1HFAA

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, pi(4,5)p2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
total genus 100
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hfaA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hfaA01
1UJJA 1HFAA 3ZYKA 1ELKA 4AVXA 2DIWA 2QY7A 1H0AA 3D9MA 3ONKA 4Q96A 1DVPA 1MHQA 1EDUA 1SZAA 3G2UA 3G2WA 1XGWA 1UJKA 4Q94A 1X5BA 2V8SE 1JUQA 2BF0X 1HF8A 2L0TB 3G2TA 4HFGA 3D9KA 3D9PA 5J08A 4JXTA 3LDZA 1JWGA 2L0IA 2KM4A 1PY1A 3G2SA 3D9JA 1INZA 1SZ9A 1JPLA 2DCPA 4GZCA 3RRUA 1HX8A 1VDYA 4FLBA 5CMWA 1LF8A 2MOWA 3D9NA 3D9IA 3G2VA 2LO6A 1HG2A 3CLJA 3D9OA 3ZYLA 3D9LA 4NACA 3ZYMA 1HG5A 4FU3A 5LOZA 4GZDA 3ONLA 5LP0A 1JWFA 5CMYA 3ZYQA 1EYHA
chains in the Genus database with same CATH superfamily
2EHOD 2LLYA 3R84B 4PAGA 1FVHA 4DMVA 2C5IT 2WS3A 3U64A 3EU5A 1E7VA 3UMVA 4IT4A 3AEEA 4YDEA 2LSIA 3N9PA 4QH4A 2NSZA 4DR2T 4YVOA 3VLEA 5AQNB 3HXDA 3MV2B 1YKEB 2VK9A 2LSYA 5L47A 1OEDA 4O4JE 4G23A 3FUJA 2YK0A 3U3WA 4JZYA 3KD7A 2CXLA 4U04A 3SFXA 4YFSA 2P2CP 3GZ2A 3UKRG 2J47A 1EDUA 1S70B 2UXXB 4I6GA 2BKPA 4JI3T 3PUJA 4O1PA 4V3IA 3P4SA 3QWPA 2DVWA 1N4PA 1UOHA 4X8QA 1N4RA 3DEOA 4YDWA 3KV5A 5IHYA 4ANWA 1I94T 3MKQB 3TWTA 2UY1B 4O4IE 4I9EA 3MGBA 4TWDA 5FY0A 5EYPF 2E0IA 2BVLA 4HWIB 2CG2A 2J09A 3ZN3A 4WWNA 3C4ZA 5JHBA 4ADZA 3O1IA 5FQ8A 2WXNA 4UR9A 2WXJA 3FFLA 3HKBE 4DV1T 3CGHA 5BV0A 5TAOA 4DV7T 5M4YA 4IL9A 3I9WA 4YY3T 2WXPA 5BR8T 2AVPA 4F3VA 4JV5T 4TUUA 3X2QE 4MKTA 4EQFA 4LUNU 2JQ9A 4L5GA 4LFAT 1RZ4A 3KS2A 2J4GA 3A7MA 4Q25A 3RRCA 4EIWA 2XAFB 4HRMB 2JQKA 3CVWA 2XASB 3FH7A 2W61A 3DBSA 2Y48B 4IHJE 4NXNT 2NTXA 1KNZA 3HVEA 5LOVE 4QXBB 3U66A 1ZP0A 3K3QC 2V5QC 3DEPA 2N9DA 3G2VA 4LF8T 4L2YA 3ZMZB 1MMNA 3Q5MA 2IUBA 1Z8UA 2QYWA 2Y4UA 3L8RA 2FJDA 3F57A 1SA0E 1NP7A 2BKGA 3PREA 1XGWA 2J9QA 4B8CB 4JI8T 5H6RB 4BEPA 1KPSB 5EIDA 4E7ZA 4GIWA 3U9WA 2XHEB 2XQ9A 3EI0A 3SRZA 1SW6A 5EKQD 2F0YA 4DR6T 3OYXA 2H6GA 4LERA 4DV6T 4AP2A 2OV9A 3D9NA 3CSFA 2CPTA 3JQ0A 1OWOA 2LHNA 4U0UA 5FZQA 2WQHA 5F3JA 5LP0A 1FIOA 2IEJA 5LHIB 3OVUA 3UTMA 3QARA 4JVSA 4R7LA 3G2WA 5FMNA 4JUYA 3GN5B 1HNWT 2CFUA 4GA0A 3VHLA 3V5SA 3LDZA 2XSAA 5G2NA 3T8MA 2H88A 3AG3E 2CWOA 4JHRA 5FIOA 4BSZB 4DR4T 5JQGE 4FLHA 5LA6E 3KAEA 1NI1A 3GWHA 1A17A 3Q9DA 3ESKA 3E22E 3CMLA 1HFAA 4TV3A 4Q69A 4U96D 4F6RD 3ZNGA 3HXFA 5FXXA 2NR4A 3NOCD 1WFDA 2OVFA 4LRZA 1CHUA 2J62A 2YOEA 1T7SA 1INZA 3Q5WA 4UWGA 5KDMC 4HOTA 5HEOA 2JMHA 4DX1A 5A1LA 3KDSE 1E8WA 4H9SE 2LAIA 4PH4B 2OCCE 1IHGA 4HKAA 4JEUB 2IQCA 1W09A 3FZLB 1U3CA 3NRXA 4GYSA 2Q7FA 1BPOA 4BT8A 2WPVA 1IZNB 3LBXA 3APCA 3MKRA 4U8YD 1SUMB 2FEZA 1NZNA 1JWGA 5LFAA 3UTKA 5JR9C 4NQ0A 2P58C 3CPZA 3FTSA 4JEHA 4CGVA 1JCSA 2VSXE 1L5JA 2H89A 1AP7A 2I2OA 3N9MA 3JYSA 5J1GA 2FI7A 4ANJA 4FHJA 1EZ3A 4IE6A 2PQRA 4CRWA 2YKSA 2JEKA 3RIBA 3CK6A 1IJ6A 1TNYA 2YNQA 2KLQA 2ZLYA 3ZXPA 5FQ7A 2V5FA 2XM2A 4TWHA 2CXFA 3LEWA 3TWXA 4XBFB 3AB3B 3FB2A 3RAUA 3O4ZA 3VTXA 3ZSSA 5AQBA 1W3BA 2IF4A 3UQ7A 3PVLA 2E2AA 4HBDA 3VRBA 2W67A 2F8XK 3JXJA 3AE1A 3K9IA 5ENRD 5FY1A 5LGNB 4KHPT 1D8DA 4U31A 3RK6A 2J8SD 3FH5A 4YJ3E 3KBTA 2E5LT 3ZXSA 3MA9A 4KI0F 3G2SA 3IXEA 5KNHD 4YJ2E 3IBEA 3PH0C 1H6PA 4NRHB 3RIUA 1T98A 1GW6A 2BS2A 3LDQB 2C0MA 2MOWA 1MYOA 1TNZA 4KVMA 3IV0A 3ZCIA 3ZYLA 5FKYA 5D0QD 4ZI7E 3T5XA 4HFBA 3SZ7A 3MJXA 4WZXA 4FHKA 3PZ4A 1UX5A 3BQKA 4APFA 2J4DA 3FXDB 3JC6D 3J9X1 1QYMA 3JQ1A 3FEXA 3C4XA 1IBMT 4HFVA 2WWUA 2HN2A 4TZ4C 5E76A 4KUMB 4JI5T 2MYOA 3Q75A 3TXNA 1KEYA 4X20E 2NW9A 2E5VA 1TN6A 5HXRA 3ZMSB 2IC6A 4H7XA 4I17A 4NIKA 1VCSA 5EIBE 3SBTB 2B6CA 5CA1E 5JREA 3RRNB 1XDPA 3E37A 2CMRA 1N36T 3UFGA 2VTBA 2IOSA 1D1CA 3ASFA 3EUVA 2RKKA 4N39A 4H9NC 4AI6A 3C64A 2PM6A 1Z0PA 2QYUA 3KSQA 3SY2A 4IDNA 4DX7D 1OT8A 1H6KA 2K3WA 2PBIA 4XZ4A 1N4QA 2XRYA 3NB2A 5CGMA 3ZN1B 3AS4A 3AE3A 5AQIB 3UU5A 4EZKA 1DC2A 4C90A 2BEDA 1UJJA 4OAVB 2GRQB 1ELKA 2B0OE 3PUGA 3O1JA 3UXGA 5JVDE 2WWVA 4U63A 3ONKA 1H7CA 4K0UA 4DV2T 5KCMA 4PDXA 4I1MA 2MBGA 1HZ4A 2V1DB 2UUCT 4WWOA 2IW5B 4BA9A 3JC6C 3RRUA 4F1PA 2V0PA 3K3OA 2LRLA 2KCKA 3HKDE 2LSUA 4ILUA 2JJ9A 4UF0B 3NQPA 3ZW3A 1DU2A 3B5MA 5JR9B 4J8DA 2P9BA 5C2TA 4G1TA 1DCEA 3EIJA 5IUXA 3VKHA 4CDNA 1DVPA 4EAHA 5DJQC 4HWDA 4NUUA 2F8YA 2V5CA 1N95A 2IO2C 2L0IA 1OWAA 1U3DA 3ZEFA 1WR0A 3NVOA 3E32A 1N94A 3RYHE 2YEVC 5CB4E 2OVBA 1OCOE 4O6FA 3PUQA 4IDPA 4HVBA 1NAFA 5C8YE 1FPPA 2EIME 4Z68A 2A3DA 4XKBA 4XKCA 4B94A 4GU5A 2DIWA 5HEUA 3C98B 4YLHA 2LM2A 1N33T 2Q9QB 4HE8A 4IRUA 2VVNA 5ENOD 5LJMA 3SFDA 1N11A 2VSNA 3ENEA 4P1NA 1SVXA 3BQLA 3LKUA 3RHWA 4GYWA 4F6RC 2LO6A 3AA6B 4FADA 3L82A 1LD8A 4O4LE 2DZNA 4LG6A 3AE6A 3B13A 1KNPA 3Q79A 2V6YB 2UXCT 4HNAD 2HH7A 2UUBT 4U07A 1H0AA 2X9YA 4N5QA 4KBQA 4F53A 2MOZA 3Q5XA 4G26A 2ZMAA 4HLEA 1YCSB 4MFRA 4CXYA 2WMOA 4LNBA 4DK5A 4JB8P 3ULYA 2KXPB 1HG2A 4QX7B 3Q4AB 4GMLA 5ENQD 4ZS2A 1G3NB 3HIZA 4JW1A 4Y6WA 5HEHA 4YHJA 3MYVA 3R9MA 4HEAA 2XJ7A 3C51A 3SBSA 4TRQA 2R03A 4I0UA 5ANRA 2HO1A 4JI0T 1X81A 2YQ8A 2I0MA 2H6IA 3C5RA 3CVVA 4A63B 3E34A 5J2TE 1MX6A 3SHFA 3HXEA 2QZAA 1WM5A 1ZV4X 4UVCB 1MNDA 1BR4A 4GAAA 4ILHB 2X6IA 4I9CA 4RG9A 3QK0A 1U5PA 3PDYA 2XCCA 3CHRA 3O1HA 4MALA 3H3AA 2IFUA 3ML8A 2WDQA 1QNFA 1O1SA 1MQSA 4FI5A 1JCRA 2PTFA 1MMGA 4HFGA 3X1DA 2VSYA 3ZFWA 5J08A 2PM7A 2D0TA 2XSBA 3UU6A 2RFAA 4HQDA 2YN6A 2VQ2A 3AU4A 4BESA 3CX6B 3TLTA 2E9XB 2WXKA 3RYCE 3IBPA 3AA1B 4LSZE 3RH3A 3OKQA 4L1BA 2BZBA 3UM3A 4GKKT 5KJNA 3E0ZA 5FQ6A 5LG3A 3O9XA 2DYSE 3O48A 3QWVA 2KCLA 3HDXA 1KK7A 2BDEA 2X6JA 2XS8A 2EHOB 5D2MC 2PJQA 2R17C 4IE0A 4XIFA 4BETA 4XI9A 4YTPA 4IDZA 3TKLB 2VQET 4JBWF 5KNGA 3PNTB 3PEVB 2RP4A 3IEEA 4ZI3D 1U2VG 3EDVA 1WLXA 2KZ7B 5CRVA 2UU9T 4KT6B 2LSGA 3SF4A 2DCPA 4GB9A 4AQFA 3ZYKA 1ZBPA 3FTXA 2UY1A 4HRNA 2QC9A 5BXOA 3Q9NC 3P4QA 3Q49B 3SWHA 4AKIA 2XAGB 2HYZA 4U8HA 4C9BB 3V2OA 4E85A 2WXFA 3EUHA 4K03A 4BTAA 1H2UA 2W0GA 2J07A 3D9IA 3FUIA 5CHEE 3D9OA 1WR6A 4KP3C 1NWMX 2GK9A 2OV8A 4GMRA 4BT9A 4MLKA 4N5CA 2N2NA 2WXLA 4KMOA 4YSXA 1HS7A 3L9TA 3P8CD 4QHOA 4GTMA 3AE5A 4H9RC 1HXIA 5EK2A 3PU8A 3HHMA 2X6FA 4ATGA 1TNOA 3AXJA 3PZDA 3EDTB 2YU2A 3I3NA 4FULA 2X9XA 4M7CA 1DNPA 2KZTB 4GZ3A 2D2SA 3PUYF 2C0SA 4WWPA 4UUCA 3Q73A 4ISSA 5FTPA 3ISMC 3N2KE 2DYRE 5JMND 3CVUA 2BS4A 1XWMA 2R2LA 2SPCA 4YNDA 4B0ZA 2LXMA 4I1AA 4J6IA 2E8IA 3AAIA 1D1AA 4HFIA 5EILA 4U0SA 2Y3AA 4YSZA 3DJBA 5KJKA 3C72A 2QA7A 4GMJA 5CA0E 3FDHA 3UX4A 3OXGA 4AQYT 1J1JA 3CVPA 3DXKG 3AEGA 3TXMA 5KMGP 4ZZCA 3G06A 5AQQB 3UFEA 4KZCA 4QQIA 2XQ0A 3AA7B 3OJAA 4XZCA 3K1SA 2V7IA 1J5ET 3ZYQA 4LF7T 4YSYA 1EPUA 3JAFA 2P9KG 4PFPA 3OYZA 4HS2A 4P0BA 3PE3A 4J8YA 3LXUX 3EIQC 2VKDA 1XNRT 3ONXA 2J1DG 3VR9A 2WQYA 5LBQB 2CLYB 3BQIA 5HYAA 4N3AA 1E7UA 4AM9A 4C0MA 1G73A 2IC9A 4AISA 3H37A 3ZKJA 4L9PA 1ELWA 3W9FA 5BNWA 1OXJA 3CIAA 1TN8A 2XY8B 4H9QC 2ZXWE 2J08A 5JHAA 3AAAC 2X9HA 4LMLA 2QY7A 3L09A 3CWZB 1FMWA 3CHMA 2IOLA 3AU5A 3QAQA 4UI9C 5KWDA 4EYUA 3D0TA 3B7RL 3SS1A 3BU8A 3LY7A 5H7PA 1Q2ZA 5CMWA 3UUBA 3DSVA 2W62A 3FZHB 2LE8A 2KWIB 3DSUA 4YHHT 3PUXF 5CBOA 3EJNA 1OY3D 3TG4A 3UUXB 3UIPC 2VGXA 3AS5A 3AE9A 4ABNA 5HXCA 2BKOA 3PV0F 1U4QA 4X64T 4WNKA 1Z3XA 2CG3A 3I4RB 3S7DA 4DV0T 5JRCA 1WRDA 5C3JA 3JUIA 4BFRA 3DSSA 5JA4D 4LMKA 3BG0B 5ABFB 1N52A 3RIFA 3CLJA 2ACXA 3T1HT 2A5EA 1WCRA 4U2ZA 4TUYE 5LBMA 4O2AE 4OHFA 4GTPA 3F31A 4L7TA 2C2LA 2ETBA 4BWRA 5ITZF 4AKLA 3W15B 3RKOA 2DLRA 3CKBA 4Q94A 5EK4A 3U3IA 4CT4A 4ATZD 4RQIA 2WXHA 2ZIRA 4KHZF 3AJIA 1HTJF 5T8IA 3PUSA 4DJAA 2WQ6A 1YMPA 3MA5A 4UQYA 3U4TA 3L08A 3C3RA 3ZHEB 4OVVA 3EHQA 1UCUA 4EEBA 2J4BA 2JIWA 4GZDA 5AAOA 3PNLB 3LK42 4HXIA 5CCLA 2Y8DA 4N3CA 2L9QA 1WYCA 1E2AA 4I55E 3R6NA 4AVXA 3RKVA 3NKZA 2GRRB 2CHZA 4GOUA 4MBGA 4ANXA 5HQ8A 5FL0A 2K24A 2ZM0A 3C98A 3R7QA 1HNXT 3FTYA 2XEHA 4U2YA 5HRYA 2DWGA 3PUAA 3UINC 2Q9QC 4C91A 3ZEFB 1DCQA 5B1BE 1R8IA 5F5WA 2Y1LE 3FHEA 4CZ2D 2JMKA 4UWLA 1QUUA 2CLYC 3MEKA 4HFCA 1UG3A 4HFEA 2XGSA 5J90A 2BKKB 1BR2A 2XQ5A 4I4TE 3TL5A 3KEZA 3FH8A 4CN1A 4WW0A 2XEEA 5FVKA 4CZZB 4N78D 1SE7A 1FT2A 3D9JA 3JCFA 4U8VD 3F2EA 2ONDA 3TWVA 4DX5D 5D0OD 3AECA 3Q2MA 3LYAA 3V79K 5CEDB 3TJPA 4BX8A 2WZIA 2CCQA 1MX4A 2FUPA 3RIAA 4CN4A 4OYJA 4QX8B 2PL2A 4MBQA 5L3GB 4WNEA 4DV4T 2K48A 4DI3A 5BT1A 4AY6A 2CEAA 3S4UA 2J49A 5KBAA 2ZM2A 4H63H 2KCVA 3RF1A 4TN7B 2XAHB 5JDGA 2EQXA 4RVBA 5LCWJ 2DL1A 3SO8A 4G11A 2KXPC 3RQUA 4N3BA 4HOSA 3FUEA 2VL8A 4EBAG 3ZJ2A 1S35A 3PRZA 3R7RA 4GTTA 2LNIA 4MHCA 2L6BA 4A56A 3PUWF 1QSDA 3ZPOA 1FVFA 1OEDE 1VRBA 5DABA 3NZUA 2IU1A 2BVMA 2LKHA 2LRKA 4DV5T 2XPKA 2VTBB 4LMJA 4O8SA 4UEMA 2MAWA 4L0RA 2UUAT 5KX5E 1E96B 4WNFA 3IHVA 1HNZT 1FCHA 2WB5A 2KWHA 4TV8E 2GRPB 1D9SA 3MZLB 4H63V 4DVDA 5FNVE 2WCAA 5LCWC 2YINA 2Y6XA 3N5LA 2XCBA 1LVFA 4DNDA 5ABFA 5JDQA 3CQCB 2YDQA 4JC8A 4B93B 4A5XA 1XZYA 2XQAA 1V54E 3I4GA 3RRWA 2FO1E 3MX3A 2L9BA 3MKDA 2AW6A 3ZU7B 4EPZA 4FA6A 3FHNA 1IAPA 2KSRA 2VURA 3NF1A 3AG1E 5L4EA 2UXDT 1TEZA 3W9GA 1UX4A 3S7FA 1HX8A 5CFBA 1KT1A 1TN7A 1HR0T 4J7WA 2YHCA 4A97A 3NBXX 2C0LA 4Y6CA 1UK5A 5JRCB 3Q7FA 2NC9A 2FULA 1I6ZA 5AQRB 1Y6IA 5DBKA 4IE4A 2V7JA 4HOUA 3G2TA 5JJ7A 4AIFA 3N2OA 3ZT7A 3SD5A 3AEAA 3DP7A 1E8ZA 4ILBA 3DXMG 5FWQA 2IO3C 3AG2E 3BUAA 4PFOA 2CE7A 1J5WA 1YYHA 2QRXA 5E0OA 4EZHA 5A23A 2ILRA 4I6EA 4GPKA 3SOLA 3Q47B 4DX2A 4A3VA 3RYIE 4FP7A 4M3OA 3CK7A 2G0UA 2IAKA 1UUSA 2UWJG 3L6AA 3KVAA 2WY2A 3C4WA 2LT3A 2WDVA 3QC9A 2X0HA 3CQXC 4YDOA 1S64A 4P09A 2DCFA 2VJ8A 2VL0A 4U74A 3HKCE 1S0PA 2H6HA 3SNXA 3NZPA 3C3QA 2OEWA 4PW8A 3T1YT 2DBAA 2XQ7A 3GW4A 5AQKB 5ANLA 3QC1A 3CHQA 4RLYA 5G04J 1W0AA 3GMIA 5H6QB 1NFIE 1HS6A 2H7OA 3E08A 1K1AA 3PUZF 1OWPA 4BX9A 4JL0A 2A9UA 3IA3A 4ANUA 4NXMT 5LNKA 5JDNA 5B3SE 4Q96A 1MHQA 2P9IG 2BBHA 3LCAA 3R9AB 1LD7A 1HU3A 1SA4A 3PE4A 2AJAA 4O60A 3N9QA 1MIYA 4IIJE 4DO0A 2D5UA 4QXHB 1UN8A 2FF4A 5AQTB 2NYJA 1SZ9A 2WM9A 4I1OB 4GZCA 2XENA 1MMDA 5FXVA 3RI5A 2XQYA 3ANWB 3CEQA 3I9YA 5ETWA 1B89A 1T72A 5LJNA 3D3MA 4B3TT 5A6CA 4IL4A 1KF6A 2H3RA 5ENTD 4CEMA 3LSVA 4CXWA 2HM8A 2PQNA 4DR1T 2M6BA 3N2GE 4IREA 5KJMA 2X66A 3ZCJA 3FULA 4BSXA 1IBLT 2L8KA 3AXJB 2DHRA 4ZI2C 2AXUA 4X65T 3WG7E 3ESLA 2HE0A 1X79A 3M3ZB 4G2AA 2FO7A 5LHHB 3AG4E 4YDYA 3ASDA 2WXQA 4H9OC 5ABGA 5HXEA 2P9NG 2KINB 3UT7A 5G04C 1HCIA 3QNKA 5FT9A 2XRZA 1BR0A 3L3PA 4A3TA 3T8OA 3CX8B 4FJYA 4CDMA 4ZOLE 3EAMA 3HA4A 2D9DA 3ABKE 2XAJB 5BV1A 4ZHQE 2EIKE 5GONE 5AIJA 2R6GF 3UT4A 1OUVA 1Y64B 3FP3A 3NRYA 2VKHA 2X6KA 2KC7A 5AJLA 3AVRA 1K1BA 1MIVA 4G8LA 2CWYA 3KINB 1QZ2A 3KV4A 2E2EA 1TJCA 2NXPA 4WNDA 4DR5T 4I2ZA 2VQFT 2XGOA 5JH7E 5JDMA 5CEAA 3T5VA 3SQVA 2B76A 2CBJA 2NP9A 3EHZA 3LK3B 2IJGX 2OA5A 5BW8C 2XZDG 3Q9UC 3VKGA 3FXEB 4IE7A 1FJGT 4J8SA 1A5EA 4DUZT 3LPZA 5AQSB 2VYIA 5HXHA 5G05J 4CI1B 5D66A 5LMNT 5JDLA 2I59A 4QXCB 2EHOA 4AV7A 3SFYA 3NOGD 4PS8A 4XAXB 2NOXA 4PUCA 4UQXA 5BMVE 3KBUA 5LXTE 3QWWA 1UJKA 5FXWA 2V8SE 2WU2A 2A4ZA 4UV9B 2VB6A 4B89A 1YQ3A 2ES0A 1OWMA 5CRUA 3PDNA 4TWFA 3QK6A 5JJ6A 5C1DA 2FJBA 1MJ0A 2X67A 3FEYA 4AKGA 4N2QA 2YDSA 4GA1A 1N0QA 1LTXA 4LCTA 4PK5A 4COFA 1JWFA 5AQ7A 5L2LA 3GZSA 4AXPA 1IQUA 3N71A 4APOA 3FU3A 4V1Av 2IHR1 2XQ8A 4YXDA 2FJEA 4Z91A 2LUHA 2X6HA 1IBKT 5AQFB 5CJ5A 2X3MA 2V7MA 4DMWA 3NZQA 3FU5A 2NTYA 5AQPB 5FZSA 2CBIA 1XDOA 3ONLC 1TYQG 3ZHEA 2KNDA 2CFZA 3K8PC 1IKND 4N2SA 1EF1C 4X5TA 4GTSA 4TV9E 4DBRA 5HCMA 5FINA 3DSXA 3ASHA 2JRKA 1Y8MA 4P0AA 4HLLA 2WXGA 1VOMA 3RJVA 2BG9B 4X1KE 3ASOE 4E6HA 1PY1A 3ZGQA 3CHPA 3H3MA 3VRAA 3N9NA 5AQ9A 1JNZA 3LS8A 4FLBA 3UUMA 4ZXLA 5AQVB 4J8FA 4NUVA 3T8KA 3DSTA 2XUEA 2V4HC 3MKQA 3PTRB 5T4YA 3PJAJ 2V7KA 5LX8A 2RG8A 4HFHA 1OCZE 4HWFA 3RSEG 3AAAB 5FP3A 2ODUA 5A7DB 2QFCA 1KZOA 2WAUA 4IYPA 2HR2A 5AENA 2X38A 3G2UA 3LG7A 1D8EA 3PEUB 4BERA 2MYSA 5F8PA 2BG9A 5T3RA 3RKGA 2C5JA 4G8KA 2R59A 4AKRB 2XPIA 2M6IA 2DWZA 4LNGA 3OXFA 3TG5A 4A1SA 2PNNA 5BUZA 5HI7A 3ONLA 4B3MT 3QUJA 4U72A 2LOPA 4PS3A 1YKHB 5ENSD 3UQ4A 3L17A 3ZKRA 2XZTG 3D9MA 4IDOA 3SFEA 1SZAA 3FUHA 4YT0A 2DZOA 3LBXB 3P2BA 1SQMA 3B7UX 3D9PA 4JI2T 2VWAA 4K0KT 4HORA 2XAQB 4A98A 3AEBA 4CDRA 5EK3A 5EYLA 3F6QA 2WB2A 3P50A 3CKDA 5AQMB 5IYZE 4DIDB 4EB6E 2R02A 4GA2A 4AOFA 3TWUA 3FUKA 2VGXB 3Q7AA 4ZZBA 4QH5A 4F1SA 2BG9C 3OBVE 3UUNA 4FC8A 3RC3A 2CXDA 1OXZA 1PC2A 3MCXA 4GPMA 4TNVA 1D1BA 3CX7B 2P9UG 1QLBA 4LF9T 4PK4A 3QOFA 4HN9A 1YA0A 2GGFA 3NAWA 4GYRA 1WAO1 4WBNE 1Z5SC 2MHKA 4HGAA 4CN6A 3VLFA 2R05A 2DNXA 1FEWA 4JHJA 2W63A 2IONA 5L3EB 2XPYA 5G05C 5JJTA 2WXMA 1NEKA 4ACKA 3ML9A 4WAFA 3OTOT 3FUNA 2ZM8A 3FZFB 4AIUA 2CHWA 4EECA 4AQFC 4DUIA 4KBMB 5AQLB 1VCTA 4C48B 3C50A 2HN1A 4WYVA 2X68A 3Q5EA 2RA1A 4EOZB 1E90A 4OK0A 1CUNA 2CA5A 3PUVF 2F4VT 4F7AA 5FL1A 2OOEA 5HWYA 2L3LA 3FTZA 3FZKB 5J0ZA 3LK2B 2Y69E 3B7TA 4KZ0A 4U95D 4BAYB 2GRLA 3B95A 3UUXA 2C5KT 2QYJA 1LKXA 4XX5A 2WP9A 4CI2B 2X0LB 3ETVA 4HFDA 1W9RA 4DI4A 4UVBB 3UU4A 2ZISA 1VDYA 1FMVA 2ZU6B 3UI2A 2XQ4A 4DPRA 2WU5A 4NACA 2VSOE 2DI4A 1HG5A 1FT1A 2VKOA 3PJAA 3ZMTB 2BUGA 1UW4B 4GK0E 3RO2A 4DLQA 1XNFA 4JI4T 3LY9A 4EYYR 3B7SA 4UIGA 3JCKC 1OEDB 4BJNA 3LVRE 3D9KA 1KLXA 3E4BA 3KVBA 4OYKA 5FYMA 3EHRA 4GTOA 2W66A 2JABA 4TUMA 1E8XA 4L23A 2JQHA 3FU6A 1AJ3A 3QB2A 2W2UA 1TNBA 2V6YA 1TJFA 5J2UE 3L54A 2XQ6A 2Y0BG 1ZHCA 2QGSA 2P9LG 4CGWA 2FBNA 3AE7A 4GCNA 1XNQT 3FTVA 1IJ5A 3RQWA 5ARGA 1OWLA 5DQWA 3GA8A 4JHKA 3ABME 2LOSA 5LYJE 3SFZA 2KM4A 3J5PA 3IHYA 2RD0A 4B3RT 4FJZA 3P1UA 1OEDC 4WNGA 4TXRA 5AQAA 2IY0C 3UKUG 4MRUA 2F37A 1BI8B 5JDFA 1V55E 5ADXL 2ODVA 3U78A 3ZYMA 5L3FB 2A5UA 4DX6D 2V6XA 3MK7C 3PS6A 1S94A 4XI0A 3TWWA 3PZ1A 4AJWA 4X66T 4GKJT 3HXCA 3V30A 2WMNA 3TWQA 4J0UA 4DBQA 2WBLA 4WBOA 4HOQA 2XM1A 5KXJA 3FTWA 1HF8A 2E9XD 5E75A 3WAKA 5ARFA 3HI2A 4L2LA 4QKNA 1G8XA 2B1EA 1ZU2A 3ABLE 4RG6A 1OCCE 3ZT6A 2IIUA 5L3DB 3P4PA 4DR7T 3K3NA 3TLSA 2BTDA 1K8KG 2RPAA 1M62A 5IWAT 3FBLA 4I50E 2PZIA 4I6JA 3EHMA 4ERRA 3CSTA 2DWKA 2FBWA 1QQEA 2L6JA 2CRBA 4ZS3A 1IQRA 3ZIMA 2JPFA 4ILAA 3HL6A 1WDYA 2VGYA 2EINE 1HX1B 4TXQA 5CBNA 3V2XA 3DRAA 3GYZA 3KSLA 4O2BE 2WXIA 3D9LA 2EIJE 5AYWD 1E1HB 4Z8XA 4X1YE 3ZPJA 1NL4A 1KT0A 1RW2A 2N1GA 2GW1A 3OAWA 3EVYA 1N34T 2CHNA 3UM1A 3ZC0A 3HG0D 3UQ3A 2WXOA 4TX5A 4CI3B 1MZCA 3UPVA 1NA3A 2V26A 1US7B 4NPPA 2R5SA 3ULQA 3HXBA 1LRZA 3VU7H 2K9AA 3TLUA 2LHRA 3ABVA 2XEVA 1TR4A 1XMOT 4J8EA 4W9RA 4U7IA 5LB7B 4FU3A 4AKHA 3SGHA 5HS0A 2AXVA 1YQ4A 4HI8A 3NWIA 4JI6T 3VTYA 3RC8A 1JNRA 1ZB1A 3ULEG 2BF0X 5BPPA 4LF4T 1NENA 2HPJA 4L9IA 3AE8A 3NZSA 3DSWA 4I43B 3RO3A 4EZ4A 5EX3A 3HYMB 1L0VA 3RX6A 1H2VC 3LVQE 2KMFA 3ZRHA 2M63A 3ZJ1A 3O4XE 2WQ7A 3CHOA 4EZLA 4KXKB 4AXHA 3OPCA 2JQQA 3ASGA 2KT9A 3Q5DA 3AEFA 1H2TC 5ENPD 4QWNB 3ZC1A 4JI1T 4LFBT 1OWNA 3JADA 4GK5E 1P5QA 4UF0A 4GZ5A 2UXNB 1H19A 3NBNB 1ZEEA 2EILE 2V4LA 2WDRA 2VKJA 5EZYE 4O4HE 2I9CA 4ZI3C 3MV3B 3UT8A 3FTUA 4PK6A 3RLFF 4JEHB 4LF5T 3CK8A 1Z3YA 5LHGB 3OXLA 2VGEA 4UWKA 4JA9A 4ZI2D 1YXRA 3J7Yq 4JA7A 4U7EB 2WVIA 3ZT5A 2ETCA 2ZM6T 5FY7A 4YTNA 4HB5A 3FZMB 3A5XA 4UV8B 5DQVA 4K0RA 4NURA 4UI9K 5FXZA 3UM0A 3QB5A 1LVKA 3APDA 1WYBA 4GTQA 3I0OA 4XEIG 4G25A 2IMLA 4CCAA 4LF6T 3B7BA 1OCRE 2LXLA 5AQHB 2BBJA 3APFA 1IXVA 1UGOA 2L0TB 3CVYA 4CYMD 2YHEA 3ZUVB 3LJ3A 3VR8A 2M67A 2WZHA 4AQGA 4ACLA 3DPYA 4A55A 3EHNA 1BLXB 4HI9A 3ZSTA 3UU3A 3OTNA 3FUDA 3QB5K 2PFVA 4BTBA 3MACA 5HCJA 3CIRA 3RGLA 1WG0A 2RFMA 2ZGGA 1E7PA 2A72A 2NW7A 2H6FA 2OLTA 4U7YA 4U3CA 1H6OA 2LKGA 2MTQA 3V31A 4EXTA 3ONJA 2KZTA 5AQGB 1Z6TA 3TGOA 5HAXA 4OAUC 1SA5A 2GRMA 4X1IE 4LEUA 4IE5A 4BJMA 3PUKA 1W0BA 4XE0A 4MS6A 3C3OA 5IY5E 4QFVA 4YTMA 1MX2A 3HVEB 1AWCB 1D0XA 3IKOB 4X62T 2YDRA 4B8AA 2XHEA 3LY8A 3ZN0B 1O5MA 4BY6A 2X51A 3MJWA 3KFWX 1HO8A 4QH1A 2PG8A 4GTRA 3CQGB 2GRNB 5C2YA 1M7KA 2UXBT 3FUMA 1K3ZD 4GZ6A 3WXXA 3TLWA 2I6HA 1HE8A 2Y4TA 3N9LA 3QNUA 4PNIA 4DUYT 3D9HA 4GYOA 1HH8A 4UQZA 5DIZA 3RRMB 1QBQA 1N4SA 1B7TA 4ASKA 4Z90A 3N9OA 2BG9E 3Q15A 2E9XA 3UULA 2W00A 4G2VA 3CR3A 1MMAA 2XS1A 1YW0A 3IHRA 1ZKEA 3S2AA 3VLDA 3UU8A 1N9AA 3UIOC 4UWHA 2WXRA 4G24A 4FJOA 5FZRA 3WI3A 3AA0B 4G63A 3JAEA 3TAXA 1JCQA 4LFCT 1EYHA 2LSVA 4DRXE 5JDHA 4PS7A 3MZKB 4O1OA 3HKEE 2D0UA 2IDOB 3ZVVA 3V5UA 3I5PA 5FJYA 2YU1A 2XQ3A 5HEJA 4OYSA 3S7BA 3PE0A 3CVLA 4ZEYA 4ILGA 1IHBA 1N0RA 3Q78A 4CQIA 4DLOA 2LJLA 4U0ZA 3A8YC 1BD8A 2EHOC 1D0YA 2P9SG 5ABHA 4JEUA 3ZMVB 3ASNE 1GQEA 3AVSA 3CVNA 4OVUA 3FUFA 3DWLG 1V9DA 3P7IA 4HTEA 4KX6A 4M1PA 5M72A 3L39A 4JLEA 3LJNA 3TLVA 4CT0A 2E9XC 2LSKA 3BQOA 2XZEA 3RPUA 3CVQA 5HKPA 1MNEA 4GYYA 3HRAA 2I1KA 1WY6A 5ENNA 4E7SA 2VVSA 3EDUA 4A1GA 5FQ4A 4HWCA 4HWHA 4JI7T 3PZ2A 2X0YA 5LP6E 5CMYA 3IF8B 4P29A 5L3BB 3KEAA 5AN8A 2A2FX 1IYGA 3WAJA 4AEZC 4ZFHA 2K5BB 2FJAA 5CERB 3AAEB 4AY5A 4EZJA 3CV0A 1KZPA 2NWBA 3GN5A 4YVQC 3EABA 4KVOA 4UELA 3AEDA 4C0EA 1MIWA 5LGTB 4PJMA 4UVAB 5KJLA 4J2CA 5JTGA 2CHXA 3L16A 3EU9A 2NW8A 3ANWA 4PJLA 4UI9J 1T8BA 1E8YA 1ELRA 5LOZA 3QDNA 4JPSA 3T9KA 1X9BA 2I1JA 4B3ST 2Q9QD 4NIQA 3DTOA 1YD8G 3FU0A 5EX0A 3L13A 4TNWA 3CKCA 3E33A 2Q9QA 5EDSA 3BK9A 2V5DA 2V8SV 2CM0A 1NA0A 1JUQA 2XTLA 3RIUC 4K5AB 3ETUA 3FBZA 3KV6A 4IGUA 3JXIA 4UXNB 5LGUB 3MXZA 3BG1B 3PZ3A 4H7YA 1KNRA 2LSJA 3ZLIA 3PURA 4MLPA 1UURA 4OFZA 4EGWA 4WUYA 3M65A 3LJCA 3PU3A 1Y01A 3IEGA 4JYAT 5AJDA 2AXDS 1N32T 4KYOB 1BI7B 4HRLA 5EN5D 2XPZA 4JD2G 2GROB 1XMQT 2JLBA 2P9PG 3P4WA 2ZGDA 3AS8A 2V7LA 3AE4A 3I0QA 5BXUA 4UWFA 5FVLA 5ABEA 4EHMA 3BEEA 2BS3A 4U33A 1JPLA 3S7JA 5LMUT 2AWIA 1D0ZA 2MPKA 1LF8A 3KV9A 3QKYA 5HXSA 2QVAA 1BR1A 4ILCA 2XGMA 2LAHA 3FY4A 3DPDA 4DV3T 4B6XA 4PJJA 3RU0A 3CK9A 3L22A 4I2WA 2KBXA 4CXXA 3LFMA 4EEDA 4TXPA 2LEHA 4I43A 4ME2A 4K5BA 1KFYA 4IULA 5HWXA 3TWRA 4IDQA 4GTVA 4PJNA 5JR9A 3RYFE 4EV6A 2W4XA 3UM2A 3FWVA 2Z6EA 2BKNA 4ZHBA 4EBAA 1ZOYA 4ILIA 5AARA 2X9WA 3QOUA 1BU9A 5HEGA 3J5QB 3AE2A 3JUEA 4IN3B 3GZ1A 2H7VC 2OEVA 1S63A 2HHHT 4RSYA 5AQOB 5B1AE 1O1RA 3CVXA 3B57A 5L4HA 2ETAA 1UN9A 3QJZA 1TNUA 2KATA 5L3CB 4OX9T 3CHSA 3P4RA 4ISTA 2MRIA 3I1AA 5LG4A 5AQUB 3TWSA 4LNUD 5CCMA 1X5BA 5LCYA 3UT5E 4DR3T 2HPLA 3HR0A 3URZA 2ACZA 2CHOA 4JXTA 4D10C 1N54A 1O3XA 4H9PC 2AXZA 1O1TA 4K5CA 1PAQA 5CECB 5AFUL 3SI5A 4KMCA 4URKA 3E30A 4F8HA 5AQJB 2VASA 4ANVA 4GCOA 2LM9A 1SHZC 3ZMUB 5G55A 3CVRA 2WSSV 2AE9A
chains in the Genus database with same CATH topology
2EHOD 3R84B 4PAGA 1FVHA 4DMVA 2C5IT 3U64A 1E7VA 3UMVA 2LSIA 3N9PA 2NSZA 4YVOA 3VLEA 3MV2B 1YKEB 2VK9A 2LSYA 4O4JE 4G23A 3FUJA 2YK0A 3U3WA 4JZYA 3KD7A 2CXLA 4U04A 4YFSA 3GZ2A 1EDUA 2UXXB 4I6GA 4V3IA 3PUJA 3QWPA 3KV5A 5IHYA 4ANWA 3MKQB 2UY1B 4O4IE 4I9EA 3MGBA 5FY0A 2E0IA 2BVLA 2CG2A 2J09A 3ZN3A 4WWNA 3C4ZA 5JHBA 4ADZA 3O1IA 5FQ8A 2WXNA 2WXJA 3FFLA 3HKBE 3CGHA 5BV0A 5TAOA 5M4YA 3I9WA 2WXPA 2AVPA 4F3VA 4TUUA 4MKTA 4EQFA 4LUNU 4L5GA 3KS2A 4EIWA 3RRCA 2XAFB 3CVWA 2XASB 3FH7A 2W61A 3DBSA 2Y48B 4IHJE 2NTXA 1KNZA 3HVEA 5LOVE 4QXBB 3U66A 3K3QC 2N9DA 3G2VA 4L2YA 3ZMZB 1MMNA 3Q5MA 2Y4UA 3F57A 1SA0E 1NP7A 3PREA 1XGWA 2J9QA 4B8CB 5H6RB 4E7ZA 4GIWA 3U9WA 2XHEB 3SRZA 5EKQD 3OYXA 4LERA 4AP2A 3D9NA 3CSFA 3JQ0A 1OWOA 2LHNA 4U0UA 5FZQA 2WQHA 5F3JA 5LP0A 1FIOA 5LHIB 3QARA 4JVSA 4R7LA 3G2WA 5FMNA 4JUYA 3GN5B 2CFUA 4GA0A 3VHLA 3V5SA 3LDZA 5G2NA 3T8MA 2CWOA 4JHRA 5JQGE 4FLHA 5LA6E 3KAEA 3GWHA 1A17A 3Q9DA 3ESKA 3E22E 3CMLA 1HFAA 4TV3A 4Q69A 5FXXA 2OVFA 4LRZA 1INZA 3Q5WA 4UWGA 5KDMC 4HOTA 2JMHA 5A1LA 3KDSE 1E8WA 4H9SE 2LAIA 4PH4B 1IHGA 4HKAA 4JEUB 2IQCA 1U3CA 3NRXA 4GYSA 2Q7FA 1BPOA 4BT8A 2WPVA 1IZNB 3LBXA 3APCA 3MKRA 2FEZA 1NZNA 1JWGA 5LFAA 3UTKA 5JR9C 4NQ0A 2P58C 3CPZA 3FTSA 4JEHA 4CGVA 2VSXE 1L5JA 2I2OA 3N9MA 3JYSA 5J1GA 2FI7A 4ANJA 4FHJA 1EZ3A 4IE6A 2PQRA 4CRWA 2JEKA 3RIBA 1IJ6A 2YNQA 2KLQA 2ZLYA 5FQ7A 2V5FA 2CXFA 3LEWA 4XBFB 3AB3B 3FB2A 3O4ZA 3VTXA 1W3BA 2IF4A 3PVLA 3K9IA 5FY1A 5LGNB 3RK6A 3FH5A 4YJ3E 3KBTA 3ZXSA 3MA9A 3G2SA 4YJ2E 3IBEA 3PH0C 4NRHB 1GW6A 1T98A 2C0MA 2MOWA 4KVMA 3IV0A 3ZCIA 3ZYLA 5D0QD 4ZI7E 3T5XA 3SZ7A 3MJXA 4FHKA 1UX5A 3BQKA 4APFA 2J4DA 3FXDB 3JC6D 3J9X1 3JQ1A 3FEXA 3C4XA 4HFVA 2WWUA 4TZ4C 5E76A 4KUMB 3TXNA 4X20E 2NW9A 5HXRA 3ZMSB 2IC6A 4H7XA 4I17A 3SBTB 5CA1E 5JREA 3RRNB 2CMRA 2VTBA 2IOSA 1D1CA 3ASFA 4N39A 4H9NC 4AI6A 3C64A 2PM6A 1Z0PA 1H6KA 2PBIA 4XZ4A 2XRYA 3ZN1B 3AS4A 4EZKA 4C90A 1UJJA 1ELKA 3PUGA 3O1JA 5JVDE 4U63A 3ONKA 1H7CA 4K0UA 5KCMA 4PDXA 4I1MA 2MBGA 1HZ4A 2V1DB 4WWOA 2IW5B 4BA9A 3JC6C 3RRUA 2V0PA 3K3OA 2KCKA 3HKDE 2LSUA 4ILUA 2JJ9A 4UF0B 3NQPA 3ZW3A 5JR9B 4J8DA 2P9BA 4G1TA 3EIJA 4CDNA 3VKHA 1DVPA 4EAHA 5DJQC 4NUUA 2L0IA 1OWAA 1U3DA 3ZEFA 3RYHE 2YEVC 5CB4E 2OVBA 4O6FA 3PUQA 4HVBA 1NAFA 5C8YE 2A3DA 4XKBA 4XKCA 4B94A 4GU5A 2DIWA 3C98B 4YLHA 2Q9QB 4HE8A 4IRUA 5LJMA 2VSNA 3ENEA 3BQLA 3LKUA 4GYWA 4F6RC 2LO6A 3AA6B 4FADA 4O4LE 3B13A 2HH7A 4U07A 1H0AA 2X9YA 4KBQA 4F53A 2MOZA 3Q5XA 4G26A 2ZMAA 4HLEA 4MFRA 4CXYA 2WMOA 4DK5A 2KXPB 1HG2A 4QX7B 3Q4AB 4GMLA 4ZS2A 3HIZA 4JW1A 4Y6WA 4YHJA 3MYVA 4HEAA 3C51A 3SBSA 4TRQA 5ANRA 2HO1A 2YQ8A 3CVVA 5J2TE 3SHFA 1WM5A 1ZV4X 4UVCB 1MNDA 1BR4A 4GAAA 4ILHB 2X6IA 4I9CA 4RG9A 3QK0A 1U5PA 3PDYA 2XCCA 3CHRA 3O1HA 4MALA 3H3AA 2IFUA 3ML8A 1QNFA 1MQSA 4FI5A 1MMGA 4HFGA 2VSYA 3ZFWA 5J08A 2PM7A 2D0TA 2VQ2A 3AU4A 3CX6B 2E9XB 2WXKA 3RYCE 3IBPA 3AA1B 3RH3A 3OKQA 4L1BA 2BZBA 5KJNA 3E0ZA 5FQ6A 3O9XA 3O48A 3QWVA 2KCLA 3HDXA 1KK7A 2BDEA 2X6JA 2EHOB 2PJQA 2R17C 4IE0A 4XIFA 4XI9A 4IDZA 3TKLB 3PNTB 3PEVB 2RP4A 3IEEA 4ZI3D 3EDVA 1WLXA 2KZ7B 4KT6B 2LSGA 3SF4A 2DCPA 4GB9A 4AQFA 3ZYKA 1ZBPA 3FTXA 2UY1A 3Q49B 3SWHA 4AKIA 2XAGB 2HYZA 4U8HA 4C9BB 4E85A 2WXFA 3EUHA 4K03A 4BTAA 1H2UA 2W0GA 2J07A 3D9IA 3FUIA 5CHEE 3D9OA 1WR6A 4KP3C 1NWMX 2GK9A 2OV8A 4BT9A 4MLKA 4N5CA 2N2NA 2WXLA 4KMOA 1HS7A 3P8CD 4QHOA 4H9RC 1HXIA 5EK2A 3PU8A 3HHMA 2X6FA 4ATGA 3PZDA 3EDTB 2YU2A 3I3NA 4FULA 2X9XA 1DNPA 2KZTB 4GZ3A 2D2SA 2C0SA 4WWPA 5FTPA 4ISSA 3N2KE 3CVUA 2SPCA 4YNDA 4B0ZA 4I1AA 4J6IA 2E8IA 3AAIA 1D1AA 4U0SA 2Y3AA 3DJBA 5KJKA 2QA7A 4GMJA 5CA0E 3FDHA 3UX4A 3OXGA 3CVPA 3TXMA 5KMGP 4KZCA 3UFEA 2XQ0A 3AA7B 3OJAA 4XZCA 2V7IA 3ZYQA 1EPUA 4PFPA 3OYZA 4HS2A 4P0BA 3PE3A 3LXUX 3EIQC 2VKDA 3ONXA 2J1DG 5LBQB 2CLYB 3BQIA 5HYAA 4N3AA 1E7UA 4AM9A 4C0MA 1G73A 2IC9A 3H37A 1ELWA 5BNWA 3CIAA 4H9QC 2J08A 5JHAA 2X9HA 2QY7A 3L09A 3CWZB 1FMWA 3CHMA 2IOLA 3AU5A 3QAQA 4UI9C 4EYUA 3D0TA 3B7RL 3SS1A 3LY7A 5CMWA 2W62A 2LE8A 2KWIB 3EJNA 3TG4A 3UUXB 2VGXA 3AS5A 4ABNA 5HXCA 1U4QA 4WNKA 1Z3XA 2CG3A 3I4RB 3S7DA 5JRCA 1WRDA 3JUIA 4BFRA 3BG0B 1N52A 3CLJA 2ACXA 4TUYE 5LBMA 4O2AE 4OHFA 3F31A 4L7TA 2C2LA 4BWRA 4AKLA 3W15B 3RKOA 2DLRA 3CKBA 4Q94A 5EK4A 3U3IA 4CT4A 2WXHA 5T8IA 2WQ6A 1HTJF 4DJAA 3PUSA 3MA5A 4UQYA 3U4TA 3L08A 3ZHEB 4OVVA 1UCUA 2J4BA 4GZDA 3PNLB 3LK42 4HXIA 5CCLA 2Y8DA 4N3CA 2L9QA 1WYCA 4I55E 3R6NA 4AVXA 3RKVA 2CHZA 4GOUA 4ANXA 5HQ8A 2K24A 2ZM0A 3C98A 3R7QA 3FTYA 2DWGA 3PUAA 2Q9QC 4C91A 3ZEFB 3FHEA 2JMKA 4UWLA 1QUUA 2CLYC 3MEKA 1UG3A 2XGSA 5J90A 1BR2A 4I4TE 3TL5A 3KEZA 3FH8A 4WW0A 4CZZB 4N78D 3D9JA 3F2EA 2ONDA 5D0OD 3Q2MA 3LYAA 3TJPA 4BX8A 2CCQA 4OYJA 4QX8B 2PL2A 4MBQA 5L3GB 4WNEA 2K48A 4DI3A 5BT1A 4AY6A 2CEAA 3S4UA 2J49A 2ZM2A 4H63H 2KCVA 4RVBA 4TN7B 2XAHB 5JDGA 2EQXA 5LCWJ 4G11A 4N3BA 4HOSA 3FUEA 2VL8A 4EBAG 3ZJ2A 1S35A 3PRZA 3R7RA 2LNIA 4MHCA 4A56A 1QSDA 3ZPOA 1FVFA 1VRBA 5DABA 3NZUA 2IU1A 2BVMA 2VTBB 4O8SA 4UEMA 4L0RA 5KX5E 1E96B 4WNFA 3IHVA 1FCHA 2KWHA 4TV8E 3MZLB 4H63V 4DVDA 5FNVE 5LCWC 2YINA 2Y6XA 3N5LA 2XCBA 1LVFA 4DNDA 5JDQA 3CQCB 4JC8A 3I4GA 3RRWA 3MX3A 2L9BA 3MKDA 2AW6A 4EPZA 4FA6A 3FHNA 1IAPA 3NF1A 1TEZA 1UX4A 3S7FA 1HX8A 1KT1A 2YHCA 3NBXX 2C0LA 4Y6CA 5JRCB 2NC9A 2FULA 1Y6IA 5DBKA 4IE4A 2V7JA 4HOUA 3G2TA 5JJ7A 4AIFA 3N2OA 3SD5A 3DP7A 1E8ZA 5FWQA 4PFOA 2CE7A 5E0OA 4EZHA 5A23A 2ILRA 4I6EA 4GPKA 3SOLA 3Q47B 4A3VA 3RYIE 4FP7A 4M3OA 3CK7A 2G0UA 2IAKA 2UWJG 3L6AA 3KVAA 3C4WA 2LT3A 3QC9A 3CQXC 4P09A 2DCFA 2VJ8A 4U74A 3HKCE 1S0PA 3SNXA 3NZPA 4PW8A 2DBAA 3GW4A 5ANLA 3QC1A 3CHQA 5G04J 3GMIA 5H6QB 1HS6A 2H7OA 3E08A 1OWPA 4BX9A 4JL0A 4ANUA 5LNKA 5JDNA 4Q96A 1MHQA 3LCAA 3R9AB 1HU3A 3PE4A 3N9QA 1MIYA 4IIJE 4DO0A 2D5UA 4QXHB 1UN8A 2FF4A 1SZ9A 2WM9A 4I1OB 4GZCA 1MMDA 5FXVA 2XQYA 3ANWB 3CEQA 3I9YA 5ETWA 1B89A 5LJNA 3D3MA 5A6CA 2H3RA 4CEMA 4CXWA 2HM8A 2PQNA 3N2GE 5KJMA 2X66A 3ZCJA 3FULA 4BSXA 2L8KA 2DHRA 4ZI2C 2AXUA 3ESLA 1X79A 4G2AA 2FO7A 5LHHB 3ASDA 2WXQA 4H9OC 5HXEA 2KINB 3UT7A 5G04C 1HCIA 3QNKA 5FT9A 2XRZA 1BR0A 3L3PA 4A3TA 3T8OA 3CX8B 4FJYA 4CDMA 4ZOLE 3HA4A 5BV1A 2XAJB 4ZHQE 5GONE 5AIJA 3UT4A 1OUVA 1Y64B 3FP3A 3NRYA 2VKHA 2X6KA 2KC7A 5AJLA 3AVRA 1MIVA 2CWYA 3KINB 1QZ2A 3KV4A 2E2EA 1TJCA 2NXPA 4WNDA 4I2ZA 2XGOA 5JH7E 5JDMA 3T5VA 2NP9A 3LK3B 2IJGX 2OA5A 5BW8C 3VKGA 3FXEB 4IE7A 4J8SA 3LPZA 2VYIA 5HXHA 5G05J 4CI1B 5JDLA 2I59A 4QXCB 2EHOA 4AV7A 4PS8A 4XAXB 2NOXA 4PUCA 4UQXA 5BMVE 3KBUA 5LXTE 3QWWA 1UJKA 5FXWA 2V8SE 2A4ZA 4UV9B 2VB6A 4B89A 1OWMA 2ES0A 3PDNA 3QK6A 5JJ6A 5C1DA 2X67A 3FEYA 4AKGA 4N2QA 4GA1A 4LCTA 4PK5A 1JWFA 5L2LA 3GZSA 4AXPA 1IQUA 3N71A 4APOA 3FU3A 4V1Av 2X6HA 2X3MA 2V7MA 4DMWA 3NZQA 3FU5A 2NTYA 5FZSA 3ZHEA 2KNDA 2CFZA 3K8PC 4N2SA 1EF1C 4TV9E 4DBRA 3ASHA 2JRKA 1Y8MA 4P0AA 2WXGA 1VOMA 3RJVA 4X1KE 4E6HA 1PY1A 3ZGQA 3CHPA 3N9NA 3LS8A 4FLBA 3UUMA 4J8FA 4NUVA 2XUEA 3MKQA 3PTRB 5T4YA 5LX8A 2V7KA 2RG8A 3AAAB 5FP3A 2ODUA 5A7DB 2QFCA 2WAUA 4IYPA 2HR2A 5AENA 2X38A 3G2UA 3LG7A 3PEUB 2MYSA 5F8PA 5T3RA 2C5JA 2R59A 4AKRB 2XPIA 3TG5A 3OXFA 4A1SA 5BUZA 5HI7A 3ONLA 3QUJA 4U72A 2LOPA 4PS3A 1YKHB 3L17A 3D9MA 1SZAA 3FUHA 3LBXB 3P2BA 1SQMA 3B7UX 3D9PA 2VWAA 4HORA 2XAQB 4CDRA 5EK3A 2WB2A 3CKDA 5IYZE 4EB6E 4GA2A 4AOFA 3FUKA 2VGXB 4F1SA 3OBVE 3UUNA 4FC8A 3RC3A 2CXDA 1OXZA 1PC2A 3MCXA 1D1BA 3CX7B 4PK4A 2GGFA 4HN9A 1YA0A 4GYRA 1WAO1 4WBNE 2MHKA 4HGAA 3VLFA 2DNXA 1FEWA 4JHJA 2W63A 2IONA 5L3EB 2XPYA 5G05C 5JJTA 2WXMA 4ACKA 3ML9A 4WAFA 3FUNA 2ZM8A 2CHWA 4EECA 4AQFC 4KBMB 3C50A 4EOZB 2X68A 2RA1A 1E90A 4OK0A 1CUNA 2CA5A 4F7AA 2OOEA 5HWYA 2L3LA 3FTZA 3LK2B 3B7TA 4KZ0A 4BAYB 2GRLA 3UUXA 2C5KT 1LKXA 4XX5A 4CI2B 2X0LB 3ETVA 4DI4A 4UVBB 1VDYA 1FMVA 2ZU6B 4DPRA 4NACA 2VSOE 2DI4A 1HG5A 2VKOA 3ZMTB 2BUGA 1UW4B 4GK0E 3RO2A 4DLQA 1XNFA 3LY9A 4EYYR 3B7SA 4UIGA 3JCKC 4BJNA 3LVRE 3D9KA 1KLXA 3E4BA 3KVBA 4OYKA 5FYMA 1E8XA 4L23A 3FU6A 1AJ3A 3QB2A 1TJFA 5J2UE 3L54A 1ZHCA 2QGSA 4CGWA 2FBNA 4GCNA 3FTVA 1IJ5A 5ARGA 1OWLA 5DQWA 3GA8A 4JHKA 2LOSA 5LYJE 3SFZA 2KM4A 3IHYA 2RD0A 4FJZA 3P1UA 4WNGA 4MRUA 5JDFA 2A5UA 2ODVA 3U78A 3ZYMA 5ADXL 5L3FB 3MK7C 3PS6A 1S94A 4XI0A 4AJWA 2WMNA 4J0UA 4HOQA 2WBLA 4WBOA 4DBQA 3FTWA 1HF8A 2E9XD 5E75A 3WAKA 5ARFA 3HI2A 4L2LA 4QKNA 1G8XA 2B1EA 1ZU2A 4RG6A 5L3DB 3K3NA 2BTDA 3FBLA 4I50E 2PZIA 4I6JA 3EHMA 4ERRA 3CSTA 2DWKA 1QQEA 2L6JA 4ZS3A 1IQRA 3ZIMA 2JPFA 3HL6A 2VGYA 3GYZA 4O2BE 2WXIA 3D9LA 5AYWD 1E1HB 4Z8XA 4X1YE 3ZPJA 1KT0A 2N1GA 2GW1A 3OAWA 3EVYA 3ZC0A 3UQ3A 2WXOA 4TX5A 4CI3B 3UPVA 1NA3A 2V26A 1US7B 2R5SA 3ULQA 1LRZA 3VU7H 2K9AA 2LHRA 2XEVA 4J8EA 4W9RA 4FU3A 4AKHA 3SGHA 2AXVA 3VTYA 3RC8A 5BPPA 2BF0X 2HPJA 4L9IA 3NZSA 4I43B 3RO3A 4EZ4A 5EX3A 3HYMB 3RX6A 1H2VC 3LVQE 2KMFA 3ZRHA 2M63A 3ZJ1A 3O4XE 2WQ7A 3CHOA 4EZLA 4KXKB 4AXHA 2JQQA 3ASGA 2KT9A 1H2TC 4QWNB 3ZC1A 1OWNA 4GK5E 1P5QA 4UF0A 4GZ5A 2UXNB 1H19A 1ZEEA 2V4LA 2VKJA 5EZYE 4O4HE 2I9CA 4ZI3C 3MV3B 3UT8A 3FTUA 4PK6A 4JEHB 3CK8A 1Z3YA 5LHGB 3OXLA 4UWKA 4JA9A 4ZI2D 3J7Yq 4JA7A 2WVIA 5FY7A 3A5XA 4UV8B 5DQVA 4K0RA 4NURA 4UI9K 5FXZA 1LVKA 3APDA 1WYBA 3I0OA 4G25A 4CCAA 3APFA 2L0TB 3CVYA 2YHEA 3LJ3A 2M67A 4AQGA 4ACLA 4A55A 3EHNA 3OTNA 3FUDA 2PFVA 4BTBA 3MACA 2A72A 2NW7A 2MTQA 4EXTA 2KZTA 1Z6TA 3TGOA 5HAXA 2GRMA 4X1IE 4LEUA 4IE5A 4BJMA 3PUKA 4XE0A 4MS6A 4QFVA 3HVEB 1D0XA 3IKOB 4B8AA 2XHEA 3LY8A 3ZN0B 4BY6A 2X51A 3MJWA 3KFWX 1HO8A 2PG8A 3CQGB 5C2YA 4GZ6A 3FUMA 3WXXA 2I6HA 1HE8A 2Y4TA 4GYOA 3N9LA 4PNIA 4UQZA 1HH8A 5DIZA 3RRMB 1B7TA 4ASKA 3N9OA 3Q15A 2E9XA 3UULA 2W00A 4G2VA 3CR3A 1MMAA 1YW0A 3IHRA 1ZKEA 3S2AA 3VLDA 4UWHA 2WXRA 4G24A 4FJOA 5FZRA 3WI3A 3AA0B 4G63A 3TAXA 1EYHA 2LSVA 5JDHA 4PS7A 3MZKB 3HKEE 2D0UA 3ZVVA 3V5UA 3I5PA 5FJYA 2YU1A 4OYSA 3S7BA 3PE0A 3CVLA 4ILGA 4CQIA 4DLOA 2LJLA 4U0ZA 2EHOC 1D0YA 4JEUA 3ZMVB 3AVSA 3CVNA 4OVUA 3FUFA 1V9DA 3P7IA 4HTEA 4M1PA 5M72A 4JLEA 4CT0A 2E9XC 2LSKA 3CVQA 3RPUA 1MNEA 4GYYA 2I1KA 1WY6A 5ENNA 4E7SA 3EDUA 4A1GA 5FQ4A 5LP6E 5CMYA 3IF8B 4P29A 5L3BB 2A2FX 1IYGA 3WAJA 4AEZC 2K5BB 3AAEB 4AY5A 4EZJA 3CV0A 3GN5A 2NWBA 4YVQC 4KVOA 4UELA 4C0EA 1MIWA 5LGTB 4PJMA 4UVAB 5KJLA 4J2CA 2CHXA 3L16A 2NW8A 3ANWA 4PJLA 4UI9J 1E8YA 1ELRA 5LOZA 3QDNA 4JPSA 2I1JA 2Q9QD 3DTOA 1YD8G 3FU0A 5EX0A 3L13A 5EDSA 3CKCA 2Q9QA 3BK9A 2CM0A 1NA0A 1JUQA 2XTLA 3ETUA 3FBZA 3KV6A 4IGUA 4UXNB 5LGUB 3BG1B 3MXZA 4H7YA 2LSJA 3ZLIA 3PURA 4MLPA 4OFZA 4WUYA 3M65A 3LJCA 3PU3A 3IEGA 5AJDA 4KYOB 2XPZA 2JLBA 3AS8A 2V7LA 3I0QA 4UWFA 3BEEA 1JPLA 3S7JA 2AWIA 1D0ZA 1LF8A 3KV9A 3QKYA 5HXSA 1BR1A 2XGMA 2LAHA 3FY4A 3DPDA 4B6XA 4PJJA 3RU0A 3CK9A 3L22A 4I2WA 4CXXA 3LFMA 2LEHA 4I43A 4ME2A 4IULA 5HWXA 4PJNA 5JR9A 3RYFE 3FWVA 2Z6EA 4EBAA 4ILIA 2X9WA 3QOUA 4IN3B 3GZ1A 2H7VC 4RSYA 3CVXA 3B57A 1UN9A 3QJZA 2KATA 5L3CB 3CHSA 4ISTA 2MRIA 3I1AA 5LG4A 5CCMA 1X5BA 5LCYA 3UT5E 2HPLA 3HR0A 3URZA 4JXTA 4D10C 1N54A 1O3XA 4H9PC 2AXZA 1PAQA 5AFUL 3SI5A 4KMCA 4URKA 2VASA 4ANVA 4GCOA 2LM9A 1SHZC 3ZMUB 5G55A 3CVRA 2WSSV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJJ A;  1HFA A;  3ZYK A;  1ELK A;  4AVX A;  2DIW A;  2QY7 A;  1H0A A;  3D9M A;  3ONK A;  4Q96 A;  1DVP A;  1MHQ A;  1EDU A;  1SZA A;  3G2U A;  3G2W A;  1XGW A;  1UJK A;  4Q94 A;  1X5B A;  2V8S E;  1JUQ A;  2BF0 X;  1HF8 A;  2L0T B;  3G2T A;  4HFG A;  3D9K A;  3D9P A;  5J08 A;  4JXT A;  3LDZ A;  1JWG A;  2L0I A;  2KM4 A;  1PY1 A;  3G2S A;  3D9J A;  1INZ A;  1SZ9 A;  1JPL A;  2DCP A;  4GZC A;  3RRU A;  1HX8 A;  1VDY A;  4FLB A;  5CMW A;  1LF8 A;  2MOW A;  3D9N A;  3D9I A;  3G2V A;  2LO6 A;  1HG2 A;  3CLJ A;  3D9O A;  3ZYL A;  3D9L A;  4NAC A;  3ZYM A;  1HG5 A;  4FU3 A;  5LOZ A;  4GZD A;  3ONL A;  5LP0 A;  1JWF A;  5CMY A;  3ZYQ A;  1EYH A; 
#chains in the Genus database with same CATH topology
 2EHO D;  2LLY A;  3R84 B;  4PAG A;  1FVH A;  4DMV A;  2C5I T;  2WS3 A;  3U64 A;  3EU5 A;  1E7V A;  3UMV A;  4IT4 A;  3AEE A;  4YDE A;  2LSI A;  3N9P A;  4QH4 A;  2NSZ A;  4DR2 T;  4YVO A;  3VLE A;  5AQN B;  3HXD A;  3MV2 B;  1YKE B;  2VK9 A;  2LSY A;  5L47 A;  1OED A;  4O4J E;  4G23 A;  3FUJ A;  2YK0 A;  3U3W A;  4JZY A;  3KD7 A;  2CXL A;  4U04 A;  3SFX A;  4YFS A;  2P2C P;  3GZ2 A;  3UKR G;  2J47 A;  1EDU A;  1S70 B;  2UXX B;  4I6G A;  2BKP A;  4JI3 T;  3PUJ A;  4O1P A;  4V3I A;  3P4S A;  3QWP A;  2DVW A;  1N4P A;  1UOH A;  4X8Q A;  1N4R A;  3DEO A;  4YDW A;  3KV5 A;  5IHY A;  4ANW A;  1I94 T;  3MKQ B;  3TWT A;  2UY1 B;  4O4I E;  4I9E A;  3MGB A;  4TWD A;  5FY0 A;  5EYP F;  2E0I A;  2BVL A;  4HWI B;  2CG2 A;  2J09 A;  3ZN3 A;  4WWN A;  3C4Z A;  5JHB A;  4ADZ A;  3O1I A;  5FQ8 A;  2WXN A;  4UR9 A;  2WXJ A;  3FFL A;  3HKB E;  4DV1 T;  3CGH A;  5BV0 A;  5TAO A;  4DV7 T;  5M4Y A;  4IL9 A;  3I9W A;  4YY3 T;  2WXP A;  5BR8 T;  2AVP A;  4F3V A;  4JV5 T;  4TUU A;  3X2Q E;  4MKT A;  4EQF A;  4LUN U;  2JQ9 A;  4L5G A;  4LFA T;  1RZ4 A;  3KS2 A;  2J4G A;  3A7M A;  4Q25 A;  3RRC A;  4EIW A;  2XAF B;  4HRM B;  2JQK A;  3CVW A;  2XAS B;  3FH7 A;  2W61 A;  3DBS A;  2Y48 B;  4IHJ E;  4NXN T;  2NTX A;  1KNZ A;  3HVE A;  5LOV E;  4QXB B;  3U66 A;  1ZP0 A;  3K3Q C;  2V5Q C;  3DEP A;  2N9D A;  3G2V A;  4LF8 T;  4L2Y A;  3ZMZ B;  1MMN A;  3Q5M A;  2IUB A;  1Z8U A;  2QYW A;  2Y4U A;  3L8R A;  2FJD A;  3F57 A;  1SA0 E;  1NP7 A;  2BKG A;  3PRE A;  1XGW A;  2J9Q A;  4B8C B;  4JI8 T;  5H6R B;  4BEP A;  1KPS B;  5EID A;  4E7Z A;  4GIW A;  3U9W A;  2XHE B;  2XQ9 A;  3EI0 A;  3SRZ A;  1SW6 A;  5EKQ D;  2F0Y A;  4DR6 T;  3OYX A;  2H6G A;  4LER A;  4DV6 T;  4AP2 A;  2OV9 A;  3D9N A;  3CSF A;  2CPT A;  3JQ0 A;  1OWO A;  2LHN A;  4U0U A;  5FZQ A;  2WQH A;  5F3J A;  5LP0 A;  1FIO A;  2IEJ A;  5LHI B;  3OVU A;  3UTM A;  3QAR A;  4JVS A;  4R7L A;  3G2W A;  5FMN A;  4JUY A;  3GN5 B;  1HNW T;  2CFU A;  4GA0 A;  3VHL A;  3V5S A;  3LDZ A;  2XSA A;  5G2N A;  3T8M A;  2H88 A;  3AG3 E;  2CWO A;  4JHR A;  5FIO A;  4BSZ B;  4DR4 T;  5JQG E;  4FLH A;  5LA6 E;  3KAE A;  1NI1 A;  3GWH A;  1A17 A;  3Q9D A;  3ESK A;  3E22 E;  3CML A;  1HFA A;  4TV3 A;  4Q69 A;  4U96 D;  4F6R D;  3ZNG A;  3HXF A;  5FXX A;  2NR4 A;  3NOC D;  1WFD A;  2OVF A;  4LRZ A;  1CHU A;  2J62 A;  2YOE A;  1T7S A;  1INZ A;  3Q5W A;  4UWG A;  5KDM C;  4HOT A;  5HEO A;  2JMH A;  4DX1 A;  5A1L A;  3KDS E;  1E8W A;  4H9S E;  2LAI A;  4PH4 B;  2OCC E;  1IHG A;  4HKA A;  4JEU B;  2IQC A;  1W09 A;  3FZL B;  1U3C A;  3NRX A;  4GYS A;  2Q7F A;  1BPO A;  4BT8 A;  2WPV A;  1IZN B;  3LBX A;  3APC A;  3MKR A;  4U8Y D;  1SUM B;  2FEZ A;  1NZN A;  1JWG A;  5LFA A;  3UTK A;  5JR9 C;  4NQ0 A;  2P58 C;  3CPZ A;  3FTS A;  4JEH A;  4CGV A;  1JCS A;  2VSX E;  1L5J A;  2H89 A;  1AP7 A;  2I2O A;  3N9M A;  3JYS A;  5J1G A;  2FI7 A;  4ANJ A;  4FHJ A;  1EZ3 A;  4IE6 A;  2PQR A;  4CRW A;  2YKS A;  2JEK A;  3RIB A;  3CK6 A;  1IJ6 A;  1TNY A;  2YNQ A;  2KLQ A;  2ZLY A;  3ZXP A;  5FQ7 A;  2V5F A;  2XM2 A;  4TWH A;  2CXF A;  3LEW A;  3TWX A;  4XBF B;  3AB3 B;  3FB2 A;  3RAU A;  3O4Z A;  3VTX A;  3ZSS A;  5AQB A;  1W3B A;  2IF4 A;  3UQ7 A;  3PVL A;  2E2A A;  4HBD A;  3VRB A;  2W67 A;  2F8X K;  3JXJ A;  3AE1 A;  3K9I A;  5ENR D;  5FY1 A;  5LGN B;  4KHP T;  1D8D A;  4U31 A;  3RK6 A;  2J8S D;  3FH5 A;  4YJ3 E;  3KBT A;  2E5L T;  3ZXS A;  3MA9 A;  4KI0 F;  3G2S A;  3IXE A;  5KNH D;  4YJ2 E;  3IBE A;  3PH0 C;  1H6P A;  4NRH B;  3RIU A;  1T98 A;  1GW6 A;  2BS2 A;  3LDQ B;  2C0M A;  2MOW A;  1MYO A;  1TNZ A;  4KVM A;  3IV0 A;  3ZCI A;  3ZYL A;  5FKY A;  5D0Q D;  4ZI7 E;  3T5X A;  4HFB A;  3SZ7 A;  3MJX A;  4WZX A;  4FHK A;  3PZ4 A;  1UX5 A;  3BQK A;  4APF A;  2J4D A;  3FXD B;  3JC6 D;  3J9X 1;  1QYM A;  3JQ1 A;  3FEX A;  3C4X A;  1IBM T;  4HFV A;  2WWU A;  2HN2 A;  4TZ4 C;  5E76 A;  4KUM B;  4JI5 T;  2MYO A;  3Q75 A;  3TXN A;  1KEY A;  4X20 E;  2NW9 A;  2E5V A;  1TN6 A;  5HXR A;  3ZMS B;  2IC6 A;  4H7X A;  4I17 A;  4NIK A;  1VCS A;  5EIB E;  3SBT B;  2B6C A;  5CA1 E;  5JRE A;  3RRN B;  1XDP A;  3E37 A;  2CMR A;  1N36 T;  3UFG A;  2VTB A;  2IOS A;  1D1C A;  3ASF A;  3EUV A;  2RKK A;  4N39 A;  4H9N C;  4AI6 A;  3C64 A;  2PM6 A;  1Z0P A;  2QYU A;  3KSQ A;  3SY2 A;  4IDN A;  4DX7 D;  1OT8 A;  1H6K A;  2K3W A;  2PBI A;  4XZ4 A;  1N4Q A;  2XRY A;  3NB2 A;  5CGM A;  3ZN1 B;  3AS4 A;  3AE3 A;  5AQI B;  3UU5 A;  4EZK A;  1DC2 A;  4C90 A;  2BED A;  1UJJ A;  4OAV B;  2GRQ B;  1ELK A;  2B0O E;  3PUG A;  3O1J A;  3UXG A;  5JVD E;  2WWV A;  4U63 A;  3ONK A;  1H7C A;  4K0U A;  4DV2 T;  5KCM A;  4PDX A;  4I1M A;  2MBG A;  1HZ4 A;  2V1D B;  2UUC T;  4WWO A;  2IW5 B;  4BA9 A;  3JC6 C;  3RRU A;  4F1P A;  2V0P A;  3K3O A;  2LRL A;  2KCK A;  3HKD E;  2LSU A;  4ILU A;  2JJ9 A;  4UF0 B;  3NQP A;  3ZW3 A;  1DU2 A;  3B5M A;  5JR9 B;  4J8D A;  2P9B A;  5C2T A;  4G1T A;  1DCE A;  3EIJ A;  5IUX A;  3VKH A;  4CDN A;  1DVP A;  4EAH A;  5DJQ C;  4HWD A;  4NUU A;  2F8Y A;  2V5C A;  1N95 A;  2IO2 C;  2L0I A;  1OWA A;  1U3D A;  3ZEF A;  1WR0 A;  3NVO A;  3E32 A;  1N94 A;  3RYH E;  2YEV C;  5CB4 E;  2OVB A;  1OCO E;  4O6F A;  3PUQ A;  4IDP A;  4HVB A;  1NAF A;  5C8Y E;  1FPP A;  2EIM E;  4Z68 A;  2A3D A;  4XKB A;  4XKC A;  4B94 A;  4GU5 A;  2DIW A;  5HEU A;  3C98 B;  4YLH A;  2LM2 A;  1N33 T;  2Q9Q B;  4HE8 A;  4IRU A;  2VVN A;  5ENO D;  5LJM A;  3SFD A;  1N11 A;  2VSN A;  3ENE A;  4P1N A;  1SVX A;  3BQL A;  3LKU A;  3RHW A;  4GYW A;  4F6R C;  2LO6 A;  3AA6 B;  4FAD A;  3L82 A;  1LD8 A;  4O4L E;  2DZN A;  4LG6 A;  3AE6 A;  3B13 A;  1KNP A;  3Q79 A;  2V6Y B;  2UXC T;  4HNA D;  2HH7 A;  2UUB T;  4U07 A;  1H0A A;  2X9Y A;  4N5Q A;  4KBQ A;  4F53 A;  2MOZ A;  3Q5X A;  4G26 A;  2ZMA A;  4HLE A;  1YCS B;  4MFR A;  4CXY A;  2WMO A;  4LNB A;  4DK5 A;  4JB8 P;  3ULY A;  2KXP B;  1HG2 A;  4QX7 B;  3Q4A B;  4GML A;  5ENQ D;  4ZS2 A;  1G3N B;  3HIZ A;  4JW1 A;  4Y6W A;  5HEH A;  4YHJ A;  3MYV A;  3R9M A;  4HEA A;  2XJ7 A;  3C51 A;  3SBS A;  4TRQ A;  2R03 A;  4I0U A;  5ANR A;  2HO1 A;  4JI0 T;  1X81 A;  2YQ8 A;  2I0M A;  2H6I A;  3C5R A;  3CVV A;  4A63 B;  3E34 A;  5J2T E;  1MX6 A;  3SHF A;  3HXE A;  2QZA A;  1WM5 A;  1ZV4 X;  4UVC B;  1MND A;  1BR4 A;  4GAA A;  4ILH B;  2X6I A;  4I9C A;  4RG9 A;  3QK0 A;  1U5P A;  3PDY A;  2XCC A;  3CHR A;  3O1H A;  4MAL A;  3H3A A;  2IFU A;  3ML8 A;  2WDQ A;  1QNF A;  1O1S A;  1MQS A;  4FI5 A;  1JCR A;  2PTF A;  1MMG A;  4HFG A;  3X1D A;  2VSY A;  3ZFW A;  5J08 A;  2PM7 A;  2D0T A;  2XSB A;  3UU6 A;  2RFA A;  4HQD A;  2YN6 A;  2VQ2 A;  3AU4 A;  4BES A;  3CX6 B;  3TLT A;  2E9X B;  2WXK A;  3RYC E;  3IBP A;  3AA1 B;  4LSZ E;  3RH3 A;  3OKQ A;  4L1B A;  2BZB A;  3UM3 A;  4GKK T;  5KJN A;  3E0Z A;  5FQ6 A;  5LG3 A;  3O9X A;  2DYS E;  3O48 A;  3QWV A;  2KCL A;  3HDX A;  1KK7 A;  2BDE A;  2X6J A;  2XS8 A;  2EHO B;  5D2M C;  2PJQ A;  2R17 C;  4IE0 A;  4XIF A;  4BET A;  4XI9 A;  4YTP A;  4IDZ A;  3TKL B;  2VQE T;  4JBW F;  5KNG A;  3PNT B;  3PEV B;  2RP4 A;  3IEE A;  4ZI3 D;  1U2V G;  3EDV A;  1WLX A;  2KZ7 B;  5CRV A;  2UU9 T;  4KT6 B;  2LSG A;  3SF4 A;  2DCP A;  4GB9 A;  4AQF A;  3ZYK A;  1ZBP A;  3FTX A;  2UY1 A;  4HRN A;  2QC9 A;  5BXO A;  3Q9N C;  3P4Q A;  3Q49 B;  3SWH A;  4AKI A;  2XAG B;  2HYZ A;  4U8H A;  4C9B B;  3V2O A;  4E85 A;  2WXF A;  3EUH A;  4K03 A;  4BTA A;  1H2U A;  2W0G A;  2J07 A;  3D9I A;  3FUI A;  5CHE E;  3D9O A;  1WR6 A;  4KP3 C;  1NWM X;  2GK9 A;  2OV8 A;  4GMR A;  4BT9 A;  4MLK A;  4N5C A;  2N2N A;  2WXL A;  4KMO A;  4YSX A;  1HS7 A;  3L9T A;  3P8C D;  4QHO A;  4GTM A;  3AE5 A;  4H9R C;  1HXI A;  5EK2 A;  3PU8 A;  3HHM A;  2X6F A;  4ATG A;  1TNO A;  3AXJ A;  3PZD A;  3EDT B;  2YU2 A;  3I3N A;  4FUL A;  2X9X A;  4M7C A;  1DNP A;  2KZT B;  4GZ3 A;  2D2S A;  3PUY F;  2C0S A;  4WWP A;  4UUC A;  3Q73 A;  4ISS A;  5FTP A;  3ISM C;  3N2K E;  2DYR E;  5JMN D;  3CVU A;  2BS4 A;  1XWM A;  2R2L A;  2SPC A;  4YND A;  4B0Z A;  2LXM A;  4I1A A;  4J6I A;  2E8I A;  3AAI A;  1D1A A;  4HFI A;  5EIL A;  4U0S A;  2Y3A A;  4YSZ A;  3DJB A;  5KJK A;  3C72 A;  2QA7 A;  4GMJ A;  5CA0 E;  3FDH A;  3UX4 A;  3OXG A;  4AQY T;  1J1J A;  3CVP A;  3DXK G;  3AEG A;  3TXM A;  5KMG P;  4ZZC A;  3G06 A;  5AQQ B;  3UFE A;  4KZC A;  4QQI A;  2XQ0 A;  3AA7 B;  3OJA A;  4XZC A;  3K1S A;  2V7I A;  1J5E T;  3ZYQ A;  4LF7 T;  4YSY A;  1EPU A;  3JAF A;  2P9K G;  4PFP A;  3OYZ A;  4HS2 A;  4P0B A;  3PE3 A;  4J8Y A;  3LXU X;  3EIQ C;  2VKD A;  1XNR T;  3ONX A;  2J1D G;  3VR9 A;  2WQY A;  5LBQ B;  2CLY B;  3BQI A;  5HYA A;  4N3A A;  1E7U A;  4AM9 A;  4C0M A;  1G73 A;  2IC9 A;  4AIS A;  3H37 A;  3ZKJ A;  4L9P A;  1ELW A;  3W9F A;  5BNW A;  1OXJ A;  3CIA A;  1TN8 A;  2XY8 B;  4H9Q C;  2ZXW E;  2J08 A;  5JHA A;  3AAA C;  2X9H A;  4LML A;  2QY7 A;  3L09 A;  3CWZ B;  1FMW A;  3CHM A;  2IOL A;  3AU5 A;  3QAQ A;  4UI9 C;  5KWD A;  4EYU A;  3D0T A;  3B7R L;  3SS1 A;  3BU8 A;  3LY7 A;  5H7P A;  1Q2Z A;  5CMW A;  3UUB A;  3DSV A;  2W62 A;  3FZH B;  2LE8 A;  2KWI B;  3DSU A;  4YHH T;  3PUX F;  5CBO A;  3EJN A;  1OY3 D;  3TG4 A;  3UUX B;  3UIP C;  2VGX A;  3AS5 A;  3AE9 A;  4ABN A;  5HXC A;  2BKO A;  3PV0 F;  1U4Q A;  4X64 T;  4WNK A;  1Z3X A;  2CG3 A;  3I4R B;  3S7D A;  4DV0 T;  5JRC A;  1WRD A;  5C3J A;  3JUI A;  4BFR A;  3DSS A;  5JA4 D;  4LMK A;  3BG0 B;  5ABF B;  1N52 A;  3RIF A;  3CLJ A;  2ACX A;  3T1H T;  2A5E A;  1WCR A;  4U2Z A;  4TUY E;  5LBM A;  4O2A E;  4OHF A;  4GTP A;  3F31 A;  4L7T A;  2C2L A;  2ETB A;  4BWR A;  5ITZ F;  4AKL A;  3W15 B;  3RKO A;  2DLR A;  3CKB A;  4Q94 A;  5EK4 A;  3U3I A;  4CT4 A;  4ATZ D;  4RQI A;  2WXH A;  2ZIR A;  4KHZ F;  3AJI A;  1HTJ F;  5T8I A;  3PUS A;  4DJA A;  2WQ6 A;  1YMP A;  3MA5 A;  4UQY A;  3U4T A;  3L08 A;  3C3R A;  3ZHE B;  4OVV A;  3EHQ A;  1UCU A;  4EEB A;  2J4B A;  2JIW A;  4GZD A;  5AAO A;  3PNL B;  3LK4 2;  4HXI A;  5CCL A;  2Y8D A;  4N3C A;  2L9Q A;  1WYC A;  1E2A A;  4I55 E;  3R6N A;  4AVX A;  3RKV A;  3NKZ A;  2GRR B;  2CHZ A;  4GOU A;  4MBG A;  4ANX A;  5HQ8 A;  5FL0 A;  2K24 A;  2ZM0 A;  3C98 A;  3R7Q A;  1HNX T;  3FTY A;  2XEH A;  4U2Y A;  5HRY A;  2DWG A;  3PUA A;  3UIN C;  2Q9Q C;  4C91 A;  3ZEF B;  1DCQ A;  5B1B E;  1R8I A;  5F5W A;  2Y1L E;  3FHE A;  4CZ2 D;  2JMK A;  4UWL A;  1QUU A;  2CLY C;  3MEK A;  4HFC A;  1UG3 A;  4HFE A;  2XGS A;  5J90 A;  2BKK B;  1BR2 A;  2XQ5 A;  4I4T E;  3TL5 A;  3KEZ A;  3FH8 A;  4CN1 A;  4WW0 A;  2XEE A;  5FVK A;  4CZZ B;  4N78 D;  1SE7 A;  1FT2 A;  3D9J A;  3JCF A;  4U8V D;  3F2E A;  2OND A;  3TWV A;  4DX5 D;  5D0O D;  3AEC A;  3Q2M A;  3LYA A;  3V79 K;  5CED B;  3TJP A;  4BX8 A;  2WZI A;  2CCQ A;  1MX4 A;  2FUP A;  3RIA A;  4CN4 A;  4OYJ A;  4QX8 B;  2PL2 A;  4MBQ A;  5L3G B;  4WNE A;  4DV4 T;  2K48 A;  4DI3 A;  5BT1 A;  4AY6 A;  2CEA A;  3S4U A;  2J49 A;  5KBA A;  2ZM2 A;  4H63 H;  2KCV A;  3RF1 A;  4TN7 B;  2XAH B;  5JDG A;  2EQX A;  4RVB A;  5LCW J;  2DL1 A;  3SO8 A;  4G11 A;  2KXP C;  3RQU A;  4N3B A;  4HOS A;  3FUE A;  2VL8 A;  4EBA G;  3ZJ2 A;  1S35 A;  3PRZ A;  3R7R A;  4GTT A;  2LNI A;  4MHC A;  2L6B A;  4A56 A;  3PUW F;  1QSD A;  3ZPO A;  1FVF A;  1OED E;  1VRB A;  5DAB A;  3NZU A;  2IU1 A;  2BVM A;  2LKH A;  2LRK A;  4DV5 T;  2XPK A;  2VTB B;  4LMJ A;  4O8S A;  4UEM A;  2MAW A;  4L0R A;  2UUA T;  5KX5 E;  1E96 B;  4WNF A;  3IHV A;  1HNZ T;  1FCH A;  2WB5 A;  2KWH A;  4TV8 E;  2GRP B;  1D9S A;  3MZL B;  4H63 V;  4DVD A;  5FNV E;  2WCA A;  5LCW C;  2YIN A;  2Y6X A;  3N5L A;  2XCB A;  1LVF A;  4DND A;  5ABF A;  5JDQ A;  3CQC B;  2YDQ A;  4JC8 A;  4B93 B;  4A5X A;  1XZY A;  2XQA A;  1V54 E;  3I4G A;  3RRW A;  2FO1 E;  3MX3 A;  2L9B A;  3MKD A;  2AW6 A;  3ZU7 B;  4EPZ A;  4FA6 A;  3FHN A;  1IAP A;  2KSR A;  2VUR A;  3NF1 A;  3AG1 E;  5L4E A;  2UXD T;  1TEZ A;  3W9G A;  1UX4 A;  3S7F A;  1HX8 A;  5CFB A;  1KT1 A;  1TN7 A;  1HR0 T;  4J7W A;  2YHC A;  4A97 A;  3NBX X;  2C0L A;  4Y6C A;  1UK5 A;  5JRC B;  3Q7F A;  2NC9 A;  2FUL A;  1I6Z A;  5AQR B;  1Y6I A;  5DBK A;  4IE4 A;  2V7J A;  4HOU A;  3G2T A;  5JJ7 A;  4AIF A;  3N2O A;  3ZT7 A;  3SD5 A;  3AEA A;  3DP7 A;  1E8Z A;  4ILB A;  3DXM G;  5FWQ A;  2IO3 C;  3AG2 E;  3BUA A;  4PFO A;  2CE7 A;  1J5W A;  1YYH A;  2QRX A;  5E0O A;  4EZH A;  5A23 A;  2ILR A;  4I6E A;  4GPK A;  3SOL A;  3Q47 B;  4DX2 A;  4A3V A;  3RYI E;  4FP7 A;  4M3O A;  3CK7 A;  2G0U A;  2IAK A;  1UUS A;  2UWJ G;  3L6A A;  3KVA A;  2WY2 A;  3C4W A;  2LT3 A;  2WDV A;  3QC9 A;  2X0H A;  3CQX C;  4YDO A;  1S64 A;  4P09 A;  2DCF A;  2VJ8 A;  2VL0 A;  4U74 A;  3HKC E;  1S0P A;  2H6H A;  3SNX A;  3NZP A;  3C3Q A;  2OEW A;  4PW8 A;  3T1Y T;  2DBA A;  2XQ7 A;  3GW4 A;  5AQK B;  5ANL A;  3QC1 A;  3CHQ A;  4RLY A;  5G04 J;  1W0A A;  3GMI A;  5H6Q B;  1NFI E;  1HS6 A;  2H7O A;  3E08 A;  1K1A A;  3PUZ F;  1OWP A;  4BX9 A;  4JL0 A;  2A9U A;  3IA3 A;  4ANU A;  4NXM T;  5LNK A;  5JDN A;  5B3S E;  4Q96 A;  1MHQ A;  2P9I G;  2BBH A;  3LCA A;  3R9A B;  1LD7 A;  1HU3 A;  1SA4 A;  3PE4 A;  2AJA A;  4O60 A;  3N9Q A;  1MIY A;  4IIJ E;  4DO0 A;  2D5U A;  4QXH B;  1UN8 A;  2FF4 A;  5AQT B;  2NYJ A;  1SZ9 A;  2WM9 A;  4I1O B;  4GZC A;  2XEN A;  1MMD A;  5FXV A;  3RI5 A;  2XQY A;  3ANW B;  3CEQ A;  3I9Y A;  5ETW A;  1B89 A;  1T72 A;  5LJN A;  3D3M A;  4B3T T;  5A6C A;  4IL4 A;  1KF6 A;  2H3R A;  5ENT D;  4CEM A;  3LSV A;  4CXW A;  2HM8 A;  2PQN A;  4DR1 T;  2M6B A;  3N2G E;  4IRE A;  5KJM A;  2X66 A;  3ZCJ A;  3FUL A;  4BSX A;  1IBL T;  2L8K A;  3AXJ B;  2DHR A;  4ZI2 C;  2AXU A;  4X65 T;  3WG7 E;  3ESL A;  2HE0 A;  1X79 A;  3M3Z B;  4G2A A;  2FO7 A;  5LHH B;  3AG4 E;  4YDY A;  3ASD A;  2WXQ A;  4H9O C;  5ABG A;  5HXE A;  2P9N G;  2KIN B;  3UT7 A;  5G04 C;  1HCI A;  3QNK A;  5FT9 A;  2XRZ A;  1BR0 A;  3L3P A;  4A3T A;  3T8O A;  3CX8 B;  4FJY A;  4CDM A;  4ZOL E;  3EAM A;  3HA4 A;  2D9D A;  3ABK E;  2XAJ B;  5BV1 A;  4ZHQ E;  2EIK E;  5GON E;  5AIJ A;  2R6G F;  3UT4 A;  1OUV A;  1Y64 B;  3FP3 A;  3NRY A;  2VKH A;  2X6K A;  2KC7 A;  5AJL A;  3AVR A;  1K1B A;  1MIV A;  4G8L A;  2CWY A;  3KIN B;  1QZ2 A;  3KV4 A;  2E2E A;  1TJC A;  2NXP A;  4WND A;  4DR5 T;  4I2Z A;  2VQF T;  2XGO A;  5JH7 E;  5JDM A;  5CEA A;  3T5V A;  3SQV A;  2B76 A;  2CBJ A;  2NP9 A;  3EHZ A;  3LK3 B;  2IJG X;  2OA5 A;  5BW8 C;  2XZD G;  3Q9U C;  3VKG A;  3FXE B;  4IE7 A;  1FJG T;  4J8S A;  1A5E A;  4DUZ T;  3LPZ A;  5AQS B;  2VYI A;  5HXH A;  5G05 J;  4CI1 B;  5D66 A;  5LMN T;  5JDL A;  2I59 A;  4QXC B;  2EHO A;  4AV7 A;  3SFY A;  3NOG D;  4PS8 A;  4XAX B;  2NOX A;  4PUC A;  4UQX A;  5BMV E;  3KBU A;  5LXT E;  3QWW A;  1UJK A;  5FXW A;  2V8S E;  2WU2 A;  2A4Z A;  4UV9 B;  2VB6 A;  4B89 A;  1YQ3 A;  2ES0 A;  1OWM A;  5CRU A;  3PDN A;  4TWF A;  3QK6 A;  5JJ6 A;  5C1D A;  2FJB A;  1MJ0 A;  2X67 A;  3FEY A;  4AKG A;  4N2Q A;  2YDS A;  4GA1 A;  1N0Q A;  1LTX A;  4LCT A;  4PK5 A;  4COF A;  1JWF A;  5AQ7 A;  5L2L A;  3GZS A;  4AXP A;  1IQU A;  3N71 A;  4APO A;  3FU3 A;  4V1A v;  2IHR 1;  2XQ8 A;  4YXD A;  2FJE A;  4Z91 A;  2LUH A;  2X6H A;  1IBK T;  5AQF B;  5CJ5 A;  2X3M A;  2V7M A;  4DMW A;  3NZQ A;  3FU5 A;  2NTY A;  5AQP B;  5FZS A;  2CBI A;  1XDO A;  3ONL C;  1TYQ G;  3ZHE A;  2KND A;  2CFZ A;  3K8P C;  1IKN D;  4N2S A;  1EF1 C;  4X5T A;  4GTS A;  4TV9 E;  4DBR A;  5HCM A;  5FIN A;  3DSX A;  3ASH A;  2JRK A;  1Y8M A;  4P0A A;  4HLL A;  2WXG A;  1VOM A;  3RJV A;  2BG9 B;  4X1K E;  3ASO E;  4E6H A;  1PY1 A;  3ZGQ A;  3CHP A;  3H3M A;  3VRA A;  3N9N A;  5AQ9 A;  1JNZ A;  3LS8 A;  4FLB A;  3UUM A;  4ZXL A;  5AQV B;  4J8F A;  4NUV A;  3T8K A;  3DST A;  2XUE A;  2V4H C;  3MKQ A;  3PTR B;  5T4Y A;  3PJA J;  2V7K A;  5LX8 A;  2RG8 A;  4HFH A;  1OCZ E;  4HWF A;  3RSE G;  3AAA B;  5FP3 A;  2ODU A;  5A7D B;  2QFC A;  1KZO A;  2WAU A;  4IYP A;  2HR2 A;  5AEN A;  2X38 A;  3G2U A;  3LG7 A;  1D8E A;  3PEU B;  4BER A;  2MYS A;  5F8P A;  2BG9 A;  5T3R A;  3RKG A;  2C5J A;  4G8K A;  2R59 A;  4AKR B;  2XPI A;  2M6I A;  2DWZ A;  4LNG A;  3OXF A;  3TG5 A;  4A1S A;  2PNN A;  5BUZ A;  5HI7 A;  3ONL A;  4B3M T;  3QUJ A;  4U72 A;  2LOP A;  4PS3 A;  1YKH B;  5ENS D;  3UQ4 A;  3L17 A;  3ZKR A;  2XZT G;  3D9M A;  4IDO A;  3SFE A;  1SZA A;  3FUH A;  4YT0 A;  2DZO A;  3LBX B;  3P2B A;  1SQM A;  3B7U X;  3D9P A;  4JI2 T;  2VWA A;  4K0K T;  4HOR A;  2XAQ B;  4A98 A;  3AEB A;  4CDR A;  5EK3 A;  5EYL A;  3F6Q A;  2WB2 A;  3P50 A;  3CKD A;  5AQM B;  5IYZ E;  4DID B;  4EB6 E;  2R02 A;  4GA2 A;  4AOF A;  3TWU A;  3FUK A;  2VGX B;  3Q7A A;  4ZZB A;  4QH5 A;  4F1S A;  2BG9 C;  3OBV E;  3UUN A;  4FC8 A;  3RC3 A;  2CXD A;  1OXZ A;  1PC2 A;  3MCX A;  4GPM A;  4TNV A;  1D1B A;  3CX7 B;  2P9U G;  1QLB A;  4LF9 T;  4PK4 A;  3QOF A;  4HN9 A;  1YA0 A;  2GGF A;  3NAW A;  4GYR A;  1WAO 1;  4WBN E;  1Z5S C;  2MHK A;  4HGA A;  4CN6 A;  3VLF A;  2R05 A;  2DNX A;  1FEW A;  4JHJ A;  2W63 A;  2ION A;  5L3E B;  2XPY A;  5G05 C;  5JJT A;  2WXM A;  1NEK A;  4ACK A;  3ML9 A;  4WAF A;  3OTO T;  3FUN A;  2ZM8 A;  3FZF B;  4AIU A;  2CHW A;  4EEC A;  4AQF C;  4DUI A;  4KBM B;  5AQL B;  1VCT A;  4C48 B;  3C50 A;  2HN1 A;  4WYV A;  2X68 A;  3Q5E A;  2RA1 A;  4EOZ B;  1E90 A;  4OK0 A;  1CUN A;  2CA5 A;  3PUV F;  2F4V T;  4F7A A;  5FL1 A;  2OOE A;  5HWY A;  2L3L A;  3FTZ A;  3FZK B;  5J0Z A;  3LK2 B;  2Y69 E;  3B7T A;  4KZ0 A;  4U95 D;  4BAY B;  2GRL A;  3B95 A;  3UUX A;  2C5K T;  2QYJ A;  1LKX A;  4XX5 A;  2WP9 A;  4CI2 B;  2X0L B;  3ETV A;  4HFD A;  1W9R A;  4DI4 A;  4UVB B;  3UU4 A;  2ZIS A;  1VDY A;  1FMV A;  2ZU6 B;  3UI2 A;  2XQ4 A;  4DPR A;  2WU5 A;  4NAC A;  2VSO E;  2DI4 A;  1HG5 A;  1FT1 A;  2VKO A;  3PJA A;  3ZMT B;  2BUG A;  1UW4 B;  4GK0 E;  3RO2 A;  4DLQ A;  1XNF A;  4JI4 T;  3LY9 A;  4EYY R;  3B7S A;  4UIG A;  3JCK C;  1OED B;  4BJN A;  3LVR E;  3D9K A;  1KLX A;  3E4B A;  3KVB A;  4OYK A;  5FYM A;  3EHR A;  4GTO A;  2W66 A;  2JAB A;  4TUM A;  1E8X A;  4L23 A;  2JQH A;  3FU6 A;  1AJ3 A;  3QB2 A;  2W2U A;  1TNB A;  2V6Y A;  1TJF A;  5J2U E;  3L54 A;  2XQ6 A;  2Y0B G;  1ZHC A;  2QGS A;  2P9L G;  4CGW A;  2FBN A;  3AE7 A;  4GCN A;  1XNQ T;  3FTV A;  1IJ5 A;  3RQW A;  5ARG A;  1OWL A;  5DQW A;  3GA8 A;  4JHK A;  3ABM E;  2LOS A;  5LYJ E;  3SFZ A;  2KM4 A;  3J5P A;  3IHY A;  2RD0 A;  4B3R T;  4FJZ A;  3P1U A;  1OED C;  4WNG A;  4TXR A;  5AQA A;  2IY0 C;  3UKU G;  4MRU A;  2F37 A;  1BI8 B;  5JDF A;  1V55 E;  5ADX L;  2ODV A;  3U78 A;  3ZYM A;  5L3F B;  2A5U A;  4DX6 D;  2V6X A;  3MK7 C;  3PS6 A;  1S94 A;  4XI0 A;  3TWW A;  3PZ1 A;  4AJW A;  4X66 T;  4GKJ T;  3HXC A;  3V30 A;  2WMN A;  3TWQ A;  4J0U A;  4DBQ A;  2WBL A;  4WBO A;  4HOQ A;  2XM1 A;  5KXJ A;  3FTW A;  1HF8 A;  2E9X D;  5E75 A;  3WAK A;  5ARF A;  3HI2 A;  4L2L A;  4QKN A;  1G8X A;  2B1E A;  1ZU2 A;  3ABL E;  4RG6 A;  1OCC E;  3ZT6 A;  2IIU A;  5L3D B;  3P4P A;  4DR7 T;  3K3N A;  3TLS A;  2BTD A;  1K8K G;  2RPA A;  1M62 A;  5IWA T;  3FBL A;  4I50 E;  2PZI A;  4I6J A;  3EHM A;  4ERR A;  3CST A;  2DWK A;  2FBW A;  1QQE A;  2L6J A;  2CRB A;  4ZS3 A;  1IQR A;  3ZIM A;  2JPF A;  4ILA A;  3HL6 A;  1WDY A;  2VGY A;  2EIN E;  1HX1 B;  4TXQ A;  5CBN A;  3V2X A;  3DRA A;  3GYZ A;  3KSL A;  4O2B E;  2WXI A;  3D9L A;  2EIJ E;  5AYW D;  1E1H B;  4Z8X A;  4X1Y E;  3ZPJ A;  1NL4 A;  1KT0 A;  1RW2 A;  2N1G A;  2GW1 A;  3OAW A;  3EVY A;  1N34 T;  2CHN A;  3UM1 A;  3ZC0 A;  3HG0 D;  3UQ3 A;  2WXO A;  4TX5 A;  4CI3 B;  1MZC A;  3UPV A;  1NA3 A;  2V26 A;  1US7 B;  4NPP A;  2R5S A;  3ULQ A;  3HXB A;  1LRZ A;  3VU7 H;  2K9A A;  3TLU A;  2LHR A;  3ABV A;  2XEV A;  1TR4 A;  1XMO T;  4J8E A;  4W9R A;  4U7I A;  5LB7 B;  4FU3 A;  4AKH A;  3SGH A;  5HS0 A;  2AXV A;  1YQ4 A;  4HI8 A;  3NWI A;  4JI6 T;  3VTY A;  3RC8 A;  1JNR A;  1ZB1 A;  3ULE G;  2BF0 X;  5BPP A;  4LF4 T;  1NEN A;  2HPJ A;  4L9I A;  3AE8 A;  3NZS A;  3DSW A;  4I43 B;  3RO3 A;  4EZ4 A;  5EX3 A;  3HYM B;  1L0V A;  3RX6 A;  1H2V C;  3LVQ E;  2KMF A;  3ZRH A;  2M63 A;  3ZJ1 A;  3O4X E;  2WQ7 A;  3CHO A;  4EZL A;  4KXK B;  4AXH A;  3OPC A;  2JQQ A;  3ASG A;  2KT9 A;  3Q5D A;  3AEF A;  1H2T C;  5ENP D;  4QWN B;  3ZC1 A;  4JI1 T;  4LFB T;  1OWN A;  3JAD A;  4GK5 E;  1P5Q A;  4UF0 A;  4GZ5 A;  2UXN B;  1H19 A;  3NBN B;  1ZEE A;  2EIL E;  2V4L A;  2WDR A;  2VKJ A;  5EZY E;  4O4H E;  2I9C A;  4ZI3 C;  3MV3 B;  3UT8 A;  3FTU A;  4PK6 A;  3RLF F;  4JEH B;  4LF5 T;  3CK8 A;  1Z3Y A;  5LHG B;  3OXL A;  2VGE A;  4UWK A;  4JA9 A;  4ZI2 D;  1YXR A;  3J7Y q;  4JA7 A;  4U7E B;  2WVI A;  3ZT5 A;  2ETC A;  2ZM6 T;  5FY7 A;  4YTN A;  4HB5 A;  3FZM B;  3A5X A;  4UV8 B;  5DQV A;  4K0R A;  4NUR A;  4UI9 K;  5FXZ A;  3UM0 A;  3QB5 A;  1LVK A;  3APD A;  1WYB A;  4GTQ A;  3I0O A;  4XEI G;  4G25 A;  2IML A;  4CCA A;  4LF6 T;  3B7B A;  1OCR E;  2LXL A;  5AQH B;  2BBJ A;  3APF A;  1IXV A;  1UGO A;  2L0T B;  3CVY A;  4CYM D;  2YHE A;  3ZUV B;  3LJ3 A;  3VR8 A;  2M67 A;  2WZH A;  4AQG A;  4ACL A;  3DPY A;  4A55 A;  3EHN A;  1BLX B;  4HI9 A;  3ZST A;  3UU3 A;  3OTN A;  3FUD A;  3QB5 K;  2PFV A;  4BTB A;  3MAC A;  5HCJ A;  3CIR A;  3RGL A;  1WG0 A;  2RFM A;  2ZGG A;  1E7P A;  2A72 A;  2NW7 A;  2H6F A;  2OLT A;  4U7Y A;  4U3C A;  1H6O A;  2LKG A;  2MTQ A;  3V31 A;  4EXT A;  3ONJ A;  2KZT A;  5AQG B;  1Z6T A;  3TGO A;  5HAX A;  4OAU C;  1SA5 A;  2GRM A;  4X1I E;  4LEU A;  4IE5 A;  4BJM A;  3PUK A;  1W0B A;  4XE0 A;  4MS6 A;  3C3O A;  5IY5 E;  4QFV A;  4YTM A;  1MX2 A;  3HVE B;  1AWC B;  1D0X A;  3IKO B;  4X62 T;  2YDR A;  4B8A A;  2XHE A;  3LY8 A;  3ZN0 B;  1O5M A;  4BY6 A;  2X51 A;  3MJW A;  3KFW X;  1HO8 A;  4QH1 A;  2PG8 A;  4GTR A;  3CQG B;  2GRN B;  5C2Y A;  1M7K A;  2UXB T;  3FUM A;  1K3Z D;  4GZ6 A;  3WXX A;  3TLW A;  2I6H A;  1HE8 A;  2Y4T A;  3N9L A;  3QNU A;  4PNI A;  4DUY T;  3D9H A;  4GYO A;  1HH8 A;  4UQZ A;  5DIZ A;  3RRM B;  1QBQ A;  1N4S A;  1B7T A;  4ASK A;  4Z90 A;  3N9O A;  2BG9 E;  3Q15 A;  2E9X A;  3UUL A;  2W00 A;  4G2V A;  3CR3 A;  1MMA A;  2XS1 A;  1YW0 A;  3IHR A;  1ZKE A;  3S2A A;  3VLD A;  3UU8 A;  1N9A A;  3UIO C;  4UWH A;  2WXR A;  4G24 A;  4FJO A;  5FZR A;  3WI3 A;  3AA0 B;  4G63 A;  3JAE A;  3TAX A;  1JCQ A;  4LFC T;  1EYH A;  2LSV A;  4DRX E;  5JDH A;  4PS7 A;  3MZK B;  4O1O A;  3HKE E;  2D0U A;  2IDO B;  3ZVV A;  3V5U A;  3I5P A;  5FJY A;  2YU1 A;  2XQ3 A;  5HEJ A;  4OYS A;  3S7B A;  3PE0 A;  3CVL A;  4ZEY A;  4ILG A;  1IHB A;  1N0R A;  3Q78 A;  4CQI A;  4DLO A;  2LJL A;  4U0Z A;  3A8Y C;  1BD8 A;  2EHO C;  1D0Y A;  2P9S G;  5ABH A;  4JEU A;  3ZMV B;  3ASN E;  1GQE A;  3AVS A;  3CVN A;  4OVU A;  3FUF A;  3DWL G;  1V9D A;  3P7I A;  4HTE A;  4KX6 A;  4M1P A;  5M72 A;  3L39 A;  4JLE A;  3LJN A;  3TLV A;  4CT0 A;  2E9X C;  2LSK A;  3BQO A;  2XZE A;  3RPU A;  3CVQ A;  5HKP A;  1MNE A;  4GYY A;  3HRA A;  2I1K A;  1WY6 A;  5ENN A;  4E7S A;  2VVS A;  3EDU A;  4A1G A;  5FQ4 A;  4HWC A;  4HWH A;  4JI7 T;  3PZ2 A;  2X0Y A;  5LP6 E;  5CMY A;  3IF8 B;  4P29 A;  5L3B B;  3KEA A;  5AN8 A;  2A2F X;  1IYG A;  3WAJ A;  4AEZ C;  4ZFH A;  2K5B B;  2FJA A;  5CER B;  3AAE B;  4AY5 A;  4EZJ A;  3CV0 A;  1KZP A;  2NWB A;  3GN5 A;  4YVQ C;  3EAB A;  4KVO A;  4UEL A;  3AED A;  4C0E A;  1MIW A;  5LGT B;  4PJM A;  4UVA B;  5KJL A;  4J2C A;  5JTG A;  2CHX A;  3L16 A;  3EU9 A;  2NW8 A;  3ANW A;  4PJL A;  4UI9 J;  1T8B A;  1E8Y A;  1ELR A;  5LOZ A;  3QDN A;  4JPS A;  3T9K A;  1X9B A;  2I1J A;  4B3S T;  2Q9Q D;  4NIQ A;  3DTO A;  1YD8 G;  3FU0 A;  5EX0 A;  3L13 A;  4TNW A;  3CKC A;  3E33 A;  2Q9Q A;  5EDS A;  3BK9 A;  2V5D A;  2V8S V;  2CM0 A;  1NA0 A;  1JUQ A;  2XTL A;  3RIU C;  4K5A B;  3ETU A;  3FBZ A;  3KV6 A;  4IGU A;  3JXI A;  4UXN B;  5LGU B;  3MXZ A;  3BG1 B;  3PZ3 A;  4H7Y A;  1KNR A;  2LSJ A;  3ZLI A;  3PUR A;  4MLP A;  1UUR A;  4OFZ A;  4EGW A;  4WUY A;  3M65 A;  3LJC A;  3PU3 A;  1Y01 A;  3IEG A;  4JYA T;  5AJD A;  2AXD S;  1N32 T;  4KYO B;  1BI7 B;  4HRL A;  5EN5 D;  2XPZ A;  4JD2 G;  2GRO B;  1XMQ T;  2JLB A;  2P9P G;  3P4W A;  2ZGD A;  3AS8 A;  2V7L A;  3AE4 A;  3I0Q A;  5BXU A;  4UWF A;  5FVL A;  5ABE A;  4EHM A;  3BEE A;  2BS3 A;  4U33 A;  1JPL A;  3S7J A;  5LMU T;  2AWI A;  1D0Z A;  2MPK A;  1LF8 A;  3KV9 A;  3QKY A;  5HXS A;  2QVA A;  1BR1 A;  4ILC A;  2XGM A;  2LAH A;  3FY4 A;  3DPD A;  4DV3 T;  4B6X A;  4PJJ A;  3RU0 A;  3CK9 A;  3L22 A;  4I2W A;  2KBX A;  4CXX A;  3LFM A;  4EED A;  4TXP A;  2LEH A;  4I43 A;  4ME2 A;  4K5B A;  1KFY A;  4IUL A;  5HWX A;  3TWR A;  4IDQ A;  4GTV A;  4PJN A;  5JR9 A;  3RYF E;  4EV6 A;  2W4X A;  3UM2 A;  3FWV A;  2Z6E A;  2BKN A;  4ZHB A;  4EBA A;  1ZOY A;  4ILI A;  5AAR A;  2X9W A;  3QOU A;  1BU9 A;  5HEG A;  3J5Q B;  3AE2 A;  3JUE A;  4IN3 B;  3GZ1 A;  2H7V C;  2OEV A;  1S63 A;  2HHH T;  4RSY A;  5AQO B;  5B1A E;  1O1R A;  3CVX A;  3B57 A;  5L4H A;  2ETA A;  1UN9 A;  3QJZ A;  1TNU A;  2KAT A;  5L3C B;  4OX9 T;  3CHS A;  3P4R A;  4IST A;  2MRI A;  3I1A A;  5LG4 A;  5AQU B;  3TWS A;  4LNU D;  5CCM A;  1X5B A;  5LCY A;  3UT5 E;  4DR3 T;  2HPL A;  3HR0 A;  3URZ A;  2ACZ A;  2CHO A;  4JXT A;  4D10 C;  1N54 A;  1O3X A;  4H9P C;  2AXZ A;  1O1T A;  4K5C A;  1PAQ A;  5CEC B;  5AFU L;  3SI5 A;  4KMC A;  4URK A;  3E30 A;  4F8H A;  5AQJ B;  2VAS A;  4ANV A;  4GCO A;  2LM9 A;  1SHZ C;  3ZMU B;  5G55 A;  3CVR A;  2WSS V;  2AE9 A; 
#chains in the Genus database with same CATH homology
 2EHO D;  3R84 B;  4PAG A;  1FVH A;  4DMV A;  2C5I T;  3U64 A;  1E7V A;  3UMV A;  2LSI A;  3N9P A;  2NSZ A;  4YVO A;  3VLE A;  3MV2 B;  1YKE B;  2VK9 A;  2LSY A;  4O4J E;  4G23 A;  3FUJ A;  2YK0 A;  3U3W A;  4JZY A;  3KD7 A;  2CXL A;  4U04 A;  4YFS A;  3GZ2 A;  1EDU A;  2UXX B;  4I6G A;  4V3I A;  3PUJ A;  3QWP A;  3KV5 A;  5IHY A;  4ANW A;  3MKQ B;  2UY1 B;  4O4I E;  4I9E A;  3MGB A;  5FY0 A;  2E0I A;  2BVL A;  2CG2 A;  2J09 A;  3ZN3 A;  4WWN A;  3C4Z A;  5JHB A;  4ADZ A;  3O1I A;  5FQ8 A;  2WXN A;  2WXJ A;  3FFL A;  3HKB E;  3CGH A;  5BV0 A;  5TAO A;  5M4Y A;  3I9W A;  2WXP A;  2AVP A;  4F3V A;  4TUU A;  4MKT A;  4EQF A;  4LUN U;  4L5G A;  3KS2 A;  4EIW A;  3RRC A;  2XAF B;  3CVW A;  2XAS B;  3FH7 A;  2W61 A;  3DBS A;  2Y48 B;  4IHJ E;  2NTX A;  1KNZ A;  3HVE A;  5LOV E;  4QXB B;  3U66 A;  3K3Q C;  2N9D A;  3G2V A;  4L2Y A;  3ZMZ B;  1MMN A;  3Q5M A;  2Y4U A;  3F57 A;  1SA0 E;  1NP7 A;  3PRE A;  1XGW A;  2J9Q A;  4B8C B;  5H6R B;  4E7Z A;  4GIW A;  3U9W A;  2XHE B;  3SRZ A;  5EKQ D;  3OYX A;  4LER A;  4AP2 A;  3D9N A;  3CSF A;  3JQ0 A;  1OWO A;  2LHN A;  4U0U A;  5FZQ A;  2WQH A;  5F3J A;  5LP0 A;  1FIO A;  5LHI B;  3QAR A;  4JVS A;  4R7L A;  3G2W A;  5FMN A;  4JUY A;  3GN5 B;  2CFU A;  4GA0 A;  3VHL A;  3V5S A;  3LDZ A;  5G2N A;  3T8M A;  2CWO A;  4JHR A;  5JQG E;  4FLH A;  5LA6 E;  3KAE A;  3GWH A;  1A17 A;  3Q9D A;  3ESK A;  3E22 E;  3CML A;  1HFA A;  4TV3 A;  4Q69 A;  5FXX A;  2OVF A;  4LRZ A;  1INZ A;  3Q5W A;  4UWG A;  5KDM C;  4HOT A;  2JMH A;  5A1L A;  3KDS E;  1E8W A;  4H9S E;  2LAI A;  4PH4 B;  1IHG A;  4HKA A;  4JEU B;  2IQC A;  1U3C A;  3NRX A;  4GYS A;  2Q7F A;  1BPO A;  4BT8 A;  2WPV A;  1IZN B;  3LBX A;  3APC A;  3MKR A;  2FEZ A;  1NZN A;  1JWG A;  5LFA A;  3UTK A;  5JR9 C;  4NQ0 A;  2P58 C;  3CPZ A;  3FTS A;  4JEH A;  4CGV A;  2VSX E;  1L5J A;  2I2O A;  3N9M A;  3JYS A;  5J1G A;  2FI7 A;  4ANJ A;  4FHJ A;  1EZ3 A;  4IE6 A;  2PQR A;  4CRW A;  2JEK A;  3RIB A;  1IJ6 A;  2YNQ A;  2KLQ A;  2ZLY A;  5FQ7 A;  2V5F A;  2CXF A;  3LEW A;  4XBF B;  3AB3 B;  3FB2 A;  3O4Z A;  3VTX A;  1W3B A;  2IF4 A;  3PVL A;  3K9I A;  5FY1 A;  5LGN B;  3RK6 A;  3FH5 A;  4YJ3 E;  3KBT A;  3ZXS A;  3MA9 A;  3G2S A;  4YJ2 E;  3IBE A;  3PH0 C;  4NRH B;  1GW6 A;  1T98 A;  2C0M A;  2MOW A;  4KVM A;  3IV0 A;  3ZCI A;  3ZYL A;  5D0Q D;  4ZI7 E;  3T5X A;  3SZ7 A;  3MJX A;  4FHK A;  1UX5 A;  3BQK A;  4APF A;  2J4D A;  3FXD B;  3JC6 D;  3J9X 1;  3JQ1 A;  3FEX A;  3C4X A;  4HFV A;  2WWU A;  4TZ4 C;  5E76 A;  4KUM B;  3TXN A;  4X20 E;  2NW9 A;  5HXR A;  3ZMS B;  2IC6 A;  4H7X A;  4I17 A;  3SBT B;  5CA1 E;  5JRE A;  3RRN B;  2CMR A;  2VTB A;  2IOS A;  1D1C A;  3ASF A;  4N39 A;  4H9N C;  4AI6 A;  3C64 A;  2PM6 A;  1Z0P A;  1H6K A;  2PBI A;  4XZ4 A;  2XRY A;  3ZN1 B;  3AS4 A;  4EZK A;  4C90 A;  1UJJ A;  1ELK A;  3PUG A;  3O1J A;  5JVD E;  4U63 A;  3ONK A;  1H7C A;  4K0U A;  5KCM A;  4PDX A;  4I1M A;  2MBG A;  1HZ4 A;  2V1D B;  4WWO A;  2IW5 B;  4BA9 A;  3JC6 C;  3RRU A;  2V0P A;  3K3O A;  2KCK A;  3HKD E;  2LSU A;  4ILU A;  2JJ9 A;  4UF0 B;  3NQP A;  3ZW3 A;  5JR9 B;  4J8D A;  2P9B A;  4G1T A;  3EIJ A;  4CDN A;  3VKH A;  1DVP A;  4EAH A;  5DJQ C;  4NUU A;  2L0I A;  1OWA A;  1U3D A;  3ZEF A;  3RYH E;  2YEV C;  5CB4 E;  2OVB A;  4O6F A;  3PUQ A;  4HVB A;  1NAF A;  5C8Y E;  2A3D A;  4XKB A;  4XKC A;  4B94 A;  4GU5 A;  2DIW A;  3C98 B;  4YLH A;  2Q9Q B;  4HE8 A;  4IRU A;  5LJM A;  2VSN A;  3ENE A;  3BQL A;  3LKU A;  4GYW A;  4F6R C;  2LO6 A;  3AA6 B;  4FAD A;  4O4L E;  3B13 A;  2HH7 A;  4U07 A;  1H0A A;  2X9Y A;  4KBQ A;  4F53 A;  2MOZ A;  3Q5X A;  4G26 A;  2ZMA A;  4HLE A;  4MFR A;  4CXY A;  2WMO A;  4DK5 A;  2KXP B;  1HG2 A;  4QX7 B;  3Q4A B;  4GML A;  4ZS2 A;  3HIZ A;  4JW1 A;  4Y6W A;  4YHJ A;  3MYV A;  4HEA A;  3C51 A;  3SBS A;  4TRQ A;  5ANR A;  2HO1 A;  2YQ8 A;  3CVV A;  5J2T E;  3SHF A;  1WM5 A;  1ZV4 X;  4UVC B;  1MND A;  1BR4 A;  4GAA A;  4ILH B;  2X6I A;  4I9C A;  4RG9 A;  3QK0 A;  1U5P A;  3PDY A;  2XCC A;  3CHR A;  3O1H A;  4MAL A;  3H3A A;  2IFU A;  3ML8 A;  1QNF A;  1MQS A;  4FI5 A;  1MMG A;  4HFG A;  2VSY A;  3ZFW A;  5J08 A;  2PM7 A;  2D0T A;  2VQ2 A;  3AU4 A;  3CX6 B;  2E9X B;  2WXK A;  3RYC E;  3IBP A;  3AA1 B;  3RH3 A;  3OKQ A;  4L1B A;  2BZB A;  5KJN A;  3E0Z A;  5FQ6 A;  3O9X A;  3O48 A;  3QWV A;  2KCL A;  3HDX A;  1KK7 A;  2BDE A;  2X6J A;  2EHO B;  2PJQ A;  2R17 C;  4IE0 A;  4XIF A;  4XI9 A;  4IDZ A;  3TKL B;  3PNT B;  3PEV B;  2RP4 A;  3IEE A;  4ZI3 D;  3EDV A;  1WLX A;  2KZ7 B;  4KT6 B;  2LSG A;  3SF4 A;  2DCP A;  4GB9 A;  4AQF A;  3ZYK A;  1ZBP A;  3FTX A;  2UY1 A;  3Q49 B;  3SWH A;  4AKI A;  2XAG B;  2HYZ A;  4U8H A;  4C9B B;  4E85 A;  2WXF A;  3EUH A;  4K03 A;  4BTA A;  1H2U A;  2W0G A;  2J07 A;  3D9I A;  3FUI A;  5CHE E;  3D9O A;  1WR6 A;  4KP3 C;  1NWM X;  2GK9 A;  2OV8 A;  4BT9 A;  4MLK A;  4N5C A;  2N2N A;  2WXL A;  4KMO A;  1HS7 A;  3P8C D;  4QHO A;  4H9R C;  1HXI A;  5EK2 A;  3PU8 A;  3HHM A;  2X6F A;  4ATG A;  3PZD A;  3EDT B;  2YU2 A;  3I3N A;  4FUL A;  2X9X A;  1DNP A;  2KZT B;  4GZ3 A;  2D2S A;  2C0S A;  4WWP A;  5FTP A;  4ISS A;  3N2K E;  3CVU A;  2SPC A;  4YND A;  4B0Z A;  4I1A A;  4J6I A;  2E8I A;  3AAI A;  1D1A A;  4U0S A;  2Y3A A;  3DJB A;  5KJK A;  2QA7 A;  4GMJ A;  5CA0 E;  3FDH A;  3UX4 A;  3OXG A;  3CVP A;  3TXM A;  5KMG P;  4KZC A;  3UFE A;  2XQ0 A;  3AA7 B;  3OJA A;  4XZC A;  2V7I A;  3ZYQ A;  1EPU A;  4PFP A;  3OYZ A;  4HS2 A;  4P0B A;  3PE3 A;  3LXU X;  3EIQ C;  2VKD A;  3ONX A;  2J1D G;  5LBQ B;  2CLY B;  3BQI A;  5HYA A;  4N3A A;  1E7U A;  4AM9 A;  4C0M A;  1G73 A;  2IC9 A;  3H37 A;  1ELW A;  5BNW A;  3CIA A;  4H9Q C;  2J08 A;  5JHA A;  2X9H A;  2QY7 A;  3L09 A;  3CWZ B;  1FMW A;  3CHM A;  2IOL A;  3AU5 A;  3QAQ A;  4UI9 C;  4EYU A;  3D0T A;  3B7R L;  3SS1 A;  3LY7 A;  5CMW A;  2W62 A;  2LE8 A;  2KWI B;  3EJN A;  3TG4 A;  3UUX B;  2VGX A;  3AS5 A;  4ABN A;  5HXC A;  1U4Q A;  4WNK A;  1Z3X A;  2CG3 A;  3I4R B;  3S7D A;  5JRC A;  1WRD A;  3JUI A;  4BFR A;  3BG0 B;  1N52 A;  3CLJ A;  2ACX A;  4TUY E;  5LBM A;  4O2A E;  4OHF A;  3F31 A;  4L7T A;  2C2L A;  4BWR A;  4AKL A;  3W15 B;  3RKO A;  2DLR A;  3CKB A;  4Q94 A;  5EK4 A;  3U3I A;  4CT4 A;  2WXH A;  5T8I A;  2WQ6 A;  1HTJ F;  4DJA A;  3PUS A;  3MA5 A;  4UQY A;  3U4T A;  3L08 A;  3ZHE B;  4OVV A;  1UCU A;  2J4B A;  4GZD A;  3PNL B;  3LK4 2;  4HXI A;  5CCL A;  2Y8D A;  4N3C A;  2L9Q A;  1WYC A;  4I55 E;  3R6N A;  4AVX A;  3RKV A;  2CHZ A;  4GOU A;  4ANX A;  5HQ8 A;  2K24 A;  2ZM0 A;  3C98 A;  3R7Q A;  3FTY A;  2DWG A;  3PUA A;  2Q9Q C;  4C91 A;  3ZEF B;  3FHE A;  2JMK A;  4UWL A;  1QUU A;  2CLY C;  3MEK A;  1UG3 A;  2XGS A;  5J90 A;  1BR2 A;  4I4T E;  3TL5 A;  3KEZ A;  3FH8 A;  4WW0 A;  4CZZ B;  4N78 D;  3D9J A;  3F2E A;  2OND A;  5D0O D;  3Q2M A;  3LYA A;  3TJP A;  4BX8 A;  2CCQ A;  4OYJ A;  4QX8 B;  2PL2 A;  4MBQ A;  5L3G B;  4WNE A;  2K48 A;  4DI3 A;  5BT1 A;  4AY6 A;  2CEA A;  3S4U A;  2J49 A;  2ZM2 A;  4H63 H;  2KCV A;  4RVB A;  4TN7 B;  2XAH B;  5JDG A;  2EQX A;  5LCW J;  4G11 A;  4N3B A;  4HOS A;  3FUE A;  2VL8 A;  4EBA G;  3ZJ2 A;  1S35 A;  3PRZ A;  3R7R A;  2LNI A;  4MHC A;  4A56 A;  1QSD A;  3ZPO A;  1FVF A;  1VRB A;  5DAB A;  3NZU A;  2IU1 A;  2BVM A;  2VTB B;  4O8S A;  4UEM A;  4L0R A;  5KX5 E;  1E96 B;  4WNF A;  3IHV A;  1FCH A;  2KWH A;  4TV8 E;  3MZL B;  4H63 V;  4DVD A;  5FNV E;  5LCW C;  2YIN A;  2Y6X A;  3N5L A;  2XCB A;  1LVF A;  4DND A;  5JDQ A;  3CQC B;  4JC8 A;  3I4G A;  3RRW A;  3MX3 A;  2L9B A;  3MKD A;  2AW6 A;  4EPZ A;  4FA6 A;  3FHN A;  1IAP A;  3NF1 A;  1TEZ A;  1UX4 A;  3S7F A;  1HX8 A;  1KT1 A;  2YHC A;  3NBX X;  2C0L A;  4Y6C A;  5JRC B;  2NC9 A;  2FUL A;  1Y6I A;  5DBK A;  4IE4 A;  2V7J A;  4HOU A;  3G2T A;  5JJ7 A;  4AIF A;  3N2O A;  3SD5 A;  3DP7 A;  1E8Z A;  5FWQ A;  4PFO A;  2CE7 A;  5E0O A;  4EZH A;  5A23 A;  2ILR A;  4I6E A;  4GPK A;  3SOL A;  3Q47 B;  4A3V A;  3RYI E;  4FP7 A;  4M3O A;  3CK7 A;  2G0U A;  2IAK A;  2UWJ G;  3L6A A;  3KVA A;  3C4W A;  2LT3 A;  3QC9 A;  3CQX C;  4P09 A;  2DCF A;  2VJ8 A;  4U74 A;  3HKC E;  1S0P A;  3SNX A;  3NZP A;  4PW8 A;  2DBA A;  3GW4 A;  5ANL A;  3QC1 A;  3CHQ A;  5G04 J;  3GMI A;  5H6Q B;  1HS6 A;  2H7O A;  3E08 A;  1OWP A;  4BX9 A;  4JL0 A;  4ANU A;  5LNK A;  5JDN A;  4Q96 A;  1MHQ A;  3LCA A;  3R9A B;  1HU3 A;  3PE4 A;  3N9Q A;  1MIY A;  4IIJ E;  4DO0 A;  2D5U A;  4QXH B;  1UN8 A;  2FF4 A;  1SZ9 A;  2WM9 A;  4I1O B;  4GZC A;  1MMD A;  5FXV A;  2XQY A;  3ANW B;  3CEQ A;  3I9Y A;  5ETW A;  1B89 A;  5LJN A;  3D3M A;  5A6C A;  2H3R A;  4CEM A;  4CXW A;  2HM8 A;  2PQN A;  3N2G E;  5KJM A;  2X66 A;  3ZCJ A;  3FUL A;  4BSX A;  2L8K A;  2DHR A;  4ZI2 C;  2AXU A;  3ESL A;  1X79 A;  4G2A A;  2FO7 A;  5LHH B;  3ASD A;  2WXQ A;  4H9O C;  5HXE A;  2KIN B;  3UT7 A;  5G04 C;  1HCI A;  3QNK A;  5FT9 A;  2XRZ A;  1BR0 A;  3L3P A;  4A3T A;  3T8O A;  3CX8 B;  4FJY A;  4CDM A;  4ZOL E;  3HA4 A;  5BV1 A;  2XAJ B;  4ZHQ E;  5GON E;  5AIJ A;  3UT4 A;  1OUV A;  1Y64 B;  3FP3 A;  3NRY A;  2VKH A;  2X6K A;  2KC7 A;  5AJL A;  3AVR A;  1MIV A;  2CWY A;  3KIN B;  1QZ2 A;  3KV4 A;  2E2E A;  1TJC A;  2NXP A;  4WND A;  4I2Z A;  2XGO A;  5JH7 E;  5JDM A;  3T5V A;  2NP9 A;  3LK3 B;  2IJG X;  2OA5 A;  5BW8 C;  3VKG A;  3FXE B;  4IE7 A;  4J8S A;  3LPZ A;  2VYI A;  5HXH A;  5G05 J;  4CI1 B;  5JDL A;  2I59 A;  4QXC B;  2EHO A;  4AV7 A;  4PS8 A;  4XAX B;  2NOX A;  4PUC A;  4UQX A;  5BMV E;  3KBU A;  5LXT E;  3QWW A;  1UJK A;  5FXW A;  2V8S E;  2A4Z A;  4UV9 B;  2VB6 A;  4B89 A;  1OWM A;  2ES0 A;  3PDN A;  3QK6 A;  5JJ6 A;  5C1D A;  2X67 A;  3FEY A;  4AKG A;  4N2Q A;  4GA1 A;  4LCT A;  4PK5 A;  1JWF A;  5L2L A;  3GZS A;  4AXP A;  1IQU A;  3N71 A;  4APO A;  3FU3 A;  4V1A v;  2X6H A;  2X3M A;  2V7M A;  4DMW A;  3NZQ A;  3FU5 A;  2NTY A;  5FZS A;  3ZHE A;  2KND A;  2CFZ A;  3K8P C;  4N2S A;  1EF1 C;  4TV9 E;  4DBR A;  3ASH A;  2JRK A;  1Y8M A;  4P0A A;  2WXG A;  1VOM A;  3RJV A;  4X1K E;  4E6H A;  1PY1 A;  3ZGQ A;  3CHP A;  3N9N A;  3LS8 A;  4FLB A;  3UUM A;  4J8F A;  4NUV A;  2XUE A;  3MKQ A;  3PTR B;  5T4Y A;  5LX8 A;  2V7K A;  2RG8 A;  3AAA B;  5FP3 A;  2ODU A;  5A7D B;  2QFC A;  2WAU A;  4IYP A;  2HR2 A;  5AEN A;  2X38 A;  3G2U A;  3LG7 A;  3PEU B;  2MYS A;  5F8P A;  5T3R A;  2C5J A;  2R59 A;  4AKR B;  2XPI A;  3TG5 A;  3OXF A;  4A1S A;  5BUZ A;  5HI7 A;  3ONL A;  3QUJ A;  4U72 A;  2LOP A;  4PS3 A;  1YKH B;  3L17 A;  3D9M A;  1SZA A;  3FUH A;  3LBX B;  3P2B A;  1SQM A;  3B7U X;  3D9P A;  2VWA A;  4HOR A;  2XAQ B;  4CDR A;  5EK3 A;  2WB2 A;  3CKD A;  5IYZ E;  4EB6 E;  4GA2 A;  4AOF A;  3FUK A;  2VGX B;  4F1S A;  3OBV E;  3UUN A;  4FC8 A;  3RC3 A;  2CXD A;  1OXZ A;  1PC2 A;  3MCX A;  1D1B A;  3CX7 B;  4PK4 A;  2GGF A;  4HN9 A;  1YA0 A;  4GYR A;  1WAO 1;  4WBN E;  2MHK A;  4HGA A;  3VLF A;  2DNX A;  1FEW A;  4JHJ A;  2W63 A;  2ION A;  5L3E B;  2XPY A;  5G05 C;  5JJT A;  2WXM A;  4ACK A;  3ML9 A;  4WAF A;  3FUN A;  2ZM8 A;  2CHW A;  4EEC A;  4AQF C;  4KBM B;  3C50 A;  4EOZ B;  2X68 A;  2RA1 A;  1E90 A;  4OK0 A;  1CUN A;  2CA5 A;  4F7A A;  2OOE A;  5HWY A;  2L3L A;  3FTZ A;  3LK2 B;  3B7T A;  4KZ0 A;  4BAY B;  2GRL A;  3UUX A;  2C5K T;  1LKX A;  4XX5 A;  4CI2 B;  2X0L B;  3ETV A;  4DI4 A;  4UVB B;  1VDY A;  1FMV A;  2ZU6 B;  4DPR A;  4NAC A;  2VSO E;  2DI4 A;  1HG5 A;  2VKO A;  3ZMT B;  2BUG A;  1UW4 B;  4GK0 E;  3RO2 A;  4DLQ A;  1XNF A;  3LY9 A;  4EYY R;  3B7S A;  4UIG A;  3JCK C;  4BJN A;  3LVR E;  3D9K A;  1KLX A;  3E4B A;  3KVB A;  4OYK A;  5FYM A;  1E8X A;  4L23 A;  3FU6 A;  1AJ3 A;  3QB2 A;  1TJF A;  5J2U E;  3L54 A;  1ZHC A;  2QGS A;  4CGW A;  2FBN A;  4GCN A;  3FTV A;  1IJ5 A;  5ARG A;  1OWL A;  5DQW A;  3GA8 A;  4JHK A;  2LOS A;  5LYJ E;  3SFZ A;  2KM4 A;  3IHY A;  2RD0 A;  4FJZ A;  3P1U A;  4WNG A;  4MRU A;  5JDF A;  2A5U A;  2ODV A;  3U78 A;  3ZYM A;  5ADX L;  5L3F B;  3MK7 C;  3PS6 A;  1S94 A;  4XI0 A;  4AJW A;  2WMN A;  4J0U A;  4HOQ A;  2WBL A;  4WBO A;  4DBQ A;  3FTW A;  1HF8 A;  2E9X D;  5E75 A;  3WAK A;  5ARF A;  3HI2 A;  4L2L A;  4QKN A;  1G8X A;  2B1E A;  1ZU2 A;  4RG6 A;  5L3D B;  3K3N A;  2BTD A;  3FBL A;  4I50 E;  2PZI A;  4I6J A;  3EHM A;  4ERR A;  3CST A;  2DWK A;  1QQE A;  2L6J A;  4ZS3 A;  1IQR A;  3ZIM A;  2JPF A;  3HL6 A;  2VGY A;  3GYZ A;  4O2B E;  2WXI A;  3D9L A;  5AYW D;  1E1H B;  4Z8X A;  4X1Y E;  3ZPJ A;  1KT0 A;  2N1G A;  2GW1 A;  3OAW A;  3EVY A;  3ZC0 A;  3UQ3 A;  2WXO A;  4TX5 A;  4CI3 B;  3UPV A;  1NA3 A;  2V26 A;  1US7 B;  2R5S A;  3ULQ A;  1LRZ A;  3VU7 H;  2K9A A;  2LHR A;  2XEV A;  4J8E A;  4W9R A;  4FU3 A;  4AKH A;  3SGH A;  2AXV A;  3VTY A;  3RC8 A;  5BPP A;  2BF0 X;  2HPJ A;  4L9I A;  3NZS A;  4I43 B;  3RO3 A;  4EZ4 A;  5EX3 A;  3HYM B;  3RX6 A;  1H2V C;  3LVQ E;  2KMF A;  3ZRH A;  2M63 A;  3ZJ1 A;  3O4X E;  2WQ7 A;  3CHO A;  4EZL A;  4KXK B;  4AXH A;  2JQQ A;  3ASG A;  2KT9 A;  1H2T C;  4QWN B;  3ZC1 A;  1OWN A;  4GK5 E;  1P5Q A;  4UF0 A;  4GZ5 A;  2UXN B;  1H19 A;  1ZEE A;  2V4L A;  2VKJ A;  5EZY E;  4O4H E;  2I9C A;  4ZI3 C;  3MV3 B;  3UT8 A;  3FTU A;  4PK6 A;  4JEH B;  3CK8 A;  1Z3Y A;  5LHG B;  3OXL A;  4UWK A;  4JA9 A;  4ZI2 D;  3J7Y q;  4JA7 A;  2WVI A;  5FY7 A;  3A5X A;  4UV8 B;  5DQV A;  4K0R A;  4NUR A;  4UI9 K;  5FXZ A;  1LVK A;  3APD A;  1WYB A;  3I0O A;  4G25 A;  4CCA A;  3APF A;  2L0T B;  3CVY A;  2YHE A;  3LJ3 A;  2M67 A;  4AQG A;  4ACL A;  4A55 A;  3EHN A;  3OTN A;  3FUD A;  2PFV A;  4BTB A;  3MAC A;  2A72 A;  2NW7 A;  2MTQ A;  4EXT A;  2KZT A;  1Z6T A;  3TGO A;  5HAX A;  2GRM A;  4X1I E;  4LEU A;  4IE5 A;  4BJM A;  3PUK A;  4XE0 A;  4MS6 A;  4QFV A;  3HVE B;  1D0X A;  3IKO B;  4B8A A;  2XHE A;  3LY8 A;  3ZN0 B;  4BY6 A;  2X51 A;  3MJW A;  3KFW X;  1HO8 A;  2PG8 A;  3CQG B;  5C2Y A;  4GZ6 A;  3FUM A;  3WXX A;  2I6H A;  1HE8 A;  2Y4T A;  4GYO A;  3N9L A;  4PNI A;  4UQZ A;  1HH8 A;  5DIZ A;  3RRM B;  1B7T A;  4ASK A;  3N9O A;  3Q15 A;  2E9X A;  3UUL A;  2W00 A;  4G2V A;  3CR3 A;  1MMA A;  1YW0 A;  3IHR A;  1ZKE A;  3S2A A;  3VLD A;  4UWH A;  2WXR A;  4G24 A;  4FJO A;  5FZR A;  3WI3 A;  3AA0 B;  4G63 A;  3TAX A;  1EYH A;  2LSV A;  5JDH A;  4PS7 A;  3MZK B;  3HKE E;  2D0U A;  3ZVV A;  3V5U A;  3I5P A;  5FJY A;  2YU1 A;  4OYS A;  3S7B A;  3PE0 A;  3CVL A;  4ILG A;  4CQI A;  4DLO A;  2LJL A;  4U0Z A;  2EHO C;  1D0Y A;  4JEU A;  3ZMV B;  3AVS A;  3CVN A;  4OVU A;  3FUF A;  1V9D A;  3P7I A;  4HTE A;  4M1P A;  5M72 A;  4JLE A;  4CT0 A;  2E9X C;  2LSK A;  3CVQ A;  3RPU A;  1MNE A;  4GYY A;  2I1K A;  1WY6 A;  5ENN A;  4E7S A;  3EDU A;  4A1G A;  5FQ4 A;  5LP6 E;  5CMY A;  3IF8 B;  4P29 A;  5L3B B;  2A2F X;  1IYG A;  3WAJ A;  4AEZ C;  2K5B B;  3AAE B;  4AY5 A;  4EZJ A;  3CV0 A;  3GN5 A;  2NWB A;  4YVQ C;  4KVO A;  4UEL A;  4C0E A;  1MIW A;  5LGT B;  4PJM A;  4UVA B;  5KJL A;  4J2C A;  2CHX A;  3L16 A;  2NW8 A;  3ANW A;  4PJL A;  4UI9 J;  1E8Y A;  1ELR A;  5LOZ A;  3QDN A;  4JPS A;  2I1J A;  2Q9Q D;  3DTO A;  1YD8 G;  3FU0 A;  5EX0 A;  3L13 A;  5EDS A;  3CKC A;  2Q9Q A;  3BK9 A;  2CM0 A;  1NA0 A;  1JUQ A;  2XTL A;  3ETU A;  3FBZ A;  3KV6 A;  4IGU A;  4UXN B;  5LGU B;  3BG1 B;  3MXZ A;  4H7Y A;  2LSJ A;  3ZLI A;  3PUR A;  4MLP A;  4OFZ A;  4WUY A;  3M65 A;  3LJC A;  3PU3 A;  3IEG A;  5AJD A;  4KYO B;  2XPZ A;  2JLB A;  3AS8 A;  2V7L A;  3I0Q A;  4UWF A;  3BEE A;  1JPL A;  3S7J A;  2AWI A;  1D0Z A;  1LF8 A;  3KV9 A;  3QKY A;  5HXS A;  1BR1 A;  2XGM A;  2LAH A;  3FY4 A;  3DPD A;  4B6X A;  4PJJ A;  3RU0 A;  3CK9 A;  3L22 A;  4I2W A;  4CXX A;  3LFM A;  2LEH A;  4I43 A;  4ME2 A;  4IUL A;  5HWX A;  4PJN A;  5JR9 A;  3RYF E;  3FWV A;  2Z6E A;  4EBA A;  4ILI A;  2X9W A;  3QOU A;  4IN3 B;  3GZ1 A;  2H7V C;  4RSY A;  3CVX A;  3B57 A;  1UN9 A;  3QJZ A;  2KAT A;  5L3C B;  3CHS A;  4IST A;  2MRI A;  3I1A A;  5LG4 A;  5CCM A;  1X5B A;  5LCY A;  3UT5 E;  2HPL A;  3HR0 A;  3URZ A;  4JXT A;  4D10 C;  1N54 A;  1O3X A;  4H9P C;  2AXZ A;  1PAQ A;  5AFU L;  3SI5 A;  4KMC A;  4URK A;  2VAS A;  4ANV A;  4GCO A;  2LM9 A;  1SHZ C;  3ZMU B;  5G55 A;  3CVR A;  2WSS V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...