1HFAA

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, pi(4,5)p2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 100
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hfaA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hfaA01
3ZYMA 1HG5A 3G2WA 3D9MA 1ELKA 1JUQA 4GZCA 2L0IA 4NACA 2BF0X 3D9IA 3ONKA 1X5BA 2L0TB 4AVXA 1HG2A 1DVPA 4HFGA 4Q94A 1UJJA 3D9NA 1EYHA 4Q96A 1H0AA 3D9OA 1HF8A 3G2TA 1UJKA 1HFAA 3G2SA 2QY7A 2DIWA 5LOZA 4FLBA 1XGWA 3D9JA 3ZYKA 1JWFA 2V8SE 3ZYLA 4FU3A 5J08A 1JWGA 3D9KA 3LDZA 4GZDA 1HX8A 3G2VA 1PY1A 3G2UA 5CMYA 1SZ9A 2KM4A 5LP0A 1JPLA 3D9PA 3D9LA 3RRUA 4JXTA 1SZAA 3ZYQA 1MHQA 2LO6A 3ONLA 5CMWA 3CLJA 2MOWA 1INZA 1EDUA 1VDYA 1LF8A 2DCPA
chains in the Genus database with same CATH superfamily
2ETBA 4X1KE 4KUMB 1G73A 4AEZC 3RF1A 3CSTA 1OT8A 4A5XA 2RKKA 2WXRA 3BQIA 4JHKA 4IDQA 3GZSA 4JPSA 3AS4A 1VCTA 1W0BA 1AJ3A 2IO3C 3DWLG 3IA3A 4RG9A 2X6IA 5AQAA 5C8YE 1MX2A 4LF9T 4GU5A 5AQQB 4DPRA 3ZT6A 5HEHA 5JJ7A 2VWAA 4X62T 3FBLA 2QA7A 3SY2A 2WB2A 1KEYA 3DSVA 3ZMZB 3LY7A 1SW6A 4BTAA 1IXVA 2FJBA 2ZIRA 2X67A 3MJWA 3O4ZA 3W15B 1YMPA 4NURA 4DV4T 4UWFA 2UY1A 4XI9A 4YDWA 1JCRA 2ZLYA 3ZKRA 1T7SA 3PVLA 4JD2G 5AYWD 3CVNA 4X1IE 2DZOA 2KSRA 5CRUA 1MMGA 2E2EA 4LF6T 2J8SD 2FO1E 1NEKA 2MRIA 3SFZA 4AQFA 1MX6A 4YT0A 1N0QA 4X8QA 4WWOA 3CKCA 3JXIA 3UUMA 3EDUA 2CHZA 1VCSA 3MKDA 3ZYKA 3VLDA 1SVXA 3DEPA 2GW1A 4J8YA 4AKLA 2FULA 4YHHT 3HVEA 5BXOA 1HZ4A 5F3JA 4Z8XA 1JUQA 3PE3A 3C98A 4RSYA 2I59A 1FIOA 3PU3A 2ZGDA 4YDOA 3HKDE 5ENRD 4NUVA 4J8EA 4AI6A 1OEDB 1I94T 3UUXA 3NZUA 1FJGT 3ML8A 1FMWA 4I55E 5JRCB 4ZI3C 4U8YD 4DIDB 5F8PA 4UEMA 5FIOA 3F6QA 5CBOA 2CMRA 2P9KG 2LXLA 5D0OD 1R8IA 3ENEA 1KK7A 5M72A 1BR4A 3Q2MA 2LSVA 2OEVA 5ENOD 4C48B 2JQKA 2M6BA 2QYWA 3P2BA 5LA6E 3K3OA 3E33A 4EPZA 3JADA 1D8DA 5AQSB 5IWAT 2XEHA 2LHRA 3IF8B 1HFAA 4GKKT 5M4YA 4JEUA 5FY7A 4XEIG 4OYJA 2AE9A 5JTGA 4UV9B 1FT1A 1HX8A 1Z5SC 4MKTA 3AE9A 4L2LA 2E2AA 3SWHA 4OFZA 3APDA 3U66A 3A8YC 3IXEA 2QGSA 4H63V 4IE0A 4GTRA 2XS8A 4K0RA 3Q5DA 4BJMA 3PREA 3O1IA 3I3NA 3BK9A 5FVLA 3LVRE 2XTLA 4L7TA 2E0IA 4KYOB 1H2VC 2PFVA 4MLKA 4C91A 4U7IA 2WPVA 3ISMC 3VKGA 1E2AA 4HWCA 4AXHA 3ZJ1A 4BFRA 4CN1A 2ZM2A 5GONE 2V7LA 3V79K 2LKGA 5J0ZA 3R9MA 2CBJA 4XIFA 4FHKA 4BY6A 1OWAA 3UQ4A 1VOMA 4ILCA 2IIUA 1U3DA 2FJDA 2WXNA 2RPAA 3OJAA 3PV0F 5EIBE 2YQ8A 2XAFB 3FB2A 4BJNA 2VGXA 5AQBA 3PTRB 2EHOD 3ZKJA 4NRHB 2WXIA 3PUGA 1US7B 1GQEA 2XCBA 2ZISA 3UINC 5AJDA 3ZLIA 1N4PA 1E8YA 5KJKA 4O4JE 2XQ5A 1YW0A 1YA0A 4B8AA 3JQ0A 5JA4D 5KNHD 3H3AA 2IC6A 4IT4A 5KWDA 4QH4A 3RK6A 3AA0B 4GMRA 1ZOYA 3FZKB 3LBXA 4ZOLE 2BG9B 3FFLA 1SA5A 3EJNA 2RG8A 5LP6E 3MCXA 4OYSA 3R9AB 2QZAA 3C50A 5J2TE 5LMNT 3B7SA 2UUCT 2Z6EA 3ULQA 2CHOA 1IBKT 4O60A 3FU0A 3U3IA 5LHHB 1ZB1A 5G04J 4U8VD 1DNPA 3MACA 5BV1A 4HFDA 3U3WA 2Q9QD 4KMOA 3RO2A 1TNBA 4YXDA 5A7DB 5FL0A 2F4VT 2VYIA 3IBPA 3ZHEB 2XAJB 2X38A 4JBWF 3DXMG 4JLEA 3GWHA 1UJJA 2LUHA 2WY2A 5ENNA 1HF8A 2V5DA 4ILUA 4OHFA 3ZUVB 4PUCA 2FI7A 3N2OA 4U3CA 2VSXE 3OTNA 1PC2A 4LMLA 3UU6A 3MV2B 5LGTB 4X64T 3G2VA 4HWDA 2KZTB 3RX6A 1HO8A 3ZU7B 4TNVA 3ETUA 2AW6A 3CIAA 5B3SE 2HE0A 1OY3D 1XWMA 4A63B 4UVBB 1U5PA 4A97A 4JI1T 4CEMA 3LK2B 3N2GE 3JAEA 3FHEA 2M67A 3OXLA 3N71A 5LOZA 2VVSA 3CK9A 1X9BA 3HKBE 3UXGA 4EHMA 3UU3A 3UKRG 3M3ZB 5CHEE 2MYOA 4C0EA 3K3NA 2CPTA 3IKOB 4HORA 5JQGE 1J5ET 1KZPA 2EILE 1W09A 5D66A 3ASOE 4C0MA 3CK6A 1ZBPA 2K24A 1X5BA 2Q7FA 4LCTA 2KT9A 4B0ZA 4DX5D 3PUJA 5BT1A 2YN6A 2VURA 5FMNA 1MZCA 3PUWF 3R6NA 3I9WA 2R17C 5IYZE 2NR4A 3N9NA 2EHOC 2F8YA 4GZ3A 4MBGA 4LEUA 3UULA 3WAJA 2LSJA 3D9MA 2BUGA 3P4RA 2XHEB 5AFUL 4H9OC 3CKDA 2QRXA 5CA1E 3C3RA 3FZHB 4L0RA 4ZHQE 1YD8G 1D8EA 1S0PA 3WI3A 4OX9T 2P9LG 3ANWB 3NQPA 3C64A 5JDNA 1O5MA 4O4HE 2X3MA 1OXJA 2OA5A 4HWFA 5AQGB 4PK4A 4LF8T 4AY6A 2W66A 3PUYF 4TRQA 1TN6A 2I2OA 3UT7A 5L3BB 4FA6A 4G8LA 2WQ6A 3Q5EA 5AQNB 1ZHCA 2JMHA 2LM9A 5C2TA 4H9QC 5G2NA 1J5WA 4GTSA 4WNKA 1XNRT 3GMIA 2Q9QC 5FQ7A 5J90A 3DBSA 4DR6T 4GZ6A 5JMND 3QUJA 3ASDA 4WNDA 4I4TE 3IEEA 2MPKA 2H89A 2BG9C 2AXUA 2F8XK 4BT9A 2RP4A 2BKPA 1ZKEA 2SPCA 3KSLA 2J4GA 2YKSA 3KVBA 2UXDT 3QWWA 2JRKA 4DO0A 1D1AA 2YINA 3EHRA 3ETVA 3Q75A 2DBAA 2EHOA 2X6FA 2I9CA 4DNDA 2A9UA 2Y69E 2BBHA 2V6YA 2JEKA 4QX7B 5HI7A 3N9QA 4WW0A 4ANXA 2DIWA 3SQVA 1KT1A 1IBLT 2WXQA 4ILGA 4LERA 4U0ZA 3RKOA 2YU2A 1OWMA 2CHNA 3AEBA 4EZJA 5HAXA 4YJ3E 3UT8A 4N2SA 3GZ1A 5T4YA 5HXCA 5LCWC 4TXPA 2Y4TA 2JQ9A 1QZ2A 4N3AA 3EVYA 4JHJA 2VB6A 2ODUA 2WXKA 4I9EA 4HFHA 1ZV4X 2LSKA 4GK5E 4KX6A 5ANRA 1Z3XA 4DLQA 1WG0A 4JI2T 5AQPB 2Q9QA 1H7CA 5C2YA 3CVLA 3K1SA 4QX8B 4JXTA 4DLOA 5ANLA 3ZN0B 1LVFA 4TXRA 3P4QA 3VTYA 4BX8A 3QB5K 3ASFA 2CWOA 2XQ3A 5F5WA 4AKHA 3ABME 2NWBA 5KBAA 3FUEA 3UU8A 4IREA 3KV9A 2NW9A 2LSIA 4HI8A 3FUHA 4FP7A 4Z91A 2VK9A 3CV0A 4HE8A 4RQIA 2GROB 3CR3A 1NAFA 1NFIE 2WU2A 4OYKA 1LKXA 4XBFB 3T5VA 2D9DA 4EXTA 2NW7A 2A5EA 4N2QA 3QARA 4PNIA 3E34A 3ZGQA 1WFDA 5AQTB 2RD0A 4P09A 4YTMA 4DI4A 4QXHB 4H9PC 4LFBT 1OUVA 2A4ZA 4K0KT 4Q94A 2JQQA 3JYSA 2NW8A 5ENSD 4CGWA 4AISA 3EIJA 3CQXC 2E9XD 4XX5A 5KJMA 1ZU2A 2WXLA 1XNQT 3I5PA 4FLBA 5H6RB 1S70B 1U3CA 4CGVA 2H3RA 4IHJE 3NRXA 4AQYT 1HH8A 3AAAB 4H9RC 4YDEA 2MOWA 3DEOA 4I2WA 3U9WA 4IIJE 5HXSA 2BEDA 3ZPOA 3ZFWA 2WB5A 2X9XA 3L13A 4PAGA 2BF0X 3OXGA 4N5CA 5EYLA 1E7PA 5HWXA 5HYAA 3ABKE 4O4IE 3CHQA 2DHRA 3U4TA 3D9OA 4CXYA 3PNTB 2ZU6B 4GYWA 3CHMA 4I6GA 3PJAA 3LDZA 2WM9A 1EF1C 3TWUA 4PS8A 3SRZA 1K3ZD 5A23A 2C5IT 3C4WA 3AAEB 4O8SA 4WZXA 5LP0A 3KS2A 4U07A 3O4XE 3CLJA 2PG8A 3UM1A 4B6XA 3FUDA 2VJ8A 4GZCA 3IHRA 3ZT7A 3O1HA 1X81A 2CE7A 2XPIA 4QQIA 1K1AA 3NOCD 5FY1A 4FC8A 2P9PG 4HB5A 3QKYA 4DV6T 1TYQG 4IDPA 2J47A 3LJCA 2I0MA 5EKQD 3L39A 3E30A 2IHR1 2X51A 4ZZCA 1N52A 1TNYA 3DSSA 3OBVE 3PEUB 4I0UA 2LSYA 3Q5XA 2Y1LE 1EZ3A 3I4GA 3ZJ2A 3LPZA 3QB5A 4CN4A 4OAVB 1I6ZA 3Q5WA 3D9IA 4UELA 3MV3B 4DK5A 4FJYA 5L2LA 4KXKB 1ZP0A 4JA7A 3B7TA 4N3BA 1O3XA 1WYCA 2LKHA 4LMJA 5BW8C 1XGWA 3HKEE 3KEZA 3HA4A 2MYSA 3LS8A 3W9GA 2W61A 3ZPJA 4DV2T 4GB9A 4B3MT 4DR1T 3FZMB 3RRMB 3TWTA 5E76A 2I1KA 3FH7A 4DR4T 4IL4A 1MMAA 4NXMT 2H88A 2WWVA 3U64A 4DR2T 1TNOA 3PUZF 2XZTG 4PH4B 3JAFA 1HG2A 3DSXA 2V7IA 1UUSA 4UI9K 5T3RA 4ATZD 3G2SA 5HEUA 3RYCE 4XKCA 2OCCE 5LNKA 4DBRA 4UWGA 2A5UA 2E9XC 3O9XA 4AIUA 1N4RA 2JABA 4GPMA 4AKGA 4LNBA 3PDNA 4F1SA 4A3TA 3HXCA 4CZZB 3KV6A 1MNEA 4IE6A 4BSXA 1U4QA 4KZ0A 4WUYA 1E96B 3HYMB 2CWYA 2E5LT 1DU2A 4UR9A 2EIJE 2CXLA 2VQFT 2X0HA 2YDSA 5AQVB 3BU8A 4P0AA 3WXXA 1QBQA 2L9BA 5EDSA 1JCSA 3L17A 1IJ5A 4B3RT 1T8BA 3AE2A 3PUSA 2BDEA 1H6KA 1MHQA 3TWWA 2VSNA 4UI9C 5FXZA 2KWIB 5AIJA 2KMFA 1E1HB 5FYMA 3L22A 1WRDA 4TWFA 5HQ8A 3JQ1A 3DSUA 4UVCB 4WNFA 3JCKC 2Y4UA 4GPKA 4CT0A 2BS4A 1Y8MA 4U04A 4A56A 3Q7FA 4CXWA 3SF4A 4FLHA 4CYMD 2R59A 2WSSV 4L9PA 2R05A 5CERB 5DJQC 1BR2A 3PZ1A 4GKJT 5FP3A 4PK6A 4AJWA 4GTOA 4JHRA 5CCLA 1IAPA 2BZBA 5D0QD 2WZIA 5ADXL 3SGHA 2E9XA 4LF7T 2KBXA 4U95D 5B1BE 4EAHA 4I1OB 1XMQT 4EIWA 4JB8P 5AQFB 3F31A 2FJAA 4KT6B 4U96D 4PJJA 2W2UA 1N94A 2VSYA 1QSDA 3P1UA 4WWPA 2E8IA 4XAXB 5AQMB 2HPLA 4XKBA 5L3CB 4JA9A 5HXHA 1OWNA 2LO6A 4BAYB 3RRCA 4YTNA 2P9SG 3RH3A 5LMUT 2CXFA 1WAO1 3B7UX 2Y3AA 5HEJA 2VTBA 3CSFA 3NVOA 3C3QA 3X1DA 2XENA 3PE0A 2QYJA 3UT4A 4X1YE 1SUMB 4UF0B 1LVKA 3B5MA 4NIQA 4HXIA 4JI0T 5J2UE 4O1OA 4JV5T 1QYMA 4UVAB 5AN8A 4UWHA 2P9BA 5G05C 2HO1A 5ENTD 4F1PA 1SA0E 3BUAA 2XGMA 3RSEG 3E37A 4HFVA 3GW4A 2WDQA 4JVSA 4QXCB 2XZDG 2WMNA 3V2XA 4MHCA 4MFRA 3NRYA 2EIME 3TXNA 3EIQC 3RIUC 2ODVA 2IO2C 3AVRA 3SFDA 1NL4A 2ZM8A 3GN5A 2IAKA 4RLYA 4OK0A 3B13A 3T9KA 4HRLA 2XQ8A 3RRWA 2PJQA 1H6OA 2WBLA 3G2WA 2VVNA 4CDRA 4DI3A 1A17A 4Q69A 1E8XA 3FUNA 3RU0A 3RYIE 3C4ZA 2XPKA 4AM9A 4U2ZA 1UCUA 4L9IA 2RA1A 1WR6A 2WXPA 5AQ9A 4BX9A 4HKAA 3UM2A 3FHNA 3N9OA 3TLSA 5ABFA 5CRVA 5CFBA 3MEKA 1UW4B 4YDYA 2PQNA 3Q79A 3OVUA 3LK42 2J9QA 3QDNA 2X9YA 2WCAA 5JDGA 3LDQB 2V7KA 5CA0E 3ESKA 3AXJB 3FUJA 5A1LA 3Q5MA 1KNRA 2XQ0A 2FBWA 2J09A 4EZ4A 4X65T 4GMJA 2JPFA 2HR2A 2L3LA 5ARGA 2N9DA 4ZZBA 1WDYA 4G8KA 5BPPA 4DR5T 4FJZA 3ABLE 3Q78A 1AP7A 1D0ZA 1Z8UA 1TN7A 2P58C 2XM2A 3TLVA 3UU4A 3UT5E 2LAHA 4QFVA 3UM3A 3RQUA 3PE4A 3MKQB 2GRPB 2WMOA 3PZ3A 3CVWA 5G05J 5FT9A 1ZEEA 1GW6A 5KCMA 2H7OA 1UX4A 2BVMA 3WG7E 4IDOA 1VRBA 4CN6A 3ZN3A 4MRUA 3IV0A 4UV8B 3CVXA 4BERA 3OYXA 3FTVA 4ZHBA 1KNPA 3UTKA 3KV4A 1N4SA 4G24A 1O1SA 2LRKA 1MYOA 2R2LA 3RQWA 4F8HA 4NXNT 3PURA 4GMLA 2YU1A 3FZLB 3ZSTA 3A5XA 3NZSA 1UGOA 3VLFA 4B8CB 3ONLC 3RPUA 1U2VG 3D3MA 3I4RB 1S94A 3C72A 2CG3A 2QYUA 3L08A 2J62A 2P9UG 3PU8A 3LJNA 3LXUX 3ZVVA 2JMKA 1OEDC 2OLTA 3SFYA 4J7WA 3GZ2A 3ESLA 2XSAA 3AB3B 3H37A 5B1AE 2K9AA 3Q9DA 3CHSA 3V5SA 3RRNB 4LF5T 3EHNA 1K8KG 3N9LA 3DXKG 2V7JA 3HXBA 3AE5A 3RKGA 1OEDE 2XQAA 4L1BA 2X9WA 3LVQE 2OOEA 5LJNA 3P8CD 4O6FA 4J8FA 2B0OE 2XQ4A 4A1GA 5JR9B 1Y64B 4G63A 2B76A 1LD7A 3MZKB 1INZA 2K5BB 2MAWA 4J2CA 5AQ7A 4NUUA 1OCZE 4AKIA 3LCAA 4EYUA 1YXRA 2P9NG 1S64A 4IE5A 5J1GA 2L9QA 2DZNA 2EINE 3AU4A 3KV5A 2YOEA 4E7SA 3ML9A 4A1SA 2WDVA 3TWQA 5AENA 5LHGB 3CX8B 2DI4A 5EX0A 2CEAA 2JLBA 4HOTA 1ELWA 1IHBA 4JEHB 3L54A 4G23A 4DV5T 3ONLA 5EIDA 4GTPA 3URZA 1LRZA 2C5KT 3CKBA 2VQET 4G1TA 2XS1A 1E8WA 5JDFA 1CUNA 5CJ5A 4GTQA 4QH1A 2CFZA 4EBAG 1OEDA 4AKRB 5BR8T 2ZM0A 1X79A 2LXMA 2CM0A 3BG0B 4CDNA 5JVDE 3T1HT 5AQUB 1IYGA 3QOFA 3IHYA 3AEDA 2V8SV 1MJ0A 4ZI7E 2GRMA 2BS3A 1EDUA 3EI0A 4KVOA 4NPPA 5FXWA 3S7FA 4PJMA 3R7QA 2KZ7B 4ILAA 4TNWA 2PQRA 2BKOA 1EPUA 3L9TA 3UU5A 5FJYA 2BTDA 1TEZA 4JI5T 3K8PC 4H7YA 2H6IA 3LG7A 4L5GA 3S7BA 2D5UA 3DPDA 3IEGA 4EZHA 5CGMA 5H6QB 1JWFA 3FU6A 2PNNA 1WR0A 3CIRA 5E0OA 4PFOA 5CEAA 3RIAA 3E08A 3AE1A 4KHPT 2GRRB 3HG0D 1Z6TA 5AQLB 5HCMA 4CXXA 2H6FA 3DRAA 3DSTA 2CG2A 4F3VA 4CI3B 3ZEFB 1L0VA 3VRAA 2YHEA 2BG9E 3ONKA 4HFBA 1J1JA 1WYBA 3CPZA 4HFGA 4I50E 4U8HA 2XSBA 3N9MA 4U0UA 5EYPF 3D9NA 3VRBA 4I2ZA 2D0UA 2W0GA 3AU5A 3RKVA 2YK0A 4GK0E 2CHXA 3TL5A 1XNFA 2FUPA 5LJMA 2V7MA 2WZHA 5KNGA 3Q7AA 2KCKA 2VGYA 1UX5A 3LK3B 4TXQA 2XCCA 3UM0A 3NOGD 2CLYB 3HXDA 5AQHB 4XZCA 2WXFA 4YSZA 4I1MA 5L3FB 2KWHA 5JDHA 1XDOA 4LNUD 1V54E 3RAUA 4U72A 2PM7A 2LRLA 3OTOT 2OV8A 4ILHB 4FHJA 3FH5A 2F37A 2F0YA 2KNDA 2XAHB 5BMVE 2C0LA 2IQCA 1BR1A 2NYJA 2BG9A 3QK6A 4JI8T 3E32A 3KD7A 3VHLA 3Q9NC 4BA9A 5JREA 2YEVC 3QOUA 1E90A 1QUUA 2K48A 4AIFA 4P0BA 1W3BA 3Q15A 3WAKA 4HOSA 3AS8A 2UXCT 3FH8A 5AQIB 1NWMX 5IHYA 2RFAA 3TAXA 2J4DA 2UY1B 5AARA 5HKPA 3L82A 1DC2A 3UI2A 3P4WA 5FTPA 4ZEYA 3MZLB 4G11A 4IN3B 3UFEA 3SS1A 3ZHEA 5AQJB 4L23A 4X66T 2XQ7A 1QQEA 3TWSA 2V5QC 4CCAA 2DYRE 2X6HA 2XAQB 2RFMA 2LSUA 4IDZA 4GCNA 3SFXA 3OKQA 3HDXA 2VQ2A 3UUNA 3SOLA 2KZTA 3QC1A 1Y6IA 2DCFA 3NBXX 2MHKA 4IGUA 5CCMA 1BI8B 1HS7A 4GA0A 3UFGA 3QK0A 4OAUC 1VDYA 4L2YA 2KLQA 3TLWA 4YY3T 3JXJA 1SE7A 3FUFA 1UOHA 3HVEB 2LSGA 3M65A 1A5EA 3C98B 3UMVA 4EQFA 1KLXA 1KT0A 4UWLA 3CMLA 3ONXA 2QFCA 1Q2ZA 2NXPA 4AY5A 2CFUA 3C4XA 4ANVA 4QWNB 2AWIA 2C2LA 4LFAT 1LD8A 4UQZA 2BVLA 3V2OA 1HNXT 3UUXB 2L8KA 1BD8A 4G2VA 5LCWJ 3EABA 4GYRA 4WAFA 5C1DA 5FINA 2IJGX 1W0AA 2EQXA 3KAEA 4F6RC 2UXBT 4I9CA 2DYSE 1FVHA 4DUZT 4ANWA 4DX1A 3I1AA 3EHMA 3RO3A 1YCSB 2IOSA 3IHVA 3EAMA 3FDHA 2ES0A 2GRQB 2WAUA 5EK4A 3TG5A 3UKUG 3QWPA 2YDRA 2Y8DA 4JEUB 3CHPA 4HRMB 3NF1A 3AA6B 2CXDA 3V5UA 5CB4E 3CWZB 4HBDA 3PJAJ 4UXNB 3TLTA 2XHEA 4DX7D 1PAQA 2AJAA 1OXZA 2A2FX 3P4SA 5DIZA 4BEPA 3VR8A 4A3VA 3ANWA 1OWLA 3KDSE 1D1CA 1MQSA 1N33T 1SA4A 4RVBA 3AEFA 3V31A 4HVBA 4PFPA 5FXVA 2VGEA 4GTVA 3N5LA 4HI9A 3ZW3A 3FP3A 3D9JA 4DMWA 1JCQA 2EIKE 3ZMTB 2J1DG 2WXHA 3AG4E 3OAWA 3FUMA 5FZSA 5LBMA 1YKHB 3L8RA 4BT8A 3CVPA 2XAGB 1IZNB 4KI0F 1OCCE 3DSWA 4ZFHA 3HKCE 5BNWA 2ILRA 1ELKA 4DMVA 2CA5A 5HCJA 2KC7A 2OVFA 4MALA 4H9SE 4Q96A 3TGOA 4GA2A 1UJKA 3HIZA 4CRWA 5JJTA 2LOPA 4K5AB 2PM6A 1BI7B 1N32T 5HEGA 3L3PA 2QC9A 2VGXB 4UQYA 2HH7A 4J8DA 3MKRA 2KM4A 4UIGA 1JNZA 4CZ2D 1FMVA 4BWRA 2N2NA 3AG1E 5L4HA 3ASHA 3DP7A 3A7MA 3N2KE 3LFMA 2UWJG 4JZYA 3F57A 2LEHA 2V0PA 5DBKA 3HRAA 2YHCA 4DX2A 4ACKA 5LHIB 4M3OA 3HI2A 4KVMA 3LBXB 3BEEA 3FTWA 3GYZA 3B7RL 3P4PA 1WCRA 2DWKA 5EN5D 1N34T 2IU1A 3J5QB 2V8SE 2PZIA 1G3NB 2R6GF 4FU3A 4B89A 1KNZA 4OVUA 4WNEA 1KPSB 3PZ2A 4IL9A 2XQYA 2IFUA 4DV0T 4ZS2A 2ZM6T 2IMLA 3EHQA 1K1BA 4HLLA 4E6HA 3ASNE 1LF8A 2DCPA 3CX7B 2XUEA 2MBGA 2IOLA 2KATA 3ZMUB 3NZPA 3SFEA 3UIOC 3J5PA 4B93B 2V4LA 4J0UA 3TWVA 4HTEA 2D0TA 4YTPA 3AAAC 3FTUA 4Z68A 1MIVA 5AQRB 3QAQA 4EZLA 5JDLA 3CHOA 2R02A 5HS0A 4K0UA 4N78D 3AA1B 4AQGA 3SZ7A 2HN2A 3OYZA 2XEEA 3CEQA 3SHFA 3DPYA 3AE7A 1MMDA 1NZNA 1TJCA 4TV9E 4CI1B 4YSYA 3PUKA 4TV3A 1XZYA 4KHZF 2W4XA 2YDQA 3R84B 5L3DB 3FULA 3MJXA 1E7UA 2KXPB 4FJOA 4JL0A 3RIBA 4HEAA 4IE7A 2V5CA 3VU7H 4IYPA 4WNGA 3Q47B 1JNRA 3FXDB 3ZXSA 1HTJF 3AEEA 4C9BB 2ACZA 4MS6A 1MNDA 2PTFA 3AG3E 2FF4A 5JHBA 2XGSA 1S35A 3RYHE 4UQXA 5KJLA 3ULEG 3APCA 3EUHA 3PEVB 3IBEA 4HN9A 2OV9A 1HS6A 3O1JA 2WQYA 1D0XA 3HL6A 1BLXB 2X66A 3NWIA 4TWHA 4HGAA 3FY4A 1FEWA 4FADA 1BU9A 1V55E 3DJBA 1HXIA 1M62A 3PUXF 1H19A 2QY7A 3SBSA 5LFAA 5EK2A 4ASKA 4I43A 2XPZA 5T8IA 4ME2A 3AEGA 4DBQA 4JI7T 2X0YA 4DUIA 3ZXPA 5FWQA 3NKZA 3RLFF 3VTXA 3Q73A 4WWNA 2AXDS 4GCOA 2VSOE 2B6CA 4GYYA 2E5VA 2CCQA 2H6HA 4LG6A 3SI5A 3RJVA 2W62A 3ZSSA 3FTZA 2KCLA 3SBTB 4LRZA 3KVAA 1D0YA 3MYVA 5AQKB 3AE4A 3QC9A 2DL1A 1HU3A 3F2EA 3PUVF 4DV7T 4J8SA 3FTYA 3CQCB 4YLHA 4UI9J 1SQMA 4H9NC 5FL1A 2VKJA 2LOSA 4DVDA 3EUVA 4EECA 4LUNU 3ZCIA 2XRYA 3D9LA 5EK3A 4FULA 2V5FA 4Z90A 1E7VA 3OXFA 3CVYA 2NTXA 3KSQA 5FNVE 3K9IA 3AEAA 4V1Av 4K5CA 3PNLB 4E85A 4U7EB 2CRBA 5HXEA 4ANUA 5AJLA 3HR0A 3ZT5A 4B3ST 2ETAA 5G04C 5LBQB 5ABGA 3J7Yq 1HNZT 5ARFA 3R7RA 1DCEA 2ETCA 3APFA 1OWPA 1N36T 3EU5A 3JUEA 3RC8A 2X9HA 3FTSA 4PK5A 4O2AE 1N4QA 3MGBA 4TWDA 4U7YA 2LNIA 3LEWA 4COFA 3FU5A 3L09A 1IQRA 4CT4A 4C90A 5LGNB 2Y0BG 4BTBA 2AXZA 2L0IA 4EOZB 3J9X1 2ACXA 5L4EA 3MK7C 2LT3A 1H2TC 1L5JA 4LFCT 2EHOB 2FEZA 5JH7E 5LCYA 2IEJA 4ZXLA 3FZFB 1MIYA 1RZ4A 2V6YB 3SD5A 3Q4AB 4O1PA 3RHWA 5EILA 4O4LE 5L47A 2FJEA 2JQHA 3KBTA 5J08A 3QB2A 2NOXA 1UK5A 3HXFA 3RIUA 3PH0C 5CMYA 3K3QC 4GTTA 4XZ4A 1OCOE 4HWHA 4G2AA 3ZC1A 2XZEA 2WP9A 3NBNB 3KINB 3QWVA 4DRXE 2W67A 1IQUA 2I1JA 3AE3A 1B7TA 4I17A 1P5QA 2AXVA 3KEAA 4JC8A 2VL8A 2ZXWE 1D9SA 1WLXA 3MA5A 2BS2A 2XQ9A 3MX3A 5FZRA 4ZS3A 2DWZA 5CECB 3UX4A 2GGFA 1TNZA 3UPVA 2KXPC 2IONA 4BETA 2XASB 3JUIA 4ACLA 1BPOA 2WVIA 2Q9QB 5FZQA 4YVQC 2YNQA 4M7CA 2XPYA 2FBNA 2IW5B 1NP7A 4GA1A 1YQ4A 4AV7A 2ZGGA 4AP2A 5DABA 1DVPA 5JJ6A 1SHZC 3TWXA 1HR0T 2LM2A 1O1RA 5CEDB 3BG1B 4JI6T 2X6JA 3T8KA 4CDMA 4ISSA 1WM5A 3G06A 1QLBA 2V6XA 4PJLA 4ANJA 1SZ9A 2LLYA 1Y01A 2Y6XA 2A3DA 1IBMT 4HFIA 4YHJA 1NA0A 5G55A 4AOFA 4WBNE 2G0UA 5LGUB 1UN8A 2FO7A 3C3OA 4EBAA 2UUAT 4N39A 4GYSA 4Q25A 1N54A 2VASA 2DVWA 3E4BA 4JUYA 4IE4A 2HPJA 4BSZB 1TJFA 5C3JA 5KDMC 2V1DB 3LJ3A 5ENQD 4FI5A 4TV8E 1HE8A 4YVOA 1JPLA 5EZYE 4ERRA 1CHUA 4JI3T 3AJIA 2VL0A 5DQWA 5BUZA 5EX3A 3CVVA 2M6IA 4WBOA 4GTMA 5HRYA 4B94A 4ILBA 3FBZA 2B1EA 2QVAA 5KX5E 4IDNA 2PL2A 1KFYA 1T72A 3S7DA 2KCVA 4GAAA 4DUYT 2XY8B 4U0SA 1IJ6A 2LHNA 1NI1A 3PZDA 3BQOA 4U33A 4OVVA 3UQ3A 3FUIA 5FVKA 3D9HA 3RIFA 4E7ZA 4LF4T 3PUQA 4EB6E 2JJ9A 3G2TA 4G26A 2I6HA 3JCFA 4UF0A 3U78A 1XDPA 2NP9A 5JRCA 3RI5A 4JW1A 3SO8A 1TN8A 4F7AA 3ABVA 3G2UA 3ZC0A 4JYAT 3PRZA 4N5QA 1UG3A 4TN7B 3NAWA 3AVSA 3C5RA 5ITZF 5AAOA 1NA3A 5KXJA 3OPCA 4CQIA 3V30A 2L0TB 4TZ4C 4QH5A 5FKYA 4APOA 2IY0C 4KZCA 5L3EB 4X5TA 4XI0A 3D0TA 2X6KA 1MMNA 4X20E 3UUBA 1YQ3A 1MX4A 4YNDA 4HS2A 4EGWA 4GZDA 3B95A 4ZI2D 3TLUA 1HNWT 4UUCA 5JHAA 3S2AA 4DJAA 4H7XA 4LSZE 4U63A 2CBIA 4TUMA 3ZIMA 4HLEA 5CMWA 2HHHT 1OCRE 5D2MC 1XMOT 1UURA 1NENA 3FTXA 2KINB 3TKLB 4ADZA 2XEVA 2LE8A 4AXPA 3HHMA 2W00A 2XQ6A 1E8ZA 3DTOA 4UWKA 5KJNA 3T8OA 1WY6A 4A55A 4YSXA 3ZNGA 3T1YT 1O1TA 5LOVE 4HFCA 2GRNB 3PZ4A 1W9RA 3KBUA 4MBQA 3EU9A 2WXMA 4GIWA 3RYFE 4EZKA 1FT2A 4DV3T 4F6RD 4DV1T 2WQHA 4P29A 3LKUA 3ZMSB 2UXXB 3QNUA 1HCIA 3L16A 3VLEA 4QHOA 2V4HC 3AA7B 2BKGA 2X0LB 3AXJA 4EEBA 1BR0A 1ELRA 1N9AA 2WXJA 4K5BA 3ZMVB 3SNXA 3ZRHA 4EV6A 1AWCB 4CI2B 5IUXA 1H0AA 3ONJA 2IUBA 2VKDA 5FQ6A 2W63A 2XGOA 3I9YA 1PY1A 2L6JA 1QNFA 2IDOB 1H6PA 1YKEB 4GYOA 4PS3A 4RG6A 5CBNA 2NC9A 3MXZA 3JC6D 4GZ5A 4TX5A 2HYZA 5E75A 4ISTA 4IRUA 4ABNA 3MKQA 3FEXA 4NACA 4W9RA 2WXOA 3L6AA 2M63A 5FQ4A 4AVXA 5JR9C 3UQ7A 2J49A 1Z3YA 5LX8A 4KMCA 1FCHA 4PDXA 2K3WA 4Y6CA 3MA9A 2J4BA 2H7VC 4U74A 2A72A 3ZN1B 3LYAA 3S7JA 2BKKB 1D1BA 3FXEB 2NSZA 5DQVA 3PDYA 3Q49B 1TR4A 5AQOB 4HQDA 3T8MA 3CGHA 5FXXA 5FY0A 5LYJE 4TUUA 3X2QE 1FVFA 3AE8A 3CVQA 3ZCJA 2E9XB 1T98A 3VKHA 3PUAA 4KP3C 4O2BE 4KBMB 1UN9A 2C5JA 3AAIA 3VR9A 5KMGP 3QNKA 1H2UA 3PS6A 2P9IG 2V26A 4N3CA 3BQKA 3EDTB 1OWOA 3W9FA 4H63H 4HWIB 1N11A 5ABHA 5HEOA 1KZOA 3I0QA 3FU3A 4ZI2C 1DCQA 3ZYMA 1HG5A 4JI4T 4DX6D 2C0MA 3UIPC 2DWGA 2R03A 3TJPA 3P7IA 3P50A 5LG3A 5JDQA 2LJLA 4PS7A 2VTBB 3I0OA 5JR9A 2OVBA 3LY8A 4I43B 1FPPA 4HOUA 5LB7B 4U31A 4HFEA 4URKA 2D2SA 4QXBB 3RRUA 2WWUA 2WDRA 2J07A 3C51A 2X68A 3O48A 2C0SA 3AE6A 2Y48B 4HNAD 3TXMA 2ZMAA 4U2YA 2WS3A 4M1PA 2R5SA 1S63A 1EYHA 3AS5A 2N1GA 4WYVA 3EDVA 4F53A 3BQLA 2LAIA 3CX6B 3QJZA 3ASGA 4XE0A 2IC9A 1JWGA 5TAOA 4DR7T 4JEHA 5BXUA 2WQ7A 5JDMA 3ULYA 4APFA 3NZQA 3GN5B 2H6GA 3CQGB 3NB2A 3B7BA 3RGLA 3HXEA 2HN1A 2PBIA 4MLPA 4LNGA 2ONDA 3CK8A 4DR3T 2XM1A 4J6IA 3JC6C 2J08A 2HM8A 3CK7A 5A6CA 2WU5A 2GK9A 1HX1B 3UTMA 4V3IA 2CLYC 3LSVA 2VKOA 4LMKA 4TUYE 1IHGA 4ILIA 1KF6A 4ATGA 5ENPD 5ABFB 2VKHA 5H7PA 3TWRA 1M7KA 2BKNA 4PJNA 1N0RA 1IKND 2BBJA 4I6JA 3D9PA 3ZYQA 4HOQA 4YFSA 4G25A 4EYYR 2WXGA 2CHWA 2P2CP 3CHRA 4P1NA 5FQ8A 3FEYA 4D10C 2JIWA 1MIWA 1B89A 4R7LA 4NIKA 2IF4A 3T5XA 4IULA 5BV0A 1G8XA 2UU9T 3FUKA 4NQ0A 1Z0PA 1RW2A 4K03A 4EEDA 2UUBT 4I1AA 4I6EA 3E22E 2L6BA 3LY9A 3Q9UC 5HXRA 2UXNB 3KFWX 5HWYA 2DLRA 1SZAA 1N95A 3ZEFA 4PW8A 3N9PA 4GOUA 3EHZA 3CVUA 3S4UA 5LG4A 3AECA 3AG2E 5ABEA 1TNUA 3FWVA 3B57A 2MTQA 5L3GB 4B3TT 2AVPA 4ZI3D 1YYHA 5LXTE 3TG4A 4BESA 4QKNA 3H3MA 1V9DA 3ZYLA 4A98A 3CVRA 3RC3A 3D9KA 1LTXA 2OEWA 4Y6WA 2MOZA 4KBQA 2NTYA 2DNXA 5ETWA 2GRLA 3E0ZA 2XRZA 3GA8A 4AQFC 5IY5E 2XJ7A 4HRNA 4YJ2E
chains in the Genus database with same CATH topology
4X1KE 4KUMB 1G73A 4AEZC 3CSTA 2WXRA 3BQIA 4JHKA 3GZSA 4JPSA 3AS4A 1AJ3A 4RG9A 2X6IA 5C8YE 4GU5A 4DPRA 5JJ7A 2VWAA 3FBLA 2QA7A 2WB2A 3ZMZB 3LY7A 4BTAA 2X67A 3MJWA 3O4ZA 3W15B 4NURA 4UWFA 2UY1A 4XI9A 2ZLYA 3PVLA 5AYWD 3CVNA 4X1IE 1MMGA 2E2EA 2MRIA 3SFZA 4AQFA 4WWOA 3CKCA 3UUMA 3EDUA 2CHZA 3MKDA 3ZYKA 3VLDA 2GW1A 4AKLA 2FULA 3HVEA 1HZ4A 5F3JA 4Z8XA 1JUQA 3PE3A 3C98A 4RSYA 2I59A 1FIOA 3PU3A 3HKDE 4NUVA 4J8EA 4AI6A 3UUXA 3NZUA 3ML8A 1FMWA 4I55E 5JRCB 4ZI3C 5F8PA 4UEMA 2CMRA 5D0OD 3ENEA 1KK7A 5M72A 1BR4A 3Q2MA 2LSVA 3P2BA 5LA6E 3K3OA 4EPZA 2LHRA 3IF8B 1HFAA 5M4YA 4JEUA 5FY7A 4OYJA 4UV9B 1HX8A 4MKTA 4L2LA 3SWHA 4OFZA 3APDA 3U66A 2QGSA 4H63V 4IE0A 4K0RA 4BJMA 3PREA 3O1IA 3I3NA 3BK9A 3LVRE 2XTLA 4L7TA 2E0IA 4KYOB 1H2VC 2PFVA 4MLKA 4C91A 2WPVA 3VKGA 4AXHA 3ZJ1A 4BFRA 2ZM2A 5GONE 2V7LA 4XIFA 4FHKA 4BY6A 1OWAA 1VOMA 1U3DA 2WXNA 3OJAA 2YQ8A 2XAFB 3FB2A 4BJNA 2VGXA 3PTRB 2EHOD 4NRHB 2WXIA 3PUGA 1US7B 2XCBA 5AJDA 3ZLIA 1E8YA 5KJKA 4O4JE 1YW0A 1YA0A 4B8AA 3JQ0A 3H3AA 2IC6A 3RK6A 3AA0B 3LBXA 4ZOLE 3FFLA 3EJNA 2RG8A 5LP6E 3MCXA 4OYSA 3R9AB 3C50A 5J2TE 3B7SA 2Z6EA 3ULQA 3FU0A 3U3IA 5LHHB 5G04J 1DNPA 3MACA 5BV1A 3U3WA 2Q9QD 4KMOA 3RO2A 5A7DB 2VYIA 3IBPA 3ZHEB 2XAJB 2X38A 4JLEA 3GWHA 1UJJA 5ENNA 1HF8A 4ILUA 4OHFA 4PUCA 2FI7A 3N2OA 2VSXE 3OTNA 1PC2A 3MV2B 5LGTB 3G2VA 2KZTB 3RX6A 1HO8A 3ETUA 2AW6A 3CIAA 4UVBB 1U5PA 4CEMA 3LK2B 3N2GE 3FHEA 2M67A 3OXLA 3N71A 5LOZA 3CK9A 3HKBE 5CHEE 4C0EA 3K3NA 3IKOB 4HORA 5JQGE 4C0MA 1ZBPA 2K24A 1X5BA 2Q7FA 4LCTA 2KT9A 4B0ZA 3PUJA 5BT1A 5FMNA 3R6NA 3I9WA 2R17C 5IYZE 3N9NA 2EHOC 4GZ3A 4LEUA 3UULA 3WAJA 2LSJA 3D9MA 2BUGA 2XHEB 5AFUL 4H9OC 3CKDA 5CA1E 4L0RA 4ZHQE 1YD8G 1S0PA 3WI3A 3NQPA 3ANWB 3C64A 5JDNA 4O4HE 2X3MA 2OA5A 4PK4A 4AY6A 4TRQA 2I2OA 3UT7A 5L3BB 4FA6A 2WQ6A 1ZHCA 2JMHA 2LM9A 4H9QC 5G2NA 4WNKA 3GMIA 2Q9QC 5FQ7A 5J90A 3DBSA 4GZ6A 3QUJA 3ASDA 4WNDA 4I4TE 3IEEA 2AXUA 4BT9A 2RP4A 1ZKEA 2SPCA 3KVBA 3QWWA 2JRKA 4DO0A 1D1AA 2YINA 3ETVA 2DBAA 2EHOA 2X6FA 2I9CA 4DNDA 2JEKA 4QX7B 5HI7A 3N9QA 4WW0A 4ANXA 2DIWA 1KT1A 2WXQA 4ILGA 4LERA 4U0ZA 3RKOA 2YU2A 1OWMA 4EZJA 5HAXA 4YJ3E 3UT8A 4N2SA 3GZ1A 5T4YA 5HXCA 5LCWC 2Y4TA 1QZ2A 4N3AA 3EVYA 4JHJA 2VB6A 2ODUA 2WXKA 4I9EA 5ANRA 1ZV4X 2LSKA 4GK5E 1Z3XA 4DLQA 2Q9QA 1H7CA 5C2YA 3CVLA 4QX8B 4JXTA 4DLOA 5ANLA 3ZN0B 1LVFA 3VTYA 4BX8A 3ASFA 2CWOA 4AKHA 2NWBA 3FUEA 3KV9A 2NW9A 2LSIA 3FUHA 4FP7A 2VK9A 3CV0A 4HE8A 3CR3A 1NAFA 4OYKA 1LKXA 4XBFB 3T5VA 4EXTA 2NW7A 4N2QA 3QARA 4PNIA 3ZGQA 2RD0A 4P09A 4DI4A 4QXHB 4H9PC 1OUVA 2A4ZA 4Q94A 2JQQA 3JYSA 2NW8A 4CGWA 3EIJA 3CQXC 2E9XD 4XX5A 5KJMA 1ZU2A 2WXLA 3I5PA 4FLBA 5H6RB 1U3CA 4CGVA 2H3RA 4IHJE 3NRXA 1HH8A 3AAAB 4H9RC 2MOWA 4I2WA 3U9WA 4IIJE 5HXSA 3ZPOA 3ZFWA 2X9XA 3L13A 4PAGA 2BF0X 3OXGA 4N5CA 5HWXA 5HYAA 4O4IE 3CHQA 2DHRA 3U4TA 3D9OA 4CXYA 3PNTB 2ZU6B 4GYWA 3CHMA 4I6GA 3LDZA 2WM9A 1EF1C 4PS8A 3SRZA 5A23A 2C5IT 3C4WA 3AAEB 4O8SA 5LP0A 3KS2A 4U07A 3O4XE 3CLJA 2PG8A 4B6XA 3FUDA 2VJ8A 4GZCA 3IHRA 3O1HA 2CE7A 2XPIA 5FY1A 4FC8A 3QKYA 3LJCA 5EKQD 2X51A 1N52A 3OBVE 3PEUB 2LSYA 3Q5XA 1EZ3A 3I4GA 3ZJ2A 3LPZA 4DK5A 3Q5WA 3D9IA 4UELA 3MV3B 4FJYA 5L2LA 4KXKB 4JA7A 3B7TA 4N3BA 1O3XA 1WYCA 5BW8C 1XGWA 3HKEE 3KEZA 3HA4A 2MYSA 3LS8A 2W61A 3ZPJA 4GB9A 3RRMB 5E76A 2I1KA 3FH7A 1MMAA 3U64A 4PH4B 1HG2A 2V7IA 4UI9K 5T3RA 3G2SA 3RYCE 4XKCA 5LNKA 4DBRA 4UWGA 2A5UA 2E9XC 3O9XA 4AKGA 3PDNA 4F1SA 4A3TA 4CZZB 3KV6A 1MNEA 4IE6A 4BSXA 1U4QA 4KZ0A 4WUYA 1E96B 3HYMB 2CWYA 2CXLA 4P0AA 3WXXA 2L9BA 5EDSA 3L17A 1IJ5A 3PUSA 2BDEA 1H6KA 1MHQA 2VSNA 4UI9C 5FXZA 2KWIB 5AIJA 2KMFA 1E1HB 5FYMA 3L22A 1WRDA 5HQ8A 3JQ1A 4UVCB 4WNFA 3JCKC 2Y4UA 4GPKA 4CT0A 1Y8MA 4U04A 4A56A 4CXWA 3SF4A 4FLHA 2R59A 2WSSV 5DJQC 1BR2A 5FP3A 4PK6A 4AJWA 4JHRA 5CCLA 1IAPA 2BZBA 5D0QD 5ADXL 3SGHA 2E9XA 4EAHA 4I1OB 4EIWA 3F31A 4KT6B 4PJJA 2VSYA 1QSDA 3P1UA 4WWPA 2E8IA 4XAXB 2HPLA 4XKBA 5L3CB 4JA9A 5HXHA 1OWNA 2LO6A 4BAYB 3RRCA 3RH3A 2CXFA 1WAO1 3B7UX 2Y3AA 2VTBA 3CSFA 3PE0A 3UT4A 4X1YE 4HXIA 4UF0B 1LVKA 5J2UE 4UVAB 4UWHA 2P9BA 5G05C 2HO1A 1SA0E 2XGMA 3GW4A 4HFVA 4JVSA 4QXCB 2WMNA 4MHCA 4MFRA 3NRYA 3TXNA 3EIQC 2ODVA 3AVRA 2ZM8A 3GN5A 2IAKA 4OK0A 3B13A 3RRWA 2PJQA 2WBLA 3G2WA 4CDRA 4DI3A 1A17A 4Q69A 1E8XA 3FUNA 3RU0A 3RYIE 3C4ZA 4AM9A 1UCUA 4L9IA 2RA1A 1WR6A 2WXPA 4BX9A 4HKAA 3FHNA 3N9OA 3MEKA 1UW4B 2PQNA 3LK42 2J9QA 3QDNA 2X9YA 5JDGA 2V7KA 5CA0E 3ESKA 3FUJA 5A1LA 3Q5MA 2XQ0A 2J09A 4EZ4A 4GMJA 2JPFA 2HR2A 2L3LA 5ARGA 2N9DA 5BPPA 4FJZA 1D0ZA 2P58C 3UT5E 2LAHA 4QFVA 3PE4A 3MKQB 2WMOA 3CVWA 5G05J 5FT9A 1ZEEA 1GW6A 5KCMA 2H7OA 1UX4A 2BVMA 1VRBA 3ZN3A 4MRUA 3IV0A 4UV8B 3CVXA 3OYXA 3FTVA 3UTKA 3KV4A 4G24A 3PURA 4GMLA 2YU1A 3A5XA 3NZSA 3VLFA 4B8CB 3RPUA 3D3MA 3I4RB 1S94A 2CG3A 3L08A 3PU8A 3LXUX 3ZVVA 2JMKA 3GZ2A 3ESLA 3H37A 3AB3B 2K9AA 3Q9DA 3CHSA 3V5SA 3RRNB 3EHNA 3N9LA 2V7JA 4L1BA 2X9WA 3LVQE 2OOEA 5LJNA 3P8CD 4O6FA 4J8FA 4A1GA 5JR9B 1Y64B 4G63A 3MZKB 1INZA 2K5BB 4J2CA 4NUUA 4AKIA 3LCAA 4EYUA 4IE5A 5J1GA 2L9QA 3AU4A 3KV5A 4E7SA 3ML9A 4A1SA 5AENA 5LHGB 3CX8B 2DI4A 5EX0A 2CEAA 2JLBA 4HOTA 1ELWA 4JEHB 3L54A 4G23A 3ONLA 3URZA 1LRZA 2C5KT 3CKBA 4G1TA 1E8WA 5JDFA 1CUNA 2CFZA 4EBAG 4AKRB 2ZM0A 1X79A 2CM0A 3BG0B 4CDNA 5JVDE 1IYGA 3IHYA 4ZI7E 2GRMA 1EDUA 4KVOA 5FXWA 3S7FA 4PJMA 3R7QA 2KZ7B 2PQRA 1EPUA 5FJYA 2BTDA 1TEZA 3K8PC 4H7YA 3LG7A 4L5GA 3S7BA 2D5UA 3DPDA 3IEGA 4EZHA 1JWFA 5H6QB 3FU6A 5E0OA 4PFOA 3E08A 1Z6TA 4F3VA 4CXXA 2CG2A 4CI3B 3ZEFB 2YHEA 3ONKA 1WYBA 3CPZA 4HFGA 4I50E 4U8HA 4U0UA 3N9MA 3D9NA 4I2ZA 2D0UA 2W0GA 3AU5A 3RKVA 2YK0A 4GK0E 2CHXA 3TL5A 1XNFA 5LJMA 2V7MA 2KCKA 2VGYA 1UX5A 3LK3B 2XCCA 2CLYB 4XZCA 2WXFA 4I1MA 5L3FB 2KWHA 5JDHA 4U72A 2PM7A 2OV8A 4ILHB 4FHJA 3FH5A 2KNDA 2XAHB 5BMVE 2C0LA 2IQCA 1BR1A 3QK6A 3KD7A 3VHLA 4BA9A 5JREA 2YEVC 3QOUA 1E90A 1QUUA 2K48A 4AIFA 4P0BA 1W3BA 3Q15A 3WAKA 4HOSA 3AS8A 3FH8A 1NWMX 5IHYA 3TAXA 2J4DA 2UY1B 5FTPA 3MZLB 4G11A 4IN3B 3UFEA 3SS1A 3ZHEA 4L23A 1QQEA 4CCAA 2X6HA 2XAQB 2LSUA 4IDZA 4GCNA 3OKQA 3HDXA 2VQ2A 3UUNA 3SOLA 2KZTA 3QC1A 1Y6IA 2DCFA 3NBXX 2MHKA 4IGUA 5CCMA 1HS7A 4GA0A 3QK0A 1VDYA 4L2YA 2KLQA 3FUFA 3HVEB 2LSGA 3M65A 3C98B 3UMVA 4EQFA 1KLXA 1KT0A 4UWLA 3CMLA 3ONXA 2QFCA 2NXPA 4AY5A 2CFUA 3C4XA 4ANVA 4QWNB 2AWIA 2C2LA 4UQZA 2BVLA 3UUXB 2L8KA 4G2VA 5LCWJ 4WAFA 4GYRA 5C1DA 2IJGX 2EQXA 3KAEA 4F6RC 4I9CA 1FVHA 4ANWA 3I1AA 3EHMA 3RO3A 2IOSA 3IHVA 3FDHA 2ES0A 2WAUA 5EK4A 3TG5A 3QWPA 4JEUB 2Y8DA 3CHPA 3NF1A 3AA6B 2CXDA 3V5UA 5CB4E 3CWZB 4UXNB 2XHEA 1PAQA 1OXZA 2A2FX 5DIZA 4A3VA 3ANWA 1OWLA 3KDSE 1D1CA 1MQSA 4RVBA 4HVBA 4PFPA 5FXVA 3N5LA 3ZW3A 3FP3A 3D9JA 4DMWA 3ZMTB 2J1DG 2WXHA 3OAWA 3FUMA 5FZSA 5LBMA 1YKHB 4BT8A 3CVPA 2XAGB 1IZNB 3HKCE 5BNWA 2ILRA 1ELKA 4DMVA 2CA5A 2KC7A 2OVFA 4MALA 4H9SE 4Q96A 3TGOA 4GA2A 1UJKA 3HIZA 4CRWA 5JJTA 2LOPA 2PM6A 3L3PA 2VGXB 4UQYA 2HH7A 4J8DA 3MKRA 2KM4A 4UIGA 1FMVA 4BWRA 2N2NA 3ASHA 3DP7A 3N2KE 3LFMA 2UWJG 4JZYA 3F57A 2LEHA 2V0PA 5DBKA 2YHCA 4ACKA 5LHIB 4M3OA 3HI2A 4KVMA 3GYZA 3LBXB 3BEEA 3FTWA 3B7RL 2DWKA 2IU1A 2V8SE 2PZIA 4FU3A 4B89A 1KNZA 4OVUA 4WNEA 2XQYA 2IFUA 4ZS2A 4E6HA 1LF8A 2DCPA 3CX7B 2XUEA 2MBGA 2IOLA 2KATA 3ZMUB 3NZPA 2V4LA 4J0UA 4HTEA 2D0TA 3FTUA 1MIVA 3QAQA 4EZLA 5JDLA 3CHOA 4K0UA 4N78D 3AA1B 4AQGA 3SZ7A 3OYZA 3CEQA 3SHFA 1MMDA 1NZNA 1TJCA 4TV9E 4CI1B 3PUKA 4TV3A 3R84B 5L3DB 3FULA 3MJXA 1E7UA 2KXPB 4FJOA 4JL0A 3RIBA 4HEAA 4IE7A 3VU7H 4IYPA 4WNGA 3Q47B 3FXDB 3ZXSA 1HTJF 4C9BB 4MS6A 1MNDA 2FF4A 5JHBA 2XGSA 1S35A 3RYHE 4UQXA 5KJLA 3APCA 3EUHA 3PEVB 3IBEA 4HN9A 1HS6A 3O1JA 1D0XA 3HL6A 2X66A 3FY4A 4HGAA 1FEWA 4FADA 3DJBA 1HXIA 1H19A 2QY7A 3SBSA 5LFAA 5EK2A 4ASKA 4I43A 2XPZA 5T8IA 4ME2A 4DBQA 5FWQA 3VTXA 4WWNA 4GCOA 2VSOE 4GYYA 2CCQA 3SI5A 3RJVA 2W62A 3FTZA 2KCLA 3SBTB 4LRZA 3KVAA 1D0YA 3MYVA 3QC9A 1HU3A 3F2EA 4J8SA 3FTYA 3CQCB 4YLHA 4UI9J 1SQMA 4H9NC 2VKJA 2LOSA 4DVDA 4EECA 4LUNU 3ZCIA 2XRYA 3D9LA 5EK3A 4FULA 2V5FA 1E7VA 3OXFA 3CVYA 2NTXA 5FNVE 3K9IA 4E85A 4V1Av 3PNLB 5HXEA 4ANUA 5AJLA 3HR0A 5G04C 5LBQB 3J7Yq 3R7RA 5ARFA 3APFA 1OWPA 3RC8A 2X9HA 3FTSA 4PK5A 4O2AE 3MGBA 3LEWA 2LNIA 3FU5A 1IQRA 3L09A 4CT4A 4C90A 5LGNB 4BTBA 2AXZA 2L0IA 4EOZB 3J9X1 2ACXA 1H2TC 3MK7C 2LT3A 1L5JA 2EHOB 2FEZA 5JH7E 5LCYA 1MIYA 3SD5A 3Q4AB 4O4LE 3KBTA 5J08A 3QB2A 2NOXA 5CMYA 3PH0C 3K3QC 4XZ4A 4G2AA 3ZC1A 3KINB 3QWVA 1IQUA 2I1JA 1B7TA 4I17A 1P5QA 2AXVA 4JC8A 2VL8A 1WLXA 3MA5A 3MX3A 5FZRA 4ZS3A 3UX4A 2GGFA 3UPVA 2IONA 2XASB 3JUIA 4ACLA 1BPOA 2WVIA 2Q9QB 5FZQA 4YVQC 2YNQA 2XPYA 2FBNA 2IW5B 1NP7A 4GA1A 4AV7A 4AP2A 5DABA 1DVPA 5JJ6A 1SHZC 3BG1B 2X6JA 4CDMA 4ISSA 1WM5A 4PJLA 4ANJA 1SZ9A 2Y6XA 2A3DA 4YHJA 1NA0A 5G55A 4AOFA 4WBNE 2G0UA 5LGUB 1UN8A 2FO7A 4EBAA 4N39A 4GYSA 1N54A 2VASA 3E4BA 4JUYA 4IE4A 2HPJA 1TJFA 5KDMC 2V1DB 3LJ3A 4FI5A 4TV8E 1HE8A 4YVOA 1JPLA 5EZYE 4ERRA 5DQWA 5BUZA 5EX3A 3CVVA 4WBOA 4B94A 3FBZA 2B1EA 5KX5E 2PL2A 3S7DA 2KCVA 4GAAA 4U0SA 1IJ6A 2LHNA 3PZDA 4OVVA 3UQ3A 3FUIA 4E7ZA 3PUQA 4EB6E 2JJ9A 3G2TA 4G26A 4UF0A 5JRCA 2I6HA 3U78A 2NP9A 4JW1A 4F7AA 3G2UA 3PRZA 3ZC0A 1UG3A 4TN7B 3AVSA 1NA3A 4CQIA 2L0TB 4TZ4C 4APOA 4KZCA 5L3EB 4XI0A 3D0TA 2X6KA 1MMNA 4X20E 4YNDA 4HS2A 4GZDA 4ZI2D 5JHAA 3S2AA 4DJAA 4H7XA 4U63A 4HLEA 3ZIMA 5CMWA 3FTXA 2KINB 3TKLB 4ADZA 2XEVA 2LE8A 4AXPA 3HHMA 2W00A 1E8ZA 3DTOA 4UWKA 5KJNA 3T8OA 1WY6A 4A55A 5LOVE 3KBUA 4MBQA 2WXMA 4GIWA 3RYFE 4EZKA 2WQHA 4P29A 3LKUA 3ZMSB 2UXXB 1HCIA 3L16A 3VLEA 4QHOA 3AA7B 2X0LB 1BR0A 1ELRA 2WXJA 3SNXA 3ZMVB 3ZRHA 4CI2B 1H0AA 2VKDA 5FQ6A 2W63A 2XGOA 3I9YA 1PY1A 2L6JA 1QNFA 1YKEB 4GYOA 4PS3A 4RG6A 2NC9A 3MXZA 3JC6D 4GZ5A 4TX5A 2HYZA 5E75A 4ISTA 4IRUA 4ABNA 3MKQA 3FEXA 4NACA 4W9RA 2WXOA 3L6AA 2M63A 5FQ4A 4AVXA 5JR9C 2J49A 1Z3YA 5LX8A 4KMCA 1FCHA 4PDXA 4Y6CA 3MA9A 2J4BA 2H7VC 4U74A 2A72A 3ZN1B 3LYAA 3S7JA 1D1BA 3FXEB 2NSZA 5DQVA 3PDYA 3Q49B 3T8MA 3CGHA 5FXXA 5FY0A 5LYJE 4TUUA 1FVFA 3CVQA 3ZCJA 2E9XB 1T98A 3VKHA 3PUAA 4KP3C 4O2BE 4KBMB 1UN9A 2C5JA 3AAIA 5KMGP 3QNKA 1H2UA 3PS6A 2V26A 4N3CA 3BQKA 3EDTB 1OWOA 4H63H 3I0QA 3FU3A 4ZI2C 3ZYMA 1HG5A 2C0MA 2DWGA 3TJPA 3P7IA 5JDQA 2LJLA 4PS7A 2VTBB 3I0OA 5JR9A 2OVBA 3LY8A 4I43B 4HOUA 4URKA 2D2SA 4QXBB 3RRUA 2WWUA 2J07A 3C51A 2X68A 3O48A 2C0SA 2Y48B 3TXMA 2ZMAA 4M1PA 2R5SA 1EYHA 3AS5A 2N1GA 3EDVA 4F53A 3BQLA 2LAIA 3CX6B 3QJZA 3ASGA 4XE0A 2IC9A 1JWGA 5TAOA 4JEHA 2WQ7A 5JDMA 4APFA 3NZQA 3GN5B 3CQGB 2PBIA 4MLPA 2ONDA 3CK8A 4J6IA 3JC6C 2J08A 2HM8A 3CK7A 5A6CA 2GK9A 4V3IA 2CLYC 2VKOA 4TUYE 1IHGA 4ILIA 4ATGA 2VKHA 4PJNA 4I6JA 3D9PA 3ZYQA 4HOQA 4YFSA 4G25A 4EYYR 2WXGA 2CHWA 3CHRA 5FQ8A 3FEYA 4D10C 1MIWA 1B89A 4R7LA 2IF4A 3T5XA 4IULA 5BV0A 1G8XA 3FUKA 4NQ0A 1Z0PA 4K03A 4I1AA 4I6EA 3E22E 3LY9A 5HXRA 2UXNB 3KFWX 5HWYA 2DLRA 1SZAA 3ZEFA 4PW8A 3N9PA 4GOUA 3CVUA 3S4UA 5LG4A 3FWVA 3B57A 2MTQA 5L3GB 2AVPA 4ZI3D 5LXTE 3TG4A 4QKNA 1V9DA 3ZYLA 3CVRA 3RC3A 3D9KA 4Y6WA 2MOZA 4KBQA 2NTYA 2DNXA 5ETWA 2GRLA 3E0ZA 2XRZA 3GA8A 4AQFC 4YJ2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYM A;  1HG5 A;  3G2W A;  3D9M A;  1ELK A;  1JUQ A;  4GZC A;  2L0I A;  4NAC A;  2BF0 X;  3D9I A;  3ONK A;  1X5B A;  2L0T B;  4AVX A;  1HG2 A;  1DVP A;  4HFG A;  4Q94 A;  1UJJ A;  3D9N A;  1EYH A;  4Q96 A;  1H0A A;  3D9O A;  1HF8 A;  3G2T A;  1UJK A;  1HFA A;  3G2S A;  2QY7 A;  2DIW A;  5LOZ A;  4FLB A;  1XGW A;  3D9J A;  3ZYK A;  1JWF A;  2V8S E;  3ZYL A;  4FU3 A;  5J08 A;  1JWG A;  3D9K A;  3LDZ A;  4GZD A;  1HX8 A;  3G2V A;  1PY1 A;  3G2U A;  5CMY A;  1SZ9 A;  2KM4 A;  5LP0 A;  1JPL A;  3D9P A;  3D9L A;  3RRU A;  4JXT A;  1SZA A;  3ZYQ A;  1MHQ A;  2LO6 A;  3ONL A;  5CMW A;  3CLJ A;  2MOW A;  1INZ A;  1EDU A;  1VDY A;  1LF8 A;  2DCP A; 
#chains in the Genus database with same CATH topology
 2ETB A;  4X1K E;  4KUM B;  1G73 A;  4AEZ C;  3RF1 A;  3CST A;  1OT8 A;  4A5X A;  2RKK A;  2WXR A;  3BQI A;  4JHK A;  4IDQ A;  3GZS A;  4JPS A;  3AS4 A;  1VCT A;  1W0B A;  1AJ3 A;  2IO3 C;  3DWL G;  3IA3 A;  4RG9 A;  2X6I A;  5AQA A;  5C8Y E;  1MX2 A;  4LF9 T;  4GU5 A;  5AQQ B;  4DPR A;  3ZT6 A;  5HEH A;  5JJ7 A;  2VWA A;  4X62 T;  3FBL A;  2QA7 A;  3SY2 A;  2WB2 A;  1KEY A;  3DSV A;  3ZMZ B;  3LY7 A;  1SW6 A;  4BTA A;  1IXV A;  2FJB A;  2ZIR A;  2X67 A;  3MJW A;  3O4Z A;  3W15 B;  1YMP A;  4NUR A;  4DV4 T;  4UWF A;  2UY1 A;  4XI9 A;  4YDW A;  1JCR A;  2ZLY A;  3ZKR A;  1T7S A;  3PVL A;  4JD2 G;  5AYW D;  3CVN A;  4X1I E;  2DZO A;  2KSR A;  5CRU A;  1MMG A;  2E2E A;  4LF6 T;  2J8S D;  2FO1 E;  1NEK A;  2MRI A;  3SFZ A;  4AQF A;  1MX6 A;  4YT0 A;  1N0Q A;  4X8Q A;  4WWO A;  3CKC A;  3JXI A;  3UUM A;  3EDU A;  2CHZ A;  1VCS A;  3MKD A;  3ZYK A;  3VLD A;  1SVX A;  3DEP A;  2GW1 A;  4J8Y A;  4AKL A;  2FUL A;  4YHH T;  3HVE A;  5BXO A;  1HZ4 A;  5F3J A;  4Z8X A;  1JUQ A;  3PE3 A;  3C98 A;  4RSY A;  2I59 A;  1FIO A;  3PU3 A;  2ZGD A;  4YDO A;  3HKD E;  5ENR D;  4NUV A;  4J8E A;  4AI6 A;  1OED B;  1I94 T;  3UUX A;  3NZU A;  1FJG T;  3ML8 A;  1FMW A;  4I55 E;  5JRC B;  4ZI3 C;  4U8Y D;  4DID B;  5F8P A;  4UEM A;  5FIO A;  3F6Q A;  5CBO A;  2CMR A;  2P9K G;  2LXL A;  5D0O D;  1R8I A;  3ENE A;  1KK7 A;  5M72 A;  1BR4 A;  3Q2M A;  2LSV A;  2OEV A;  5ENO D;  4C48 B;  2JQK A;  2M6B A;  2QYW A;  3P2B A;  5LA6 E;  3K3O A;  3E33 A;  4EPZ A;  3JAD A;  1D8D A;  5AQS B;  5IWA T;  2XEH A;  2LHR A;  3IF8 B;  1HFA A;  4GKK T;  5M4Y A;  4JEU A;  5FY7 A;  4XEI G;  4OYJ A;  2AE9 A;  5JTG A;  4UV9 B;  1FT1 A;  1HX8 A;  1Z5S C;  4MKT A;  3AE9 A;  4L2L A;  2E2A A;  3SWH A;  4OFZ A;  3APD A;  3U66 A;  3A8Y C;  3IXE A;  2QGS A;  4H63 V;  4IE0 A;  4GTR A;  2XS8 A;  4K0R A;  3Q5D A;  4BJM A;  3PRE A;  3O1I A;  3I3N A;  3BK9 A;  5FVL A;  3LVR E;  2XTL A;  4L7T A;  2E0I A;  4KYO B;  1H2V C;  2PFV A;  4MLK A;  4C91 A;  4U7I A;  2WPV A;  3ISM C;  3VKG A;  1E2A A;  4HWC A;  4AXH A;  3ZJ1 A;  4BFR A;  4CN1 A;  2ZM2 A;  5GON E;  2V7L A;  3V79 K;  2LKG A;  5J0Z A;  3R9M A;  2CBJ A;  4XIF A;  4FHK A;  4BY6 A;  1OWA A;  3UQ4 A;  1VOM A;  4ILC A;  2IIU A;  1U3D A;  2FJD A;  2WXN A;  2RPA A;  3OJA A;  3PV0 F;  5EIB E;  2YQ8 A;  2XAF B;  3FB2 A;  4BJN A;  2VGX A;  5AQB A;  3PTR B;  2EHO D;  3ZKJ A;  4NRH B;  2WXI A;  3PUG A;  1US7 B;  1GQE A;  2XCB A;  2ZIS A;  3UIN C;  5AJD A;  3ZLI A;  1N4P A;  1E8Y A;  5KJK A;  4O4J E;  2XQ5 A;  1YW0 A;  1YA0 A;  4B8A A;  3JQ0 A;  5JA4 D;  5KNH D;  3H3A A;  2IC6 A;  4IT4 A;  5KWD A;  4QH4 A;  3RK6 A;  3AA0 B;  4GMR A;  1ZOY A;  3FZK B;  3LBX A;  4ZOL E;  2BG9 B;  3FFL A;  1SA5 A;  3EJN A;  2RG8 A;  5LP6 E;  3MCX A;  4OYS A;  3R9A B;  2QZA A;  3C50 A;  5J2T E;  5LMN T;  3B7S A;  2UUC T;  2Z6E A;  3ULQ A;  2CHO A;  1IBK T;  4O60 A;  3FU0 A;  3U3I A;  5LHH B;  1ZB1 A;  5G04 J;  4U8V D;  1DNP A;  3MAC A;  5BV1 A;  4HFD A;  3U3W A;  2Q9Q D;  4KMO A;  3RO2 A;  1TNB A;  4YXD A;  5A7D B;  5FL0 A;  2F4V T;  2VYI A;  3IBP A;  3ZHE B;  2XAJ B;  2X38 A;  4JBW F;  3DXM G;  4JLE A;  3GWH A;  1UJJ A;  2LUH A;  2WY2 A;  5ENN A;  1HF8 A;  2V5D A;  4ILU A;  4OHF A;  3ZUV B;  4PUC A;  2FI7 A;  3N2O A;  4U3C A;  2VSX E;  3OTN A;  1PC2 A;  4LML A;  3UU6 A;  3MV2 B;  5LGT B;  4X64 T;  3G2V A;  4HWD A;  2KZT B;  3RX6 A;  1HO8 A;  3ZU7 B;  4TNV A;  3ETU A;  2AW6 A;  3CIA A;  5B3S E;  2HE0 A;  1OY3 D;  1XWM A;  4A63 B;  4UVB B;  1U5P A;  4A97 A;  4JI1 T;  4CEM A;  3LK2 B;  3N2G E;  3JAE A;  3FHE A;  2M67 A;  3OXL A;  3N71 A;  5LOZ A;  2VVS A;  3CK9 A;  1X9B A;  3HKB E;  3UXG A;  4EHM A;  3UU3 A;  3UKR G;  3M3Z B;  5CHE E;  2MYO A;  4C0E A;  3K3N A;  2CPT A;  3IKO B;  4HOR A;  5JQG E;  1J5E T;  1KZP A;  2EIL E;  1W09 A;  5D66 A;  3ASO E;  4C0M A;  3CK6 A;  1ZBP A;  2K24 A;  1X5B A;  2Q7F A;  4LCT A;  2KT9 A;  4B0Z A;  4DX5 D;  3PUJ A;  5BT1 A;  2YN6 A;  2VUR A;  5FMN A;  1MZC A;  3PUW F;  3R6N A;  3I9W A;  2R17 C;  5IYZ E;  2NR4 A;  3N9N A;  2EHO C;  2F8Y A;  4GZ3 A;  4MBG A;  4LEU A;  3UUL A;  3WAJ A;  2LSJ A;  3D9M A;  2BUG A;  3P4R A;  2XHE B;  5AFU L;  4H9O C;  3CKD A;  2QRX A;  5CA1 E;  3C3R A;  3FZH B;  4L0R A;  4ZHQ E;  1YD8 G;  1D8E A;  1S0P A;  3WI3 A;  4OX9 T;  2P9L G;  3ANW B;  3NQP A;  3C64 A;  5JDN A;  1O5M A;  4O4H E;  2X3M A;  1OXJ A;  2OA5 A;  4HWF A;  5AQG B;  4PK4 A;  4LF8 T;  4AY6 A;  2W66 A;  3PUY F;  4TRQ A;  1TN6 A;  2I2O A;  3UT7 A;  5L3B B;  4FA6 A;  4G8L A;  2WQ6 A;  3Q5E A;  5AQN B;  1ZHC A;  2JMH A;  2LM9 A;  5C2T A;  4H9Q C;  5G2N A;  1J5W A;  4GTS A;  4WNK A;  1XNR T;  3GMI A;  2Q9Q C;  5FQ7 A;  5J90 A;  3DBS A;  4DR6 T;  4GZ6 A;  5JMN D;  3QUJ A;  3ASD A;  4WND A;  4I4T E;  3IEE A;  2MPK A;  2H89 A;  2BG9 C;  2AXU A;  2F8X K;  4BT9 A;  2RP4 A;  2BKP A;  1ZKE A;  2SPC A;  3KSL A;  2J4G A;  2YKS A;  3KVB A;  2UXD T;  3QWW A;  2JRK A;  4DO0 A;  1D1A A;  2YIN A;  3EHR A;  3ETV A;  3Q75 A;  2DBA A;  2EHO A;  2X6F A;  2I9C A;  4DND A;  2A9U A;  2Y69 E;  2BBH A;  2V6Y A;  2JEK A;  4QX7 B;  5HI7 A;  3N9Q A;  4WW0 A;  4ANX A;  2DIW A;  3SQV A;  1KT1 A;  1IBL T;  2WXQ A;  4ILG A;  4LER A;  4U0Z A;  3RKO A;  2YU2 A;  1OWM A;  2CHN A;  3AEB A;  4EZJ A;  5HAX A;  4YJ3 E;  3UT8 A;  4N2S A;  3GZ1 A;  5T4Y A;  5HXC A;  5LCW C;  4TXP A;  2Y4T A;  2JQ9 A;  1QZ2 A;  4N3A A;  3EVY A;  4JHJ A;  2VB6 A;  2ODU A;  2WXK A;  4I9E A;  4HFH A;  1ZV4 X;  2LSK A;  4GK5 E;  4KX6 A;  5ANR A;  1Z3X A;  4DLQ A;  1WG0 A;  4JI2 T;  5AQP B;  2Q9Q A;  1H7C A;  5C2Y A;  3CVL A;  3K1S A;  4QX8 B;  4JXT A;  4DLO A;  5ANL A;  3ZN0 B;  1LVF A;  4TXR A;  3P4Q A;  3VTY A;  4BX8 A;  3QB5 K;  3ASF A;  2CWO A;  2XQ3 A;  5F5W A;  4AKH A;  3ABM E;  2NWB A;  5KBA A;  3FUE A;  3UU8 A;  4IRE A;  3KV9 A;  2NW9 A;  2LSI A;  4HI8 A;  3FUH A;  4FP7 A;  4Z91 A;  2VK9 A;  3CV0 A;  4HE8 A;  4RQI A;  2GRO B;  3CR3 A;  1NAF A;  1NFI E;  2WU2 A;  4OYK A;  1LKX A;  4XBF B;  3T5V A;  2D9D A;  4EXT A;  2NW7 A;  2A5E A;  4N2Q A;  3QAR A;  4PNI A;  3E34 A;  3ZGQ A;  1WFD A;  5AQT B;  2RD0 A;  4P09 A;  4YTM A;  4DI4 A;  4QXH B;  4H9P C;  4LFB T;  1OUV A;  2A4Z A;  4K0K T;  4Q94 A;  2JQQ A;  3JYS A;  2NW8 A;  5ENS D;  4CGW A;  4AIS A;  3EIJ A;  3CQX C;  2E9X D;  4XX5 A;  5KJM A;  1ZU2 A;  2WXL A;  1XNQ T;  3I5P A;  4FLB A;  5H6R B;  1S70 B;  1U3C A;  4CGV A;  2H3R A;  4IHJ E;  3NRX A;  4AQY T;  1HH8 A;  3AAA B;  4H9R C;  4YDE A;  2MOW A;  3DEO A;  4I2W A;  3U9W A;  4IIJ E;  5HXS A;  2BED A;  3ZPO A;  3ZFW A;  2WB5 A;  2X9X A;  3L13 A;  4PAG A;  2BF0 X;  3OXG A;  4N5C A;  5EYL A;  1E7P A;  5HWX A;  5HYA A;  3ABK E;  4O4I E;  3CHQ A;  2DHR A;  3U4T A;  3D9O A;  4CXY A;  3PNT B;  2ZU6 B;  4GYW A;  3CHM A;  4I6G A;  3PJA A;  3LDZ A;  2WM9 A;  1EF1 C;  3TWU A;  4PS8 A;  3SRZ A;  1K3Z D;  5A23 A;  2C5I T;  3C4W A;  3AAE B;  4O8S A;  4WZX A;  5LP0 A;  3KS2 A;  4U07 A;  3O4X E;  3CLJ A;  2PG8 A;  3UM1 A;  4B6X A;  3FUD A;  2VJ8 A;  4GZC A;  3IHR A;  3ZT7 A;  3O1H A;  1X81 A;  2CE7 A;  2XPI A;  4QQI A;  1K1A A;  3NOC D;  5FY1 A;  4FC8 A;  2P9P G;  4HB5 A;  3QKY A;  4DV6 T;  1TYQ G;  4IDP A;  2J47 A;  3LJC A;  2I0M A;  5EKQ D;  3L39 A;  3E30 A;  2IHR 1;  2X51 A;  4ZZC A;  1N52 A;  1TNY A;  3DSS A;  3OBV E;  3PEU B;  4I0U A;  2LSY A;  3Q5X A;  2Y1L E;  1EZ3 A;  3I4G A;  3ZJ2 A;  3LPZ A;  3QB5 A;  4CN4 A;  4OAV B;  1I6Z A;  3Q5W A;  3D9I A;  4UEL A;  3MV3 B;  4DK5 A;  4FJY A;  5L2L A;  4KXK B;  1ZP0 A;  4JA7 A;  3B7T A;  4N3B A;  1O3X A;  1WYC A;  2LKH A;  4LMJ A;  5BW8 C;  1XGW A;  3HKE E;  3KEZ A;  3HA4 A;  2MYS A;  3LS8 A;  3W9G A;  2W61 A;  3ZPJ A;  4DV2 T;  4GB9 A;  4B3M T;  4DR1 T;  3FZM B;  3RRM B;  3TWT A;  5E76 A;  2I1K A;  3FH7 A;  4DR4 T;  4IL4 A;  1MMA A;  4NXM T;  2H88 A;  2WWV A;  3U64 A;  4DR2 T;  1TNO A;  3PUZ F;  2XZT G;  4PH4 B;  3JAF A;  1HG2 A;  3DSX A;  2V7I A;  1UUS A;  4UI9 K;  5T3R A;  4ATZ D;  3G2S A;  5HEU A;  3RYC E;  4XKC A;  2OCC E;  5LNK A;  4DBR A;  4UWG A;  2A5U A;  2E9X C;  3O9X A;  4AIU A;  1N4R A;  2JAB A;  4GPM A;  4AKG A;  4LNB A;  3PDN A;  4F1S A;  4A3T A;  3HXC A;  4CZZ B;  3KV6 A;  1MNE A;  4IE6 A;  4BSX A;  1U4Q A;  4KZ0 A;  4WUY A;  1E96 B;  3HYM B;  2CWY A;  2E5L T;  1DU2 A;  4UR9 A;  2EIJ E;  2CXL A;  2VQF T;  2X0H A;  2YDS A;  5AQV B;  3BU8 A;  4P0A A;  3WXX A;  1QBQ A;  2L9B A;  5EDS A;  1JCS A;  3L17 A;  1IJ5 A;  4B3R T;  1T8B A;  3AE2 A;  3PUS A;  2BDE A;  1H6K A;  1MHQ A;  3TWW A;  2VSN A;  4UI9 C;  5FXZ A;  2KWI B;  5AIJ A;  2KMF A;  1E1H B;  5FYM A;  3L22 A;  1WRD A;  4TWF A;  5HQ8 A;  3JQ1 A;  3DSU A;  4UVC B;  4WNF A;  3JCK C;  2Y4U A;  4GPK A;  4CT0 A;  2BS4 A;  1Y8M A;  4U04 A;  4A56 A;  3Q7F A;  4CXW A;  3SF4 A;  4FLH A;  4CYM D;  2R59 A;  2WSS V;  4L9P A;  2R05 A;  5CER B;  5DJQ C;  1BR2 A;  3PZ1 A;  4GKJ T;  5FP3 A;  4PK6 A;  4AJW A;  4GTO A;  4JHR A;  5CCL A;  1IAP A;  2BZB A;  5D0Q D;  2WZI A;  5ADX L;  3SGH A;  2E9X A;  4LF7 T;  2KBX A;  4U95 D;  5B1B E;  4EAH A;  4I1O B;  1XMQ T;  4EIW A;  4JB8 P;  5AQF B;  3F31 A;  2FJA A;  4KT6 B;  4U96 D;  4PJJ A;  2W2U A;  1N94 A;  2VSY A;  1QSD A;  3P1U A;  4WWP A;  2E8I A;  4XAX B;  5AQM B;  2HPL A;  4XKB A;  5L3C B;  4JA9 A;  5HXH A;  1OWN A;  2LO6 A;  4BAY B;  3RRC A;  4YTN A;  2P9S G;  3RH3 A;  5LMU T;  2CXF A;  1WAO 1;  3B7U X;  2Y3A A;  5HEJ A;  2VTB A;  3CSF A;  3NVO A;  3C3Q A;  3X1D A;  2XEN A;  3PE0 A;  2QYJ A;  3UT4 A;  4X1Y E;  1SUM B;  4UF0 B;  1LVK A;  3B5M A;  4NIQ A;  4HXI A;  4JI0 T;  5J2U E;  4O1O A;  4JV5 T;  1QYM A;  4UVA B;  5AN8 A;  4UWH A;  2P9B A;  5G05 C;  2HO1 A;  5ENT D;  4F1P A;  1SA0 E;  3BUA A;  2XGM A;  3RSE G;  3E37 A;  4HFV A;  3GW4 A;  2WDQ A;  4JVS A;  4QXC B;  2XZD G;  2WMN A;  3V2X A;  4MHC A;  4MFR A;  3NRY A;  2EIM E;  3TXN A;  3EIQ C;  3RIU C;  2ODV A;  2IO2 C;  3AVR A;  3SFD A;  1NL4 A;  2ZM8 A;  3GN5 A;  2IAK A;  4RLY A;  4OK0 A;  3B13 A;  3T9K A;  4HRL A;  2XQ8 A;  3RRW A;  2PJQ A;  1H6O A;  2WBL A;  3G2W A;  2VVN A;  4CDR A;  4DI3 A;  1A17 A;  4Q69 A;  1E8X A;  3FUN A;  3RU0 A;  3RYI E;  3C4Z A;  2XPK A;  4AM9 A;  4U2Z A;  1UCU A;  4L9I A;  2RA1 A;  1WR6 A;  2WXP A;  5AQ9 A;  4BX9 A;  4HKA A;  3UM2 A;  3FHN A;  3N9O A;  3TLS A;  5ABF A;  5CRV A;  5CFB A;  3MEK A;  1UW4 B;  4YDY A;  2PQN A;  3Q79 A;  3OVU A;  3LK4 2;  2J9Q A;  3QDN A;  2X9Y A;  2WCA A;  5JDG A;  3LDQ B;  2V7K A;  5CA0 E;  3ESK A;  3AXJ B;  3FUJ A;  5A1L A;  3Q5M A;  1KNR A;  2XQ0 A;  2FBW A;  2J09 A;  4EZ4 A;  4X65 T;  4GMJ A;  2JPF A;  2HR2 A;  2L3L A;  5ARG A;  2N9D A;  4ZZB A;  1WDY A;  4G8K A;  5BPP A;  4DR5 T;  4FJZ A;  3ABL E;  3Q78 A;  1AP7 A;  1D0Z A;  1Z8U A;  1TN7 A;  2P58 C;  2XM2 A;  3TLV A;  3UU4 A;  3UT5 E;  2LAH A;  4QFV A;  3UM3 A;  3RQU A;  3PE4 A;  3MKQ B;  2GRP B;  2WMO A;  3PZ3 A;  3CVW A;  5G05 J;  5FT9 A;  1ZEE A;  1GW6 A;  5KCM A;  2H7O A;  1UX4 A;  2BVM A;  3WG7 E;  4IDO A;  1VRB A;  4CN6 A;  3ZN3 A;  4MRU A;  3IV0 A;  4UV8 B;  3CVX A;  4BER A;  3OYX A;  3FTV A;  4ZHB A;  1KNP A;  3UTK A;  3KV4 A;  1N4S A;  4G24 A;  1O1S A;  2LRK A;  1MYO A;  2R2L A;  3RQW A;  4F8H A;  4NXN T;  3PUR A;  4GML A;  2YU1 A;  3FZL B;  3ZST A;  3A5X A;  3NZS A;  1UGO A;  3VLF A;  4B8C B;  3ONL C;  3RPU A;  1U2V G;  3D3M A;  3I4R B;  1S94 A;  3C72 A;  2CG3 A;  2QYU A;  3L08 A;  2J62 A;  2P9U G;  3PU8 A;  3LJN A;  3LXU X;  3ZVV A;  2JMK A;  1OED C;  2OLT A;  3SFY A;  4J7W A;  3GZ2 A;  3ESL A;  2XSA A;  3AB3 B;  3H37 A;  5B1A E;  2K9A A;  3Q9D A;  3CHS A;  3V5S A;  3RRN B;  4LF5 T;  3EHN A;  1K8K G;  3N9L A;  3DXK G;  2V7J A;  3HXB A;  3AE5 A;  3RKG A;  1OED E;  2XQA A;  4L1B A;  2X9W A;  3LVQ E;  2OOE A;  5LJN A;  3P8C D;  4O6F A;  4J8F A;  2B0O E;  2XQ4 A;  4A1G A;  5JR9 B;  1Y64 B;  4G63 A;  2B76 A;  1LD7 A;  3MZK B;  1INZ A;  2K5B B;  2MAW A;  4J2C A;  5AQ7 A;  4NUU A;  1OCZ E;  4AKI A;  3LCA A;  4EYU A;  1YXR A;  2P9N G;  1S64 A;  4IE5 A;  5J1G A;  2L9Q A;  2DZN A;  2EIN E;  3AU4 A;  3KV5 A;  2YOE A;  4E7S A;  3ML9 A;  4A1S A;  2WDV A;  3TWQ A;  5AEN A;  5LHG B;  3CX8 B;  2DI4 A;  5EX0 A;  2CEA A;  2JLB A;  4HOT A;  1ELW A;  1IHB A;  4JEH B;  3L54 A;  4G23 A;  4DV5 T;  3ONL A;  5EID A;  4GTP A;  3URZ A;  1LRZ A;  2C5K T;  3CKB A;  2VQE T;  4G1T A;  2XS1 A;  1E8W A;  5JDF A;  1CUN A;  5CJ5 A;  4GTQ A;  4QH1 A;  2CFZ A;  4EBA G;  1OED A;  4AKR B;  5BR8 T;  2ZM0 A;  1X79 A;  2LXM A;  2CM0 A;  3BG0 B;  4CDN A;  5JVD E;  3T1H T;  5AQU B;  1IYG A;  3QOF A;  3IHY A;  3AED A;  2V8S V;  1MJ0 A;  4ZI7 E;  2GRM A;  2BS3 A;  1EDU A;  3EI0 A;  4KVO A;  4NPP A;  5FXW A;  3S7F A;  4PJM A;  3R7Q A;  2KZ7 B;  4ILA A;  4TNW A;  2PQR A;  2BKO A;  1EPU A;  3L9T A;  3UU5 A;  5FJY A;  2BTD A;  1TEZ A;  4JI5 T;  3K8P C;  4H7Y A;  2H6I A;  3LG7 A;  4L5G A;  3S7B A;  2D5U A;  3DPD A;  3IEG A;  4EZH A;  5CGM A;  5H6Q B;  1JWF A;  3FU6 A;  2PNN A;  1WR0 A;  3CIR A;  5E0O A;  4PFO A;  5CEA A;  3RIA A;  3E08 A;  3AE1 A;  4KHP T;  2GRR B;  3HG0 D;  1Z6T A;  5AQL B;  5HCM A;  4CXX A;  2H6F A;  3DRA A;  3DST A;  2CG2 A;  4F3V A;  4CI3 B;  3ZEF B;  1L0V A;  3VRA A;  2YHE A;  2BG9 E;  3ONK A;  4HFB A;  1J1J A;  1WYB A;  3CPZ A;  4HFG A;  4I50 E;  4U8H A;  2XSB A;  3N9M A;  4U0U A;  5EYP F;  3D9N A;  3VRB A;  4I2Z A;  2D0U A;  2W0G A;  3AU5 A;  3RKV A;  2YK0 A;  4GK0 E;  2CHX A;  3TL5 A;  1XNF A;  2FUP A;  5LJM A;  2V7M A;  2WZH A;  5KNG A;  3Q7A A;  2KCK A;  2VGY A;  1UX5 A;  3LK3 B;  4TXQ A;  2XCC A;  3UM0 A;  3NOG D;  2CLY B;  3HXD A;  5AQH B;  4XZC A;  2WXF A;  4YSZ A;  4I1M A;  5L3F B;  2KWH A;  5JDH A;  1XDO A;  4LNU D;  1V54 E;  3RAU A;  4U72 A;  2PM7 A;  2LRL A;  3OTO T;  2OV8 A;  4ILH B;  4FHJ A;  3FH5 A;  2F37 A;  2F0Y A;  2KND A;  2XAH B;  5BMV E;  2C0L A;  2IQC A;  1BR1 A;  2NYJ A;  2BG9 A;  3QK6 A;  4JI8 T;  3E32 A;  3KD7 A;  3VHL A;  3Q9N C;  4BA9 A;  5JRE A;  2YEV C;  3QOU A;  1E90 A;  1QUU A;  2K48 A;  4AIF A;  4P0B A;  1W3B A;  3Q15 A;  3WAK A;  4HOS A;  3AS8 A;  2UXC T;  3FH8 A;  5AQI B;  1NWM X;  5IHY A;  2RFA A;  3TAX A;  2J4D A;  2UY1 B;  5AAR A;  5HKP A;  3L82 A;  1DC2 A;  3UI2 A;  3P4W A;  5FTP A;  4ZEY A;  3MZL B;  4G11 A;  4IN3 B;  3UFE A;  3SS1 A;  3ZHE A;  5AQJ B;  4L23 A;  4X66 T;  2XQ7 A;  1QQE A;  3TWS A;  2V5Q C;  4CCA A;  2DYR E;  2X6H A;  2XAQ B;  2RFM A;  2LSU A;  4IDZ A;  4GCN A;  3SFX A;  3OKQ A;  3HDX A;  2VQ2 A;  3UUN A;  3SOL A;  2KZT A;  3QC1 A;  1Y6I A;  2DCF A;  3NBX X;  2MHK A;  4IGU A;  5CCM A;  1BI8 B;  1HS7 A;  4GA0 A;  3UFG A;  3QK0 A;  4OAU C;  1VDY A;  4L2Y A;  2KLQ A;  3TLW A;  4YY3 T;  3JXJ A;  1SE7 A;  3FUF A;  1UOH A;  3HVE B;  2LSG A;  3M65 A;  1A5E A;  3C98 B;  3UMV A;  4EQF A;  1KLX A;  1KT0 A;  4UWL A;  3CML A;  3ONX A;  2QFC A;  1Q2Z A;  2NXP A;  4AY5 A;  2CFU A;  3C4X A;  4ANV A;  4QWN B;  2AWI A;  2C2L A;  4LFA T;  1LD8 A;  4UQZ A;  2BVL A;  3V2O A;  1HNX T;  3UUX B;  2L8K A;  1BD8 A;  4G2V A;  5LCW J;  3EAB A;  4GYR A;  4WAF A;  5C1D A;  5FIN A;  2IJG X;  1W0A A;  2EQX A;  3KAE A;  4F6R C;  2UXB T;  4I9C A;  2DYS E;  1FVH A;  4DUZ T;  4ANW A;  4DX1 A;  3I1A A;  3EHM A;  3RO3 A;  1YCS B;  2IOS A;  3IHV A;  3EAM A;  3FDH A;  2ES0 A;  2GRQ B;  2WAU A;  5EK4 A;  3TG5 A;  3UKU G;  3QWP A;  2YDR A;  2Y8D A;  4JEU B;  3CHP A;  4HRM B;  3NF1 A;  3AA6 B;  2CXD A;  3V5U A;  5CB4 E;  3CWZ B;  4HBD A;  3PJA J;  4UXN B;  3TLT A;  2XHE A;  4DX7 D;  1PAQ A;  2AJA A;  1OXZ A;  2A2F X;  3P4S A;  5DIZ A;  4BEP A;  3VR8 A;  4A3V A;  3ANW A;  1OWL A;  3KDS E;  1D1C A;  1MQS A;  1N33 T;  1SA4 A;  4RVB A;  3AEF A;  3V31 A;  4HVB A;  4PFP A;  5FXV A;  2VGE A;  4GTV A;  3N5L A;  4HI9 A;  3ZW3 A;  3FP3 A;  3D9J A;  4DMW A;  1JCQ A;  2EIK E;  3ZMT B;  2J1D G;  2WXH A;  3AG4 E;  3OAW A;  3FUM A;  5FZS A;  5LBM A;  1YKH B;  3L8R A;  4BT8 A;  3CVP A;  2XAG B;  1IZN B;  4KI0 F;  1OCC E;  3DSW A;  4ZFH A;  3HKC E;  5BNW A;  2ILR A;  1ELK A;  4DMV A;  2CA5 A;  5HCJ A;  2KC7 A;  2OVF A;  4MAL A;  4H9S E;  4Q96 A;  3TGO A;  4GA2 A;  1UJK A;  3HIZ A;  4CRW A;  5JJT A;  2LOP A;  4K5A B;  2PM6 A;  1BI7 B;  1N32 T;  5HEG A;  3L3P A;  2QC9 A;  2VGX B;  4UQY A;  2HH7 A;  4J8D A;  3MKR A;  2KM4 A;  4UIG A;  1JNZ A;  4CZ2 D;  1FMV A;  4BWR A;  2N2N A;  3AG1 E;  5L4H A;  3ASH A;  3DP7 A;  3A7M A;  3N2K E;  3LFM A;  2UWJ G;  4JZY A;  3F57 A;  2LEH A;  2V0P A;  5DBK A;  3HRA A;  2YHC A;  4DX2 A;  4ACK A;  5LHI B;  4M3O A;  3HI2 A;  4KVM A;  3LBX B;  3BEE A;  3FTW A;  3GYZ A;  3B7R L;  3P4P A;  1WCR A;  2DWK A;  5EN5 D;  1N34 T;  2IU1 A;  3J5Q B;  2V8S E;  2PZI A;  1G3N B;  2R6G F;  4FU3 A;  4B89 A;  1KNZ A;  4OVU A;  4WNE A;  1KPS B;  3PZ2 A;  4IL9 A;  2XQY A;  2IFU A;  4DV0 T;  4ZS2 A;  2ZM6 T;  2IML A;  3EHQ A;  1K1B A;  4HLL A;  4E6H A;  3ASN E;  1LF8 A;  2DCP A;  3CX7 B;  2XUE A;  2MBG A;  2IOL A;  2KAT A;  3ZMU B;  3NZP A;  3SFE A;  3UIO C;  3J5P A;  4B93 B;  2V4L A;  4J0U A;  3TWV A;  4HTE A;  2D0T A;  4YTP A;  3AAA C;  3FTU A;  4Z68 A;  1MIV A;  5AQR B;  3QAQ A;  4EZL A;  5JDL A;  3CHO A;  2R02 A;  5HS0 A;  4K0U A;  4N78 D;  3AA1 B;  4AQG A;  3SZ7 A;  2HN2 A;  3OYZ A;  2XEE A;  3CEQ A;  3SHF A;  3DPY A;  3AE7 A;  1MMD A;  1NZN A;  1TJC A;  4TV9 E;  4CI1 B;  4YSY A;  3PUK A;  4TV3 A;  1XZY A;  4KHZ F;  2W4X A;  2YDQ A;  3R84 B;  5L3D B;  3FUL A;  3MJX A;  1E7U A;  2KXP B;  4FJO A;  4JL0 A;  3RIB A;  4HEA A;  4IE7 A;  2V5C A;  3VU7 H;  4IYP A;  4WNG A;  3Q47 B;  1JNR A;  3FXD B;  3ZXS A;  1HTJ F;  3AEE A;  4C9B B;  2ACZ A;  4MS6 A;  1MND A;  2PTF A;  3AG3 E;  2FF4 A;  5JHB A;  2XGS A;  1S35 A;  3RYH E;  4UQX A;  5KJL A;  3ULE G;  3APC A;  3EUH A;  3PEV B;  3IBE A;  4HN9 A;  2OV9 A;  1HS6 A;  3O1J A;  2WQY A;  1D0X A;  3HL6 A;  1BLX B;  2X66 A;  3NWI A;  4TWH A;  4HGA A;  3FY4 A;  1FEW A;  4FAD A;  1BU9 A;  1V55 E;  3DJB A;  1HXI A;  1M62 A;  3PUX F;  1H19 A;  2QY7 A;  3SBS A;  5LFA A;  5EK2 A;  4ASK A;  4I43 A;  2XPZ A;  5T8I A;  4ME2 A;  3AEG A;  4DBQ A;  4JI7 T;  2X0Y A;  4DUI A;  3ZXP A;  5FWQ A;  3NKZ A;  3RLF F;  3VTX A;  3Q73 A;  4WWN A;  2AXD S;  4GCO A;  2VSO E;  2B6C A;  4GYY A;  2E5V A;  2CCQ A;  2H6H A;  4LG6 A;  3SI5 A;  3RJV A;  2W62 A;  3ZSS A;  3FTZ A;  2KCL A;  3SBT B;  4LRZ A;  3KVA A;  1D0Y A;  3MYV A;  5AQK B;  3AE4 A;  3QC9 A;  2DL1 A;  1HU3 A;  3F2E A;  3PUV F;  4DV7 T;  4J8S A;  3FTY A;  3CQC B;  4YLH A;  4UI9 J;  1SQM A;  4H9N C;  5FL1 A;  2VKJ A;  2LOS A;  4DVD A;  3EUV A;  4EEC A;  4LUN U;  3ZCI A;  2XRY A;  3D9L A;  5EK3 A;  4FUL A;  2V5F A;  4Z90 A;  1E7V A;  3OXF A;  3CVY A;  2NTX A;  3KSQ A;  5FNV E;  3K9I A;  3AEA A;  4V1A v;  4K5C A;  3PNL B;  4E85 A;  4U7E B;  2CRB A;  5HXE A;  4ANU A;  5AJL A;  3HR0 A;  3ZT5 A;  4B3S T;  2ETA A;  5G04 C;  5LBQ B;  5ABG A;  3J7Y q;  1HNZ T;  5ARF A;  3R7R A;  1DCE A;  2ETC A;  3APF A;  1OWP A;  1N36 T;  3EU5 A;  3JUE A;  3RC8 A;  2X9H A;  3FTS A;  4PK5 A;  4O2A E;  1N4Q A;  3MGB A;  4TWD A;  4U7Y A;  2LNI A;  3LEW A;  4COF A;  3FU5 A;  3L09 A;  1IQR A;  4CT4 A;  4C90 A;  5LGN B;  2Y0B G;  4BTB A;  2AXZ A;  2L0I A;  4EOZ B;  3J9X 1;  2ACX A;  5L4E A;  3MK7 C;  2LT3 A;  1H2T C;  1L5J A;  4LFC T;  2EHO B;  2FEZ A;  5JH7 E;  5LCY A;  2IEJ A;  4ZXL A;  3FZF B;  1MIY A;  1RZ4 A;  2V6Y B;  3SD5 A;  3Q4A B;  4O1P A;  3RHW A;  5EIL A;  4O4L E;  5L47 A;  2FJE A;  2JQH A;  3KBT A;  5J08 A;  3QB2 A;  2NOX A;  1UK5 A;  3HXF A;  3RIU A;  3PH0 C;  5CMY A;  3K3Q C;  4GTT A;  4XZ4 A;  1OCO E;  4HWH A;  4G2A A;  3ZC1 A;  2XZE A;  2WP9 A;  3NBN B;  3KIN B;  3QWV A;  4DRX E;  2W67 A;  1IQU A;  2I1J A;  3AE3 A;  1B7T A;  4I17 A;  1P5Q A;  2AXV A;  3KEA A;  4JC8 A;  2VL8 A;  2ZXW E;  1D9S A;  1WLX A;  3MA5 A;  2BS2 A;  2XQ9 A;  3MX3 A;  5FZR A;  4ZS3 A;  2DWZ A;  5CEC B;  3UX4 A;  2GGF A;  1TNZ A;  3UPV A;  2KXP C;  2ION A;  4BET A;  2XAS B;  3JUI A;  4ACL A;  1BPO A;  2WVI A;  2Q9Q B;  5FZQ A;  4YVQ C;  2YNQ A;  4M7C A;  2XPY A;  2FBN A;  2IW5 B;  1NP7 A;  4GA1 A;  1YQ4 A;  4AV7 A;  2ZGG A;  4AP2 A;  5DAB A;  1DVP A;  5JJ6 A;  1SHZ C;  3TWX A;  1HR0 T;  2LM2 A;  1O1R A;  5CED B;  3BG1 B;  4JI6 T;  2X6J A;  3T8K A;  4CDM A;  4ISS A;  1WM5 A;  3G06 A;  1QLB A;  2V6X A;  4PJL A;  4ANJ A;  1SZ9 A;  2LLY A;  1Y01 A;  2Y6X A;  2A3D A;  1IBM T;  4HFI A;  4YHJ A;  1NA0 A;  5G55 A;  4AOF A;  4WBN E;  2G0U A;  5LGU B;  1UN8 A;  2FO7 A;  3C3O A;  4EBA A;  2UUA T;  4N39 A;  4GYS A;  4Q25 A;  1N54 A;  2VAS A;  2DVW A;  3E4B A;  4JUY A;  4IE4 A;  2HPJ A;  4BSZ B;  1TJF A;  5C3J A;  5KDM C;  2V1D B;  3LJ3 A;  5ENQ D;  4FI5 A;  4TV8 E;  1HE8 A;  4YVO A;  1JPL A;  5EZY E;  4ERR A;  1CHU A;  4JI3 T;  3AJI A;  2VL0 A;  5DQW A;  5BUZ A;  5EX3 A;  3CVV A;  2M6I A;  4WBO A;  4GTM A;  5HRY A;  4B94 A;  4ILB A;  3FBZ A;  2B1E A;  2QVA A;  5KX5 E;  4IDN A;  2PL2 A;  1KFY A;  1T72 A;  3S7D A;  2KCV A;  4GAA A;  4DUY T;  2XY8 B;  4U0S A;  1IJ6 A;  2LHN A;  1NI1 A;  3PZD A;  3BQO A;  4U33 A;  4OVV A;  3UQ3 A;  3FUI A;  5FVK A;  3D9H A;  3RIF A;  4E7Z A;  4LF4 T;  3PUQ A;  4EB6 E;  2JJ9 A;  3G2T A;  4G26 A;  2I6H A;  3JCF A;  4UF0 A;  3U78 A;  1XDP A;  2NP9 A;  5JRC A;  3RI5 A;  4JW1 A;  3SO8 A;  1TN8 A;  4F7A A;  3ABV A;  3G2U A;  3ZC0 A;  4JYA T;  3PRZ A;  4N5Q A;  1UG3 A;  4TN7 B;  3NAW A;  3AVS A;  3C5R A;  5ITZ F;  5AAO A;  1NA3 A;  5KXJ A;  3OPC A;  4CQI A;  3V30 A;  2L0T B;  4TZ4 C;  4QH5 A;  5FKY A;  4APO A;  2IY0 C;  4KZC A;  5L3E B;  4X5T A;  4XI0 A;  3D0T A;  2X6K A;  1MMN A;  4X20 E;  3UUB A;  1YQ3 A;  1MX4 A;  4YND A;  4HS2 A;  4EGW A;  4GZD A;  3B95 A;  4ZI2 D;  3TLU A;  1HNW T;  4UUC A;  5JHA A;  3S2A A;  4DJA A;  4H7X A;  4LSZ E;  4U63 A;  2CBI A;  4TUM A;  3ZIM A;  4HLE A;  5CMW A;  2HHH T;  1OCR E;  5D2M C;  1XMO T;  1UUR A;  1NEN A;  3FTX A;  2KIN B;  3TKL B;  4ADZ A;  2XEV A;  2LE8 A;  4AXP A;  3HHM A;  2W00 A;  2XQ6 A;  1E8Z A;  3DTO A;  4UWK A;  5KJN A;  3T8O A;  1WY6 A;  4A55 A;  4YSX A;  3ZNG A;  3T1Y T;  1O1T A;  5LOV E;  4HFC A;  2GRN B;  3PZ4 A;  1W9R A;  3KBU A;  4MBQ A;  3EU9 A;  2WXM A;  4GIW A;  3RYF E;  4EZK A;  1FT2 A;  4DV3 T;  4F6R D;  4DV1 T;  2WQH A;  4P29 A;  3LKU A;  3ZMS B;  2UXX B;  3QNU A;  1HCI A;  3L16 A;  3VLE A;  4QHO A;  2V4H C;  3AA7 B;  2BKG A;  2X0L B;  3AXJ A;  4EEB A;  1BR0 A;  1ELR A;  1N9A A;  2WXJ A;  4K5B A;  3ZMV B;  3SNX A;  3ZRH A;  4EV6 A;  1AWC B;  4CI2 B;  5IUX A;  1H0A A;  3ONJ A;  2IUB A;  2VKD A;  5FQ6 A;  2W63 A;  2XGO A;  3I9Y A;  1PY1 A;  2L6J A;  1QNF A;  2IDO B;  1H6P A;  1YKE B;  4GYO A;  4PS3 A;  4RG6 A;  5CBN A;  2NC9 A;  3MXZ A;  3JC6 D;  4GZ5 A;  4TX5 A;  2HYZ A;  5E75 A;  4IST A;  4IRU A;  4ABN A;  3MKQ A;  3FEX A;  4NAC A;  4W9R A;  2WXO A;  3L6A A;  2M63 A;  5FQ4 A;  4AVX A;  5JR9 C;  3UQ7 A;  2J49 A;  1Z3Y A;  5LX8 A;  4KMC A;  1FCH A;  4PDX A;  2K3W A;  4Y6C A;  3MA9 A;  2J4B A;  2H7V C;  4U74 A;  2A72 A;  3ZN1 B;  3LYA A;  3S7J A;  2BKK B;  1D1B A;  3FXE B;  2NSZ A;  5DQV A;  3PDY A;  3Q49 B;  1TR4 A;  5AQO B;  4HQD A;  3T8M A;  3CGH A;  5FXX A;  5FY0 A;  5LYJ E;  4TUU A;  3X2Q E;  1FVF A;  3AE8 A;  3CVQ A;  3ZCJ A;  2E9X B;  1T98 A;  3VKH A;  3PUA A;  4KP3 C;  4O2B E;  4KBM B;  1UN9 A;  2C5J A;  3AAI A;  3VR9 A;  5KMG P;  3QNK A;  1H2U A;  3PS6 A;  2P9I G;  2V26 A;  4N3C A;  3BQK A;  3EDT B;  1OWO A;  3W9F A;  4H63 H;  4HWI B;  1N11 A;  5ABH A;  5HEO A;  1KZO A;  3I0Q A;  3FU3 A;  4ZI2 C;  1DCQ A;  3ZYM A;  1HG5 A;  4JI4 T;  4DX6 D;  2C0M A;  3UIP C;  2DWG A;  2R03 A;  3TJP A;  3P7I A;  3P50 A;  5LG3 A;  5JDQ A;  2LJL A;  4PS7 A;  2VTB B;  3I0O A;  5JR9 A;  2OVB A;  3LY8 A;  4I43 B;  1FPP A;  4HOU A;  5LB7 B;  4U31 A;  4HFE A;  4URK A;  2D2S A;  4QXB B;  3RRU A;  2WWU A;  2WDR A;  2J07 A;  3C51 A;  2X68 A;  3O48 A;  2C0S A;  3AE6 A;  2Y48 B;  4HNA D;  3TXM A;  2ZMA A;  4U2Y A;  2WS3 A;  4M1P A;  2R5S A;  1S63 A;  1EYH A;  3AS5 A;  2N1G A;  4WYV A;  3EDV A;  4F53 A;  3BQL A;  2LAI A;  3CX6 B;  3QJZ A;  3ASG A;  4XE0 A;  2IC9 A;  1JWG A;  5TAO A;  4DR7 T;  4JEH A;  5BXU A;  2WQ7 A;  5JDM A;  3ULY A;  4APF A;  3NZQ A;  3GN5 B;  2H6G A;  3CQG B;  3NB2 A;  3B7B A;  3RGL A;  3HXE A;  2HN1 A;  2PBI A;  4MLP A;  4LNG A;  2OND A;  3CK8 A;  4DR3 T;  2XM1 A;  4J6I A;  3JC6 C;  2J08 A;  2HM8 A;  3CK7 A;  5A6C A;  2WU5 A;  2GK9 A;  1HX1 B;  3UTM A;  4V3I A;  2CLY C;  3LSV A;  2VKO A;  4LMK A;  4TUY E;  1IHG A;  4ILI A;  1KF6 A;  4ATG A;  5ENP D;  5ABF B;  2VKH A;  5H7P A;  3TWR A;  1M7K A;  2BKN A;  4PJN A;  1N0R A;  1IKN D;  2BBJ A;  4I6J A;  3D9P A;  3ZYQ A;  4HOQ A;  4YFS A;  4G25 A;  4EYY R;  2WXG A;  2CHW A;  2P2C P;  3CHR A;  4P1N A;  5FQ8 A;  3FEY A;  4D10 C;  2JIW A;  1MIW A;  1B89 A;  4R7L A;  4NIK A;  2IF4 A;  3T5X A;  4IUL A;  5BV0 A;  1G8X A;  2UU9 T;  3FUK A;  4NQ0 A;  1Z0P A;  1RW2 A;  4K03 A;  4EED A;  2UUB T;  4I1A A;  4I6E A;  3E22 E;  2L6B A;  3LY9 A;  3Q9U C;  5HXR A;  2UXN B;  3KFW X;  5HWY A;  2DLR A;  1SZA A;  1N95 A;  3ZEF A;  4PW8 A;  3N9P A;  4GOU A;  3EHZ A;  3CVU A;  3S4U A;  5LG4 A;  3AEC A;  3AG2 E;  5ABE A;  1TNU A;  3FWV A;  3B57 A;  2MTQ A;  5L3G B;  4B3T T;  2AVP A;  4ZI3 D;  1YYH A;  5LXT E;  3TG4 A;  4BES A;  4QKN A;  3H3M A;  1V9D A;  3ZYL A;  4A98 A;  3CVR A;  3RC3 A;  3D9K A;  1LTX A;  2OEW A;  4Y6W A;  2MOZ A;  4KBQ A;  2NTY A;  2DNX A;  5ETW A;  2GRL A;  3E0Z A;  2XRZ A;  3GA8 A;  4AQF C;  5IY5 E;  2XJ7 A;  4HRN A;  4YJ2 E; 
#chains in the Genus database with same CATH homology
 4X1K E;  4KUM B;  1G73 A;  4AEZ C;  3CST A;  2WXR A;  3BQI A;  4JHK A;  3GZS A;  4JPS A;  3AS4 A;  1AJ3 A;  4RG9 A;  2X6I A;  5C8Y E;  4GU5 A;  4DPR A;  5JJ7 A;  2VWA A;  3FBL A;  2QA7 A;  2WB2 A;  3ZMZ B;  3LY7 A;  4BTA A;  2X67 A;  3MJW A;  3O4Z A;  3W15 B;  4NUR A;  4UWF A;  2UY1 A;  4XI9 A;  2ZLY A;  3PVL A;  5AYW D;  3CVN A;  4X1I E;  1MMG A;  2E2E A;  2MRI A;  3SFZ A;  4AQF A;  4WWO A;  3CKC A;  3UUM A;  3EDU A;  2CHZ A;  3MKD A;  3ZYK A;  3VLD A;  2GW1 A;  4AKL A;  2FUL A;  3HVE A;  1HZ4 A;  5F3J A;  4Z8X A;  1JUQ A;  3PE3 A;  3C98 A;  4RSY A;  2I59 A;  1FIO A;  3PU3 A;  3HKD E;  4NUV A;  4J8E A;  4AI6 A;  3UUX A;  3NZU A;  3ML8 A;  1FMW A;  4I55 E;  5JRC B;  4ZI3 C;  5F8P A;  4UEM A;  2CMR A;  5D0O D;  3ENE A;  1KK7 A;  5M72 A;  1BR4 A;  3Q2M A;  2LSV A;  3P2B A;  5LA6 E;  3K3O A;  4EPZ A;  2LHR A;  3IF8 B;  1HFA A;  5M4Y A;  4JEU A;  5FY7 A;  4OYJ A;  4UV9 B;  1HX8 A;  4MKT A;  4L2L A;  3SWH A;  4OFZ A;  3APD A;  3U66 A;  2QGS A;  4H63 V;  4IE0 A;  4K0R A;  4BJM A;  3PRE A;  3O1I A;  3I3N A;  3BK9 A;  3LVR E;  2XTL A;  4L7T A;  2E0I A;  4KYO B;  1H2V C;  2PFV A;  4MLK A;  4C91 A;  2WPV A;  3VKG A;  4AXH A;  3ZJ1 A;  4BFR A;  2ZM2 A;  5GON E;  2V7L A;  4XIF A;  4FHK A;  4BY6 A;  1OWA A;  1VOM A;  1U3D A;  2WXN A;  3OJA A;  2YQ8 A;  2XAF B;  3FB2 A;  4BJN A;  2VGX A;  3PTR B;  2EHO D;  4NRH B;  2WXI A;  3PUG A;  1US7 B;  2XCB A;  5AJD A;  3ZLI A;  1E8Y A;  5KJK A;  4O4J E;  1YW0 A;  1YA0 A;  4B8A A;  3JQ0 A;  3H3A A;  2IC6 A;  3RK6 A;  3AA0 B;  3LBX A;  4ZOL E;  3FFL A;  3EJN A;  2RG8 A;  5LP6 E;  3MCX A;  4OYS A;  3R9A B;  3C50 A;  5J2T E;  3B7S A;  2Z6E A;  3ULQ A;  3FU0 A;  3U3I A;  5LHH B;  5G04 J;  1DNP A;  3MAC A;  5BV1 A;  3U3W A;  2Q9Q D;  4KMO A;  3RO2 A;  5A7D B;  2VYI A;  3IBP A;  3ZHE B;  2XAJ B;  2X38 A;  4JLE A;  3GWH A;  1UJJ A;  5ENN A;  1HF8 A;  4ILU A;  4OHF A;  4PUC A;  2FI7 A;  3N2O A;  2VSX E;  3OTN A;  1PC2 A;  3MV2 B;  5LGT B;  3G2V A;  2KZT B;  3RX6 A;  1HO8 A;  3ETU A;  2AW6 A;  3CIA A;  4UVB B;  1U5P A;  4CEM A;  3LK2 B;  3N2G E;  3FHE A;  2M67 A;  3OXL A;  3N71 A;  5LOZ A;  3CK9 A;  3HKB E;  5CHE E;  4C0E A;  3K3N A;  3IKO B;  4HOR A;  5JQG E;  4C0M A;  1ZBP A;  2K24 A;  1X5B A;  2Q7F A;  4LCT A;  2KT9 A;  4B0Z A;  3PUJ A;  5BT1 A;  5FMN A;  3R6N A;  3I9W A;  2R17 C;  5IYZ E;  3N9N A;  2EHO C;  4GZ3 A;  4LEU A;  3UUL A;  3WAJ A;  2LSJ A;  3D9M A;  2BUG A;  2XHE B;  5AFU L;  4H9O C;  3CKD A;  5CA1 E;  4L0R A;  4ZHQ E;  1YD8 G;  1S0P A;  3WI3 A;  3NQP A;  3ANW B;  3C64 A;  5JDN A;  4O4H E;  2X3M A;  2OA5 A;  4PK4 A;  4AY6 A;  4TRQ A;  2I2O A;  3UT7 A;  5L3B B;  4FA6 A;  2WQ6 A;  1ZHC A;  2JMH A;  2LM9 A;  4H9Q C;  5G2N A;  4WNK A;  3GMI A;  2Q9Q C;  5FQ7 A;  5J90 A;  3DBS A;  4GZ6 A;  3QUJ A;  3ASD A;  4WND A;  4I4T E;  3IEE A;  2AXU A;  4BT9 A;  2RP4 A;  1ZKE A;  2SPC A;  3KVB A;  3QWW A;  2JRK A;  4DO0 A;  1D1A A;  2YIN A;  3ETV A;  2DBA A;  2EHO A;  2X6F A;  2I9C A;  4DND A;  2JEK A;  4QX7 B;  5HI7 A;  3N9Q A;  4WW0 A;  4ANX A;  2DIW A;  1KT1 A;  2WXQ A;  4ILG A;  4LER A;  4U0Z A;  3RKO A;  2YU2 A;  1OWM A;  4EZJ A;  5HAX A;  4YJ3 E;  3UT8 A;  4N2S A;  3GZ1 A;  5T4Y A;  5HXC A;  5LCW C;  2Y4T A;  1QZ2 A;  4N3A A;  3EVY A;  4JHJ A;  2VB6 A;  2ODU A;  2WXK A;  4I9E A;  5ANR A;  1ZV4 X;  2LSK A;  4GK5 E;  1Z3X A;  4DLQ A;  2Q9Q A;  1H7C A;  5C2Y A;  3CVL A;  4QX8 B;  4JXT A;  4DLO A;  5ANL A;  3ZN0 B;  1LVF A;  3VTY A;  4BX8 A;  3ASF A;  2CWO A;  4AKH A;  2NWB A;  3FUE A;  3KV9 A;  2NW9 A;  2LSI A;  3FUH A;  4FP7 A;  2VK9 A;  3CV0 A;  4HE8 A;  3CR3 A;  1NAF A;  4OYK A;  1LKX A;  4XBF B;  3T5V A;  4EXT A;  2NW7 A;  4N2Q A;  3QAR A;  4PNI A;  3ZGQ A;  2RD0 A;  4P09 A;  4DI4 A;  4QXH B;  4H9P C;  1OUV A;  2A4Z A;  4Q94 A;  2JQQ A;  3JYS A;  2NW8 A;  4CGW A;  3EIJ A;  3CQX C;  2E9X D;  4XX5 A;  5KJM A;  1ZU2 A;  2WXL A;  3I5P A;  4FLB A;  5H6R B;  1U3C A;  4CGV A;  2H3R A;  4IHJ E;  3NRX A;  1HH8 A;  3AAA B;  4H9R C;  2MOW A;  4I2W A;  3U9W A;  4IIJ E;  5HXS A;  3ZPO A;  3ZFW A;  2X9X A;  3L13 A;  4PAG A;  2BF0 X;  3OXG A;  4N5C A;  5HWX A;  5HYA A;  4O4I E;  3CHQ A;  2DHR A;  3U4T A;  3D9O A;  4CXY A;  3PNT B;  2ZU6 B;  4GYW A;  3CHM A;  4I6G A;  3LDZ A;  2WM9 A;  1EF1 C;  4PS8 A;  3SRZ A;  5A23 A;  2C5I T;  3C4W A;  3AAE B;  4O8S A;  5LP0 A;  3KS2 A;  4U07 A;  3O4X E;  3CLJ A;  2PG8 A;  4B6X A;  3FUD A;  2VJ8 A;  4GZC A;  3IHR A;  3O1H A;  2CE7 A;  2XPI A;  5FY1 A;  4FC8 A;  3QKY A;  3LJC A;  5EKQ D;  2X51 A;  1N52 A;  3OBV E;  3PEU B;  2LSY A;  3Q5X A;  1EZ3 A;  3I4G A;  3ZJ2 A;  3LPZ A;  4DK5 A;  3Q5W A;  3D9I A;  4UEL A;  3MV3 B;  4FJY A;  5L2L A;  4KXK B;  4JA7 A;  3B7T A;  4N3B A;  1O3X A;  1WYC A;  5BW8 C;  1XGW A;  3HKE E;  3KEZ A;  3HA4 A;  2MYS A;  3LS8 A;  2W61 A;  3ZPJ A;  4GB9 A;  3RRM B;  5E76 A;  2I1K A;  3FH7 A;  1MMA A;  3U64 A;  4PH4 B;  1HG2 A;  2V7I A;  4UI9 K;  5T3R A;  3G2S A;  3RYC E;  4XKC A;  5LNK A;  4DBR A;  4UWG A;  2A5U A;  2E9X C;  3O9X A;  4AKG A;  3PDN A;  4F1S A;  4A3T A;  4CZZ B;  3KV6 A;  1MNE A;  4IE6 A;  4BSX A;  1U4Q A;  4KZ0 A;  4WUY A;  1E96 B;  3HYM B;  2CWY A;  2CXL A;  4P0A A;  3WXX A;  2L9B A;  5EDS A;  3L17 A;  1IJ5 A;  3PUS A;  2BDE A;  1H6K A;  1MHQ A;  2VSN A;  4UI9 C;  5FXZ A;  2KWI B;  5AIJ A;  2KMF A;  1E1H B;  5FYM A;  3L22 A;  1WRD A;  5HQ8 A;  3JQ1 A;  4UVC B;  4WNF A;  3JCK C;  2Y4U A;  4GPK A;  4CT0 A;  1Y8M A;  4U04 A;  4A56 A;  4CXW A;  3SF4 A;  4FLH A;  2R59 A;  2WSS V;  5DJQ C;  1BR2 A;  5FP3 A;  4PK6 A;  4AJW A;  4JHR A;  5CCL A;  1IAP A;  2BZB A;  5D0Q D;  5ADX L;  3SGH A;  2E9X A;  4EAH A;  4I1O B;  4EIW A;  3F31 A;  4KT6 B;  4PJJ A;  2VSY A;  1QSD A;  3P1U A;  4WWP A;  2E8I A;  4XAX B;  2HPL A;  4XKB A;  5L3C B;  4JA9 A;  5HXH A;  1OWN A;  2LO6 A;  4BAY B;  3RRC A;  3RH3 A;  2CXF A;  1WAO 1;  3B7U X;  2Y3A A;  2VTB A;  3CSF A;  3PE0 A;  3UT4 A;  4X1Y E;  4HXI A;  4UF0 B;  1LVK A;  5J2U E;  4UVA B;  4UWH A;  2P9B A;  5G05 C;  2HO1 A;  1SA0 E;  2XGM A;  3GW4 A;  4HFV A;  4JVS A;  4QXC B;  2WMN A;  4MHC A;  4MFR A;  3NRY A;  3TXN A;  3EIQ C;  2ODV A;  3AVR A;  2ZM8 A;  3GN5 A;  2IAK A;  4OK0 A;  3B13 A;  3RRW A;  2PJQ A;  2WBL A;  3G2W A;  4CDR A;  4DI3 A;  1A17 A;  4Q69 A;  1E8X A;  3FUN A;  3RU0 A;  3RYI E;  3C4Z A;  4AM9 A;  1UCU A;  4L9I A;  2RA1 A;  1WR6 A;  2WXP A;  4BX9 A;  4HKA A;  3FHN A;  3N9O A;  3MEK A;  1UW4 B;  2PQN A;  3LK4 2;  2J9Q A;  3QDN A;  2X9Y A;  5JDG A;  2V7K A;  5CA0 E;  3ESK A;  3FUJ A;  5A1L A;  3Q5M A;  2XQ0 A;  2J09 A;  4EZ4 A;  4GMJ A;  2JPF A;  2HR2 A;  2L3L A;  5ARG A;  2N9D A;  5BPP A;  4FJZ A;  1D0Z A;  2P58 C;  3UT5 E;  2LAH A;  4QFV A;  3PE4 A;  3MKQ B;  2WMO A;  3CVW A;  5G05 J;  5FT9 A;  1ZEE A;  1GW6 A;  5KCM A;  2H7O A;  1UX4 A;  2BVM A;  1VRB A;  3ZN3 A;  4MRU A;  3IV0 A;  4UV8 B;  3CVX A;  3OYX A;  3FTV A;  3UTK A;  3KV4 A;  4G24 A;  3PUR A;  4GML A;  2YU1 A;  3A5X A;  3NZS A;  3VLF A;  4B8C B;  3RPU A;  3D3M A;  3I4R B;  1S94 A;  2CG3 A;  3L08 A;  3PU8 A;  3LXU X;  3ZVV A;  2JMK A;  3GZ2 A;  3ESL A;  3H37 A;  3AB3 B;  2K9A A;  3Q9D A;  3CHS A;  3V5S A;  3RRN B;  3EHN A;  3N9L A;  2V7J A;  4L1B A;  2X9W A;  3LVQ E;  2OOE A;  5LJN A;  3P8C D;  4O6F A;  4J8F A;  4A1G A;  5JR9 B;  1Y64 B;  4G63 A;  3MZK B;  1INZ A;  2K5B B;  4J2C A;  4NUU A;  4AKI A;  3LCA A;  4EYU A;  4IE5 A;  5J1G A;  2L9Q A;  3AU4 A;  3KV5 A;  4E7S A;  3ML9 A;  4A1S A;  5AEN A;  5LHG B;  3CX8 B;  2DI4 A;  5EX0 A;  2CEA A;  2JLB A;  4HOT A;  1ELW A;  4JEH B;  3L54 A;  4G23 A;  3ONL A;  3URZ A;  1LRZ A;  2C5K T;  3CKB A;  4G1T A;  1E8W A;  5JDF A;  1CUN A;  2CFZ A;  4EBA G;  4AKR B;  2ZM0 A;  1X79 A;  2CM0 A;  3BG0 B;  4CDN A;  5JVD E;  1IYG A;  3IHY A;  4ZI7 E;  2GRM A;  1EDU A;  4KVO A;  5FXW A;  3S7F A;  4PJM A;  3R7Q A;  2KZ7 B;  2PQR A;  1EPU A;  5FJY A;  2BTD A;  1TEZ A;  3K8P C;  4H7Y A;  3LG7 A;  4L5G A;  3S7B A;  2D5U A;  3DPD A;  3IEG A;  4EZH A;  1JWF A;  5H6Q B;  3FU6 A;  5E0O A;  4PFO A;  3E08 A;  1Z6T A;  4F3V A;  4CXX A;  2CG2 A;  4CI3 B;  3ZEF B;  2YHE A;  3ONK A;  1WYB A;  3CPZ A;  4HFG A;  4I50 E;  4U8H A;  4U0U A;  3N9M A;  3D9N A;  4I2Z A;  2D0U A;  2W0G A;  3AU5 A;  3RKV A;  2YK0 A;  4GK0 E;  2CHX A;  3TL5 A;  1XNF A;  5LJM A;  2V7M A;  2KCK A;  2VGY A;  1UX5 A;  3LK3 B;  2XCC A;  2CLY B;  4XZC A;  2WXF A;  4I1M A;  5L3F B;  2KWH A;  5JDH A;  4U72 A;  2PM7 A;  2OV8 A;  4ILH B;  4FHJ A;  3FH5 A;  2KND A;  2XAH B;  5BMV E;  2C0L A;  2IQC A;  1BR1 A;  3QK6 A;  3KD7 A;  3VHL A;  4BA9 A;  5JRE A;  2YEV C;  3QOU A;  1E90 A;  1QUU A;  2K48 A;  4AIF A;  4P0B A;  1W3B A;  3Q15 A;  3WAK A;  4HOS A;  3AS8 A;  3FH8 A;  1NWM X;  5IHY A;  3TAX A;  2J4D A;  2UY1 B;  5FTP A;  3MZL B;  4G11 A;  4IN3 B;  3UFE A;  3SS1 A;  3ZHE A;  4L23 A;  1QQE A;  4CCA A;  2X6H A;  2XAQ B;  2LSU A;  4IDZ A;  4GCN A;  3OKQ A;  3HDX A;  2VQ2 A;  3UUN A;  3SOL A;  2KZT A;  3QC1 A;  1Y6I A;  2DCF A;  3NBX X;  2MHK A;  4IGU A;  5CCM A;  1HS7 A;  4GA0 A;  3QK0 A;  1VDY A;  4L2Y A;  2KLQ A;  3FUF A;  3HVE B;  2LSG A;  3M65 A;  3C98 B;  3UMV A;  4EQF A;  1KLX A;  1KT0 A;  4UWL A;  3CML A;  3ONX A;  2QFC A;  2NXP A;  4AY5 A;  2CFU A;  3C4X A;  4ANV A;  4QWN B;  2AWI A;  2C2L A;  4UQZ A;  2BVL A;  3UUX B;  2L8K A;  4G2V A;  5LCW J;  4WAF A;  4GYR A;  5C1D A;  2IJG X;  2EQX A;  3KAE A;  4F6R C;  4I9C A;  1FVH A;  4ANW A;  3I1A A;  3EHM A;  3RO3 A;  2IOS A;  3IHV A;  3FDH A;  2ES0 A;  2WAU A;  5EK4 A;  3TG5 A;  3QWP A;  4JEU B;  2Y8D A;  3CHP A;  3NF1 A;  3AA6 B;  2CXD A;  3V5U A;  5CB4 E;  3CWZ B;  4UXN B;  2XHE A;  1PAQ A;  1OXZ A;  2A2F X;  5DIZ A;  4A3V A;  3ANW A;  1OWL A;  3KDS E;  1D1C A;  1MQS A;  4RVB A;  4HVB A;  4PFP A;  5FXV A;  3N5L A;  3ZW3 A;  3FP3 A;  3D9J A;  4DMW A;  3ZMT B;  2J1D G;  2WXH A;  3OAW A;  3FUM A;  5FZS A;  5LBM A;  1YKH B;  4BT8 A;  3CVP A;  2XAG B;  1IZN B;  3HKC E;  5BNW A;  2ILR A;  1ELK A;  4DMV A;  2CA5 A;  2KC7 A;  2OVF A;  4MAL A;  4H9S E;  4Q96 A;  3TGO A;  4GA2 A;  1UJK A;  3HIZ A;  4CRW A;  5JJT A;  2LOP A;  2PM6 A;  3L3P A;  2VGX B;  4UQY A;  2HH7 A;  4J8D A;  3MKR A;  2KM4 A;  4UIG A;  1FMV A;  4BWR A;  2N2N A;  3ASH A;  3DP7 A;  3N2K E;  3LFM A;  2UWJ G;  4JZY A;  3F57 A;  2LEH A;  2V0P A;  5DBK A;  2YHC A;  4ACK A;  5LHI B;  4M3O A;  3HI2 A;  4KVM A;  3GYZ A;  3LBX B;  3BEE A;  3FTW A;  3B7R L;  2DWK A;  2IU1 A;  2V8S E;  2PZI A;  4FU3 A;  4B89 A;  1KNZ A;  4OVU A;  4WNE A;  2XQY A;  2IFU A;  4ZS2 A;  4E6H A;  1LF8 A;  2DCP A;  3CX7 B;  2XUE A;  2MBG A;  2IOL A;  2KAT A;  3ZMU B;  3NZP A;  2V4L A;  4J0U A;  4HTE A;  2D0T A;  3FTU A;  1MIV A;  3QAQ A;  4EZL A;  5JDL A;  3CHO A;  4K0U A;  4N78 D;  3AA1 B;  4AQG A;  3SZ7 A;  3OYZ A;  3CEQ A;  3SHF A;  1MMD A;  1NZN A;  1TJC A;  4TV9 E;  4CI1 B;  3PUK A;  4TV3 A;  3R84 B;  5L3D B;  3FUL A;  3MJX A;  1E7U A;  2KXP B;  4FJO A;  4JL0 A;  3RIB A;  4HEA A;  4IE7 A;  3VU7 H;  4IYP A;  4WNG A;  3Q47 B;  3FXD B;  3ZXS A;  1HTJ F;  4C9B B;  4MS6 A;  1MND A;  2FF4 A;  5JHB A;  2XGS A;  1S35 A;  3RYH E;  4UQX A;  5KJL A;  3APC A;  3EUH A;  3PEV B;  3IBE A;  4HN9 A;  1HS6 A;  3O1J A;  1D0X A;  3HL6 A;  2X66 A;  3FY4 A;  4HGA A;  1FEW A;  4FAD A;  3DJB A;  1HXI A;  1H19 A;  2QY7 A;  3SBS A;  5LFA A;  5EK2 A;  4ASK A;  4I43 A;  2XPZ A;  5T8I A;  4ME2 A;  4DBQ A;  5FWQ A;  3VTX A;  4WWN A;  4GCO A;  2VSO E;  4GYY A;  2CCQ A;  3SI5 A;  3RJV A;  2W62 A;  3FTZ A;  2KCL A;  3SBT B;  4LRZ A;  3KVA A;  1D0Y A;  3MYV A;  3QC9 A;  1HU3 A;  3F2E A;  4J8S A;  3FTY A;  3CQC B;  4YLH A;  4UI9 J;  1SQM A;  4H9N C;  2VKJ A;  2LOS A;  4DVD A;  4EEC A;  4LUN U;  3ZCI A;  2XRY A;  3D9L A;  5EK3 A;  4FUL A;  2V5F A;  1E7V A;  3OXF A;  3CVY A;  2NTX A;  5FNV E;  3K9I A;  4E85 A;  4V1A v;  3PNL B;  5HXE A;  4ANU A;  5AJL A;  3HR0 A;  5G04 C;  5LBQ B;  3J7Y q;  3R7R A;  5ARF A;  3APF A;  1OWP A;  3RC8 A;  2X9H A;  3FTS A;  4PK5 A;  4O2A E;  3MGB A;  3LEW A;  2LNI A;  3FU5 A;  1IQR A;  3L09 A;  4CT4 A;  4C90 A;  5LGN B;  4BTB A;  2AXZ A;  2L0I A;  4EOZ B;  3J9X 1;  2ACX A;  1H2T C;  3MK7 C;  2LT3 A;  1L5J A;  2EHO B;  2FEZ A;  5JH7 E;  5LCY A;  1MIY A;  3SD5 A;  3Q4A B;  4O4L E;  3KBT A;  5J08 A;  3QB2 A;  2NOX A;  5CMY A;  3PH0 C;  3K3Q C;  4XZ4 A;  4G2A A;  3ZC1 A;  3KIN B;  3QWV A;  1IQU A;  2I1J A;  1B7T A;  4I17 A;  1P5Q A;  2AXV A;  4JC8 A;  2VL8 A;  1WLX A;  3MA5 A;  3MX3 A;  5FZR A;  4ZS3 A;  3UX4 A;  2GGF A;  3UPV A;  2ION A;  2XAS B;  3JUI A;  4ACL A;  1BPO A;  2WVI A;  2Q9Q B;  5FZQ A;  4YVQ C;  2YNQ A;  2XPY A;  2FBN A;  2IW5 B;  1NP7 A;  4GA1 A;  4AV7 A;  4AP2 A;  5DAB A;  1DVP A;  5JJ6 A;  1SHZ C;  3BG1 B;  2X6J A;  4CDM A;  4ISS A;  1WM5 A;  4PJL A;  4ANJ A;  1SZ9 A;  2Y6X A;  2A3D A;  4YHJ A;  1NA0 A;  5G55 A;  4AOF A;  4WBN E;  2G0U A;  5LGU B;  1UN8 A;  2FO7 A;  4EBA A;  4N39 A;  4GYS A;  1N54 A;  2VAS A;  3E4B A;  4JUY A;  4IE4 A;  2HPJ A;  1TJF A;  5KDM C;  2V1D B;  3LJ3 A;  4FI5 A;  4TV8 E;  1HE8 A;  4YVO A;  1JPL A;  5EZY E;  4ERR A;  5DQW A;  5BUZ A;  5EX3 A;  3CVV A;  4WBO A;  4B94 A;  3FBZ A;  2B1E A;  5KX5 E;  2PL2 A;  3S7D A;  2KCV A;  4GAA A;  4U0S A;  1IJ6 A;  2LHN A;  3PZD A;  4OVV A;  3UQ3 A;  3FUI A;  4E7Z A;  3PUQ A;  4EB6 E;  2JJ9 A;  3G2T A;  4G26 A;  4UF0 A;  5JRC A;  2I6H A;  3U78 A;  2NP9 A;  4JW1 A;  4F7A A;  3G2U A;  3PRZ A;  3ZC0 A;  1UG3 A;  4TN7 B;  3AVS A;  1NA3 A;  4CQI A;  2L0T B;  4TZ4 C;  4APO A;  4KZC A;  5L3E B;  4XI0 A;  3D0T A;  2X6K A;  1MMN A;  4X20 E;  4YND A;  4HS2 A;  4GZD A;  4ZI2 D;  5JHA A;  3S2A A;  4DJA A;  4H7X A;  4U63 A;  4HLE A;  3ZIM A;  5CMW A;  3FTX A;  2KIN B;  3TKL B;  4ADZ A;  2XEV A;  2LE8 A;  4AXP A;  3HHM A;  2W00 A;  1E8Z A;  3DTO A;  4UWK A;  5KJN A;  3T8O A;  1WY6 A;  4A55 A;  5LOV E;  3KBU A;  4MBQ A;  2WXM A;  4GIW A;  3RYF E;  4EZK A;  2WQH A;  4P29 A;  3LKU A;  3ZMS B;  2UXX B;  1HCI A;  3L16 A;  3VLE A;  4QHO A;  3AA7 B;  2X0L B;  1BR0 A;  1ELR A;  2WXJ A;  3SNX A;  3ZMV B;  3ZRH A;  4CI2 B;  1H0A A;  2VKD A;  5FQ6 A;  2W63 A;  2XGO A;  3I9Y A;  1PY1 A;  2L6J A;  1QNF A;  1YKE B;  4GYO A;  4PS3 A;  4RG6 A;  2NC9 A;  3MXZ A;  3JC6 D;  4GZ5 A;  4TX5 A;  2HYZ A;  5E75 A;  4IST A;  4IRU A;  4ABN A;  3MKQ A;  3FEX A;  4NAC A;  4W9R A;  2WXO A;  3L6A A;  2M63 A;  5FQ4 A;  4AVX A;  5JR9 C;  2J49 A;  1Z3Y A;  5LX8 A;  4KMC A;  1FCH A;  4PDX A;  4Y6C A;  3MA9 A;  2J4B A;  2H7V C;  4U74 A;  2A72 A;  3ZN1 B;  3LYA A;  3S7J A;  1D1B A;  3FXE B;  2NSZ A;  5DQV A;  3PDY A;  3Q49 B;  3T8M A;  3CGH A;  5FXX A;  5FY0 A;  5LYJ E;  4TUU A;  1FVF A;  3CVQ A;  3ZCJ A;  2E9X B;  1T98 A;  3VKH A;  3PUA A;  4KP3 C;  4O2B E;  4KBM B;  1UN9 A;  2C5J A;  3AAI A;  5KMG P;  3QNK A;  1H2U A;  3PS6 A;  2V26 A;  4N3C A;  3BQK A;  3EDT B;  1OWO A;  4H63 H;  3I0Q A;  3FU3 A;  4ZI2 C;  3ZYM A;  1HG5 A;  2C0M A;  2DWG A;  3TJP A;  3P7I A;  5JDQ A;  2LJL A;  4PS7 A;  2VTB B;  3I0O A;  5JR9 A;  2OVB A;  3LY8 A;  4I43 B;  4HOU A;  4URK A;  2D2S A;  4QXB B;  3RRU A;  2WWU A;  2J07 A;  3C51 A;  2X68 A;  3O48 A;  2C0S A;  2Y48 B;  3TXM A;  2ZMA A;  4M1P A;  2R5S A;  1EYH A;  3AS5 A;  2N1G A;  3EDV A;  4F53 A;  3BQL A;  2LAI A;  3CX6 B;  3QJZ A;  3ASG A;  4XE0 A;  2IC9 A;  1JWG A;  5TAO A;  4JEH A;  2WQ7 A;  5JDM A;  4APF A;  3NZQ A;  3GN5 B;  3CQG B;  2PBI A;  4MLP A;  2OND A;  3CK8 A;  4J6I A;  3JC6 C;  2J08 A;  2HM8 A;  3CK7 A;  5A6C A;  2GK9 A;  4V3I A;  2CLY C;  2VKO A;  4TUY E;  1IHG A;  4ILI A;  4ATG A;  2VKH A;  4PJN A;  4I6J A;  3D9P A;  3ZYQ A;  4HOQ A;  4YFS A;  4G25 A;  4EYY R;  2WXG A;  2CHW A;  3CHR A;  5FQ8 A;  3FEY A;  4D10 C;  1MIW A;  1B89 A;  4R7L A;  2IF4 A;  3T5X A;  4IUL A;  5BV0 A;  1G8X A;  3FUK A;  4NQ0 A;  1Z0P A;  4K03 A;  4I1A A;  4I6E A;  3E22 E;  3LY9 A;  5HXR A;  2UXN B;  3KFW X;  5HWY A;  2DLR A;  1SZA A;  3ZEF A;  4PW8 A;  3N9P A;  4GOU A;  3CVU A;  3S4U A;  5LG4 A;  3FWV A;  3B57 A;  2MTQ A;  5L3G B;  2AVP A;  4ZI3 D;  5LXT E;  3TG4 A;  4QKN A;  1V9D A;  3ZYL A;  3CVR A;  3RC3 A;  3D9K A;  4Y6W A;  2MOZ A;  4KBQ A;  2NTY A;  2DNX A;  5ETW A;  2GRL A;  3E0Z A;  2XRZ A;  3GA8 A;  4AQF C;  4YJ2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...