1HFAA

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, pi(4,5)p2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
total genus 100
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hfaA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hfaA01
3G2TA 4Q96A 4AVXA 3RRUA 3ZYKA 1SZ9A 5J08A 1JWGA 3D9OA 2QY7A 2BF0X 3D9JA 3D9PA 2DIWA 1JUQA 3ZYMA 1VDYA 2KM4A 3D9LA 4GZDA 1H0AA 2LO6A 1HG5A 3G2SA 3G2WA 4FU3A 1JWFA 3ONLA 5LOZA 3ZYQA 1INZA 1HX8A 1MHQA 3G2UA 3LDZA 3ONKA 1LF8A 2L0IA 3D9KA 1EDUA 1DVPA 3CLJA 3D9MA 5CMWA 3D9NA 1HFAA 4GZCA 1JPLA 1UJJA 1ELKA 1UJKA 3ZYLA 4JXTA 4HFGA 3G2VA 4NACA 1SZAA 4FLBA 5LP0A 3D9IA 2MOWA 2L0TB 1XGWA 1HF8A 1PY1A 1X5BA 2DCPA 4Q94A 1HG2A 1EYHA 5CMYA 2V8SE
chains in the Genus database with same CATH superfamily
4ZXLA 3UUNA 5HXHA 5ANRA 5EX0A 1OUVA 3UMVA 3IF8B 2VL8A 4B3MT 3FBLA 3NOGD 3N9OA 4BA9A 1MMNA 2WVIA 3FUJA 4EPZA 4EB6E 3TWTA 3SWHA 3VU7H 4CCAA 2CCQA 3UT5E 4GAAA 2WXIA 1E7PA 2I1JA 1FT2A 4CGVA 1IAPA 3B7UX 3CKCA 4DUYT 4G8KA 3G2TA 1LTXA 3EHMA 2CBJA 1D1BA 4DR5T 3VRAA 3NOCD 1Y8MA 1H2TC 3FTYA 3LFMA 3Q75A 5FIOA 3AEDA 3RRNB 1MMGA 4X1KE 4UF0B 3IKOB 4G24A 3QOUA 4O4LE 3WXXA 1WR6A 5EX3A 3TAXA 1EDUA 2QFCA 2G0UA 3CVWA 2A3DA 4ABNA 3AXJB 1XNRT 2QYWA 1GQEA 4TNWA 4LNBA 2Q7FA 4IE6A 4YHHT 3ONLC 1Z3XA 4YJ3E 4PJJA 4H63H 3PVLA 3FTWA 2E0IA 5ABHA 4G63A 4BX8A 3IEGA 4GCOA 1H6PA 3BQLA 4UV8B 4DI3A 2KATA 1MMAA 2OVBA 3ZPOA 2I0MA 2AXDS 2X9HA 1PC2A 3KS2A 4EYUA 5AQIB 3WI3A 2BKNA 2LM2A 5ARFA 3VRBA 2IAKA 4IE0A 3UINC 2JMHA 3ULQA 3CQXC 3R9AB 5D0QD 5CMYA 3KD7A 3FUMA 2V1DB 2A5UA 4F53A 1BR4A 2IC6A 2VGXB 4CDNA 2M6IA 2WXFA 2EHOB 4BT8A 2FO7A 5JJ7A 2D9DA 1WFDA 3ZNGA 3PE3A 4BY6A 4JZYA 1QUUA 1E7UA 1XMOT 1INZA 4HWDA 3GZ1A 4XI9A 4HFDA 3OKQA 4CZ2D 3DTOA 3IA3A 3NRXA 2UUBT 4U95D 4OYJA 3RX6A 3NB2A 2IO3C 2VL0A 2OLTA 5LB7B 5JTGA 1NFIE 1OXZA 3EVYA 1SA4A 2R03A 4O4JE 2W0GA 1IBMT 2N2NA 5JMND 5FNVE 2C2LA 4UVAB 1CUNA 4U8YD 4F3VA 2ONDA 3QDNA 1TNYA 4OK0A 3DPDA 4ADZA 5FY7A 3ZMVB 3FZLB 1K1AA 4GK0E 1FMWA 4UI9J 3ZT7A 2JLBA 5AQVB 3KVBA 3U3WA 3M3ZB 4JB8P 4H63V 3RPUA 4IDOA 2V5DA 1IQUA 3ABME 2N9DA 4ANJA 1N34T 2ETAA 5BPPA 3N9NA 2J07A 2DZOA 4KVOA 3AA1B 4O8SA 4DV0T 4EOZB 4OVVA 4YJ2E 4LFCT 5ARGA 3RHWA 3K9IA 1E1HB 5C2TA 4AI6A 3UFEA 5AQJB 5DJQC 2X68A 3ZC0A 3P7IA 3U3IA 2RKKA 2XS1A 4TV8E 3SHFA 4HOTA 5BR8T 1LKXA 3ML9A 2BKKB 2JQKA 2IW5B 2NXPA 1PY1A 5G04J 4ZHQE 1J1JA 4IGUA 3QK6A 3T1YT 3PJAJ 2IMLA 5J2TE 2VSOE 2XQ8A 1B89A 4ANWA 4X8QA 4DR3T 1JUQA 5AQUB 4JI1T 4G8LA 2CWYA 2BKPA 4APOA 4L2LA 3E30A 5GONE 3NVOA 1HNWT 1FJGT 4YNDA 2L6BA 2V4LA 1UX5A 3DSXA 3LPZA 4C90A 5ENPD 3SFDA 4AM9A 3B5MA 3N9MA 3CVVA 3CVRA 1M62A 3CQCB 3PV0F 2ZM2A 3Q7AA 4J8YA 3CGHA 4AKLA 3I3NA 3ONJA 3MX3A 5JDQA 1IJ5A 3N71A 4GB9A 1OY3D 4EZJA 3HHMA 2VK9A 4LMKA 4C91A 4GKKT 4PW8A 1HFAA 2A4ZA 2BEDA 3LY7A 5G04C 4AY5A 2XQAA 3NZPA 2XM2A 3QK0A 3L39A 5IY5E 3JUIA 2VKHA 1EYHA 4ISSA 3Q79A 3U78A 2IFUA 3AA6B 3VHLA 5EK3A 3JUEA 4MFRA 2WMOA 1M7KA 2V26A 5CGMA 1BR2A 2M6BA 4JBWF 2KNDA 1TEZA 4RG9A 2LLYA 4HORA 4CI2B 4KHZF 3LYAA 4AQFA 5FP3A 2IJGX 1HR0T 4PS3A 3KSQA 2KMFA 1JCQA 2AXZA 4OAVB 4EECA 3E4BA 4N5CA 3FH8A 2MRIA 4F8HA 3BG1B 2CHZA 2XPZA 1YW0A 5T3RA 4FJYA 2K5BB 3CVYA 3AU4A 3AE8A 3ZW3A 5CCMA 2WQ6A 2PZIA 4GTQA 1O1RA 2XQ7A 4GTVA 4JUYA 3QWVA 3FU6A 4LF6T 4GZDA 5CJ5A 1HZ4A 4IL4A 4DV1T 3FUFA 2WB2A 2GRPB 2Y69E 4HOUA 1RZ4A 2J9QA 2Q9QA 4HI9A 3SD5A 2ACXA 2KCKA 3LK42 2W67A 2F8YA 4B89A 1N95A 1G73A 3C50A 3RC3A 1H2VC 4ZI3C 4HBDA 4GPKA 4HN9A 2YOEA 3HDXA 2XY8B 3ASNE 2X0YA 4MRUA 4TXPA 1WY6A 3CEQA 2OVFA 4PFPA 3MZLB 2V7MA 5D0OD 2XPYA 3KAEA 4C0MA 3OAWA 3S7FA 1SUMB 2YEVC 1HXIA 3UUMA 4TWFA 5G55A 4XE0A 3ULYA 5AENA 1UJJA 2DWZA 3TGOA 3ABVA 3I9YA 3RI5A 3O1IA 3AE3A 2XQ4A 3F6QA 4XBFB 4JPSA 5CEAA 3FTSA 2VKJA 5J1GA 5C1DA 2VGYA 5CA1E 3I4RB 2C5KT 2KC7A 1MNEA 5AQLB 2D0UA 3Q5MA 4ZZBA 1ZU2A 3L08A 5ENNA 2WQYA 5KX5E 3RLFF 1DCEA 2VQET 3ZFWA 3PDNA 2FEZA 3IV0A 2WU2A 3D9HA 2BG9A 2C5IT 2WZIA 3UM3A 4FLHA 4HRMB 1N52A 3SFZA 2X6HA 3HL6A 4K03A 2XQYA 4KMCA 4J8DA 2UWJG 2WB5A 3DXKG 2HM8A 2UXDT 1H0AA 2UXNB 3KFWX 2XEHA 3G2WA 1TYQG 3T8KA 4XX5A 2IONA 3LY9A 5CHEE 2ZM0A 3T1HT 4DK5A 5JDMA 4I1AA 2I2OA 2B76A 3W9FA 4IL9A 2KINB 5BV1A 4ANXA 3NZQA 2DL1A 4DVDA 1YA0A 2GRNB 3ZVVA 1KFYA 4NUUA 5LCWC 5HEJA 2IEJA 1UX4A 4ZHBA 3C51A 4PH4B 5BW8C 3HG0D 2D0TA 3I1AA 3TWQA 2VWAA 3TG4A 2F8XK 2AJAA 4C48B 4GYOA 2KZTB 3U64A 3C72A 1CHUA 2LEHA 4DV2T 3AVRA 5EK2A 4BX9A 1YXRA 5FXXA 4MS6A 4KP3C 5LGNB 3IEEA 4DLQA 3RO2A 3BK9A 1D8DA 5JA4D 1QLBA 1KT1A 3MZKB 2BKOA 4YLHA 2XPKA 2PFVA 4K5BA 5EYPF 3AE9A 5H6RB 1N11A 2UXBT 4GMRA 3RIFA 2LJLA 1OEDC 2CHWA 4AQFC 3ZCJA 3RRUA 4TUYE 2XQ6A 3CHPA 3AG4E 1S64A 4J6IA 3QWWA 3LS8A 2LXMA 4FJOA 2PM6A 3DRAA 1UG3A 4O4IE 1TR4A 4E85A 4P09A 4YDYA 3ZU7B 1W0BA 4HFIA 1H6OA 3PZ2A 2ZGGA 1XZYA 1KNPA 2XGMA 3QC1A 4LNGA 3S7JA 2H89A 3L54A 3C64A 5AQPB 4HKAA 2DWKA 1MX2A 2ZGDA 3R7RA 4LFBT 4TZ4C 3DBSA 1UGOA 2LSGA 1N0RA 2L6JA 3OYXA 2Q9QC 4AJWA 4HWHA 2M67A 1H6KA 3Q5XA 1U5PA 4JYAT 4N2QA 2IU1A 3WG7E 1LD7A 2E9XB 2X0HA 3N9LA 2UY1B 1IXVA 2V6YA 1MJ0A 3UU4A 4PJNA 2JABA 5FQ7A 3L8RA 3PTRB 2CEAA 4IE7A 3Q9DA 3ZT6A 4U2ZA 2LSKA 2KZTA 3NKZA 5KNHD 3UM1A 3C3OA 4ILIA 5KJLA 4PS7A 4PJLA 2X6KA 1HX8A 3FWVA 5HCMA 3Q4AB 3D9KA 2AXVA 3MV2B 2PL2A 2D5UA 2DNXA 2MTQA 4U7IA 2X6FA 4ZS3A 3AS5A 3F57A 3UKUG 1OCOE 3UXGA 3J5PA 4CDRA 4ZI3D 2FF4A 3I0OA 3N9PA 2DZNA 3CKBA 4EQFA 3FUHA 3TWUA 5L3DB 2LUHA 3ASFA 4G2AA 5C8YE 3LCAA 2LRLA 4YSXA 4NPPA 1VOMA 4DV7T 3LXUX 5BNWA 4L7TA 4TUUA 4AQGA 1T98A 1FIOA 4UR9A 4ILAA 4ACKA 1XNQT 2CLYB 3PUQA 3ZC1A 3JCKC 2CRBA 4I55E 3JC6D 4K0UA 4K5AB 4ILUA 3MYVA 4EEBA 3C5RA 4Q69A 3AE4A 2HN2A 2WXOA 5LHIB 3UU6A 2H88A 5LA6E 1FPPA 4FADA 3ZPJA 1DC2A 2CG3A 4QH4A 2BBHA 2LHRA 1LF8A 3P1UA 4NQ0A 1QSDA 3B7RL 4J0UA 4GYYA 3PEVB 1WM5A 3Q9NC 3O4XE 2VTBB 5LFAA 3G06A 1E8ZA 1OWLA 2E2EA 3PUJA 2WS3A 3L22A 3C4ZA 3PURA 3PUXF 2DYRE 4G2VA 4KBQA 5JJ6A 2XQ0A 2V8SV 2H6HA 3P4RA 2VTBA 4OX9T 5LOZA 4QXHB 4BSXA 4BT9A 3JCFA 3HKDE 3FP3A 1H2UA 2HH7A 2VVSA 5F8PA 4IRUA 2EHOA 4I4TE 1YKEB 2XPIA 4L1BA 1UCUA 5EILA 3Q5WA 2IDOB 3OYZA 3PZ4A 4UF0A 1HG2A 4ERRA 3IBEA 2PBIA 2CBIA 3AEFA 1ZBPA 2WP9A 5EK4A 5J08A 1OWMA 4X66T 2GGFA 2YU2A 3LY8A 3ML8A 4UWKA 3E0ZA 2ACZA 2PTFA 4MBGA 4N3BA 3OTNA 4LRZA 3UKRG 5LNKA 4H9RC 5CEDB 2Y4TA 3CX7B 4ANUA 2WM9A 3L13A 3TLWA 3AEBA 3E08A 4ZOLE 5LP0A 1E2AA 3FB2A 4PFOA 4I43B 3JADA 3UIPC 2CMRA 4TUMA 3FTUA 4UQZA 2P9SG 3RKVA 3ZYQA 4LF5T 2VQ2A 4UWFA 3CPZA 4YFSA 1FCHA 2ZISA 2KWIB 5T8IA 5JDHA 5J0ZA 4F1PA 4UWLA 2HPLA 4A56A 1QZ2A 3LJNA 4NXNT 5LP6E 2CFZA 3AS8A 4ATZD 4F1SA 4NIKA 3CVQA 3G2UA 4YXDA 1N9AA 2P58C 5DQWA 2NTXA 4ZI2C 4IULA 4PK4A 4XZCA 1O5MA 2UUCT 4WBOA 3L9TA 3UFGA 3G2VA 5IYZE 4COFA 4E7SA 5HWXA 4I9CA 4DMVA 5EIBE 4X5TA 4WNEA 5FQ6A 5JJTA 5AYWD 4GA1A 1ZB1A 4O2AE 4GOUA 2I59A 4ILGA 4U0UA 5FYMA 1QYMA 2GRLA 4YT0A 3C98B 3R7QA 2CXLA 4OHFA 3PH0C 2J1DG 1W9RA 4MLKA 1FVFA 2FBNA 4XIFA 1KK7A 2H7VC 1ZV4X 5KJNA 3OXFA 5B1AE 4JI6T 3MGBA 5JH7E 5LG3A 4LF8T 3ESLA 4B8AA 4PS8A 4M7CA 2BG9E 1MIVA 4KUMB 4PNIA 2L0TB 5LGUB 3FH5A 4Q96A 5FVKA 3R9MA 4A1GA 3APFA 1VDYA 1JNZA 4AKGA 4QH1A 5DIZA 4WW0A 2CM0A 1LRZA 3ONKA 4IDNA 1KZOA 4Z90A 3ULEG 3MKRA 5HQ8A 2PQRA 2CLYC 2ETBA 4ACLA 5CFBA 4QXBB 3VR9A 3GYZA 2GRRB 2DCPA 2V4HC 3IHYA 2RG8A 2PG8A 3MKDA 4R7LA 5FZQA 4H7YA 4XI0A 5AQ7A 4ILHB 2IOSA 4YVOA 2UUAT 2HO1A 1KNZA 2ZMAA 1W3BA 5HAXA 2FBWA 4DPRA 2A5EA 1MX6A 5FL0A 2MOZA 3KBUA 5LCYA 3F31A 4L9IA 5FMNA 3UU5A 4BJMA 1TNOA 2FO1E 3NZSA 3CIRA 2WU5A 3W15B 2LNIA 3I9WA 1BI7B 5JREA 3LSVA 1EZ3A 4LEUA 1Z8UA 3CVPA 3FDHA 2EHOC 1DCQA 1KF6A 2UU9T 2R6GF 3P50A 1BPOA 3D9JA 1MIWA 4CI3B 4HOQA 4AISA 3SRZA 5M4YA 4IIJE 3PZ3A 4FU3A 3HYMB 3VR8A 1HNXT 3FUKA 2I1KA 4U7EB 3S2AA 2XAFB 2X38A 1UOHA 3D9MA 3EDTB 3ONXA 5BXUA 3CK8A 4OVUA 4ATGA 2VSYA 4GTMA 2WXLA 3FFLA 3BQIA 4U8VD 3HKBE 2Y48B 4NXMT 3X1DA 2K3WA 2WDQA 4IE4A 3UULA 4YHJA 4IDPA 3MACA 2X51A 3D9PA 3MEKA 3K3QC 4JV5T 5AQRB 4QKNA 1QQEA 2BVLA 3AA0B 3EHZA 1EF1C 1NL4A 2YDRA 4EV6A 3CVUA 3ETUA 3UQ4A 1DVPA 4FHJA 3K3NA 4GZCA 5ITZF 4BTAA 2NW8A 5LG4A 3D0TA 3UTMA 2BUGA 3LJ3A 4UI9C 1IYGA 3RF1A 5A7DB 4U31A 2QY7A 4HRLA 2CHNA 4N3AA 2FJBA 3ZCIA 1TN7A 2AXUA 3Q5DA 4OYSA 4BSZB 3AAAC 1T7SA 3V5SA 1RW2A 4I43A 3TWSA 3PJAA 4DIDB 5AQAA 3ZYLA 2L8KA 3UTKA 3WAKA 3ZJ1A 3ZXSA 1JCRA 3FU3A 4AXHA 3RU0A 2KXPB 1P5QA 4B94A 3VTXA 1XWMA 4I2ZA 2XQ3A 2E9XA 5JDLA 4GCNA 4GMJA 5FWQA 1LD8A 5C2YA 2WMNA 3P4SA 4Z91A 3ZSTA 3FUIA 2AW6A 2IHR1 2FI7A 2BS3A 3HXDA 3B57A 2J49A 3ZKJA 4CZZB 3ZMZB 5L47A 3CX8B 3ZRHA 3T8MA 2YKSA 3BG0B 4EZHA 3CVNA 2LAHA 4WBNE 1LVKA 5JR9C 4MLPA 3L09A 4P0AA 1J5WA 2UXCT 2XASB 3IXEA 4GYRA 2LHNA 5AQTB 2ODUA 4YVQC 3SZ7A 2XSAA 5ENTD 2ZU6B 2W00A 2XZTG 2Y0BG 1YQ4A 4ZI2D 4TXRA 1N36T 2K48A 2YDSA 1X9BA 4GZ6A 1NEKA 3RIAA 3TWXA 3FEXA 3ABLE 4NIQA 3U66A 1IQRA 3DSUA 1HF8A 4HEAA 4DNDA 4EAHA 4L9PA 2MBGA 5L4EA 3NZUA 5AQHB 4JEUA 3U9WA 1HNZT 2BVMA 4YTMA 2ZM6T 5BXOA 4DBQA 1HCIA 3V5UA 3BEEA 2Z6EA 4K0RA 4HFEA 3ZHEB 4YDWA 1FVHA 4I6GA 4QXCB 4JA9A 4ZEYA 1OXJA 1UW4B 4WYVA 2NYJA 2RFMA 3PRZA 4KT6B 4HS2A 4PK5A 2CE7A 4KI0F 3Q78A 2CPTA 2EIKE 5JHBA 3EUVA 3DSTA 5LX8A 1JNRA 3PE0A 1YCSB 1NZNA 2LSVA 3CHRA 5CA0E 3Q15A 2R2LA 4GZ5A 4DR1T 1G3NB 4UELA 1O1SA 4H9PC 3CV0A 1SW6A 1AP7A 3ANWA 2H7OA 4U04A 3RJVA 3MJXA 3HVEA 3MA5A 5KCMA 4X64T 3C98A 3C4XA 3L82A 3RQUA 4GYSA 1HTJF 3N5LA 5FZRA 1IJ6A 4A98A 3R6NA 2ES0A 1L5JA 2BS4A 5J2UE 4J7WA 1TNBA 2J8SD 2V5FA 2XQ5A 1QNFA 2VGEA 1NA0A 1E8YA 1Z5SC 2P9BA 3HKEE 2XRYA 3FEYA 3OBVE 5DQVA 5AJDA 2WXPA 1ZP0A 3FBZA 3UUXB 3P8CD 4HWFA 3DEPA 3ZMTB 2C5JA 3CSTA 2CHOA 5L3CB 1UJKA 4AEZC 1FT1A 3VLFA 4DX1A 4JHRA 1O3XA 2NOXA 4Y6WA 3QOFA 4P29A 4GK5E 4CXWA 3HRAA 3ISMC 4JVSA 2FULA 4IDZA 1BI8B 3AB3B 3DEOA 3FUDA 3JC6C 3ZYMA 4KYOB 5JDNA 2AE9A 4K5CA 4GU5A 2JIWA 4O1OA 2MYOA 4LERA 5IWAT 1U3CA 1BLXB 2E9XC 1YQ3A 4FJZA 2OA5A 2C0LA 4EGWA 4CT0A 4B3TT 5ABFB 1IBLT 2XQ9A 1KZPA 3CK7A 3EHNA 3EDVA 4U3CA 3RIUC 5JDFA 2XZDG 3L17A 4P1NA 4AQYT 1TN6A 2XHEA 3ASHA 2BG9B 2DIWA 2V6YB 5JR9A 4B3ST 3CHMA 5ENQD 2J4DA 3JQ1A 3Q73A 5HI7A 2B0OE 3HVEB 3OXLA 5LXTE 3I4GA 2W63A 5HXSA 5AFUL 3A8YC 3LBXB 3TXMA 4UQYA 4AIFA 4M1PA 1OEDE 2I6HA 5JR9B 2WXHA 5ENSD 3CVXA 2MOWA 1KPSB 1X79A 1TJCA 1OCCE 3UM2A 2WPVA 2DWGA 1HU3A 1WG0A 4WUYA 3CX6B 4U72A 3V30A 2Y4UA 3RYFE 3DXMG 3L6AA 4H9QC 3PS6A 4JEHA 3UU3A 2Q9QB 3CHSA 2R05A 4KVMA 3CVLA 5H7PA 4HLLA 3SGHA 2JMKA 4B93B 4QWNB 4V1Av 5IHYA 5JVDE 1S0PA 4A55A 1IKND 1ZKEA 1Z6TA 3RRMB 2WXMA 4LMLA 1OWNA 4HVBA 1UN8A 5LJNA 4PDXA 5L2LA 3CWZB 3CQGB 3RYCE 5F5WA 5T4YA 4F7AA 4CN1A 1S35A 4DO0A 3PNTB 3ONLA 4TNVA 3PUAA 4JI8T 2CFUA 5JDGA 3TXNA 2BZBA 5HKPA 1MX4A 2SPCA 1BU9A 4GIWA 2BTDA 2XJ7A 3ABKE 5A23A 4L2YA 3LG7A 3TKLB 4Y6CA 4AY6A 4FA6A 3KDSE 3ESKA 5G05J 4ZZCA 3MK7C 4QX7B 4U96D 1D1CA 3AU5A 3RRWA 2IOLA 5FINA 4GTTA 3RO3A 1G8XA 1NI1A 3UI2A 5KNGA 2KSRA 1H19A 2WXNA 5FXWA 4GA2A 3Q9UC 4AOFA 5FQ4A 4GYWA 4IHJE 4DR6T 3O48A 2XSBA 2XEVA 3TLTA 2CWOA 4UQXA 2W62A 4GMLA 1US7B 5FVLA 3LK3B 4CRWA 5LMNT 4CI1B 2P9IG 4TXQA 4IT4A 4QFVA 2WWUA 3AE1A 3G2SA 2RD0A 2V0PA 4GA0A 5AQFB 2RP4A 1XMQT 2CG2A 4JHJA 4HFHA 2N1GA 4EIWA 4I1MA 1EPUA 2H3RA 2VASA 3SFEA 3PUGA 1HS6A 2R59A 4KXKB 3O4ZA 4WWNA 1S94A 4HE8A 1IBKT 2MPKA 4YSYA 3KV9A 4RLYA 4U0SA 4Q25A 2XEEA 3D9OA 3T5VA 2ODVA 3TWVA 5FKYA 3I5PA 1Z0PA 2V7LA 4M3OA 4NRHB 5JRCB 3MXZA 2QYJA 4OFZA 2YK0A 3AAAB 4HB5A 4GTOA 5D66A 1B7TA 3AECA 1WAO1 4TWDA 2MYSA 3AEEA 4XEIG 4GTPA 3TLSA 2AWIA 4B8CB 4DRXE 3URZA 2F4VT 3E37A 1LVFA 3H3MA 1K3ZD 3SFYA 5AAOA 4A63B 3B7BA 4PAGA 4EZKA 4DX2A 4O1PA 4MHCA 4U2YA 2ETCA 3PZDA 4KHPT 5CCLA 4NURA 3KVAA 5CBOA 1UUSA 5HCJA 3NBXX 3NRYA 4CXXA 1Q2ZA 2LKGA 1ZOYA 3UPVA 4B6XA 2CHXA 2LRKA 5AQOB 1WLXA 3FZKB 1JPLA 2WDRA 3J7Yq 1OWPA 4EHMA 4NACA 2RPAA 5AQSB 1YD8G 3FHEA 4YDEA 4B0ZA 2R02A 1SA0E 2DYSE 5EDSA 5DBKA 1KEYA 2DHRA 2VB6A 3WAJA 3FY4A 3B7SA 2VYIA 2I9CA 3V2XA 2CXFA 2XAJB 1VCSA 3V31A 1OCRE 4I6EA 4DLOA 3LDZA 3DSWA 5LJMA 4JI2T 3FULA 3CHQA 4UVCB 5KDMC 3E32A 5FY0A 4U07A 4Q94A 2X66A 4AKHA 3PE4A 1HX1B 3AS4A 1D0YA 3PDYA 1ZEEA 5ETWA 3GA8A 3FXDB 3J9X1 3VLEA 3B13A 2GRQB 2GRMA 3BUAA 3RQWA 3K3OA 1OCZE 3EU9A 4GTRA 2X9YA 3CK9A 3FZFB 4N5QA 2X6IA 3GN5A 3P4PA 2WWVA 3RKOA 3LEWA 4ZFHA 3CIAA 4AXPA 5JHAA 2M63A 3QWPA 4BESA 5KXJA 2V5CA 4A5XA 1DNPA 3ENEA 3HXEA 4TN7B 4FC8A 2PNNA 5DABA 5L3FB 1UN9A 2UXXB 1JWGA 4HXIA 3P4QA 5LOVE 2IIUA 3TLVA 1H7CA 2L9QA 2J08A 2GW1A 3ZSSA 4UIGA 1OEDA 3CMLA 3RIBA 2LOPA 3NWIA 4JI5T 3APDA 3EIQC 3UT7A 5C3JA 4WNGA 3D9NA 1KLXA 5L3GB 4JI7T 3Q49B 3IBPA 5HEUA 4V3IA 2NW7A 3NF1A 4GZ3A 4WWPA 2LOSA 1ELRA 2LM9A 1V55E 4UXNB 3AJIA 3UQ7A 3HXBA 2BDEA 2RA1A 4EBAG 4WZXA 5HEOA 3JAEA 2A2FX 3AE6A 2YQ8A 4N39A 2LSUA 4MKTA 4U63A 2XHEB 2YU1A 5ADXL 4HFGA 2J09A 4HFCA 2J4BA 3AEGA 2XENA 5B3SE 2XM1A 3UM0A 1FEWA 2XAGB 1K1BA 5FZSA 5A1LA 3ZJ2A 4N3CA 2W61A 3PZ1A 3JAFA 1HS7A 3EABA 2WQ7A 4K0KT 4YDOA 2R5SA 3Q47B 3NAWA 3PNLB 4KMOA 3KSLA 1SVXA 2OCCE 3ASGA 3TG5A 4EYYR 2P9PG 2WBLA 3JYSA 3LK2B 3T5XA 4CN4A 4G1TA 4YTPA 3MV3B 5HYAA 4JXTA 2QRXA 3OTOT 1SZAA 2RFAA 4TRQA 2L3LA 3OJAA 3CHOA 4JA7A 3QB2A 5AQKB 4W9RA 4RVBA 4DV3T 3FUNA 2CXDA 3FU5A 4J2CA 3P2BA 4WAFA 2E5VA 4CEMA 2BG9C 2MAWA 2OV9A 4CT4A 3VTYA 1X81A 1MHQA 5FY1A 4CXYA 4G11A 5CERB 1K8KG 3HXCA 1XDOA 4H7XA 1TN8A 4OAUC 2IO2C 2LXLA 5ANLA 2VGXA 3SF4A 3ETVA 2OOEA 2WSSV 3RYIE 4WNKA 5LHHB 5KJKA 4EZ4A 4AVXA 4N78D 4TV3A 2VSXE 2WAUA 5LMUT 3MCXA 2QC9A 2XAQB 4BERA 4CQIA 3TL5A 2JPFA 2R17C 1A17A 2ZIRA 5AJLA 3LVQE 1S70B 1UK5A 4H9OC 2FUPA 4UWGA 3ZN0B 1QBQA 3MA9A 4LG6A 3FXEB 2WCAA 4KBMB 1N4SA 1MIYA 2KT9A 4DX6D 2V6XA 5AQNB 3HI2A 4GTSA 3N9QA 3UT8A 3CKDA 2NWBA 3W9GA 2FJDA 4LF4T 2KXPC 2YHEA 2WDVA 2X9XA 5HEHA 3PUSA 5KWDA 3F2EA 4IE5A 3QNKA 1D0ZA 3QB5A 4DV6T 3QC9A 5E76A 3VKHA 5FXZA 2JQ9A 1GW6A 5KJMA 3DP7A 4RSYA 2V7KA 4WWOA 3ZMUB 2IY0C 1N4RA 2HE0A 1VRBA 4CGWA 2X0LB 2XGSA 4PUCA 1OT8A 3RSEG 3QB5K 5HXRA 4QQIA 5LYJE 1VCTA 4YY3T 1X5BA 2Y6XA 3PU3A 4O2BE 2J4GA 3O1HA 3GN5B 1JCSA 4DUIA 4DX7D 1O1TA 4URKA 3PUZF 3ZKRA 1HG5A 3NQPA 3GMIA 1YMPA 3ZT5A 4YTNA 4FHKA 3EU5A 3AE7A 4TV9E 3FTXA 3QARA 2BBJA 1XDPA 2HN1A 1U2VG 3BQOA 4GKJT 3LVRE 2VKOA 2IQCA 5L4HA 3O1JA 5AARA 3AG1E 5BT1A 4GPMA 3PUWF 5BMVE 4IYPA 1XNFA 3LKUA 3SFXA 5JQGE 2XZEA 4E6HA 2KLQA 4NUVA 4HWIB 2PQNA 3D9LA 3SQVA 2K24A 4LFAT 2VSNA 2FJEA 1U3DA 2LSIA 3HXFA 2NTYA 4DV4T 5BUZA 3ZLIA 2NSZA 3RK6A 4HWCA 3RC8A 3AAEB 4BJNA 2OEVA 4E7ZA 1YYHA 2JJ9A 3CR3A 5B1BE 4UVBB 3MKQB 1Y64B 2XTLA 3CSFA 5D2MC 4OYKA 4D10C 3ASOE 3TJPA 2PM7A 1D9SA 1R8IA 2H6IA 4H9SE 5HS0A 4ANVA 2V7JA 4XAXB 4J8EA 4BEPA 4UEMA 5HWYA 4AV7A 5FQ8A 2BS2A 4LF7T 3UT4A 4RG6A 4U0ZA 2EIME 4HFVA 3Q2MA 5FXVA 3DSVA 4JD2G 3PU8A 4H9NC 1N0QA 1DU2A 2H6GA 4B3RT 4DR7T 2QGSA 4ILCA 3EIJA 3KEZA 2HYZA 1S63A 1N4QA 2WY2A 2QA7A 3HKCE 3RRCA 2V8SE 3PREA 2EQXA 4AKIA 3FZMB 1MQSA 4U7YA 1OEDB 3EUHA 3P4WA 2EIJE 5KBAA 1IZNB 3OVUA 4I6JA 3RYHE 1WRDA 2HR2A 2QYUA 1IHBA 1Z3YA 2PJQA 2W2UA 2V5QC 4X62T 4JEUB 4ASKA 4DBRA 1SHZC 1MYOA 2KBXA 3Q5EA 4JI4T 2DVWA 4DI4A 2Q9QD 1V54E 3GZ2A 5LCWJ 3FU0A 2ZLYA 5LBQB 4ZI7E 3AXJA 4YSZA 3FZHB 3AVSA 3N2GE 3FUEA 5AQ9A 1JWFA 4DV5T 2WXKA 2FJAA 3AE5A 5AQQB 1HO8A 3ZN3A 4HOSA 5FT9A 4EZLA 5M72A 4TWHA 4C0EA 3FTZA 1D8EA 3LJCA 3AG2E 2HPJA 2B1EA 1W0AA 1W09A 4G26A 2C0SA 3A7MA 1XGWA 3JXIA 2EILE 1N94A 1T8BA 2NR4A 4FULA 4CDMA 4MALA 1MMDA 1SZ9A 2IF4A 4HTEA 1YKHB 3EJNA 1BR1A 3C4WA 5HXEA 1PAQA 2LT3A 3RGLA 5CRUA 2DLRA 1NENA 2XUEA 3A5XA 4I1OB 4IREA 3QKYA 5EZYE 2L0IA 3KINB 2LSJA 5ENRD 1TJFA 3AEAA 2YHCA 5LBMA 3IHVA 3TWWA 1J5ET 1I94T 1ELKA 3K8PC 4J8FA 4LUNU 1N4PA 4AP2A 4O60A 5EYLA 3QUJA 5G05C 2LKHA 1SA5A 2CA5A 4BWRA 4JI0T 2KZ7B 3E33A 5FTPA 2X67A 1ZHCA 2DI4A 4HRNA 3JXJA 2WQHA 3PEUB 2JRKA 1SQMA 4EBAA 4BAYB 1I6ZA 1KNRA 5E0OA 3AG3E 2EINE 3Q7FA 3QNUA 4U8HA 2E8IA 3B95A 3E34A 2ILRA 4XKCA 2LE8A 5L3EB 4JC8A 2YINA 5CECB 2E5LT 3FTVA 2KCVA 3SBTB 3UQ3A 5HXCA 3VLDA 3TLUA 5ABEA 2LAIA 2P9KG 2H6FA 4A3TA 3SOLA 3ZGQA 4UUCA 3QAQA 3SY2A 1WYBA 4N2SA 3BQKA 4DJAA 1D0XA 3C3QA 4ME2A 3DSSA 4MBQA 5H6QB 3IHRA 1A5EA 4WNDA 5HRYA 4DX5D 1OWOA 3R84B 1SE7A 3KV5A 3PUYF 2LSYA 2DCFA 1NA3A 5EKQD 5E75A 4FLBA 2WXJA 4ISTA 1E8WA 1E7VA 3D9IA 3AA7B 2JQHA 3CK6A 3J5QB 3ZXPA 5J90A 3C3RA 1L0VA 4JL0A 4P0BA 3VKGA 2BKGA 4F6RD 1BR0A 4Z8XA 2BF0X 4HFBA 4DR2T 3DJBA 5LGTB 4CN6A 2WXQA 1MZCA 3MJWA 5HEGA 3O9XA 5ABGA 4G23A 4RQIA 2KWHA 1NP7A 2DBAA 4UV9B 4BETA 2OEWA 4I2WA 4X1IE 2JQQA 5EIDA 1Y01A 2GK9A 4JEHB 3ZN1B 1BD8A 2X6JA 3EHRA 5FJYA 3OPCA 3ZEFB 2NC9A 3AE2A 2X3MA 5CB4E 4LF9T 4JLEA 4ILBA 3X2QE 1V9DA 1IHGA 4I9EA 4TX5A 3S7BA 1AWCB 4U33A 1TNZA 1U4QA 3KEAA 4DMWA 3UUXA 2OV8A 4QH5A 2XRZA 2JEKA 3I0QA 5BV0A 3BU8A 3ZEFA 1AJ3A 4UWHA 3SO8A 4HI8A 3FH7A 3V2OA 3UU8A 3EAMA 2W4XA 4HLEA 2J62A 2EHOD 2E9XD 5F3JA 3QJZA 4I17A 4FI5A 2XS8A 5FL1A 2YN6A 5EN5D 1N32T 5KMGP 5AN8A 3EDUA 1N33T 4A3VA 4EEDA 4HQDA 4AKRB 4KX6A 2LO6A 2W66A 5AQMB 4HGAA 2P2CP 1ELWA 4JI3T 1FMVA 3U4TA 4DUZT 3CLJA 5CMWA 1HE8A 2F0YA 3EI0A 2QZAA 3ASDA 5L3BB 3EHQA 1E96B 2WXGA 2L9BA 4LMJA 4L0RA 2VJ8A 4LNUD 5G2NA 3UX4A 3MKQA 4KZ0A 4Z68A 3L16A 3LDQB 4IDQA 4X20E 3ZUVB 3T8OA 3DWLG 3E22E 3ZMSB 2KM4A 2P9UG 4FP7A 1HH8A 4APFA 4JW1A 4XZ4A 3DPYA 1WR0A 1E90A 4QX8B 3GW4A 4G25A 2E2AA 4X1YE 1Y6IA 3JQ0A 2XGOA 4JHKA 3PUKA 5IUXA 2VURA 2WXRA 4CYMD 2HHHT 2K9AA 4A1SA 1TNUA 2F37A 5ENOD 5AQBA 1MNDA 5CBNA 3APCA 4J8SA 4PK6A 4LSZE 3KBTA 1NAFA 3H3AA 4UI9K 2A72A 1KT0A 4EXTA 4O4HE 5A6CA 4O6FA 2IUBA 3FHNA 4I50E 5AQGB 3S7DA 3KV4A 4HNAD 4WNFA 3RAUA 3GWHA 3KV6A 2VKDA 2V7IA 2KCLA 2ZXWE 2NW9A 2P9NG 3PUVF 4C9BB 4QHOA 4ZS2A 2Y1LE 4BFRA 3SNXA 3S4UA 5JRCA 4I0UA 2XCBA 1NWMX 3H37A 3D3MA 3UUBA 4LCTA 2MHKA 2QVAA 4U74A 3ZYKA 3K1SA 2GROB 2XAHB 3N2KE 3M65A 5LHGB 2VVNA 3UIOC 5TAOA 1D1AA 4L5GA 2P9LG 3L3PA 3RKGA 5ABFA 3SS1A 3HR0A 3ZHEA 3GZSA 2Y8DA 2AVPA 3NBNB 4AIUA 3N2OA 4KZCA 2J47A 4IN3B 3HA4A 5AIJA 3HIZA 2D2SA 2ZM8A 2A9UA 2YNQA 3SBSA 3SI5A 2NP9A 1T72A 2VQFT 4DR4T 2IC9A 5CRVA 3LBXA 2UY1A 3TWRA 3ANWB 3OXGA 4BTBA 2Y3AA 2X9WA 3AAIA 2XCCA 3T9KA 1WCRA 4PJMA 3B7TA 4L23A 3RIUA 1E8XA 4A97A 2YDQA 3RH3A 1N54A 1WDYA 4XKBA 4F6RC 3V79K 3ZIMA 1OWAA 2WZHA 2C0MA 1UURA 4X65T 1WYCA 2B6CA
chains in the Genus database with same CATH topology
3UUNA 5HXHA 5ANRA 5EX0A 1OUVA 3UMVA 3IF8B 2VL8A 3FBLA 3N9OA 4BA9A 1MMNA 3FUJA 2WVIA 4EPZA 4EB6E 3SWHA 3VU7H 4CCAA 2CCQA 3UT5E 4GAAA 2WXIA 2I1JA 4CGVA 1IAPA 3B7UX 3CKCA 3G2TA 3EHMA 1D1BA 1Y8MA 1H2TC 3FTYA 3LFMA 3RRNB 1MMGA 4X1KE 4UF0B 3IKOB 4G24A 3QOUA 4O4LE 3WXXA 1WR6A 5EX3A 3TAXA 1EDUA 2QFCA 2G0UA 3CVWA 2A3DA 4ABNA 2Q7FA 4IE6A 1Z3XA 4YJ3E 4PJJA 4H63H 3PVLA 3FTWA 2E0IA 4G63A 4BX8A 3IEGA 4GCOA 3BQLA 4UV8B 4DI3A 2KATA 1MMAA 2OVBA 3ZPOA 2X9HA 1PC2A 3KS2A 4EYUA 3WI3A 5ARFA 2IAKA 4IE0A 3ULQA 2JMHA 3CQXC 3R9AB 5D0QD 5CMYA 3KD7A 3FUMA 2V1DB 2A5UA 4F53A 1BR4A 2IC6A 2VGXB 4CDNA 2WXFA 2EHOB 4BT8A 2FO7A 5JJ7A 3PE3A 4BY6A 4JZYA 1QUUA 1E7UA 1INZA 3GZ1A 4XI9A 3OKQA 3DTOA 3NRXA 4OYJA 3RX6A 3EVYA 1OXZA 4O4JE 2W0GA 2N2NA 5FNVE 2C2LA 4UVAB 1CUNA 4F3VA 2ONDA 3QDNA 4OK0A 3DPDA 4ADZA 5FY7A 3ZMVB 4GK0E 1FMWA 4UI9J 2JLBA 3KVBA 3U3WA 4H63V 3RPUA 1IQUA 2N9DA 4ANJA 5BPPA 3N9NA 2J07A 4KVOA 3AA1B 4O8SA 4EOZB 4OVVA 4YJ2E 5ARGA 3K9IA 1E1HB 4AI6A 3UFEA 5DJQC 2X68A 3P7IA 3U3IA 3ZC0A 3SHFA 4TV8E 4HOTA 1LKXA 3ML9A 2NXPA 2IW5B 1PY1A 5G04J 4ZHQE 4IGUA 3QK6A 5J2TE 2VSOE 1B89A 4ANWA 1JUQA 2CWYA 4APOA 4L2LA 5GONE 4YNDA 2V4LA 1UX5A 3LPZA 4C90A 4AM9A 3N9MA 3CVVA 3CVRA 3CQCB 2ZM2A 3CGHA 4AKLA 3I3NA 3MX3A 5JDQA 1IJ5A 3N71A 4GB9A 4EZJA 3HHMA 2VK9A 4C91A 4PW8A 1HFAA 2A4ZA 3LY7A 5G04C 4AY5A 3NZPA 3QK0A 3JUIA 2VKHA 1EYHA 4ISSA 3U78A 2IFUA 3AA6B 3VHLA 5EK3A 4MFRA 2WMOA 2V26A 1BR2A 1TEZA 2KNDA 4RG9A 4HORA 4CI2B 3LYAA 4AQFA 5FP3A 2IJGX 4PS3A 2KMFA 2AXZA 4EECA 3E4BA 4N5CA 3FH8A 2MRIA 3BG1B 2CHZA 2XPZA 1YW0A 5T3RA 4FJYA 2K5BB 3CVYA 3AU4A 3ZW3A 5CCMA 2WQ6A 2PZIA 4JUYA 3QWVA 3FU6A 4GZDA 1HZ4A 3FUFA 2WB2A 4HOUA 2J9QA 2Q9QA 3SD5A 2ACXA 2KCKA 3LK42 4B89A 1G73A 3C50A 3RC3A 1H2VC 4ZI3C 4GPKA 4HN9A 3HDXA 4MRUA 1WY6A 3CEQA 2OVFA 4PFPA 3MZLB 2V7MA 5D0OD 2XPYA 3KAEA 4C0MA 3OAWA 3S7FA 2YEVC 1HXIA 3UUMA 5G55A 4XE0A 5AENA 1UJJA 3TGOA 3I9YA 3O1IA 4XBFB 4JPSA 3FTSA 2VKJA 5J1GA 5C1DA 2VGYA 5CA1E 3I4RB 2C5KT 2KC7A 1MNEA 2D0UA 3Q5MA 1ZU2A 3L08A 5ENNA 5KX5E 3ZFWA 3PDNA 2FEZA 3IV0A 2C5IT 1N52A 3SFZA 2X6HA 3HL6A 4K03A 2XQYA 4KMCA 4J8DA 2UWJG 2HM8A 1H0AA 2UXNB 3KFWX 3G2WA 4XX5A 2IONA 3LY9A 5CHEE 2ZM0A 4DK5A 5JDMA 4I1AA 2I2OA 2KINB 5BV1A 4ANXA 3NZQA 4DVDA 1YA0A 3ZVVA 4NUUA 5LCWC 1UX4A 3C51A 4PH4B 5BW8C 2D0TA 3I1AA 2VWAA 3TG4A 4GYOA 2KZTB 3U64A 2LEHA 3AVRA 5EK2A 4BX9A 5FXXA 4MS6A 4KP3C 5LGNB 3IEEA 4DLQA 3RO2A 3BK9A 1KT1A 3MZKB 4YLHA 2PFVA 5H6RB 2LJLA 2CHWA 4AQFC 3ZCJA 3RRUA 4TUYE 3CHPA 4J6IA 3QWWA 3LS8A 4FJOA 2PM6A 1UG3A 4O4IE 4E85A 4P09A 2XGMA 3QC1A 3S7JA 3L54A 3C64A 4HKAA 2DWKA 3R7RA 4TZ4C 3DBSA 2LSGA 2L6JA 3OYXA 2Q9QC 4AJWA 2M67A 1H6KA 3Q5XA 1U5PA 4N2QA 2IU1A 2E9XB 3N9LA 2UY1B 4PJNA 5FQ7A 3PTRB 2CEAA 4IE7A 3Q9DA 2KZTA 2LSKA 4ILIA 5KJLA 4PS7A 4PJLA 2X6KA 1HX8A 3FWVA 3Q4AB 3D9KA 2AXVA 3MV2B 2PL2A 2D5UA 2DNXA 2MTQA 2X6FA 3AS5A 4ZS3A 3F57A 4CDRA 4ZI3D 2FF4A 3I0OA 3N9PA 3CKBA 4EQFA 3FUHA 5L3DB 3ASFA 4G2AA 5C8YE 3LCAA 1VOMA 3LXUX 5BNWA 4L7TA 4TUUA 4AQGA 1T98A 1FIOA 4ACKA 2CLYB 3PUQA 3ZC1A 3JCKC 4I55E 3JC6D 4K0UA 4ILUA 3MYVA 4Q69A 2WXOA 5LHIB 5LA6E 4FADA 3ZPJA 2CG3A 2LHRA 1LF8A 3P1UA 4NQ0A 1QSDA 3B7RL 4J0UA 4GYYA 3PEVB 1WM5A 3O4XE 2VTBB 5LFAA 1E8ZA 1OWLA 2E2EA 3PUJA 3L22A 3C4ZA 3PURA 4KBQA 4G2VA 5JJ6A 2XQ0A 2VTBA 5LOZA 4QXHB 4BSXA 4BT9A 3HKDE 3FP3A 1H2UA 2HH7A 5F8PA 4IRUA 2EHOA 4I4TE 1YKEB 2XPIA 4L1BA 1UCUA 3Q5WA 3OYZA 4UF0A 1HG2A 4ERRA 3IBEA 2PBIA 1ZBPA 5EK4A 5J08A 1OWMA 2GGFA 2YU2A 3LY8A 3ML8A 4UWKA 3E0ZA 4N3BA 3OTNA 4LRZA 5LNKA 4H9RC 2Y4TA 3CX7B 4ANUA 2WM9A 3L13A 3E08A 4ZOLE 5LP0A 3FB2A 4PFOA 4I43B 2CMRA 3FTUA 4UQZA 3RKVA 3ZYQA 2VQ2A 4UWFA 3CPZA 4YFSA 1FCHA 2KWIB 5T8IA 5JDHA 4UWLA 2HPLA 4A56A 1QZ2A 3AS8A 5LP6E 2CFZA 4F1SA 3CVQA 3G2UA 2P58C 5DQWA 2NTXA 4ZI2C 4IULA 4PK4A 4XZCA 4WBOA 3G2VA 5IYZE 4E7SA 5HWXA 4I9CA 4DMVA 4WNEA 5FQ6A 5JJTA 5AYWD 4GA1A 4O2AE 4GOUA 2I59A 4ILGA 4U0UA 5FYMA 2GRLA 3C98B 3R7QA 2CXLA 4OHFA 3PH0C 2J1DG 4MLKA 1FVFA 2FBNA 4XIFA 1KK7A 2H7VC 1ZV4X 5KJNA 3OXFA 3MGBA 5JH7E 3ESLA 4B8AA 4PS8A 4PNIA 1MIVA 4KUMB 2L0TB 5LGUB 3FH5A 4Q96A 4A1GA 3APFA 1VDYA 4AKGA 5DIZA 4WW0A 2CM0A 1LRZA 3ONKA 3MKRA 5HQ8A 2PQRA 2CLYC 4ACLA 4QXBB 3GYZA 2DCPA 3IHYA 2RG8A 2PG8A 3MKDA 4R7LA 5FZQA 4H7YA 4XI0A 4ILHB 2IOSA 4YVOA 2HO1A 1KNZA 2ZMAA 1W3BA 5HAXA 4DPRA 2MOZA 3KBUA 5LCYA 3F31A 4L9IA 5FMNA 4BJMA 3NZSA 3W15B 2LNIA 3I9WA 5JREA 1EZ3A 4LEUA 3CVPA 3FDHA 2EHOC 3D9JA 1BPOA 1MIWA 4CI3B 4HOQA 3SRZA 5M4YA 4IIJE 4FU3A 3HYMB 3FUKA 2I1KA 3S2AA 2XAFB 2X38A 3EDTB 3D9MA 3ONXA 3CK8A 4OVUA 4ATGA 2VSYA 2WXLA 3FFLA 3BQIA 3HKBE 2Y48B 3UULA 4IE4A 4YHJA 3MACA 2X51A 3D9PA 3MEKA 3K3QC 4QKNA 1QQEA 2BVLA 3AA0B 1EF1C 3CVUA 3ETUA 1DVPA 4FHJA 3K3NA 4GZCA 4BTAA 2NW8A 5LG4A 3D0TA 2BUGA 3LJ3A 4UI9C 1IYGA 5A7DB 2QY7A 4N3AA 3ZCIA 2AXUA 4OYSA 3V5SA 4I43A 3ZYLA 2L8KA 3UTKA 3WAKA 3ZJ1A 3ZXSA 3FU3A 4AXHA 3RU0A 2KXPB 1P5QA 4B94A 3VTXA 4I2ZA 2E9XA 5JDLA 4GCNA 4GMJA 5FWQA 5C2YA 2WMNA 3FUIA 2AW6A 2FI7A 3B57A 2J49A 4CZZB 3ZMZB 3ZRHA 3CX8B 3T8MA 3CVNA 3BG0B 4EZHA 2LAHA 4WBNE 1LVKA 5JR9C 4MLPA 3L09A 4P0AA 2XASB 4GYRA 2LHNA 2ODUA 4YVQC 3SZ7A 2ZU6B 2W00A 4ZI2D 2K48A 4GZ6A 3FEXA 3U66A 1IQRA 1HF8A 4HEAA 4DNDA 4EAHA 2MBGA 3NZUA 4JEUA 3U9WA 2BVMA 4DBQA 1HCIA 3V5UA 3BEEA 2Z6EA 4K0RA 3ZHEB 1FVHA 4I6GA 4QXCB 4JA9A 1UW4B 3PRZA 4KT6B 4HS2A 4PK5A 2CE7A 5JHBA 5LX8A 3PE0A 2LSVA 1NZNA 3CHRA 5CA0E 3Q15A 4GZ5A 4UELA 4H9PC 3CV0A 3ANWA 2H7OA 4U04A 3RJVA 3MJXA 3HVEA 3MA5A 5KCMA 3C98A 3C4XA 4GYSA 1HTJF 3N5LA 5FZRA 1IJ6A 3R6NA 1L5JA 2ES0A 5J2UE 2V5FA 1QNFA 1NA0A 1E8YA 2P9BA 3HKEE 2XRYA 3FEYA 3OBVE 5DQVA 5AJDA 2WXPA 3FBZA 3UUXB 3P8CD 3ZMTB 2C5JA 3CSTA 5L3CB 1UJKA 4AEZC 3VLFA 4JHRA 1O3XA 2NOXA 4Y6WA 4P29A 4GK5E 4CXWA 4JVSA 2FULA 4IDZA 3AB3B 3FUDA 3JC6C 3ZYMA 4KYOB 5JDNA 4GU5A 4LERA 1U3CA 2E9XC 4FJZA 2OA5A 2C0LA 4CT0A 3CK7A 3EHNA 3EDVA 5JDFA 3L17A 4FLHA 2XHEA 3ASHA 3CHMA 2DIWA 5JR9A 5HI7A 2J4DA 3JQ1A 3HVEB 3OXLA 5LXTE 3I4GA 2W63A 5HXSA 5AFUL 3LBXB 3TXMA 4UQYA 4AIFA 4M1PA 5JR9B 2I6HA 2WXHA 3CVXA 2MOWA 1X79A 1TJCA 2WPVA 2DWGA 1HU3A 4WUYA 3CX6B 4U72A 2Y4UA 3RYFE 3L6AA 4H9QC 3PS6A 4JEHA 2Q9QB 3CHSA 4KVMA 3CVLA 3SGHA 2JMKA 4A55A 4QWNB 4V1Av 5IHYA 5JVDE 1S0PA 1ZKEA 1Z6TA 3RRMB 2WXMA 1OWNA 4HVBA 1UN8A 5LJNA 4PDXA 5L2LA 3CWZB 3CQGB 3RYCE 5T4YA 4F7AA 1S35A 4DO0A 3PNTB 3ONLA 3PUAA 2CFUA 5JDGA 3TXNA 2BZBA 2SPCA 4GIWA 2BTDA 5A23A 4L2YA 3LG7A 3TKLB 4Y6CA 4AY6A 4FA6A 3KDSE 3ESKA 5G05J 3MK7C 4QX7B 1D1CA 3AU5A 3RRWA 2IOLA 3RO3A 1G8XA 1H19A 2WXNA 5FXWA 4GA2A 4AOFA 5FQ4A 4GYWA 4IHJE 3O48A 2XEVA 2CWOA 4UQXA 2W62A 4GMLA 1US7B 3LK3B 4CRWA 4CI1B 4QFVA 2WWUA 3G2SA 2RD0A 2V0PA 4GA0A 2RP4A 2CG2A 4JHJA 2N1GA 4EIWA 4I1MA 1EPUA 2H3RA 2VASA 3PUGA 1HS6A 2R59A 4KXKB 3O4ZA 4WWNA 1S94A 4HE8A 3KV9A 4U0SA 3D9OA 3T5VA 2ODVA 3I5PA 1Z0PA 2V7LA 4M3OA 4NRHB 5JRCB 3MXZA 4OFZA 2YK0A 3AAAB 1B7TA 1WAO1 2MYSA 2AWIA 4B8CB 3URZA 1LVFA 4PAGA 4EZKA 4MHCA 3PZDA 5CCLA 4NURA 3KVAA 3NBXX 3NRYA 4CXXA 3UPVA 4B6XA 2CHXA 1WLXA 1JPLA 3J7Yq 1OWPA 4NACA 1YD8G 3FHEA 4B0ZA 1SA0E 5EDSA 5DBKA 2DHRA 2VB6A 3WAJA 3FY4A 3B7SA 2VYIA 2I9CA 2CXFA 2XAJB 4I6EA 4DLOA 3LDZA 5LJMA 3FULA 3CHQA 4UVCB 5KDMC 5FY0A 4U07A 4Q94A 2X66A 4AKHA 3PE4A 3AS4A 1D0YA 3PDYA 1ZEEA 5ETWA 3GA8A 3FXDB 3J9X1 3VLEA 3B13A 2GRMA 3K3OA 2X9YA 3CK9A 2X6IA 3GN5A 3RKOA 3LEWA 3CIAA 4AXPA 5JHAA 2M63A 3QWPA 3ENEA 1DNPA 4TN7B 4FC8A 5DABA 5L3FB 1UN9A 2UXXB 1JWGA 4HXIA 5LOVE 1H7CA 2L9QA 2J08A 2GW1A 4UIGA 3CMLA 3RIBA 2LOPA 3APDA 3EIQC 3UT7A 4WNGA 3D9NA 1KLXA 5L3GB 3Q49B 3IBPA 4V3IA 2NW7A 3NF1A 4GZ3A 4WWPA 2LOSA 1ELRA 2LM9A 4UXNB 2BDEA 2RA1A 4EBAG 2A2FX 2YQ8A 4N39A 2LSUA 4MKTA 4U63A 2XHEB 2YU1A 5ADXL 4HFGA 2J09A 2J4BA 1FEWA 2XAGB 5FZSA 5A1LA 3ZJ2A 4N3CA 2W61A 1HS7A 2WQ7A 2R5SA 3Q47B 3PNLB 4KMOA 3ASGA 3TG5A 4EYYR 2WBLA 3JYSA 3LK2B 3T5XA 4G1TA 3MV3B 5HYAA 4JXTA 1SZAA 4TRQA 2L3LA 3OJAA 3CHOA 4JA7A 3QB2A 4W9RA 4RVBA 3FUNA 2CXDA 3FU5A 4J2CA 3P2BA 4WAFA 4CEMA 4CT4A 3VTYA 1MHQA 5FY1A 4CXYA 4G11A 4H7XA 5ANLA 2VGXA 3SF4A 3ETVA 2OOEA 2WSSV 3RYIE 4WNKA 5LHHB 5KJKA 4EZ4A 4AVXA 4N78D 4TV3A 2VSXE 2WAUA 3MCXA 2XAQB 4CQIA 3TL5A 2JPFA 2R17C 1A17A 5AJLA 3LVQE 4H9OC 4UWGA 3ZN0B 3MA9A 3FXEB 4KBMB 1MIYA 2KT9A 3HI2A 3UT8A 3N9QA 3CKDA 2NWBA 2YHEA 2X9XA 3PUSA 3F2EA 4IE5A 3QNKA 1D0ZA 3QC9A 5E76A 3VKHA 5FXZA 1GW6A 5KJMA 3DP7A 4RSYA 2V7KA 4WWOA 3ZMUB 1VRBA 4CGWA 2X0LB 2XGSA 4PUCA 5HXRA 5LYJE 1X5BA 2Y6XA 3PU3A 4O2BE 3O1HA 3GN5B 4URKA 3NQPA 1HG5A 3GMIA 4FHKA 3FTXA 4TV9E 3QARA 3LVRE 2VKOA 2IQCA 3O1JA 5BT1A 5BMVE 4IYPA 1XNFA 3LKUA 4E6HA 5JQGE 2KLQA 4NUVA 2PQNA 3D9LA 2K24A 2VSNA 1U3DA 2LSIA 2NTYA 5BUZA 3ZLIA 2NSZA 3RK6A 3RC8A 3AAEB 4BJNA 4E7ZA 2JJ9A 3CR3A 4UVBB 3MKQB 1Y64B 2XTLA 3CSFA 4OYKA 4D10C 3TJPA 2PM7A 4H9SE 4ANVA 2V7JA 4XAXB 4J8EA 4UEMA 5HWYA 4AV7A 5FQ8A 3UT4A 4RG6A 4U0ZA 4HFVA 3Q2MA 5FXVA 3PU8A 4H9NC 2QGSA 3EIJA 3KEZA 2HYZA 2QA7A 3HKCE 3RRCA 3PREA 2V8SE 2EQXA 4AKIA 1MQSA 3EUHA 1IZNB 4I6JA 3RYHE 1WRDA 2HR2A 1Z3YA 2PJQA 4JEUB 4ASKA 4DBRA 1SHZC 4DI4A 2Q9QD 3GZ2A 5LCWJ 3FU0A 2ZLYA 5LBQB 4ZI7E 3AVSA 3N2GE 3FUEA 1JWFA 2WXKA 1HO8A 3ZN3A 4HOSA 5FT9A 4EZLA 5M72A 4C0EA 3FTZA 3LJCA 2HPJA 2B1EA 4G26A 2C0SA 1XGWA 4CDMA 4FULA 4MALA 1MMDA 1SZ9A 2IF4A 4HTEA 1YKHB 3EJNA 1BR1A 3C4WA 5HXEA 1PAQA 2LT3A 2DLRA 2XUEA 3A5XA 4I1OB 3QKYA 5EZYE 2L0IA 3KINB 2LSJA 1TJFA 2YHCA 5LBMA 3IHVA 1ELKA 3K8PC 4J8FA 4LUNU 4AP2A 3QUJA 5G05C 2CA5A 4BWRA 2KZ7B 5FTPA 2X67A 1ZHCA 2DI4A 3PEUB 2WQHA 2JRKA 1SQMA 4EBAA 4BAYB 5E0OA 4U8HA 2E8IA 2ILRA 4XKCA 2LE8A 5L3EB 4JC8A 2YINA 3FTVA 2KCVA 3SBTB 3UQ3A 5HXCA 3VLDA 2LAIA 4A3TA 3SOLA 3ZGQA 3QAQA 1WYBA 4N2SA 3BQKA 4DJAA 1D0XA 4ME2A 4MBQA 5H6QB 3IHRA 4WNDA 1OWOA 3R84B 3KV5A 2LSYA 2DCFA 1NA3A 5EKQD 5E75A 4FLBA 2WXJA 4ISTA 1E8WA 1E7VA 3D9IA 3AA7B 5J90A 4JL0A 4P0BA 3VKGA 1BR0A 4Z8XA 2BF0X 3DJBA 5LGTB 2WXQA 3MJWA 3O9XA 4G23A 2KWHA 1NP7A 2DBAA 4UV9B 4I2WA 4X1IE 2JQQA 2GK9A 4JEHB 3ZN1B 2X6JA 5FJYA 3ZEFB 2NC9A 2X3MA 5CB4E 4JLEA 1V9DA 1IHGA 4I9EA 4TX5A 3S7BA 1U4QA 4DMWA 3UUXA 2OV8A 2XRZA 2JEKA 3I0QA 5BV0A 3ZEFA 1AJ3A 4UWHA 3FH7A 4HLEA 2EHOD 2E9XD 5F3JA 3QJZA 4I17A 4FI5A 5KMGP 3EDUA 4A3VA 4AKRB 2LO6A 4HGAA 1ELWA 1FMVA 3U4TA 3CLJA 5CMWA 1HE8A 3ASDA 5L3BB 1E96B 2WXGA 2L9BA 4L0RA 2VJ8A 5G2NA 3UX4A 3MKQA 4KZ0A 3L16A 4X20E 3T8OA 3E22E 3ZMSB 2KM4A 4FP7A 1HH8A 4APFA 4JW1A 4XZ4A 1E90A 4QX8B 4G25A 3GW4A 4X1YE 1Y6IA 3JQ0A 2XGOA 4JHKA 3PUKA 2WXRA 2K9AA 4A1SA 1MNDA 3APCA 4J8SA 4PK6A 3KBTA 1NAFA 3H3AA 4UI9K 2A72A 1KT0A 4EXTA 4O4HE 5A6CA 4O6FA 3FHNA 4I50E 3S7DA 3KV4A 4WNFA 3GWHA 3KV6A 2VKDA 2V7IA 2KCLA 2NW9A 4C9BB 4QHOA 4ZS2A 4BFRA 3SNXA 3S4UA 5JRCA 2XCBA 1NWMX 3H37A 3D3MA 4LCTA 2MHKA 4U74A 3ZYKA 2XAHB 3N2KE 3M65A 5LHGB 5TAOA 1D1AA 4L5GA 3L3PA 3SS1A 3HR0A 3ZHEA 3GZSA 2Y8DA 2AVPA 3N2OA 4KZCA 4IN3B 3HA4A 5AIJA 3HIZA 2D2SA 2ZM8A 2YNQA 3SBSA 3SI5A 2NP9A 2IC9A 3LBXA 2UY1A 3ANWB 3OXGA 4BTBA 2Y3AA 2X9WA 3AAIA 2XCCA 4PJMA 3B7TA 4L23A 1E8XA 3RH3A 1N54A 4XKBA 4F6RC 3ZIMA 1OWAA 2C0MA 1WYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2T A;  4Q96 A;  4AVX A;  3RRU A;  3ZYK A;  1SZ9 A;  5J08 A;  1JWG A;  3D9O A;  2QY7 A;  2BF0 X;  3D9J A;  3D9P A;  2DIW A;  1JUQ A;  3ZYM A;  1VDY A;  2KM4 A;  3D9L A;  4GZD A;  1H0A A;  2LO6 A;  1HG5 A;  3G2S A;  3G2W A;  4FU3 A;  1JWF A;  3ONL A;  5LOZ A;  3ZYQ A;  1INZ A;  1HX8 A;  1MHQ A;  3G2U A;  3LDZ A;  3ONK A;  1LF8 A;  2L0I A;  3D9K A;  1EDU A;  1DVP A;  3CLJ A;  3D9M A;  5CMW A;  3D9N A;  1HFA A;  4GZC A;  1JPL A;  1UJJ A;  1ELK A;  1UJK A;  3ZYL A;  4JXT A;  4HFG A;  3G2V A;  4NAC A;  1SZA A;  4FLB A;  5LP0 A;  3D9I A;  2MOW A;  2L0T B;  1XGW A;  1HF8 A;  1PY1 A;  1X5B A;  2DCP A;  4Q94 A;  1HG2 A;  1EYH A;  5CMY A;  2V8S E; 
#chains in the Genus database with same CATH topology
 4ZXL A;  3UUN A;  5HXH A;  5ANR A;  5EX0 A;  1OUV A;  3UMV A;  3IF8 B;  2VL8 A;  4B3M T;  3FBL A;  3NOG D;  3N9O A;  4BA9 A;  1MMN A;  2WVI A;  3FUJ A;  4EPZ A;  4EB6 E;  3TWT A;  3SWH A;  3VU7 H;  4CCA A;  2CCQ A;  3UT5 E;  4GAA A;  2WXI A;  1E7P A;  2I1J A;  1FT2 A;  4CGV A;  1IAP A;  3B7U X;  3CKC A;  4DUY T;  4G8K A;  3G2T A;  1LTX A;  3EHM A;  2CBJ A;  1D1B A;  4DR5 T;  3VRA A;  3NOC D;  1Y8M A;  1H2T C;  3FTY A;  3LFM A;  3Q75 A;  5FIO A;  3AED A;  3RRN B;  1MMG A;  4X1K E;  4UF0 B;  3IKO B;  4G24 A;  3QOU A;  4O4L E;  3WXX A;  1WR6 A;  5EX3 A;  3TAX A;  1EDU A;  2QFC A;  2G0U A;  3CVW A;  2A3D A;  4ABN A;  3AXJ B;  1XNR T;  2QYW A;  1GQE A;  4TNW A;  4LNB A;  2Q7F A;  4IE6 A;  4YHH T;  3ONL C;  1Z3X A;  4YJ3 E;  4PJJ A;  4H63 H;  3PVL A;  3FTW A;  2E0I A;  5ABH A;  4G63 A;  4BX8 A;  3IEG A;  4GCO A;  1H6P A;  3BQL A;  4UV8 B;  4DI3 A;  2KAT A;  1MMA A;  2OVB A;  3ZPO A;  2I0M A;  2AXD S;  2X9H A;  1PC2 A;  3KS2 A;  4EYU A;  5AQI B;  3WI3 A;  2BKN A;  2LM2 A;  5ARF A;  3VRB A;  2IAK A;  4IE0 A;  3UIN C;  2JMH A;  3ULQ A;  3CQX C;  3R9A B;  5D0Q D;  5CMY A;  3KD7 A;  3FUM A;  2V1D B;  2A5U A;  4F53 A;  1BR4 A;  2IC6 A;  2VGX B;  4CDN A;  2M6I A;  2WXF A;  2EHO B;  4BT8 A;  2FO7 A;  5JJ7 A;  2D9D A;  1WFD A;  3ZNG A;  3PE3 A;  4BY6 A;  4JZY A;  1QUU A;  1E7U A;  1XMO T;  1INZ A;  4HWD A;  3GZ1 A;  4XI9 A;  4HFD A;  3OKQ A;  4CZ2 D;  3DTO A;  3IA3 A;  3NRX A;  2UUB T;  4U95 D;  4OYJ A;  3RX6 A;  3NB2 A;  2IO3 C;  2VL0 A;  2OLT A;  5LB7 B;  5JTG A;  1NFI E;  1OXZ A;  3EVY A;  1SA4 A;  2R03 A;  4O4J E;  2W0G A;  1IBM T;  2N2N A;  5JMN D;  5FNV E;  2C2L A;  4UVA B;  1CUN A;  4U8Y D;  4F3V A;  2OND A;  3QDN A;  1TNY A;  4OK0 A;  3DPD A;  4ADZ A;  5FY7 A;  3ZMV B;  3FZL B;  1K1A A;  4GK0 E;  1FMW A;  4UI9 J;  3ZT7 A;  2JLB A;  5AQV B;  3KVB A;  3U3W A;  3M3Z B;  4JB8 P;  4H63 V;  3RPU A;  4IDO A;  2V5D A;  1IQU A;  3ABM E;  2N9D A;  4ANJ A;  1N34 T;  2ETA A;  5BPP A;  3N9N A;  2J07 A;  2DZO A;  4KVO A;  3AA1 B;  4O8S A;  4DV0 T;  4EOZ B;  4OVV A;  4YJ2 E;  4LFC T;  5ARG A;  3RHW A;  3K9I A;  1E1H B;  5C2T A;  4AI6 A;  3UFE A;  5AQJ B;  5DJQ C;  2X68 A;  3ZC0 A;  3P7I A;  3U3I A;  2RKK A;  2XS1 A;  4TV8 E;  3SHF A;  4HOT A;  5BR8 T;  1LKX A;  3ML9 A;  2BKK B;  2JQK A;  2IW5 B;  2NXP A;  1PY1 A;  5G04 J;  4ZHQ E;  1J1J A;  4IGU A;  3QK6 A;  3T1Y T;  3PJA J;  2IML A;  5J2T E;  2VSO E;  2XQ8 A;  1B89 A;  4ANW A;  4X8Q A;  4DR3 T;  1JUQ A;  5AQU B;  4JI1 T;  4G8L A;  2CWY A;  2BKP A;  4APO A;  4L2L A;  3E30 A;  5GON E;  3NVO A;  1HNW T;  1FJG T;  4YND A;  2L6B A;  2V4L A;  1UX5 A;  3DSX A;  3LPZ A;  4C90 A;  5ENP D;  3SFD A;  4AM9 A;  3B5M A;  3N9M A;  3CVV A;  3CVR A;  1M62 A;  3CQC B;  3PV0 F;  2ZM2 A;  3Q7A A;  4J8Y A;  3CGH A;  4AKL A;  3I3N A;  3ONJ A;  3MX3 A;  5JDQ A;  1IJ5 A;  3N71 A;  4GB9 A;  1OY3 D;  4EZJ A;  3HHM A;  2VK9 A;  4LMK A;  4C91 A;  4GKK T;  4PW8 A;  1HFA A;  2A4Z A;  2BED A;  3LY7 A;  5G04 C;  4AY5 A;  2XQA A;  3NZP A;  2XM2 A;  3QK0 A;  3L39 A;  5IY5 E;  3JUI A;  2VKH A;  1EYH A;  4ISS A;  3Q79 A;  3U78 A;  2IFU A;  3AA6 B;  3VHL A;  5EK3 A;  3JUE A;  4MFR A;  2WMO A;  1M7K A;  2V26 A;  5CGM A;  1BR2 A;  2M6B A;  4JBW F;  2KND A;  1TEZ A;  4RG9 A;  2LLY A;  4HOR A;  4CI2 B;  4KHZ F;  3LYA A;  4AQF A;  5FP3 A;  2IJG X;  1HR0 T;  4PS3 A;  3KSQ A;  2KMF A;  1JCQ A;  2AXZ A;  4OAV B;  4EEC A;  3E4B A;  4N5C A;  3FH8 A;  2MRI A;  4F8H A;  3BG1 B;  2CHZ A;  2XPZ A;  1YW0 A;  5T3R A;  4FJY A;  2K5B B;  3CVY A;  3AU4 A;  3AE8 A;  3ZW3 A;  5CCM A;  2WQ6 A;  2PZI A;  4GTQ A;  1O1R A;  2XQ7 A;  4GTV A;  4JUY A;  3QWV A;  3FU6 A;  4LF6 T;  4GZD A;  5CJ5 A;  1HZ4 A;  4IL4 A;  4DV1 T;  3FUF A;  2WB2 A;  2GRP B;  2Y69 E;  4HOU A;  1RZ4 A;  2J9Q A;  2Q9Q A;  4HI9 A;  3SD5 A;  2ACX A;  2KCK A;  3LK4 2;  2W67 A;  2F8Y A;  4B89 A;  1N95 A;  1G73 A;  3C50 A;  3RC3 A;  1H2V C;  4ZI3 C;  4HBD A;  4GPK A;  4HN9 A;  2YOE A;  3HDX A;  2XY8 B;  3ASN E;  2X0Y A;  4MRU A;  4TXP A;  1WY6 A;  3CEQ A;  2OVF A;  4PFP A;  3MZL B;  2V7M A;  5D0O D;  2XPY A;  3KAE A;  4C0M A;  3OAW A;  3S7F A;  1SUM B;  2YEV C;  1HXI A;  3UUM A;  4TWF A;  5G55 A;  4XE0 A;  3ULY A;  5AEN A;  1UJJ A;  2DWZ A;  3TGO A;  3ABV A;  3I9Y A;  3RI5 A;  3O1I A;  3AE3 A;  2XQ4 A;  3F6Q A;  4XBF B;  4JPS A;  5CEA A;  3FTS A;  2VKJ A;  5J1G A;  5C1D A;  2VGY A;  5CA1 E;  3I4R B;  2C5K T;  2KC7 A;  1MNE A;  5AQL B;  2D0U A;  3Q5M A;  4ZZB A;  1ZU2 A;  3L08 A;  5ENN A;  2WQY A;  5KX5 E;  3RLF F;  1DCE A;  2VQE T;  3ZFW A;  3PDN A;  2FEZ A;  3IV0 A;  2WU2 A;  3D9H A;  2BG9 A;  2C5I T;  2WZI A;  3UM3 A;  4FLH A;  4HRM B;  1N52 A;  3SFZ A;  2X6H A;  3HL6 A;  4K03 A;  2XQY A;  4KMC A;  4J8D A;  2UWJ G;  2WB5 A;  3DXK G;  2HM8 A;  2UXD T;  1H0A A;  2UXN B;  3KFW X;  2XEH A;  3G2W A;  1TYQ G;  3T8K A;  4XX5 A;  2ION A;  3LY9 A;  5CHE E;  2ZM0 A;  3T1H T;  4DK5 A;  5JDM A;  4I1A A;  2I2O A;  2B76 A;  3W9F A;  4IL9 A;  2KIN B;  5BV1 A;  4ANX A;  3NZQ A;  2DL1 A;  4DVD A;  1YA0 A;  2GRN B;  3ZVV A;  1KFY A;  4NUU A;  5LCW C;  5HEJ A;  2IEJ A;  1UX4 A;  4ZHB A;  3C51 A;  4PH4 B;  5BW8 C;  3HG0 D;  2D0T A;  3I1A A;  3TWQ A;  2VWA A;  3TG4 A;  2F8X K;  2AJA A;  4C48 B;  4GYO A;  2KZT B;  3U64 A;  3C72 A;  1CHU A;  2LEH A;  4DV2 T;  3AVR A;  5EK2 A;  4BX9 A;  1YXR A;  5FXX A;  4MS6 A;  4KP3 C;  5LGN B;  3IEE A;  4DLQ A;  3RO2 A;  3BK9 A;  1D8D A;  5JA4 D;  1QLB A;  1KT1 A;  3MZK B;  2BKO A;  4YLH A;  2XPK A;  2PFV A;  4K5B A;  5EYP F;  3AE9 A;  5H6R B;  1N11 A;  2UXB T;  4GMR A;  3RIF A;  2LJL A;  1OED C;  2CHW A;  4AQF C;  3ZCJ A;  3RRU A;  4TUY E;  2XQ6 A;  3CHP A;  3AG4 E;  1S64 A;  4J6I A;  3QWW A;  3LS8 A;  2LXM A;  4FJO A;  2PM6 A;  3DRA A;  1UG3 A;  4O4I E;  1TR4 A;  4E85 A;  4P09 A;  4YDY A;  3ZU7 B;  1W0B A;  4HFI A;  1H6O A;  3PZ2 A;  2ZGG A;  1XZY A;  1KNP A;  2XGM A;  3QC1 A;  4LNG A;  3S7J A;  2H89 A;  3L54 A;  3C64 A;  5AQP B;  4HKA A;  2DWK A;  1MX2 A;  2ZGD A;  3R7R A;  4LFB T;  4TZ4 C;  3DBS A;  1UGO A;  2LSG A;  1N0R A;  2L6J A;  3OYX A;  2Q9Q C;  4AJW A;  4HWH A;  2M67 A;  1H6K A;  3Q5X A;  1U5P A;  4JYA T;  4N2Q A;  2IU1 A;  3WG7 E;  1LD7 A;  2E9X B;  2X0H A;  3N9L A;  2UY1 B;  1IXV A;  2V6Y A;  1MJ0 A;  3UU4 A;  4PJN A;  2JAB A;  5FQ7 A;  3L8R A;  3PTR B;  2CEA A;  4IE7 A;  3Q9D A;  3ZT6 A;  4U2Z A;  2LSK A;  2KZT A;  3NKZ A;  5KNH D;  3UM1 A;  3C3O A;  4ILI A;  5KJL A;  4PS7 A;  4PJL A;  2X6K A;  1HX8 A;  3FWV A;  5HCM A;  3Q4A B;  3D9K A;  2AXV A;  3MV2 B;  2PL2 A;  2D5U A;  2DNX A;  2MTQ A;  4U7I A;  2X6F A;  4ZS3 A;  3AS5 A;  3F57 A;  3UKU G;  1OCO E;  3UXG A;  3J5P A;  4CDR A;  4ZI3 D;  2FF4 A;  3I0O A;  3N9P A;  2DZN A;  3CKB A;  4EQF A;  3FUH A;  3TWU A;  5L3D B;  2LUH A;  3ASF A;  4G2A A;  5C8Y E;  3LCA A;  2LRL A;  4YSX A;  4NPP A;  1VOM A;  4DV7 T;  3LXU X;  5BNW A;  4L7T A;  4TUU A;  4AQG A;  1T98 A;  1FIO A;  4UR9 A;  4ILA A;  4ACK A;  1XNQ T;  2CLY B;  3PUQ A;  3ZC1 A;  3JCK C;  2CRB A;  4I55 E;  3JC6 D;  4K0U A;  4K5A B;  4ILU A;  3MYV A;  4EEB A;  3C5R A;  4Q69 A;  3AE4 A;  2HN2 A;  2WXO A;  5LHI B;  3UU6 A;  2H88 A;  5LA6 E;  1FPP A;  4FAD A;  3ZPJ A;  1DC2 A;  2CG3 A;  4QH4 A;  2BBH A;  2LHR A;  1LF8 A;  3P1U A;  4NQ0 A;  1QSD A;  3B7R L;  4J0U A;  4GYY A;  3PEV B;  1WM5 A;  3Q9N C;  3O4X E;  2VTB B;  5LFA A;  3G06 A;  1E8Z A;  1OWL A;  2E2E A;  3PUJ A;  2WS3 A;  3L22 A;  3C4Z A;  3PUR A;  3PUX F;  2DYR E;  4G2V A;  4KBQ A;  5JJ6 A;  2XQ0 A;  2V8S V;  2H6H A;  3P4R A;  2VTB A;  4OX9 T;  5LOZ A;  4QXH B;  4BSX A;  4BT9 A;  3JCF A;  3HKD E;  3FP3 A;  1H2U A;  2HH7 A;  2VVS A;  5F8P A;  4IRU A;  2EHO A;  4I4T E;  1YKE B;  2XPI A;  4L1B A;  1UCU A;  5EIL A;  3Q5W A;  2IDO B;  3OYZ A;  3PZ4 A;  4UF0 A;  1HG2 A;  4ERR A;  3IBE A;  2PBI A;  2CBI A;  3AEF A;  1ZBP A;  2WP9 A;  5EK4 A;  5J08 A;  1OWM A;  4X66 T;  2GGF A;  2YU2 A;  3LY8 A;  3ML8 A;  4UWK A;  3E0Z A;  2ACZ A;  2PTF A;  4MBG A;  4N3B A;  3OTN A;  4LRZ A;  3UKR G;  5LNK A;  4H9R C;  5CED B;  2Y4T A;  3CX7 B;  4ANU A;  2WM9 A;  3L13 A;  3TLW A;  3AEB A;  3E08 A;  4ZOL E;  5LP0 A;  1E2A A;  3FB2 A;  4PFO A;  4I43 B;  3JAD A;  3UIP C;  2CMR A;  4TUM A;  3FTU A;  4UQZ A;  2P9S G;  3RKV A;  3ZYQ A;  4LF5 T;  2VQ2 A;  4UWF A;  3CPZ A;  4YFS A;  1FCH A;  2ZIS A;  2KWI B;  5T8I A;  5JDH A;  5J0Z A;  4F1P A;  4UWL A;  2HPL A;  4A56 A;  1QZ2 A;  3LJN A;  4NXN T;  5LP6 E;  2CFZ A;  3AS8 A;  4ATZ D;  4F1S A;  4NIK A;  3CVQ A;  3G2U A;  4YXD A;  1N9A A;  2P58 C;  5DQW A;  2NTX A;  4ZI2 C;  4IUL A;  4PK4 A;  4XZC A;  1O5M A;  2UUC T;  4WBO A;  3L9T A;  3UFG A;  3G2V A;  5IYZ E;  4COF A;  4E7S A;  5HWX A;  4I9C A;  4DMV A;  5EIB E;  4X5T A;  4WNE A;  5FQ6 A;  5JJT A;  5AYW D;  4GA1 A;  1ZB1 A;  4O2A E;  4GOU A;  2I59 A;  4ILG A;  4U0U A;  5FYM A;  1QYM A;  2GRL A;  4YT0 A;  3C98 B;  3R7Q A;  2CXL A;  4OHF A;  3PH0 C;  2J1D G;  1W9R A;  4MLK A;  1FVF A;  2FBN A;  4XIF A;  1KK7 A;  2H7V C;  1ZV4 X;  5KJN A;  3OXF A;  5B1A E;  4JI6 T;  3MGB A;  5JH7 E;  5LG3 A;  4LF8 T;  3ESL A;  4B8A A;  4PS8 A;  4M7C A;  2BG9 E;  1MIV A;  4KUM B;  4PNI A;  2L0T B;  5LGU B;  3FH5 A;  4Q96 A;  5FVK A;  3R9M A;  4A1G A;  3APF A;  1VDY A;  1JNZ A;  4AKG A;  4QH1 A;  5DIZ A;  4WW0 A;  2CM0 A;  1LRZ A;  3ONK A;  4IDN A;  1KZO A;  4Z90 A;  3ULE G;  3MKR A;  5HQ8 A;  2PQR A;  2CLY C;  2ETB A;  4ACL A;  5CFB A;  4QXB B;  3VR9 A;  3GYZ A;  2GRR B;  2DCP A;  2V4H C;  3IHY A;  2RG8 A;  2PG8 A;  3MKD A;  4R7L A;  5FZQ A;  4H7Y A;  4XI0 A;  5AQ7 A;  4ILH B;  2IOS A;  4YVO A;  2UUA T;  2HO1 A;  1KNZ A;  2ZMA A;  1W3B A;  5HAX A;  2FBW A;  4DPR A;  2A5E A;  1MX6 A;  5FL0 A;  2MOZ A;  3KBU A;  5LCY A;  3F31 A;  4L9I A;  5FMN A;  3UU5 A;  4BJM A;  1TNO A;  2FO1 E;  3NZS A;  3CIR A;  2WU5 A;  3W15 B;  2LNI A;  3I9W A;  1BI7 B;  5JRE A;  3LSV A;  1EZ3 A;  4LEU A;  1Z8U A;  3CVP A;  3FDH A;  2EHO C;  1DCQ A;  1KF6 A;  2UU9 T;  2R6G F;  3P50 A;  1BPO A;  3D9J A;  1MIW A;  4CI3 B;  4HOQ A;  4AIS A;  3SRZ A;  5M4Y A;  4IIJ E;  3PZ3 A;  4FU3 A;  3HYM B;  3VR8 A;  1HNX T;  3FUK A;  2I1K A;  4U7E B;  3S2A A;  2XAF B;  2X38 A;  1UOH A;  3D9M A;  3EDT B;  3ONX A;  5BXU A;  3CK8 A;  4OVU A;  4ATG A;  2VSY A;  4GTM A;  2WXL A;  3FFL A;  3BQI A;  4U8V D;  3HKB E;  2Y48 B;  4NXM T;  3X1D A;  2K3W A;  2WDQ A;  4IE4 A;  3UUL A;  4YHJ A;  4IDP A;  3MAC A;  2X51 A;  3D9P A;  3MEK A;  3K3Q C;  4JV5 T;  5AQR B;  4QKN A;  1QQE A;  2BVL A;  3AA0 B;  3EHZ A;  1EF1 C;  1NL4 A;  2YDR A;  4EV6 A;  3CVU A;  3ETU A;  3UQ4 A;  1DVP A;  4FHJ A;  3K3N A;  4GZC A;  5ITZ F;  4BTA A;  2NW8 A;  5LG4 A;  3D0T A;  3UTM A;  2BUG A;  3LJ3 A;  4UI9 C;  1IYG A;  3RF1 A;  5A7D B;  4U31 A;  2QY7 A;  4HRL A;  2CHN A;  4N3A A;  2FJB A;  3ZCI A;  1TN7 A;  2AXU A;  3Q5D A;  4OYS A;  4BSZ B;  3AAA C;  1T7S A;  3V5S A;  1RW2 A;  4I43 A;  3TWS A;  3PJA A;  4DID B;  5AQA A;  3ZYL A;  2L8K A;  3UTK A;  3WAK A;  3ZJ1 A;  3ZXS A;  1JCR A;  3FU3 A;  4AXH A;  3RU0 A;  2KXP B;  1P5Q A;  4B94 A;  3VTX A;  1XWM A;  4I2Z A;  2XQ3 A;  2E9X A;  5JDL A;  4GCN A;  4GMJ A;  5FWQ A;  1LD8 A;  5C2Y A;  2WMN A;  3P4S A;  4Z91 A;  3ZST A;  3FUI A;  2AW6 A;  2IHR 1;  2FI7 A;  2BS3 A;  3HXD A;  3B57 A;  2J49 A;  3ZKJ A;  4CZZ B;  3ZMZ B;  5L47 A;  3CX8 B;  3ZRH A;  3T8M A;  2YKS A;  3BG0 B;  4EZH A;  3CVN A;  2LAH A;  4WBN E;  1LVK A;  5JR9 C;  4MLP A;  3L09 A;  4P0A A;  1J5W A;  2UXC T;  2XAS B;  3IXE A;  4GYR A;  2LHN A;  5AQT B;  2ODU A;  4YVQ C;  3SZ7 A;  2XSA A;  5ENT D;  2ZU6 B;  2W00 A;  2XZT G;  2Y0B G;  1YQ4 A;  4ZI2 D;  4TXR A;  1N36 T;  2K48 A;  2YDS A;  1X9B A;  4GZ6 A;  1NEK A;  3RIA A;  3TWX A;  3FEX A;  3ABL E;  4NIQ A;  3U66 A;  1IQR A;  3DSU A;  1HF8 A;  4HEA A;  4DND A;  4EAH A;  4L9P A;  2MBG A;  5L4E A;  3NZU A;  5AQH B;  4JEU A;  3U9W A;  1HNZ T;  2BVM A;  4YTM A;  2ZM6 T;  5BXO A;  4DBQ A;  1HCI A;  3V5U A;  3BEE A;  2Z6E A;  4K0R A;  4HFE A;  3ZHE B;  4YDW A;  1FVH A;  4I6G A;  4QXC B;  4JA9 A;  4ZEY A;  1OXJ A;  1UW4 B;  4WYV A;  2NYJ A;  2RFM A;  3PRZ A;  4KT6 B;  4HS2 A;  4PK5 A;  2CE7 A;  4KI0 F;  3Q78 A;  2CPT A;  2EIK E;  5JHB A;  3EUV A;  3DST A;  5LX8 A;  1JNR A;  3PE0 A;  1YCS B;  1NZN A;  2LSV A;  3CHR A;  5CA0 E;  3Q15 A;  2R2L A;  4GZ5 A;  4DR1 T;  1G3N B;  4UEL A;  1O1S A;  4H9P C;  3CV0 A;  1SW6 A;  1AP7 A;  3ANW A;  2H7O A;  4U04 A;  3RJV A;  3MJX A;  3HVE A;  3MA5 A;  5KCM A;  4X64 T;  3C98 A;  3C4X A;  3L82 A;  3RQU A;  4GYS A;  1HTJ F;  3N5L A;  5FZR A;  1IJ6 A;  4A98 A;  3R6N A;  2ES0 A;  1L5J A;  2BS4 A;  5J2U E;  4J7W A;  1TNB A;  2J8S D;  2V5F A;  2XQ5 A;  1QNF A;  2VGE A;  1NA0 A;  1E8Y A;  1Z5S C;  2P9B A;  3HKE E;  2XRY A;  3FEY A;  3OBV E;  5DQV A;  5AJD A;  2WXP A;  1ZP0 A;  3FBZ A;  3UUX B;  3P8C D;  4HWF A;  3DEP A;  3ZMT B;  2C5J A;  3CST A;  2CHO A;  5L3C B;  1UJK A;  4AEZ C;  1FT1 A;  3VLF A;  4DX1 A;  4JHR A;  1O3X A;  2NOX A;  4Y6W A;  3QOF A;  4P29 A;  4GK5 E;  4CXW A;  3HRA A;  3ISM C;  4JVS A;  2FUL A;  4IDZ A;  1BI8 B;  3AB3 B;  3DEO A;  3FUD A;  3JC6 C;  3ZYM A;  4KYO B;  5JDN A;  2AE9 A;  4K5C A;  4GU5 A;  2JIW A;  4O1O A;  2MYO A;  4LER A;  5IWA T;  1U3C A;  1BLX B;  2E9X C;  1YQ3 A;  4FJZ A;  2OA5 A;  2C0L A;  4EGW A;  4CT0 A;  4B3T T;  5ABF B;  1IBL T;  2XQ9 A;  1KZP A;  3CK7 A;  3EHN A;  3EDV A;  4U3C A;  3RIU C;  5JDF A;  2XZD G;  3L17 A;  4P1N A;  4AQY T;  1TN6 A;  2XHE A;  3ASH A;  2BG9 B;  2DIW A;  2V6Y B;  5JR9 A;  4B3S T;  3CHM A;  5ENQ D;  2J4D A;  3JQ1 A;  3Q73 A;  5HI7 A;  2B0O E;  3HVE B;  3OXL A;  5LXT E;  3I4G A;  2W63 A;  5HXS A;  5AFU L;  3A8Y C;  3LBX B;  3TXM A;  4UQY A;  4AIF A;  4M1P A;  1OED E;  2I6H A;  5JR9 B;  2WXH A;  5ENS D;  3CVX A;  2MOW A;  1KPS B;  1X79 A;  1TJC A;  1OCC E;  3UM2 A;  2WPV A;  2DWG A;  1HU3 A;  1WG0 A;  4WUY A;  3CX6 B;  4U72 A;  3V30 A;  2Y4U A;  3RYF E;  3DXM G;  3L6A A;  4H9Q C;  3PS6 A;  4JEH A;  3UU3 A;  2Q9Q B;  3CHS A;  2R05 A;  4KVM A;  3CVL A;  5H7P A;  4HLL A;  3SGH A;  2JMK A;  4B93 B;  4QWN B;  4V1A v;  5IHY A;  5JVD E;  1S0P A;  4A55 A;  1IKN D;  1ZKE A;  1Z6T A;  3RRM B;  2WXM A;  4LML A;  1OWN A;  4HVB A;  1UN8 A;  5LJN A;  4PDX A;  5L2L A;  3CWZ B;  3CQG B;  3RYC E;  5F5W A;  5T4Y A;  4F7A A;  4CN1 A;  1S35 A;  4DO0 A;  3PNT B;  3ONL A;  4TNV A;  3PUA A;  4JI8 T;  2CFU A;  5JDG A;  3TXN A;  2BZB A;  5HKP A;  1MX4 A;  2SPC A;  1BU9 A;  4GIW A;  2BTD A;  2XJ7 A;  3ABK E;  5A23 A;  4L2Y A;  3LG7 A;  3TKL B;  4Y6C A;  4AY6 A;  4FA6 A;  3KDS E;  3ESK A;  5G05 J;  4ZZC A;  3MK7 C;  4QX7 B;  4U96 D;  1D1C A;  3AU5 A;  3RRW A;  2IOL A;  5FIN A;  4GTT A;  3RO3 A;  1G8X A;  1NI1 A;  3UI2 A;  5KNG A;  2KSR A;  1H19 A;  2WXN A;  5FXW A;  4GA2 A;  3Q9U C;  4AOF A;  5FQ4 A;  4GYW A;  4IHJ E;  4DR6 T;  3O48 A;  2XSB A;  2XEV A;  3TLT A;  2CWO A;  4UQX A;  2W62 A;  4GML A;  1US7 B;  5FVL A;  3LK3 B;  4CRW A;  5LMN T;  4CI1 B;  2P9I G;  4TXQ A;  4IT4 A;  4QFV A;  2WWU A;  3AE1 A;  3G2S A;  2RD0 A;  2V0P A;  4GA0 A;  5AQF B;  2RP4 A;  1XMQ T;  2CG2 A;  4JHJ A;  4HFH A;  2N1G A;  4EIW A;  4I1M A;  1EPU A;  2H3R A;  2VAS A;  3SFE A;  3PUG A;  1HS6 A;  2R59 A;  4KXK B;  3O4Z A;  4WWN A;  1S94 A;  4HE8 A;  1IBK T;  2MPK A;  4YSY A;  3KV9 A;  4RLY A;  4U0S A;  4Q25 A;  2XEE A;  3D9O A;  3T5V A;  2ODV A;  3TWV A;  5FKY A;  3I5P A;  1Z0P A;  2V7L A;  4M3O A;  4NRH B;  5JRC B;  3MXZ A;  2QYJ A;  4OFZ A;  2YK0 A;  3AAA B;  4HB5 A;  4GTO A;  5D66 A;  1B7T A;  3AEC A;  1WAO 1;  4TWD A;  2MYS A;  3AEE A;  4XEI G;  4GTP A;  3TLS A;  2AWI A;  4B8C B;  4DRX E;  3URZ A;  2F4V T;  3E37 A;  1LVF A;  3H3M A;  1K3Z D;  3SFY A;  5AAO A;  4A63 B;  3B7B A;  4PAG A;  4EZK A;  4DX2 A;  4O1P A;  4MHC A;  4U2Y A;  2ETC A;  3PZD A;  4KHP T;  5CCL A;  4NUR A;  3KVA A;  5CBO A;  1UUS A;  5HCJ A;  3NBX X;  3NRY A;  4CXX A;  1Q2Z A;  2LKG A;  1ZOY A;  3UPV A;  4B6X A;  2CHX A;  2LRK A;  5AQO B;  1WLX A;  3FZK B;  1JPL A;  2WDR A;  3J7Y q;  1OWP A;  4EHM A;  4NAC A;  2RPA A;  5AQS B;  1YD8 G;  3FHE A;  4YDE A;  4B0Z A;  2R02 A;  1SA0 E;  2DYS E;  5EDS A;  5DBK A;  1KEY A;  2DHR A;  2VB6 A;  3WAJ A;  3FY4 A;  3B7S A;  2VYI A;  2I9C A;  3V2X A;  2CXF A;  2XAJ B;  1VCS A;  3V31 A;  1OCR E;  4I6E A;  4DLO A;  3LDZ A;  3DSW A;  5LJM A;  4JI2 T;  3FUL A;  3CHQ A;  4UVC B;  5KDM C;  3E32 A;  5FY0 A;  4U07 A;  4Q94 A;  2X66 A;  4AKH A;  3PE4 A;  1HX1 B;  3AS4 A;  1D0Y A;  3PDY A;  1ZEE A;  5ETW A;  3GA8 A;  3FXD B;  3J9X 1;  3VLE A;  3B13 A;  2GRQ B;  2GRM A;  3BUA A;  3RQW A;  3K3O A;  1OCZ E;  3EU9 A;  4GTR A;  2X9Y A;  3CK9 A;  3FZF B;  4N5Q A;  2X6I A;  3GN5 A;  3P4P A;  2WWV A;  3RKO A;  3LEW A;  4ZFH A;  3CIA A;  4AXP A;  5JHA A;  2M63 A;  3QWP A;  4BES A;  5KXJ A;  2V5C A;  4A5X A;  1DNP A;  3ENE A;  3HXE A;  4TN7 B;  4FC8 A;  2PNN A;  5DAB A;  5L3F B;  1UN9 A;  2UXX B;  1JWG A;  4HXI A;  3P4Q A;  5LOV E;  2IIU A;  3TLV A;  1H7C A;  2L9Q A;  2J08 A;  2GW1 A;  3ZSS A;  4UIG A;  1OED A;  3CML A;  3RIB A;  2LOP A;  3NWI A;  4JI5 T;  3APD A;  3EIQ C;  3UT7 A;  5C3J A;  4WNG A;  3D9N A;  1KLX A;  5L3G B;  4JI7 T;  3Q49 B;  3IBP A;  5HEU A;  4V3I A;  2NW7 A;  3NF1 A;  4GZ3 A;  4WWP A;  2LOS A;  1ELR A;  2LM9 A;  1V55 E;  4UXN B;  3AJI A;  3UQ7 A;  3HXB A;  2BDE A;  2RA1 A;  4EBA G;  4WZX A;  5HEO A;  3JAE A;  2A2F X;  3AE6 A;  2YQ8 A;  4N39 A;  2LSU A;  4MKT A;  4U63 A;  2XHE B;  2YU1 A;  5ADX L;  4HFG A;  2J09 A;  4HFC A;  2J4B A;  3AEG A;  2XEN A;  5B3S E;  2XM1 A;  3UM0 A;  1FEW A;  2XAG B;  1K1B A;  5FZS A;  5A1L A;  3ZJ2 A;  4N3C A;  2W61 A;  3PZ1 A;  3JAF A;  1HS7 A;  3EAB A;  2WQ7 A;  4K0K T;  4YDO A;  2R5S A;  3Q47 B;  3NAW A;  3PNL B;  4KMO A;  3KSL A;  1SVX A;  2OCC E;  3ASG A;  3TG5 A;  4EYY R;  2P9P G;  2WBL A;  3JYS A;  3LK2 B;  3T5X A;  4CN4 A;  4G1T A;  4YTP A;  3MV3 B;  5HYA A;  4JXT A;  2QRX A;  3OTO T;  1SZA A;  2RFA A;  4TRQ A;  2L3L A;  3OJA A;  3CHO A;  4JA7 A;  3QB2 A;  5AQK B;  4W9R A;  4RVB A;  4DV3 T;  3FUN A;  2CXD A;  3FU5 A;  4J2C A;  3P2B A;  4WAF A;  2E5V A;  4CEM A;  2BG9 C;  2MAW A;  2OV9 A;  4CT4 A;  3VTY A;  1X81 A;  1MHQ A;  5FY1 A;  4CXY A;  4G11 A;  5CER B;  1K8K G;  3HXC A;  1XDO A;  4H7X A;  1TN8 A;  4OAU C;  2IO2 C;  2LXL A;  5ANL A;  2VGX A;  3SF4 A;  3ETV A;  2OOE A;  2WSS V;  3RYI E;  4WNK A;  5LHH B;  5KJK A;  4EZ4 A;  4AVX A;  4N78 D;  4TV3 A;  2VSX E;  2WAU A;  5LMU T;  3MCX A;  2QC9 A;  2XAQ B;  4BER A;  4CQI A;  3TL5 A;  2JPF A;  2R17 C;  1A17 A;  2ZIR A;  5AJL A;  3LVQ E;  1S70 B;  1UK5 A;  4H9O C;  2FUP A;  4UWG A;  3ZN0 B;  1QBQ A;  3MA9 A;  4LG6 A;  3FXE B;  2WCA A;  4KBM B;  1N4S A;  1MIY A;  2KT9 A;  4DX6 D;  2V6X A;  5AQN B;  3HI2 A;  4GTS A;  3N9Q A;  3UT8 A;  3CKD A;  2NWB A;  3W9G A;  2FJD A;  4LF4 T;  2KXP C;  2YHE A;  2WDV A;  2X9X A;  5HEH A;  3PUS A;  5KWD A;  3F2E A;  4IE5 A;  3QNK A;  1D0Z A;  3QB5 A;  4DV6 T;  3QC9 A;  5E76 A;  3VKH A;  5FXZ A;  2JQ9 A;  1GW6 A;  5KJM A;  3DP7 A;  4RSY A;  2V7K A;  4WWO A;  3ZMU B;  2IY0 C;  1N4R A;  2HE0 A;  1VRB A;  4CGW A;  2X0L B;  2XGS A;  4PUC A;  1OT8 A;  3RSE G;  3QB5 K;  5HXR A;  4QQI A;  5LYJ E;  1VCT A;  4YY3 T;  1X5B A;  2Y6X A;  3PU3 A;  4O2B E;  2J4G A;  3O1H A;  3GN5 B;  1JCS A;  4DUI A;  4DX7 D;  1O1T A;  4URK A;  3PUZ F;  3ZKR A;  1HG5 A;  3NQP A;  3GMI A;  1YMP A;  3ZT5 A;  4YTN A;  4FHK A;  3EU5 A;  3AE7 A;  4TV9 E;  3FTX A;  3QAR A;  2BBJ A;  1XDP A;  2HN1 A;  1U2V G;  3BQO A;  4GKJ T;  3LVR E;  2VKO A;  2IQC A;  5L4H A;  3O1J A;  5AAR A;  3AG1 E;  5BT1 A;  4GPM A;  3PUW F;  5BMV E;  4IYP A;  1XNF A;  3LKU A;  3SFX A;  5JQG E;  2XZE A;  4E6H A;  2KLQ A;  4NUV A;  4HWI B;  2PQN A;  3D9L A;  3SQV A;  2K24 A;  4LFA T;  2VSN A;  2FJE A;  1U3D A;  2LSI A;  3HXF A;  2NTY A;  4DV4 T;  5BUZ A;  3ZLI A;  2NSZ A;  3RK6 A;  4HWC A;  3RC8 A;  3AAE B;  4BJN A;  2OEV A;  4E7Z A;  1YYH A;  2JJ9 A;  3CR3 A;  5B1B E;  4UVB B;  3MKQ B;  1Y64 B;  2XTL A;  3CSF A;  5D2M C;  4OYK A;  4D10 C;  3ASO E;  3TJP A;  2PM7 A;  1D9S A;  1R8I A;  2H6I A;  4H9S E;  5HS0 A;  4ANV A;  2V7J A;  4XAX B;  4J8E A;  4BEP A;  4UEM A;  5HWY A;  4AV7 A;  5FQ8 A;  2BS2 A;  4LF7 T;  3UT4 A;  4RG6 A;  4U0Z A;  2EIM E;  4HFV A;  3Q2M A;  5FXV A;  3DSV A;  4JD2 G;  3PU8 A;  4H9N C;  1N0Q A;  1DU2 A;  2H6G A;  4B3R T;  4DR7 T;  2QGS A;  4ILC A;  3EIJ A;  3KEZ A;  2HYZ A;  1S63 A;  1N4Q A;  2WY2 A;  2QA7 A;  3HKC E;  3RRC A;  2V8S E;  3PRE A;  2EQX A;  4AKI A;  3FZM B;  1MQS A;  4U7Y A;  1OED B;  3EUH A;  3P4W A;  2EIJ E;  5KBA A;  1IZN B;  3OVU A;  4I6J A;  3RYH E;  1WRD A;  2HR2 A;  2QYU A;  1IHB A;  1Z3Y A;  2PJQ A;  2W2U A;  2V5Q C;  4X62 T;  4JEU B;  4ASK A;  4DBR A;  1SHZ C;  1MYO A;  2KBX A;  3Q5E A;  4JI4 T;  2DVW A;  4DI4 A;  2Q9Q D;  1V54 E;  3GZ2 A;  5LCW J;  3FU0 A;  2ZLY A;  5LBQ B;  4ZI7 E;  3AXJ A;  4YSZ A;  3FZH B;  3AVS A;  3N2G E;  3FUE A;  5AQ9 A;  1JWF A;  4DV5 T;  2WXK A;  2FJA A;  3AE5 A;  5AQQ B;  1HO8 A;  3ZN3 A;  4HOS A;  5FT9 A;  4EZL A;  5M72 A;  4TWH A;  4C0E A;  3FTZ A;  1D8E A;  3LJC A;  3AG2 E;  2HPJ A;  2B1E A;  1W0A A;  1W09 A;  4G26 A;  2C0S A;  3A7M A;  1XGW A;  3JXI A;  2EIL E;  1N94 A;  1T8B A;  2NR4 A;  4FUL A;  4CDM A;  4MAL A;  1MMD A;  1SZ9 A;  2IF4 A;  4HTE A;  1YKH B;  3EJN A;  1BR1 A;  3C4W A;  5HXE A;  1PAQ A;  2LT3 A;  3RGL A;  5CRU A;  2DLR A;  1NEN A;  2XUE A;  3A5X A;  4I1O B;  4IRE A;  3QKY A;  5EZY E;  2L0I A;  3KIN B;  2LSJ A;  5ENR D;  1TJF A;  3AEA A;  2YHC A;  5LBM A;  3IHV A;  3TWW A;  1J5E T;  1I94 T;  1ELK A;  3K8P C;  4J8F A;  4LUN U;  1N4P A;  4AP2 A;  4O60 A;  5EYL A;  3QUJ A;  5G05 C;  2LKH A;  1SA5 A;  2CA5 A;  4BWR A;  4JI0 T;  2KZ7 B;  3E33 A;  5FTP A;  2X67 A;  1ZHC A;  2DI4 A;  4HRN A;  3JXJ A;  2WQH A;  3PEU B;  2JRK A;  1SQM A;  4EBA A;  4BAY B;  1I6Z A;  1KNR A;  5E0O A;  3AG3 E;  2EIN E;  3Q7F A;  3QNU A;  4U8H A;  2E8I A;  3B95 A;  3E34 A;  2ILR A;  4XKC A;  2LE8 A;  5L3E B;  4JC8 A;  2YIN A;  5CEC B;  2E5L T;  3FTV A;  2KCV A;  3SBT B;  3UQ3 A;  5HXC A;  3VLD A;  3TLU A;  5ABE A;  2LAI A;  2P9K G;  2H6F A;  4A3T A;  3SOL A;  3ZGQ A;  4UUC A;  3QAQ A;  3SY2 A;  1WYB A;  4N2S A;  3BQK A;  4DJA A;  1D0X A;  3C3Q A;  4ME2 A;  3DSS A;  4MBQ A;  5H6Q B;  3IHR A;  1A5E A;  4WND A;  5HRY A;  4DX5 D;  1OWO A;  3R84 B;  1SE7 A;  3KV5 A;  3PUY F;  2LSY A;  2DCF A;  1NA3 A;  5EKQ D;  5E75 A;  4FLB A;  2WXJ A;  4IST A;  1E8W A;  1E7V A;  3D9I A;  3AA7 B;  2JQH A;  3CK6 A;  3J5Q B;  3ZXP A;  5J90 A;  3C3R A;  1L0V A;  4JL0 A;  4P0B A;  3VKG A;  2BKG A;  4F6R D;  1BR0 A;  4Z8X A;  2BF0 X;  4HFB A;  4DR2 T;  3DJB A;  5LGT B;  4CN6 A;  2WXQ A;  1MZC A;  3MJW A;  5HEG A;  3O9X A;  5ABG A;  4G23 A;  4RQI A;  2KWH A;  1NP7 A;  2DBA A;  4UV9 B;  4BET A;  2OEW A;  4I2W A;  4X1I E;  2JQQ A;  5EID A;  1Y01 A;  2GK9 A;  4JEH B;  3ZN1 B;  1BD8 A;  2X6J A;  3EHR A;  5FJY A;  3OPC A;  3ZEF B;  2NC9 A;  3AE2 A;  2X3M A;  5CB4 E;  4LF9 T;  4JLE A;  4ILB A;  3X2Q E;  1V9D A;  1IHG A;  4I9E A;  4TX5 A;  3S7B A;  1AWC B;  4U33 A;  1TNZ A;  1U4Q A;  3KEA A;  4DMW A;  3UUX A;  2OV8 A;  4QH5 A;  2XRZ A;  2JEK A;  3I0Q A;  5BV0 A;  3BU8 A;  3ZEF A;  1AJ3 A;  4UWH A;  3SO8 A;  4HI8 A;  3FH7 A;  3V2O A;  3UU8 A;  3EAM A;  2W4X A;  4HLE A;  2J62 A;  2EHO D;  2E9X D;  5F3J A;  3QJZ A;  4I17 A;  4FI5 A;  2XS8 A;  5FL1 A;  2YN6 A;  5EN5 D;  1N32 T;  5KMG P;  5AN8 A;  3EDU A;  1N33 T;  4A3V A;  4EED A;  4HQD A;  4AKR B;  4KX6 A;  2LO6 A;  2W66 A;  5AQM B;  4HGA A;  2P2C P;  1ELW A;  4JI3 T;  1FMV A;  3U4T A;  4DUZ T;  3CLJ A;  5CMW A;  1HE8 A;  2F0Y A;  3EI0 A;  2QZA A;  3ASD A;  5L3B B;  3EHQ A;  1E96 B;  2WXG A;  2L9B A;  4LMJ A;  4L0R A;  2VJ8 A;  4LNU D;  5G2N A;  3UX4 A;  3MKQ A;  4KZ0 A;  4Z68 A;  3L16 A;  3LDQ B;  4IDQ A;  4X20 E;  3ZUV B;  3T8O A;  3DWL G;  3E22 E;  3ZMS B;  2KM4 A;  2P9U G;  4FP7 A;  1HH8 A;  4APF A;  4JW1 A;  4XZ4 A;  3DPY A;  1WR0 A;  1E90 A;  4QX8 B;  3GW4 A;  4G25 A;  2E2A A;  4X1Y E;  1Y6I A;  3JQ0 A;  2XGO A;  4JHK A;  3PUK A;  5IUX A;  2VUR A;  2WXR A;  4CYM D;  2HHH T;  2K9A A;  4A1S A;  1TNU A;  2F37 A;  5ENO D;  5AQB A;  1MND A;  5CBN A;  3APC A;  4J8S A;  4PK6 A;  4LSZ E;  3KBT A;  1NAF A;  3H3A A;  4UI9 K;  2A72 A;  1KT0 A;  4EXT A;  4O4H E;  5A6C A;  4O6F A;  2IUB A;  3FHN A;  4I50 E;  5AQG B;  3S7D A;  3KV4 A;  4HNA D;  4WNF A;  3RAU A;  3GWH A;  3KV6 A;  2VKD A;  2V7I A;  2KCL A;  2ZXW E;  2NW9 A;  2P9N G;  3PUV F;  4C9B B;  4QHO A;  4ZS2 A;  2Y1L E;  4BFR A;  3SNX A;  3S4U A;  5JRC A;  4I0U A;  2XCB A;  1NWM X;  3H37 A;  3D3M A;  3UUB A;  4LCT A;  2MHK A;  2QVA A;  4U74 A;  3ZYK A;  3K1S A;  2GRO B;  2XAH B;  3N2K E;  3M65 A;  5LHG B;  2VVN A;  3UIO C;  5TAO A;  1D1A A;  4L5G A;  2P9L G;  3L3P A;  3RKG A;  5ABF A;  3SS1 A;  3HR0 A;  3ZHE A;  3GZS A;  2Y8D A;  2AVP A;  3NBN B;  4AIU A;  3N2O A;  4KZC A;  2J47 A;  4IN3 B;  3HA4 A;  5AIJ A;  3HIZ A;  2D2S A;  2ZM8 A;  2A9U A;  2YNQ A;  3SBS A;  3SI5 A;  2NP9 A;  1T72 A;  2VQF T;  4DR4 T;  2IC9 A;  5CRV A;  3LBX A;  2UY1 A;  3TWR A;  3ANW B;  3OXG A;  4BTB A;  2Y3A A;  2X9W A;  3AAI A;  2XCC A;  3T9K A;  1WCR A;  4PJM A;  3B7T A;  4L23 A;  3RIU A;  1E8X A;  4A97 A;  2YDQ A;  3RH3 A;  1N54 A;  1WDY A;  4XKB A;  4F6R C;  3V79 K;  3ZIM A;  1OWA A;  2WZH A;  2C0M A;  1UUR A;  4X65 T;  1WYC A;  2B6C A; 
#chains in the Genus database with same CATH homology
 3UUN A;  5HXH A;  5ANR A;  5EX0 A;  1OUV A;  3UMV A;  3IF8 B;  2VL8 A;  3FBL A;  3N9O A;  4BA9 A;  1MMN A;  3FUJ A;  2WVI A;  4EPZ A;  4EB6 E;  3SWH A;  3VU7 H;  4CCA A;  2CCQ A;  3UT5 E;  4GAA A;  2WXI A;  2I1J A;  4CGV A;  1IAP A;  3B7U X;  3CKC A;  3G2T A;  3EHM A;  1D1B A;  1Y8M A;  1H2T C;  3FTY A;  3LFM A;  3RRN B;  1MMG A;  4X1K E;  4UF0 B;  3IKO B;  4G24 A;  3QOU A;  4O4L E;  3WXX A;  1WR6 A;  5EX3 A;  3TAX A;  1EDU A;  2QFC A;  2G0U A;  3CVW A;  2A3D A;  4ABN A;  2Q7F A;  4IE6 A;  1Z3X A;  4YJ3 E;  4PJJ A;  4H63 H;  3PVL A;  3FTW A;  2E0I A;  4G63 A;  4BX8 A;  3IEG A;  4GCO A;  3BQL A;  4UV8 B;  4DI3 A;  2KAT A;  1MMA A;  2OVB A;  3ZPO A;  2X9H A;  1PC2 A;  3KS2 A;  4EYU A;  3WI3 A;  5ARF A;  2IAK A;  4IE0 A;  3ULQ A;  2JMH A;  3CQX C;  3R9A B;  5D0Q D;  5CMY A;  3KD7 A;  3FUM A;  2V1D B;  2A5U A;  4F53 A;  1BR4 A;  2IC6 A;  2VGX B;  4CDN A;  2WXF A;  2EHO B;  4BT8 A;  2FO7 A;  5JJ7 A;  3PE3 A;  4BY6 A;  4JZY A;  1QUU A;  1E7U A;  1INZ A;  3GZ1 A;  4XI9 A;  3OKQ A;  3DTO A;  3NRX A;  4OYJ A;  3RX6 A;  3EVY A;  1OXZ A;  4O4J E;  2W0G A;  2N2N A;  5FNV E;  2C2L A;  4UVA B;  1CUN A;  4F3V A;  2OND A;  3QDN A;  4OK0 A;  3DPD A;  4ADZ A;  5FY7 A;  3ZMV B;  4GK0 E;  1FMW A;  4UI9 J;  2JLB A;  3KVB A;  3U3W A;  4H63 V;  3RPU A;  1IQU A;  2N9D A;  4ANJ A;  5BPP A;  3N9N A;  2J07 A;  4KVO A;  3AA1 B;  4O8S A;  4EOZ B;  4OVV A;  4YJ2 E;  5ARG A;  3K9I A;  1E1H B;  4AI6 A;  3UFE A;  5DJQ C;  2X68 A;  3P7I A;  3U3I A;  3ZC0 A;  3SHF A;  4TV8 E;  4HOT A;  1LKX A;  3ML9 A;  2NXP A;  2IW5 B;  1PY1 A;  5G04 J;  4ZHQ E;  4IGU A;  3QK6 A;  5J2T E;  2VSO E;  1B89 A;  4ANW A;  1JUQ A;  2CWY A;  4APO A;  4L2L A;  5GON E;  4YND A;  2V4L A;  1UX5 A;  3LPZ A;  4C90 A;  4AM9 A;  3N9M A;  3CVV A;  3CVR A;  3CQC B;  2ZM2 A;  3CGH A;  4AKL A;  3I3N A;  3MX3 A;  5JDQ A;  1IJ5 A;  3N71 A;  4GB9 A;  4EZJ A;  3HHM A;  2VK9 A;  4C91 A;  4PW8 A;  1HFA A;  2A4Z A;  3LY7 A;  5G04 C;  4AY5 A;  3NZP A;  3QK0 A;  3JUI A;  2VKH A;  1EYH A;  4ISS A;  3U78 A;  2IFU A;  3AA6 B;  3VHL A;  5EK3 A;  4MFR A;  2WMO A;  2V26 A;  1BR2 A;  1TEZ A;  2KND A;  4RG9 A;  4HOR A;  4CI2 B;  3LYA A;  4AQF A;  5FP3 A;  2IJG X;  4PS3 A;  2KMF A;  2AXZ A;  4EEC A;  3E4B A;  4N5C A;  3FH8 A;  2MRI A;  3BG1 B;  2CHZ A;  2XPZ A;  1YW0 A;  5T3R A;  4FJY A;  2K5B B;  3CVY A;  3AU4 A;  3ZW3 A;  5CCM A;  2WQ6 A;  2PZI A;  4JUY A;  3QWV A;  3FU6 A;  4GZD A;  1HZ4 A;  3FUF A;  2WB2 A;  4HOU A;  2J9Q A;  2Q9Q A;  3SD5 A;  2ACX A;  2KCK A;  3LK4 2;  4B89 A;  1G73 A;  3C50 A;  3RC3 A;  1H2V C;  4ZI3 C;  4GPK A;  4HN9 A;  3HDX A;  4MRU A;  1WY6 A;  3CEQ A;  2OVF A;  4PFP A;  3MZL B;  2V7M A;  5D0O D;  2XPY A;  3KAE A;  4C0M A;  3OAW A;  3S7F A;  2YEV C;  1HXI A;  3UUM A;  5G55 A;  4XE0 A;  5AEN A;  1UJJ A;  3TGO A;  3I9Y A;  3O1I A;  4XBF B;  4JPS A;  3FTS A;  2VKJ A;  5J1G A;  5C1D A;  2VGY A;  5CA1 E;  3I4R B;  2C5K T;  2KC7 A;  1MNE A;  2D0U A;  3Q5M A;  1ZU2 A;  3L08 A;  5ENN A;  5KX5 E;  3ZFW A;  3PDN A;  2FEZ A;  3IV0 A;  2C5I T;  1N52 A;  3SFZ A;  2X6H A;  3HL6 A;  4K03 A;  2XQY A;  4KMC A;  4J8D A;  2UWJ G;  2HM8 A;  1H0A A;  2UXN B;  3KFW X;  3G2W A;  4XX5 A;  2ION A;  3LY9 A;  5CHE E;  2ZM0 A;  4DK5 A;  5JDM A;  4I1A A;  2I2O A;  2KIN B;  5BV1 A;  4ANX A;  3NZQ A;  4DVD A;  1YA0 A;  3ZVV A;  4NUU A;  5LCW C;  1UX4 A;  3C51 A;  4PH4 B;  5BW8 C;  2D0T A;  3I1A A;  2VWA A;  3TG4 A;  4GYO A;  2KZT B;  3U64 A;  2LEH A;  3AVR A;  5EK2 A;  4BX9 A;  5FXX A;  4MS6 A;  4KP3 C;  5LGN B;  3IEE A;  4DLQ A;  3RO2 A;  3BK9 A;  1KT1 A;  3MZK B;  4YLH A;  2PFV A;  5H6R B;  2LJL A;  2CHW A;  4AQF C;  3ZCJ A;  3RRU A;  4TUY E;  3CHP A;  4J6I A;  3QWW A;  3LS8 A;  4FJO A;  2PM6 A;  1UG3 A;  4O4I E;  4E85 A;  4P09 A;  2XGM A;  3QC1 A;  3S7J A;  3L54 A;  3C64 A;  4HKA A;  2DWK A;  3R7R A;  4TZ4 C;  3DBS A;  2LSG A;  2L6J A;  3OYX A;  2Q9Q C;  4AJW A;  2M67 A;  1H6K A;  3Q5X A;  1U5P A;  4N2Q A;  2IU1 A;  2E9X B;  3N9L A;  2UY1 B;  4PJN A;  5FQ7 A;  3PTR B;  2CEA A;  4IE7 A;  3Q9D A;  2KZT A;  2LSK A;  4ILI A;  5KJL A;  4PS7 A;  4PJL A;  2X6K A;  1HX8 A;  3FWV A;  3Q4A B;  3D9K A;  2AXV A;  3MV2 B;  2PL2 A;  2D5U A;  2DNX A;  2MTQ A;  2X6F A;  3AS5 A;  4ZS3 A;  3F57 A;  4CDR A;  4ZI3 D;  2FF4 A;  3I0O A;  3N9P A;  3CKB A;  4EQF A;  3FUH A;  5L3D B;  3ASF A;  4G2A A;  5C8Y E;  3LCA A;  1VOM A;  3LXU X;  5BNW A;  4L7T A;  4TUU A;  4AQG A;  1T98 A;  1FIO A;  4ACK A;  2CLY B;  3PUQ A;  3ZC1 A;  3JCK C;  4I55 E;  3JC6 D;  4K0U A;  4ILU A;  3MYV A;  4Q69 A;  2WXO A;  5LHI B;  5LA6 E;  4FAD A;  3ZPJ A;  2CG3 A;  2LHR A;  1LF8 A;  3P1U A;  4NQ0 A;  1QSD A;  3B7R L;  4J0U A;  4GYY A;  3PEV B;  1WM5 A;  3O4X E;  2VTB B;  5LFA A;  1E8Z A;  1OWL A;  2E2E A;  3PUJ A;  3L22 A;  3C4Z A;  3PUR A;  4KBQ A;  4G2V A;  5JJ6 A;  2XQ0 A;  2VTB A;  5LOZ A;  4QXH B;  4BSX A;  4BT9 A;  3HKD E;  3FP3 A;  1H2U A;  2HH7 A;  5F8P A;  4IRU A;  2EHO A;  4I4T E;  1YKE B;  2XPI A;  4L1B A;  1UCU A;  3Q5W A;  3OYZ A;  4UF0 A;  1HG2 A;  4ERR A;  3IBE A;  2PBI A;  1ZBP A;  5EK4 A;  5J08 A;  1OWM A;  2GGF A;  2YU2 A;  3LY8 A;  3ML8 A;  4UWK A;  3E0Z A;  4N3B A;  3OTN A;  4LRZ A;  5LNK A;  4H9R C;  2Y4T A;  3CX7 B;  4ANU A;  2WM9 A;  3L13 A;  3E08 A;  4ZOL E;  5LP0 A;  3FB2 A;  4PFO A;  4I43 B;  2CMR A;  3FTU A;  4UQZ A;  3RKV A;  3ZYQ A;  2VQ2 A;  4UWF A;  3CPZ A;  4YFS A;  1FCH A;  2KWI B;  5T8I A;  5JDH A;  4UWL A;  2HPL A;  4A56 A;  1QZ2 A;  3AS8 A;  5LP6 E;  2CFZ A;  4F1S A;  3CVQ A;  3G2U A;  2P58 C;  5DQW A;  2NTX A;  4ZI2 C;  4IUL A;  4PK4 A;  4XZC A;  4WBO A;  3G2V A;  5IYZ E;  4E7S A;  5HWX A;  4I9C A;  4DMV A;  4WNE A;  5FQ6 A;  5JJT A;  5AYW D;  4GA1 A;  4O2A E;  4GOU A;  2I59 A;  4ILG A;  4U0U A;  5FYM A;  2GRL A;  3C98 B;  3R7Q A;  2CXL A;  4OHF A;  3PH0 C;  2J1D G;  4MLK A;  1FVF A;  2FBN A;  4XIF A;  1KK7 A;  2H7V C;  1ZV4 X;  5KJN A;  3OXF A;  3MGB A;  5JH7 E;  3ESL A;  4B8A A;  4PS8 A;  4PNI A;  1MIV A;  4KUM B;  2L0T B;  5LGU B;  3FH5 A;  4Q96 A;  4A1G A;  3APF A;  1VDY A;  4AKG A;  5DIZ A;  4WW0 A;  2CM0 A;  1LRZ A;  3ONK A;  3MKR A;  5HQ8 A;  2PQR A;  2CLY C;  4ACL A;  4QXB B;  3GYZ A;  2DCP A;  3IHY A;  2RG8 A;  2PG8 A;  3MKD A;  4R7L A;  5FZQ A;  4H7Y A;  4XI0 A;  4ILH B;  2IOS A;  4YVO A;  2HO1 A;  1KNZ A;  2ZMA A;  1W3B A;  5HAX A;  4DPR A;  2MOZ A;  3KBU A;  5LCY A;  3F31 A;  4L9I A;  5FMN A;  4BJM A;  3NZS A;  3W15 B;  2LNI A;  3I9W A;  5JRE A;  1EZ3 A;  4LEU A;  3CVP A;  3FDH A;  2EHO C;  3D9J A;  1BPO A;  1MIW A;  4CI3 B;  4HOQ A;  3SRZ A;  5M4Y A;  4IIJ E;  4FU3 A;  3HYM B;  3FUK A;  2I1K A;  3S2A A;  2XAF B;  2X38 A;  3EDT B;  3D9M A;  3ONX A;  3CK8 A;  4OVU A;  4ATG A;  2VSY A;  2WXL A;  3FFL A;  3BQI A;  3HKB E;  2Y48 B;  3UUL A;  4IE4 A;  4YHJ A;  3MAC A;  2X51 A;  3D9P A;  3MEK A;  3K3Q C;  4QKN A;  1QQE A;  2BVL A;  3AA0 B;  1EF1 C;  3CVU A;  3ETU A;  1DVP A;  4FHJ A;  3K3N A;  4GZC A;  4BTA A;  2NW8 A;  5LG4 A;  3D0T A;  2BUG A;  3LJ3 A;  4UI9 C;  1IYG A;  5A7D B;  2QY7 A;  4N3A A;  3ZCI A;  2AXU A;  4OYS A;  3V5S A;  4I43 A;  3ZYL A;  2L8K A;  3UTK A;  3WAK A;  3ZJ1 A;  3ZXS A;  3FU3 A;  4AXH A;  3RU0 A;  2KXP B;  1P5Q A;  4B94 A;  3VTX A;  4I2Z A;  2E9X A;  5JDL A;  4GCN A;  4GMJ A;  5FWQ A;  5C2Y A;  2WMN A;  3FUI A;  2AW6 A;  2FI7 A;  3B57 A;  2J49 A;  4CZZ B;  3ZMZ B;  3ZRH A;  3CX8 B;  3T8M A;  3CVN A;  3BG0 B;  4EZH A;  2LAH A;  4WBN E;  1LVK A;  5JR9 C;  4MLP A;  3L09 A;  4P0A A;  2XAS B;  4GYR A;  2LHN A;  2ODU A;  4YVQ C;  3SZ7 A;  2ZU6 B;  2W00 A;  4ZI2 D;  2K48 A;  4GZ6 A;  3FEX A;  3U66 A;  1IQR A;  1HF8 A;  4HEA A;  4DND A;  4EAH A;  2MBG A;  3NZU A;  4JEU A;  3U9W A;  2BVM A;  4DBQ A;  1HCI A;  3V5U A;  3BEE A;  2Z6E A;  4K0R A;  3ZHE B;  1FVH A;  4I6G A;  4QXC B;  4JA9 A;  1UW4 B;  3PRZ A;  4KT6 B;  4HS2 A;  4PK5 A;  2CE7 A;  5JHB A;  5LX8 A;  3PE0 A;  2LSV A;  1NZN A;  3CHR A;  5CA0 E;  3Q15 A;  4GZ5 A;  4UEL A;  4H9P C;  3CV0 A;  3ANW A;  2H7O A;  4U04 A;  3RJV A;  3MJX A;  3HVE A;  3MA5 A;  5KCM A;  3C98 A;  3C4X A;  4GYS A;  1HTJ F;  3N5L A;  5FZR A;  1IJ6 A;  3R6N A;  1L5J A;  2ES0 A;  5J2U E;  2V5F A;  1QNF A;  1NA0 A;  1E8Y A;  2P9B A;  3HKE E;  2XRY A;  3FEY A;  3OBV E;  5DQV A;  5AJD A;  2WXP A;  3FBZ A;  3UUX B;  3P8C D;  3ZMT B;  2C5J A;  3CST A;  5L3C B;  1UJK A;  4AEZ C;  3VLF A;  4JHR A;  1O3X A;  2NOX A;  4Y6W A;  4P29 A;  4GK5 E;  4CXW A;  4JVS A;  2FUL A;  4IDZ A;  3AB3 B;  3FUD A;  3JC6 C;  3ZYM A;  4KYO B;  5JDN A;  4GU5 A;  4LER A;  1U3C A;  2E9X C;  4FJZ A;  2OA5 A;  2C0L A;  4CT0 A;  3CK7 A;  3EHN A;  3EDV A;  5JDF A;  3L17 A;  4FLH A;  2XHE A;  3ASH A;  3CHM A;  2DIW A;  5JR9 A;  5HI7 A;  2J4D A;  3JQ1 A;  3HVE B;  3OXL A;  5LXT E;  3I4G A;  2W63 A;  5HXS A;  5AFU L;  3LBX B;  3TXM A;  4UQY A;  4AIF A;  4M1P A;  5JR9 B;  2I6H A;  2WXH A;  3CVX A;  2MOW A;  1X79 A;  1TJC A;  2WPV A;  2DWG A;  1HU3 A;  4WUY A;  3CX6 B;  4U72 A;  2Y4U A;  3RYF E;  3L6A A;  4H9Q C;  3PS6 A;  4JEH A;  2Q9Q B;  3CHS A;  4KVM A;  3CVL A;  3SGH A;  2JMK A;  4A55 A;  4QWN B;  4V1A v;  5IHY A;  5JVD E;  1S0P A;  1ZKE A;  1Z6T A;  3RRM B;  2WXM A;  1OWN A;  4HVB A;  1UN8 A;  5LJN A;  4PDX A;  5L2L A;  3CWZ B;  3CQG B;  3RYC E;  5T4Y A;  4F7A A;  1S35 A;  4DO0 A;  3PNT B;  3ONL A;  3PUA A;  2CFU A;  5JDG A;  3TXN A;  2BZB A;  2SPC A;  4GIW A;  2BTD A;  5A23 A;  4L2Y A;  3LG7 A;  3TKL B;  4Y6C A;  4AY6 A;  4FA6 A;  3KDS E;  3ESK A;  5G05 J;  3MK7 C;  4QX7 B;  1D1C A;  3AU5 A;  3RRW A;  2IOL A;  3RO3 A;  1G8X A;  1H19 A;  2WXN A;  5FXW A;  4GA2 A;  4AOF A;  5FQ4 A;  4GYW A;  4IHJ E;  3O48 A;  2XEV A;  2CWO A;  4UQX A;  2W62 A;  4GML A;  1US7 B;  3LK3 B;  4CRW A;  4CI1 B;  4QFV A;  2WWU A;  3G2S A;  2RD0 A;  2V0P A;  4GA0 A;  2RP4 A;  2CG2 A;  4JHJ A;  2N1G A;  4EIW A;  4I1M A;  1EPU A;  2H3R A;  2VAS A;  3PUG A;  1HS6 A;  2R59 A;  4KXK B;  3O4Z A;  4WWN A;  1S94 A;  4HE8 A;  3KV9 A;  4U0S A;  3D9O A;  3T5V A;  2ODV A;  3I5P A;  1Z0P A;  2V7L A;  4M3O A;  4NRH B;  5JRC B;  3MXZ A;  4OFZ A;  2YK0 A;  3AAA B;  1B7T A;  1WAO 1;  2MYS A;  2AWI A;  4B8C B;  3URZ A;  1LVF A;  4PAG A;  4EZK A;  4MHC A;  3PZD A;  5CCL A;  4NUR A;  3KVA A;  3NBX X;  3NRY A;  4CXX A;  3UPV A;  4B6X A;  2CHX A;  1WLX A;  1JPL A;  3J7Y q;  1OWP A;  4NAC A;  1YD8 G;  3FHE A;  4B0Z A;  1SA0 E;  5EDS A;  5DBK A;  2DHR A;  2VB6 A;  3WAJ A;  3FY4 A;  3B7S A;  2VYI A;  2I9C A;  2CXF A;  2XAJ B;  4I6E A;  4DLO A;  3LDZ A;  5LJM A;  3FUL A;  3CHQ A;  4UVC B;  5KDM C;  5FY0 A;  4U07 A;  4Q94 A;  2X66 A;  4AKH A;  3PE4 A;  3AS4 A;  1D0Y A;  3PDY A;  1ZEE A;  5ETW A;  3GA8 A;  3FXD B;  3J9X 1;  3VLE A;  3B13 A;  2GRM A;  3K3O A;  2X9Y A;  3CK9 A;  2X6I A;  3GN5 A;  3RKO A;  3LEW A;  3CIA A;  4AXP A;  5JHA A;  2M63 A;  3QWP A;  3ENE A;  1DNP A;  4TN7 B;  4FC8 A;  5DAB A;  5L3F B;  1UN9 A;  2UXX B;  1JWG A;  4HXI A;  5LOV E;  1H7C A;  2L9Q A;  2J08 A;  2GW1 A;  4UIG A;  3CML A;  3RIB A;  2LOP A;  3APD A;  3EIQ C;  3UT7 A;  4WNG A;  3D9N A;  1KLX A;  5L3G B;  3Q49 B;  3IBP A;  4V3I A;  2NW7 A;  3NF1 A;  4GZ3 A;  4WWP A;  2LOS A;  1ELR A;  2LM9 A;  4UXN B;  2BDE A;  2RA1 A;  4EBA G;  2A2F X;  2YQ8 A;  4N39 A;  2LSU A;  4MKT A;  4U63 A;  2XHE B;  2YU1 A;  5ADX L;  4HFG A;  2J09 A;  2J4B A;  1FEW A;  2XAG B;  5FZS A;  5A1L A;  3ZJ2 A;  4N3C A;  2W61 A;  1HS7 A;  2WQ7 A;  2R5S A;  3Q47 B;  3PNL B;  4KMO A;  3ASG A;  3TG5 A;  4EYY R;  2WBL A;  3JYS A;  3LK2 B;  3T5X A;  4G1T A;  3MV3 B;  5HYA A;  4JXT A;  1SZA A;  4TRQ A;  2L3L A;  3OJA A;  3CHO A;  4JA7 A;  3QB2 A;  4W9R A;  4RVB A;  3FUN A;  2CXD A;  3FU5 A;  4J2C A;  3P2B A;  4WAF A;  4CEM A;  4CT4 A;  3VTY A;  1MHQ A;  5FY1 A;  4CXY A;  4G11 A;  4H7X A;  5ANL A;  2VGX A;  3SF4 A;  3ETV A;  2OOE A;  2WSS V;  3RYI E;  4WNK A;  5LHH B;  5KJK A;  4EZ4 A;  4AVX A;  4N78 D;  4TV3 A;  2VSX E;  2WAU A;  3MCX A;  2XAQ B;  4CQI A;  3TL5 A;  2JPF A;  2R17 C;  1A17 A;  5AJL A;  3LVQ E;  4H9O C;  4UWG A;  3ZN0 B;  3MA9 A;  3FXE B;  4KBM B;  1MIY A;  2KT9 A;  3HI2 A;  3UT8 A;  3N9Q A;  3CKD A;  2NWB A;  2YHE A;  2X9X A;  3PUS A;  3F2E A;  4IE5 A;  3QNK A;  1D0Z A;  3QC9 A;  5E76 A;  3VKH A;  5FXZ A;  1GW6 A;  5KJM A;  3DP7 A;  4RSY A;  2V7K A;  4WWO A;  3ZMU B;  1VRB A;  4CGW A;  2X0L B;  2XGS A;  4PUC A;  5HXR A;  5LYJ E;  1X5B A;  2Y6X A;  3PU3 A;  4O2B E;  3O1H A;  3GN5 B;  4URK A;  3NQP A;  1HG5 A;  3GMI A;  4FHK A;  3FTX A;  4TV9 E;  3QAR A;  3LVR E;  2VKO A;  2IQC A;  3O1J A;  5BT1 A;  5BMV E;  4IYP A;  1XNF A;  3LKU A;  4E6H A;  5JQG E;  2KLQ A;  4NUV A;  2PQN A;  3D9L A;  2K24 A;  2VSN A;  1U3D A;  2LSI A;  2NTY A;  5BUZ A;  3ZLI A;  2NSZ A;  3RK6 A;  3RC8 A;  3AAE B;  4BJN A;  4E7Z A;  2JJ9 A;  3CR3 A;  4UVB B;  3MKQ B;  1Y64 B;  2XTL A;  3CSF A;  4OYK A;  4D10 C;  3TJP A;  2PM7 A;  4H9S E;  4ANV A;  2V7J A;  4XAX B;  4J8E A;  4UEM A;  5HWY A;  4AV7 A;  5FQ8 A;  3UT4 A;  4RG6 A;  4U0Z A;  4HFV A;  3Q2M A;  5FXV A;  3PU8 A;  4H9N C;  2QGS A;  3EIJ A;  3KEZ A;  2HYZ A;  2QA7 A;  3HKC E;  3RRC A;  3PRE A;  2V8S E;  2EQX A;  4AKI A;  1MQS A;  3EUH A;  1IZN B;  4I6J A;  3RYH E;  1WRD A;  2HR2 A;  1Z3Y A;  2PJQ A;  4JEU B;  4ASK A;  4DBR A;  1SHZ C;  4DI4 A;  2Q9Q D;  3GZ2 A;  5LCW J;  3FU0 A;  2ZLY A;  5LBQ B;  4ZI7 E;  3AVS A;  3N2G E;  3FUE A;  1JWF A;  2WXK A;  1HO8 A;  3ZN3 A;  4HOS A;  5FT9 A;  4EZL A;  5M72 A;  4C0E A;  3FTZ A;  3LJC A;  2HPJ A;  2B1E A;  4G26 A;  2C0S A;  1XGW A;  4CDM A;  4FUL A;  4MAL A;  1MMD A;  1SZ9 A;  2IF4 A;  4HTE A;  1YKH B;  3EJN A;  1BR1 A;  3C4W A;  5HXE A;  1PAQ A;  2LT3 A;  2DLR A;  2XUE A;  3A5X A;  4I1O B;  3QKY A;  5EZY E;  2L0I A;  3KIN B;  2LSJ A;  1TJF A;  2YHC A;  5LBM A;  3IHV A;  1ELK A;  3K8P C;  4J8F A;  4LUN U;  4AP2 A;  3QUJ A;  5G05 C;  2CA5 A;  4BWR A;  2KZ7 B;  5FTP A;  2X67 A;  1ZHC A;  2DI4 A;  3PEU B;  2WQH A;  2JRK A;  1SQM A;  4EBA A;  4BAY B;  5E0O A;  4U8H A;  2E8I A;  2ILR A;  4XKC A;  2LE8 A;  5L3E B;  4JC8 A;  2YIN A;  3FTV A;  2KCV A;  3SBT B;  3UQ3 A;  5HXC A;  3VLD A;  2LAI A;  4A3T A;  3SOL A;  3ZGQ A;  3QAQ A;  1WYB A;  4N2S A;  3BQK A;  4DJA A;  1D0X A;  4ME2 A;  4MBQ A;  5H6Q B;  3IHR A;  4WND A;  1OWO A;  3R84 B;  3KV5 A;  2LSY A;  2DCF A;  1NA3 A;  5EKQ D;  5E75 A;  4FLB A;  2WXJ A;  4IST A;  1E8W A;  1E7V A;  3D9I A;  3AA7 B;  5J90 A;  4JL0 A;  4P0B A;  3VKG A;  1BR0 A;  4Z8X A;  2BF0 X;  3DJB A;  5LGT B;  2WXQ A;  3MJW A;  3O9X A;  4G23 A;  2KWH A;  1NP7 A;  2DBA A;  4UV9 B;  4I2W A;  4X1I E;  2JQQ A;  2GK9 A;  4JEH B;  3ZN1 B;  2X6J A;  5FJY A;  3ZEF B;  2NC9 A;  2X3M A;  5CB4 E;  4JLE A;  1V9D A;  1IHG A;  4I9E A;  4TX5 A;  3S7B A;  1U4Q A;  4DMW A;  3UUX A;  2OV8 A;  2XRZ A;  2JEK A;  3I0Q A;  5BV0 A;  3ZEF A;  1AJ3 A;  4UWH A;  3FH7 A;  4HLE A;  2EHO D;  2E9X D;  5F3J A;  3QJZ A;  4I17 A;  4FI5 A;  5KMG P;  3EDU A;  4A3V A;  4AKR B;  2LO6 A;  4HGA A;  1ELW A;  1FMV A;  3U4T A;  3CLJ A;  5CMW A;  1HE8 A;  3ASD A;  5L3B B;  1E96 B;  2WXG A;  2L9B A;  4L0R A;  2VJ8 A;  5G2N A;  3UX4 A;  3MKQ A;  4KZ0 A;  3L16 A;  4X20 E;  3T8O A;  3E22 E;  3ZMS B;  2KM4 A;  4FP7 A;  1HH8 A;  4APF A;  4JW1 A;  4XZ4 A;  1E90 A;  4QX8 B;  4G25 A;  3GW4 A;  4X1Y E;  1Y6I A;  3JQ0 A;  2XGO A;  4JHK A;  3PUK A;  2WXR A;  2K9A A;  4A1S A;  1MND A;  3APC A;  4J8S A;  4PK6 A;  3KBT A;  1NAF A;  3H3A A;  4UI9 K;  2A72 A;  1KT0 A;  4EXT A;  4O4H E;  5A6C A;  4O6F A;  3FHN A;  4I50 E;  3S7D A;  3KV4 A;  4WNF A;  3GWH A;  3KV6 A;  2VKD A;  2V7I A;  2KCL A;  2NW9 A;  4C9B B;  4QHO A;  4ZS2 A;  4BFR A;  3SNX A;  3S4U A;  5JRC A;  2XCB A;  1NWM X;  3H37 A;  3D3M A;  4LCT A;  2MHK A;  4U74 A;  3ZYK A;  2XAH B;  3N2K E;  3M65 A;  5LHG B;  5TAO A;  1D1A A;  4L5G A;  3L3P A;  3SS1 A;  3HR0 A;  3ZHE A;  3GZS A;  2Y8D A;  2AVP A;  3N2O A;  4KZC A;  4IN3 B;  3HA4 A;  5AIJ A;  3HIZ A;  2D2S A;  2ZM8 A;  2YNQ A;  3SBS A;  3SI5 A;  2NP9 A;  2IC9 A;  3LBX A;  2UY1 A;  3ANW B;  3OXG A;  4BTB A;  2Y3A A;  2X9W A;  3AAI A;  2XCC A;  4PJM A;  3B7T A;  4L23 A;  1E8X A;  3RH3 A;  1N54 A;  4XKB A;  4F6R C;  3ZIM A;  1OWA A;  2C0M A;  1WYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...