1TNBA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a substrate kksktkcvif peptide derived from tc21
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords geranylgeranyltransferase type I alpha subunit
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 122
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnbA00
3EUVA 4YDEA 1S64A 1TNZA 1N4SA 1LTXA 4GTSA 3E37A 3E30A 3HXEA 1KZPA 4LNGA 1N4PA 1LD8A 1NI1A 3HXBA 3SFYA 1MZCA 1N4QA 2H6GA 2ZIRA 1DCEA 3PZ4A 4GTRA 1X81A 1QBQA 1TNBA 1TN7A 3HXFA 4L9PA 3Q79A 3KSLA 1N95A 3PZ2A 2IEJA 1FT2A 4YDOA 1O1RA 3DSWA 3E32A 1NL4A 3HXDA 3Q73A 3EU5A 2R2LA 4GTOA 1FT1A 1N94A 3Q78A 1TN6A 1FPPA 4LNBA 2H6FA 1LD7A 1N4RA 3E34A 3KSQA 1N9AA 1JCRA 1JCSA 1SA4A 4GTQA 4MBGA 1D8DA 1S63A 3DSSA 4EHMA 3DPYA 3DSUA 2F0YA 1KZOA 3Q7FA 3SFXA 2BEDA 3Q7AA 4GTVA 1JCQA 2H6IA 3PZ3A 1TNUA 1TN8A 1SA5A 4GTTA 3DRAA 3DSXA 4GTPA 1TNOA 1O1TA 2ZISA 3PZ1A 1D8EA 3DSTA 3Q75A 1O5MA 3HXCA 4GTMA 1O1SA 2H6HA 3C72A 3DSVA 1TNYA 3E33A
chains in the Genus database with same CATH superfamily
4KVMA 4HFGA 4LERA 5EX3A 3TWRA 3E30A 3EHNA 4ACLA 4O1PA 1EF1C 4ANVA 4LG6A 1UOHA 3L16A 4BY6A 1NI1A 4TUMA 1N0RA 5CHEE 2VJ8A 4D10C 4BTBA 2ZIRA 3EU9A 5FIOA 4BSZB 1SQMA 3D9OA 2YNQA 2MYOA 4BT8A 3CHQA 2VGXB 1HFAA 1ZU2A 5JHAA 2LUHA 2Y3AA 3FWVA 3MZLB 4DLQA 1FPPA 2H6FA 2HYZA 3FULA 4L2YA 3TXNA 1SZAA 4ATZD 1H2TC 3C5RA 4KBQA 3SFXA 2DZNA 2XZDG 1Z6TA 1JCQA 3FHEA 1TNOA 2QZAA 4Z68A 1KPSB 4GZDA 2XRYA 2BKKB 3C72A 3RSEG 1MJ0A 2VGXA 3ASFA 2X6IA 1TNZA 2P9UG 1LTXA 4P29A 1WM5A 3FTVA 1D9SA 5ENTD 4B0ZA 2Q7FA 4N5QA 3D9KA 1XGWA 5FQ4A 2MHKA 4BERA 1TN7A 2L0TB 4ZFHA 2QC9A 4L9PA 1IQRA 2NXPA 2VSYA 3SD5A 3IBEA 3FFLA 1Z3XA 3FU6A 2WXHA 5M72A 3PE4A 3D9MA 3G2TA 3LY9A 3PUKA 5C2YA 1V54E 2WVIA 1SW6A 3TWTA 1JCRA 1MX4A 4I9CA 5D2MC 4DI3A 2PL2A 3FDHA 4J8FA 1D8DA 4B89A 1JWFA 2WXOA 4KT6B 3V31A 5AQ7A 3PZDA 3Q47B 4HORA 4U8YD 3L13A 2FEZA 4EECA 1NP7A 2H6IA 2R17C 4GTTA 4GTPA 3TG4A 1OCOE 5KWDA 4K5BA 5KJNA 4AV7A 3S2AA 4RQIA 3C3QA 3HXCA 4GTMA 4GPMA 2OVFA 3CHOA 1DNPA 4I1MA 1TJCA 5A23A 2OEWA 2J08A 2I2OA 3EIQC 4LNGA 1Q2ZA 3ML8A 4F1SA 1Y8MA 4EBAA 2KZTB 4GTRA 3ZYQA 4J8YA 2XCCA 3HXFA 4JZYA 2FO1E 4KZ0A 2VQ2A 2XGOA 4JPSA 3ULYA 4C0MA 5AN8A 4W9RA 4YNDA 5BT1A 3L22A 4I1AA 4BX8A 4DK5A 2LNIA 4RSYA 2I9CA 2KCVA 2VTBB 3UXGA 3Q15A 1TN6A 2F8YA 1S0PA 3QJZA 4I2WA 2WXJA 4WUYA 3B7BA 1YMPA 3GZSA 4MBGA 3U3WA 4J8DA 2ZU6B 2KC7A 2F37A 4JEHA 1S70B 3O48A 3QWPA 4I2ZA 2BEDA 3DXMG 3PZ3A 2IJGX 2KZTA 3LVQE 2LXLA 4XIFA 2B0OE 2IO3C 2ZISA 1Z5SC 3DSTA 4ZHBA 3U4TA 4A63B 3CKBA 2NYJA 5ENRD 1B89A 4GA2A 2GROB 3RRNB 3L82A 3CLJA 2VTBA 2GRNB 5HKPA 1N4PA 5BW8C 3FTUA 3B7RL 3ZRHA 3MV3B 5AYWD 4L1BA 3DEOA 4H7XA 1TNBA 4K03A 3V79K 3CVVA 1GW6A 3C3OA 4KMOA 3NBNB 2AXUA 3MKQB 3FH7A 1HF8A 3FU0A 3F6QA 1H6OA 3NOGD 3CVLA 1SZ9A 1IKND 3UQ3A 3ZHEB 3AG4E 2J9QA 4DJAA 5D0QD 2XEEA 1AWCB 4WAFA 1MHQA 4A55A 4U7EB 2GRPB 4U04A 3R9MA 2MOWA 2XGSA 5CCMA 3Q9UC 4UWFA 4KVOA 4FHJA 4XZ4A 4XX5A 3DPDA 3BU8A 3U64A 3CVXA 3Q4AB 2WXNA 2V5QC 4NACA 4LNUD 3CVWA 1JPLA 2P9KG 4GU5A 2ETBA 3AG3E 3IXEA 1OCRE 3B7UX 3LY8A 4KYOB 1N52A 3MKQA 1O1SA 4J6IA 2IOLA 4WNFA 3EHQA 1N11A 1MYOA 2EILE 2WB2A 4OAVB 2X6KA 3FUFA 3FTYA 3P1UA 3ZHEA 3FUMA 2PQNA 1QZ2A 1N4QA 2J49A 4CZ2D 1IYGA 3LY7A 1DCEA 4YDYA 4LEUA 3SFZA 2XEHA 1QBQA 4DLOA 2IY0C 4K5CA 3CK8A 2UWJG 4BX9A 1AP7A 3HG0D 4N5CA 2XCBA 3G2WA 5AAOA 3IKOB 4U8VD 5FZSA 3LKUA 1H2VC 2YINA 2LSUA 4PS8A 1MX2A 5FT9A 1ELRA 3HIZA 4FJZA 4OVUA 5EX0A 5CBNA 2B6CA 3ZFWA 2UY1B 4HQDA 2XGMA 2XPYA 3DSUA 4JB8P 1H2UA 4I6GA 1KZOA 1FCHA 4G23A 3ASDA 3TWVA 2FI7A 1SVXA 4GZ6A 1E90A 4HRLA 4UWKA 1YCSB 1G3NB 2NSZA 3LS8A 5A7DB 4CT4A 3W9FA 5G2NA 5ENOD 3Q5MA 2BKGA 2FF4A 3LXUX 2KBXA 3SHFA 2DVWA 5EYLA 2XPIA 4DRXE 3HXBA 5BXUA 1MZCA 4I6JA 3SO8A 1TJFA 2UY1A 3JYSA 2DCPA 1BU9A 3CHPA 2X38A 3R7RA 1N95A 3PH0C 2IOSA 2IF4A 4BETA 1FT2A 1O1RA 3OXLA 3HXDA 3Q73A 5E75A 4GCNA 3FUEA 2ZXWE 1N94A 3TJPA 4HS2A 2AXVA 2DZOA 1Y6IA 2IO2C 3ZKJA 4G8KA 4B93B 3PVLA 3ENEA 3RJVA 3ISMC 3Q7FA 3S7DA 2XS1A 3ABKE 1A5EA 3MA5A 5CCLA 1L5JA 3GW4A 2HO1A 4M3OA 1IHBA 3OXGA 4AJWA 1HU3A 5EKQD 2PM7A 2A5EA 4FC8A 4JHRA 4FU3A 4WWPA 4CT0A 4IULA 3RRUA 3TWWA 4AEZC 3FUDA 3GZ2A 3I4RB 1YYHA 2DWZA 3J5QB 3ZPJA 4GTSA 3E37A 2EIME 2WXKA 2C0LA 1H6KA 4RG6A 4QQIA 4RG9A 3G2SA 4RVBA 3FTZA 4FP7A 4TRQA 5LOZA 5BXOA 1EPUA 1NA3A 1RW2A 4DI4A 3PZ2A 4CYMD 4GZ5A 5G05J 4DPRA 4GMJA 2HE0A 2E2EA 4M7CA 4YVOA 3FEXA 4PUCA 1U3CA 3TWQA 2CHXA 2WQHA 3AG1E 1BLXB 3UINC 3BEEA 3GZ1A 4PDXA 3NF1A 4EHMA 1DC2A 1N54A 2I6HA 4GPKA 4XEIG 2RFAA 4PS7A 2I1KA 4JA7A 4GTVA 3NAWA 4Y6CA 2GRMA 5KJKA 2WXGA 2YQ8A 5FZQA 3JCKC 3JUEA 3T9KA 5G05C 3TWSA 1HZ4A 3PZ1A 1YA0A 5G04J 4A1GA 3N71A 3Q75A 4HB5A 4C0EA 1O5MA 3BG0B 3URZA 5ANLA 4X8QA 2J4DA 2AW6A 1E7VA 1TYQG 3FEYA 4Y6WA 2C0MA 2OEVA 3FUNA 4WNEA 5FTPA 4AM9A 4AY5A 4HOTA 5FINA 3DBSA 4TUUA 2H6GA 3WG7E 3MYVA 1UN9A 3ZGQA 4ABNA 5CRUA 4HNAD 5AENA 4DX1A 2HR2A 1VDYA 3Q79A 1QNFA 3IV0A 2GRQB 2GRRB 3RK6A 3CQGB 3SY2A 4MKTA 2P9SG 5G04C 4HOQA 4AIFA 5C1DA 5DBKA 3CVYA 3ABLE 1N0QA 5G55A 3CK9A 5AJDA 4GTOA 2LAIA 4XKBA 2WXIA 3E34A 1N9AA 2WMNA 3CVQA 3QWWA 4JHKA 5AQAA 5CRVA 3D3MA 4BSXA 3L54A 2R59A 2R05A 4G8LA 3UM3A 4JA9A 4JD2G 4AXHA 3EJNA 5E76A 1UJJA 3ZU7B 3ZUVB 2JLBA 1U2VG 1NA0A 5EYPF 5BPPA 5ITZF 4GAAA 1HO8A 2WXFA 4PH4B 2P9IG 4U07A 2OV8A 2EINE 2L6BA 1DVPA 5HS0A 3UI2A 3B95A 2XS8A 2RKKA 3ZVVA 1ZBPA 3CVUA 4UWLA 3ML9A 2Y69E 5JJ6A 2C2LA 2XPZA 3KEAA 1EYHA 3SFYA 3UM0A 3HRAA 2V4LA 4HOUA 5LX8A 4GCOA 5KJLA 3OAWA 5AQ9A 2GRLA 2PM6A 4AY6A 5ENQD 3ZYLA 2IQCA 3ONKA 4FULA 4LNBA 3TGOA 3S7FA 3VLFA 2FBNA 3IEGA 3ZEFA 3AG2E 1U3DA 4GZCA 1SA4A 3T5XA 1S63A 2EQXA 4FLBA 4IYPA 4K5AB 2F0YA 4F1PA 3PS6A 1JUQA 3LJ3A 3QARA 1E96B 2ILRA 3ULQA 2P2CP 4F3VA 4V3IA 1OCCE 4URKA 3QOUA 2XENA 3CSFA 1OWNA 3CQCB 2WXRA 2PQRA 1O1TA 1K1BA 1E8YA 2CHWA 4AP2A 3SNXA 4GMLA 5H7PA 3U9WA 2XHEA 2WM9A 3ESKA 2A4ZA 1BI7B 1TNYA 4BEPA 4ILHB 1KT1A 2DYSE 4G1TA 3PNTB 1FVHA 3CEQA 3NZSA 3OTNA 1KZPA 2I1JA 2ETCA 4CRWA 3CGHA 2CG2A 3P2BA 3B13A 2PNNA 1LF8A 1EDUA 4I6EA 4EZLA 3FH8A 3QAQA 3HHMA 5CBOA 4DUIA 3VTXA 1IHGA 4BFRA 2IEJA 2YHCA 3CKCA 4CGVA 5FQ7A 1NZNA 1N4RA 3UIOC 4BTAA 3MGBA 3ZNGA 2R02A 5EDSA 3PE3A 3CHSA 3PREA 2HM8A 3W9GA 3HDXA 4GB9A 3VTYA 4I17A 4N3CA 4BT9A 2XRZA 3IHYA 3JUIA 1OWOA 4PS3A 3MEKA 2ETAA 5CEAA 1TN8A 1SA5A 4GZ3A 2V4HC 1WY6A 3CVPA 4J8EA 1UG3A 1ZB1A 2DBAA 4J7WA 4ANXA 3MX3A 1S64A 3CIAA 3QB2A 2MRIA 4YVQC 2WPVA 3FUJA 3UT8A 3QNKA 3ASGA 2OCCE 3AS5A 1PC2A 3ABME 3FP3A 4DX7D 5KNHD 1DCQA 2IFUA 4GMRA 1UW4B 1OUVA 3JQ0A 4ANUA 4G2VA 3V2OA 3UTMA 3I5PA 3FUIA 1IXVA 4J0UA 3TL5A 1X5BA 3CVNA 4YDOA 3E32A 1PY1A 2CFZA 4N3AA 5FQ8A 2XEVA 3S7BA 4IRUA 4A1SA 4BESA 3D9LA 2E0IA 1QQEA 4U0ZA 3VLDA 4JEUA 3UMVA 3DPYA 4UWHA 4WWOA 2LSVA 2L0IA 4XE0A 3TWUA 4I9EA 1OY3D 4A3TA 3JXIA 5AARA 5J08A 2Y4TA 4HLLA 3RO3A 3RAUA 4HLEA 2Y1LE 5AJLA 3KAEA 5IY5E 3ZN3A 5JJTA 1MQSA 2GW1A 3ASNE 3DEPA 2F8XK 3AS8A 3FU5A 4YDEA 4EPZA 2JEKA 2WXQA 3B7TA 4APFA 4ILGA 4U0SA 4AVXA 3UX4A 3MKRA 3HXEA 4O1OA 4WNDA 4NIKA 1RZ4A 3EIJA 3G2VA 2NC9A 1OXJA 4F7AA 4HI9A 3D9IA 4HXIA 2WQ7A 5ARFA 3V2XA 4TXQA 3ASOE 2VYIA 3QDNA 1BI8B 2P58C 3RKVA 3NQPA 4OYSA 2P9LG 1OWPA 2RD0A 3FUKA 3L9TA 1UN8A 3FU3A 2X6FA 4UQXA 2JABA 3PNLB 2EIJE 3FTWA 3RO2A 1H0AA 4CDNA 4NURA 2ONDA 4UI9J 2KCKA 3FTSA 4GTQA 1WG0A 2ZGDA 2CG3A 3JXJA 4N3BA 2IU1A 3PRZA 4G11A 4CDRA 4ACKA 2WXPA 3ZYKA 2QYJA 4GA1A 3VLEA 4J8SA 4ANWA 3Q7AA 3L08A 2IONA 2RFMA 4UQYA 5T8IA 1E7UA 4B94A 3DSXA 4O60A 3T8MA 1BD8A 3UT7A 3L6AA 2OVBA 3K9IA 3LVRE 4CDMA 2L6JA 3SF4A 1OT8A 1W3BA 3LCAA 3UIPC 4I1OB 2R5SA 4U95D 3R9AB 5LP0A 5FQ6A 2X3MA 1N4SA 4GA0A 2CHZA 4UI9C 2X6HA 5ANRA 4EZJA 5JHBA 3APCA 5ARGA 4CCAA 3QWVA 3AAAC 3UT4A 1WDYA 2V8SE 3SBTB 3PZ4A 4U63A 2J07A 3LPZA 3BUAA 2LAHA 4C9BB 2Y4UA 2KCLA 4WWNA 3ESLA 2AWIA 1KT0A 4JHJA 3CR3A 4LRZA 3SZ7A 3D9PA 1H6PA 3L17A 4UI9K 2BUGA 3S7JA 3E4BA 4QFVA 5A6CA 2R2LA 3TAXA 5ENSD 3DWLG 3CK7A 3MJWA 5DIZA 2WQ6A 2R03A 3HVEB 2AXZA 5BNWA 1JCSA 2VSNA 4JVSA 4CEMA 3CHRA 4R7LA 3NB2A 3DXKG 1Z3YA 4ATGA 4FHKA 4NRHB 4EZKA 1JWGA 4HBDA 3UPVA 1V55E 4XKCA 1XNFA 2J4BA 3DRAA 3KD7A 2QY7A 5J90A 1HG5A 3FTXA 1D8EA 1UJKA 4LSZE 3PDNA 3UM2A 1MX6A 5FWQA 2Y0BG 3CHMA 3LEWA 1TR4A 3E33A 4UWGA 5LCWJ 3FY4A 5BV1A 5T3RA 2VSXE 3AU5A 2VGYA 5JMND 1ELKA 4F6RD 4NQ0A 3ONLA 4L23A 3HVEA 1INZA 3I4GA 4XI0A 4TV3A 3ULEG 3D9NA 3KSLA 3SGHA 1FVFA 3APFA 4U0UA 3T5VA 2P9PG 5KCMA 4HRNA 4Q69A 2A5UA 3EU5A 4MRUA 5FZRA 4LUNU 2GGFA 1PAQA 5LCWC 4KZCA 3Q78A 1HXIA 4F53A 3EDTB 5B1BE 2L9BA 3PEVB 4JC8A 5FJYA 2LXMA 3B7SA 4HRMB 3WXXA 3TXMA 1P5QA 3CSTA 3FH5A 3LJNA 5JJ7A 2WXMA 3FUHA 4HOSA 2DYRE 4G26A 3BG1B 4IN3B 3KEZA 5AQBA 3SQVA 3ZIMA 3Q49B 4APOA 3NZUA 5CERB 2XZTG 1ELWA 3RIBA 2FULA 4RLYA 3ZYMA 3UKRG 3TWXA 4DX5D 2M63A 1K3ZD 4N39A 3Q9NC 1OCZE 3DSVA 5ENPD 2VSOE 5CMWA 2KM4A 4GYWA 1H19A 1WAO1 5KNGA 2YHEA 2XQ0A 2VGEA 1K1AA 2V0PA 4G24A 4MLPA 1HS6A 3AU4A 4JL0A 4OVVA 2ZGGA 3QKYA 3QC1A 3LYAA 1BPOA 5B1AE 3SBSA 4ME2A 4N2QA 3I3NA 4O6FA 3PUJA 4JW1A 3EHRA 2P9NG 3IHVA 4FA6A 3DSWA 2CFUA 3CV0A 1FT1A 5ENNA 4HI8A 3G2UA 4FLHA 5EILA 1OWMA 3O4ZA 3KSQA 5CEDB 4UQZA 2BF0X 3C3RA 3UUXA 2EIKE 3T8KA 4EQFA 1HX8A 2QFCA 4G25A 3OXFA 1E8XA 3RRMB 3ZXPA 5LFAA 5BV0A 3X2QE 1HE8A 3ASHA 4I43A 3APDA 4ILIA 3UM1A 5HI7A 1TNUA 4B8AA 4K0RA 4U8HA 4DX2A 3J5PA 4LCTA 3D9HA 3AJIA 4AOFA 4OAUC 1IQUA 2DIWA 3R7QA 2H6HA 4WNGA 5HRYA 5CECB 2BTDA 3EUVA 2AVPA 5CMYA 4E85A 4A3VA 3PEUB 4GYYA 1HH8A 2V5FA 2LO6A 4BWRA 1LD8A 5JA4D 5AIJA 2J8SD 5B3SE 1X81A 2KATA 5T4YA 4Q96A 4TXRA 3AS4A 2RG8A 2OOEA 1KLXA 4UUCA 3C98A 3GYZA 4FADA 4CGWA 3ZW3A 2QYUA 1TEZA 4GYOA 3EHMA 4Q94A 4H7YA 4FJYA 1NL4A 3BQOA 4KXKB 4TXPA 3TG5A 2KXPC 5EIDA 2J09A 2X6JA 1LD7A 3JQ1A 4YDWA 2WXLA 3MV2B 3KS2A 3SI5A 3DSSA 4DX6D 1NFIE 1E8WA 1A17A 4MS6A 5EIBE 1E8ZA 4EBAG 5BUZA 3RU0A 5KJMA 5D66A 4L7TA 2WMOA 3UKUG 3MCXA 3NOCD 1HG2A 4L2LA 3QK0A 3D9JA 4U96D 5EN5D 3ZXSA 1QYMA 2PZIA 4HVBA 3U66A 4N2SA 5HQ8A 4JXTA 4E6HA 3LDZA 4XI9A 5KBAA 2FO7A 3V30A 4C48B 2AJAA 5D0OD 1K8KG 4B8CB 1OWLA 3HYMB
chains in the Genus database with same CATH topology
3EUVA 4YDEA 1S64A 1TNZA 1N4SA 1LTXA 4GTSA 3E37A 3E30A 3HXEA 1KZPA 4LNGA 1N4PA 1LD8A 1NI1A 3HXBA 3SFYA 1MZCA 1N4QA 2H6GA 2ZIRA 1DCEA 3PZ4A 4GTRA 1X81A 1QBQA 1TNBA 1TN7A 3HXFA 4L9PA 3Q79A 3KSLA 1N95A 3PZ2A 2IEJA 1FT2A 4YDOA 1O1RA 3DSWA 3E32A 1NL4A 3HXDA 3Q73A 3EU5A 2R2LA 4GTOA 1FT1A 1N94A 3Q78A 1TN6A 1FPPA 4LNBA 2H6FA 1LD7A 1N4RA 3E34A 3KSQA 1N9AA 1JCRA 1JCSA 1SA4A 4GTQA 4MBGA 1D8DA 1S63A 3DSSA 4EHMA 3DPYA 3DSUA 2F0YA 1KZOA 3Q7FA 3SFXA 2BEDA 3Q7AA 4GTVA 1JCQA 2H6IA 3PZ3A 1TNUA 1TN8A 1SA5A 4GTTA 3DRAA 3DSXA 4GTPA 1TNOA 1O1TA 2ZISA 3PZ1A 1D8EA 3DSTA 3Q75A 1O5MA 3HXCA 4GTMA 1O1SA 2H6HA 3C72A 3DSVA 1TNYA 3E33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EUV A;  4YDE A;  1S64 A;  1TNZ A;  1N4S A;  1LTX A;  4GTS A;  3E37 A;  3E30 A;  3HXE A;  1KZP A;  4LNG A;  1N4P A;  1LD8 A;  1NI1 A;  3HXB A;  3SFY A;  1MZC A;  1N4Q A;  2H6G A;  2ZIR A;  1DCE A;  3PZ4 A;  4GTR A;  1X81 A;  1QBQ A;  1TNB A;  1TN7 A;  3HXF A;  4L9P A;  3Q79 A;  3KSL A;  1N95 A;  3PZ2 A;  2IEJ A;  1FT2 A;  4YDO A;  1O1R A;  3DSW A;  3E32 A;  1NL4 A;  3HXD A;  3Q73 A;  3EU5 A;  2R2L A;  4GTO A;  1FT1 A;  1N94 A;  3Q78 A;  1TN6 A;  1FPP A;  4LNB A;  2H6F A;  1LD7 A;  1N4R A;  3E34 A;  3KSQ A;  1N9A A;  1JCR A;  1JCS A;  1SA4 A;  4GTQ A;  4MBG A;  1D8D A;  1S63 A;  3DSS A;  4EHM A;  3DPY A;  3DSU A;  2F0Y A;  1KZO A;  3Q7F A;  3SFX A;  2BED A;  3Q7A A;  4GTV A;  1JCQ A;  2H6I A;  3PZ3 A;  1TNU A;  1TN8 A;  1SA5 A;  4GTT A;  3DRA A;  3DSX A;  4GTP A;  1TNO A;  1O1T A;  2ZIS A;  3PZ1 A;  1D8E A;  3DST A;  3Q75 A;  1O5M A;  3HXC A;  4GTM A;  1O1S A;  2H6H A;  3C72 A;  3DSV A;  1TNY A;  3E33 A; 
#chains in the Genus database with same CATH topology
 4KVM A;  4HFG A;  4LER A;  5EX3 A;  3TWR A;  3E30 A;  3EHN A;  4ACL A;  4O1P A;  1EF1 C;  4ANV A;  4LG6 A;  1UOH A;  3L16 A;  4BY6 A;  1NI1 A;  4TUM A;  1N0R A;  5CHE E;  2VJ8 A;  4D10 C;  4BTB A;  2ZIR A;  3EU9 A;  5FIO A;  4BSZ B;  1SQM A;  3D9O A;  2YNQ A;  2MYO A;  4BT8 A;  3CHQ A;  2VGX B;  1HFA A;  1ZU2 A;  5JHA A;  2LUH A;  2Y3A A;  3FWV A;  3MZL B;  4DLQ A;  1FPP A;  2H6F A;  2HYZ A;  3FUL A;  4L2Y A;  3TXN A;  1SZA A;  4ATZ D;  1H2T C;  3C5R A;  4KBQ A;  3SFX A;  2DZN A;  2XZD G;  1Z6T A;  1JCQ A;  3FHE A;  1TNO A;  2QZA A;  4Z68 A;  1KPS B;  4GZD A;  2XRY A;  2BKK B;  3C72 A;  3RSE G;  1MJ0 A;  2VGX A;  3ASF A;  2X6I A;  1TNZ A;  2P9U G;  1LTX A;  4P29 A;  1WM5 A;  3FTV A;  1D9S A;  5ENT D;  4B0Z A;  2Q7F A;  4N5Q A;  3D9K A;  1XGW A;  5FQ4 A;  2MHK A;  4BER A;  1TN7 A;  2L0T B;  4ZFH A;  2QC9 A;  4L9P A;  1IQR A;  2NXP A;  2VSY A;  3SD5 A;  3IBE A;  3FFL A;  1Z3X A;  3FU6 A;  2WXH A;  5M72 A;  3PE4 A;  3D9M A;  3G2T A;  3LY9 A;  3PUK A;  5C2Y A;  1V54 E;  2WVI A;  1SW6 A;  3TWT A;  1JCR A;  1MX4 A;  4I9C A;  5D2M C;  4DI3 A;  2PL2 A;  3FDH A;  4J8F A;  1D8D A;  4B89 A;  1JWF A;  2WXO A;  4KT6 B;  3V31 A;  5AQ7 A;  3PZD A;  3Q47 B;  4HOR A;  4U8Y D;  3L13 A;  2FEZ A;  4EEC A;  1NP7 A;  2H6I A;  2R17 C;  4GTT A;  4GTP A;  3TG4 A;  1OCO E;  5KWD A;  4K5B A;  5KJN A;  4AV7 A;  3S2A A;  4RQI A;  3C3Q A;  3HXC A;  4GTM A;  4GPM A;  2OVF A;  3CHO A;  1DNP A;  4I1M A;  1TJC A;  5A23 A;  2OEW A;  2J08 A;  2I2O A;  3EIQ C;  4LNG A;  1Q2Z A;  3ML8 A;  4F1S A;  1Y8M A;  4EBA A;  2KZT B;  4GTR A;  3ZYQ A;  4J8Y A;  2XCC A;  3HXF A;  4JZY A;  2FO1 E;  4KZ0 A;  2VQ2 A;  2XGO A;  4JPS A;  3ULY A;  4C0M A;  5AN8 A;  4W9R A;  4YND A;  5BT1 A;  3L22 A;  4I1A A;  4BX8 A;  4DK5 A;  2LNI A;  4RSY A;  2I9C A;  2KCV A;  2VTB B;  3UXG A;  3Q15 A;  1TN6 A;  2F8Y A;  1S0P A;  3QJZ A;  4I2W A;  2WXJ A;  4WUY A;  3B7B A;  1YMP A;  3GZS A;  4MBG A;  3U3W A;  4J8D A;  2ZU6 B;  2KC7 A;  2F37 A;  4JEH A;  1S70 B;  3O48 A;  3QWP A;  4I2Z A;  2BED A;  3DXM G;  3PZ3 A;  2IJG X;  2KZT A;  3LVQ E;  2LXL A;  4XIF A;  2B0O E;  2IO3 C;  2ZIS A;  1Z5S C;  3DST A;  4ZHB A;  3U4T A;  4A63 B;  3CKB A;  2NYJ A;  5ENR D;  1B89 A;  4GA2 A;  2GRO B;  3RRN B;  3L82 A;  3CLJ A;  2VTB A;  2GRN B;  5HKP A;  1N4P A;  5BW8 C;  3FTU A;  3B7R L;  3ZRH A;  3MV3 B;  5AYW D;  4L1B A;  3DEO A;  4H7X A;  1TNB A;  4K03 A;  3V79 K;  3CVV A;  1GW6 A;  3C3O A;  4KMO A;  3NBN B;  2AXU A;  3MKQ B;  3FH7 A;  1HF8 A;  3FU0 A;  3F6Q A;  1H6O A;  3NOG D;  3CVL A;  1SZ9 A;  1IKN D;  3UQ3 A;  3ZHE B;  3AG4 E;  2J9Q A;  4DJA A;  5D0Q D;  2XEE A;  1AWC B;  4WAF A;  1MHQ A;  4A55 A;  4U7E B;  2GRP B;  4U04 A;  3R9M A;  2MOW A;  2XGS A;  5CCM A;  3Q9U C;  4UWF A;  4KVO A;  4FHJ A;  4XZ4 A;  4XX5 A;  3DPD A;  3BU8 A;  3U64 A;  3CVX A;  3Q4A B;  2WXN A;  2V5Q C;  4NAC A;  4LNU D;  3CVW A;  1JPL A;  2P9K G;  4GU5 A;  2ETB A;  3AG3 E;  3IXE A;  1OCR E;  3B7U X;  3LY8 A;  4KYO B;  1N52 A;  3MKQ A;  1O1S A;  4J6I A;  2IOL A;  4WNF A;  3EHQ A;  1N11 A;  1MYO A;  2EIL E;  2WB2 A;  4OAV B;  2X6K A;  3FUF A;  3FTY A;  3P1U A;  3ZHE A;  3FUM A;  2PQN A;  1QZ2 A;  1N4Q A;  2J49 A;  4CZ2 D;  1IYG A;  3LY7 A;  1DCE A;  4YDY A;  4LEU A;  3SFZ A;  2XEH A;  1QBQ A;  4DLO A;  2IY0 C;  4K5C A;  3CK8 A;  2UWJ G;  4BX9 A;  1AP7 A;  3HG0 D;  4N5C A;  2XCB A;  3G2W A;  5AAO A;  3IKO B;  4U8V D;  5FZS A;  3LKU A;  1H2V C;  2YIN A;  2LSU A;  4PS8 A;  1MX2 A;  5FT9 A;  1ELR A;  3HIZ A;  4FJZ A;  4OVU A;  5EX0 A;  5CBN A;  2B6C A;  3ZFW A;  2UY1 B;  4HQD A;  2XGM A;  2XPY A;  3DSU A;  4JB8 P;  1H2U A;  4I6G A;  1KZO A;  1FCH A;  4G23 A;  3ASD A;  3TWV A;  2FI7 A;  1SVX A;  4GZ6 A;  1E90 A;  4HRL A;  4UWK A;  1YCS B;  1G3N B;  2NSZ A;  3LS8 A;  5A7D B;  4CT4 A;  3W9F A;  5G2N A;  5ENO D;  3Q5M A;  2BKG A;  2FF4 A;  3LXU X;  2KBX A;  3SHF A;  2DVW A;  5EYL A;  2XPI A;  4DRX E;  3HXB A;  5BXU A;  1MZC A;  4I6J A;  3SO8 A;  1TJF A;  2UY1 A;  3JYS A;  2DCP A;  1BU9 A;  3CHP A;  2X38 A;  3R7R A;  1N95 A;  3PH0 C;  2IOS A;  2IF4 A;  4BET A;  1FT2 A;  1O1R A;  3OXL A;  3HXD A;  3Q73 A;  5E75 A;  4GCN A;  3FUE A;  2ZXW E;  1N94 A;  3TJP A;  4HS2 A;  2AXV A;  2DZO A;  1Y6I A;  2IO2 C;  3ZKJ A;  4G8K A;  4B93 B;  3PVL A;  3ENE A;  3RJV A;  3ISM C;  3Q7F A;  3S7D A;  2XS1 A;  3ABK E;  1A5E A;  3MA5 A;  5CCL A;  1L5J A;  3GW4 A;  2HO1 A;  4M3O A;  1IHB A;  3OXG A;  4AJW A;  1HU3 A;  5EKQ D;  2PM7 A;  2A5E A;  4FC8 A;  4JHR A;  4FU3 A;  4WWP A;  4CT0 A;  4IUL A;  3RRU A;  3TWW A;  4AEZ C;  3FUD A;  3GZ2 A;  3I4R B;  1YYH A;  2DWZ A;  3J5Q B;  3ZPJ A;  4GTS A;  3E37 A;  2EIM E;  2WXK A;  2C0L A;  1H6K A;  4RG6 A;  4QQI A;  4RG9 A;  3G2S A;  4RVB A;  3FTZ A;  4FP7 A;  4TRQ A;  5LOZ A;  5BXO A;  1EPU A;  1NA3 A;  1RW2 A;  4DI4 A;  3PZ2 A;  4CYM D;  4GZ5 A;  5G05 J;  4DPR A;  4GMJ A;  2HE0 A;  2E2E A;  4M7C A;  4YVO A;  3FEX A;  4PUC A;  1U3C A;  3TWQ A;  2CHX A;  2WQH A;  3AG1 E;  1BLX B;  3UIN C;  3BEE A;  3GZ1 A;  4PDX A;  3NF1 A;  4EHM A;  1DC2 A;  1N54 A;  2I6H A;  4GPK A;  4XEI G;  2RFA A;  4PS7 A;  2I1K A;  4JA7 A;  4GTV A;  3NAW A;  4Y6C A;  2GRM A;  5KJK A;  2WXG A;  2YQ8 A;  5FZQ A;  3JCK C;  3JUE A;  3T9K A;  5G05 C;  3TWS A;  1HZ4 A;  3PZ1 A;  1YA0 A;  5G04 J;  4A1G A;  3N71 A;  3Q75 A;  4HB5 A;  4C0E A;  1O5M A;  3BG0 B;  3URZ A;  5ANL A;  4X8Q A;  2J4D A;  2AW6 A;  1E7V A;  1TYQ G;  3FEY A;  4Y6W A;  2C0M A;  2OEV A;  3FUN A;  4WNE A;  5FTP A;  4AM9 A;  4AY5 A;  4HOT A;  5FIN A;  3DBS A;  4TUU A;  2H6G A;  3WG7 E;  3MYV A;  1UN9 A;  3ZGQ A;  4ABN A;  5CRU A;  4HNA D;  5AEN A;  4DX1 A;  2HR2 A;  1VDY A;  3Q79 A;  1QNF A;  3IV0 A;  2GRQ B;  2GRR B;  3RK6 A;  3CQG B;  3SY2 A;  4MKT A;  2P9S G;  5G04 C;  4HOQ A;  4AIF A;  5C1D A;  5DBK A;  3CVY A;  3ABL E;  1N0Q A;  5G55 A;  3CK9 A;  5AJD A;  4GTO A;  2LAI A;  4XKB A;  2WXI A;  3E34 A;  1N9A A;  2WMN A;  3CVQ A;  3QWW A;  4JHK A;  5AQA A;  5CRV A;  3D3M A;  4BSX A;  3L54 A;  2R59 A;  2R05 A;  4G8L A;  3UM3 A;  4JA9 A;  4JD2 G;  4AXH A;  3EJN A;  5E76 A;  1UJJ A;  3ZU7 B;  3ZUV B;  2JLB A;  1U2V G;  1NA0 A;  5EYP F;  5BPP A;  5ITZ F;  4GAA A;  1HO8 A;  2WXF A;  4PH4 B;  2P9I G;  4U07 A;  2OV8 A;  2EIN E;  2L6B A;  1DVP A;  5HS0 A;  3UI2 A;  3B95 A;  2XS8 A;  2RKK A;  3ZVV A;  1ZBP A;  3CVU A;  4UWL A;  3ML9 A;  2Y69 E;  5JJ6 A;  2C2L A;  2XPZ A;  3KEA A;  1EYH A;  3SFY A;  3UM0 A;  3HRA A;  2V4L A;  4HOU A;  5LX8 A;  4GCO A;  5KJL A;  3OAW A;  5AQ9 A;  2GRL A;  2PM6 A;  4AY6 A;  5ENQ D;  3ZYL A;  2IQC A;  3ONK A;  4FUL A;  4LNB A;  3TGO A;  3S7F A;  3VLF A;  2FBN A;  3IEG A;  3ZEF A;  3AG2 E;  1U3D A;  4GZC A;  1SA4 A;  3T5X A;  1S63 A;  2EQX A;  4FLB A;  4IYP A;  4K5A B;  2F0Y A;  4F1P A;  3PS6 A;  1JUQ A;  3LJ3 A;  3QAR A;  1E96 B;  2ILR A;  3ULQ A;  2P2C P;  4F3V A;  4V3I A;  1OCC E;  4URK A;  3QOU A;  2XEN A;  3CSF A;  1OWN A;  3CQC B;  2WXR A;  2PQR A;  1O1T A;  1K1B A;  1E8Y A;  2CHW A;  4AP2 A;  3SNX A;  4GML A;  5H7P A;  3U9W A;  2XHE A;  2WM9 A;  3ESK A;  2A4Z A;  1BI7 B;  1TNY A;  4BEP A;  4ILH B;  1KT1 A;  2DYS E;  4G1T A;  3PNT B;  1FVH A;  3CEQ A;  3NZS A;  3OTN A;  1KZP A;  2I1J A;  2ETC A;  4CRW A;  3CGH A;  2CG2 A;  3P2B A;  3B13 A;  2PNN A;  1LF8 A;  1EDU A;  4I6E A;  4EZL A;  3FH8 A;  3QAQ A;  3HHM A;  5CBO A;  4DUI A;  3VTX A;  1IHG A;  4BFR A;  2IEJ A;  2YHC A;  3CKC A;  4CGV A;  5FQ7 A;  1NZN A;  1N4R A;  3UIO C;  4BTA A;  3MGB A;  3ZNG A;  2R02 A;  5EDS A;  3PE3 A;  3CHS A;  3PRE A;  2HM8 A;  3W9G A;  3HDX A;  4GB9 A;  3VTY A;  4I17 A;  4N3C A;  4BT9 A;  2XRZ A;  3IHY A;  3JUI A;  1OWO A;  4PS3 A;  3MEK A;  2ETA A;  5CEA A;  1TN8 A;  1SA5 A;  4GZ3 A;  2V4H C;  1WY6 A;  3CVP A;  4J8E A;  1UG3 A;  1ZB1 A;  2DBA A;  4J7W A;  4ANX A;  3MX3 A;  1S64 A;  3CIA A;  3QB2 A;  2MRI A;  4YVQ C;  2WPV A;  3FUJ A;  3UT8 A;  3QNK A;  3ASG A;  2OCC E;  3AS5 A;  1PC2 A;  3ABM E;  3FP3 A;  4DX7 D;  5KNH D;  1DCQ A;  2IFU A;  4GMR A;  1UW4 B;  1OUV A;  3JQ0 A;  4ANU A;  4G2V A;  3V2O A;  3UTM A;  3I5P A;  3FUI A;  1IXV A;  4J0U A;  3TL5 A;  1X5B A;  3CVN A;  4YDO A;  3E32 A;  1PY1 A;  2CFZ A;  4N3A A;  5FQ8 A;  2XEV A;  3S7B A;  4IRU A;  4A1S A;  4BES A;  3D9L A;  2E0I A;  1QQE A;  4U0Z A;  3VLD A;  4JEU A;  3UMV A;  3DPY A;  4UWH A;  4WWO A;  2LSV A;  2L0I A;  4XE0 A;  3TWU A;  4I9E A;  1OY3 D;  4A3T A;  3JXI A;  5AAR A;  5J08 A;  2Y4T A;  4HLL A;  3RO3 A;  3RAU A;  4HLE A;  2Y1L E;  5AJL A;  3KAE A;  5IY5 E;  3ZN3 A;  5JJT A;  1MQS A;  2GW1 A;  3ASN E;  3DEP A;  2F8X K;  3AS8 A;  3FU5 A;  4YDE A;  4EPZ A;  2JEK A;  2WXQ A;  3B7T A;  4APF A;  4ILG A;  4U0S A;  4AVX A;  3UX4 A;  3MKR A;  3HXE A;  4O1O A;  4WND A;  4NIK A;  1RZ4 A;  3EIJ A;  3G2V A;  2NC9 A;  1OXJ A;  4F7A A;  4HI9 A;  3D9I A;  4HXI A;  2WQ7 A;  5ARF A;  3V2X A;  4TXQ A;  3ASO E;  2VYI A;  3QDN A;  1BI8 B;  2P58 C;  3RKV A;  3NQP A;  4OYS A;  2P9L G;  1OWP A;  2RD0 A;  3FUK A;  3L9T A;  1UN8 A;  3FU3 A;  2X6F A;  4UQX A;  2JAB A;  3PNL B;  2EIJ E;  3FTW A;  3RO2 A;  1H0A A;  4CDN A;  4NUR A;  2OND A;  4UI9 J;  2KCK A;  3FTS A;  4GTQ A;  1WG0 A;  2ZGD A;  2CG3 A;  3JXJ A;  4N3B A;  2IU1 A;  3PRZ A;  4G11 A;  4CDR A;  4ACK A;  2WXP A;  3ZYK A;  2QYJ A;  4GA1 A;  3VLE A;  4J8S A;  4ANW A;  3Q7A A;  3L08 A;  2ION A;  2RFM A;  4UQY A;  5T8I A;  1E7U A;  4B94 A;  3DSX A;  4O60 A;  3T8M A;  1BD8 A;  3UT7 A;  3L6A A;  2OVB A;  3K9I A;  3LVR E;  4CDM A;  2L6J A;  3SF4 A;  1OT8 A;  1W3B A;  3LCA A;  3UIP C;  4I1O B;  2R5S A;  4U95 D;  3R9A B;  5LP0 A;  5FQ6 A;  2X3M A;  1N4S A;  4GA0 A;  2CHZ A;  4UI9 C;  2X6H A;  5ANR A;  4EZJ A;  5JHB A;  3APC A;  5ARG A;  4CCA A;  3QWV A;  3AAA C;  3UT4 A;  1WDY A;  2V8S E;  3SBT B;  3PZ4 A;  4U63 A;  2J07 A;  3LPZ A;  3BUA A;  2LAH A;  4C9B B;  2Y4U A;  2KCL A;  4WWN A;  3ESL A;  2AWI A;  1KT0 A;  4JHJ A;  3CR3 A;  4LRZ A;  3SZ7 A;  3D9P A;  1H6P A;  3L17 A;  4UI9 K;  2BUG A;  3S7J A;  3E4B A;  4QFV A;  5A6C A;  2R2L A;  3TAX A;  5ENS D;  3DWL G;  3CK7 A;  3MJW A;  5DIZ A;  2WQ6 A;  2R03 A;  3HVE B;  2AXZ A;  5BNW A;  1JCS A;  2VSN A;  4JVS A;  4CEM A;  3CHR A;  4R7L A;  3NB2 A;  3DXK G;  1Z3Y A;  4ATG A;  4FHK A;  4NRH B;  4EZK A;  1JWG A;  4HBD A;  3UPV A;  1V55 E;  4XKC A;  1XNF A;  2J4B A;  3DRA A;  3KD7 A;  2QY7 A;  5J90 A;  1HG5 A;  3FTX A;  1D8E A;  1UJK A;  4LSZ E;  3PDN A;  3UM2 A;  1MX6 A;  5FWQ A;  2Y0B G;  3CHM A;  3LEW A;  1TR4 A;  3E33 A;  4UWG A;  5LCW J;  3FY4 A;  5BV1 A;  5T3R A;  2VSX E;  3AU5 A;  2VGY A;  5JMN D;  1ELK A;  4F6R D;  4NQ0 A;  3ONL A;  4L23 A;  3HVE A;  1INZ A;  3I4G A;  4XI0 A;  4TV3 A;  3ULE G;  3D9N A;  3KSL A;  3SGH A;  1FVF A;  3APF A;  4U0U A;  3T5V A;  2P9P G;  5KCM A;  4HRN A;  4Q69 A;  2A5U A;  3EU5 A;  4MRU A;  5FZR A;  4LUN U;  2GGF A;  1PAQ A;  5LCW C;  4KZC A;  3Q78 A;  1HXI A;  4F53 A;  3EDT B;  5B1B E;  2L9B A;  3PEV B;  4JC8 A;  5FJY A;  2LXM A;  3B7S A;  4HRM B;  3WXX A;  3TXM A;  1P5Q A;  3CST A;  3FH5 A;  3LJN A;  5JJ7 A;  2WXM A;  3FUH A;  4HOS A;  2DYR E;  4G26 A;  3BG1 B;  4IN3 B;  3KEZ A;  5AQB A;  3SQV A;  3ZIM A;  3Q49 B;  4APO A;  3NZU A;  5CER B;  2XZT G;  1ELW A;  3RIB A;  2FUL A;  4RLY A;  3ZYM A;  3UKR G;  3TWX A;  4DX5 D;  2M63 A;  1K3Z D;  4N39 A;  3Q9N C;  1OCZ E;  3DSV A;  5ENP D;  2VSO E;  5CMW A;  2KM4 A;  4GYW A;  1H19 A;  1WAO 1;  5KNG A;  2YHE A;  2XQ0 A;  2VGE A;  1K1A A;  2V0P A;  4G24 A;  4MLP A;  1HS6 A;  3AU4 A;  4JL0 A;  4OVV A;  2ZGG A;  3QKY A;  3QC1 A;  3LYA A;  1BPO A;  5B1A E;  3SBS A;  4ME2 A;  4N2Q A;  3I3N A;  4O6F A;  3PUJ A;  4JW1 A;  3EHR A;  2P9N G;  3IHV A;  4FA6 A;  3DSW A;  2CFU A;  3CV0 A;  1FT1 A;  5ENN A;  4HI8 A;  3G2U A;  4FLH A;  5EIL A;  1OWM A;  3O4Z A;  3KSQ A;  5CED B;  4UQZ A;  2BF0 X;  3C3R A;  3UUX A;  2EIK E;  3T8K A;  4EQF A;  1HX8 A;  2QFC A;  4G25 A;  3OXF A;  1E8X A;  3RRM B;  3ZXP A;  5LFA A;  5BV0 A;  3X2Q E;  1HE8 A;  3ASH A;  4I43 A;  3APD A;  4ILI A;  3UM1 A;  5HI7 A;  1TNU A;  4B8A A;  4K0R A;  4U8H A;  4DX2 A;  3J5P A;  4LCT A;  3D9H A;  3AJI A;  4AOF A;  4OAU C;  1IQU A;  2DIW A;  3R7Q A;  2H6H A;  4WNG A;  5HRY A;  5CEC B;  2BTD A;  3EUV A;  2AVP A;  5CMY A;  4E85 A;  4A3V A;  3PEU B;  4GYY A;  1HH8 A;  2V5F A;  2LO6 A;  4BWR A;  1LD8 A;  5JA4 D;  5AIJ A;  2J8S D;  5B3S E;  1X81 A;  2KAT A;  5T4Y A;  4Q96 A;  4TXR A;  3AS4 A;  2RG8 A;  2OOE A;  1KLX A;  4UUC A;  3C98 A;  3GYZ A;  4FAD A;  4CGW A;  3ZW3 A;  2QYU A;  1TEZ A;  4GYO A;  3EHM A;  4Q94 A;  4H7Y A;  4FJY A;  1NL4 A;  3BQO A;  4KXK B;  4TXP A;  3TG5 A;  2KXP C;  5EID A;  2J09 A;  2X6J A;  1LD7 A;  3JQ1 A;  4YDW A;  2WXL A;  3MV2 B;  3KS2 A;  3SI5 A;  3DSS A;  4DX6 D;  1NFI E;  1E8W A;  1A17 A;  4MS6 A;  5EIB E;  1E8Z A;  4EBA G;  5BUZ A;  3RU0 A;  5KJM A;  5D66 A;  4L7T A;  2WMO A;  3UKU G;  3MCX A;  3NOC D;  1HG2 A;  4L2L A;  3QK0 A;  3D9J A;  4U96 D;  5EN5 D;  3ZXS A;  1QYM A;  2PZI A;  4HVB A;  3U66 A;  4N2S A;  5HQ8 A;  4JXT A;  4E6H A;  3LDZ A;  4XI9 A;  5KBA A;  2FO7 A;  3V30 A;  4C48 B;  2AJA A;  5D0O D;  1K8K G;  4B8C B;  1OWL A;  3HYM B; 
#chains in the Genus database with same CATH homology
 3EUV A;  4YDE A;  1S64 A;  1TNZ A;  1N4S A;  1LTX A;  4GTS A;  3E37 A;  3E30 A;  3HXE A;  1KZP A;  4LNG A;  1N4P A;  1LD8 A;  1NI1 A;  3HXB A;  3SFY A;  1MZC A;  1N4Q A;  2H6G A;  2ZIR A;  1DCE A;  3PZ4 A;  4GTR A;  1X81 A;  1QBQ A;  1TNB A;  1TN7 A;  3HXF A;  4L9P A;  3Q79 A;  3KSL A;  1N95 A;  3PZ2 A;  2IEJ A;  1FT2 A;  4YDO A;  1O1R A;  3DSW A;  3E32 A;  1NL4 A;  3HXD A;  3Q73 A;  3EU5 A;  2R2L A;  4GTO A;  1FT1 A;  1N94 A;  3Q78 A;  1TN6 A;  1FPP A;  4LNB A;  2H6F A;  1LD7 A;  1N4R A;  3E34 A;  3KSQ A;  1N9A A;  1JCR A;  1JCS A;  1SA4 A;  4GTQ A;  4MBG A;  1D8D A;  1S63 A;  3DSS A;  4EHM A;  3DPY A;  3DSU A;  2F0Y A;  1KZO A;  3Q7F A;  3SFX A;  2BED A;  3Q7A A;  4GTV A;  1JCQ A;  2H6I A;  3PZ3 A;  1TNU A;  1TN8 A;  1SA5 A;  4GTT A;  3DRA A;  3DSX A;  4GTP A;  1TNO A;  1O1T A;  2ZIS A;  3PZ1 A;  1D8E A;  3DST A;  3Q75 A;  1O5M A;  3HXC A;  4GTM A;  1O1S A;  2H6H A;  3C72 A;  3DSV A;  1TNY A;  3E33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...