1HFAA

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, pi(4,5)p2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 100
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hfaA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hfaA01
3D9IA 1DVPA 3D9KA 2V8SE 3G2UA 5J08A 1UJKA 1HFAA 2BF0X 3G2SA 3D9OA 1EYHA 1HG2A 4Q96A 5CMYA 1ELKA 2DIWA 1EDUA 1SZ9A 3RRUA 1HF8A 3G2WA 3D9NA 1UJJA 4JXTA 3CLJA 1MHQA 3G2TA 4FU3A 1INZA 2L0IA 1H0AA 3ONKA 1JWGA 3LDZA 2KM4A 1XGWA 3D9JA 4HFGA 4Q94A 3ONLA 4FLBA 1PY1A 1JPLA 4GZDA 3D9MA 4NACA 1VDYA 3ZYKA 3D9LA 5CMWA 4GZCA 3ZYQA 1HX8A 5LP0A 2L0TB 3G2VA 1SZAA 2QY7A 3ZYLA 4AVXA 2DCPA 1HG5A 1LF8A 1JWFA 3ZYMA 2LO6A 1JUQA 3D9PA 5LOZA 2MOWA 1X5BA
chains in the Genus database with same CATH superfamily
5A6CA 2H6FA 2AJAA 1BI8B 3UM3A 4A1SA 4LMKA 4BETA 4JBWF 1FMWA 4Z91A 2QRXA 4DLQA 3DXMG 4UWHA 5FWQA 3TKLB 2R2LA 3C3RA 4I1OB 4U63A 2BVLA 1Z8UA 1HCIA 4JL0A 4BTAA 4AQFA 4DV6T 3DXKG 1VOMA 1HX8A 4X5TA 5L47A 4AISA 1E90A 4XKCA 4IE5A 2IC9A 4GA0A 2ZM6T 2IF4A 3ISMC 3LY7A 3FH5A 4HRMB 3CHOA 4L7TA 4HN9A 2PZIA 2L8KA 3QKYA 4BJNA 3S7FA 4N3CA 4WNEA 3TLSA 3ZCJA 3NB2A 4QFVA 3FXDB 3QWVA 4LMLA 3ZCIA 3IBEA 4G11A 4X64T 4H9NC 4EHMA 3B7SA 3HYMB 2A5UA 1N11A 3UU6A 1ZB1A 2MYOA 1MIWA 2A5EA 5D2MC 3F31A 3I0OA 3JCFA 1DVPA 2HN1A 1IBKT 1SA0E 4LEUA 4RG6A 2VQ2A 1WFDA 3V5SA 2WQHA 3ZT5A 4GZ3A 3P4PA 2FI7A 1W0BA 1XWMA 1MIYA 1K1BA 5ANLA 3OKQA 3AEGA 2C5IT 2YN6A 4G63A 3UU4A 4YLHA 4I6EA 4L9PA 2NR4A 2EHOA 3JYSA 3HIZA 3D3MA 4HOQA 1Z0PA 1N54A 4XX5A 5G04J 3DTOA 5JR9A 1YCSB 3B7BA 3CHSA 3RO2A 4P29A 3VRAA 3SF4A 3AE8A 3LJCA 4F7AA 3ZMVB 3Q79A 2E2AA 1S0PA 4GTPA 4DR6T 3SO8A 3KSQA 3V2XA 1N95A 4RG9A 5KWDA 4JD2G 3LJ3A 5AQMB 4ZI2C 3FUJA 3FU0A 5TAOA 3JUIA 3BK9A 1D8EA 4AQGA 2XQ5A 4A98A 3L08A 4ILAA 3UMVA 2V7MA 2KXPC 2ZU6B 4GK0E 3C98B 1OWLA 2LKGA 2ZISA 4OVVA 3EHQA 3AVSA 2JMHA 4ADZA 4OX9T 3ONKA 1XMOT 1N32T 2OOEA 4U96D 4YHJA 4V3IA 1TNYA 5EN5D 1P5QA 2F8XK 5D66A 4PJLA 1H2UA 2LSIA 3AG4E 5LOZA 2X6HA 4EGWA 3UTMA 5KXJA 2J07A 1HFAA 3PZ3A 5EKQD 3FTYA 3GN5B 2HPLA 3LPZA 2H6IA 3L13A 3KEZA 3ZKRA 1K1AA 3Q5MA 2VURA 2EILE 3TLUA 1ZHCA 4I2WA 5HXHA 3KV5A 2LT3A 2HPJA 4BEPA 2K48A 5FNVE 1VDYA 4CI2B 4ABNA 3HHMA 5L4EA 4DR5T 1YMPA 2V0PA 3Q75A 4TZ4C 3L09A 4YSXA 4JI0T 4QXCB 4JZYA 5JMND 1BU9A 5C2TA 3MYVA 3DEOA 5E75A 4G8LA 5AQ7A 3ZU7B 1XNFA 3DRAA 3SBSA 3ONLC 4APFA 4ANVA 5LG4A 1NEKA 3EHRA 4UF0B 2VTBB 2KZTB 3M3ZB 5FL0A 3ZN1B 2IFUA 4V1Av 3S7DA 3B7RL 4K5CA 4H9SE 4HLLA 3TXNA 5JJTA 2L0TB 4KUMB 1BLXB 4OHFA 4GCOA 5AQOB 4X20E 5H6QB 3ZNGA 1NL4A 5J2TE 5CCLA 2N9DA 3HR0A 4TWHA 3LS8A 3EUVA 1AWCB 4HOTA 3FTWA 4LF8T 4J7WA 1E7PA 1MMAA 1ZOYA 5HWYA 3RYCE 2V4LA 1DU2A 1E8YA 1MX6A 1EPUA 3VRBA 1XGWA 4IE4A 5LJNA 2CA5A 3JCKC 1OCZE 1T7SA 4K0RA 2UU9T 2VL8A 2XQAA 5AQJB 3BQOA 3MJWA 1D1AA 2CFUA 4L2LA 4WYVA 4YTNA 4MLKA 4U33A 3HKCE 4L5GA 4FADA 4UI9C 2JPFA 4ISSA 4JHRA 4GMJA 2ZGGA 2CEAA 3VLFA 1HX1B 1D0ZA 3V30A 1MQSA 4TWDA 3OXGA 4IYPA 1TEZA 3C4ZA 3GWHA 5LFAA 2V5DA 2RFAA 2PG8A 3CGHA 4BTBA 4DPRA 4ISTA 3ZC1A 1TR4A 3FZMB 4AJWA 5JJ6A 3MZLB 2WWUA 3TL5A 2XQ7A 5CEDB 4G2AA 3D9MA 4IL9A 5HEUA 4FULA 4AKLA 3F57A 5AQVB 5C3JA 4OYSA 1N4RA 4U2ZA 4CXXA 4DNDA 2UWJG 2VGXA 2CLYC 3CVUA 2XAGB 1CHUA 2OEWA 4YXDA 2K9AA 5M72A 5L3EB 4YNDA 3F2EA 1FT2A 2WM9A 1S63A 4CDRA 4XKBA 2PQNA 3FUDA 4YFSA 1E8XA 4I0UA 3AS5A 4HFEA 4FJZA 3CHQA 4AXPA 4G1TA 2IQCA 2KCVA 3GW4A 4A55A 4IDNA 4LFAT 3FDHA 2WXJA 1ELKA 1QUUA 2F37A 1UJJA 2P9NG 3VKHA 3JQ0A 2VGEA 3UIOC 2WXOA 5IY5E 4IIJE 3F6QA 2VKHA 4MHCA 4CT4A 4IDOA 5JVDE 3O48A 4U72A 3PZ4A 5ADXL 1X81A 1UCUA 3ZT6A 3MV2B 2I0MA 2R03A 2XJ7A 4TWFA 4K03A 4HLEA 3CHMA 2JQKA 4F3VA 3OXFA 3RIUA 2BG9C 5L2LA 2IOSA 3PUWF 4TUMA 2BEDA 3R9AB 3N2OA 4L23A 4ZXLA 3CR3A 4ZI3C 4GZ5A 3U3IA 2BVMA 2DI4A 5JRCA 1OWNA 2J1DG 4CN4A 2J08A 3Q7FA 3ZXPA 3AXJB 2J9QA 4HI9A 3IHVA 2ZM8A 5IWAT 2Y1LE 2OA5A 5IHYA 3FUHA 3LK42 3FTUA 1D8DA 5AIJA 4FHKA 2LSKA 3C5RA 5AN8A 4F1SA 3L8RA 1SHZC 3KSLA 2FO7A 2Y0BG 2VSNA 4JI5T 3QDNA 5EILA 3X2QE 3RYIE 4HQDA 3AB3B 3Q9DA 2GRNB 5FVLA 5D0OD 2NYJA 4EIWA 3OTNA 3LKUA 3B57A 2XZEA 2V5FA 1Y01A 4NQ0A 2I59A 2GRQB 2RPAA 4B3ST 3UUXB 3RC3A 2V5CA 5FQ4A 3AA6B 1ZU2A 5J90A 1L5JA 1N4SA 1KNZA 1CUNA 3JADA 4JI6T 5DIZA 1DC2A 3PS6A 2LKHA 3QC9A 1HZ4A 1K3ZD 4HFGA 3EIQC 4G24A 2XGSA 1O1TA 2KBXA 5DABA 2XAHB 1JNZA 4O60A 4TXPA 2V26A 1E8ZA 4YJ2E 1FIOA 5BXUA 2JJ9A 2HH7A 4DIDB 5LMNT 2KATA 4PNIA 4ANXA 4Z90A 4FC8A 3ZFWA 3FH8A 3ZLIA 1HNZT 4NURA 1OEDB 3PUAA 3LXUX 2VK9A 2PL2A 4F1PA 3MK7C 3QB5K 4OYKA 4O8SA 1UN8A 3PTRB 4ILIA 2YU1A 3AVRA 3KV6A 3ZJ1A 5HXRA 2FJAA 2NWBA 4GTVA 4BJMA 5BT1A 5ETWA 5T4YA 2IAKA 1KFYA 2KZ7B 1WCRA 1FMVA 5T8IA 5F3JA 3UULA 3NOGD 4DX7D 5FQ6A 4U31A 4UWKA 3FULA 1XZYA 2CWOA 3I1AA 1PAQA 1IJ6A 4JVSA 3ABME 3DPYA 2OV8A 2BKNA 4JYAT 4B3MT 1WYCA 2M63A 2Y4UA 3MXZA 2L3LA 5LOVE 4KVMA 4B8AA 4NXMT 1ZP0A 4U7IA 3SNXA 3E0ZA 3QWPA 2CXFA 3FUKA 3MKQB 1QNFA 1U2VG 2KCLA 2Y3AA 3G2UA 2Q9QC 1IAPA 4YDOA 4Q69A 3LCAA 5KJMA 2J49A 5CERB 4KP3C 3P2BA 2FJBA 2XGMA 3L9TA 3G2TA 4AKRB 1INZA 5EX0A 3Q5XA 4KHPT 1H6PA 3NBNB 2EQXA 2WVIA 5F8PA 4AKHA 1OWMA 5AQIB 3SOLA 2XQ3A 4QX7B 5HCMA 4EYYR 3PRZA 1NA0A 3ZYLA 4I6GA 2DCPA 1JWFA 2V6YB 3O1HA 3ZPOA 1N36T 1E96B 3ZKJA 2NP9A 3ABKE 4LG6A 4HFVA 2YHCA 4N3AA 5G2NA 2LUHA 5FQ8A 2DWZA 2AXZA 4E6HA 4AP2A 3MGBA 4C0MA 4ILBA 4WWPA 4P1NA 1HH8A 4AQFC 3MZKB 5JHBA 1V9DA 4LFBT 2P9UG 3HDXA 3CWZB 2I2OA 1M62A 2A2FX 5JREA 3O4ZA 5L3BB 4GPMA 4HOUA 3KV4A 2E5LT 3A5XA 2N2NA 3B7UX 5JA4D 2XS1A 4HNAD 4PJNA 4KZ0A 4AIUA 4JEHB 5FY1A 2GRLA 2J4GA 2LRLA 2WSSV 1S70B 2DZNA 5FT9A 2VVSA 4KXKB 3HG0D 2UXCT 1MHQA 3NZPA 1RW2A 4HFDA 3V31A 1TNUA 3C98A 4U04A 5H6RB 5JDNA 4LF7T 3JUEA 3TWWA 4KBMB 5L3CB 5EK2A 3SBTB 2LSUA 3FZFB 3U4TA 5ABFB 1Q2ZA 2FUPA 3FUNA 3NBXX 3TJPA 1OWAA 2ZLYA 3ASHA 5JJ7A 2K5BB 1E8WA 4O4LE 1SA5A 2V7IA 2WS3A 2LEHA 4HB5A 2GW1A 4J8EA 1LD7A 3VKGA 1JNRA 5JH7E 2ES0A 3QB2A 4HFIA 4EOZB 4FHJA 4TV8E 2LSGA 4XAXB 5BR8T 1US7B 4XE0A 1ZBPA 2QYWA 3APFA 2EHOC 2MRIA 3GN5A 5T3RA 4HOSA 3ZMSB 4IT4A 1U4QA 5E0OA 4BX9A 2H7OA 4DV2T 3R6NA 5EYLA 2LO6A 3CVYA 1YKEB 4M7CA 2XGOA 3WXXA 3ZC0A 4N5QA 4L2YA 5CGMA 3LDQB 3BU8A 5EIBE 3N9PA 5CMYA 1HS7A 3KV9A 3ML8A 5AQLB 2WXLA 4J8YA 3MJXA 3EHNA 3HKEE 4H9PC 3C4WA 5HAXA 2NSZA 2VQFT 4AY6A 3P50A 3VHLA 3JC6C 2UY1A 5DBKA 5BV0A 4TXQA 5EX3A 3FZKB 1S94A 2YKSA 4X65T 5JDLA 3EIJA 1IJ5A 5LP0A 4AVXA 2R59A 4UF0A 3GMIA 2KZTA 2WQ6A 2HR2A 3PURA 3BEEA 4GTTA 2CLYB 4O4HE 4I9EA 1R8IA 3CIAA 4WBOA 1BD8A 3KINB 1EYHA 3KS2A 3ZUVB 5AENA 2KCKA 2WQYA 4GU5A 3ONJA 4IE7A 4PJMA 1OXJA 4FU3A 5IYZE 4MRUA 4IDZA 4EYUA 3ETUA 5AQHB 2MHKA 2GRMA 1OCOE 5FP3A 2QZAA 2AVPA 1WR6A 5AQQB 4I43B 2IIUA 3FBZA 2KMFA 4IN3B 3GZ1A 4G25A 2MOWA 4TXRA 5EIDA 3TXMA 4IREA 2RG8A 2W63A 2V5QC 2KC7A 2H3RA 4DO0A 4K0KT 3ETVA 1GW6A 2FBNA 4JI8T 3G2WA 3PDNA 2F4VT 4JXTA 4YVQC 4CXYA 4LNGA 3ZMZB 4I50E 2X68A 3FFLA 4HWHA 4FI5A 3QOUA 5DJQC 2QGSA 2IMLA 4Q94A 3FXEB 3PUJA 1NFIE 4TN7B 1IXVA 1FPPA 4PJJA 3PE0A 2I9CA 2P2CP 3RGLA 3BQIA 3N9LA 2BKKB 4GTSA 3SFXA 3PU3A 3D0TA 5EYPF 2BG9B 2ETBA 5H7PA 4M3OA 4B0ZA 4EZKA 4A56A 5G05J 2P9IG 1OY3D 3VTXA 4CQIA 1LVFA 2K24A 4BSZB 4TUYE 1TJCA 4KMOA 2CXDA 3FU5A 1H7CA 2XZDG 1IKND 3KFWX 5AFUL 2PQRA 4GK5E 2ILRA 3AU4A 3A7MA 2QC9A 1FVHA 5IUXA 3GZ2A 1T72A 5LMUT 4DI4A 4C0EA 4U74A 4BAYB 1YW0A 3AEEA 4O2BE 2JMKA 1M7KA 2PM7A 3CK8A 1OCCE 4ZFHA 1VRBA 3UT8A 4XI0A 2G0UA 2Y8DA 3EDTB 3SFDA 1KF6A 3MKDA 3RRWA 2XQ8A 2LAHA 3T1YT 1YD8G 4EBAG 2BUGA 4LMJA 1N9AA 5A1LA 2W66A 2VASA 5J2UE 1IQRA 4B3TT 2V4HC 4EEBA 3Q15A 3P8CD 4EXTA 3MCXA 1HXIA 5CA0E 5G04C 4H7YA 3UUBA 2IW5B 2XZTG 4Z68A 4CZZB 3H3AA 2UUBT 4LF6T 3HVEB 4EZ4A 2CE7A 3MEKA 4AV7A 1ZV4X 3TG5A 3ULYA 2IO2C 5EZYE 2VGYA 4GPKA 2B1EA 2R05A 4ZI2D 2R17C 3U3WA 1TN7A 4AI6A 3CQXC 4JI7T 1N52A 3AXJA 3TLTA 5BUZA 4U0UA 4AY5A 4CRWA 4AM9A 3QB5A 4JUYA 5FZRA 1T8BA 5ABHA 2XS8A 4O1OA 2LHRA 2A9UA 1B89A 2X67A 1ZKEA 3H37A 1Z5SC 2BBHA 4JPSA 3J5QB 3ZN3A 3IEGA 2X0YA 1NZNA 3Q5EA 3E32A 4B3RT 5G55A 4ILUA 3RH3A 3UQ3A 4TNVA 2CHOA 2V1DB 4X66T 3AA1B 3NKZA 4RVBA 5F5WA 2JLBA 5JDGA 3RIBA 3L82A 2BBJA 5ENQD 3UUXA 4U2YA 3AEFA 3TWQA 1QZ2A 3W15B 3W9GA 4N39A 1LTXA 3P4SA 2R6GF 2JQHA 3NF1A 3ZPJA 3FB2A 4DV4T 1N0RA 4ILHB 4J0UA 3I9WA 2ZM2A 5KNGA 2FEZA 4A3VA 4OYJA 3BG0B 1D9SA 4G26A 2VYIA 3CKDA 4CGWA 5AQPB 4MFRA 2XM2A 5BV1A 4I2ZA 3TG4A 1U3DA 1SE7A 1W9RA 1MMNA 2RFMA 3ANWB 2E5VA 2CHZA 2X6IA 5HCJA 5KNHD 4CZ2D 4UR9A 4CI3B 3I4RB 4IULA 2VWAA 3ULQA 3Q5WA 1OEDA 3D9JA 3K3OA 3ULEG 3RYFE 3ASFA 2DZOA 4EZJA 1OUVA 3T8KA 4G2VA 4F8HA 2XPYA 3AEDA 3UKUG 3PZ2A 1W09A 3Q47B 3VLEA 2BDEA 3CHRA 1EF1C 4ASKA 2VSXE 4GMRA 4AEZC 3ML9A 4UQZA 5M4YA 2XQ9A 3IKOB 3N9MA 3L3PA 4L9IA 3TWRA 3RPUA 2XUEA 3AAIA 2IJGX 4UQYA 2RA1A 5FKYA 1IBLT 1WRDA 3JAEA 4R7LA 4PDXA 4FA6A 5JQGE 3ZSTA 3TWSA 1IHBA 1MJ0A 3NRYA 2P9SG 2LXLA 5AYWD 1SQMA 3AS8A 3RU0A 2AWIA 1N0QA 4DX6D 3CVLA 1EZ3A 2V8SE 2SPCA 3K3QC 2IUBA 3T5VA 1A17A 2DCFA 5LB7B 3RYHE 3ENEA 1UUSA 2X3MA 4ILGA 2LLYA 3MKQA 2M6IA 3KAEA 3Q7AA 2JEKA 2VSOE 1HU3A 2IONA 2X6FA 4YVOA 2UUCT 4GYWA 1KNRA 5JDQA 1ELRA 3RRMB 4N2QA 5LP6E 3AE7A 5ANRA 3EU9A 3SWHA 4GAAA 2YDRA 3RKOA 3UUNA 3D9LA 5FXWA 2ZGDA 2V7KA 4JA7A 5LX8A 2V6YA 4JB8P 2XHEB 4J2CA 2XAQB 3UT5E 4CI1B 1FJGT 1Y8MA 3ZHEB 4GIWA 4XIFA 4ZZBA 3IXEA 1V55E 3V5UA 2BKGA 2VQET 4YTMA 4GZDA 5AQBA 2MAWA 3Q5DA 2X38A 3ZYQA 4DR2T 2NW9A 1J1JA 3CKCA 2LNIA 1HR0T 1UG3A 1WAO1 4QH5A 3CHPA 3CMLA 2KSRA 4DR7T 5HI7A 1SW6A 3DSTA 4CN6A 5FL1A 4P09A 2IEJA 4TV3A 4JEHA 4H7XA 4EZHA 3Q73A 1U3CA 3GA8A 2UXXB 3ONLA 5ENPD 2A72A 4PS8A 3I3NA 2DWGA 4WZXA 4UV9B 3U64A 3T8OA 1SZAA 5CBNA 4EEDA 2E9XC 5JTGA 3PZDA 1G3NB 4G23A 4B6XA 4HXIA 4A63B 2EIKE 3PH0C 3P1UA 2L9BA 3K1SA 3E30A 3LSVA 4GTRA 1W0AA 4LF9T 1B7TA 2D5UA 3J7Yq 4ERRA 1YYHA 3PUKA 4XZCA 1SZ9A 3NWIA 2V7JA 4OAUC 2XEHA 3AU5A 3EABA 2BKPA 1N34T 3ONXA 4O1PA 2IU1A 3RQWA 3HKDE 2KM4A 2WB2A 3I9YA 4ZI3D 1BR1A 2IO3C 3LK3B 4OK0A 2ONDA 2X0HA 1E2AA 5A7DB 3VR8A 3C51A 5AQKB 2DHRA 3AAAC 4LFCT 3UQ7A 2VJ8A 3UX4A 1MYOA 2MYSA 4HI8A 4JI2T 3FEYA 1Z6TA 3X1DA 2ACXA 1SUMB 4O2AE 4GYOA 4I9CA 3UFEA 1JCSA 3PZ1A 4KT6B 4DUYT 2EIME 2QA7A 2XQ4A 3IEEA 4MBQA 2JIWA 2YEVC 1BR0A 5CECB 5FXVA 3WAJA 2J8SD 2H89A 2XTLA 1QSDA 3KVAA 4EECA 3T9KA 3A8YC 3QK6A 4PFOA 1E7VA 4CEMA 4FP7A 3VLDA 5CB4E 4YDYA 2HHHT 2XQYA 2AXDS 3SRZA 3CVQA 3B95A 3TAXA 3D9PA 1D0XA 3AA0B 3SQVA 3QARA 3UM0A 5CRVA 3UM2A 5CHEE 3DEPA 3HRAA 3PNTB 4DX5D 3CKBA 4ZS3A 3ZT7A 4YSZA 4AOFA 5CA1E 3Q4AB 2WDRA 4A97A 4QKNA 1UGOA 2YK0A 3ZXSA 4LCTA 3TWTA 2HM8A 4BY6A 3N2KE 1HS6A 1Y64B 3MKRA 3WG7E 3L54A 4EB6E 3D9HA 3KBUA 4BA9A 3CPZA 5LA6E 3R7QA 2H6GA 4CYMD 2ACZA 2LE8A 4ZEYA 1IBMT 4BERA 2KWIB 5HS0A 2UXDT 3LY8A 3UM1A 5AQAA 4I1MA 1N33T 4JV5T 1EDUA 2ZXWE 2NW8A 4GKKT 3CEQA 5ARFA 4WUYA 4PK6A 5FYMA 4KI0F 4PK5A 1WDYA 4K5AB 1N4PA 3E37A 5AJLA 2KT9A 4JEUB 2J4DA 4PS3A 3UUMA 5HEOA 3JAFA 4GZCA 3CK6A 3N9QA 1MX4A 4KVOA 3Q9UC 4ANJA 2WPVA 2KXPB 4MBGA 2WDQA 5LCYA 1SA4A 2C0SA 4IRUA 2DYSE 3R9MA 3I4GA 4DK5A 4E7ZA 3SZ7A 4Q96A 1TYQG 3BG1B 5ENSD 5LCWC 1HO8A 3G06A 3S7JA 5E76A 4RLYA 4X1YE 3LYAA 3O1IA 3R84B 1JWGA 2AE9A 3AS4A 3I5PA 1I94T 5FXZA 2BG9A 4JHJA 4F53A 4GYSA 3M65A 2BS4A 4N78D 5HWXA 5KX5E 2J09A 3OXLA 3PUYF 1O1SA 1BR4A 5DQVA 2WXFA 3LK2B 3C64A 4KYOB 2GRPB 3GZSA 4NUVA 5JDMA 3FHEA 1G8XA 1L0VA 1O1RA 3ZRHA 4HFHA 4X62T 1ZEEA 4KX6A 3OJAA 3AG1E 2RD0A 4H9RC 5B1BE 4U07A 2CCQA 3VTYA 4N3BA 1PC2A 5L3GB 3IA3A 3CK9A 2XSBA 5KBAA 3BQKA 3EDUA 4DV3T 1MMGA 4LF5T 5DQWA 3UTKA 3TGOA 1GQEA 2XCBA 2B76A 3AE9A 2X9XA 4DV1T 3U9WA 4ZHQE 1I6ZA 1XMQT 1NA3A 3Q78A 3Q9NC 4DBRA 3PUGA 1TJFA 4YSYA 2PM6A 3UXGA 1TNOA 4U7YA 5KCMA 2I1KA 2IC6A 3RIFA 3LDZA 4LERA 4XI9A 1QQEA 3E4BA 3JXJA 4GOUA 2CMRA 1NP7A 1LKXA 4EV6A 4Y6CA 4FLHA 3FUIA 4L1BA 3HVEA 1KZOA 2EINE 4TUUA 4MALA 2E2EA 3RSEG 4WNKA 4TV9E 2RKKA 1A5EA 3FY4A 4XZ4A 2F8YA 1WLXA 2BZBA 4F6RC 2X0LB 4C90A 3LVRE 2CHWA 4CGVA 3ESLA 2D0UA 5LNKA 4X1IE 2LM9A 2GRRB 3NZQA 3HKBE 3ZYKA 2XCCA 4MKTA 3PUVF 4L0RA 1UOHA 5JR9C 3QC1A 3C3QA 2JQ9A 2WXPA 4DMVA 4APOA 1DCQA 4B8CB 4ACLA 1YQ4A 2J47A 4YHHT 3B5MA 1MX2A 4HWFA 4HTEA 4HBDA 4JLEA 5EDSA 4JA9A 2QFCA 4GKJT 2X66A 2LRKA 3APDA 5FQ7A 5AARA 2EHOD 3UT4A 4QHOA 3V2OA 3IF8B 4U0ZA 1NAFA 3G2VA 1QLBA 2H7VC 4LNUD 1HG5A 1N94A 2P9LG 2VTBA 4HRNA 2BS2A 4GA2A 2WXQA 1IQUA 2CPTA 1FT1A 2OVBA 2YNQA 2CHNA 5LJMA 4BSXA 4UELA 4O4JE 3N5LA 3D9OA 2XRYA 3ESKA 4YDEA 4HWIB 1NWMX 2XQ6A 5BW8C 4NPPA 1Z3XA 4IE0A 3C3OA 3HXDA 3QNKA 5KJLA 2XAJB 2XAFB 4DR1T 3JC6D 1D1BA 4YY3T 2WXGA 2MOZA 1DNPA 4U8YD 2GROB 3DBSA 4LNBA 4A1GA 3LEWA 2FULA 4E85A 1JUQA 2WCAA 2PTFA 4MS6A 4ZS2A 3RQUA 3DPDA 2X9HA 3N71A 4AKIA 2NW7A 3SS1A 1D1CA 4UI9K 3RF1A 2R02A 1V54E 1OEDE 4KMCA 3B7TA 4OAVB 4ZI7E 2CBJA 3QAQA 4DRXE 1O3XA 4TNWA 1WY6A 4KZCA 4YDWA 3KDSE 4E7SA 2QY7A 1HTJF 4QQIA 1UN9A 2JQQA 1H6KA 3L39A 1X5BA 3DSWA 1TNBA 4QWNB 1MZCA 3CX8B 3FZHB 4JHKA 4ACKA 4WW0A 1OWOA 3UU5A 2PBIA 2NTYA 3CVRA 3FTSA 3NZUA 4IDPA 3B13A 5JHAA 1E1HB 4DI3A 1OCRE 4I17A 3CVWA 3OAWA 2VKDA 3CQGB 3AE3A 5FVKA 4P0BA 4QXBB 3ZEFB 3KVBA 3FBLA 2E9XB 2XY8B 3N9OA 5HYAA 4DX2A 1X9BA 4DVDA 3UT7A 3P4WA 1DCEA 2MBGA 3SFZA 5J08A 3CIRA 3E33A 4HWCA 3CVVA 2OEVA 5AQRB 3RAUA 4C48B 3KEAA 3PVLA 3NRXA 5CFBA 3G2SA 1MIVA 3FWVA 4O6FA 5GONE 4WNDA 1OEDC 2V7LA 4U95D 4JI1T 5FZQA 2P9BA 3ZJ2A 3FU6A 1MNEA 3AE6A 4GMLA 5G05C 2PFVA 3PJAJ 4BX8A 2XHEA 3AAAB 1OWPA 4URKA 4ILCA 5BNWA 4WAFA 4EQFA 4CXWA 2LSJA 3ZHEA 3N2GE 4GA1A 2V8SV 4IGUA 1JCQA 3L16A 2D2SA 3HXEA 5C1DA 2BF0X 4UIGA 4J8FA 3CVNA 5L4HA 4NUUA 3EHMA 2DWKA 2JRKA 1H2VC 4OFZA 3L6AA 5HXCA 2IOLA 2VKOA 2Y48B 4UWLA 3T8MA 3W9FA 2XASB 3NAWA 4NACA 5AQFB 4DLOA 4TRQA 4YT0A 3CSTA 3CK7A 3MA9A 4HORA 4XEIG 2GGFA 3ZW3A 3RX6A 4B93B 3LBXB 4G8KA 3OPCA 1MNDA 4AXHA 3RRUA 4DV5T 4EPZA 3D9NA 1Z3YA 1E7UA 3EJNA 3FP3A 1XNRT 2OV9A 4DBQA 4CT0A 4PK4A 1HNXT 4J8DA 3ZYMA 2YOEA 5LHHB 2LHNA 2BKOA 4NXNT 3AE4A 1W3BA 4PFPA 2WB5A 2WBLA 3SD5A 5FXXA 2FF4A 2LM2A 2X51A 4HFCA 5HEHA 3AA7B 4HVBA 4UXNB 3T1HT 4ANWA 4M1PA 1HE8A 4GCNA 3UFGA 1J5WA 2NC9A 1D0YA 3KBTA 4DJAA 3U66A 1BR2A 3PUXF 4HFBA 5LHIB 2Q9QB 3PUQA 1KLXA 3D9IA 3RIUC 3RC8A 2UY1B 2OVFA 3KD7A 3E08A 3CX7B 4A5XA 4K5BA 3IHYA 2DBAA 4BWRA 4MLPA 4B94A 4X1KE 2UXNB 2XM1A 1HNWT 4GTOA 5J1GA 1VCSA 2C0LA 4UQXA 5AJDA 4UI9J 3RRNB 5CMWA 5LGUB 4PW8A 1G73A 4UVBB 2HE0A 3RK6A 1UW4B 3PREA 4N5CA 1TNZA 2IHR1 3O1JA 2IY0C 4I1AA 4I6JA 5FY0A 2OLTA 2Q7FA 3S4UA 1Y6IA 3O4XE 4UV8B 4KBQA 3IV0A 1KNPA 3PUSA 4Q25A 1FVFA 2I1JA 3HXBA 2KWHA 5FINA 3LJNA 2RP4A 1OT8A 4FLBA 2YU2A 5LG3A 4GB9A 5BPPA 2XEEA 3MX3A 1IHGA 3O9XA 4LF4T 3PE3A 4EBAA 3UU3A 4BT8A 4JEUA 2VVNA 2PNNA 4UVCB 1O5MA 2B6CA 2L6JA 2Y4TA 3PJAA 1KK7A 4BT9A 2M67A 2W4XA 3T5XA 5KDMC 4RQIA 4QXHB 1KEYA 2D9DA 1KPSB 3OYXA 4AKGA 3APCA 1YA0A 5ABGA 2P9PG 3LFMA 4COFA 1TN6A 2FO1E 3P7IA 3NVOA 5FTPA 4HWDA 1WYBA 2FJEA 3C4XA 3QNUA 4H63H 2MPKA 3QWWA 5LHGB 1J5ET 3SHFA 3N9NA 4O4IE 5JDHA 3HL6A 3QK0A 3S2AA 5BMVE 5CCMA 2WMNA 2X9YA 5ENTD 4HE8A 4GTMA 3PE4A 3ZSSA 2W00A 4DUZT 3DWLG 3CX6B 3CLJA 4HRLA 2XENA 4EZLA 2VSYA 2EHOB 3EI0A 3MA5A 3BUAA 2BG9E 2IDOB 3OTOT 2W61A 2LXMA 5AQNB 2LJLA 5JR9B 3RLFF 3ASOE 2XQ0A 5HXEA 3PU8A 3K3NA 3ASNE 3NZSA 2CWYA 2ZMAA 2XPIA 5KJNA 2E8IA 3VR9A 4JI4T 2NTXA 2DIWA 2P58C 3DSUA 4WNGA 5AAOA 2ZM0A 3FTXA 3DSVA 2QVAA 5HKPA 1H0AA 3OBVE 3OYZA 4LUNU 4D10C 4QH1A 2PJQA 3RO3A 2WXHA 5AQUB 1UX5A 2GK9A 3NOCD 3DSSA 3CVXA 2CRBA 3ZN0B 2B0OE 2HN2A 3FTZA 3IBPA 1MMDA 4GTQA 4ZZCA 3AECA 3AEAA 3ABLE 2C5JA 4BESA 3SI5A 3VU7H 2YINA 3AG3E 3PNLB 5CRUA 4GZ6A 2EIJE 3K9IA 4CDNA 3ZGQA 5HQ8A 1LVKA 3DSXA 5HRYA 5ABFA 4DR3T 3ABVA 4U7EB 5ENOD 3QJZA 3IHRA 5AQTB 2AXUA 3C72A 3EAMA 4FJYA 3RI5A 2DLRA 2X9WA 4ME2A 5D0QD 2AXVA 2E9XD 5HXSA 3PEUB 5C2YA 1KT0A 4HKAA 4ATZD 1N4QA 3J5PA 2DVWA 2LOPA 3ASGA 2R5SA 2VL0A 2E0IA 5FY7A 4NIKA 2XPZA 3LY9A 3CV0A 4I55E 4IE6A 3UPVA 2VB6A 3SGHA 5CEAA 3EVYA 3QUJA 4NIQA 4LRZA 3UI2A 2CXLA 4JW1A 4UWFA 4LSZE 3ZMTB 5B1AE 3UIPC 2XEVA 4ANUA 4YJ3E 4EAHA 3PDYA 1H19A 3FHNA 1NI1A 5L3FB 1UJKA 4CCAA 2CFZA 5BXOA 4PS7A 3L22A 2N1GA 2J62A 2QYUA 1BPOA 3MACA 1BI7B 1FCHA 2WXRA 4HEAA 2BTDA 3FTVA 3TWVA 2Y6XA 1IYGA 2J4BA 4U3CA 2FJDA 5LYJE 2YQ8A 5L3DB 2NOXA 4DV0T 4P0AA 3RHWA 1U5PA 4JC8A 5KJKA 3HXFA 3TWXA 4CDMA 4HGAA 3C50A 4Y6WA 2YHEA 4W9RA 2D0TA 3RKGA 1KT1A 1SVXA 3SFEA 2XRZA 4I43A 2DNXA 3CVPA 2C5KT 4ZOLE 4TX5A 2LSYA 2DL1A 2WQ7A 2WU5A 2VKJA 3NQPA 3ZVVA 2W2UA 3GYZA 1UURA 2L6BA 3AE5A 5EK4A 2Z6EA 3EU5A 2WWVA 1ELWA 4H63V 1KZPA 1LF8A 2P9KG 3RIAA 2C2LA 2W0GA 2KLQA 4DMWA 4DV7T 5LCWJ 3SFYA 4PH4B 4U8VD 1S35A 4WBNE 4IHJE 2YDSA 4QH4A 5AQ9A 2WDVA 3WAKA 2X6JA 5ARGA 2KNDA 4FJOA 4DX1A 4N2SA 2LAIA 5LBMA 4WNFA 3K8PC 2Y69E 5CJ5A 2LOSA 3PV0F 4I4TE 3MV3B 4AIFA 4PAGA 2WXIA 3UINC 2WZHA 3UKRG 1LRZA 3ZMUB 2V6XA 4BFRA 1X79A 2VGXB 3FEXA 1AJ3A 3JQ1A 1WR0A 3AAEB 3ZIMA 5LBQB 5B3SE 1S64A 5KMGP 3D9KA 4C9BB 2FBWA 3TLVA 3ZEFA 2E9XA 2Q9QD 2W67A 2HO1A 2A3DA 3AE1A 2KINB 1HF8A 3CSFA 3FUMA 5HEJA 4ZHBA 3URZA 1UX4A 5LGTB 4AQYT 5HEGA 3OVUA 2WXNA 2ZIRA 4YTPA 1XDPA 4H9OC 4PUCA 4U0SA 4DUIA 2L9QA 2WP9A 4UEMA 4UWGA 4IL4A 4J6IA 5C8YE 3BQLA 4QX8B 1LD8A 1WG0A 4K0UA 2WU2A 1K8KG 2JABA 5ENRD 2W62A 3DJBA 1NENA 5FJYA 3FUEA 3E34A 3LVQE 4X8QA 3RJVA 2MTQA 3RRCA 4J8SA 4XBFB 3R7RA 3Q49B 2H88A 1T98A 3RKVA 4ATGA 4JI3T 2NXPA 2BS3A 4DR4T 2DYRE 2OCCE 3FH7A 5FZSA 3HXCA 3UQ4A 3TWUA 4A3TA 5AQGB 4OVUA 3UU8A 2LSVA 4NRHB 1FEWA 1UK5A 1XDOA 2AW6A 3DP7A 5A23A 1XNQT 3QOFA 2WAUA 1HG2A 1QBQA 4HS2A 5JRCB 3WI3A 2XSAA 1YXRA 3FUFA 2YDQA 3P4RA 3LBXA 5CBOA 2HYZA 1VCTA 4UUCA 5ENNA 5ITZF 4CN1A 4GYRA 5JDFA 3E22E 3LG7A 1JPLA 1PY1A 3SY2A 1H2TC 2C0MA 2CHXA 2CG3A 3AJIA 3AE2A 1JCRA 5FMNA 4H9QC 2A4ZA 2X6KA 1YKHB 3HI2A 3V79K 1OXZA 2K3WA 1QYMA 3U78A 2ETCA 2QYJA 4Z8XA 3ASDA 2H6HA 3FU3A 1IZNB 4GYYA 4F6RD 1YQ3A 3PEVB 2WZIA 4RSYA 5ABEA 4WWOA 3PUZF 1TN8A 5LXTE 3EDVA 4KHZF 2XPKA 3AG2E 2ETAA 2WY2A 5FIOA 4UVAB 1RZ4A 3JXIA 3I0QA 3P4QA 2I6HA 2CBIA 3H3MA 2UUAT 5EK3A 2ODUA 5LGNB 3EHZA 4WWNA 3S7BA 3Q2MA 4IDQA 2UXBT 3CQCB 4C91A 1H6OA 1WM5A 2ODVA 3L17A 4U8HA 5J0ZA 2Q9QA 2WMOA 3TLWA 2L0IA 2CG2A 2F0YA 1AP7A 3HA4A 3ANWA 3AEBA 3FZLB 2WXKA 5AQSB 3J9X1 2M6BA 4B89A 2CM0A 2WXMA 3EUHA
chains in the Genus database with same CATH topology
5A6CA 4A1SA 1FMWA 4DLQA 4UWHA 5FWQA 3TKLB 4I1OB 4U63A 2BVLA 1HCIA 4JL0A 4BTAA 4AQFA 1VOMA 1HX8A 1E90A 4XKCA 4IE5A 2IC9A 4GA0A 2IF4A 3LY7A 3FH5A 3CHOA 4L7TA 4HN9A 2PZIA 2L8KA 3QKYA 4BJNA 3S7FA 4N3CA 4WNEA 3ZCJA 4QFVA 3FXDB 3QWVA 3ZCIA 3IBEA 4G11A 4H9NC 3B7SA 3HYMB 2A5UA 1MIWA 3F31A 3I0OA 1DVPA 1SA0E 4LEUA 4RG6A 2VQ2A 3V5SA 2WQHA 4GZ3A 2FI7A 1MIYA 5ANLA 3OKQA 2C5IT 4G63A 4YLHA 4I6EA 2EHOA 3JYSA 3HIZA 3D3MA 4HOQA 1Z0PA 1N54A 4XX5A 5G04J 3DTOA 5JR9A 3CHSA 3RO2A 4P29A 3SF4A 3LJCA 4F7AA 3ZMVB 1S0PA 4RG9A 3LJ3A 4ZI2C 3FUJA 3FU0A 5TAOA 3JUIA 3BK9A 4AQGA 3L08A 3UMVA 2V7MA 2ZU6B 4GK0E 3C98B 1OWLA 4OVVA 3AVSA 2JMHA 4ADZA 3ONKA 2OOEA 4YHJA 4V3IA 1P5QA 4PJLA 1H2UA 2LSIA 5LOZA 2X6HA 2J07A 1HFAA 5EKQD 3FTYA 3GN5B 2HPLA 3LPZA 3L13A 3KEZA 3Q5MA 1ZHCA 4I2WA 5HXHA 3KV5A 2LT3A 2HPJA 2K48A 5FNVE 1VDYA 4CI2B 4ABNA 3HHMA 2V0PA 4TZ4C 3L09A 4QXCB 4JZYA 3MYVA 5E75A 1XNFA 3SBSA 4APFA 4ANVA 5LG4A 4UF0B 2VTBB 2KZTB 3ZN1B 2IFUA 4V1Av 3S7DA 3B7RL 4H9SE 3TXNA 5JJTA 2L0TB 4KUMB 4OHFA 4GCOA 4X20E 5H6QB 5J2TE 5CCLA 2N9DA 3HR0A 3LS8A 4HOTA 3FTWA 5HWYA 1MMAA 3RYCE 2V4LA 1E8YA 1EPUA 1XGWA 4IE4A 5LJNA 2CA5A 3JCKC 4K0RA 2VL8A 3MJWA 1D1AA 2CFUA 4L2LA 4MLKA 3HKCE 4L5GA 4FADA 4UI9C 2JPFA 4ISSA 4JHRA 4GMJA 2CEAA 3VLFA 1D0ZA 1MQSA 3OXGA 4IYPA 1TEZA 3C4ZA 3GWHA 5LFAA 2PG8A 3CGHA 4BTBA 4DPRA 4ISTA 3ZC1A 4AJWA 5JJ6A 3MZLB 2WWUA 3TL5A 3D9MA 4G2AA 4FULA 4AKLA 3F57A 4OYSA 4CXXA 4DNDA 2UWJG 2VGXA 2CLYC 3CVUA 2XAGB 2K9AA 5M72A 5L3EB 4YNDA 3F2EA 2WM9A 4CDRA 4XKBA 2PQNA 3FUDA 4YFSA 1E8XA 3AS5A 4FJZA 3CHQA 4AXPA 4G1TA 2IQCA 2KCVA 3GW4A 4A55A 3FDHA 2WXJA 1ELKA 1QUUA 1UJJA 3VKHA 3JQ0A 2WXOA 4IIJE 2VKHA 4MHCA 4CT4A 5JVDE 3O48A 4U72A 5ADXL 1UCUA 3MV2B 4K03A 4HLEA 3CHMA 4F3VA 3OXFA 5L2LA 2IOSA 3R9AB 3N2OA 4L23A 3CR3A 4ZI3C 4GZ5A 3U3IA 2BVMA 2DI4A 5JRCA 1OWNA 2J1DG 2J08A 2J9QA 3IHVA 2ZM8A 2OA5A 5IHYA 3FUHA 3LK42 3FTUA 5AIJA 4FHKA 2LSKA 4F1SA 1SHZC 2FO7A 2VSNA 3QDNA 3RYIE 3AB3B 3Q9DA 5D0OD 4EIWA 3OTNA 3LKUA 3B57A 2V5FA 4NQ0A 2I59A 3UUXB 3RC3A 5FQ4A 3AA6B 1ZU2A 5J90A 1L5JA 1KNZA 1CUNA 5DIZA 3PS6A 3QC9A 1HZ4A 4HFGA 3EIQC 4G24A 2XGSA 5DABA 2XAHB 2V26A 1E8ZA 4YJ2E 1FIOA 2JJ9A 2HH7A 2KATA 4PNIA 4ANXA 4FC8A 3ZFWA 3FH8A 3ZLIA 4NURA 3PUAA 3LXUX 2VK9A 2PL2A 3MK7C 4OYKA 4O8SA 1UN8A 3PTRB 4ILIA 2YU1A 3AVRA 3KV6A 3ZJ1A 5HXRA 2NWBA 4BJMA 5BT1A 5ETWA 5T4YA 2IAKA 2KZ7B 1FMVA 5T8IA 5F3JA 3UULA 5FQ6A 4UWKA 3FULA 2CWOA 3I1AA 1PAQA 1IJ6A 4JVSA 2OV8A 1WYCA 2M63A 2Y4UA 3MXZA 2L3LA 5LOVE 4KVMA 4B8AA 3SNXA 3E0ZA 3QWPA 2CXFA 3FUKA 3MKQB 1QNFA 2KCLA 2Y3AA 3G2UA 2Q9QC 1IAPA 4Q69A 3LCAA 5KJMA 2J49A 4KP3C 3P2BA 2XGMA 3G2TA 4AKRB 1INZA 5EX0A 3Q5XA 2EQXA 2WVIA 5F8PA 4AKHA 1OWMA 3SOLA 3PRZA 4QX7B 4EYYR 1NA0A 3ZYLA 4I6GA 2DCPA 1JWFA 3O1HA 3ZPOA 1E96B 2NP9A 4HFVA 2YHCA 4N3AA 5G2NA 5FQ8A 2AXZA 4E6HA 4AP2A 3MGBA 4C0MA 4WWPA 1HH8A 4AQFC 3MZKB 5JHBA 1V9DA 3HDXA 3CWZB 2I2OA 2A2FX 5JREA 3O4ZA 5L3BB 4HOUA 3KV4A 3A5XA 2N2NA 3B7UX 4KZ0A 4PJNA 4JEHB 5FY1A 2GRLA 2WSSV 5FT9A 4KXKB 1MHQA 3NZPA 3C98A 4U04A 5H6RB 5JDNA 4KBMB 5L3CB 5EK2A 3SBTB 2LSUA 3U4TA 3FUNA 3NBXX 3TJPA 1OWAA 2ZLYA 3ASHA 5JJ7A 2K5BB 1E8WA 4O4LE 2V7IA 2LEHA 2GW1A 4J8EA 3VKGA 5JH7E 2ES0A 3QB2A 4EOZB 4FHJA 4TV8E 2LSGA 4XAXB 1US7B 4XE0A 1ZBPA 3APFA 2EHOC 2MRIA 3GN5A 5T3RA 4HOSA 3ZMSB 1U4QA 5E0OA 4BX9A 2H7OA 3R6NA 2LO6A 3CVYA 1YKEB 2XGOA 3WXXA 3ZC0A 4L2YA 3N9PA 5CMYA 1HS7A 3KV9A 3ML8A 2WXLA 3MJXA 3EHNA 3HKEE 4H9PC 3C4WA 5HAXA 2NSZA 4AY6A 3VHLA 3JC6C 2UY1A 5DBKA 5BV0A 5EX3A 1S94A 5JDLA 3EIJA 1IJ5A 5LP0A 4AVXA 2R59A 4UF0A 3GMIA 2KZTA 2WQ6A 2HR2A 3PURA 3BEEA 2CLYB 4O4HE 4I9EA 3CIAA 4WBOA 1EYHA 3KINB 3KS2A 5AENA 2KCKA 4GU5A 4IE7A 4PJMA 4FU3A 5IYZE 4MRUA 4IDZA 4EYUA 3ETUA 2MHKA 2GRMA 5FP3A 2AVPA 1WR6A 4I43B 3FBZA 2KMFA 4IN3B 3GZ1A 4G25A 2MOWA 3TXMA 2RG8A 2W63A 2KC7A 2H3RA 4DO0A 3ETVA 1GW6A 2FBNA 3G2WA 3PDNA 4JXTA 4YVQC 4CXYA 3ZMZB 4I50E 2X68A 3FFLA 4FI5A 3QOUA 5DJQC 2QGSA 4Q94A 3FXEB 3PUJA 4TN7B 4PJJA 3PE0A 2I9CA 3BQIA 3N9LA 3PU3A 3D0TA 4EZKA 4M3OA 4B0ZA 4A56A 5G05J 3VTXA 4CQIA 1LVFA 2K24A 4TUYE 1TJCA 4KMOA 2CXDA 3FU5A 1H7CA 3KFWX 5AFUL 2PQRA 4GK5E 2ILRA 3AU4A 1FVHA 3GZ2A 4DI4A 4C0EA 4U74A 4BAYB 1YW0A 4O2BE 2JMKA 2PM7A 3CK8A 1VRBA 3UT8A 4XI0A 2G0UA 2Y8DA 3EDTB 3MKDA 3RRWA 2LAHA 1YD8G 4EBAG 2BUGA 5A1LA 2VASA 5J2UE 1IQRA 3Q15A 3P8CD 4EXTA 3MCXA 1HXIA 5CA0E 5G04C 4H7YA 2IW5B 4CZZB 3H3AA 3HVEB 4EZ4A 2CE7A 3MEKA 4AV7A 1ZV4X 3TG5A 5EZYE 2VGYA 4GPKA 2B1EA 3U3WA 4ZI2D 2R17C 4AI6A 3CQXC 1N52A 5BUZA 4U0UA 4AY5A 4CRWA 4AM9A 4JUYA 5FZRA 2LHRA 1B89A 2X67A 1ZKEA 3H37A 4JPSA 3ZN3A 3IEGA 1NZNA 5G55A 4ILUA 3RH3A 3UQ3A 2V1DB 3AA1B 4RVBA 2JLBA 5JDGA 3RIBA 3UUXA 1QZ2A 3W15B 4N39A 3ZPJA 3NF1A 3FB2A 4ILHB 4J0UA 3I9WA 2ZM2A 2FEZA 4A3VA 4OYJA 3BG0B 4G26A 2VYIA 3CKDA 4CGWA 4MFRA 5BV1A 4I2ZA 3TG4A 1U3DA 1MMNA 3ANWB 2X6IA 2CHZA 4CI3B 3I4RB 4IULA 2VWAA 3ULQA 3Q5WA 3D9JA 3K3OA 3RYFE 3ASFA 4EZJA 1OUVA 4G2VA 2XPYA 3Q47B 3VLEA 2BDEA 3CHRA 1EF1C 4ASKA 2VSXE 4AEZC 3ML9A 4UQZA 5M4YA 3IKOB 3N9MA 3L3PA 4L9IA 3RPUA 2XUEA 3AAIA 2IJGX 4UQYA 2RA1A 1WRDA 4R7LA 4PDXA 4FA6A 5JQGE 3NRYA 5AYWD 1SQMA 3AS8A 3RU0A 2AWIA 3CVLA 1EZ3A 2V8SE 2SPCA 3K3QC 3T5VA 1A17A 2DCFA 3RYHE 3ENEA 2X3MA 4ILGA 3MKQA 3KAEA 2JEKA 2VSOE 1HU3A 2IONA 2X6FA 4YVOA 4GYWA 5JDQA 1ELRA 3RRMB 4N2QA 5LP6E 5ANRA 3SWHA 4GAAA 3RKOA 3UUNA 3D9LA 5FXWA 2V7KA 4JA7A 5LX8A 2XHEB 4J2CA 2XAQB 3UT5E 4CI1B 1Y8MA 3ZHEB 4GIWA 4XIFA 3V5UA 4GZDA 2X38A 3ZYQA 2NW9A 3CKCA 2LNIA 1UG3A 1WAO1 3CHPA 3CMLA 5HI7A 4P09A 4TV3A 4JEHA 4H7XA 4EZHA 1U3CA 3GA8A 2UXXB 3ONLA 2A72A 4PS8A 3I3NA 2DWGA 4UV9B 3U64A 3T8OA 1SZAA 3PZDA 2E9XC 4G23A 4B6XA 4HXIA 3PH0C 3P1UA 2L9BA 1B7TA 2D5UA 3J7Yq 4ERRA 3PUKA 4XZCA 1SZ9A 2V7JA 3AU5A 3ONXA 2IU1A 3HKDE 2KM4A 2WB2A 3I9YA 4ZI3D 1BR1A 3LK3B 4OK0A 2ONDA 5A7DB 3C51A 2DHRA 2VJ8A 3UX4A 2MYSA 3FEYA 1Z6TA 2ACXA 4O2AE 4GYOA 4I9CA 3UFEA 4KT6B 2QA7A 3IEEA 4MBQA 2YEVC 1BR0A 5FXVA 3WAJA 2XTLA 1QSDA 3KVAA 4EECA 1E7VA 3QK6A 4PFOA 4CEMA 4FP7A 3VLDA 5CB4E 2XQYA 3SRZA 3CVQA 3TAXA 3D9PA 1D0XA 3AA0B 3QARA 5CHEE 3PNTB 3CKBA 4ZS3A 4AOFA 5CA1E 3Q4AB 4QKNA 2YK0A 3ZXSA 4LCTA 2HM8A 4BY6A 3N2KE 1HS6A 1Y64B 3MKRA 3L54A 4EB6E 3KBUA 4BA9A 3CPZA 5LA6E 3R7QA 2LE8A 2KWIB 3LY8A 4I1MA 1EDUA 2NW8A 3CEQA 5ARFA 4WUYA 4PK6A 5FYMA 4PK5A 5AJLA 2KT9A 4JEUB 2J4DA 4PS3A 3UUMA 4GZCA 3N9QA 4KVOA 4ANJA 2WPVA 2KXPB 5LCYA 2C0SA 4IRUA 3I4GA 4DK5A 4E7ZA 3SZ7A 4Q96A 3BG1B 5LCWC 1HO8A 3S7JA 5E76A 4X1YE 3LYAA 3O1IA 3R84B 1JWGA 3AS4A 3I5PA 5FXZA 4JHJA 4F53A 4GYSA 3M65A 4N78D 5HWXA 5KX5E 2J09A 3OXLA 1BR4A 5DQVA 2WXFA 3LK2B 3C64A 4KYOB 3GZSA 4NUVA 5JDMA 3FHEA 1G8XA 3ZRHA 1ZEEA 3OJAA 2RD0A 4H9RC 4U07A 2CCQA 3VTYA 4N3BA 1PC2A 5L3GB 3CK9A 3BQKA 3EDUA 1MMGA 5DQWA 3UTKA 3TGOA 2XCBA 2X9XA 3U9WA 4ZHQE 1NA3A 4DBRA 3PUGA 1TJFA 2PM6A 5KCMA 2I1KA 2IC6A 3LDZA 4LERA 4XI9A 1QQEA 3E4BA 4GOUA 2CMRA 1NP7A 1LKXA 4Y6CA 4FLHA 3FUIA 4L1BA 3HVEA 4TUUA 4MALA 2E2EA 4WNKA 4TV9E 3FY4A 4XZ4A 1WLXA 2BZBA 4F6RC 2X0LB 4C90A 3LVRE 2CHWA 4CGVA 3ESLA 2D0UA 5LNKA 4X1IE 2LM9A 3NZQA 3HKBE 3ZYKA 2XCCA 4MKTA 4L0RA 5JR9C 3QC1A 2WXPA 4DMVA 4APOA 4B8CB 4ACLA 4HTEA 4JLEA 5EDSA 4JA9A 2QFCA 2X66A 3APDA 5FQ7A 2EHOD 3UT4A 4QHOA 3IF8B 4U0ZA 1NAFA 3G2VA 2H7VC 1HG5A 2VTBA 4GA2A 2WXQA 1IQUA 2OVBA 2YNQA 5LJMA 4BSXA 4UELA 4O4JE 3N5LA 3D9OA 2XRYA 3ESKA 1NWMX 5BW8C 1Z3XA 4IE0A 3QNKA 5KJLA 2XAJB 2XAFB 3JC6D 1D1BA 2WXGA 2MOZA 1DNPA 3DBSA 4A1GA 3LEWA 2FULA 4E85A 1JUQA 4MS6A 4ZS2A 3DPDA 2X9HA 3N71A 4AKIA 2NW7A 3SS1A 1D1CA 4UI9K 4KMCA 3B7TA 4ZI7E 3QAQA 1O3XA 1WY6A 4KZCA 3KDSE 4E7SA 2QY7A 1HTJF 1UN9A 2JQQA 1H6KA 1X5BA 4QWNB 3CX8B 4JHKA 4ACKA 4WW0A 1OWOA 2PBIA 2NTYA 3CVRA 3FTSA 3NZUA 3B13A 5JHAA 1E1HB 4DI3A 4I17A 3CVWA 3OAWA 2VKDA 3CQGB 4P0BA 4QXBB 3ZEFB 3KVBA 3FBLA 2E9XB 3N9OA 5HYAA 4DVDA 3UT7A 2MBGA 3SFZA 5J08A 3CVVA 3PVLA 3NRXA 3G2SA 1MIVA 3FWVA 4O6FA 5GONE 4WNDA 2V7LA 5FZQA 2P9BA 3ZJ2A 3FU6A 1MNEA 4GMLA 5G05C 2PFVA 4BX8A 2XHEA 3AAAB 1OWPA 4URKA 5BNWA 4WAFA 4EQFA 4CXWA 2LSJA 3ZHEA 3N2GE 4GA1A 4IGUA 3L16A 2D2SA 5C1DA 2BF0X 4UIGA 4J8FA 3CVNA 4NUUA 3EHMA 2DWKA 2JRKA 1H2VC 4OFZA 3L6AA 5HXCA 2IOLA 2VKOA 2Y48B 4UWLA 3T8MA 2XASB 4NACA 4DLOA 4TRQA 3CSTA 3CK7A 3MA9A 4HORA 2GGFA 3ZW3A 3RX6A 3LBXB 1MNDA 4AXHA 3RRUA 4EPZA 3D9NA 1Z3YA 1E7UA 3EJNA 3FP3A 4DBQA 4CT0A 4PK4A 4J8DA 3ZYMA 5LHHB 2LHNA 1W3BA 4PFPA 2WBLA 3SD5A 5FXXA 2FF4A 2X51A 3AA7B 4HVBA 4UXNB 4ANWA 4M1PA 1HE8A 4GCNA 2NC9A 1D0YA 3KBTA 4DJAA 3U66A 1BR2A 5LHIB 2Q9QB 3PUQA 1KLXA 3D9IA 3RC8A 2UY1B 2OVFA 3KD7A 3E08A 3CX7B 3IHYA 2DBAA 4BWRA 4MLPA 4B94A 4X1KE 2UXNB 5J1GA 2C0LA 4UQXA 5AJDA 4UI9J 3RRNB 5CMWA 5LGUB 4PW8A 1G73A 4UVBB 3RK6A 1UW4B 3PREA 4N5CA 3O1JA 4I1AA 4I6JA 5FY0A 2Q7FA 3S4UA 1Y6IA 3O4XE 4UV8B 4KBQA 3IV0A 3PUSA 1FVFA 2I1JA 2KWHA 2RP4A 4FLBA 2YU2A 4GB9A 5BPPA 3MX3A 1IHGA 3O9XA 3PE3A 4EBAA 4BT8A 4JEUA 4UVCB 2L6JA 2Y4TA 1KK7A 4BT9A 2M67A 3T5XA 5KDMC 4QXHB 3OYXA 4AKGA 3APCA 1YA0A 3LFMA 3P7IA 5FTPA 1WYBA 3C4XA 4H63H 3QWWA 5LHGB 3SHFA 3N9NA 4O4IE 5JDHA 3HL6A 3QK0A 3S2AA 5BMVE 5CCMA 2WMNA 2X9YA 4HE8A 3PE4A 2W00A 3CX6B 3CLJA 4EZLA 2VSYA 2EHOB 3MA5A 2W61A 2LJLA 5JR9B 2XQ0A 5HXEA 3PU8A 3K3NA 3NZSA 2CWYA 2ZMAA 2XPIA 5KJNA 2E8IA 2NTXA 2DIWA 2P58C 4WNGA 2ZM0A 3FTXA 1H0AA 3OBVE 3OYZA 4LUNU 4D10C 2PJQA 3RO3A 2WXHA 1UX5A 2GK9A 3CVXA 3ZN0B 3FTZA 3IBPA 1MMDA 2C5JA 3SI5A 3VU7H 2YINA 3PNLB 4GZ6A 3K9IA 4CDNA 3ZGQA 5HQ8A 1LVKA 3QJZA 3IHRA 2AXUA 4FJYA 2DLRA 2X9WA 4ME2A 5D0QD 2AXVA 2E9XD 5HXSA 3PEUB 5C2YA 1KT0A 4HKAA 2LOPA 3ASGA 2R5SA 2E0IA 5FY7A 2XPZA 3LY9A 3CV0A 4I55E 4IE6A 3UPVA 2VB6A 3SGHA 3EVYA 3QUJA 4LRZA 2CXLA 4JW1A 4UWFA 3ZMTB 2XEVA 4ANUA 4YJ3E 4EAHA 3PDYA 1H19A 3FHNA 5L3FB 1UJKA 4CCAA 2CFZA 4PS7A 3L22A 2N1GA 1BPOA 3MACA 1FCHA 2WXRA 4HEAA 2BTDA 3FTVA 2Y6XA 1IYGA 2J4BA 5LYJE 2YQ8A 5L3DB 2NOXA 4JC8A 4P0AA 1U5PA 5KJKA 4CDMA 4HGAA 3C50A 4Y6WA 2YHEA 4W9RA 2D0TA 1KT1A 2XRZA 4I43A 2DNXA 3CVPA 2C5KT 4ZOLE 4TX5A 2LSYA 2WQ7A 2VKJA 3NQPA 3ZVVA 3GYZA 5EK4A 2Z6EA 1ELWA 4H63V 1LF8A 2C2LA 2W0GA 2KLQA 4DMWA 5LCWJ 4PH4B 1S35A 4WBNE 4IHJE 3WAKA 2X6JA 5ARGA 2KNDA 4FJOA 4N2SA 2LAIA 5LBMA 4WNFA 3K8PC 2LOSA 4I4TE 3MV3B 4AIFA 4PAGA 2WXIA 1LRZA 3ZMUB 4BFRA 1X79A 2VGXB 3FEXA 1AJ3A 3JQ1A 3AAEB 3ZIMA 5LBQB 5KMGP 3D9KA 4C9BB 3ZEFA 2E9XA 2Q9QD 2HO1A 2A3DA 2KINB 1HF8A 3CSFA 3FUMA 3URZA 1UX4A 5LGTB 2WXNA 4PUCA 4H9OC 4U0SA 2L9QA 4UEMA 4UWGA 4J6IA 5C8YE 3BQLA 4QX8B 4K0UA 2W62A 3DJBA 5FJYA 3FUEA 3LVQE 3RJVA 2MTQA 3RRCA 4J8SA 4XBFB 3R7RA 3Q49B 1T98A 3RKVA 4ATGA 2NXPA 3FH7A 5FZSA 4A3TA 4OVUA 2LSVA 4NRHB 1FEWA 2AW6A 3DP7A 5A23A 2WAUA 1HG2A 4HS2A 5JRCB 3WI3A 3FUFA 3LBXA 2HYZA 5ENNA 4GYRA 5JDFA 3E22E 3LG7A 1JPLA 1PY1A 1H2TC 2C0MA 2CHXA 2CG3A 5FMNA 4H9QC 2A4ZA 2X6KA 1YKHB 3HI2A 1OXZA 3U78A 4Z8XA 3ASDA 3FU3A 1IZNB 4GYYA 3PEVB 4RSYA 4WWOA 5LXTE 3EDVA 4UVAB 3I0QA 2I6HA 5EK3A 2ODUA 5LGNB 4WWNA 3S7BA 3Q2MA 3CQCB 4C91A 1WM5A 3L17A 2ODVA 4U8HA 2Q9QA 2WMOA 2L0IA 2CG2A 3HA4A 3ANWA 2WXKA 3J9X1 4B89A 2CM0A 2WXMA 3EUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9I A;  1DVP A;  3D9K A;  2V8S E;  3G2U A;  5J08 A;  1UJK A;  1HFA A;  2BF0 X;  3G2S A;  3D9O A;  1EYH A;  1HG2 A;  4Q96 A;  5CMY A;  1ELK A;  2DIW A;  1EDU A;  1SZ9 A;  3RRU A;  1HF8 A;  3G2W A;  3D9N A;  1UJJ A;  4JXT A;  3CLJ A;  1MHQ A;  3G2T A;  4FU3 A;  1INZ A;  2L0I A;  1H0A A;  3ONK A;  1JWG A;  3LDZ A;  2KM4 A;  1XGW A;  3D9J A;  4HFG A;  4Q94 A;  3ONL A;  4FLB A;  1PY1 A;  1JPL A;  4GZD A;  3D9M A;  4NAC A;  1VDY A;  3ZYK A;  3D9L A;  5CMW A;  4GZC A;  3ZYQ A;  1HX8 A;  5LP0 A;  2L0T B;  3G2V A;  1SZA A;  2QY7 A;  3ZYL A;  4AVX A;  2DCP A;  1HG5 A;  1LF8 A;  1JWF A;  3ZYM A;  2LO6 A;  1JUQ A;  3D9P A;  5LOZ A;  2MOW A;  1X5B A; 
#chains in the Genus database with same CATH topology
 5A6C A;  2H6F A;  2AJA A;  1BI8 B;  3UM3 A;  4A1S A;  4LMK A;  4BET A;  4JBW F;  1FMW A;  4Z91 A;  2QRX A;  4DLQ A;  3DXM G;  4UWH A;  5FWQ A;  3TKL B;  2R2L A;  3C3R A;  4I1O B;  4U63 A;  2BVL A;  1Z8U A;  1HCI A;  4JL0 A;  4BTA A;  4AQF A;  4DV6 T;  3DXK G;  1VOM A;  1HX8 A;  4X5T A;  5L47 A;  4AIS A;  1E90 A;  4XKC A;  4IE5 A;  2IC9 A;  4GA0 A;  2ZM6 T;  2IF4 A;  3ISM C;  3LY7 A;  3FH5 A;  4HRM B;  3CHO A;  4L7T A;  4HN9 A;  2PZI A;  2L8K A;  3QKY A;  4BJN A;  3S7F A;  4N3C A;  4WNE A;  3TLS A;  3ZCJ A;  3NB2 A;  4QFV A;  3FXD B;  3QWV A;  4LML A;  3ZCI A;  3IBE A;  4G11 A;  4X64 T;  4H9N C;  4EHM A;  3B7S A;  3HYM B;  2A5U A;  1N11 A;  3UU6 A;  1ZB1 A;  2MYO A;  1MIW A;  2A5E A;  5D2M C;  3F31 A;  3I0O A;  3JCF A;  1DVP A;  2HN1 A;  1IBK T;  1SA0 E;  4LEU A;  4RG6 A;  2VQ2 A;  1WFD A;  3V5S A;  2WQH A;  3ZT5 A;  4GZ3 A;  3P4P A;  2FI7 A;  1W0B A;  1XWM A;  1MIY A;  1K1B A;  5ANL A;  3OKQ A;  3AEG A;  2C5I T;  2YN6 A;  4G63 A;  3UU4 A;  4YLH A;  4I6E A;  4L9P A;  2NR4 A;  2EHO A;  3JYS A;  3HIZ A;  3D3M A;  4HOQ A;  1Z0P A;  1N54 A;  4XX5 A;  5G04 J;  3DTO A;  5JR9 A;  1YCS B;  3B7B A;  3CHS A;  3RO2 A;  4P29 A;  3VRA A;  3SF4 A;  3AE8 A;  3LJC A;  4F7A A;  3ZMV B;  3Q79 A;  2E2A A;  1S0P A;  4GTP A;  4DR6 T;  3SO8 A;  3KSQ A;  3V2X A;  1N95 A;  4RG9 A;  5KWD A;  4JD2 G;  3LJ3 A;  5AQM B;  4ZI2 C;  3FUJ A;  3FU0 A;  5TAO A;  3JUI A;  3BK9 A;  1D8E A;  4AQG A;  2XQ5 A;  4A98 A;  3L08 A;  4ILA A;  3UMV A;  2V7M A;  2KXP C;  2ZU6 B;  4GK0 E;  3C98 B;  1OWL A;  2LKG A;  2ZIS A;  4OVV A;  3EHQ A;  3AVS A;  2JMH A;  4ADZ A;  4OX9 T;  3ONK A;  1XMO T;  1N32 T;  2OOE A;  4U96 D;  4YHJ A;  4V3I A;  1TNY A;  5EN5 D;  1P5Q A;  2F8X K;  5D66 A;  4PJL A;  1H2U A;  2LSI A;  3AG4 E;  5LOZ A;  2X6H A;  4EGW A;  3UTM A;  5KXJ A;  2J07 A;  1HFA A;  3PZ3 A;  5EKQ D;  3FTY A;  3GN5 B;  2HPL A;  3LPZ A;  2H6I A;  3L13 A;  3KEZ A;  3ZKR A;  1K1A A;  3Q5M A;  2VUR A;  2EIL E;  3TLU A;  1ZHC A;  4I2W A;  5HXH A;  3KV5 A;  2LT3 A;  2HPJ A;  4BEP A;  2K48 A;  5FNV E;  1VDY A;  4CI2 B;  4ABN A;  3HHM A;  5L4E A;  4DR5 T;  1YMP A;  2V0P A;  3Q75 A;  4TZ4 C;  3L09 A;  4YSX A;  4JI0 T;  4QXC B;  4JZY A;  5JMN D;  1BU9 A;  5C2T A;  3MYV A;  3DEO A;  5E75 A;  4G8L A;  5AQ7 A;  3ZU7 B;  1XNF A;  3DRA A;  3SBS A;  3ONL C;  4APF A;  4ANV A;  5LG4 A;  1NEK A;  3EHR A;  4UF0 B;  2VTB B;  2KZT B;  3M3Z B;  5FL0 A;  3ZN1 B;  2IFU A;  4V1A v;  3S7D A;  3B7R L;  4K5C A;  4H9S E;  4HLL A;  3TXN A;  5JJT A;  2L0T B;  4KUM B;  1BLX B;  4OHF A;  4GCO A;  5AQO B;  4X20 E;  5H6Q B;  3ZNG A;  1NL4 A;  5J2T E;  5CCL A;  2N9D A;  3HR0 A;  4TWH A;  3LS8 A;  3EUV A;  1AWC B;  4HOT A;  3FTW A;  4LF8 T;  4J7W A;  1E7P A;  1MMA A;  1ZOY A;  5HWY A;  3RYC E;  2V4L A;  1DU2 A;  1E8Y A;  1MX6 A;  1EPU A;  3VRB A;  1XGW A;  4IE4 A;  5LJN A;  2CA5 A;  3JCK C;  1OCZ E;  1T7S A;  4K0R A;  2UU9 T;  2VL8 A;  2XQA A;  5AQJ B;  3BQO A;  3MJW A;  1D1A A;  2CFU A;  4L2L A;  4WYV A;  4YTN A;  4MLK A;  4U33 A;  3HKC E;  4L5G A;  4FAD A;  4UI9 C;  2JPF A;  4ISS A;  4JHR A;  4GMJ A;  2ZGG A;  2CEA A;  3VLF A;  1HX1 B;  1D0Z A;  3V30 A;  1MQS A;  4TWD A;  3OXG A;  4IYP A;  1TEZ A;  3C4Z A;  3GWH A;  5LFA A;  2V5D A;  2RFA A;  2PG8 A;  3CGH A;  4BTB A;  4DPR A;  4IST A;  3ZC1 A;  1TR4 A;  3FZM B;  4AJW A;  5JJ6 A;  3MZL B;  2WWU A;  3TL5 A;  2XQ7 A;  5CED B;  4G2A A;  3D9M A;  4IL9 A;  5HEU A;  4FUL A;  4AKL A;  3F57 A;  5AQV B;  5C3J A;  4OYS A;  1N4R A;  4U2Z A;  4CXX A;  4DND A;  2UWJ G;  2VGX A;  2CLY C;  3CVU A;  2XAG B;  1CHU A;  2OEW A;  4YXD A;  2K9A A;  5M72 A;  5L3E B;  4YND A;  3F2E A;  1FT2 A;  2WM9 A;  1S63 A;  4CDR A;  4XKB A;  2PQN A;  3FUD A;  4YFS A;  1E8X A;  4I0U A;  3AS5 A;  4HFE A;  4FJZ A;  3CHQ A;  4AXP A;  4G1T A;  2IQC A;  2KCV A;  3GW4 A;  4A55 A;  4IDN A;  4LFA T;  3FDH A;  2WXJ A;  1ELK A;  1QUU A;  2F37 A;  1UJJ A;  2P9N G;  3VKH A;  3JQ0 A;  2VGE A;  3UIO C;  2WXO A;  5IY5 E;  4IIJ E;  3F6Q A;  2VKH A;  4MHC A;  4CT4 A;  4IDO A;  5JVD E;  3O48 A;  4U72 A;  3PZ4 A;  5ADX L;  1X81 A;  1UCU A;  3ZT6 A;  3MV2 B;  2I0M A;  2R03 A;  2XJ7 A;  4TWF A;  4K03 A;  4HLE A;  3CHM A;  2JQK A;  4F3V A;  3OXF A;  3RIU A;  2BG9 C;  5L2L A;  2IOS A;  3PUW F;  4TUM A;  2BED A;  3R9A B;  3N2O A;  4L23 A;  4ZXL A;  3CR3 A;  4ZI3 C;  4GZ5 A;  3U3I A;  2BVM A;  2DI4 A;  5JRC A;  1OWN A;  2J1D G;  4CN4 A;  2J08 A;  3Q7F A;  3ZXP A;  3AXJ B;  2J9Q A;  4HI9 A;  3IHV A;  2ZM8 A;  5IWA T;  2Y1L E;  2OA5 A;  5IHY A;  3FUH A;  3LK4 2;  3FTU A;  1D8D A;  5AIJ A;  4FHK A;  2LSK A;  3C5R A;  5AN8 A;  4F1S A;  3L8R A;  1SHZ C;  3KSL A;  2FO7 A;  2Y0B G;  2VSN A;  4JI5 T;  3QDN A;  5EIL A;  3X2Q E;  3RYI E;  4HQD A;  3AB3 B;  3Q9D A;  2GRN B;  5FVL A;  5D0O D;  2NYJ A;  4EIW A;  3OTN A;  3LKU A;  3B57 A;  2XZE A;  2V5F A;  1Y01 A;  4NQ0 A;  2I59 A;  2GRQ B;  2RPA A;  4B3S T;  3UUX B;  3RC3 A;  2V5C A;  5FQ4 A;  3AA6 B;  1ZU2 A;  5J90 A;  1L5J A;  1N4S A;  1KNZ A;  1CUN A;  3JAD A;  4JI6 T;  5DIZ A;  1DC2 A;  3PS6 A;  2LKH A;  3QC9 A;  1HZ4 A;  1K3Z D;  4HFG A;  3EIQ C;  4G24 A;  2XGS A;  1O1T A;  2KBX A;  5DAB A;  2XAH B;  1JNZ A;  4O60 A;  4TXP A;  2V26 A;  1E8Z A;  4YJ2 E;  1FIO A;  5BXU A;  2JJ9 A;  2HH7 A;  4DID B;  5LMN T;  2KAT A;  4PNI A;  4ANX A;  4Z90 A;  4FC8 A;  3ZFW A;  3FH8 A;  3ZLI A;  1HNZ T;  4NUR A;  1OED B;  3PUA A;  3LXU X;  2VK9 A;  2PL2 A;  4F1P A;  3MK7 C;  3QB5 K;  4OYK A;  4O8S A;  1UN8 A;  3PTR B;  4ILI A;  2YU1 A;  3AVR A;  3KV6 A;  3ZJ1 A;  5HXR A;  2FJA A;  2NWB A;  4GTV A;  4BJM A;  5BT1 A;  5ETW A;  5T4Y A;  2IAK A;  1KFY A;  2KZ7 B;  1WCR A;  1FMV A;  5T8I A;  5F3J A;  3UUL A;  3NOG D;  4DX7 D;  5FQ6 A;  4U31 A;  4UWK A;  3FUL A;  1XZY A;  2CWO A;  3I1A A;  1PAQ A;  1IJ6 A;  4JVS A;  3ABM E;  3DPY A;  2OV8 A;  2BKN A;  4JYA T;  4B3M T;  1WYC A;  2M63 A;  2Y4U A;  3MXZ A;  2L3L A;  5LOV E;  4KVM A;  4B8A A;  4NXM T;  1ZP0 A;  4U7I A;  3SNX A;  3E0Z A;  3QWP A;  2CXF A;  3FUK A;  3MKQ B;  1QNF A;  1U2V G;  2KCL A;  2Y3A A;  3G2U A;  2Q9Q C;  1IAP A;  4YDO A;  4Q69 A;  3LCA A;  5KJM A;  2J49 A;  5CER B;  4KP3 C;  3P2B A;  2FJB A;  2XGM A;  3L9T A;  3G2T A;  4AKR B;  1INZ A;  5EX0 A;  3Q5X A;  4KHP T;  1H6P A;  3NBN B;  2EQX A;  2WVI A;  5F8P A;  4AKH A;  1OWM A;  5AQI B;  3SOL A;  2XQ3 A;  4QX7 B;  5HCM A;  4EYY R;  3PRZ A;  1NA0 A;  3ZYL A;  4I6G A;  2DCP A;  1JWF A;  2V6Y B;  3O1H A;  3ZPO A;  1N36 T;  1E96 B;  3ZKJ A;  2NP9 A;  3ABK E;  4LG6 A;  4HFV A;  2YHC A;  4N3A A;  5G2N A;  2LUH A;  5FQ8 A;  2DWZ A;  2AXZ A;  4E6H A;  4AP2 A;  3MGB A;  4C0M A;  4ILB A;  4WWP A;  4P1N A;  1HH8 A;  4AQF C;  3MZK B;  5JHB A;  1V9D A;  4LFB T;  2P9U G;  3HDX A;  3CWZ B;  2I2O A;  1M62 A;  2A2F X;  5JRE A;  3O4Z A;  5L3B B;  4GPM A;  4HOU A;  3KV4 A;  2E5L T;  3A5X A;  2N2N A;  3B7U X;  5JA4 D;  2XS1 A;  4HNA D;  4PJN A;  4KZ0 A;  4AIU A;  4JEH B;  5FY1 A;  2GRL A;  2J4G A;  2LRL A;  2WSS V;  1S70 B;  2DZN A;  5FT9 A;  2VVS A;  4KXK B;  3HG0 D;  2UXC T;  1MHQ A;  3NZP A;  1RW2 A;  4HFD A;  3V31 A;  1TNU A;  3C98 A;  4U04 A;  5H6R B;  5JDN A;  4LF7 T;  3JUE A;  3TWW A;  4KBM B;  5L3C B;  5EK2 A;  3SBT B;  2LSU A;  3FZF B;  3U4T A;  5ABF B;  1Q2Z A;  2FUP A;  3FUN A;  3NBX X;  3TJP A;  1OWA A;  2ZLY A;  3ASH A;  5JJ7 A;  2K5B B;  1E8W A;  4O4L E;  1SA5 A;  2V7I A;  2WS3 A;  2LEH A;  4HB5 A;  2GW1 A;  4J8E A;  1LD7 A;  3VKG A;  1JNR A;  5JH7 E;  2ES0 A;  3QB2 A;  4HFI A;  4EOZ B;  4FHJ A;  4TV8 E;  2LSG A;  4XAX B;  5BR8 T;  1US7 B;  4XE0 A;  1ZBP A;  2QYW A;  3APF A;  2EHO C;  2MRI A;  3GN5 A;  5T3R A;  4HOS A;  3ZMS B;  4IT4 A;  1U4Q A;  5E0O A;  4BX9 A;  2H7O A;  4DV2 T;  3R6N A;  5EYL A;  2LO6 A;  3CVY A;  1YKE B;  4M7C A;  2XGO A;  3WXX A;  3ZC0 A;  4N5Q A;  4L2Y A;  5CGM A;  3LDQ B;  3BU8 A;  5EIB E;  3N9P A;  5CMY A;  1HS7 A;  3KV9 A;  3ML8 A;  5AQL B;  2WXL A;  4J8Y A;  3MJX A;  3EHN A;  3HKE E;  4H9P C;  3C4W A;  5HAX A;  2NSZ A;  2VQF T;  4AY6 A;  3P50 A;  3VHL A;  3JC6 C;  2UY1 A;  5DBK A;  5BV0 A;  4TXQ A;  5EX3 A;  3FZK B;  1S94 A;  2YKS A;  4X65 T;  5JDL A;  3EIJ A;  1IJ5 A;  5LP0 A;  4AVX A;  2R59 A;  4UF0 A;  3GMI A;  2KZT A;  2WQ6 A;  2HR2 A;  3PUR A;  3BEE A;  4GTT A;  2CLY B;  4O4H E;  4I9E A;  1R8I A;  3CIA A;  4WBO A;  1BD8 A;  3KIN B;  1EYH A;  3KS2 A;  3ZUV B;  5AEN A;  2KCK A;  2WQY A;  4GU5 A;  3ONJ A;  4IE7 A;  4PJM A;  1OXJ A;  4FU3 A;  5IYZ E;  4MRU A;  4IDZ A;  4EYU A;  3ETU A;  5AQH B;  2MHK A;  2GRM A;  1OCO E;  5FP3 A;  2QZA A;  2AVP A;  1WR6 A;  5AQQ B;  4I43 B;  2IIU A;  3FBZ A;  2KMF A;  4IN3 B;  3GZ1 A;  4G25 A;  2MOW A;  4TXR A;  5EID A;  3TXM A;  4IRE A;  2RG8 A;  2W63 A;  2V5Q C;  2KC7 A;  2H3R A;  4DO0 A;  4K0K T;  3ETV A;  1GW6 A;  2FBN A;  4JI8 T;  3G2W A;  3PDN A;  2F4V T;  4JXT A;  4YVQ C;  4CXY A;  4LNG A;  3ZMZ B;  4I50 E;  2X68 A;  3FFL A;  4HWH A;  4FI5 A;  3QOU A;  5DJQ C;  2QGS A;  2IML A;  4Q94 A;  3FXE B;  3PUJ A;  1NFI E;  4TN7 B;  1IXV A;  1FPP A;  4PJJ A;  3PE0 A;  2I9C A;  2P2C P;  3RGL A;  3BQI A;  3N9L A;  2BKK B;  4GTS A;  3SFX A;  3PU3 A;  3D0T A;  5EYP F;  2BG9 B;  2ETB A;  5H7P A;  4M3O A;  4B0Z A;  4EZK A;  4A56 A;  5G05 J;  2P9I G;  1OY3 D;  3VTX A;  4CQI A;  1LVF A;  2K24 A;  4BSZ B;  4TUY E;  1TJC A;  4KMO A;  2CXD A;  3FU5 A;  1H7C A;  2XZD G;  1IKN D;  3KFW X;  5AFU L;  2PQR A;  4GK5 E;  2ILR A;  3AU4 A;  3A7M A;  2QC9 A;  1FVH A;  5IUX A;  3GZ2 A;  1T72 A;  5LMU T;  4DI4 A;  4C0E A;  4U74 A;  4BAY B;  1YW0 A;  3AEE A;  4O2B E;  2JMK A;  1M7K A;  2PM7 A;  3CK8 A;  1OCC E;  4ZFH A;  1VRB A;  3UT8 A;  4XI0 A;  2G0U A;  2Y8D A;  3EDT B;  3SFD A;  1KF6 A;  3MKD A;  3RRW A;  2XQ8 A;  2LAH A;  3T1Y T;  1YD8 G;  4EBA G;  2BUG A;  4LMJ A;  1N9A A;  5A1L A;  2W66 A;  2VAS A;  5J2U E;  1IQR A;  4B3T T;  2V4H C;  4EEB A;  3Q15 A;  3P8C D;  4EXT A;  3MCX A;  1HXI A;  5CA0 E;  5G04 C;  4H7Y A;  3UUB A;  2IW5 B;  2XZT G;  4Z68 A;  4CZZ B;  3H3A A;  2UUB T;  4LF6 T;  3HVE B;  4EZ4 A;  2CE7 A;  3MEK A;  4AV7 A;  1ZV4 X;  3TG5 A;  3ULY A;  2IO2 C;  5EZY E;  2VGY A;  4GPK A;  2B1E A;  2R05 A;  4ZI2 D;  2R17 C;  3U3W A;  1TN7 A;  4AI6 A;  3CQX C;  4JI7 T;  1N52 A;  3AXJ A;  3TLT A;  5BUZ A;  4U0U A;  4AY5 A;  4CRW A;  4AM9 A;  3QB5 A;  4JUY A;  5FZR A;  1T8B A;  5ABH A;  2XS8 A;  4O1O A;  2LHR A;  2A9U A;  1B89 A;  2X67 A;  1ZKE A;  3H37 A;  1Z5S C;  2BBH A;  4JPS A;  3J5Q B;  3ZN3 A;  3IEG A;  2X0Y A;  1NZN A;  3Q5E A;  3E32 A;  4B3R T;  5G55 A;  4ILU A;  3RH3 A;  3UQ3 A;  4TNV A;  2CHO A;  2V1D B;  4X66 T;  3AA1 B;  3NKZ A;  4RVB A;  5F5W A;  2JLB A;  5JDG A;  3RIB A;  3L82 A;  2BBJ A;  5ENQ D;  3UUX A;  4U2Y A;  3AEF A;  3TWQ A;  1QZ2 A;  3W15 B;  3W9G A;  4N39 A;  1LTX A;  3P4S A;  2R6G F;  2JQH A;  3NF1 A;  3ZPJ A;  3FB2 A;  4DV4 T;  1N0R A;  4ILH B;  4J0U A;  3I9W A;  2ZM2 A;  5KNG A;  2FEZ A;  4A3V A;  4OYJ A;  3BG0 B;  1D9S A;  4G26 A;  2VYI A;  3CKD A;  4CGW A;  5AQP B;  4MFR A;  2XM2 A;  5BV1 A;  4I2Z A;  3TG4 A;  1U3D A;  1SE7 A;  1W9R A;  1MMN A;  2RFM A;  3ANW B;  2E5V A;  2CHZ A;  2X6I A;  5HCJ A;  5KNH D;  4CZ2 D;  4UR9 A;  4CI3 B;  3I4R B;  4IUL A;  2VWA A;  3ULQ A;  3Q5W A;  1OED A;  3D9J A;  3K3O A;  3ULE G;  3RYF E;  3ASF A;  2DZO A;  4EZJ A;  1OUV A;  3T8K A;  4G2V A;  4F8H A;  2XPY A;  3AED A;  3UKU G;  3PZ2 A;  1W09 A;  3Q47 B;  3VLE A;  2BDE A;  3CHR A;  1EF1 C;  4ASK A;  2VSX E;  4GMR A;  4AEZ C;  3ML9 A;  4UQZ A;  5M4Y A;  2XQ9 A;  3IKO B;  3N9M A;  3L3P A;  4L9I A;  3TWR A;  3RPU A;  2XUE A;  3AAI A;  2IJG X;  4UQY A;  2RA1 A;  5FKY A;  1IBL T;  1WRD A;  3JAE A;  4R7L A;  4PDX A;  4FA6 A;  5JQG E;  3ZST A;  3TWS A;  1IHB A;  1MJ0 A;  3NRY A;  2P9S G;  2LXL A;  5AYW D;  1SQM A;  3AS8 A;  3RU0 A;  2AWI A;  1N0Q A;  4DX6 D;  3CVL A;  1EZ3 A;  2V8S E;  2SPC A;  3K3Q C;  2IUB A;  3T5V A;  1A17 A;  2DCF A;  5LB7 B;  3RYH E;  3ENE A;  1UUS A;  2X3M A;  4ILG A;  2LLY A;  3MKQ A;  2M6I A;  3KAE A;  3Q7A A;  2JEK A;  2VSO E;  1HU3 A;  2ION A;  2X6F A;  4YVO A;  2UUC T;  4GYW A;  1KNR A;  5JDQ A;  1ELR A;  3RRM B;  4N2Q A;  5LP6 E;  3AE7 A;  5ANR A;  3EU9 A;  3SWH A;  4GAA A;  2YDR A;  3RKO A;  3UUN A;  3D9L A;  5FXW A;  2ZGD A;  2V7K A;  4JA7 A;  5LX8 A;  2V6Y A;  4JB8 P;  2XHE B;  4J2C A;  2XAQ B;  3UT5 E;  4CI1 B;  1FJG T;  1Y8M A;  3ZHE B;  4GIW A;  4XIF A;  4ZZB A;  3IXE A;  1V55 E;  3V5U A;  2BKG A;  2VQE T;  4YTM A;  4GZD A;  5AQB A;  2MAW A;  3Q5D A;  2X38 A;  3ZYQ A;  4DR2 T;  2NW9 A;  1J1J A;  3CKC A;  2LNI A;  1HR0 T;  1UG3 A;  1WAO 1;  4QH5 A;  3CHP A;  3CML A;  2KSR A;  4DR7 T;  5HI7 A;  1SW6 A;  3DST A;  4CN6 A;  5FL1 A;  4P09 A;  2IEJ A;  4TV3 A;  4JEH A;  4H7X A;  4EZH A;  3Q73 A;  1U3C A;  3GA8 A;  2UXX B;  3ONL A;  5ENP D;  2A72 A;  4PS8 A;  3I3N A;  2DWG A;  4WZX A;  4UV9 B;  3U64 A;  3T8O A;  1SZA A;  5CBN A;  4EED A;  2E9X C;  5JTG A;  3PZD A;  1G3N B;  4G23 A;  4B6X A;  4HXI A;  4A63 B;  2EIK E;  3PH0 C;  3P1U A;  2L9B A;  3K1S A;  3E30 A;  3LSV A;  4GTR A;  1W0A A;  4LF9 T;  1B7T A;  2D5U A;  3J7Y q;  4ERR A;  1YYH A;  3PUK A;  4XZC A;  1SZ9 A;  3NWI A;  2V7J A;  4OAU C;  2XEH A;  3AU5 A;  3EAB A;  2BKP A;  1N34 T;  3ONX A;  4O1P A;  2IU1 A;  3RQW A;  3HKD E;  2KM4 A;  2WB2 A;  3I9Y A;  4ZI3 D;  1BR1 A;  2IO3 C;  3LK3 B;  4OK0 A;  2OND A;  2X0H A;  1E2A A;  5A7D B;  3VR8 A;  3C51 A;  5AQK B;  2DHR A;  3AAA C;  4LFC T;  3UQ7 A;  2VJ8 A;  3UX4 A;  1MYO A;  2MYS A;  4HI8 A;  4JI2 T;  3FEY A;  1Z6T A;  3X1D A;  2ACX A;  1SUM B;  4O2A E;  4GYO A;  4I9C A;  3UFE A;  1JCS A;  3PZ1 A;  4KT6 B;  4DUY T;  2EIM E;  2QA7 A;  2XQ4 A;  3IEE A;  4MBQ A;  2JIW A;  2YEV C;  1BR0 A;  5CEC B;  5FXV A;  3WAJ A;  2J8S D;  2H89 A;  2XTL A;  1QSD A;  3KVA A;  4EEC A;  3T9K A;  3A8Y C;  3QK6 A;  4PFO A;  1E7V A;  4CEM A;  4FP7 A;  3VLD A;  5CB4 E;  4YDY A;  2HHH T;  2XQY A;  2AXD S;  3SRZ A;  3CVQ A;  3B95 A;  3TAX A;  3D9P A;  1D0X A;  3AA0 B;  3SQV A;  3QAR A;  3UM0 A;  5CRV A;  3UM2 A;  5CHE E;  3DEP A;  3HRA A;  3PNT B;  4DX5 D;  3CKB A;  4ZS3 A;  3ZT7 A;  4YSZ A;  4AOF A;  5CA1 E;  3Q4A B;  2WDR A;  4A97 A;  4QKN A;  1UGO A;  2YK0 A;  3ZXS A;  4LCT A;  3TWT A;  2HM8 A;  4BY6 A;  3N2K E;  1HS6 A;  1Y64 B;  3MKR A;  3WG7 E;  3L54 A;  4EB6 E;  3D9H A;  3KBU A;  4BA9 A;  3CPZ A;  5LA6 E;  3R7Q A;  2H6G A;  4CYM D;  2ACZ A;  2LE8 A;  4ZEY A;  1IBM T;  4BER A;  2KWI B;  5HS0 A;  2UXD T;  3LY8 A;  3UM1 A;  5AQA A;  4I1M A;  1N33 T;  4JV5 T;  1EDU A;  2ZXW E;  2NW8 A;  4GKK T;  3CEQ A;  5ARF A;  4WUY A;  4PK6 A;  5FYM A;  4KI0 F;  4PK5 A;  1WDY A;  4K5A B;  1N4P A;  3E37 A;  5AJL A;  2KT9 A;  4JEU B;  2J4D A;  4PS3 A;  3UUM A;  5HEO A;  3JAF A;  4GZC A;  3CK6 A;  3N9Q A;  1MX4 A;  4KVO A;  3Q9U C;  4ANJ A;  2WPV A;  2KXP B;  4MBG A;  2WDQ A;  5LCY A;  1SA4 A;  2C0S A;  4IRU A;  2DYS E;  3R9M A;  3I4G A;  4DK5 A;  4E7Z A;  3SZ7 A;  4Q96 A;  1TYQ G;  3BG1 B;  5ENS D;  5LCW C;  1HO8 A;  3G06 A;  3S7J A;  5E76 A;  4RLY A;  4X1Y E;  3LYA A;  3O1I A;  3R84 B;  1JWG A;  2AE9 A;  3AS4 A;  3I5P A;  1I94 T;  5FXZ A;  2BG9 A;  4JHJ A;  4F53 A;  4GYS A;  3M65 A;  2BS4 A;  4N78 D;  5HWX A;  5KX5 E;  2J09 A;  3OXL A;  3PUY F;  1O1S A;  1BR4 A;  5DQV A;  2WXF A;  3LK2 B;  3C64 A;  4KYO B;  2GRP B;  3GZS A;  4NUV A;  5JDM A;  3FHE A;  1G8X A;  1L0V A;  1O1R A;  3ZRH A;  4HFH A;  4X62 T;  1ZEE A;  4KX6 A;  3OJA A;  3AG1 E;  2RD0 A;  4H9R C;  5B1B E;  4U07 A;  2CCQ A;  3VTY A;  4N3B A;  1PC2 A;  5L3G B;  3IA3 A;  3CK9 A;  2XSB A;  5KBA A;  3BQK A;  3EDU A;  4DV3 T;  1MMG A;  4LF5 T;  5DQW A;  3UTK A;  3TGO A;  1GQE A;  2XCB A;  2B76 A;  3AE9 A;  2X9X A;  4DV1 T;  3U9W A;  4ZHQ E;  1I6Z A;  1XMQ T;  1NA3 A;  3Q78 A;  3Q9N C;  4DBR A;  3PUG A;  1TJF A;  4YSY A;  2PM6 A;  3UXG A;  1TNO A;  4U7Y A;  5KCM A;  2I1K A;  2IC6 A;  3RIF A;  3LDZ A;  4LER A;  4XI9 A;  1QQE A;  3E4B A;  3JXJ A;  4GOU A;  2CMR A;  1NP7 A;  1LKX A;  4EV6 A;  4Y6C A;  4FLH A;  3FUI A;  4L1B A;  3HVE A;  1KZO A;  2EIN E;  4TUU A;  4MAL A;  2E2E A;  3RSE G;  4WNK A;  4TV9 E;  2RKK A;  1A5E A;  3FY4 A;  4XZ4 A;  2F8Y A;  1WLX A;  2BZB A;  4F6R C;  2X0L B;  4C90 A;  3LVR E;  2CHW A;  4CGV A;  3ESL A;  2D0U A;  5LNK A;  4X1I E;  2LM9 A;  2GRR B;  3NZQ A;  3HKB E;  3ZYK A;  2XCC A;  4MKT A;  3PUV F;  4L0R A;  1UOH A;  5JR9 C;  3QC1 A;  3C3Q A;  2JQ9 A;  2WXP A;  4DMV A;  4APO A;  1DCQ A;  4B8C B;  4ACL A;  1YQ4 A;  2J47 A;  4YHH T;  3B5M A;  1MX2 A;  4HWF A;  4HTE A;  4HBD A;  4JLE A;  5EDS A;  4JA9 A;  2QFC A;  4GKJ T;  2X66 A;  2LRK A;  3APD A;  5FQ7 A;  5AAR A;  2EHO D;  3UT4 A;  4QHO A;  3V2O A;  3IF8 B;  4U0Z A;  1NAF A;  3G2V A;  1QLB A;  2H7V C;  4LNU D;  1HG5 A;  1N94 A;  2P9L G;  2VTB A;  4HRN A;  2BS2 A;  4GA2 A;  2WXQ A;  1IQU A;  2CPT A;  1FT1 A;  2OVB A;  2YNQ A;  2CHN A;  5LJM A;  4BSX A;  4UEL A;  4O4J E;  3N5L A;  3D9O A;  2XRY A;  3ESK A;  4YDE A;  4HWI B;  1NWM X;  2XQ6 A;  5BW8 C;  4NPP A;  1Z3X A;  4IE0 A;  3C3O A;  3HXD A;  3QNK A;  5KJL A;  2XAJ B;  2XAF B;  4DR1 T;  3JC6 D;  1D1B A;  4YY3 T;  2WXG A;  2MOZ A;  1DNP A;  4U8Y D;  2GRO B;  3DBS A;  4LNB A;  4A1G A;  3LEW A;  2FUL A;  4E85 A;  1JUQ A;  2WCA A;  2PTF A;  4MS6 A;  4ZS2 A;  3RQU A;  3DPD A;  2X9H A;  3N71 A;  4AKI A;  2NW7 A;  3SS1 A;  1D1C A;  4UI9 K;  3RF1 A;  2R02 A;  1V54 E;  1OED E;  4KMC A;  3B7T A;  4OAV B;  4ZI7 E;  2CBJ A;  3QAQ A;  4DRX E;  1O3X A;  4TNW A;  1WY6 A;  4KZC A;  4YDW A;  3KDS E;  4E7S A;  2QY7 A;  1HTJ F;  4QQI A;  1UN9 A;  2JQQ A;  1H6K A;  3L39 A;  1X5B A;  3DSW A;  1TNB A;  4QWN B;  1MZC A;  3CX8 B;  3FZH B;  4JHK A;  4ACK A;  4WW0 A;  1OWO A;  3UU5 A;  2PBI A;  2NTY A;  3CVR A;  3FTS A;  3NZU A;  4IDP A;  3B13 A;  5JHA A;  1E1H B;  4DI3 A;  1OCR E;  4I17 A;  3CVW A;  3OAW A;  2VKD A;  3CQG B;  3AE3 A;  5FVK A;  4P0B A;  4QXB B;  3ZEF B;  3KVB A;  3FBL A;  2E9X B;  2XY8 B;  3N9O A;  5HYA A;  4DX2 A;  1X9B A;  4DVD A;  3UT7 A;  3P4W A;  1DCE A;  2MBG A;  3SFZ A;  5J08 A;  3CIR A;  3E33 A;  4HWC A;  3CVV A;  2OEV A;  5AQR B;  3RAU A;  4C48 B;  3KEA A;  3PVL A;  3NRX A;  5CFB A;  3G2S A;  1MIV A;  3FWV A;  4O6F A;  5GON E;  4WND A;  1OED C;  2V7L A;  4U95 D;  4JI1 T;  5FZQ A;  2P9B A;  3ZJ2 A;  3FU6 A;  1MNE A;  3AE6 A;  4GML A;  5G05 C;  2PFV A;  3PJA J;  4BX8 A;  2XHE A;  3AAA B;  1OWP A;  4URK A;  4ILC A;  5BNW A;  4WAF A;  4EQF A;  4CXW A;  2LSJ A;  3ZHE A;  3N2G E;  4GA1 A;  2V8S V;  4IGU A;  1JCQ A;  3L16 A;  2D2S A;  3HXE A;  5C1D A;  2BF0 X;  4UIG A;  4J8F A;  3CVN A;  5L4H A;  4NUU A;  3EHM A;  2DWK A;  2JRK A;  1H2V C;  4OFZ A;  3L6A A;  5HXC A;  2IOL A;  2VKO A;  2Y48 B;  4UWL A;  3T8M A;  3W9F A;  2XAS B;  3NAW A;  4NAC A;  5AQF B;  4DLO A;  4TRQ A;  4YT0 A;  3CST A;  3CK7 A;  3MA9 A;  4HOR A;  4XEI G;  2GGF A;  3ZW3 A;  3RX6 A;  4B93 B;  3LBX B;  4G8K A;  3OPC A;  1MND A;  4AXH A;  3RRU A;  4DV5 T;  4EPZ A;  3D9N A;  1Z3Y A;  1E7U A;  3EJN A;  3FP3 A;  1XNR T;  2OV9 A;  4DBQ A;  4CT0 A;  4PK4 A;  1HNX T;  4J8D A;  3ZYM A;  2YOE A;  5LHH B;  2LHN A;  2BKO A;  4NXN T;  3AE4 A;  1W3B A;  4PFP A;  2WB5 A;  2WBL A;  3SD5 A;  5FXX A;  2FF4 A;  2LM2 A;  2X51 A;  4HFC A;  5HEH A;  3AA7 B;  4HVB A;  4UXN B;  3T1H T;  4ANW A;  4M1P A;  1HE8 A;  4GCN A;  3UFG A;  1J5W A;  2NC9 A;  1D0Y A;  3KBT A;  4DJA A;  3U66 A;  1BR2 A;  3PUX F;  4HFB A;  5LHI B;  2Q9Q B;  3PUQ A;  1KLX A;  3D9I A;  3RIU C;  3RC8 A;  2UY1 B;  2OVF A;  3KD7 A;  3E08 A;  3CX7 B;  4A5X A;  4K5B A;  3IHY A;  2DBA A;  4BWR A;  4MLP A;  4B94 A;  4X1K E;  2UXN B;  2XM1 A;  1HNW T;  4GTO A;  5J1G A;  1VCS A;  2C0L A;  4UQX A;  5AJD A;  4UI9 J;  3RRN B;  5CMW A;  5LGU B;  4PW8 A;  1G73 A;  4UVB B;  2HE0 A;  3RK6 A;  1UW4 B;  3PRE A;  4N5C A;  1TNZ A;  2IHR 1;  3O1J A;  2IY0 C;  4I1A A;  4I6J A;  5FY0 A;  2OLT A;  2Q7F A;  3S4U A;  1Y6I A;  3O4X E;  4UV8 B;  4KBQ A;  3IV0 A;  1KNP A;  3PUS A;  4Q25 A;  1FVF A;  2I1J A;  3HXB A;  2KWH A;  5FIN A;  3LJN A;  2RP4 A;  1OT8 A;  4FLB A;  2YU2 A;  5LG3 A;  4GB9 A;  5BPP A;  2XEE A;  3MX3 A;  1IHG A;  3O9X A;  4LF4 T;  3PE3 A;  4EBA A;  3UU3 A;  4BT8 A;  4JEU A;  2VVN A;  2PNN A;  4UVC B;  1O5M A;  2B6C A;  2L6J A;  2Y4T A;  3PJA A;  1KK7 A;  4BT9 A;  2M67 A;  2W4X A;  3T5X A;  5KDM C;  4RQI A;  4QXH B;  1KEY A;  2D9D A;  1KPS B;  3OYX A;  4AKG A;  3APC A;  1YA0 A;  5ABG A;  2P9P G;  3LFM A;  4COF A;  1TN6 A;  2FO1 E;  3P7I A;  3NVO A;  5FTP A;  4HWD A;  1WYB A;  2FJE A;  3C4X A;  3QNU A;  4H63 H;  2MPK A;  3QWW A;  5LHG B;  1J5E T;  3SHF A;  3N9N A;  4O4I E;  5JDH A;  3HL6 A;  3QK0 A;  3S2A A;  5BMV E;  5CCM A;  2WMN A;  2X9Y A;  5ENT D;  4HE8 A;  4GTM A;  3PE4 A;  3ZSS A;  2W00 A;  4DUZ T;  3DWL G;  3CX6 B;  3CLJ A;  4HRL A;  2XEN A;  4EZL A;  2VSY A;  2EHO B;  3EI0 A;  3MA5 A;  3BUA A;  2BG9 E;  2IDO B;  3OTO T;  2W61 A;  2LXM A;  5AQN B;  2LJL A;  5JR9 B;  3RLF F;  3ASO E;  2XQ0 A;  5HXE A;  3PU8 A;  3K3N A;  3ASN E;  3NZS A;  2CWY A;  2ZMA A;  2XPI A;  5KJN A;  2E8I A;  3VR9 A;  4JI4 T;  2NTX A;  2DIW A;  2P58 C;  3DSU A;  4WNG A;  5AAO A;  2ZM0 A;  3FTX A;  3DSV A;  2QVA A;  5HKP A;  1H0A A;  3OBV E;  3OYZ A;  4LUN U;  4D10 C;  4QH1 A;  2PJQ A;  3RO3 A;  2WXH A;  5AQU B;  1UX5 A;  2GK9 A;  3NOC D;  3DSS A;  3CVX A;  2CRB A;  3ZN0 B;  2B0O E;  2HN2 A;  3FTZ A;  3IBP A;  1MMD A;  4GTQ A;  4ZZC A;  3AEC A;  3AEA A;  3ABL E;  2C5J A;  4BES A;  3SI5 A;  3VU7 H;  2YIN A;  3AG3 E;  3PNL B;  5CRU A;  4GZ6 A;  2EIJ E;  3K9I A;  4CDN A;  3ZGQ A;  5HQ8 A;  1LVK A;  3DSX A;  5HRY A;  5ABF A;  4DR3 T;  3ABV A;  4U7E B;  5ENO D;  3QJZ A;  3IHR A;  5AQT B;  2AXU A;  3C72 A;  3EAM A;  4FJY A;  3RI5 A;  2DLR A;  2X9W A;  4ME2 A;  5D0Q D;  2AXV A;  2E9X D;  5HXS A;  3PEU B;  5C2Y A;  1KT0 A;  4HKA A;  4ATZ D;  1N4Q A;  3J5P A;  2DVW A;  2LOP A;  3ASG A;  2R5S A;  2VL0 A;  2E0I A;  5FY7 A;  4NIK A;  2XPZ A;  3LY9 A;  3CV0 A;  4I55 E;  4IE6 A;  3UPV A;  2VB6 A;  3SGH A;  5CEA A;  3EVY A;  3QUJ A;  4NIQ A;  4LRZ A;  3UI2 A;  2CXL A;  4JW1 A;  4UWF A;  4LSZ E;  3ZMT B;  5B1A E;  3UIP C;  2XEV A;  4ANU A;  4YJ3 E;  4EAH A;  3PDY A;  1H19 A;  3FHN A;  1NI1 A;  5L3F B;  1UJK A;  4CCA A;  2CFZ A;  5BXO A;  4PS7 A;  3L22 A;  2N1G A;  2J62 A;  2QYU A;  1BPO A;  3MAC A;  1BI7 B;  1FCH A;  2WXR A;  4HEA A;  2BTD A;  3FTV A;  3TWV A;  2Y6X A;  1IYG A;  2J4B A;  4U3C A;  2FJD A;  5LYJ E;  2YQ8 A;  5L3D B;  2NOX A;  4DV0 T;  4P0A A;  3RHW A;  1U5P A;  4JC8 A;  5KJK A;  3HXF A;  3TWX A;  4CDM A;  4HGA A;  3C50 A;  4Y6W A;  2YHE A;  4W9R A;  2D0T A;  3RKG A;  1KT1 A;  1SVX A;  3SFE A;  2XRZ A;  4I43 A;  2DNX A;  3CVP A;  2C5K T;  4ZOL E;  4TX5 A;  2LSY A;  2DL1 A;  2WQ7 A;  2WU5 A;  2VKJ A;  3NQP A;  3ZVV A;  2W2U A;  3GYZ A;  1UUR A;  2L6B A;  3AE5 A;  5EK4 A;  2Z6E A;  3EU5 A;  2WWV A;  1ELW A;  4H63 V;  1KZP A;  1LF8 A;  2P9K G;  3RIA A;  2C2L A;  2W0G A;  2KLQ A;  4DMW A;  4DV7 T;  5LCW J;  3SFY A;  4PH4 B;  4U8V D;  1S35 A;  4WBN E;  4IHJ E;  2YDS A;  4QH4 A;  5AQ9 A;  2WDV A;  3WAK A;  2X6J A;  5ARG A;  2KND A;  4FJO A;  4DX1 A;  4N2S A;  2LAI A;  5LBM A;  4WNF A;  3K8P C;  2Y69 E;  5CJ5 A;  2LOS A;  3PV0 F;  4I4T E;  3MV3 B;  4AIF A;  4PAG A;  2WXI A;  3UIN C;  2WZH A;  3UKR G;  1LRZ A;  3ZMU B;  2V6X A;  4BFR A;  1X79 A;  2VGX B;  3FEX A;  1AJ3 A;  3JQ1 A;  1WR0 A;  3AAE B;  3ZIM A;  5LBQ B;  5B3S E;  1S64 A;  5KMG P;  3D9K A;  4C9B B;  2FBW A;  3TLV A;  3ZEF A;  2E9X A;  2Q9Q D;  2W67 A;  2HO1 A;  2A3D A;  3AE1 A;  2KIN B;  1HF8 A;  3CSF A;  3FUM A;  5HEJ A;  4ZHB A;  3URZ A;  1UX4 A;  5LGT B;  4AQY T;  5HEG A;  3OVU A;  2WXN A;  2ZIR A;  4YTP A;  1XDP A;  4H9O C;  4PUC A;  4U0S A;  4DUI A;  2L9Q A;  2WP9 A;  4UEM A;  4UWG A;  4IL4 A;  4J6I A;  5C8Y E;  3BQL A;  4QX8 B;  1LD8 A;  1WG0 A;  4K0U A;  2WU2 A;  1K8K G;  2JAB A;  5ENR D;  2W62 A;  3DJB A;  1NEN A;  5FJY A;  3FUE A;  3E34 A;  3LVQ E;  4X8Q A;  3RJV A;  2MTQ A;  3RRC A;  4J8S A;  4XBF B;  3R7R A;  3Q49 B;  2H88 A;  1T98 A;  3RKV A;  4ATG A;  4JI3 T;  2NXP A;  2BS3 A;  4DR4 T;  2DYR E;  2OCC E;  3FH7 A;  5FZS A;  3HXC A;  3UQ4 A;  3TWU A;  4A3T A;  5AQG B;  4OVU A;  3UU8 A;  2LSV A;  4NRH B;  1FEW A;  1UK5 A;  1XDO A;  2AW6 A;  3DP7 A;  5A23 A;  1XNQ T;  3QOF A;  2WAU A;  1HG2 A;  1QBQ A;  4HS2 A;  5JRC B;  3WI3 A;  2XSA A;  1YXR A;  3FUF A;  2YDQ A;  3P4R A;  3LBX A;  5CBO A;  2HYZ A;  1VCT A;  4UUC A;  5ENN A;  5ITZ F;  4CN1 A;  4GYR A;  5JDF A;  3E22 E;  3LG7 A;  1JPL A;  1PY1 A;  3SY2 A;  1H2T C;  2C0M A;  2CHX A;  2CG3 A;  3AJI A;  3AE2 A;  1JCR A;  5FMN A;  4H9Q C;  2A4Z A;  2X6K A;  1YKH B;  3HI2 A;  3V79 K;  1OXZ A;  2K3W A;  1QYM A;  3U78 A;  2ETC A;  2QYJ A;  4Z8X A;  3ASD A;  2H6H A;  3FU3 A;  1IZN B;  4GYY A;  4F6R D;  1YQ3 A;  3PEV B;  2WZI A;  4RSY A;  5ABE A;  4WWO A;  3PUZ F;  1TN8 A;  5LXT E;  3EDV A;  4KHZ F;  2XPK A;  3AG2 E;  2ETA A;  2WY2 A;  5FIO A;  4UVA B;  1RZ4 A;  3JXI A;  3I0Q A;  3P4Q A;  2I6H A;  2CBI A;  3H3M A;  2UUA T;  5EK3 A;  2ODU A;  5LGN B;  3EHZ A;  4WWN A;  3S7B A;  3Q2M A;  4IDQ A;  2UXB T;  3CQC B;  4C91 A;  1H6O A;  1WM5 A;  2ODV A;  3L17 A;  4U8H A;  5J0Z A;  2Q9Q A;  2WMO A;  3TLW A;  2L0I A;  2CG2 A;  2F0Y A;  1AP7 A;  3HA4 A;  3ANW A;  3AEB A;  3FZL B;  2WXK A;  5AQS B;  3J9X 1;  2M6B A;  4B89 A;  2CM0 A;  2WXM A;  3EUH A; 
#chains in the Genus database with same CATH homology
 5A6C A;  4A1S A;  1FMW A;  4DLQ A;  4UWH A;  5FWQ A;  3TKL B;  4I1O B;  4U63 A;  2BVL A;  1HCI A;  4JL0 A;  4BTA A;  4AQF A;  1VOM A;  1HX8 A;  1E90 A;  4XKC A;  4IE5 A;  2IC9 A;  4GA0 A;  2IF4 A;  3LY7 A;  3FH5 A;  3CHO A;  4L7T A;  4HN9 A;  2PZI A;  2L8K A;  3QKY A;  4BJN A;  3S7F A;  4N3C A;  4WNE A;  3ZCJ A;  4QFV A;  3FXD B;  3QWV A;  3ZCI A;  3IBE A;  4G11 A;  4H9N C;  3B7S A;  3HYM B;  2A5U A;  1MIW A;  3F31 A;  3I0O A;  1DVP A;  1SA0 E;  4LEU A;  4RG6 A;  2VQ2 A;  3V5S A;  2WQH A;  4GZ3 A;  2FI7 A;  1MIY A;  5ANL A;  3OKQ A;  2C5I T;  4G63 A;  4YLH A;  4I6E A;  2EHO A;  3JYS A;  3HIZ A;  3D3M A;  4HOQ A;  1Z0P A;  1N54 A;  4XX5 A;  5G04 J;  3DTO A;  5JR9 A;  3CHS A;  3RO2 A;  4P29 A;  3SF4 A;  3LJC A;  4F7A A;  3ZMV B;  1S0P A;  4RG9 A;  3LJ3 A;  4ZI2 C;  3FUJ A;  3FU0 A;  5TAO A;  3JUI A;  3BK9 A;  4AQG A;  3L08 A;  3UMV A;  2V7M A;  2ZU6 B;  4GK0 E;  3C98 B;  1OWL A;  4OVV A;  3AVS A;  2JMH A;  4ADZ A;  3ONK A;  2OOE A;  4YHJ A;  4V3I A;  1P5Q A;  4PJL A;  1H2U A;  2LSI A;  5LOZ A;  2X6H A;  2J07 A;  1HFA A;  5EKQ D;  3FTY A;  3GN5 B;  2HPL A;  3LPZ A;  3L13 A;  3KEZ A;  3Q5M A;  1ZHC A;  4I2W A;  5HXH A;  3KV5 A;  2LT3 A;  2HPJ A;  2K48 A;  5FNV E;  1VDY A;  4CI2 B;  4ABN A;  3HHM A;  2V0P A;  4TZ4 C;  3L09 A;  4QXC B;  4JZY A;  3MYV A;  5E75 A;  1XNF A;  3SBS A;  4APF A;  4ANV A;  5LG4 A;  4UF0 B;  2VTB B;  2KZT B;  3ZN1 B;  2IFU A;  4V1A v;  3S7D A;  3B7R L;  4H9S E;  3TXN A;  5JJT A;  2L0T B;  4KUM B;  4OHF A;  4GCO A;  4X20 E;  5H6Q B;  5J2T E;  5CCL A;  2N9D A;  3HR0 A;  3LS8 A;  4HOT A;  3FTW A;  5HWY A;  1MMA A;  3RYC E;  2V4L A;  1E8Y A;  1EPU A;  1XGW A;  4IE4 A;  5LJN A;  2CA5 A;  3JCK C;  4K0R A;  2VL8 A;  3MJW A;  1D1A A;  2CFU A;  4L2L A;  4MLK A;  3HKC E;  4L5G A;  4FAD A;  4UI9 C;  2JPF A;  4ISS A;  4JHR A;  4GMJ A;  2CEA A;  3VLF A;  1D0Z A;  1MQS A;  3OXG A;  4IYP A;  1TEZ A;  3C4Z A;  3GWH A;  5LFA A;  2PG8 A;  3CGH A;  4BTB A;  4DPR A;  4IST A;  3ZC1 A;  4AJW A;  5JJ6 A;  3MZL B;  2WWU A;  3TL5 A;  3D9M A;  4G2A A;  4FUL A;  4AKL A;  3F57 A;  4OYS A;  4CXX A;  4DND A;  2UWJ G;  2VGX A;  2CLY C;  3CVU A;  2XAG B;  2K9A A;  5M72 A;  5L3E B;  4YND A;  3F2E A;  2WM9 A;  4CDR A;  4XKB A;  2PQN A;  3FUD A;  4YFS A;  1E8X A;  3AS5 A;  4FJZ A;  3CHQ A;  4AXP A;  4G1T A;  2IQC A;  2KCV A;  3GW4 A;  4A55 A;  3FDH A;  2WXJ A;  1ELK A;  1QUU A;  1UJJ A;  3VKH A;  3JQ0 A;  2WXO A;  4IIJ E;  2VKH A;  4MHC A;  4CT4 A;  5JVD E;  3O48 A;  4U72 A;  5ADX L;  1UCU A;  3MV2 B;  4K03 A;  4HLE A;  3CHM A;  4F3V A;  3OXF A;  5L2L A;  2IOS A;  3R9A B;  3N2O A;  4L23 A;  3CR3 A;  4ZI3 C;  4GZ5 A;  3U3I A;  2BVM A;  2DI4 A;  5JRC A;  1OWN A;  2J1D G;  2J08 A;  2J9Q A;  3IHV A;  2ZM8 A;  2OA5 A;  5IHY A;  3FUH A;  3LK4 2;  3FTU A;  5AIJ A;  4FHK A;  2LSK A;  4F1S A;  1SHZ C;  2FO7 A;  2VSN A;  3QDN A;  3RYI E;  3AB3 B;  3Q9D A;  5D0O D;  4EIW A;  3OTN A;  3LKU A;  3B57 A;  2V5F A;  4NQ0 A;  2I59 A;  3UUX B;  3RC3 A;  5FQ4 A;  3AA6 B;  1ZU2 A;  5J90 A;  1L5J A;  1KNZ A;  1CUN A;  5DIZ A;  3PS6 A;  3QC9 A;  1HZ4 A;  4HFG A;  3EIQ C;  4G24 A;  2XGS A;  5DAB A;  2XAH B;  2V26 A;  1E8Z A;  4YJ2 E;  1FIO A;  2JJ9 A;  2HH7 A;  2KAT A;  4PNI A;  4ANX A;  4FC8 A;  3ZFW A;  3FH8 A;  3ZLI A;  4NUR A;  3PUA A;  3LXU X;  2VK9 A;  2PL2 A;  3MK7 C;  4OYK A;  4O8S A;  1UN8 A;  3PTR B;  4ILI A;  2YU1 A;  3AVR A;  3KV6 A;  3ZJ1 A;  5HXR A;  2NWB A;  4BJM A;  5BT1 A;  5ETW A;  5T4Y A;  2IAK A;  2KZ7 B;  1FMV A;  5T8I A;  5F3J A;  3UUL A;  5FQ6 A;  4UWK A;  3FUL A;  2CWO A;  3I1A A;  1PAQ A;  1IJ6 A;  4JVS A;  2OV8 A;  1WYC A;  2M63 A;  2Y4U A;  3MXZ A;  2L3L A;  5LOV E;  4KVM A;  4B8A A;  3SNX A;  3E0Z A;  3QWP A;  2CXF A;  3FUK A;  3MKQ B;  1QNF A;  2KCL A;  2Y3A A;  3G2U A;  2Q9Q C;  1IAP A;  4Q69 A;  3LCA A;  5KJM A;  2J49 A;  4KP3 C;  3P2B A;  2XGM A;  3G2T A;  4AKR B;  1INZ A;  5EX0 A;  3Q5X A;  2EQX A;  2WVI A;  5F8P A;  4AKH A;  1OWM A;  3SOL A;  3PRZ A;  4QX7 B;  4EYY R;  1NA0 A;  3ZYL A;  4I6G A;  2DCP A;  1JWF A;  3O1H A;  3ZPO A;  1E96 B;  2NP9 A;  4HFV A;  2YHC A;  4N3A A;  5G2N A;  5FQ8 A;  2AXZ A;  4E6H A;  4AP2 A;  3MGB A;  4C0M A;  4WWP A;  1HH8 A;  4AQF C;  3MZK B;  5JHB A;  1V9D A;  3HDX A;  3CWZ B;  2I2O A;  2A2F X;  5JRE A;  3O4Z A;  5L3B B;  4HOU A;  3KV4 A;  3A5X A;  2N2N A;  3B7U X;  4KZ0 A;  4PJN A;  4JEH B;  5FY1 A;  2GRL A;  2WSS V;  5FT9 A;  4KXK B;  1MHQ A;  3NZP A;  3C98 A;  4U04 A;  5H6R B;  5JDN A;  4KBM B;  5L3C B;  5EK2 A;  3SBT B;  2LSU A;  3U4T A;  3FUN A;  3NBX X;  3TJP A;  1OWA A;  2ZLY A;  3ASH A;  5JJ7 A;  2K5B B;  1E8W A;  4O4L E;  2V7I A;  2LEH A;  2GW1 A;  4J8E A;  3VKG A;  5JH7 E;  2ES0 A;  3QB2 A;  4EOZ B;  4FHJ A;  4TV8 E;  2LSG A;  4XAX B;  1US7 B;  4XE0 A;  1ZBP A;  3APF A;  2EHO C;  2MRI A;  3GN5 A;  5T3R A;  4HOS A;  3ZMS B;  1U4Q A;  5E0O A;  4BX9 A;  2H7O A;  3R6N A;  2LO6 A;  3CVY A;  1YKE B;  2XGO A;  3WXX A;  3ZC0 A;  4L2Y A;  3N9P A;  5CMY A;  1HS7 A;  3KV9 A;  3ML8 A;  2WXL A;  3MJX A;  3EHN A;  3HKE E;  4H9P C;  3C4W A;  5HAX A;  2NSZ A;  4AY6 A;  3VHL A;  3JC6 C;  2UY1 A;  5DBK A;  5BV0 A;  5EX3 A;  1S94 A;  5JDL A;  3EIJ A;  1IJ5 A;  5LP0 A;  4AVX A;  2R59 A;  4UF0 A;  3GMI A;  2KZT A;  2WQ6 A;  2HR2 A;  3PUR A;  3BEE A;  2CLY B;  4O4H E;  4I9E A;  3CIA A;  4WBO A;  1EYH A;  3KIN B;  3KS2 A;  5AEN A;  2KCK A;  4GU5 A;  4IE7 A;  4PJM A;  4FU3 A;  5IYZ E;  4MRU A;  4IDZ A;  4EYU A;  3ETU A;  2MHK A;  2GRM A;  5FP3 A;  2AVP A;  1WR6 A;  4I43 B;  3FBZ A;  2KMF A;  4IN3 B;  3GZ1 A;  4G25 A;  2MOW A;  3TXM A;  2RG8 A;  2W63 A;  2KC7 A;  2H3R A;  4DO0 A;  3ETV A;  1GW6 A;  2FBN A;  3G2W A;  3PDN A;  4JXT A;  4YVQ C;  4CXY A;  3ZMZ B;  4I50 E;  2X68 A;  3FFL A;  4FI5 A;  3QOU A;  5DJQ C;  2QGS A;  4Q94 A;  3FXE B;  3PUJ A;  4TN7 B;  4PJJ A;  3PE0 A;  2I9C A;  3BQI A;  3N9L A;  3PU3 A;  3D0T A;  4EZK A;  4M3O A;  4B0Z A;  4A56 A;  5G05 J;  3VTX A;  4CQI A;  1LVF A;  2K24 A;  4TUY E;  1TJC A;  4KMO A;  2CXD A;  3FU5 A;  1H7C A;  3KFW X;  5AFU L;  2PQR A;  4GK5 E;  2ILR A;  3AU4 A;  1FVH A;  3GZ2 A;  4DI4 A;  4C0E A;  4U74 A;  4BAY B;  1YW0 A;  4O2B E;  2JMK A;  2PM7 A;  3CK8 A;  1VRB A;  3UT8 A;  4XI0 A;  2G0U A;  2Y8D A;  3EDT B;  3MKD A;  3RRW A;  2LAH A;  1YD8 G;  4EBA G;  2BUG A;  5A1L A;  2VAS A;  5J2U E;  1IQR A;  3Q15 A;  3P8C D;  4EXT A;  3MCX A;  1HXI A;  5CA0 E;  5G04 C;  4H7Y A;  2IW5 B;  4CZZ B;  3H3A A;  3HVE B;  4EZ4 A;  2CE7 A;  3MEK A;  4AV7 A;  1ZV4 X;  3TG5 A;  5EZY E;  2VGY A;  4GPK A;  2B1E A;  3U3W A;  4ZI2 D;  2R17 C;  4AI6 A;  3CQX C;  1N52 A;  5BUZ A;  4U0U A;  4AY5 A;  4CRW A;  4AM9 A;  4JUY A;  5FZR A;  2LHR A;  1B89 A;  2X67 A;  1ZKE A;  3H37 A;  4JPS A;  3ZN3 A;  3IEG A;  1NZN A;  5G55 A;  4ILU A;  3RH3 A;  3UQ3 A;  2V1D B;  3AA1 B;  4RVB A;  2JLB A;  5JDG A;  3RIB A;  3UUX A;  1QZ2 A;  3W15 B;  4N39 A;  3ZPJ A;  3NF1 A;  3FB2 A;  4ILH B;  4J0U A;  3I9W A;  2ZM2 A;  2FEZ A;  4A3V A;  4OYJ A;  3BG0 B;  4G26 A;  2VYI A;  3CKD A;  4CGW A;  4MFR A;  5BV1 A;  4I2Z A;  3TG4 A;  1U3D A;  1MMN A;  3ANW B;  2X6I A;  2CHZ A;  4CI3 B;  3I4R B;  4IUL A;  2VWA A;  3ULQ A;  3Q5W A;  3D9J A;  3K3O A;  3RYF E;  3ASF A;  4EZJ A;  1OUV A;  4G2V A;  2XPY A;  3Q47 B;  3VLE A;  2BDE A;  3CHR A;  1EF1 C;  4ASK A;  2VSX E;  4AEZ C;  3ML9 A;  4UQZ A;  5M4Y A;  3IKO B;  3N9M A;  3L3P A;  4L9I A;  3RPU A;  2XUE A;  3AAI A;  2IJG X;  4UQY A;  2RA1 A;  1WRD A;  4R7L A;  4PDX A;  4FA6 A;  5JQG E;  3NRY A;  5AYW D;  1SQM A;  3AS8 A;  3RU0 A;  2AWI A;  3CVL A;  1EZ3 A;  2V8S E;  2SPC A;  3K3Q C;  3T5V A;  1A17 A;  2DCF A;  3RYH E;  3ENE A;  2X3M A;  4ILG A;  3MKQ A;  3KAE A;  2JEK A;  2VSO E;  1HU3 A;  2ION A;  2X6F A;  4YVO A;  4GYW A;  5JDQ A;  1ELR A;  3RRM B;  4N2Q A;  5LP6 E;  5ANR A;  3SWH A;  4GAA A;  3RKO A;  3UUN A;  3D9L A;  5FXW A;  2V7K A;  4JA7 A;  5LX8 A;  2XHE B;  4J2C A;  2XAQ B;  3UT5 E;  4CI1 B;  1Y8M A;  3ZHE B;  4GIW A;  4XIF A;  3V5U A;  4GZD A;  2X38 A;  3ZYQ A;  2NW9 A;  3CKC A;  2LNI A;  1UG3 A;  1WAO 1;  3CHP A;  3CML A;  5HI7 A;  4P09 A;  4TV3 A;  4JEH A;  4H7X A;  4EZH A;  1U3C A;  3GA8 A;  2UXX B;  3ONL A;  2A72 A;  4PS8 A;  3I3N A;  2DWG A;  4UV9 B;  3U64 A;  3T8O A;  1SZA A;  3PZD A;  2E9X C;  4G23 A;  4B6X A;  4HXI A;  3PH0 C;  3P1U A;  2L9B A;  1B7T A;  2D5U A;  3J7Y q;  4ERR A;  3PUK A;  4XZC A;  1SZ9 A;  2V7J A;  3AU5 A;  3ONX A;  2IU1 A;  3HKD E;  2KM4 A;  2WB2 A;  3I9Y A;  4ZI3 D;  1BR1 A;  3LK3 B;  4OK0 A;  2OND A;  5A7D B;  3C51 A;  2DHR A;  2VJ8 A;  3UX4 A;  2MYS A;  3FEY A;  1Z6T A;  2ACX A;  4O2A E;  4GYO A;  4I9C A;  3UFE A;  4KT6 B;  2QA7 A;  3IEE A;  4MBQ A;  2YEV C;  1BR0 A;  5FXV A;  3WAJ A;  2XTL A;  1QSD A;  3KVA A;  4EEC A;  1E7V A;  3QK6 A;  4PFO A;  4CEM A;  4FP7 A;  3VLD A;  5CB4 E;  2XQY A;  3SRZ A;  3CVQ A;  3TAX A;  3D9P A;  1D0X A;  3AA0 B;  3QAR A;  5CHE E;  3PNT B;  3CKB A;  4ZS3 A;  4AOF A;  5CA1 E;  3Q4A B;  4QKN A;  2YK0 A;  3ZXS A;  4LCT A;  2HM8 A;  4BY6 A;  3N2K E;  1HS6 A;  1Y64 B;  3MKR A;  3L54 A;  4EB6 E;  3KBU A;  4BA9 A;  3CPZ A;  5LA6 E;  3R7Q A;  2LE8 A;  2KWI B;  3LY8 A;  4I1M A;  1EDU A;  2NW8 A;  3CEQ A;  5ARF A;  4WUY A;  4PK6 A;  5FYM A;  4PK5 A;  5AJL A;  2KT9 A;  4JEU B;  2J4D A;  4PS3 A;  3UUM A;  4GZC A;  3N9Q A;  4KVO A;  4ANJ A;  2WPV A;  2KXP B;  5LCY A;  2C0S A;  4IRU A;  3I4G A;  4DK5 A;  4E7Z A;  3SZ7 A;  4Q96 A;  3BG1 B;  5LCW C;  1HO8 A;  3S7J A;  5E76 A;  4X1Y E;  3LYA A;  3O1I A;  3R84 B;  1JWG A;  3AS4 A;  3I5P A;  5FXZ A;  4JHJ A;  4F53 A;  4GYS A;  3M65 A;  4N78 D;  5HWX A;  5KX5 E;  2J09 A;  3OXL A;  1BR4 A;  5DQV A;  2WXF A;  3LK2 B;  3C64 A;  4KYO B;  3GZS A;  4NUV A;  5JDM A;  3FHE A;  1G8X A;  3ZRH A;  1ZEE A;  3OJA A;  2RD0 A;  4H9R C;  4U07 A;  2CCQ A;  3VTY A;  4N3B A;  1PC2 A;  5L3G B;  3CK9 A;  3BQK A;  3EDU A;  1MMG A;  5DQW A;  3UTK A;  3TGO A;  2XCB A;  2X9X A;  3U9W A;  4ZHQ E;  1NA3 A;  4DBR A;  3PUG A;  1TJF A;  2PM6 A;  5KCM A;  2I1K A;  2IC6 A;  3LDZ A;  4LER A;  4XI9 A;  1QQE A;  3E4B A;  4GOU A;  2CMR A;  1NP7 A;  1LKX A;  4Y6C A;  4FLH A;  3FUI A;  4L1B A;  3HVE A;  4TUU A;  4MAL A;  2E2E A;  4WNK A;  4TV9 E;  3FY4 A;  4XZ4 A;  1WLX A;  2BZB A;  4F6R C;  2X0L B;  4C90 A;  3LVR E;  2CHW A;  4CGV A;  3ESL A;  2D0U A;  5LNK A;  4X1I E;  2LM9 A;  3NZQ A;  3HKB E;  3ZYK A;  2XCC A;  4MKT A;  4L0R A;  5JR9 C;  3QC1 A;  2WXP A;  4DMV A;  4APO A;  4B8C B;  4ACL A;  4HTE A;  4JLE A;  5EDS A;  4JA9 A;  2QFC A;  2X66 A;  3APD A;  5FQ7 A;  2EHO D;  3UT4 A;  4QHO A;  3IF8 B;  4U0Z A;  1NAF A;  3G2V A;  2H7V C;  1HG5 A;  2VTB A;  4GA2 A;  2WXQ A;  1IQU A;  2OVB A;  2YNQ A;  5LJM A;  4BSX A;  4UEL A;  4O4J E;  3N5L A;  3D9O A;  2XRY A;  3ESK A;  1NWM X;  5BW8 C;  1Z3X A;  4IE0 A;  3QNK A;  5KJL A;  2XAJ B;  2XAF B;  3JC6 D;  1D1B A;  2WXG A;  2MOZ A;  1DNP A;  3DBS A;  4A1G A;  3LEW A;  2FUL A;  4E85 A;  1JUQ A;  4MS6 A;  4ZS2 A;  3DPD A;  2X9H A;  3N71 A;  4AKI A;  2NW7 A;  3SS1 A;  1D1C A;  4UI9 K;  4KMC A;  3B7T A;  4ZI7 E;  3QAQ A;  1O3X A;  1WY6 A;  4KZC A;  3KDS E;  4E7S A;  2QY7 A;  1HTJ F;  1UN9 A;  2JQQ A;  1H6K A;  1X5B A;  4QWN B;  3CX8 B;  4JHK A;  4ACK A;  4WW0 A;  1OWO A;  2PBI A;  2NTY A;  3CVR A;  3FTS A;  3NZU A;  3B13 A;  5JHA A;  1E1H B;  4DI3 A;  4I17 A;  3CVW A;  3OAW A;  2VKD A;  3CQG B;  4P0B A;  4QXB B;  3ZEF B;  3KVB A;  3FBL A;  2E9X B;  3N9O A;  5HYA A;  4DVD A;  3UT7 A;  2MBG A;  3SFZ A;  5J08 A;  3CVV A;  3PVL A;  3NRX A;  3G2S A;  1MIV A;  3FWV A;  4O6F A;  5GON E;  4WND A;  2V7L A;  5FZQ A;  2P9B A;  3ZJ2 A;  3FU6 A;  1MNE A;  4GML A;  5G05 C;  2PFV A;  4BX8 A;  2XHE A;  3AAA B;  1OWP A;  4URK A;  5BNW A;  4WAF A;  4EQF A;  4CXW A;  2LSJ A;  3ZHE A;  3N2G E;  4GA1 A;  4IGU A;  3L16 A;  2D2S A;  5C1D A;  2BF0 X;  4UIG A;  4J8F A;  3CVN A;  4NUU A;  3EHM A;  2DWK A;  2JRK A;  1H2V C;  4OFZ A;  3L6A A;  5HXC A;  2IOL A;  2VKO A;  2Y48 B;  4UWL A;  3T8M A;  2XAS B;  4NAC A;  4DLO A;  4TRQ A;  3CST A;  3CK7 A;  3MA9 A;  4HOR A;  2GGF A;  3ZW3 A;  3RX6 A;  3LBX B;  1MND A;  4AXH A;  3RRU A;  4EPZ A;  3D9N A;  1Z3Y A;  1E7U A;  3EJN A;  3FP3 A;  4DBQ A;  4CT0 A;  4PK4 A;  4J8D A;  3ZYM A;  5LHH B;  2LHN A;  1W3B A;  4PFP A;  2WBL A;  3SD5 A;  5FXX A;  2FF4 A;  2X51 A;  3AA7 B;  4HVB A;  4UXN B;  4ANW A;  4M1P A;  1HE8 A;  4GCN A;  2NC9 A;  1D0Y A;  3KBT A;  4DJA A;  3U66 A;  1BR2 A;  5LHI B;  2Q9Q B;  3PUQ A;  1KLX A;  3D9I A;  3RC8 A;  2UY1 B;  2OVF A;  3KD7 A;  3E08 A;  3CX7 B;  3IHY A;  2DBA A;  4BWR A;  4MLP A;  4B94 A;  4X1K E;  2UXN B;  5J1G A;  2C0L A;  4UQX A;  5AJD A;  4UI9 J;  3RRN B;  5CMW A;  5LGU B;  4PW8 A;  1G73 A;  4UVB B;  3RK6 A;  1UW4 B;  3PRE A;  4N5C A;  3O1J A;  4I1A A;  4I6J A;  5FY0 A;  2Q7F A;  3S4U A;  1Y6I A;  3O4X E;  4UV8 B;  4KBQ A;  3IV0 A;  3PUS A;  1FVF A;  2I1J A;  2KWH A;  2RP4 A;  4FLB A;  2YU2 A;  4GB9 A;  5BPP A;  3MX3 A;  1IHG A;  3O9X A;  3PE3 A;  4EBA A;  4BT8 A;  4JEU A;  4UVC B;  2L6J A;  2Y4T A;  1KK7 A;  4BT9 A;  2M67 A;  3T5X A;  5KDM C;  4QXH B;  3OYX A;  4AKG A;  3APC A;  1YA0 A;  3LFM A;  3P7I A;  5FTP A;  1WYB A;  3C4X A;  4H63 H;  3QWW A;  5LHG B;  3SHF A;  3N9N A;  4O4I E;  5JDH A;  3HL6 A;  3QK0 A;  3S2A A;  5BMV E;  5CCM A;  2WMN A;  2X9Y A;  4HE8 A;  3PE4 A;  2W00 A;  3CX6 B;  3CLJ A;  4EZL A;  2VSY A;  2EHO B;  3MA5 A;  2W61 A;  2LJL A;  5JR9 B;  2XQ0 A;  5HXE A;  3PU8 A;  3K3N A;  3NZS A;  2CWY A;  2ZMA A;  2XPI A;  5KJN A;  2E8I A;  2NTX A;  2DIW A;  2P58 C;  4WNG A;  2ZM0 A;  3FTX A;  1H0A A;  3OBV E;  3OYZ A;  4LUN U;  4D10 C;  2PJQ A;  3RO3 A;  2WXH A;  1UX5 A;  2GK9 A;  3CVX A;  3ZN0 B;  3FTZ A;  3IBP A;  1MMD A;  2C5J A;  3SI5 A;  3VU7 H;  2YIN A;  3PNL B;  4GZ6 A;  3K9I A;  4CDN A;  3ZGQ A;  5HQ8 A;  1LVK A;  3QJZ A;  3IHR A;  2AXU A;  4FJY A;  2DLR A;  2X9W A;  4ME2 A;  5D0Q D;  2AXV A;  2E9X D;  5HXS A;  3PEU B;  5C2Y A;  1KT0 A;  4HKA A;  2LOP A;  3ASG A;  2R5S A;  2E0I A;  5FY7 A;  2XPZ A;  3LY9 A;  3CV0 A;  4I55 E;  4IE6 A;  3UPV A;  2VB6 A;  3SGH A;  3EVY A;  3QUJ A;  4LRZ A;  2CXL A;  4JW1 A;  4UWF A;  3ZMT B;  2XEV A;  4ANU A;  4YJ3 E;  4EAH A;  3PDY A;  1H19 A;  3FHN A;  5L3F B;  1UJK A;  4CCA A;  2CFZ A;  4PS7 A;  3L22 A;  2N1G A;  1BPO A;  3MAC A;  1FCH A;  2WXR A;  4HEA A;  2BTD A;  3FTV A;  2Y6X A;  1IYG A;  2J4B A;  5LYJ E;  2YQ8 A;  5L3D B;  2NOX A;  4JC8 A;  4P0A A;  1U5P A;  5KJK A;  4CDM A;  4HGA A;  3C50 A;  4Y6W A;  2YHE A;  4W9R A;  2D0T A;  1KT1 A;  2XRZ A;  4I43 A;  2DNX A;  3CVP A;  2C5K T;  4ZOL E;  4TX5 A;  2LSY A;  2WQ7 A;  2VKJ A;  3NQP A;  3ZVV A;  3GYZ A;  5EK4 A;  2Z6E A;  1ELW A;  4H63 V;  1LF8 A;  2C2L A;  2W0G A;  2KLQ A;  4DMW A;  5LCW J;  4PH4 B;  1S35 A;  4WBN E;  4IHJ E;  3WAK A;  2X6J A;  5ARG A;  2KND A;  4FJO A;  4N2S A;  2LAI A;  5LBM A;  4WNF A;  3K8P C;  2LOS A;  4I4T E;  3MV3 B;  4AIF A;  4PAG A;  2WXI A;  1LRZ A;  3ZMU B;  4BFR A;  1X79 A;  2VGX B;  3FEX A;  1AJ3 A;  3JQ1 A;  3AAE B;  3ZIM A;  5LBQ B;  5KMG P;  3D9K A;  4C9B B;  3ZEF A;  2E9X A;  2Q9Q D;  2HO1 A;  2A3D A;  2KIN B;  1HF8 A;  3CSF A;  3FUM A;  3URZ A;  1UX4 A;  5LGT B;  2WXN A;  4PUC A;  4H9O C;  4U0S A;  2L9Q A;  4UEM A;  4UWG A;  4J6I A;  5C8Y E;  3BQL A;  4QX8 B;  4K0U A;  2W62 A;  3DJB A;  5FJY A;  3FUE A;  3LVQ E;  3RJV A;  2MTQ A;  3RRC A;  4J8S A;  4XBF B;  3R7R A;  3Q49 B;  1T98 A;  3RKV A;  4ATG A;  2NXP A;  3FH7 A;  5FZS A;  4A3T A;  4OVU A;  2LSV A;  4NRH B;  1FEW A;  2AW6 A;  3DP7 A;  5A23 A;  2WAU A;  1HG2 A;  4HS2 A;  5JRC B;  3WI3 A;  3FUF A;  3LBX A;  2HYZ A;  5ENN A;  4GYR A;  5JDF A;  3E22 E;  3LG7 A;  1JPL A;  1PY1 A;  1H2T C;  2C0M A;  2CHX A;  2CG3 A;  5FMN A;  4H9Q C;  2A4Z A;  2X6K A;  1YKH B;  3HI2 A;  1OXZ A;  3U78 A;  4Z8X A;  3ASD A;  3FU3 A;  1IZN B;  4GYY A;  3PEV B;  4RSY A;  4WWO A;  5LXT E;  3EDV A;  4UVA B;  3I0Q A;  2I6H A;  5EK3 A;  2ODU A;  5LGN B;  4WWN A;  3S7B A;  3Q2M A;  3CQC B;  4C91 A;  1WM5 A;  3L17 A;  2ODV A;  4U8H A;  2Q9Q A;  2WMO A;  2L0I A;  2CG2 A;  3HA4 A;  3ANW A;  2WXK A;  3J9X 1;  4B89 A;  2CM0 A;  2WXM A;  3EUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...