A;  3MYV A;  4YND A;  2VTB B;  2I1K A;  2DL1 A;  5EKQ D;  4RG9 A;  4DX2 A;  2NSZ A;  4IDQ A;  2VGE A;  4HKA A;  4BES A;  4E7Z A;  4G2V A;  4ISS A;  3GYZ A;  2VSY A;  3AS5 A;  2DYR E;  3Q9N C;  5D66 A;  3UU6 A;  3L8R A;  5L2L A;  3QWP A;  3FTY A;  4AQF C;  3ZXS A;  4DLO A;  1FT2 A;  4A3V A;  4HFV A;  4HFB A;  1XGW A;  3T5X A;  2VTB A;  3APF A;  2X38 A;  5KJL A;  3NB2 A;  5F8P A;  4TX5 A;  3PUS A;  3PEU B;  4LMJ A;  1MX4 A;  5CRU A;  2EIJ E;  1LD7 A;  4DV0 T;  1X81 A;  2CWO A;  3G2T A;  1UJJ A;  3F2E A;  3UQ3 A;  4AKL A;  1HR0 T;  4C90 A;  1ZP0 A;  2KMF A;  2HN2 A;  3Q9D A;  1GQE A;  2DHR A;  3ZMS B;  3SOL A;  3RO3 A;  3PUZ F;  3MZK B;  2X9Y A;  4JYA T;  2WU5 A;  3CHM A;  4JI2 T;  1K1B A;  4FP7 A;  3TWS A;  2BKK B;  2XAJ B;  5HXH A;  4NPP A;  2J4G A;  4DK5 A;  4NIK A;  4YVQ C;  4WAF A;  1YKE B;  2KT9 A;  5ABE A;  4B3S T;  4LNG A;  4AM9 A;  5JHB A;  2KIN B;  3PZ3 A;  3BU8 A;  1H6K A;  2L0I A;  3LG7 A;  5FWQ A;  3SQV A;  2LSY A;  2C2L A;  2CHN A;  1T8B A;  4HWF A;  2XEH A;  5ITZ F;  2B0O E;  2Y4T A;  3OTN A;  3ETU A;  3ZSS A;  2HYZ A;  3L09 A;  2NC9 A;  2HN1 A;  2JMH A;  1ZU2 A;  2CBI A;  3UT7 A;  3CQG B;  1N32 T;  4H9R C;  3MCX A;  4ZI7 E;  5AQP B;  2FO7 A;  4JV5 T;  3DSV A;  3LXU X;  2CPT A;  1XNR T;  2LAH A;  4K5C A;  4YSX A;  3S7D A;  3GMI A;  2VK9 A;  4E7S A;  5LBM A;  1N4P A;  2J9Q A;  4AKI A;  4ZI2 D;  1TNY A;  3ZGQ A;  4M3O A;  3V30 A;  3HXB A;  3NOC D;  3FUM A;  3SWH A;  4E85 A;  3K8P C;  4GTR A;  2MYS A;  2PM7 A;  3PUJ A;  4GIW A;  1UUR A;  1UK5 A;  2DVW A;  5ADX L;  4JD2 G;  4J7W A;  2GRM A;  3SHF A;  4WBO A;  2W66 A;  1V54 E;  3ZJ2 A;  3GW4 A;  2P9I G;  1BR0 A;  3AG3 E;  5CRV A;  5AQV B;  3RKO A;  4B3R T;  3EJN A;  4EEB A;  1OY3 D;  1MMA A;  3ASO E;  4DRX E;  3UTM A;  4DV5 T;  4GYY A;  4J8E A;  1E7U A;  3FTU A;  4CGW A;  5BUZ A;  4YFS A;  1ZHC A;  5J2T E;  2KC7 A;  3G2U A;  2GW1 A;  2R17 C;  2CE7 A;  2YQ8 A;  3I9W A;  4H9O C;  3C72 A;  3V31 A;  1H2U A;  2UY1 B;  3TXM A;  3SD5 A;  2E2E A;  4U8Y D;  4JBW F;  4DR6 T;  3TWW A;  3ZST A;  4XBF B;  5JDQ A;  1NEK A;  1Y8M A;  2LUH A;  5ANL A;  5BV1 A;  3D9O A;  4NRH B;  4KHZ F;  1N0R A;  4U8V D;  3CHP A;  2ZLY A;  1ELK A;  1FMV A;  5FZS A;  2UY1 A;  4GZ5 A;  4LFA T;  1KZP A;  4WNK A;  5AQJ B;  2X66 A;  2YDS A;  3DPD A;  4UWH A;  5T8I A;  3UT8 A;  5FJY A;  1E90 A;  3U78 A;  2OA5 A;  3RRC A;  4DR7 T;  1MYO A;  1Z3Y A;  2KXP B;  2X0H A;  1BLX B;  1G8X A;  5AJL A;  4BA9 A;  4UIG A;  2WXO A;  3D9H A;  4MKT A;  2HH7 A;  2XAF B;  3B7T A;  4UEL A;  4YDE A;  3ZKR A;  3RQU A;  1T7S A;  2ETB A;  4Z90 A;  1ZOY A;  5AFU L;  2ILR A;  3V79 K;  3UUB A;  2V5F A;  2CM0 A;  1N33 T;  5BW8 C;  5AQS B;  4GK0 E;  1HX1 B;  2LJL A;  5LG3 A;  5JR9 A;  5LJM A;  3HXE A;  4EZ4 A;  2H6H A;  5L3F B;  3J5Q B;  4ASK A;  3AG1 E;  5LGU B;  3UFE A;  3CVL A;  3QB2 A;  4I1O B;  4GTM A;  2XZT G;  4ZHQ E;  4IRU A;  1OCC E;  1NL4 A;  3ZMT B;  2VSO E;  5B3S E;  4GAA A;  3G2S A;  2YHC A;  3CKC A;  4QXH B;  4WBN E;  3ZU7 B;  4PFP A;  2OLT A;  4YSY A;  4U8H A;  4IE0 A;  4QH4 A;  1UN9 A;  3AE7 A;  5DJQ C;  1KZO A;  4U0Z A;  3MJX A;  2RFM A;  4ANU A;  2LSI A;  4AKG A;  4EV6 A;  4AKH A;  3ML8 A;  2VL8 A;  2VKD A;  5ENQ D;  4C0E A;  3W15 B;  4CQI A;  5KX5 E;  3RRM B;  4HI9 A;  5JTG A;  2XAG B;  3OYX A;  1NA0 A;  3RK6 A;  4EZH A;  4G8L A;  5G05 J;  3BQL A;  3CQX C;  3EHZ A;  3FFL A;  5IY5 E;  4LF7 T;  2VGY A;  2FJA A;  2FEZ A;  3LS8 A;  1UX4 A;  2W67 A;  2UUB T;  1A17 A;  4FUL A;  1OED C;  2KXP C;  4PDX A;  4P1N A;  4TXQ A;  5JDM A;  1DCQ A;  4H9P C;  2BUG A;  2WXL A;  4IL4 A;  2E9X B;  4YY3 T;  5M72 A;  2XSA A;  3OJA A;  4AOF A;  3Q7A A;  2OEW A;  1FCH A;  1T72 A;  4HVB A;  1JCS A;  3S7F A;  3RYH E;  4P0A A;  4EHM A;  1JWF A;  4QX8 B;  1TN6 A;  3IEE A;  1INZ A;  2Z6E A;  1QUU A;  4P09 A;  4U2Z A;  4AY5 A;  3FY4 A;  4HOQ A;  2PM6 A;  2E9X A;  5L47 A;  1IBM T;  3O4Z A;  4EBA G;  4GYO A;  4JI0 T;  4EOZ B;  3SBS A;  4B8C B;  4HWD A;  4GZD A;  4UWG A;  3S2A A;  4U72 A;  4A63 B;  5DQV A;  1BI8 B;  1IJ5 A;  3KSL A;  1I94 T;  2UXC T;  4HGA A;  1H19 A;  5ENO D;  4KBQ A;  2F8X K;  2NP9 A;  2VUR A;  3KV5 A;  3E4B A;  2L6B A;  2Q9Q B;  3B5M A;  3KV6 A;  3AG2 E;  4I43 B;  4L9I A;  3PU3 A;  1QQE A;  4A98 A;  3F57 A;  3UIP C;  1QYM A;  3TG5 A;  2PQR A;  4EED A;  1M7K A;  1VCT A;  2WXK A;  4NXN T;  5FQ4 A;  4TXP A;  2C5J A;  4LNB A;  5LMN T;  1BD8 A;  5A23 A;  4O4L E;  1JNR A;  1SA4 A;  4U7I A;  2MOZ A;  2Q9Q A;  4DV4 T;  3BG0 B;  3QB5 K;  5BV0 A;  2EHO B;  1H2V C;  4I43 A;  4ZI3 C;  3T5V A;  2AXV A;  1J1J A;  2FI7 A;  3DSW A;  4N2S A;  5HXE A;  3RIF A;  4UUC A;  5JDN A;  3NRX A;  3JAF A;  3AG4 E;  3SRZ A;  3FU5 A;  2WXR A;  4HOT A;  2N2N A;  2BKG A;  4G1T A;  2V7K A;  3RKV A;  1QBQ A;  1XMO T;  1EYH A;  3K1S A;  2EHO A;  5EYL A;  2LEH A;  4O1P A;  2E9X C;  4DV6 T;  4YDO A;  3QOU A;  4A5X A;  4EYU A;  4XKC A;  4NXM T;  4AQY T;  3CQC B;  4G26 A;  1N94 A;  3BG1 B;  2W00 A;  2NXP A;  2EIL E;  2CHW A;  3ZC1 A;  4PS8 A;  1UOH A;  4J0U A;  1L5J A;  5LP6 E;  4AP2 A;  4EZK A;  2XEE A;  1TN7 A;  5HWY A;  2VSX E;  2Y3A A;  4UVB B;  4DUY T;  2LM2 A;  3LK4 2;  5CGM A;  4U63 A;  2XAH B;  2BZB A;  2IIU A;  3UUX B;  3MV2 B;  4KHP T;  5DBK A;  3ESL A;  4APF A;  1XZY A;  2XGS A;  2LHN A;  3P4R A;  4KBM B;  3PRZ A;  3HVE B;  3MA5 A;  2IW5 B;  3JCK C;  5J1G A;  2DYS E;  1UG3 A;  5LB7 B;  2R59 A;  3ABV A;  3N2G E;  3ZNG A;  3RLF F;  3DEP A;  5A6C A;  3T1H T;  2V7J A;  5L3B B;  1E8Z A;  1XWM A;  5JQG E;  4O2A E;  3UUX A;  5FXX A;  3FTZ A;  1Y64 B;  3CVQ A;  1S0P A;  3HVE A;  3RYF E;  5KJK A;  2XQ7 A;  3MA9 A;  5AQO B;  2JRK A;  2XQA A;  3ZYK A;  3I4R B;  5AEN A;  4BEP A;  5CB4 E;  3LEW A;  3E22 E;  5AIJ A;  3FZH B;  3N9O A;  5LG4 A;  4I6G A;  3TXN A;  4QWN B;  3I1A A;  2WDR A;  3BQI A;  2QA7 A;  3HKC E;  3UXG A;  2EHO C;  3AE4 A;  4DBR A;  5KBA A;  4M7C A;  5LX8 A;  2A5U A;  2ETC A;  1B7T A;  4GPM A;  2WMN A;  4Y6C A;  4KXK B;  4CRW A;  3CVP A;  5LGT B;  4NIQ A;  1KK7 A;  1OWN A;  4GTT A;  3Q7F A;  1UUS A;  3FUF A;  4PW8 A;  2DWG A;  2X9X A;  5BNW A;  5HRY A;  3HXD A;  2LOP A;  2I2O A;  4FJY A;  2FUP A;  3ASG A;  1SUM B;  3D9P A;  5KNG A;  1IHB A;  3X2Q E;  2EIK E;  2XZD G;  4U2Y A;  4O4I E;  4GPK A;  3UM1 A;  3IA3 A;  5LOV E;  4ANV A;  1W0A A;  3R7Q A;  4ACL A;  3C4Z A;  2H7V C;  2PL2 A;  3PUY F;  4CZ2 D;  1N4Q A;  3FZF B;  2F8Y A;  3L54 A;  1NEN A;  5AQL B;  1K8K G;  5J90 A;  1D9S A;  2UXX B;  5LYJ E;  4UV8 B;  3ONL C;  3SS1 A;  3L17 A;  3UTK A;  2P58 C;  2BVL A;  3SF4 A;  4FLH A;  4CI1 B;  4BT9 A;  3CPZ A;  2YOE A;  3PV0 F;  4GCO A;  2PQN A;  4G24 A;  1MMD A;  3UIN C;  5G04 J;  2WXH A;  5AQ7 A;  3VHL A;  3SO8 A;  5HEO A;  2KAT A;  2XRY A;  4UI9 J;  2RP4 A;  1OWP A;  3P4P A;  4ACK A;  1U4Q A;  1MQS A;  2P9B A;  2GRN B;  2R6G F;  3DSS A;  3A5X A;  2QZA A;  2ZIR A;  4DLQ A;  4HS2 A;  2NW9 A;  3KFW X;  5CEA A;  2K9A A;  3PZD A;  4AXP A;  2AJA A;  5D2M C;  3N9N A;  4JI8 T;  1T98 A;  3LSV A;  4QXB B;  3OXG A;  1JCQ A;  3W9F A;  2I59 A;  2XPI A;  3FH7 A;  4JB8 P;  3PEV B;  4UI9 K;  2CRB A;  5T4Y A;  3EU9 A;  3CWZ B;  1TR4 A;  3LDZ A;  3AB3 B;  3N9P A;  2XQ4 A;  4YXD A;  2VQ2 A;  2BF0 X;  4IRE A;  5KXJ A;  5KJN A;  3MKQ B;  3OPC A;  3MZL B;  3ZLI A;  4LFC T;  2OVF A;  2BTD A;  3ANW B;  4ZS2 A;  4GA1 A;  2V6X A;  1W9R A;  5FXW A;  3T1Y T;  2WDV A;  3RIA A;  4DV2 T;  3U66 A;  5AQ9 A;  5FXV A;  3CHO A;  2VVN A;  4ZEY A;  1G3N B;  2XGO A;  3DXK G;  1LVK A;  4HQD A;  4DR1 T;  1EZ3 A;  5AJD A;  3MKQ A;  3FWV A;  1Y01 A;  3I0Q A;  1SHZ C;  3IBE A;  1O1S A;  3ANW A;  3ZN3 A;  4CDM A;  2ZM8 A;  3HA4 A;  1HE8 A;  2LAI A;  4AV7 A;  2MOW A;  1AWC B;  4HOU A;  1WCR A;  3UI2 A;  4O1O A;  2DIW A;  3SGH A;  2A9U A;  4GK5 E; 
#chains in the Genus database with same CATH homology
 3V5S A;  4CXY A;  4UV9 B;  5H6Q B;  1D1A A;  2JJ9 A;  4HN9 A;  3IHV A;  1HX8 A;  3ZMV B;  4ADZ A;  1ELR A;  2LSJ A;  5L3D B;  4AKR B;  2ZM0 A;  2M67 A;  4QFV A;  5EX3 A;  2A2F X;  3RJV A;  2XAQ B;  2HPL A;  1FIO A;  1DVP A;  3WI3 A;  2K48 A;  3VTX A;  3ULQ A;  5FP3 A;  1B89 A;  5G05 C;  4U0U A;  5EDS A;  3Q5M A;  4APO A;  1E96 B;  3UPV A;  4AQG A;  2J1D G;  5FQ7 A;  2CG2 A;  3TG4 A;  2LSK A;  4U04 A;  4BTB A;  2KZ7 B;  3Q15 A;  5HXS A;  5D0O D;  4A1G A;  2A72 A;  2LT3 A;  1HG5 A;  3CVX A;  1Z6T A;  3FTW A;  3EHM A;  2IJG X;  4G63 A;  5CMY A;  2WVI A;  3SFZ A;  3OBV E;  3C50 A;  5C8Y E;  4RSY A;  4WUY A;  3CLJ A;  4L5G A;  4PJL A;  2I6H A;  2XPY A;  1X5B A;  4LCT A;  3FUI A;  4NUR A;  1IQU A;  3N2K E;  3FP3 A;  3PUK A;  4GA0 A;  5D0Q D;  1BR4 A;  3NZU A;  4IST A;  3FBL A;  3RYI E;  4QXC B;  4H63 H;  3WXX A;  5L3E B;  4Q94 A;  4XIF A;  1FEW A;  2VKH A;  2IF4 A;  3Q4A B;  3MX3 A;  4CGV A;  3CK9 A;  2ES0 A;  2JQQ A;  2X6H A;  1E8Y A;  3OAW A;  2LSU A;  5HI7 A;  4CI2 B;  4ZS3 A;  4FC8 A;  4OK0 A;  4WNF A;  2GK9 A;  3JUI A;  2IQC A;  3D9K A;  4ZI2 C;  2V26 A;  4I1M A;  1UX5 A;  4I6J A;  3R84 B;  2IU1 A;  3JQ0 A;  4HXI A;  3N71 A;  1YW0 A;  1LF8 A;  3B7R L;  4YHJ A;  2UXN B;  4A56 A;  3I4G A;  3KDS E;  4I1A A;  3IHR A;  5CA0 E;  4MBQ A;  3O1J A;  5G55 A;  4J8F A;  2NWB A;  2VAS A;  3K3Q C;  3QJZ A;  1JUQ A;  1SZ9 A;  3ZC0 A;  4EXT A;  3OXL A;  5LCW J;  2CXL A;  5HXC A;  1WLX A;  5BMV E;  4F3V A;  1HH8 A;  1IZN B;  1NP7 A;  5LP0 A;  1WRD A;  4PFO A;  4M1P A;  3D9M A;  4JHR A;  3CK8 A;  3ZCI A;  4LUN U;  2I9C A;  2VSN A;  4OVV A;  3LJ3 A;  4QKN A;  3Q5W A;  3ZN0 B;  4WND A;  5CHE E;  2D0T A;  1HCI A;  4WNG A;  2OVB A;  3FHE A;  3D9L A;  2KCK A;  3O1I A;  1E8X A;  5JHA A;  4IE6 A;  3KBT A;  4DBQ A;  2G0U A;  4DMV A;  1UJK A;  2W0G A;  5A1L A;  4KZ0 A;  3FH8 A;  4I4T E;  4QHO A;  2CCQ A;  2IAK A;  2ODU A;  3O1H A;  4L23 A;  2AXU A;  4EEC A;  4JEU B;  5G04 C;  4GZ3 A;  2VGX B;  1HS6 A;  4UI9 C;  3EVY A;  3L3P A;  3HL6 A;  2IC6 A;  4UWK A;  3IF8 B;  3NZP A;  4WNE A;  2RD0 A;  5FZQ A;  2XPZ A;  4HTE A;  4K0R A;  5JJ6 A;  3FDH A;  3NQP A;  1V9D A;  2VGX A;  2SPC A;  2CG3 A;  2E0I A;  4JA7 A;  3ZYM A;  4WW0 A;  3V5U A;  3AU4 A;  1QSD A;  4PS7 A;  3JC6 D;  4UXN B;  1MIV A;  1IQR A;  1H2T C;  2KWI B;  1P5Q A;  5LOZ A;  2PFV A;  3LK3 B;  3AA6 B;  5T3R A;  4ATG A;  3K9I A;  4I2Z A;  5CMW A;  5KJM A;  2L9Q A;  3FUL A;  1LKX A;  5LA6 E;  3FUN A;  4Y6W A;  2ION A;  2K24 A;  3H37 A;  5FQ8 A;  4AIF A;  3C4W A;  4ABN A;  4CEM A;  2FBN A;  4CXW A;  2NW8 A;  3KIN B;  1HFA A;  4PK6 A;  4DPR A;  3L13 A;  2QGS A;  4JHK A;  3CVN A;  1JWG A;  2D5U A;  2J4D A;  4KUM B;  1YD8 G;  4ILI A;  2CHZ A;  3P7I A;  1VDY A;  2WXN A;  2XCC A;  4H7X A;  3SI5 A;  5CCM A;  3ZCJ A;  1FVF A;  3CX7 B;  2V7L A;  2XQY A;  1HXI A;  4L2Y A;  2V7I A;  3MK7 C;  2ZMA A;  2VB6 A;  1HG2 A;  2OOE A;  4GB9 A;  4CT4 A;  2V4L A;  4JZY A;  4BAY B;  2L8K A;  3T8M A;  2NTY A;  2K5B B;  2XEV A;  3LYA A;  3AA0 B;  2WPV A;  3FHN A;  4XZ4 A;  3ZEF B;  3FUE A;  4N39 A;  2WXJ A;  4KYO B;  3PDY A;  4MFR A;  3TL5 A;  3ASF A;  2BDE A;  3CSF A;  2JPF A;  4JPS A;  3MJW A;  4F53 A;  3ZYL A;  3S7B A;  3ZEF A;  5L3C B;  2LSV A;  4JC8 A;  4O8S A;  4GCN A;  4CDN A;  4YJ2 E;  4BX8 A;  3C51 A;  3R9A B;  4J8S A;  5DAB A;  4A3T A;  2ACX A;  4JLE A;  3ASD A;  4EAH A;  4KMC A;  2CFU A;  3KD7 A;  3ZPO A;  5JDF A;  5JH7 E;  3L22 A;  1E1H B;  2PBI A;  4CCA A;  4EBA A;  3QAQ A;  1PAQ A;  4BY6 A;  3U9W A;  2J08 A;  1HZ4 A;  2JEK A;  2LM9 A;  4NQ0 A;  3ENE A;  2R5S A;  3KVA A;  2HO1 A;  3ONL A;  2JLB A;  1MMG A;  2YK0 A;  4PAG A;  1MNE A;  2QY7 A;  3FBZ A;  4JVS A;  4K03 A;  3U64 A;  3RO2 A;  3P8C D;  4AJW A;  2W61 A;  1WM5 A;  4IHJ E;  3VLD A;  4G11 A;  3ML9 A;  3CK7 A;  3AA7 B;  4PNI A;  3ETV A;  4Q69 A;  4CXX A;  4ILG A;  1E8W A;  4KT6 B;  2V0P A;  5LFA A;  4XI9 A;  4GA2 A;  5C2Y A;  5M4Y A;  2Q9Q D;  4MLP A;  1IHG A;  3O9X A;  3B7S A;  5TAO A;  1Y6I A;  5JDH A;  5FTP A;  2X6F A;  3L16 A;  1WY6 A;  2CMR A;  4I55 E;  4HE8 A;  3GZ2 A;  3EHN A;  5JVD E;  2VKJ A;  4BJM A;  4E6H A;  1DNP A;  3FEX A;  4MAL A;  4IN3 B;  4NAC A;  2LHR A;  2IFU A;  2PG8 A;  2AW6 A;  3MKR A;  4UQY A;  5ANR A;  4U07 A;  5LCW C;  5LXT E;  4PH4 B;  3F31 A;  3AU5 A;  2J09 A;  4I2W A;  3CEQ A;  4BWR A;  1EPU A;  3O48 A;  2L3L A;  1HU3 A;  5HWX A;  4OVU A;  4DO0 A;  3QC1 A;  3AAA B;  4JXT A;  1KLX A;  1MIY A;  2LOS A;  2N1G A;  4IYP A;  3CVV A;  4PJM A;  3UUN A;  3NF1 A;  4UWF A;  1NAF A;  4L2L A;  1HF8 A;  3QWV A;  4GYR A;  2XTL A;  4FHK A;  4IUL A;  3FU3 A;  4B0Z A;  4TN7 B;  4KZC A;  3ZHE B;  1HO8 A;  3U3W A;  3KV9 A;  3PDN A;  3RC8 A;  4IGU A;  2X6I A;  5JDG A;  4TZ4 C;  4B6X A;  4OHF A;  3FUK A;  3EUH A;  5AYW D;  3LBX B;  3PTR B;  4GML A;  4LEU A;  4TV9 E;  3KEZ A;  3MV3 B;  3ZHE A;  2WAU A;  1S94 A;  1UW4 B;  2X6J A;  3I9Y A;  1OXZ A;  4JA9 A;  3CVR A;  5HQ8 A;  1VRB A;  3LBX A;  5BPP A;  2J4B A;  2D2S A;  1FMW A;  2WMO A;  3C98 B;  4F6R C;  3FTV A;  1NWM X;  4URK A;  4KVO A;  3LFM A;  2GGF A;  1ZKE A;  3NRY A;  5LHG B;  3Q5X A;  4UEM A;  2AXZ A;  3RRW A;  1KT1 A;  4FJZ A;  2WQ7 A;  1CUN A;  1S35 A;  2N9D A;  4YLH A;  1NZN A;  3C98 A;  1D1B A;  4RG6 A;  3QC9 A;  2RG8 A;  4OYK A;  1BPO A;  2IC9 A;  3URZ A;  3IEG A;  2WWU A;  5L3G B;  3ZW3 A;  3GA8 A;  2WXM A;  1U3C A;  4KP3 C;  2W62 A;  4H9N C;  1MND A;  4QX7 B;  1TJF A;  4ILH B;  2V1D B;  3ZN1 B;  3U3I A;  3TGO A;  4FA6 A;  2HR2 A;  3UT4 A;  1N54 A;  4K0U A;  3QAR A;  3IKO B;  5FY0 A;  5F3J A;  2CA5 A;  4AXH A;  1WR6 A;  2V8S E;  3FU0 A;  3E08 A;  1SZA A;  2WBL A;  3K3O A;  5LHI B;  4X1K E;  3CGH A;  3CV0 A;  4PUC A;  4O4H E;  2KWH A;  1U3D A;  4N2Q A;  2WXI A;  3DJB A;  5EZY E;  5FT9 A;  4EIW A;  3J9X 1;  3QWW A;  1OWM A;  4GZ6 A;  4GYW A;  4BTA A;  4CZZ B;  3PUR A;  3CX6 B;  3ZJ1 A;  2W63 A;  2V7M A;  4JEH B;  4I6E A;  3PS6 A;  2LO6 A;  3WAK A;  3FUD A;  4A55 A;  1H7C A;  3BEE A;  4BJN A;  4UVA B;  1MHQ A;  3ZMU B;  2D0U A;  4MLK A;  4JEH A;  3VTY A;  1YA0 A;  2WM9 A;  1Z3X A;  3I5P A;  4P29 A;  3ZVV A;  4JW1 A;  4H9S E;  2YNQ A;  3LY9 A;  5IHY A;  1SQM A;  3ASH A;  5ENN A;  4GOU A;  3S7J A;  3QUJ A;  3LVR E;  1TJC A;  3HI2 A;  3HIZ A;  3VLF A;  2CFZ A;  1KNZ A;  2DWK A;  2NW7 A;  3DP7 A;  3LK2 B;  3AVR A;  2J07 A;  2KCV A;  1AJ3 A;  3RX6 A;  2IOS A;  3GZS A;  4N5C A;  3EDV A;  5JRC B;  4EB6 E;  3EDU A;  3O4X E;  4KVM A;  2WB2 A;  4J8D A;  1HS7 A;  3CKD A;  3LJC A;  2C5K T;  4IIJ E;  5FY7 A;  3UT5 E;  5HAX A;  3PNT B;  3M65 A;  4EQF A;  3CML A;  3H3A A;  5JRC A;  1OWO A;  4HLE A;  1MMN A;  3KV4 A;  1JPL A;  3ZMZ B;  4GMJ A;  4BFR A;  4UQX A;  4UVC B;  3APD A;  3CR3 A;  3Q49 B;  3ONK A;  4MHC A;  5EK2 A;  1OWA A;  4EZL A;  4ANJ A;  2VYI A;  1XNF A;  2X9H A;  4JUY A;  4TUY E;  4GZC A;  1HTJ F;  5LGN B;  2A4Z A;  1D0Z A;  2DI4 A;  3CVY A;  3TAX A;  2X51 A;  3N9Q A;  1EDU A;  3D9I A;  3RC3 A;  3PU8 A;  3CVW A;  3APC A;  3HKB E;  3AAE B;  4TV8 E;  3KBU A;  5FY1 A;  5E75 A;  3HYM B;  3UUM A;  3AA1 B;  4TRQ A;  4IE7 A;  2DNX A;  4EYY R;  1N52 A;  5LBQ B;  3BK9 A;  2L9B A;  2X67 A;  3QK0 A;  4YVO A;  3EIQ C;  2WXQ A;  1EF1 C;  2WSS V;  1G73 A;  3B13 A;  5DQW A;  4CI3 B;  4X20 E;  2WQH A;  3MGB A;  5DIZ A;  3Q2M A;  3UUL A;  2VJ8 A;  1WYB A;  4N3A A;  3AS8 A;  3T8O A;  5HXR A;  5JR9 B;  4C0M A;  2YU1 A;  2C0L A;  3SNX A;  3OKQ A;  2KM4 A;  5FXZ A;  4V3I A;  4HEA A;  2WXG A;  3MEK A;  1X79 A;  4JEU A;  4TV3 A;  2BVM A;  4ZOL E;  2C0M A;  3JC6 C;  3KAE A;  4F7A A;  1PY1 A;  3QKY A;  3J7Y q;  2X3M A;  3G2W A;  1IJ6 A;  3ZIM A;  3U4T A;  3D9J A;  3ZPJ A;  2QFC A;  5JJ7 A;  4HFG A;  4NUU A;  3FB2 A;  3FU6 A;  3QDN A;  2KND A;  2ZU6 B;  4F1S A;  3RH3 A;  2VWA A;  2XHE B;  4EZJ A;  3LY8 A;  3B57 A;  2YIN A;  4ILU A;  3PH0 C;  2OV8 A;  3JYS A;  2OND A;  4DJA A;  3CX8 B;  4H7Y A;  2XHE A;  2ODV A;  2EQX A;  3IHY A;  2L0T B;  1IAP A;  2LNI A;  1ZBP A;  5H6R B;  1VOM A;  3VU7 H;  3PVL A;  4AEZ C;  5JR9 C;  4ME2 A;  4HOS A;  4DI4 A;  2E8I A;  2I1J A;  3CKB A;  3N9M A;  4WWO A;  1WYC A;  1LVF A;  4PJN A;  2KZT B;  1QNF A;  4NUV A;  1MIW A;  4J6I A;  4G2A A;  5KCM A;  5BT1 A;  2C5I T;  4OYS A;  4BT8 A;  4I17 A;  3N2O A;  1D0X A;  3RYC E;  2X0L B;  3P2B A;  3HKD E;  4EPZ A;  4JL0 A;  5JJT A;  2H7O A;  4PK5 A;  2WXP A;  4A1S A;  3R6N A;  2KZT A;  4J2C A;  4IDZ A;  3C4X A;  2CEA A;  2B1E A;  4PJJ A;  3N9L A;  3PUG A;  4PK4 A;  3CHR A;  4D10 C;  5FYM A;  3RRU A;  1TEZ A;  3FXD B;  3AVS A;  2AWI A;  3LPZ A;  4H9Q C;  4B8A A;  2FF4 A;  3ONX A;  3FTX A;  2CXF A;  1YKH B;  2MRI A;  1OWL A;  2Y4U A;  5GON E;  3ZFW A;  5KMG P;  3CHS A;  3ESK A;  4B89 A;  4LRZ A;  4HOR A;  4I9E A;  3S4U A;  4ANX A;  3L08 A;  3QK6 A;  1SA0 E;  2L6J A;  4Q96 A;  3LVQ E;  4V1A v;  4XI0 A;  4LER A;  1H0A A;  5FZR A;  4G23 A;  1QZ2 A;  3CHQ A;  4ZI3 D;  4H63 V;  5E0O A;  3HDX A;  5J2U E;  3HHM A;  3R7R A;  2JMK A;  4OYJ A;  2MHK A;  4MRU A;  3NZS A;  4X1Y E;  5LHH B;  2Y48 B;  3FXE B;  4U74 A;  1KT0 A;  4FHJ A;  2CLY B;  2J49 A;  4G25 A;  5FQ6 A;  2E9X D;  1D1C A;  2VKO A;  3C64 A;  4L1B A;  2XAS B;  4AY6 A;  2LE8 A;  4DI3 A;  4L0R A;  3SZ7 A;  3NBX X;  5JDL A;  4AVX A;  1FVH A;  2X68 A;  2XGM A;  2NOX A;  3HKE E;  3E0Z A;  4N3B A;  2MBG A;  4XAX B;  3B7U X;  1ELW A;  5ARF A;  2Y6X A;  4C9B B;  3HR0 A;  4I9C A;  4GYS A;  4CT0 A;  1BR1 A;  3KS2 A;  4CDR A;  3N5L A;  2CHX A;  2XQ0 A;  3PE4 A;  4DMW A;  2Q9Q C;  4WWP A;  2Y8D A;  3NZQ A;  4BSX A;  4ERR A;  3VKG A;  5J08 A;  3LCA A;  3OXF A;  3FEY A;  3Q47 B;  4XKB A;  3UMV A;  2XUE A;  3GN5 B;  3SBT B;  4XX5 A;  2UWJ G;  3I3N A;  1GW6 A;  1PC2 A;  3CST A;  1UN8 A;  3WAJ A;  1ZV4 X;  5CCL A;  5ETW A;  3MKD A;  5KDM C;  5FMN A;  3LY7 A;  4O2B E;  3GN5 A;  5HYA A;  3ZYQ A;  2EHO D;  5ARG A;  2XCB A;  3FTS A;  1W3B A;  3MAC A;  1IYG A;  3CIA A;  3RIB A;  5IYZ E;  3VLE A;  2HM8 A;  5CA1 E;  3UX4 A;  3PE3 A;  5JRE A;  1US7 B;  2CLY C;  2CXD A;  2KCL A;  3D3M A;  2LSG A;  3FUJ A;  1O3X A;  4P0B A;  2AVP A;  3FH5 A;  4W9R A;  4X1I E;  4U0S A;  3EIJ A;  4BX9 A;  2DBA A;  3D9N A;  4B94 A;  1WAO 1;  5G2N A;  4IE5 A;  4ANW A;  2H3R A;  4DVD A;  2YU2 A;  3MXZ A;  3G2V A;  4YJ3 E;  3IV0 A;  2X6K A;  1D0Y A;  2NTX A;  4R7L A;  5FNV E;  2IOL A;  2GRL A;  3TJP A;  2A3D A;  2PJQ A;  2HPJ A;  4L7T A;  3PUA A;  2KLQ A;  2FUL A;  3IBP A;  2DLR A;  4MS6 A;  2C0S A;  3DBS A;  4O6F A;  2PZI A;  4O4J E;  1Z0P A;  4AI6 A;  3DTO A;  3FUH A;  4FJO A;  3I0O A;  2XRZ A;  4I50 E;  2DCF A;  4FU3 A;  3VKH A;  4JHJ A;  2ZM2 A;  3GWH A;  4XZC A;  3L6A A;  3LKU A;  1ZEE A;  4XE0 A;  4N3C A;  3CVU A;  4C91 A;  1BR2 A;  3AS4 A;  5C1D A;  1NA3 A;  4TUU A;  4UF0 B;  5A7D B;  5LCY A;  3PNL B;  3JQ1 A;  4GU5 A;  3OYZ A;  4OFZ A;  2DCP A;  3RPU A;  2MTQ A;  2YEV C;  4AQF A;  4RVB A;  2M63 A;  4IE4 A;  2RA1 A;  5E76 A;  3ZRH A;  5EK3 A;  3EDT B;  4UF0 A;  1OUV A;  1U5P A;  3TKL B;  4N78 D;  3K3N A;  1UCU A;  3GZ1 A;  3BQK A;  3RRN B;  5EK4 A;  3QNK A;  4UWL A;  2X9W A;  4KMO A;  4PS3 A;  3D0T A;  4Z8X A;  2WQ6 A;  4FAD A;  3PUQ A;  3PE0 A;  4DND A;  3RU0 A;  5EX0 A;  4FLB A;  4UQZ A;  5LNK A;  2YHE A;  2CWY A;  3P1U A;  4FI5 A;  1LRZ A;  1E7V A;  2WXF A;  4WWN A;  5LJN A;  3KVB A;  3PRE A;  2Q7F A;  3AAI A;  3MYV A;  4YND A;  2VTB B;  2I1K A;  5EKQ D;  4RG9 A;  2NSZ A;  4HKA A;  4E7Z A;  4G2V A;  4ISS A;  3GYZ A;  2VSY A;  3AS5 A;  5L2L A;  3QWP A;  3FTY A;  4AQF C;  3ZXS A;  4DLO A;  4A3V A;  4HFV A;  1XGW A;  3T5X A;  2VTB A;  3APF A;  2X38 A;  5KJL A;  5F8P A;  4TX5 A;  3PUS A;  3PEU B;  2CWO A;  3G2T A;  1UJJ A;  3F2E A;  3UQ3 A;  4AKL A;  4C90 A;  2KMF A;  3Q9D A;  2DHR A;  3ZMS B;  3SOL A;  3RO3 A;  3MZK B;  2X9Y A;  3CHM A;  4FP7 A;  2XAJ B;  5HXH A;  4DK5 A;  4YVQ C;  4WAF A;  1YKE B;  2KT9 A;  4AM9 A;  5JHB A;  2KIN B;  1H6K A;  2L0I A;  3LG7 A;  5FWQ A;  2LSY A;  2C2L A;  2Y4T A;  3OTN A;  3ETU A;  2HYZ A;  3L09 A;  2NC9 A;  2JMH A;  1ZU2 A;  3UT7 A;  3CQG B;  4H9R C;  3MCX A;  4ZI7 E;  2FO7 A;  3LXU X;  2LAH A;  3S7D A;  3GMI A;  2VK9 A;  4E7S A;  5LBM A;  2J9Q A;  4AKI A;  4ZI2 D;  3ZGQ A;  4M3O A;  3FUM A;  3SWH A;  4E85 A;  3K8P C;  2MYS A;  2PM7 A;  3PUJ A;  4GIW A;  5ADX L;  2GRM A;  3SHF A;  4WBO A;  3ZJ2 A;  3GW4 A;  1BR0 A;  3RKO A;  3EJN A;  1MMA A;  4GYY A;  4J8E A;  1E7U A;  3FTU A;  4CGW A;  5BUZ A;  4YFS A;  1ZHC A;  5J2T E;  2KC7 A;  3G2U A;  2GW1 A;  2R17 C;  2CE7 A;  2YQ8 A;  3I9W A;  4H9O C;  1H2U A;  2UY1 B;  3TXM A;  3SD5 A;  2E2E A;  4XBF B;  5JDQ A;  1Y8M A;  5ANL A;  5BV1 A;  3D9O A;  4NRH B;  3CHP A;  2ZLY A;  1ELK A;  1FMV A;  5FZS A;  2UY1 A;  4GZ5 A;  4WNK A;  2X66 A;  4UWH A;  3DPD A;  5T8I A;  3UT8 A;  5FJY A;  1E90 A;  3U78 A;  2OA5 A;  3RRC A;  1Z3Y A;  2KXP B;  1G8X A;  5AJL A;  4BA9 A;  4UIG A;  2WXO A;  4MKT A;  2HH7 A;  2XAF B;  3B7T A;  4UEL A;  2ILR A;  5AFU L;  2V5F A;  2CM0 A;  5BW8 C;  4GK0 E;  2LJL A;  5JR9 A;  5LJM A;  4EZ4 A;  5L3F B;  4ASK A;  5LGU B;  3UFE A;  3CVL A;  3QB2 A;  4I1O B;  4ZHQ E;  4IRU A;  3ZMT B;  2VSO E;  4GAA A;  3G2S A;  2YHC A;  3CKC A;  4QXH B;  4WBN E;  4PFP A;  4U8H A;  4IE0 A;  1UN9 A;  5DJQ C;  4U0Z A;  3MJX A;  4ANU A;  2LSI A;  4AKG A;  4AKH A;  4C0E A;  3ML8 A;  2VL8 A;  2VKD A;  3W15 B;  4CQI A;  5KX5 E;  3RRM B;  2XAG B;  3OYX A;  1NA0 A;  3RK6 A;  4EZH A;  5G05 J;  3BQL A;  3CQX C;  3FFL A;  2VGY A;  2FEZ A;  3LS8 A;  1UX4 A;  1A17 A;  4FUL A;  4PDX A;  5JDM A;  4H9P C;  2BUG A;  2WXL A;  2E9X B;  5M72 A;  3OJA A;  4AOF A;  1FCH A;  4HVB A;  3S7F A;  3RYH E;  4P0A A;  1JWF A;  4QX8 B;  3IEE A;  1INZ A;  2Z6E A;  1QUU A;  4P09 A;  4AY5 A;  3FY4 A;  4HOQ A;  2PM6 A;  2E9X A;  3O4Z A;  4EBA G;  4GYO A;  4EOZ B;  3SBS A;  4B8C B;  4GZD A;  4UWG A;  3S2A A;  4U72 A;  5DQV A;  1IJ5 A;  4HGA A;  1H19 A;  4KBQ A;  2NP9 A;  3KV5 A;  3E4B A;  2Q9Q B;  3KV6 A;  4I43 B;  4L9I A;  3PU3 A;  1QQE A;  3F57 A;  3TG5 A;  2PQR A;  5FQ4 A;  2WXK A;  2C5J A;  5A23 A;  4O4L E;  2MOZ A;  2Q9Q A;  3BG0 B;  5BV0 A;  2EHO B;  1H2V C;  4I43 A;  4ZI3 C;  3T5V A;  2AXV A;  2FI7 A;  4N2S A;  5HXE A;  5JDN A;  3NRX A;  3SRZ A;  3FU5 A;  2WXR A;  4HOT A;  2N2N A;  4G1T A;  2V7K A;  3RKV A;  1EYH A;  2EHO A;  2LEH A;  2E9X C;  3QOU A;  4EYU A;  4XKC A;  3CQC B;  4G26 A;  3BG1 B;  2W00 A;  2NXP A;  2CHW A;  3ZC1 A;  4PS8 A;  4J0U A;  1L5J A;  5LP6 E;  4AP2 A;  4EZK A;  5HWY A;  2VSX E;  2Y3A A;  4UVB B;  3LK4 2;  4U63 A;  2XAH B;  2BZB A;  3MV2 B;  3UUX B;  5DBK A;  3ESL A;  4APF A;  2XGS A;  2LHN A;  4KBM B;  3PRZ A;  3HVE B;  3MA5 A;  2IW5 B;  3JCK C;  5J1G A;  1UG3 A;  2R59 A;  3N2G E;  5A6C A;  2V7J A;  5L3B B;  1E8Z A;  5JQG E;  4O2A E;  3UUX A;  5FXX A;  3FTZ A;  1Y64 B;  3CVQ A;  1S0P A;  3HVE A;  3RYF E;  5KJK A;  3MA9 A;  2JRK A;  3ZYK A;  3I4R B;  5AEN A;  5CB4 E;  3LEW A;  3E22 E;  5AIJ A;  3N9O A;  5LG4 A;  4I6G A;  3TXN A;  4QWN B;  3I1A A;  3BQI A;  2QA7 A;  3HKC E;  2EHO C;  4DBR A;  5LX8 A;  2A5U A;  1B7T A;  2WMN A;  4Y6C A;  4KXK B;  4CRW A;  3CVP A;  5LGT B;  1KK7 A;  1OWN A;  3FUF A;  4PW8 A;  2DWG A;  2X9X A;  5BNW A;  2LOP A;  2I2O A;  4FJY A;  3ASG A;  3D9P A;  4O4I E;  4GPK A;  5LOV E;  4ANV A;  4ACL A;  3R7Q A;  3C4Z A;  2H7V C;  2PL2 A;  3L54 A;  5J90 A;  2UXX B;  5LYJ E;  4UV8 B;  3SS1 A;  3L17 A;  3UTK A;  2P58 C;  2BVL A;  3SF4 A;  4FLH A;  4CI1 B;  4BT9 A;  3CPZ A;  4GCO A;  2PQN A;  4G24 A;  1MMD A;  5G04 J;  2WXH A;  3VHL A;  2KAT A;  2XRY A;  4UI9 J;  2RP4 A;  1OWP A;  4ACK A;  1U4Q A;  1MQS A;  2P9B A;  3A5X A;  4DLQ A;  4HS2 A;  2NW9 A;  3KFW X;  2K9A A;  3PZD A;  4AXP A;  3N9N A;  1T98 A;  4QXB B;  3OXG A;  2I59 A;  2XPI A;  3FH7 A;  3PEV B;  4UI9 K;  5T4Y A;  3CWZ B;  3LDZ A;  3AB3 B;  3N9P A;  2VQ2 A;  2BF0 X;  5KJN A;  3MKQ B;  3MZL B;  3ZLI A;  2OVF A;  2BTD A;  3ANW B;  4ZS2 A;  4GA1 A;  5FXW A;  3U66 A;  5FXV A;  3CHO A;  2XGO A;  1LVK A;  1EZ3 A;  5AJD A;  3MKQ A;  3FWV A;  3I0Q A;  1SHZ C;  3IBE A;  3ANW A;  3ZN3 A;  4CDM A;  2ZM8 A;  3HA4 A;  1HE8 A;  2LAI A;  4AV7 A;  2MOW A;  4HOU A;  2DIW A;  3SGH A;  4GK5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...