1TNBA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a substrate kksktkcvif peptide derived from tc21
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords geranylgeranyltransferase type I alpha subunit
total genus 122
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnbA00
3Q75A 1TN8A 4GTQA 3Q79A 2R2LA 1NI1A 4L9PA 1LD7A 3EU5A 1LTXA 4GTRA 1O1SA 3DSUA 3HXEA 1FT1A 3HXCA 1TNYA 1X81A 3SFYA 3E34A 4GTVA 3PZ2A 1N4PA 3SFXA 3HXFA 1SA4A 1N4QA 3PZ3A 3E33A 4GTSA 4MBGA 4GTOA 2IEJA 1TNBA 1O5MA 1NL4A 3DSVA 2H6GA 4GTTA 1DCEA 3DSSA 1O1RA 3DPYA 4EHMA 1TN6A 3Q7AA 3EUVA 2H6FA 1TNUA 1JCSA 3E30A 3Q78A 1N9AA 1D8EA 3DSXA 3HXDA 3Q73A 1S64A 3DSTA 1TN7A 3KSQA 4LNBA 3C72A 4GTMA 3DSWA 1QBQA 1TNOA 1D8DA 4YDEA 1SA5A 1O1TA 1N94A 1KZOA 2BEDA 1N95A 3E37A 2ZISA 3Q7FA 3HXBA 1TNZA 4GTPA 1JCRA 1N4RA 1S63A 1JCQA 1MZCA 1N4SA 4LNGA 2F0YA 2H6IA 3DRAA 2H6HA 1FT2A 1FPPA 3PZ1A 3PZ4A 2ZIRA 4YDOA 3KSLA 1LD8A 3E32A 1KZPA
chains in the Genus database with same CATH superfamily
1V54E 4G26A 3BQOA 4LUNU 1QNFA 4CT4A 1QQEA 3T9KA 3DSUA 2J8SD 1QZ2A 4RSYA 4NRHB 5C1DA 1YA0A 3GYZA 1BI8B 3MYVA 5FTPA 4GTOA 3FU0A 3MJWA 5E76A 4H7YA 2A5EA 1DCEA 3MKQB 3RO3A 5JHBA 2L6JA 4WAFA 4LG6A 3JYSA 2AWIA 4HB5A 2Y1LE 4A3TA 3BEEA 1UW4B 2V8SE 4AY5A 1A17A 2IOLA 1RZ4A 3ZPJA 3SFZA 1D9SA 4ACKA 4D10C 4AVXA 2NC9A 3RKVA 3TXNA 2YHEA 5G05C 4PS7A 4J8SA 4O6FA 3PNLB 3ZHEB 3UTMA 1PC2A 1N94A 1K1BA 4U8VD 4M3OA 1OWMA 3ASHA 5ARFA 1IQRA 1N4SA 4GYYA 4DX5D 2I1JA 3FH7A 3CK8A 5AAOA 1OWNA 4K5BA 3CHQA 1L5JA 4DLQA 2AXVA 2CHXA 3IKOB 4Q96A 1OCZE 1N54A 1Z3XA 5FZSA 4XZ4A 1NP7A 4Q94A 2KCVA 3CVUA 1TJCA 2PNNA 4UQYA 5ENNA 4RLYA 1TYQG 2IFUA 4UI9J 3O48A 3HXEA 3DXKG 2LNIA 4B8AA 3JUIA 3UXGA 2OEVA 4ZHBA 3TWWA 4FJZA 2PQRA 2KC7A 4TUUA 4BT9A 1W3BA 4ANWA 4CDNA 3CKBA 1H19A 3CSFA 1H6OA 3VTXA 3SBSA 1OWLA 3EIJA 3TGOA 1IHBA 3J5PA 4F1PA 2YHCA 3D9JA 3HIZA 3EUVA 3FULA 1HH8A 1D8EA 2VSXE 3UQ3A 4WWOA 1S64A 4ATZD 4A1SA 1WM5A 4HRMB 4KT6B 4YNDA 3CHRA 2E2EA 2HR2A 2R03A 1UOHA 2XGOA 4FULA 4U7EB 1MQSA 4FP7A 1NA3A 5CBOA 1EPUA 4XE0A 4AJWA 4AIFA 4NACA 2QZAA 3MKRA 2WPVA 2GRRB 1HXIA 2AXZA 3PVLA 2ZIRA 3C5RA 1BLXB 2ETAA 5A6CA 2WXPA 3PUJA 4G2VA 4GTQA 3QARA 3Q49B 3CVVA 4L1BA 3UKRG 5AQAA 2ZGDA 3B13A 2A5UA 4U8YD 3APCA 1AWCB 4DX6D 4GTVA 3G2UA 1BPOA 1XNFA 2GW1A 1LF8A 3ZYQA 3SFXA 2DVWA 1N4QA 1MJ0A 4C48B 5CERB 3FH8A 1U3DA 2I9CA 2UY1B 4GTTA 3V2OA 3PZDA 2XCBA 2VGXB 4ABNA 3DSSA 4U0ZA 2P9SG 4OVUA 2KCKA 2P9UG 2WMOA 4H7XA 1HG5A 5J90A 4JL0A 4C0MA 3JQ0A 1IYGA 4N3AA 4FADA 4JC8A 3G2VA 4EQFA 3L08A 3CIAA 3ZXSA 2L0TB 1SW6A 2DYSE 3FP3A 3J5QB 2OEWA 3QWVA 5JA4D 3LY9A 4I2ZA 3TWRA 4IN3B 5FT9A 4PS8A 3Q4AB 4J8FA 3Q9NC 1QYMA 4F1SA 3EU9A 1JCRA 4QQIA 5LP0A 5CRUA 4N39A 2IO2C 3G2WA 4L2LA 3LDZA 4ANXA 2VYIA 4GPKA 3DXMG 4U96D 3FHEA 1V55E 4JVSA 5AQBA 3ZYMA 2WXJA 5FQ7A 3OTNA 4JPSA 4IRUA 4I1AA 3P2BA 2B0OE 5BV0A 3EJNA 3HXFA 1DVPA 2DIWA 5ENTD 3DEOA 2R05A 1Z5SC 4RG9A 3NF1A 4EBAA 4UWFA 2RFAA 2WVIA 3SI5A 3V31A 2HE0A 2ZGGA 3WXXA 2FBNA 4KXKB 5KJLA 2HM8A 3QOUA 3APDA 3ZU7B 5AJDA 3CHMA 2CFZA 5LCWC 2Y69E 3TWSA 2LAIA 1H6PA 5CMYA 1EDUA 1YMPA 2Y4TA 4GYOA 3ASGA 2FEZA 3KSQA 3LY8A 3DSWA 1QBQA 5EX0A 3ZXPA 4RVBA 5BW8C 4BTAA 4JHKA 2V4HC 4BESA 4GTPA 4HOTA 4WNFA 3V2XA 4ANVA 3DRAA 3CVQA 1LD8A 3E32A 3B7BA 3PRZA 1K3ZD 3UINC 3GZSA 2VTBA 3FUIA 2I2OA 3D9IA 4CDRA 2XENA 3ASFA 2E0IA 3ESKA 3HXCA 4G1TA 4I1MA 5A23A 4F7AA 3IEGA 3CGHA 2PM7A 3EHRA 3Q47B 4GAAA 2WXMA 5CEAA 4URKA 5HKPA 5ENPD 3E4BA 3MA5A 2LUHA 4DPRA 2XS1A 1SZAA 4R7LA 3IXEA 3LJNA 4I43A 4FLBA 2P9LG 3VLDA 3CK7A 3JQ1A 2Y4UA 5ITZF 3KEAA 3E30A 3Q78A 3AG2E 3NOCD 2P2CP 3ULQA 2MRIA 3DSXA 2WXFA 2P9NG 2FI7A 2XEEA 4ILHB 5ENOD 4O1OA 4J8EA 1OCOE 4GA2A 3C72A 1DCQA 3ZN3A 3AG4E 2MOWA 4UQXA 3MKQA 3B7UX 2C0MA 2CHZA 5CMWA 1TEZA 4AY6A 2IQCA 4O1PA 1OWOA 3RRMB 1MZCA 4BSXA 3HYMB 4EZKA 2XGMA 4KVOA 4I17A 1E90A 3W9GA 5AYWD 4JEUA 4K0RA 3FUHA 4F6RD 2I6HA 1NI1A 3B95A 1LTXA 5FZRA 3L54A 5BNWA 1IKND 5AENA 3MCXA 2WQ6A 1SA4A 4I2WA 2GRNB 2KXPC 3E33A 3G2SA 3FDHA 1NL4A 2KZTA 2EQXA 4G8LA 4DX1A 3HVEB 3B7TA 1Z6TA 4N2SA 4ILGA 3C3OA 4EHMA 3ONLA 2FF4A 2GRQB 5KNGA 1MX2A 3CVPA 1E7VA 1E8WA 1K1AA 4GU5A 3CEQA 5EYLA 3ZRHA 3LVQE 2PL2A 4YDYA 1TR4A 3FTYA 1OUVA 3JCKC 5LCWJ 2WXNA 4U95D 2KBXA 2NYJA 3FU3A 3VLFA 3CR3A 3OXFA 4ILIA 3SD5A 4MLPA 2XRYA 3IHVA 1MYOA 1TJFA 5JMND 4B8CB 4TUMA 4WUYA 3UM1A 4UWKA 1N4RA 2V0PA 2MYOA 4EECA 3AG3E 2EIJE 4AXHA 5AARA 5BPPA 4X8QA 3CKCA 1XGWA 1PY1A 4BFRA 3GZ1A 4RG6A 5G2NA 4APOA 3LCAA 4JA7A 4B93B 2ONDA 3DPDA 2UWJG 3TWXA 2J49A 4G23A 1TNYA 4ME2A 2FULA 1HX8A 3K9IA 4XKBA 2WXIA 4G8KA 4GA1A 2XEHA 3PZ3A 2JEKA 4KYOB 4GTSA 3C98A 4M7CA 4ANUA 3FTWA 3ISMC 5EIBE 4AOFA 5FWQA 3AG1E 4IYPA 4ZFHA 3RO2A 1OWPA 1ZBPA 2WXOA 3D9MA 4U0UA 4GCOA 3SBTB 2H6FA 4AM9A 1OY3D 3BUAA 4A55A 4WNEA 5EX3A 3ML8A 5BV1A 3TL5A 1H2UA 3Q73A 3CHPA 5EIDA 2XS8A 4JZYA 4GZ5A 1UJJA 4FHJA 2P9IG 1D8DA 3UMVA 3URZA 1SZ9A 3FU5A 1UN8A 4CCAA 2VSOE 3Q7FA 3FWVA 4HXIA 2XHEA 3ESLA 1OCCE 5D0QD 3ZW3A 3LYAA 2OVBA 2H6HA 2VJ8A 2XPYA 3P1UA 2F37A 3BG0B 2DCPA 3KSLA 3TAXA 3Q75A 3Q79A 3NBNB 2MHKA 2R5SA 3AU5A 2WQ7A 4L7TA 4GPMA 4U63A 4GTRA 3JXJA 2QFCA 3FTVA 3E34A 4U0SA 1P5QA 4CEMA 1UG3A 4BX9A 4UWGA 2GRPB 2WXGA 1BD8A 3UM0A 1YYHA 4HI9A 4L2YA 1Q2ZA 2PZIA 1O5MA 1N52A 3PNTB 3QAQA 4J8DA 3AJIA 2KCLA 2V4LA 2BKKB 5FQ4A 3NB2A 1S0PA 2GROB 2LAHA 2EILE 5EN5D 4J8YA 3R7QA 2ETCA 3NZSA 1N0RA 4OAUC 2OOEA 2AVPA 2LSVA 1ELRA 3PE3A 1TNOA 1KLXA 2XQ0A 2VGXA 1IQUA 2X3MA 3WG7E 4PH4B 2GGFA 1FVHA 4HRNA 1N95A 5JHAA 4LNUD 4UI9K 5HI7A 5AQ7A 3UKUG 3PEUB 3L17A 4B94A 1Z3YA 4HVBA 5CHEE 2M63A 3LXUX 3HRAA 3JUEA 2DWZA 4B89A 5LOZA 2UY1A 3CHOA 5ENQD 3ZFWA 4OYSA 5D0OD 3KEZA 3CVNA 2WXHA 4BX8A 3ML9A 2BUGA 2P9PG 4TXPA 4C0EA 5KJKA 3B7SA 1O1SA 5AQ9A 2OV8A 3JXIA 1H0AA 3LPZA 5FZQA 3RRUA 2L6BA 3AU4A 1GW6A 4FHKA 4J0UA 3S7JA 4EPZA 5CCLA 3NQPA 2XPZA 3CQCB 2ETBA 2WXRA 4TV3A 4GMLA 4MS6A 2CFUA 4KVMA 1HU3A 1PAQA 2QC9A 4KZCA 2NSZA 4L23A 1Y6IA 2LXLA 1BI7B 3L22A 4G25A 2IONA 1H6KA 1K8KG 2J07A 3QWWA 1HG2A 2XRZA 3IV0A 1JWFA 1YCSB 1HFAA 2JLBA 5AJLA 1X5BA 3E37A 3ASDA 3CQGB 3LVRE 3MEKA 4CRWA 1JCQA 1EF1C 3NOGD 3ZUVB 1Y8MA 1OT8A 5FQ6A 3ULEG 5HRYA 3ASNE 5BXUA 3I3NA 5B3SE 2EIME 3Q5MA 4KZ0A 3ABKE 3X2QE 3LS8A 1E96B 2J08A 5G55A 4DI4A 3UM3A 5G04J 2WXLA 3QB2A 3EU5A 2YINA 5CECB 2Y3AA 4HI8A 3T5VA 4LEUA 1X81A 2OVFA 4CDMA 4F53A 4KBQA 4XEIG 3FTSA 3FUDA 4HORA 3SGHA 4UWLA 3CHSA 2XEVA 2XCCA 5ANRA 2H6GA 3L13A 3QK0A 1VDYA 5ENRD 2BKGA 1O1RA 3U9WA 3G2TA 3ENEA 2B6CA 3C3RA 1EYHA 4BETA 2DZNA 4WNDA 1JCSA 3AS4A 3TWTA 3QWPA 2LXMA 1G3NB 3DBSA 5H7PA 3MGBA 2X6KA 5AN8A 3ABLE 4GTMA 2WB2A 4UUCA 3HVEA 3TWQA 4IULA 5B1AE 4K03A 3HXBA 3CSTA 5A7DB 3VLEA 3S7BA 4HS2A 3FU6A 4BSZB 3UT8A 5JJTA 3D9KA 3FTZA 3IHYA 1SVXA 3PZ1A 2AXUA 3SQVA 4CZ2D 4DLOA 2X6IA 3FTUA 4O60A 5DBKA 2VGEA 2IY0C 3S7FA 2LO6A 3EHQA 3RSEG 3OXGA 3RRNB 3AS5A 3FEYA 3PH0C 4YVQC 4BWRA 3Q15A 5ENSD 5T3RA 1UN9A 3ZKJA 5KJNA 3TG4A 4HQDA 1AP7A 1DNPA 2V5QC 5KCMA 3IBEA 5CEDB 3U4TA 4FC8A 3DWLG 2KATA 4N5CA 1IHGA 3HDXA 2L9BA 4CYMD 1TN6A 5E75A 4GZDA 4PUCA 3O4ZA 1TNUA 2FO7A 1ELKA 3TWUA 4UWHA 2J9QA 4TXRA 2CG3A 3EIQC 2I1KA 4J6IA 2RD0A 4UI9C 4XI0A 3UI2A 3UT7A 5BXOA 4E6HA 4WWPA 2WXQA 4FJYA 1JWGA 2IF4A 4I6JA 1S63A 1ELWA 4XIFA 4HRLA 2Y0BG 4HOSA 3KAEA 3S2AA 1WAO1 4QFVA 4LCTA 5D2MC 2X6HA 4BY6A 3SNXA 4OAVB 2WXKA 5KWDA 4DJAA 4EZLA 4JA9A 4FA6A 3FEXA 3V79K 3PS6A 2R59A 4XKCA 5JJ6A 3T8KA 4Z68A 5B1BE 3PREA 5LFAA 5KNHD 4TXQA 4JHJA 3SO8A 5T8IA 4B0ZA 4HLEA 3ZIMA 2X6JA 4MBGA 2OCCE 3B7RL 4I1OB 3MX3A 4DI3A 1TNBA 3UUXA 2AW6A 1E8ZA 2C0LA 2A4ZA 5FIOA 4GYWA 5KJMA 3Q7AA 5CRVA 5KBAA 4ACLA 1N9AA 2FO1E 3UX4A 3CV0A 3DSTA 3U64A 5CBNA 5HQ8A 4JD2G 1JPLA 3ZVVA 2XGSA 3V30A 2ZISA 3RU0A 3QC1A 3CVLA 4XX5A 1JUQA 2DBAA 5T4YA 2EINE 4U8HA 4HNAD 1HO8A 2F0YA 3LJ3A 4GZ6A 1DC2A 3W9FA 2H6IA 1MX6A 3FUNA 3LKUA 4A63B 3FUJA 1ZB1A 1KPSB 3LEWA 1HS6A 3SZ7A 4GB9A 1A5EA 2YQ8A 3C3QA 2HYZA 2HO1A 1INZA 4DUIA 4DX7D 3Q9UC 4U07A 3NAWA 4DK5A 1FCHA 3MV3B 4PS3A 2IJGX 2X6FA 4JB8P 5EILA 5EYPF 3T5XA 3ULYA 2R02A 3TXMA 2IU1A 1U3CA 2WM9A 3CVYA 5M72A 3QKYA 4I6EA 2DZOA 2AJAA 3DEPA 3ZHEA 4UQZA 3UM2A 3FFLA 3EHNA 5JJ7A 4BERA 3F6QA 3ZGQA 1N11A 3UIOC 2GRMA 5DIZA 2NXPA 3RJVA 3HXDA 1TN7A 4N3BA 3CLJA 4F3VA 3FUFA 1RW2A 1UJKA 4G11A 3SHFA 2DYRE 4HBDA 2RG8A 3HHMA 4YDEA 2YNQA 3KD7A 3R9AB 3MV2B 4FLHA 3D3MA 1NZNA 2XZDG 1FPPA 3ASOE 3CVWA 3FY4A 4PDXA 4P29A 4U04A 1U2VG 3D9NA 3BU8A 4AV7A 1TN8A 4CT0A 3D9HA 5IY5E 4GA0A 4GMJA 4L9PA 5FINA 3L6AA 5ANLA 4JEHA 1E7UA 3UPVA 1FT1A 3ZEFA 4YDWA 2P9KG 3U3WA 1E8XA 3EHMA 3U66A 3S7DA 3ABME 4JXTA 2VTBB 3UIPC 4N3CA 2CHWA 4KMOA 3TJPA 4BT8A 1WG0A 1IXVA 4RQIA 3QJZA 4Q69A 3DSVA 3UT4A 1FVFA 4V3IA 3AAAC 4K5AB 5HS0A 2BF0X 2F8YA 3D9LA 3SF4A 1E8YA 3PEVB 3VTYA 1OCRE 4WWNA 3I4RB 4G24A 3QNKA 4OVVA 4A3VA 2ILRA 5AIJA 4LNBA 2BTDA 2J4DA 3CK9A 3D9PA 4YVOA 1O1TA 4LRZA 1KZOA 3PUKA 3FUMA 2JABA 4NIKA 4I6GA 3TG5A 5LX8A 3NZUA 1ZU2A 4CGWA 4BEPA 4EBAG 5FQ8A 4A1GA 1HF8A 2L0IA 3N71A 2QYJA 2RFMA 4HOUA 2GRLA 3BG1B 2V5FA 3ZNGA 3SY2A 3PE4A 3SFYA 1MX4A 4EZJA 1MHQA 5ARGA 2XPIA 3OAWA 2IO3C 4J7WA 3T8MA 1N4PA 2KM4A 2X38A 3FUKA 5EDSA 3ZYLA 3I4GA 4HLLA 2IEJA 4I9EA 4XI9A 5BT1A 1H2TC 4JW1A 1HZ4A 3FTXA 4GZ3A 4W9RA 5CCMA 2VSYA 2ZXWE 3GW4A 4Y6WA 4LSZE 5G05J 4DX2A 3I5PA 4LERA 3RIBA 2C2LA 2RKKA 3ONKA 3CVXA 3FUEA 1BU9A 3KS2A 3OXLA 2VSNA 4FU3A 4N5QA 3R7RA 5FJYA 3RK6A 2IOSA 4MRUA 1SQMA 1N0QA 2PQNA 3R9MA 2R17C 4LNGA 2EIKE 5BUZA 1KT1A 2QY7A 4N2QA 4TRQA 3QDNA 3EDTB 4I9CA 4YDOA 2LSUA 4BTBA 1KZPA 3LY7A 4GZCA 3AS8A 2R2LA 1LD7A 1NFIE 5G04C 3L16A 5D66A 1KT0A 4APFA 1S70B 3PZ2A 2P58C 2WMNA 1NA0A 3D9OA 2J4BA 1B89A 3ZYKA 2ZU6B 4GCNA 2XZTG 4ATGA 2PM6A 2WQHA 2J09A 4AP2A 4HOQA 1WDYA 4DRXE 3APFA 3DPYA 3TWVA 3HG0D 3L82A 5C2YA 4K5CA 4JHRA 4CGVA 4E85A 2VGYA 4WNGA 2VQ2A 3MZLB 4Y6CA 5EKQD 1SA5A 2CG2A 4AEZC 4NQ0A 2BEDA 4HFGA 2Q7FA 3FH5A 2KZTB 2F8XK 1TNZA 4C9BB 2QYUA 1OXJA 3L9TA 3GZ2A 5J08A 1HE8A 3PDNA 4NURA 1H2VC 1FT2A 4GMRA 1WY6A 3PZ4A 4MKTA 3RAUA
chains in the Genus database with same CATH topology
3Q75A 1TN8A 4GTQA 3Q79A 2R2LA 1NI1A 4L9PA 1LD7A 3EU5A 1LTXA 4GTRA 1O1SA 3DSUA 3HXEA 1FT1A 3HXCA 1TNYA 1X81A 3SFYA 3E34A 4GTVA 3PZ2A 1N4PA 3SFXA 3HXFA 1SA4A 1N4QA 3PZ3A 3E33A 4GTSA 4MBGA 4GTOA 2IEJA 1TNBA 1O5MA 1NL4A 3DSVA 2H6GA 4GTTA 1DCEA 3DSSA 1O1RA 3DPYA 4EHMA 1TN6A 3Q7AA 3EUVA 2H6FA 1TNUA 1JCSA 3E30A 3Q78A 1N9AA 1D8EA 3DSXA 3HXDA 3Q73A 1S64A 3DSTA 1TN7A 3KSQA 4LNBA 3C72A 4GTMA 3DSWA 1QBQA 1TNOA 1D8DA 4YDEA 1SA5A 1O1TA 1N94A 1KZOA 2BEDA 1N95A 3E37A 2ZISA 3Q7FA 3HXBA 1TNZA 4GTPA 1JCRA 1N4RA 1S63A 1JCQA 1MZCA 1N4SA 4LNGA 2F0YA 2H6IA 3DRAA 2H6HA 1FT2A 1FPPA 3PZ1A 3PZ4A 2ZIRA 4YDOA 3KSLA 1LD8A 3E32A 1KZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q75 A;  1TN8 A;  4GTQ A;  3Q79 A;  2R2L A;  1NI1 A;  4L9P A;  1LD7 A;  3EU5 A;  1LTX A;  4GTR A;  1O1S A;  3DSU A;  3HXE A;  1FT1 A;  3HXC A;  1TNY A;  1X81 A;  3SFY A;  3E34 A;  4GTV A;  3PZ2 A;  1N4P A;  3SFX A;  3HXF A;  1SA4 A;  1N4Q A;  3PZ3 A;  3E33 A;  4GTS A;  4MBG A;  4GTO A;  2IEJ A;  1TNB A;  1O5M A;  1NL4 A;  3DSV A;  2H6G A;  4GTT A;  1DCE A;  3DSS A;  1O1R A;  3DPY A;  4EHM A;  1TN6 A;  3Q7A A;  3EUV A;  2H6F A;  1TNU A;  1JCS A;  3E30 A;  3Q78 A;  1N9A A;  1D8E A;  3DSX A;  3HXD A;  3Q73 A;  1S64 A;  3DST A;  1TN7 A;  3KSQ A;  4LNB A;  3C72 A;  4GTM A;  3DSW A;  1QBQ A;  1TNO A;  1D8D A;  4YDE A;  1SA5 A;  1O1T A;  1N94 A;  1KZO A;  2BED A;  1N95 A;  3E37 A;  2ZIS A;  3Q7F A;  3HXB A;  1TNZ A;  4GTP A;  1JCR A;  1N4R A;  1S63 A;  1JCQ A;  1MZC A;  1N4S A;  4LNG A;  2F0Y A;  2H6I A;  3DRA A;  2H6H A;  1FT2 A;  1FPP A;  3PZ1 A;  3PZ4 A;  2ZIR A;  4YDO A;  3KSL A;  1LD8 A;  3E32 A;  1KZP A; 
#chains in the Genus database with same CATH topology
 1V54 E;  4G26 A;  3BQO A;  4LUN U;  1QNF A;  4CT4 A;  1QQE A;  3T9K A;  3DSU A;  2J8S D;  1QZ2 A;  4RSY A;  4NRH B;  5C1D A;  1YA0 A;  3GYZ A;  1BI8 B;  3MYV A;  5FTP A;  4GTO A;  3FU0 A;  3MJW A;  5E76 A;  4H7Y A;  2A5E A;  1DCE A;  3MKQ B;  3RO3 A;  5JHB A;  2L6J A;  4WAF A;  4LG6 A;  3JYS A;  2AWI A;  4HB5 A;  2Y1L E;  4A3T A;  3BEE A;  1UW4 B;  2V8S E;  4AY5 A;  1A17 A;  2IOL A;  1RZ4 A;  3ZPJ A;  3SFZ A;  1D9S A;  4ACK A;  4D10 C;  4AVX A;  2NC9 A;  3RKV A;  3TXN A;  2YHE A;  5G05 C;  4PS7 A;  4J8S A;  4O6F A;  3PNL B;  3ZHE B;  3UTM A;  1PC2 A;  1N94 A;  1K1B A;  4U8V D;  4M3O A;  1OWM A;  3ASH A;  5ARF A;  1IQR A;  1N4S A;  4GYY A;  4DX5 D;  2I1J A;  3FH7 A;  3CK8 A;  5AAO A;  1OWN A;  4K5B A;  3CHQ A;  1L5J A;  4DLQ A;  2AXV A;  2CHX A;  3IKO B;  4Q96 A;  1OCZ E;  1N54 A;  1Z3X A;  5FZS A;  4XZ4 A;  1NP7 A;  4Q94 A;  2KCV A;  3CVU A;  1TJC A;  2PNN A;  4UQY A;  5ENN A;  4RLY A;  1TYQ G;  2IFU A;  4UI9 J;  3O48 A;  3HXE A;  3DXK G;  2LNI A;  4B8A A;  3JUI A;  3UXG A;  2OEV A;  4ZHB A;  3TWW A;  4FJZ A;  2PQR A;  2KC7 A;  4TUU A;  4BT9 A;  1W3B A;  4ANW A;  4CDN A;  3CKB A;  1H19 A;  3CSF A;  1H6O A;  3VTX A;  3SBS A;  1OWL A;  3EIJ A;  3TGO A;  1IHB A;  3J5P A;  4F1P A;  2YHC A;  3D9J A;  3HIZ A;  3EUV A;  3FUL A;  1HH8 A;  1D8E A;  2VSX E;  3UQ3 A;  4WWO A;  1S64 A;  4ATZ D;  4A1S A;  1WM5 A;  4HRM B;  4KT6 B;  4YND A;  3CHR A;  2E2E A;  2HR2 A;  2R03 A;  1UOH A;  2XGO A;  4FUL A;  4U7E B;  1MQS A;  4FP7 A;  1NA3 A;  5CBO A;  1EPU A;  4XE0 A;  4AJW A;  4AIF A;  4NAC A;  2QZA A;  3MKR A;  2WPV A;  2GRR B;  1HXI A;  2AXZ A;  3PVL A;  2ZIR A;  3C5R A;  1BLX B;  2ETA A;  5A6C A;  2WXP A;  3PUJ A;  4G2V A;  4GTQ A;  3QAR A;  3Q49 B;  3CVV A;  4L1B A;  3UKR G;  5AQA A;  2ZGD A;  3B13 A;  2A5U A;  4U8Y D;  3APC A;  1AWC B;  4DX6 D;  4GTV A;  3G2U A;  1BPO A;  1XNF A;  2GW1 A;  1LF8 A;  3ZYQ A;  3SFX A;  2DVW A;  1N4Q A;  1MJ0 A;  4C48 B;  5CER B;  3FH8 A;  1U3D A;  2I9C A;  2UY1 B;  4GTT A;  3V2O A;  3PZD A;  2XCB A;  2VGX B;  4ABN A;  3DSS A;  4U0Z A;  2P9S G;  4OVU A;  2KCK A;  2P9U G;  2WMO A;  4H7X A;  1HG5 A;  5J90 A;  4JL0 A;  4C0M A;  3JQ0 A;  1IYG A;  4N3A A;  4FAD A;  4JC8 A;  3G2V A;  4EQF A;  3L08 A;  3CIA A;  3ZXS A;  2L0T B;  1SW6 A;  2DYS E;  3FP3 A;  3J5Q B;  2OEW A;  3QWV A;  5JA4 D;  3LY9 A;  4I2Z A;  3TWR A;  4IN3 B;  5FT9 A;  4PS8 A;  3Q4A B;  4J8F A;  3Q9N C;  1QYM A;  4F1S A;  3EU9 A;  1JCR A;  4QQI A;  5LP0 A;  5CRU A;  4N39 A;  2IO2 C;  3G2W A;  4L2L A;  3LDZ A;  4ANX A;  2VYI A;  4GPK A;  3DXM G;  4U96 D;  3FHE A;  1V55 E;  4JVS A;  5AQB A;  3ZYM A;  2WXJ A;  5FQ7 A;  3OTN A;  4JPS A;  4IRU A;  4I1A A;  3P2B A;  2B0O E;  5BV0 A;  3EJN A;  3HXF A;  1DVP A;  2DIW A;  5ENT D;  3DEO A;  2R05 A;  1Z5S C;  4RG9 A;  3NF1 A;  4EBA A;  4UWF A;  2RFA A;  2WVI A;  3SI5 A;  3V31 A;  2HE0 A;  2ZGG A;  3WXX A;  2FBN A;  4KXK B;  5KJL A;  2HM8 A;  3QOU A;  3APD A;  3ZU7 B;  5AJD A;  3CHM A;  2CFZ A;  5LCW C;  2Y69 E;  3TWS A;  2LAI A;  1H6P A;  5CMY A;  1EDU A;  1YMP A;  2Y4T A;  4GYO A;  3ASG A;  2FEZ A;  3KSQ A;  3LY8 A;  3DSW A;  1QBQ A;  5EX0 A;  3ZXP A;  4RVB A;  5BW8 C;  4BTA A;  4JHK A;  2V4H C;  4BES A;  4GTP A;  4HOT A;  4WNF A;  3V2X A;  4ANV A;  3DRA A;  3CVQ A;  1LD8 A;  3E32 A;  3B7B A;  3PRZ A;  1K3Z D;  3UIN C;  3GZS A;  2VTB A;  3FUI A;  2I2O A;  3D9I A;  4CDR A;  2XEN A;  3ASF A;  2E0I A;  3ESK A;  3HXC A;  4G1T A;  4I1M A;  5A23 A;  4F7A A;  3IEG A;  3CGH A;  2PM7 A;  3EHR A;  3Q47 B;  4GAA A;  2WXM A;  5CEA A;  4URK A;  5HKP A;  5ENP D;  3E4B A;  3MA5 A;  2LUH A;  4DPR A;  2XS1 A;  1SZA A;  4R7L A;  3IXE A;  3LJN A;  4I43 A;  4FLB A;  2P9L G;  3VLD A;  3CK7 A;  3JQ1 A;  2Y4U A;  5ITZ F;  3KEA A;  3E30 A;  3Q78 A;  3AG2 E;  3NOC D;  2P2C P;  3ULQ A;  2MRI A;  3DSX A;  2WXF A;  2P9N G;  2FI7 A;  2XEE A;  4ILH B;  5ENO D;  4O1O A;  4J8E A;  1OCO E;  4GA2 A;  3C72 A;  1DCQ A;  3ZN3 A;  3AG4 E;  2MOW A;  4UQX A;  3MKQ A;  3B7U X;  2C0M A;  2CHZ A;  5CMW A;  1TEZ A;  4AY6 A;  2IQC A;  4O1P A;  1OWO A;  3RRM B;  1MZC A;  4BSX A;  3HYM B;  4EZK A;  2XGM A;  4KVO A;  4I17 A;  1E90 A;  3W9G A;  5AYW D;  4JEU A;  4K0R A;  3FUH A;  4F6R D;  2I6H A;  1NI1 A;  3B95 A;  1LTX A;  5FZR A;  3L54 A;  5BNW A;  1IKN D;  5AEN A;  3MCX A;  2WQ6 A;  1SA4 A;  4I2W A;  2GRN B;  2KXP C;  3E33 A;  3G2S A;  3FDH A;  1NL4 A;  2KZT A;  2EQX A;  4G8L A;  4DX1 A;  3HVE B;  3B7T A;  1Z6T A;  4N2S A;  4ILG A;  3C3O A;  4EHM A;  3ONL A;  2FF4 A;  2GRQ B;  5KNG A;  1MX2 A;  3CVP A;  1E7V A;  1E8W A;  1K1A A;  4GU5 A;  3CEQ A;  5EYL A;  3ZRH A;  3LVQ E;  2PL2 A;  4YDY A;  1TR4 A;  3FTY A;  1OUV A;  3JCK C;  5LCW J;  2WXN A;  4U95 D;  2KBX A;  2NYJ A;  3FU3 A;  3VLF A;  3CR3 A;  3OXF A;  4ILI A;  3SD5 A;  4MLP A;  2XRY A;  3IHV A;  1MYO A;  1TJF A;  5JMN D;  4B8C B;  4TUM A;  4WUY A;  3UM1 A;  4UWK A;  1N4R A;  2V0P A;  2MYO A;  4EEC A;  3AG3 E;  2EIJ E;  4AXH A;  5AAR A;  5BPP A;  4X8Q A;  3CKC A;  1XGW A;  1PY1 A;  4BFR A;  3GZ1 A;  4RG6 A;  5G2N A;  4APO A;  3LCA A;  4JA7 A;  4B93 B;  2OND A;  3DPD A;  2UWJ G;  3TWX A;  2J49 A;  4G23 A;  1TNY A;  4ME2 A;  2FUL A;  1HX8 A;  3K9I A;  4XKB A;  2WXI A;  4G8K A;  4GA1 A;  2XEH A;  3PZ3 A;  2JEK A;  4KYO B;  4GTS A;  3C98 A;  4M7C A;  4ANU A;  3FTW A;  3ISM C;  5EIB E;  4AOF A;  5FWQ A;  3AG1 E;  4IYP A;  4ZFH A;  3RO2 A;  1OWP A;  1ZBP A;  2WXO A;  3D9M A;  4U0U A;  4GCO A;  3SBT B;  2H6F A;  4AM9 A;  1OY3 D;  3BUA A;  4A55 A;  4WNE A;  5EX3 A;  3ML8 A;  5BV1 A;  3TL5 A;  1H2U A;  3Q73 A;  3CHP A;  5EID A;  2XS8 A;  4JZY A;  4GZ5 A;  1UJJ A;  4FHJ A;  2P9I G;  1D8D A;  3UMV A;  3URZ A;  1SZ9 A;  3FU5 A;  1UN8 A;  4CCA A;  2VSO E;  3Q7F A;  3FWV A;  4HXI A;  2XHE A;  3ESL A;  1OCC E;  5D0Q D;  3ZW3 A;  3LYA A;  2OVB A;  2H6H A;  2VJ8 A;  2XPY A;  3P1U A;  2F37 A;  3BG0 B;  2DCP A;  3KSL A;  3TAX A;  3Q75 A;  3Q79 A;  3NBN B;  2MHK A;  2R5S A;  3AU5 A;  2WQ7 A;  4L7T A;  4GPM A;  4U63 A;  4GTR A;  3JXJ A;  2QFC A;  3FTV A;  3E34 A;  4U0S A;  1P5Q A;  4CEM A;  1UG3 A;  4BX9 A;  4UWG A;  2GRP B;  2WXG A;  1BD8 A;  3UM0 A;  1YYH A;  4HI9 A;  4L2Y A;  1Q2Z A;  2PZI A;  1O5M A;  1N52 A;  3PNT B;  3QAQ A;  4J8D A;  3AJI A;  2KCL A;  2V4L A;  2BKK B;  5FQ4 A;  3NB2 A;  1S0P A;  2GRO B;  2LAH A;  2EIL E;  5EN5 D;  4J8Y A;  3R7Q A;  2ETC A;  3NZS A;  1N0R A;  4OAU C;  2OOE A;  2AVP A;  2LSV A;  1ELR A;  3PE3 A;  1TNO A;  1KLX A;  2XQ0 A;  2VGX A;  1IQU A;  2X3M A;  3WG7 E;  4PH4 B;  2GGF A;  1FVH A;  4HRN A;  1N95 A;  5JHA A;  4LNU D;  4UI9 K;  5HI7 A;  5AQ7 A;  3UKU G;  3PEU B;  3L17 A;  4B94 A;  1Z3Y A;  4HVB A;  5CHE E;  2M63 A;  3LXU X;  3HRA A;  3JUE A;  2DWZ A;  4B89 A;  5LOZ A;  2UY1 A;  3CHO A;  5ENQ D;  3ZFW A;  4OYS A;  5D0O D;  3KEZ A;  3CVN A;  2WXH A;  4BX8 A;  3ML9 A;  2BUG A;  2P9P G;  4TXP A;  4C0E A;  5KJK A;  3B7S A;  1O1S A;  5AQ9 A;  2OV8 A;  3JXI A;  1H0A A;  3LPZ A;  5FZQ A;  3RRU A;  2L6B A;  3AU4 A;  1GW6 A;  4FHK A;  4J0U A;  3S7J A;  4EPZ A;  5CCL A;  3NQP A;  2XPZ A;  3CQC B;  2ETB A;  2WXR A;  4TV3 A;  4GML A;  4MS6 A;  2CFU A;  4KVM A;  1HU3 A;  1PAQ A;  2QC9 A;  4KZC A;  2NSZ A;  4L23 A;  1Y6I A;  2LXL A;  1BI7 B;  3L22 A;  4G25 A;  2ION A;  1H6K A;  1K8K G;  2J07 A;  3QWW A;  1HG2 A;  2XRZ A;  3IV0 A;  1JWF A;  1YCS B;  1HFA A;  2JLB A;  5AJL A;  1X5B A;  3E37 A;  3ASD A;  3CQG B;  3LVR E;  3MEK A;  4CRW A;  1JCQ A;  1EF1 C;  3NOG D;  3ZUV B;  1Y8M A;  1OT8 A;  5FQ6 A;  3ULE G;  5HRY A;  3ASN E;  5BXU A;  3I3N A;  5B3S E;  2EIM E;  3Q5M A;  4KZ0 A;  3ABK E;  3X2Q E;  3LS8 A;  1E96 B;  2J08 A;  5G55 A;  4DI4 A;  3UM3 A;  5G04 J;  2WXL A;  3QB2 A;  3EU5 A;  2YIN A;  5CEC B;  2Y3A A;  4HI8 A;  3T5V A;  4LEU A;  1X81 A;  2OVF A;  4CDM A;  4F53 A;  4KBQ A;  4XEI G;  3FTS A;  3FUD A;  4HOR A;  3SGH A;  4UWL A;  3CHS A;  2XEV A;  2XCC A;  5ANR A;  2H6G A;  3L13 A;  3QK0 A;  1VDY A;  5ENR D;  2BKG A;  1O1R A;  3U9W A;  3G2T A;  3ENE A;  2B6C A;  3C3R A;  1EYH A;  4BET A;  2DZN A;  4WND A;  1JCS A;  3AS4 A;  3TWT A;  3QWP A;  2LXM A;  1G3N B;  3DBS A;  5H7P A;  3MGB A;  2X6K A;  5AN8 A;  3ABL E;  4GTM A;  2WB2 A;  4UUC A;  3HVE A;  3TWQ A;  4IUL A;  5B1A E;  4K03 A;  3HXB A;  3CST A;  5A7D B;  3VLE A;  3S7B A;  4HS2 A;  3FU6 A;  4BSZ B;  3UT8 A;  5JJT A;  3D9K A;  3FTZ A;  3IHY A;  1SVX A;  3PZ1 A;  2AXU A;  3SQV A;  4CZ2 D;  4DLO A;  2X6I A;  3FTU A;  4O60 A;  5DBK A;  2VGE A;  2IY0 C;  3S7F A;  2LO6 A;  3EHQ A;  3RSE G;  3OXG A;  3RRN B;  3AS5 A;  3FEY A;  3PH0 C;  4YVQ C;  4BWR A;  3Q15 A;  5ENS D;  5T3R A;  1UN9 A;  3ZKJ A;  5KJN A;  3TG4 A;  4HQD A;  1AP7 A;  1DNP A;  2V5Q C;  5KCM A;  3IBE A;  5CED B;  3U4T A;  4FC8 A;  3DWL G;  2KAT A;  4N5C A;  1IHG A;  3HDX A;  2L9B A;  4CYM D;  1TN6 A;  5E75 A;  4GZD A;  4PUC A;  3O4Z A;  1TNU A;  2FO7 A;  1ELK A;  3TWU A;  4UWH A;  2J9Q A;  4TXR A;  2CG3 A;  3EIQ C;  2I1K A;  4J6I A;  2RD0 A;  4UI9 C;  4XI0 A;  3UI2 A;  3UT7 A;  5BXO A;  4E6H A;  4WWP A;  2WXQ A;  4FJY A;  1JWG A;  2IF4 A;  4I6J A;  1S63 A;  1ELW A;  4XIF A;  4HRL A;  2Y0B G;  4HOS A;  3KAE A;  3S2A A;  1WAO 1;  4QFV A;  4LCT A;  5D2M C;  2X6H A;  4BY6 A;  3SNX A;  4OAV B;  2WXK A;  5KWD A;  4DJA A;  4EZL A;  4JA9 A;  4FA6 A;  3FEX A;  3V79 K;  3PS6 A;  2R59 A;  4XKC A;  5JJ6 A;  3T8K A;  4Z68 A;  5B1B E;  3PRE A;  5LFA A;  5KNH D;  4TXQ A;  4JHJ A;  3SO8 A;  5T8I A;  4B0Z A;  4HLE A;  3ZIM A;  2X6J A;  4MBG A;  2OCC E;  3B7R L;  4I1O B;  3MX3 A;  4DI3 A;  1TNB A;  3UUX A;  2AW6 A;  1E8Z A;  2C0L A;  2A4Z A;  5FIO A;  4GYW A;  5KJM A;  3Q7A A;  5CRV A;  5KBA A;  4ACL A;  1N9A A;  2FO1 E;  3UX4 A;  3CV0 A;  3DST A;  3U64 A;  5CBN A;  5HQ8 A;  4JD2 G;  1JPL A;  3ZVV A;  2XGS A;  3V30 A;  2ZIS A;  3RU0 A;  3QC1 A;  3CVL A;  4XX5 A;  1JUQ A;  2DBA A;  5T4Y A;  2EIN E;  4U8H A;  4HNA D;  1HO8 A;  2F0Y A;  3LJ3 A;  4GZ6 A;  1DC2 A;  3W9F A;  2H6I A;  1MX6 A;  3FUN A;  3LKU A;  4A63 B;  3FUJ A;  1ZB1 A;  1KPS B;  3LEW A;  1HS6 A;  3SZ7 A;  4GB9 A;  1A5E A;  2YQ8 A;  3C3Q A;  2HYZ A;  2HO1 A;  1INZ A;  4DUI A;  4DX7 D;  3Q9U C;  4U07 A;  3NAW A;  4DK5 A;  1FCH A;  3MV3 B;  4PS3 A;  2IJG X;  2X6F A;  4JB8 P;  5EIL A;  5EYP F;  3T5X A;  3ULY A;  2R02 A;  3TXM A;  2IU1 A;  1U3C A;  2WM9 A;  3CVY A;  5M72 A;  3QKY A;  4I6E A;  2DZO A;  2AJA A;  3DEP A;  3ZHE A;  4UQZ A;  3UM2 A;  3FFL A;  3EHN A;  5JJ7 A;  4BER A;  3F6Q A;  3ZGQ A;  1N11 A;  3UIO C;  2GRM A;  5DIZ A;  2NXP A;  3RJV A;  3HXD A;  1TN7 A;  4N3B A;  3CLJ A;  4F3V A;  3FUF A;  1RW2 A;  1UJK A;  4G11 A;  3SHF A;  2DYR E;  4HBD A;  2RG8 A;  3HHM A;  4YDE A;  2YNQ A;  3KD7 A;  3R9A B;  3MV2 B;  4FLH A;  3D3M A;  1NZN A;  2XZD G;  1FPP A;  3ASO E;  3CVW A;  3FY4 A;  4PDX A;  4P29 A;  4U04 A;  1U2V G;  3D9N A;  3BU8 A;  4AV7 A;  1TN8 A;  4CT0 A;  3D9H A;  5IY5 E;  4GA0 A;  4GMJ A;  4L9P A;  5FIN A;  3L6A A;  5ANL A;  4JEH A;  1E7U A;  3UPV A;  1FT1 A;  3ZEF A;  4YDW A;  2P9K G;  3U3W A;  1E8X A;  3EHM A;  3U66 A;  3S7D A;  3ABM E;  4JXT A;  2VTB B;  3UIP C;  4N3C A;  2CHW A;  4KMO A;  3TJP A;  4BT8 A;  1WG0 A;  1IXV A;  4RQI A;  3QJZ A;  4Q69 A;  3DSV A;  3UT4 A;  1FVF A;  4V3I A;  3AAA C;  4K5A B;  5HS0 A;  2BF0 X;  2F8Y A;  3D9L A;  3SF4 A;  1E8Y A;  3PEV B;  3VTY A;  1OCR E;  4WWN A;  3I4R B;  4G24 A;  3QNK A;  4OVV A;  4A3V A;  2ILR A;  5AIJ A;  4LNB A;  2BTD A;  2J4D A;  3CK9 A;  3D9P A;  4YVO A;  1O1T A;  4LRZ A;  1KZO A;  3PUK A;  3FUM A;  2JAB A;  4NIK A;  4I6G A;  3TG5 A;  5LX8 A;  3NZU A;  1ZU2 A;  4CGW A;  4BEP A;  4EBA G;  5FQ8 A;  4A1G A;  1HF8 A;  2L0I A;  3N71 A;  2QYJ A;  2RFM A;  4HOU A;  2GRL A;  3BG1 B;  2V5F A;  3ZNG A;  3SY2 A;  3PE4 A;  3SFY A;  1MX4 A;  4EZJ A;  1MHQ A;  5ARG A;  2XPI A;  3OAW A;  2IO3 C;  4J7W A;  3T8M A;  1N4P A;  2KM4 A;  2X38 A;  3FUK A;  5EDS A;  3ZYL A;  3I4G A;  4HLL A;  2IEJ A;  4I9E A;  4XI9 A;  5BT1 A;  1H2T C;  4JW1 A;  1HZ4 A;  3FTX A;  4GZ3 A;  4W9R A;  5CCM A;  2VSY A;  2ZXW E;  3GW4 A;  4Y6W A;  4LSZ E;  5G05 J;  4DX2 A;  3I5P A;  4LER A;  3RIB A;  2C2L A;  2RKK A;  3ONK A;  3CVX A;  3FUE A;  1BU9 A;  3KS2 A;  3OXL A;  2VSN A;  4FU3 A;  4N5Q A;  3R7R A;  5FJY A;  3RK6 A;  2IOS A;  4MRU A;  1SQM A;  1N0Q A;  2PQN A;  3R9M A;  2R17 C;  4LNG A;  2EIK E;  5BUZ A;  1KT1 A;  2QY7 A;  4N2Q A;  4TRQ A;  3QDN A;  3EDT B;  4I9C A;  4YDO A;  2LSU A;  4BTB A;  1KZP A;  3LY7 A;  4GZC A;  3AS8 A;  2R2L A;  1LD7 A;  1NFI E;  5G04 C;  3L16 A;  5D66 A;  1KT0 A;  4APF A;  1S70 B;  3PZ2 A;  2P58 C;  2WMN A;  1NA0 A;  3D9O A;  2J4B A;  1B89 A;  3ZYK A;  2ZU6 B;  4GCN A;  2XZT G;  4ATG A;  2PM6 A;  2WQH A;  2J09 A;  4AP2 A;  4HOQ A;  1WDY A;  4DRX E;  3APF A;  3DPY A;  3TWV A;  3HG0 D;  3L82 A;  5C2Y A;  4K5C A;  4JHR A;  4CGV A;  4E85 A;  2VGY A;  4WNG A;  2VQ2 A;  3MZL B;  4Y6C A;  5EKQ D;  1SA5 A;  2CG2 A;  4AEZ C;  4NQ0 A;  2BED A;  4HFG A;  2Q7F A;  3FH5 A;  2KZT B;  2F8X K;  1TNZ A;  4C9B B;  2QYU A;  1OXJ A;  3L9T A;  3GZ2 A;  5J08 A;  1HE8 A;  3PDN A;  4NUR A;  1H2V C;  1FT2 A;  4GMR A;  1WY6 A;  3PZ4 A;  4MKT A;  3RAU A; 
#chains in the Genus database with same CATH homology
 3Q75 A;  1TN8 A;  4GTQ A;  3Q79 A;  2R2L A;  1NI1 A;  4L9P A;  1LD7 A;  3EU5 A;  1LTX A;  4GTR A;  1O1S A;  3DSU A;  3HXE A;  1FT1 A;  3HXC A;  1TNY A;  1X81 A;  3SFY A;  3E34 A;  4GTV A;  3PZ2 A;  1N4P A;  3SFX A;  3HXF A;  1SA4 A;  1N4Q A;  3PZ3 A;  3E33 A;  4GTS A;  4MBG A;  4GTO A;  2IEJ A;  1TNB A;  1O5M A;  1NL4 A;  3DSV A;  2H6G A;  4GTT A;  1DCE A;  3DSS A;  1O1R A;  3DPY A;  4EHM A;  1TN6 A;  3Q7A A;  3EUV A;  2H6F A;  1TNU A;  1JCS A;  3E30 A;  3Q78 A;  1N9A A;  1D8E A;  3DSX A;  3HXD A;  3Q73 A;  1S64 A;  3DST A;  1TN7 A;  3KSQ A;  4LNB A;  3C72 A;  4GTM A;  3DSW A;  1QBQ A;  1TNO A;  1D8D A;  4YDE A;  1SA5 A;  1O1T A;  1N94 A;  1KZO A;  2BED A;  1N95 A;  3E37 A;  2ZIS A;  3Q7F A;  3HXB A;  1TNZ A;  4GTP A;  1JCR A;  1N4R A;  1S63 A;  1JCQ A;  1MZC A;  1N4S A;  4LNG A;  2F0Y A;  2H6I A;  3DRA A;  2H6H A;  1FT2 A;  1FPP A;  3PZ1 A;  3PZ4 A;  2ZIR A;  4YDO A;  3KSL A;  1LD8 A;  3E32 A;  1KZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...