1TNBA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a substrate kksktkcvif peptide derived from tc21
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords geranylgeranyltransferase type I alpha subunit
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 122
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnbA00
2H6IA 2F0YA 3EUVA 1D8EA 1TNZA 1JCQA 3C72A 1NI1A 3EU5A 1N4PA 1N4QA 1SA4A 1JCSA 1N4RA 1S63A 3PZ4A 1LTXA 4MBGA 1TN6A 1FPPA 4EHMA 3KSLA 2BEDA 1LD7A 4YDOA 1N4SA 4YDEA 3HXEA 1QBQA 3Q7FA 3E33A 1N9AA 1N94A 1TN8A 3Q78A 1LD8A 2ZISA 4GTMA 1O1RA 1FT2A 1N95A 3PZ1A 3DSUA 4GTRA 1KZOA 2ZIRA 1SA5A 1S64A 4LNGA 2IEJA 4LNBA 3E32A 3SFYA 1TNUA 3HXDA 3Q79A 2R2LA 3E37A 2H6FA 3E34A 2H6GA 3DPYA 4GTPA 2H6HA 3DSSA 1KZPA 3DSXA 1FT1A 1TN7A 3KSQA 3Q73A 1TNOA 1TNYA 1DCEA 3Q7AA 1NL4A 1X81A 3Q75A 3HXCA 4GTTA 1JCRA 3DRAA 3SFXA 1O5MA 3HXFA 4GTVA 1O1TA 1MZCA 3DSWA 3E30A 4L9PA 3PZ3A 4GTQA 3PZ2A 4GTSA 3HXBA 4GTOA 3DSTA 1D8DA 3DSVA 1TNBA 1O1SA
chains in the Genus database with same CATH superfamily
2IY0C 2IONA 4GPKA 4I1AA 5KNHD 4B94A 1N4PA 4BT8A 1N4QA 2J09A 5JHBA 2PNNA 1W3BA 2KZTA 3L6AA 4KYOB 4LG6A 5M72A 1FPPA 1PC2A 3G2SA 1S70B 1N9AA 1WAO1 4UWHA 4KZ0A 5G05C 5G04C 4F1PA 3NBNB 1SQMA 3UT7A 1HF8A 4N3BA 3CVPA 2IQCA 2R05A 3TGOA 5FWQA 4I9CA 4G24A 4JB8P 3S7BA 3CSFA 5D2MC 3OXFA 3DSXA 3FP3A 2JABA 4I43A 1KLXA 4DX6D 5AJLA 1BLXB 5FZSA 3ONKA 3SBTB 4WNGA 5EDSA 3BG0B 5JHAA 4DX2A 2F37A 2EIJE 4GTTA 3D9JA 5T8IA 2P58C 4HRLA 3SFXA 3NOGD 4XX5A 1ZU2A 3IV0A 4ANUA 1HFAA 2KBXA 3PNLB 3HXBA 4BX9A 1UN8A 3CHOA 4J8YA 4O60A 5D66A 4FP7A 3T8KA 4J6IA 2ZU6B 4EZKA 3ZYQA 4ACLA 1DVPA 3CHPA 5HRYA 3AG1E 4FHJA 4EBAG 4NRHB 3D9MA 1MHQA 5FINA 3FWVA 1OWOA 4JHJA 3RSEG 4DX7D 3BUAA 5CEAA 3ASNE 3T5VA 2KZTB 2IEJA 4I1MA 4APOA 5LFAA 1U3DA 4HOTA 3B7UX 1S0PA 4WWOA 4F6RD 4HRMB 3AS4A 3Q79A 3E37A 1G3NB 1BI7B 4P29A 4GTPA 4OAVB 2WXOA 1TEZA 4KZCA 5CCLA 4HLEA 1ELKA 2XEVA 4ILHB 4LCTA 2V8SE 3D9PA 2L9BA 3CQGB 2XHEA 3MZLB 2ONDA 4UI9K 5FTPA 4U0UA 3O48A 4XI9A 2IF4A 3RIBA 4KT6B 2IOSA 4HQDA 1YCSB 4N2QA 2WXRA 1UN9A 3G2UA 2BUGA 4ILIA 3Q9NC 4DX1A 2XPIA 3EDTB 4I9EA 2UWJG 4JEHA 2Y4TA 1O1SA 2QY7A 1H6KA 1MJ0A 4U8VD 1LF8A 3DXKG 4MRUA 1QZ2A 2WXLA 3QKYA 4D10C 3QNKA 3TWXA 1OWPA 4EHMA 3K9IA 3AJIA 4ABNA 4YDOA 3TWVA 4K03A 3Q5MA 3FY4A 3ZNGA 2R5SA 4CEMA 3JYSA 2VSYA 3AG3E 1O1RA 4JHKA 2FEZA 3J5QB 3GYZA 3ZXPA 5AIJA 2WB2A 4DK5A 4I1OB 1OCRE 2ETCA 5LCWC 3ESLA 4F7AA 5H7PA 4EQFA 3C5RA 4FJZA 1RW2A 3B7SA 4TXQA 1SVXA 5AQ7A 4RG9A 4A1SA 4U95D 3NZUA 2GRQB 2XGOA 4CDNA 2FO7A 2GW1A 2OVBA 2WPVA 2CFUA 3B7RL 5CERB 1L5JA 3DWLG 2LUHA 4B0ZA 1NFIE 3CHSA 4HB5A 2J07A 2CHZA 3E30A 2KATA 3JCKC 1JUQA 5JJTA 2GRMA 1TNZA 3RRUA 2Q7FA 2XPZA 2XPYA 3R9AB 1HXIA 4C9BB 1IQUA 3QWPA 3ABKE 2HYZA 3QWWA 2OEVA 3NQPA 4C0MA 2BEDA 3UPVA 3S7FA 2X6HA 2HO1A 4JW1A 4Y6CA 3CSTA 4CT4A 5D0QD 1NA0A 3R7QA 4HOSA 4RVBA 3ABME 4A1GA 3CKBA 4CGVA 3PUJA 3FEXA 2J9QA 1Y6IA 2VTBA 5EILA 5ENQD 3PE4A 5AYWD 4BTAA 3D9KA 3LVRE 3DSSA 4KXKB 5KNGA 2E2EA 4J8EA 4AP2A 4OVVA 3Q73A 4DJAA 3LPZA 2FULA 2V5FA 3UM2A 2PM6A 1Z3YA 1MX2A 2KCLA 2ETBA 3FHEA 2WQ6A 3NAWA 3ZVVA 3U9WA 3L17A 1O5MA 4OYSA 2PZIA 3HXFA 2B0OE 3NB2A 4FLHA 3HHMA 1AP7A 3L08A 4B93B 4JHRA 4IYPA 2KC7A 3EUVA 3G2WA 4IN3B 4CRWA 1JCQA 1U3CA 4TRQA 2OVFA 1Z3XA 3FFLA 4JC8A 5KBAA 3D9LA 1E8XA 5EIBE 2V0PA 1TN6A 4GZ6A 3AS8A 2GRPB 2IU1A 2CG2A 4CCAA 1N94A 3TL5A 3JQ1A 3I4RB 3UKUG 2AJAA 1V55E 3UXGA 4WNEA 4DI3A 4GA1A 2Y69E 2DVWA 5FT9A 3U64A 4I6JA 3PVLA 3CVXA 4H7XA 1TNUA 1HS6A 1Y8MA 2X6KA 1FCHA 4PS3A 3E34A 2X6FA 3FTZA 1H0AA 1QNFA 1H2VC 3CVLA 1WM5A 3SO8A 1K1BA 1FT1A 4JPSA 3LS8A 3L54A 2VTBB 3PE3A 3OAWA 4N5CA 2ETAA 5FJYA 3CQCB 3IHYA 3GZ2A 4JD2G 1U2VG 3GZ1A 4GA2A 4NIKA 5JMND 3AG2E 2VSOE 3ZRHA 4FJYA 5CECB 5CEDB 1Q2ZA 1K1AA 1ZB1A 4L2YA 4U0SA 3UIOC 5KJLA 4FU3A 3TWWA 3UKRG 1SA4A 2HE0A 1S63A 2X6IA 5J90A 3ZKJA 3Q49B 2VGYA 2J4DA 4G2VA 3CK7A 2CG3A 4FADA 4YDEA 3FUDA 4UQYA 4AV7A 3QDNA 3MJWA 1QYMA 3KS2A 2LNIA 1EPUA 3PZ1A 3ZUVB 2KXPC 4B8CB 3UTMA 4J8DA 3MV3B 1OCZE 4J8FA 5FQ8A 3VTXA 3HXDA 5LX8A 5B1BE 1KT0A 2I9CA 2GRNB 4L7TA 3ZHEB 1H2UA 3ZPJA 4FA6A 3MKRA 3QOUA 5B1AE 2NXPA 4M3OA 3KSQA 4GCNA 5LP0A 3KEAA 3ZYMA 3QC1A 4CDRA 3GW4A 4BT9A 3DXMG 2ZXWE 2E0IA 5ANLA 2XGSA 3I5PA 5BUZA 3LJ3A 5EKQD 4U7EB 3DPDA 3NZSA 1MYOA 5CBNA 1TJCA 1BPOA 3ZGQA 3T8MA 4MKTA 3CEQA 1K3ZD 3VLDA 4CYMD 3FEYA 1H19A 2DYRE 2IO2C 3CHQA 1N11A 3EJNA 4LNUD 1E90A 4J8SA 4E85A 4JL0A 4PUCA 1IHGA 2P9NG 3IXEA 4LERA 5FQ7A 3FUEA 2DZOA 4TUMA 4N3AA 4KVOA 1LD7A 1TJFA 2R17C 4O6FA 3D9NA 5T4YA 1HX8A 1IKND 2L0IA 4GTMA 4G25A 4RLYA 5FQ4A 3D9HA 1N95A 4IULA 4ATZD 5CRUA 3CVQA 4AM9A 1E7UA 1N52A 3PH0C 3Q9UC 3RO2A 1EF1C 3ZU7B 3HYMB 4DX5D 3TG4A 2C2LA 2XRZA 2C0LA 5AARA 3PZDA 2AXVA 5ARFA 3I4GA 2I6HA 1NL4A 1MX4A 3UT4A 4NQ0A 2LXMA 2I1KA 2LSVA 4UWKA 3FUHA 4JA9A 3RRMB 1OCOE 4N5QA 4YVQC 3JUEA 2I2OA 2LXLA 4BESA 4BY6A 4APFA 3UM3A 4GTSA 4ANXA 3TWUA 1TNBA 3TXNA 3NF1A 4QFVA 4GMRA 4EECA 3P2BA 4EBAA 4HI8A 3FU0A 4JVSA 1N4RA 2GRLA 4V3IA 3IEGA 1ELWA 3MX3A 2WQHA 4U0ZA 2HR2A 4JEUA 3AG4E 1X5BA 3F6QA 3UM1A 3RK6A 3D3MA 3U3WA 5D0OD 3PUKA 3ZYLA 5G05J 5G04J 3FU3A 3ASHA 3ASGA 4UWLA 2YQ8A 1KZOA 1HH8A 4FHKA 3CR3A 4AOFA 2XENA 4YDYA 2FI7A 2WXFA 4U8YD 3P1UA 2AXZA 3PDNA 4GB9A 2LO6A 5JJ7A 4GCOA 3CK9A 4PDXA 4F3VA 3ASDA 1UJJA 4ANVA 4XE0A 4AJWA 3PNTB 3Q15A 5BPPA 5FIOA 4BEPA 1WDYA 3FH8A 3TAXA 1TNOA 4L2LA 4GMLA 5AQ9A 3ZIMA 1JCRA 4RSYA 3DRAA 3FTVA 3HIZA 4UI9C 2WMNA 3JXJA 1O1TA 3QK0A 4ZHBA 2YHCA 4I2WA 4GTOA 4AY6A 3C3QA 3RJVA 3FUJA 2VSNA 4A55A 2R59A 2P9IG 3VLFA 2R02A 4U07A 3PZ4A 1ZBPA 4GMJA 1TYQG 3U4TA 4WWNA 4A3TA 2V5QC 4B89A 1OUVA 2P2CP 1IQRA 3CK8A 1E8YA 1TN8A 4AEZC 5BV1A 1KT1A 1H2TC 2XZDG 3Q47B 5A7DB 3T5XA 1UJKA 4F53A 4O1PA 2YHEA 3ML9A 1PAQA 2YINA 2LAHA 3WG7E 4XI0A 3LXUX 5C2YA 4G1TA 2ZGDA 1A17A 3APCA 2QYUA 3LEWA 2KM4A 2P9LG 3KAEA 2B6CA 1N0RA 4E6HA 1RZ4A 4I6GA 3CVVA 2Y1LE 2VGXB 3UX4A 2XCBA 2VYIA 3UUXA 4Q96A 2QC9A 1YMPA 4HNAD 2A5UA 3LJNA 3UINC 4BSXA 4WWPA 4G8KA 1JPLA 2ILRA 5KJMA 4R7LA 3T9KA 2KCVA 2IFUA 4G8LA 3C98A 3SBSA 2Y4UA 3JQ0A 3CKCA 2WMOA 4HLLA 4EZJA 3DSWA 3PZ2A 3CVYA 4FC8A 3AU4A 3QWVA 5CMWA 3ZN3A 2RFMA 5J08A 1H6OA 4C48B 3FU6A 1H6PA 1NI1A 3EU5A 3DBSA 4G11A 2CFZA 4BX8A 3APFA 3MKQB 3RRNB 2Y3AA 3Q7FA 5CRVA 4J0UA 2IO3C 3JXIA 2F8YA 4HRNA 3C3RA 2VQ2A 3LY8A 4GTRA 2ZIRA 4PS8A 3WXXA 2RD0A 2PQRA 3EHRA 4LRZA 5LCWJ 4TXRA 4PS7A 4GZDA 3CVNA 3ZW3A 4XZ4A 3ZHEA 4NURA 3AAAC 4TXPA 5G2NA 3CV0A 4BETA 3FUNA 1OCCE 3Q7AA 2L6JA 3V2OA 4KMOA 2YNQA 2QFCA 4ME2A 4WUYA 4NACA 4U96D 3W9FA 5AENA 1IYGA 4GTQA 2XCCA 4A63B 2MOWA 1JWGA 3FH7A 5AJDA 2NSZA 4K0RA 4K5AB 3PREA 2EINE 3O4ZA 2DYSE 1BI8B 1D9SA 4HS2A 3KD7A 1OWNA 5JJ6A 4MBGA 4CZ2D 2OOEA 5FZRA 3VTYA 3C3OA 5AN8A 2DWZA 3ONLA 4C0EA 2Y0BG 4U8HA 3EU9A 5A23A 3FTWA 3FTUA 2XGMA 4YVOA 3BEEA 3UM0A 4MLPA 1E96B 3LY7A 4Q94A 5E75A 4OVUA 3PS6A 3BU8A 1UOHA 2J49A 2JEKA 2ZGGA 1YA0A 2CHXA 4BERA 3ULEG 1QQEA 1GW6A 2WXIA 1HO8A 3SF4A 3D9IA 3FDHA 3CVWA 1KZPA 4UWFA 4TV3A 2EIME 3RU0A 4WNDA 5CBOA 4I6EA 3Q75A 1A5EA 4HOUA 3QB2A 3FUMA 4ANWA 5CMYA 2GRRB 4U04A 5C1DA 5AQAA 4CT0A 2AW6A 3HG0D 5FQ6A 1HG2A 3EIQC 4KBQA 4UQXA 3ZYKA 2XS8A 4I17A 1OXJA 5ANRA 4AXHA 2QYJA 4DLOA 2M63A 4X8QA 3FUIA 4N39A 4G23A 2RG8A 4M7CA 2WXKA 3Q4AB 5BXUA 2AVPA 2XRYA 3B7BA 3ESKA 4WAFA 1QBQA 3PEVB 1XGWA 4ILGA 4HORA 4HXIA 1UG3A 2ZISA 2GGFA 3DEPA 1YYHA 2LAIA 2DBAA 1MX6A 3RKVA 3APDA 2J8SD 3ENEA 2AWIA 3G2TA 4LUNU 3B13A 3BQOA 4JXTA 2PL2A 5BXOA 4EZLA 2QZAA 2F8XK 5ENNA 5ARGA 4FULA 3ULYA 1E7VA 3AU5A 1OWLA 5BT1A 2UY1B 1PY1A 3X2QE 2OEWA 3R7RA 5EYPF 3E4BA 5KJNA 3R9MA 2NC9A 4GTVA 5BNWA 5E76A 3S7DA 2AXUA 2XEHA 4GYYA 4K5BA 5IY5E 2KCKA 4GPMA 2MRIA 3I3NA 3CLJA 1KPSB 3L16A 5EX0A 3DSVA 3QARA 4XKBA 4GYOA 1XNFA 2H6IA 4AY5A 2WXMA 1D8EA 2WXJA 3CIAA 4LEUA 1HU3A 4PH4B 4GZ5A 4AIFA 1HG5A 4FLBA 4RQIA 1OWMA 3TXMA 1BD8A 3KSLA 4ATGA 3B95A 4HFGA 1HZ4A 5A6CA 3EHNA 2WXNA 4N3CA 2DZNA 4UQZA 1HE8A 4XIFA 5G55A 5KWDA 3CGHA 1IXVA 3L22A 4GA0A 1OT8A 1S64A 2XEEA 4LNGA 2IJGX 3ULQA 4WNFA 4UUCA 2WQ7A 5EX3A 5T3RA 4IRUA 3B7TA 1TR4A 3DPYA 3ABLE 2GROB 5BV0A 2VGXA 3UT8A 1TN7A 4GZCA 5EIDA 1ELRA 2I1JA 3ML8A 3SHFA 3PRZA 3IBEA 1NZNA 3L13A 4Q69A 2DCPA 2P9KG 4I2ZA 5ITZF 3CVUA 3IKOB 1DNPA 2OV8A 2OCCE 3LVQE 2J08A 4K5CA 4DLQA 1INZA 3OTNA 1IHBA 3EHMA 3EHQA 4B8AA 4DRXE 4H7YA 3MA5A 3S2AA 4MS6A 3CHRA 5KJKA 3UIPC 3L82A 3SNXA 3URZA 4YDWA 3ZFWA 2WVIA 2LSUA 1N54A 3LCAA 2XS1A 4CDMA 3MKQA 1N4SA 3HXEA 2WXQA 3E33A 2FBNA 4CGWA 3Q78A 1FT2A 3ISMC 3TWSA 5HKPA 1MQSA 3SY2A 3JUIA 5DIZA 2A4ZA 4LNBA 5LOZA 1NA3A 3E32A 3SQVA 2X3MA 4GAAA 3LDZA 3HVEA 3LYAA 2EQXA 3FTSA 4EPZA 5JA4D 1NP7A 2VJ8A 3PEUB 4HOQA 1AWCB 4BTBA 3J5PA 4J7WA 2L0TB 1FVHA 1DCEA 2JLBA 4HVBA 5ENSD 5EYLA 3UQ3A 4DPRA 1EDUA 4L1BA 1E8WA 1FVFA 4DUIA 3V2XA 3UMVA 3G2VA 3ZXSA 4TUUA 5CHEE 5HI7A 3QJZA 4L23A 2V4LA 4L9PA 4A3VA 1DCQA 2XQ0A 3TWTA 3N71A 3ASFA 2DIWA 3SGHA 2V4HC 4ZFHA 3C72A 4G26A 2P9UG 2EILE 5ENOD 4KVMA 2CHWA 1JCSA 3S7JA 4DI4A 2MHKA 1LTXA 5BW8C 2FO1E 3QAQA 1BU9A 1LD8A 1V54E 4F1SA 3FTXA 1SW6A 1VDYA 2VGEA 5B3SE 2P9PG 3DSUA 1E8ZA 2HM8A 1SA5A 1SZAA 2BKGA 3TJPA 2C0MA 4HI9A 3L9TA 4O1OA 2RFAA 3SFYA 3UI2A 1SZ9A 2R2LA 4BWRA 5CCMA 2H6FA 2H6GA 3MV2B 1K8KG 4Z68A 3SFZA 2FF4A 3FH5A 4UWGA 5FZQA 4QQIA 2WXHA 2VSXE 5AAOA 4GYWA 3FTYA 2IOLA 1TNYA 2WXPA 3IHVA 2BF0X 4U63A 1X81A 3HVEB 2A5EA 5AQBA 2NYJA 3FUFA 1WG0A 2P9SG 3FU5A 2EIKE 2XZTG 1DC2A 1B89A 3BG1B 3LKUA 4UI9J 4N2SA 3MGBA 5HQ8A 3ZEFA 3PZ3A 4BSZB 3V30A 3TWQA 4AVXA 1D8DA 3HRAA 4HBDA 3V79K 3AS5A 2WXGA 2F0YA 3VLEA 1EYHA 4W9RA 5ENRD 4BFRA 3TG5A 2J4BA 1Z6TA 4RG6A 3TWRA 3MYVA 4XKCA 1OY3D 3OXLA 2PQNA 5HS0A 3W9GA 2R03A 3ASOE 5ENTD 3LY9A 1N0QA 5KCMA 3OXGA 2RKKA 4URKA 4GU5A 2MYOA 2WM9A 3SD5A 3GZSA 3NOCD 4LSZE 4JA7A 3MCXA 4ACKA 5DBKA 1UW4B 3RO3A 4XEIG 4Y6WA 3EIJA 3V31A 2BKKB 1JWFA 5ENPD 3SI5A 3FUKA 2H6HA 2X6JA 2UY1A 4JZYA 3U66A 2L6BA 4OAUC 1Z5SC 2X38A 3DEOA 3HXCA 3D9OA 3MEKA 3FULA 5EN5D 1P5QA 1WY6A 3HDXA 4GZ3A 4YNDA 1MZCA 3RAUA 3CHMA 2BTDA 3KEZA 2PM7A 3DSTA 3SZ7A
chains in the Genus database with same CATH topology
2H6IA 2F0YA 3EUVA 1D8EA 1TNZA 1JCQA 3C72A 1NI1A 3EU5A 1N4PA 1N4QA 1SA4A 1JCSA 1N4RA 1S63A 3PZ4A 1LTXA 4MBGA 1TN6A 1FPPA 4EHMA 3KSLA 2BEDA 1LD7A 4YDOA 1N4SA 4YDEA 3HXEA 1QBQA 3Q7FA 3E33A 1N9AA 1N94A 1TN8A 3Q78A 1LD8A 2ZISA 4GTMA 1O1RA 1FT2A 1N95A 3PZ1A 3DSUA 4GTRA 1KZOA 2ZIRA 1SA5A 1S64A 4LNGA 2IEJA 4LNBA 3E32A 3SFYA 1TNUA 3HXDA 3Q79A 2R2LA 3E37A 2H6FA 3E34A 2H6GA 3DPYA 4GTPA 2H6HA 3DSSA 1KZPA 3DSXA 1FT1A 1TN7A 3KSQA 3Q73A 1TNOA 1TNYA 1DCEA 3Q7AA 1NL4A 1X81A 3Q75A 3HXCA 4GTTA 1JCRA 3DRAA 3SFXA 1O5MA 3HXFA 4GTVA 1O1TA 1MZCA 3DSWA 3E30A 4L9PA 3PZ3A 4GTQA 3PZ2A 4GTSA 3HXBA 4GTOA 3DSTA 1D8DA 3DSVA 1TNBA 1O1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6I A;  2F0Y A;  3EUV A;  1D8E A;  1TNZ A;  1JCQ A;  3C72 A;  1NI1 A;  3EU5 A;  1N4P A;  1N4Q A;  1SA4 A;  1JCS A;  1N4R A;  1S63 A;  3PZ4 A;  1LTX A;  4MBG A;  1TN6 A;  1FPP A;  4EHM A;  3KSL A;  2BED A;  1LD7 A;  4YDO A;  1N4S A;  4YDE A;  3HXE A;  1QBQ A;  3Q7F A;  3E33 A;  1N9A A;  1N94 A;  1TN8 A;  3Q78 A;  1LD8 A;  2ZIS A;  4GTM A;  1O1R A;  1FT2 A;  1N95 A;  3PZ1 A;  3DSU A;  4GTR A;  1KZO A;  2ZIR A;  1SA5 A;  1S64 A;  4LNG A;  2IEJ A;  4LNB A;  3E32 A;  3SFY A;  1TNU A;  3HXD A;  3Q79 A;  2R2L A;  3E37 A;  2H6F A;  3E34 A;  2H6G A;  3DPY A;  4GTP A;  2H6H A;  3DSS A;  1KZP A;  3DSX A;  1FT1 A;  1TN7 A;  3KSQ A;  3Q73 A;  1TNO A;  1TNY A;  1DCE A;  3Q7A A;  1NL4 A;  1X81 A;  3Q75 A;  3HXC A;  4GTT A;  1JCR A;  3DRA A;  3SFX A;  1O5M A;  3HXF A;  4GTV A;  1O1T A;  1MZC A;  3DSW A;  3E30 A;  4L9P A;  3PZ3 A;  4GTQ A;  3PZ2 A;  4GTS A;  3HXB A;  4GTO A;  3DST A;  1D8D A;  3DSV A;  1TNB A;  1O1S A; 
#chains in the Genus database with same CATH topology
 2IY0 C;  2ION A;  4GPK A;  4I1A A;  5KNH D;  4B94 A;  1N4P A;  4BT8 A;  1N4Q A;  2J09 A;  5JHB A;  2PNN A;  1W3B A;  2KZT A;  3L6A A;  4KYO B;  4LG6 A;  5M72 A;  1FPP A;  1PC2 A;  3G2S A;  1S70 B;  1N9A A;  1WAO 1;  4UWH A;  4KZ0 A;  5G05 C;  5G04 C;  4F1P A;  3NBN B;  1SQM A;  3UT7 A;  1HF8 A;  4N3B A;  3CVP A;  2IQC A;  2R05 A;  3TGO A;  5FWQ A;  4I9C A;  4G24 A;  4JB8 P;  3S7B A;  3CSF A;  5D2M C;  3OXF A;  3DSX A;  3FP3 A;  2JAB A;  4I43 A;  1KLX A;  4DX6 D;  5AJL A;  1BLX B;  5FZS A;  3ONK A;  3SBT B;  4WNG A;  5EDS A;  3BG0 B;  5JHA A;  4DX2 A;  2F37 A;  2EIJ E;  4GTT A;  3D9J A;  5T8I A;  2P58 C;  4HRL A;  3SFX A;  3NOG D;  4XX5 A;  1ZU2 A;  3IV0 A;  4ANU A;  1HFA A;  2KBX A;  3PNL B;  3HXB A;  4BX9 A;  1UN8 A;  3CHO A;  4J8Y A;  4O60 A;  5D66 A;  4FP7 A;  3T8K A;  4J6I A;  2ZU6 B;  4EZK A;  3ZYQ A;  4ACL A;  1DVP A;  3CHP A;  5HRY A;  3AG1 E;  4FHJ A;  4EBA G;  4NRH B;  3D9M A;  1MHQ A;  5FIN A;  3FWV A;  1OWO A;  4JHJ A;  3RSE G;  4DX7 D;  3BUA A;  5CEA A;  3ASN E;  3T5V A;  2KZT B;  2IEJ A;  4I1M A;  4APO A;  5LFA A;  1U3D A;  4HOT A;  3B7U X;  1S0P A;  4WWO A;  4F6R D;  4HRM B;  3AS4 A;  3Q79 A;  3E37 A;  1G3N B;  1BI7 B;  4P29 A;  4GTP A;  4OAV B;  2WXO A;  1TEZ A;  4KZC A;  5CCL A;  4HLE A;  1ELK A;  2XEV A;  4ILH B;  4LCT A;  2V8S E;  3D9P A;  2L9B A;  3CQG B;  2XHE A;  3MZL B;  2OND A;  4UI9 K;  5FTP A;  4U0U A;  3O48 A;  4XI9 A;  2IF4 A;  3RIB A;  4KT6 B;  2IOS A;  4HQD A;  1YCS B;  4N2Q A;  2WXR A;  1UN9 A;  3G2U A;  2BUG A;  4ILI A;  3Q9N C;  4DX1 A;  2XPI A;  3EDT B;  4I9E A;  2UWJ G;  4JEH A;  2Y4T A;  1O1S A;  2QY7 A;  1H6K A;  1MJ0 A;  4U8V D;  1LF8 A;  3DXK G;  4MRU A;  1QZ2 A;  2WXL A;  3QKY A;  4D10 C;  3QNK A;  3TWX A;  1OWP A;  4EHM A;  3K9I A;  3AJI A;  4ABN A;  4YDO A;  3TWV A;  4K03 A;  3Q5M A;  3FY4 A;  3ZNG A;  2R5S A;  4CEM A;  3JYS A;  2VSY A;  3AG3 E;  1O1R A;  4JHK A;  2FEZ A;  3J5Q B;  3GYZ A;  3ZXP A;  5AIJ A;  2WB2 A;  4DK5 A;  4I1O B;  1OCR E;  2ETC A;  5LCW C;  3ESL A;  4F7A A;  5H7P A;  4EQF A;  3C5R A;  4FJZ A;  1RW2 A;  3B7S A;  4TXQ A;  1SVX A;  5AQ7 A;  4RG9 A;  4A1S A;  4U95 D;  3NZU A;  2GRQ B;  2XGO A;  4CDN A;  2FO7 A;  2GW1 A;  2OVB A;  2WPV A;  2CFU A;  3B7R L;  5CER B;  1L5J A;  3DWL G;  2LUH A;  4B0Z A;  1NFI E;  3CHS A;  4HB5 A;  2J07 A;  2CHZ A;  3E30 A;  2KAT A;  3JCK C;  1JUQ A;  5JJT A;  2GRM A;  1TNZ A;  3RRU A;  2Q7F A;  2XPZ A;  2XPY A;  3R9A B;  1HXI A;  4C9B B;  1IQU A;  3QWP A;  3ABK E;  2HYZ A;  3QWW A;  2OEV A;  3NQP A;  4C0M A;  2BED A;  3UPV A;  3S7F A;  2X6H A;  2HO1 A;  4JW1 A;  4Y6C A;  3CST A;  4CT4 A;  5D0Q D;  1NA0 A;  3R7Q A;  4HOS A;  4RVB A;  3ABM E;  4A1G A;  3CKB A;  4CGV A;  3PUJ A;  3FEX A;  2J9Q A;  1Y6I A;  2VTB A;  5EIL A;  5ENQ D;  3PE4 A;  5AYW D;  4BTA A;  3D9K A;  3LVR E;  3DSS A;  4KXK B;  5KNG A;  2E2E A;  4J8E A;  4AP2 A;  4OVV A;  3Q73 A;  4DJA A;  3LPZ A;  2FUL A;  2V5F A;  3UM2 A;  2PM6 A;  1Z3Y A;  1MX2 A;  2KCL A;  2ETB A;  3FHE A;  2WQ6 A;  3NAW A;  3ZVV A;  3U9W A;  3L17 A;  1O5M A;  4OYS A;  2PZI A;  3HXF A;  2B0O E;  3NB2 A;  4FLH A;  3HHM A;  1AP7 A;  3L08 A;  4B93 B;  4JHR A;  4IYP A;  2KC7 A;  3EUV A;  3G2W A;  4IN3 B;  4CRW A;  1JCQ A;  1U3C A;  4TRQ A;  2OVF A;  1Z3X A;  3FFL A;  4JC8 A;  5KBA A;  3D9L A;  1E8X A;  5EIB E;  2V0P A;  1TN6 A;  4GZ6 A;  3AS8 A;  2GRP B;  2IU1 A;  2CG2 A;  4CCA A;  1N94 A;  3TL5 A;  3JQ1 A;  3I4R B;  3UKU G;  2AJA A;  1V55 E;  3UXG A;  4WNE A;  4DI3 A;  4GA1 A;  2Y69 E;  2DVW A;  5FT9 A;  3U64 A;  4I6J A;  3PVL A;  3CVX A;  4H7X A;  1TNU A;  1HS6 A;  1Y8M A;  2X6K A;  1FCH A;  4PS3 A;  3E34 A;  2X6F A;  3FTZ A;  1H0A A;  1QNF A;  1H2V C;  3CVL A;  1WM5 A;  3SO8 A;  1K1B A;  1FT1 A;  4JPS A;  3LS8 A;  3L54 A;  2VTB B;  3PE3 A;  3OAW A;  4N5C A;  2ETA A;  5FJY A;  3CQC B;  3IHY A;  3GZ2 A;  4JD2 G;  1U2V G;  3GZ1 A;  4GA2 A;  4NIK A;  5JMN D;  3AG2 E;  2VSO E;  3ZRH A;  4FJY A;  5CEC B;  5CED B;  1Q2Z A;  1K1A A;  1ZB1 A;  4L2Y A;  4U0S A;  3UIO C;  5KJL A;  4FU3 A;  3TWW A;  3UKR G;  1SA4 A;  2HE0 A;  1S63 A;  2X6I A;  5J90 A;  3ZKJ A;  3Q49 B;  2VGY A;  2J4D A;  4G2V A;  3CK7 A;  2CG3 A;  4FAD A;  4YDE A;  3FUD A;  4UQY A;  4AV7 A;  3QDN A;  3MJW A;  1QYM A;  3KS2 A;  2LNI A;  1EPU A;  3PZ1 A;  3ZUV B;  2KXP C;  4B8C B;  3UTM A;  4J8D A;  3MV3 B;  1OCZ E;  4J8F A;  5FQ8 A;  3VTX A;  3HXD A;  5LX8 A;  5B1B E;  1KT0 A;  2I9C A;  2GRN B;  4L7T A;  3ZHE B;  1H2U A;  3ZPJ A;  4FA6 A;  3MKR A;  3QOU A;  5B1A E;  2NXP A;  4M3O A;  3KSQ A;  4GCN A;  5LP0 A;  3KEA A;  3ZYM A;  3QC1 A;  4CDR A;  3GW4 A;  4BT9 A;  3DXM G;  2ZXW E;  2E0I A;  5ANL A;  2XGS A;  3I5P A;  5BUZ A;  3LJ3 A;  5EKQ D;  4U7E B;  3DPD A;  3NZS A;  1MYO A;  5CBN A;  1TJC A;  1BPO A;  3ZGQ A;  3T8M A;  4MKT A;  3CEQ A;  1K3Z D;  3VLD A;  4CYM D;  3FEY A;  1H19 A;  2DYR E;  2IO2 C;  3CHQ A;  1N11 A;  3EJN A;  4LNU D;  1E90 A;  4J8S A;  4E85 A;  4JL0 A;  4PUC A;  1IHG A;  2P9N G;  3IXE A;  4LER A;  5FQ7 A;  3FUE A;  2DZO A;  4TUM A;  4N3A A;  4KVO A;  1LD7 A;  1TJF A;  2R17 C;  4O6F A;  3D9N A;  5T4Y A;  1HX8 A;  1IKN D;  2L0I A;  4GTM A;  4G25 A;  4RLY A;  5FQ4 A;  3D9H A;  1N95 A;  4IUL A;  4ATZ D;  5CRU A;  3CVQ A;  4AM9 A;  1E7U A;  1N52 A;  3PH0 C;  3Q9U C;  3RO2 A;  1EF1 C;  3ZU7 B;  3HYM B;  4DX5 D;  3TG4 A;  2C2L A;  2XRZ A;  2C0L A;  5AAR A;  3PZD A;  2AXV A;  5ARF A;  3I4G A;  2I6H A;  1NL4 A;  1MX4 A;  3UT4 A;  4NQ0 A;  2LXM A;  2I1K A;  2LSV A;  4UWK A;  3FUH A;  4JA9 A;  3RRM B;  1OCO E;  4N5Q A;  4YVQ C;  3JUE A;  2I2O A;  2LXL A;  4BES A;  4BY6 A;  4APF A;  3UM3 A;  4GTS A;  4ANX A;  3TWU A;  1TNB A;  3TXN A;  3NF1 A;  4QFV A;  4GMR A;  4EEC A;  3P2B A;  4EBA A;  4HI8 A;  3FU0 A;  4JVS A;  1N4R A;  2GRL A;  4V3I A;  3IEG A;  1ELW A;  3MX3 A;  2WQH A;  4U0Z A;  2HR2 A;  4JEU A;  3AG4 E;  1X5B A;  3F6Q A;  3UM1 A;  3RK6 A;  3D3M A;  3U3W A;  5D0O D;  3PUK A;  3ZYL A;  5G05 J;  5G04 J;  3FU3 A;  3ASH A;  3ASG A;  4UWL A;  2YQ8 A;  1KZO A;  1HH8 A;  4FHK A;  3CR3 A;  4AOF A;  2XEN A;  4YDY A;  2FI7 A;  2WXF A;  4U8Y D;  3P1U A;  2AXZ A;  3PDN A;  4GB9 A;  2LO6 A;  5JJ7 A;  4GCO A;  3CK9 A;  4PDX A;  4F3V A;  3ASD A;  1UJJ A;  4ANV A;  4XE0 A;  4AJW A;  3PNT B;  3Q15 A;  5BPP A;  5FIO A;  4BEP A;  1WDY A;  3FH8 A;  3TAX A;  1TNO A;  4L2L A;  4GML A;  5AQ9 A;  3ZIM A;  1JCR A;  4RSY A;  3DRA A;  3FTV A;  3HIZ A;  4UI9 C;  2WMN A;  3JXJ A;  1O1T A;  3QK0 A;  4ZHB A;  2YHC A;  4I2W A;  4GTO A;  4AY6 A;  3C3Q A;  3RJV A;  3FUJ A;  2VSN A;  4A55 A;  2R59 A;  2P9I G;  3VLF A;  2R02 A;  4U07 A;  3PZ4 A;  1ZBP A;  4GMJ A;  1TYQ G;  3U4T A;  4WWN A;  4A3T A;  2V5Q C;  4B89 A;  1OUV A;  2P2C P;  1IQR A;  3CK8 A;  1E8Y A;  1TN8 A;  4AEZ C;  5BV1 A;  1KT1 A;  1H2T C;  2XZD G;  3Q47 B;  5A7D B;  3T5X A;  1UJK A;  4F53 A;  4O1P A;  2YHE A;  3ML9 A;  1PAQ A;  2YIN A;  2LAH A;  3WG7 E;  4XI0 A;  3LXU X;  5C2Y A;  4G1T A;  2ZGD A;  1A17 A;  3APC A;  2QYU A;  3LEW A;  2KM4 A;  2P9L G;  3KAE A;  2B6C A;  1N0R A;  4E6H A;  1RZ4 A;  4I6G A;  3CVV A;  2Y1L E;  2VGX B;  3UX4 A;  2XCB A;  2VYI A;  3UUX A;  4Q96 A;  2QC9 A;  1YMP A;  4HNA D;  2A5U A;  3LJN A;  3UIN C;  4BSX A;  4WWP A;  4G8K A;  1JPL A;  2ILR A;  5KJM A;  4R7L A;  3T9K A;  2KCV A;  2IFU A;  4G8L A;  3C98 A;  3SBS A;  2Y4U A;  3JQ0 A;  3CKC A;  2WMO A;  4HLL A;  4EZJ A;  3DSW A;  3PZ2 A;  3CVY A;  4FC8 A;  3AU4 A;  3QWV A;  5CMW A;  3ZN3 A;  2RFM A;  5J08 A;  1H6O A;  4C48 B;  3FU6 A;  1H6P A;  1NI1 A;  3EU5 A;  3DBS A;  4G11 A;  2CFZ A;  4BX8 A;  3APF A;  3MKQ B;  3RRN B;  2Y3A A;  3Q7F A;  5CRV A;  4J0U A;  2IO3 C;  3JXI A;  2F8Y A;  4HRN A;  3C3R A;  2VQ2 A;  3LY8 A;  4GTR A;  2ZIR A;  4PS8 A;  3WXX A;  2RD0 A;  2PQR A;  3EHR A;  4LRZ A;  5LCW J;  4TXR A;  4PS7 A;  4GZD A;  3CVN A;  3ZW3 A;  4XZ4 A;  3ZHE A;  4NUR A;  3AAA C;  4TXP A;  5G2N A;  3CV0 A;  4BET A;  3FUN A;  1OCC E;  3Q7A A;  2L6J A;  3V2O A;  4KMO A;  2YNQ A;  2QFC A;  4ME2 A;  4WUY A;  4NAC A;  4U96 D;  3W9F A;  5AEN A;  1IYG A;  4GTQ A;  2XCC A;  4A63 B;  2MOW A;  1JWG A;  3FH7 A;  5AJD A;  2NSZ A;  4K0R A;  4K5A B;  3PRE A;  2EIN E;  3O4Z A;  2DYS E;  1BI8 B;  1D9S A;  4HS2 A;  3KD7 A;  1OWN A;  5JJ6 A;  4MBG A;  4CZ2 D;  2OOE A;  5FZR A;  3VTY A;  3C3O A;  5AN8 A;  2DWZ A;  3ONL A;  4C0E A;  2Y0B G;  4U8H A;  3EU9 A;  5A23 A;  3FTW A;  3FTU A;  2XGM A;  4YVO A;  3BEE A;  3UM0 A;  4MLP A;  1E96 B;  3LY7 A;  4Q94 A;  5E75 A;  4OVU A;  3PS6 A;  3BU8 A;  1UOH A;  2J49 A;  2JEK A;  2ZGG A;  1YA0 A;  2CHX A;  4BER A;  3ULE G;  1QQE A;  1GW6 A;  2WXI A;  1HO8 A;  3SF4 A;  3D9I A;  3FDH A;  3CVW A;  1KZP A;  4UWF A;  4TV3 A;  2EIM E;  3RU0 A;  4WND A;  5CBO A;  4I6E A;  3Q75 A;  1A5E A;  4HOU A;  3QB2 A;  3FUM A;  4ANW A;  5CMY A;  2GRR B;  4U04 A;  5C1D A;  5AQA A;  4CT0 A;  2AW6 A;  3HG0 D;  5FQ6 A;  1HG2 A;  3EIQ C;  4KBQ A;  4UQX A;  3ZYK A;  2XS8 A;  4I17 A;  1OXJ A;  5ANR A;  4AXH A;  2QYJ A;  4DLO A;  2M63 A;  4X8Q A;  3FUI A;  4N39 A;  4G23 A;  2RG8 A;  4M7C A;  2WXK A;  3Q4A B;  5BXU A;  2AVP A;  2XRY A;  3B7B A;  3ESK A;  4WAF A;  1QBQ A;  3PEV B;  1XGW A;  4ILG A;  4HOR A;  4HXI A;  1UG3 A;  2ZIS A;  2GGF A;  3DEP A;  1YYH A;  2LAI A;  2DBA A;  1MX6 A;  3RKV A;  3APD A;  2J8S D;  3ENE A;  2AWI A;  3G2T A;  4LUN U;  3B13 A;  3BQO A;  4JXT A;  2PL2 A;  5BXO A;  4EZL A;  2QZA A;  2F8X K;  5ENN A;  5ARG A;  4FUL A;  3ULY A;  1E7V A;  3AU5 A;  1OWL A;  5BT1 A;  2UY1 B;  1PY1 A;  3X2Q E;  2OEW A;  3R7R A;  5EYP F;  3E4B A;  5KJN A;  3R9M A;  2NC9 A;  4GTV A;  5BNW A;  5E76 A;  3S7D A;  2AXU A;  2XEH A;  4GYY A;  4K5B A;  5IY5 E;  2KCK A;  4GPM A;  2MRI A;  3I3N A;  3CLJ A;  1KPS B;  3L16 A;  5EX0 A;  3DSV A;  3QAR A;  4XKB A;  4GYO A;  1XNF A;  2H6I A;  4AY5 A;  2WXM A;  1D8E A;  2WXJ A;  3CIA A;  4LEU A;  1HU3 A;  4PH4 B;  4GZ5 A;  4AIF A;  1HG5 A;  4FLB A;  4RQI A;  1OWM A;  3TXM A;  1BD8 A;  3KSL A;  4ATG A;  3B95 A;  4HFG A;  1HZ4 A;  5A6C A;  3EHN A;  2WXN A;  4N3C A;  2DZN A;  4UQZ A;  1HE8 A;  4XIF A;  5G55 A;  5KWD A;  3CGH A;  1IXV A;  3L22 A;  4GA0 A;  1OT8 A;  1S64 A;  2XEE A;  4LNG A;  2IJG X;  3ULQ A;  4WNF A;  4UUC A;  2WQ7 A;  5EX3 A;  5T3R A;  4IRU A;  3B7T A;  1TR4 A;  3DPY A;  3ABL E;  2GRO B;  5BV0 A;  2VGX A;  3UT8 A;  1TN7 A;  4GZC A;  5EID A;  1ELR A;  2I1J A;  3ML8 A;  3SHF A;  3PRZ A;  3IBE A;  1NZN A;  3L13 A;  4Q69 A;  2DCP A;  2P9K G;  4I2Z A;  5ITZ F;  3CVU A;  3IKO B;  1DNP A;  2OV8 A;  2OCC E;  3LVQ E;  2J08 A;  4K5C A;  4DLQ A;  1INZ A;  3OTN A;  1IHB A;  3EHM A;  3EHQ A;  4B8A A;  4DRX E;  4H7Y A;  3MA5 A;  3S2A A;  4MS6 A;  3CHR A;  5KJK A;  3UIP C;  3L82 A;  3SNX A;  3URZ A;  4YDW A;  3ZFW A;  2WVI A;  2LSU A;  1N54 A;  3LCA A;  2XS1 A;  4CDM A;  3MKQ A;  1N4S A;  3HXE A;  2WXQ A;  3E33 A;  2FBN A;  4CGW A;  3Q78 A;  1FT2 A;  3ISM C;  3TWS A;  5HKP A;  1MQS A;  3SY2 A;  3JUI A;  5DIZ A;  2A4Z A;  4LNB A;  5LOZ A;  1NA3 A;  3E32 A;  3SQV A;  2X3M A;  4GAA A;  3LDZ A;  3HVE A;  3LYA A;  2EQX A;  3FTS A;  4EPZ A;  5JA4 D;  1NP7 A;  2VJ8 A;  3PEU B;  4HOQ A;  1AWC B;  4BTB A;  3J5P A;  4J7W A;  2L0T B;  1FVH A;  1DCE A;  2JLB A;  4HVB A;  5ENS D;  5EYL A;  3UQ3 A;  4DPR A;  1EDU A;  4L1B A;  1E8W A;  1FVF A;  4DUI A;  3V2X A;  3UMV A;  3G2V A;  3ZXS A;  4TUU A;  5CHE E;  5HI7 A;  3QJZ A;  4L23 A;  2V4L A;  4L9P A;  4A3V A;  1DCQ A;  2XQ0 A;  3TWT A;  3N71 A;  3ASF A;  2DIW A;  3SGH A;  2V4H C;  4ZFH A;  3C72 A;  4G26 A;  2P9U G;  2EIL E;  5ENO D;  4KVM A;  2CHW A;  1JCS A;  3S7J A;  4DI4 A;  2MHK A;  1LTX A;  5BW8 C;  2FO1 E;  3QAQ A;  1BU9 A;  1LD8 A;  1V54 E;  4F1S A;  3FTX A;  1SW6 A;  1VDY A;  2VGE A;  5B3S E;  2P9P G;  3DSU A;  1E8Z A;  2HM8 A;  1SA5 A;  1SZA A;  2BKG A;  3TJP A;  2C0M A;  4HI9 A;  3L9T A;  4O1O A;  2RFA A;  3SFY A;  3UI2 A;  1SZ9 A;  2R2L A;  4BWR A;  5CCM A;  2H6F A;  2H6G A;  3MV2 B;  1K8K G;  4Z68 A;  3SFZ A;  2FF4 A;  3FH5 A;  4UWG A;  5FZQ A;  4QQI A;  2WXH A;  2VSX E;  5AAO A;  4GYW A;  3FTY A;  2IOL A;  1TNY A;  2WXP A;  3IHV A;  2BF0 X;  4U63 A;  1X81 A;  3HVE B;  2A5E A;  5AQB A;  2NYJ A;  3FUF A;  1WG0 A;  2P9S G;  3FU5 A;  2EIK E;  2XZT G;  1DC2 A;  1B89 A;  3BG1 B;  3LKU A;  4UI9 J;  4N2S A;  3MGB A;  5HQ8 A;  3ZEF A;  3PZ3 A;  4BSZ B;  3V30 A;  3TWQ A;  4AVX A;  1D8D A;  3HRA A;  4HBD A;  3V79 K;  3AS5 A;  2WXG A;  2F0Y A;  3VLE A;  1EYH A;  4W9R A;  5ENR D;  4BFR A;  3TG5 A;  2J4B A;  1Z6T A;  4RG6 A;  3TWR A;  3MYV A;  4XKC A;  1OY3 D;  3OXL A;  2PQN A;  5HS0 A;  3W9G A;  2R03 A;  3ASO E;  5ENT D;  3LY9 A;  1N0Q A;  5KCM A;  3OXG A;  2RKK A;  4URK A;  4GU5 A;  2MYO A;  2WM9 A;  3SD5 A;  3GZS A;  3NOC D;  4LSZ E;  4JA7 A;  3MCX A;  4ACK A;  5DBK A;  1UW4 B;  3RO3 A;  4XEI G;  4Y6W A;  3EIJ A;  3V31 A;  2BKK B;  1JWF A;  5ENP D;  3SI5 A;  3FUK A;  2H6H A;  2X6J A;  2UY1 A;  4JZY A;  3U66 A;  2L6B A;  4OAU C;  1Z5S C;  2X38 A;  3DEO A;  3HXC A;  3D9O A;  3MEK A;  3FUL A;  5EN5 D;  1P5Q A;  1WY6 A;  3HDX A;  4GZ3 A;  4YND A;  1MZC A;  3RAU A;  3CHM A;  2BTD A;  3KEZ A;  2PM7 A;  3DST A;  3SZ7 A; 
#chains in the Genus database with same CATH homology
 2H6I A;  2F0Y A;  3EUV A;  1D8E A;  1TNZ A;  1JCQ A;  3C72 A;  1NI1 A;  3EU5 A;  1N4P A;  1N4Q A;  1SA4 A;  1JCS A;  1N4R A;  1S63 A;  3PZ4 A;  1LTX A;  4MBG A;  1TN6 A;  1FPP A;  4EHM A;  3KSL A;  2BED A;  1LD7 A;  4YDO A;  1N4S A;  4YDE A;  3HXE A;  1QBQ A;  3Q7F A;  3E33 A;  1N9A A;  1N94 A;  1TN8 A;  3Q78 A;  1LD8 A;  2ZIS A;  4GTM A;  1O1R A;  1FT2 A;  1N95 A;  3PZ1 A;  3DSU A;  4GTR A;  1KZO A;  2ZIR A;  1SA5 A;  1S64 A;  4LNG A;  2IEJ A;  4LNB A;  3E32 A;  3SFY A;  1TNU A;  3HXD A;  3Q79 A;  2R2L A;  3E37 A;  2H6F A;  3E34 A;  2H6G A;  3DPY A;  4GTP A;  2H6H A;  3DSS A;  1KZP A;  3DSX A;  1FT1 A;  1TN7 A;  3KSQ A;  3Q73 A;  1TNO A;  1TNY A;  1DCE A;  3Q7A A;  1NL4 A;  1X81 A;  3Q75 A;  3HXC A;  4GTT A;  1JCR A;  3DRA A;  3SFX A;  1O5M A;  3HXF A;  4GTV A;  1O1T A;  1MZC A;  3DSW A;  3E30 A;  4L9P A;  3PZ3 A;  4GTQ A;  3PZ2 A;  4GTS A;  3HXB A;  4GTO A;  3DST A;  1D8D A;  3DSV A;  1TNB A;  1O1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...