1TNBA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a substrate kksktkcvif peptide derived from tc21
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords geranylgeranyltransferase type I alpha subunit
total genus 122
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnbA00
2ZIRA 3PZ1A 1D8DA 3DSSA 2H6IA 3HXEA 4LNGA 1QBQA 1D8EA 1N4QA 1O1RA 3HXCA 1KZPA 4GTQA 1TNBA 1JCSA 3E30A 2BEDA 1TNUA 2IEJA 1SA5A 1SA4A 3EU5A 3E34A 1O1TA 4EHMA 2H6FA 1JCQA 4GTRA 1N95A 1FT2A 3PZ4A 1S63A 3DSUA 1N9AA 1TNOA 3PZ3A 3SFXA 4GTVA 2H6GA 1TN8A 4GTTA 1LD7A 1DCEA 2ZISA 3KSLA 1KZOA 1NL4A 3Q7AA 2H6HA 1TNYA 1TN6A 3DPYA 3DSVA 4GTPA 3HXFA 3Q79A 2R2LA 3Q73A 3Q75A 1LD8A 1JCRA 4GTSA 3KSQA 3DSXA 2F0YA 3E32A 3Q7FA 3E37A 3DSTA 4MBGA 1N4RA 1TN7A 3DSWA 1FPPA 3Q78A 1N4PA 1X81A 4YDOA 3E33A 3EUVA 3DRAA 1N94A 4YDEA 1N4SA 1TNZA 1LTXA 1NI1A 3HXDA 1FT1A 1MZCA 3HXBA 4L9PA 3C72A 4GTMA 1O5MA 3PZ2A 4LNBA 4GTOA 3SFYA 1O1SA 1S64A
chains in the Genus database with same CATH superfamily
2IONA 5AQ7A 4L2LA 3B95A 3FUJA 4V3IA 2VYIA 3ZRHA 4GA2A 4FJZA 3ULEG 1D8EA 3R9MA 4U8VD 3U4TA 1OWOA 2QFCA 1E7UA 4UWGA 4J7WA 5KNGA 3UKRG 3HIZA 4MKTA 4WWOA 3ZYKA 1YCSB 3FTXA 4I6EA 3C98A 3ZHEA 2GRNB 5AARA 5ITZF 3Q5MA 3CVWA 2LXLA 2AWIA 5KBAA 2R05A 2H6HA 3P2BA 2WXIA 4ACKA 4HOUA 4GZCA 3Q75A 1N54A 5HQ8A 3ESLA 2AVPA 4A3VA 3AG3E 4KMOA 4PS7A 3ZN3A 3Q7FA 3V79K 4TXQA 2I6HA 3E33A 1P5QA 3F6QA 3B7BA 3MA5A 3AAAC 3MEKA 1FT1A 4TUUA 3HXBA 4A1SA 2CG3A 3TGOA 3NQPA 1OCOE 4AP2A 3GYZA 4WWNA 1K1BA 5AJLA 3UPVA 1UN8A 1Z6TA 3PE4A 4FC8A 3PDNA 4BETA 3FDHA 4UI9K 3GW4A 1IQUA 4DI3A 3NBNB 4I2ZA 5LP0A 1S70B 2Y3AA 1HG5A 4FULA 4RG6A 2VJ8A 4OAVB 3DEOA 2WXRA 1WY6A 4URKA 2ETBA 1U2VG 2MRIA 2IF4A 2DYSE 3VTYA 2ZISA 3FUDA 3TAXA 3PZDA 1NL4A 1BI7B 3QK0A 3TL5A 2C0LA 2L9BA 4WUYA 1EYHA 5A6CA 3FUKA 3AG1E 2R2LA 4AIFA 1LD8A 4G25A 1JWFA 4DX6D 2LAHA 3D9JA 3VLFA 3CVQA 1HU3A 3JXJA 2ETAA 3JCKC 3DSWA 4JA7A 4N2QA 3FTUA 1GW6A 4DLOA 5D0OD 3TJPA 4CGWA 2QYUA 1TNZA 3QC1A 2V8SE 3AS5A 4GZDA 2OEVA 5M72A 4L9PA 4JVSA 2WVIA 2HR2A 3LS8A 5CRUA 4BESA 2J08A 4HVBA 5B3SE 4L7TA 4DUIA 2WPVA 2XRYA 3FWVA 3LXUX 1YYHA 4HQDA 3LJ3A 4U95D 4Q94A 3SY2A 1OUVA 2WMNA 5JJ6A 3PH0C 1DCQA 2FBNA 5T4YA 1SA4A 2J4BA 3BG1B 3HVEB 4U63A 4HLEA 3WG7E 2P9LG 5EKQD 4Y6WA 5EN5D 2WXHA 1TNOA 1N0QA 3MV2B 3MCXA 4U0ZA 3SI5A 5BT1A 3QB2A 1UJKA 3QWPA 4JZYA 5A23A 5T8IA 3T8KA 4CT4A 2IO2C 1TNYA 2LNIA 4I9EA 2XPYA 1JCRA 4CYMD 4ABNA 3EDTB 5CBOA 3DSXA 3JUIA 5H7PA 1WAO1 5BW8C 1NP7A 4FADA 4DX7D 3W9GA 4KZCA 2R59A 4FHJA 4J8DA 1QZ2A 3EUVA 3U3WA 3VTXA 5CBNA 4TUMA 1OCCE 4UQYA 4C0MA 1MX6A 3Q49B 4F6RD 5CCLA 4IYPA 3T5XA 2XENA 5JA4D 3QNKA 3AG2E 2P9SG 2DCPA 3APDA 3ASOE 4MLPA 2Q7FA 1H6PA 3RIBA 4CT0A 3X2QE 3HDXA 3E30A 2BEDA 5LCWJ 3MKQB 4BX9A 3MYVA 3DXKG 1H2UA 1OY3D 3PVLA 4I1OB 4FLBA 2L6JA 3SD5A 1MX4A 5G55A 1JCQA 2WXOA 2XZDG 4EQFA 3DSUA 2ONDA 4CEMA 3FEYA 4NRHB 2P9KG 2J9QA 2YNQA 4CCAA 4X8QA 3ZYLA 1Y8MA 2VGYA 2XGSA 3ABME 3FH7A 4HB5A 4GZ5A 3JUEA 3Q73A 3LY9A 4QFVA 3MGBA 5B1BE 4AXHA 1E90A 4K0RA 2WB2A 3B7UX 4K5CA 3AU5A 1JWGA 2HYZA 4O6FA 1TN7A 4BY6A 4ATZD 3L6AA 4ILIA 4BFRA 4JA9A 5HKPA 3QWVA 2WXJA 1N52A 4Z68A 3CV0A 3LPZA 2XCBA 4WNGA 3CHMA 3ULQA 1O5MA 3MZLB 3FUIA 4F7AA 4Y6CA 3ZXPA 2ETCA 4FU3A 1JUQA 2IJGX 2I1KA 5ENOD 3ZEFA 4R7LA 4KZ0A 3V2OA 4HI8A 1N4QA 2F8YA 2LSUA 3U66A 4CDNA 2Y1LE 3FUHA 2FF4A 5ENTD 2BUGA 2MYOA 2F37A 4HBDA 4U8HA 3ULYA 1S63A 3SFXA 1D9SA 4G1TA 2FO7A 3FHEA 3UM1A 4PDXA 3BEEA 3KSLA 1SW6A 2EIME 4WNDA 4GPKA 1OWLA 2YHEA 4LNUD 3PNLB 1TR4A 4IN3B 3PEUB 3HXFA 2X3MA 4NQ0A 5JJ7A 3LYAA 4ACLA 3KSQA 4E85A 3RKVA 3E32A 4GU5A 3UQ3A 4WNFA 4F1PA 1A5EA 3BU8A 2ZGGA 3CQCB 3CGHA 2V4HC 4GMLA 2I1JA 2KZTB 5CCMA 3UXGA 2QY7A 2C2LA 3UT8A 2FI7A 4I9CA 4IULA 4C48B 3ZNGA 1BD8A 1XGWA 3RSEG 2GRLA 3PZ2A 4GAAA 1Y6IA 2B0OE 5AQ9A 2V5QC 2WXMA 1RW2A 3VLEA 1KT0A 2A5EA 4HNAD 1IQRA 3G2SA 1D8DA 4K5AB 2DZNA 1K8KG 2H6IA 2Y0BG 4BT8A 3ASHA 4DX5D 1IXVA 1QBQA 3ZIMA 1O1RA 3LKUA 2J4DA 2XGOA 3CVPA 4HOTA 5CMYA 3V30A 2GRMA 4FHKA 4J6IA 1UN9A 1ELKA 4K5BA 2V0PA 4IRUA 1HO8A 5BXOA 3TWTA 3UUXA 1TN8A 2YHCA 2WXNA 1XNFA 2KXPC 4JEHA 3S7DA 3G2TA 3L82A 3TWXA 4JD2G 1BU9A 4QQIA 5AIJA 4ILGA 1U3DA 4AM9A 2GGFA 3LDZA 3NB2A 3IBEA 3CK9A 1IHBA 4UWLA 4JEUA 4P29A 1S0PA 4EBAG 3RO3A 3EIJA 4YDEA 4J8FA 2OCCE 1LTXA 4GYOA 5D66A 5J08A 4XE0A 4CDMA 3S2AA 2PQRA 3W9FA 4LNBA 4J0UA 3D9KA 5D0QD 2GRPB 5JMND 3J5QB 3UMVA 4GCNA 5B1AE 5ENSD 3MX3A 3HXCA 3ZGQA 3I4GA 3FH8A 4NACA 5IY5E 5J90A 4TV3A 2KC7A 2VGXB 3RO2A 4XIFA 4N2SA 2Y4TA 3ZW3A 1RZ4A 2WMOA 3EU9A 4AEZC 2H6GA 4I43A 3PUKA 3KEZA 2XS8A 2WXPA 4KVOA 2PL2A 4DJAA 2L0IA 2DVWA 4BERA 5AENA 3Q9UC 3Q7AA 3EHNA 3D9IA 5DIZA 3LY7A 4JXTA 5LFAA 4LG6A 3DWLG 1MQSA 5JJTA 3K9IA 4Q96A 2QYJA 2J09A 2P58C 4FP7A 4WNEA 4CZ2D 5CERB 3L13A 3I5PA 3BUAA 4OAUC 4D10C 3ZXSA 3D9PA 3Q78A 4BX8A 4O60A 4N3CA 4CDRA 3CR3A 3TG4A 3NAWA 2OVBA 1N4SA 2FULA 3RRMB 4GPMA 4GYWA 5CEAA 4WAFA 3P1UA 4BTAA 1OCRE 4UQXA 4B93B 1O1SA 3L54A 3B7TA 3KEAA 4JL0A 3JYSA 3SNXA 4UUCA 5EILA 4GMRA 4XX5A 4GTQA 1TNBA 4I1AA 3RU0A 1HX8A 1TNUA 3UT4A 3AG4E 3C5RA 1PY1A 3AS8A 4ANXA 2RD0A 4U7EB 3OAWA 2MOWA 5EYPF 4ME2A 4XEIG 3I3NA 3ZYQA 2L0TB 1TEZA 5FZSA 4F3VA 1PAQA 2V4LA 3IV0A 2P9NG 3PUJA 3DXMG 3CHQA 2GRRB 3HVEA 5FJYA 3ZUVB 5BV0A 1EF1C 1TN6A 2WQHA 3AJIA 5CHEE 1L5JA 2WXKA 3IHYA 4HRLA 2VTBA 4GTSA 1H19A 4L23A 3CEQA 3FUMA 1FVHA 3U9WA 4F1SA 2VSYA 4G8LA 3PE3A 1N4PA 2IY0C 4YDOA 5BV1A 3TWRA 1U3CA 3SBTB 4LERA 2UY1A 4C9BB 3TWWA 1HXIA 4GB9A 2I2OA 3LY8A 2KZTA 4XKBA 5CRVA 1HZ4A 3EJNA 3FU6A 1A17A 5C1DA 4HFGA 2I9CA 4TXRA 2ILRA 3CIAA 3HYMB 3D9HA 3O48A 4H7XA 1SA5A 2WXQA 3CK8A 4U96D 4BEPA 1MX2A 1HE8A 3SZ7A 4Q69A 1O1TA 5ANLA 3FY4A 3R9AB 2R02A 3PEVB 3ASGA 4JB8P 3NOCD 1E8XA 4PUCA 1SZAA 3G2WA 4K03A 4KVMA 5JHBA 1UJJA 2CHXA 1E96B 3O4ZA 1KZOA 3EIQC 3ML9A 3PREA 3JQ0A 2P9UG 1FVFA 3ENEA 4O1PA 3ONKA 4TRQA 2PZIA 4KYOB 2J8SD 3Q79A 3FTSA 2OOEA 2AJAA 4LEUA 1KLXA 4PH4B 4N5CA 3Q47B 4OVVA 4LSZE 1SVXA 2IFUA 5FIOA 2XEEA 4LRZA 5CECB 2HO1A 3TWVA 3ABKE 3C3RA 1K3ZD 1Q2ZA 2WXGA 3TWQA 1NI1A 3QOUA 2A4ZA 4EECA 2HM8A 4ZHBA 1MZCA 4GTMA 4JHJA 4FLHA 2EILE 4O1OA 4U0UA 3TXMA 4NIKA 3HHMA 2Y4UA 3S7JA 2VSOE 3EHRA 3C3QA 3T5VA 3FTWA 4APOA 2UY1B 2OVFA 3SBSA 2X38A 4B0ZA 2NC9A 4HRMB 1ZBPA 2MHKA 3CQGB 3L22A 1OWMA 4L2YA 3TWSA 4E6HA 1TJFA 1EDUA 3MKQA 5EIDA 4BT9A 4LCTA 1UG3A 4XKCA 3I4RB 2IOLA 5EIBE 5KJKA 4UWHA 3KS2A 2XQ0A 2XEHA 3OXGA 2CHWA 3FUEA 2XHEA 3APCA 1B89A 4C0EA 4ANUA 4DK5A 1HG2A 3CVNA 3N71A 1MHQA 4UWFA 5G05J 1MYOA 3BG0B 4PS8A 4DPRA 3D9NA 3FFLA 4KXKB 5KJNA 2XEVA 1ZB1A 3E37A 1DVPA 4MBGA 4RVBA 1PC2A 4DRXE 4ANVA 4BTBA 3ZVVA 4EZLA 3OXFA 5ENPD 4J8EA 5ARFA 4DI4A 3ZYMA 4B8AA 3HG0D 3PRZA 1HS6A 4MRUA 3OTNA 3ONLA 2LXMA 3B7SA 2EINE 2EIJE 2PM6A 3PZ1A 5FINA 4OYSA 3FU0A 5FQ6A 2F8XK 4UQZA 5KNHD 4HXIA 4N39A 1QYMA 2XRZA 4I2WA 1V55E 3VLDA 2YQ8A 1WDYA 4XI9A 3BQOA 2EQXA 2RKKA 1NA0A 1Z3XA 2QZAA 3L17A 4JPSA 3PZ4A 1IKND 4A55A 3ABLE 3ZKJA 4PS3A 2BTDA 5T3RA 4HS2A 1Z5SC 1QNFA 1DCEA 3UKUG 5EDSA 3V2XA 1E8WA 2BKKB 3DSVA 4G24A 1X5BA 3D9MA 3URZA 5ENNA 2WQ6A 3CKBA 5FQ8A 5BUZA 2F0YA 2DZOA 5CMWA 1N4RA 2XZTG 1FPPA 4G8KA 4EZKA 4G26A 2VSNA 5KCMA 1BI8B 4JHKA 3CKCA 5FT9A 3UIPC 3RK6A 5FQ7A 5JHAA 4AV7A 4YDWA 4N5QA 3MKRA 5FZRA 3PNTB 3UTMA 1ELRA 5G05C 4H7YA 4APFA 3SO8A 5D2MC 4G2VA 3T9KA 3CVXA 2DIWA 3CVYA 3MV3B 2LO6A 3ESKA 4UWKA 2X6IA 5EYLA 2X6JA 1N95A 5E75A 3ML8A 2KCKA 2NSZA 3QKYA 2RFMA 1OT8A 2R5SA 3LVRE 2XPZA 2IU1A 4I6GA 3C3OA 1W3BA 3SGHA 3DPYA 2VSXE 3D9LA 4BSXA 3UINC 4GTPA 3S7BA 1JPLA 2AXZA 4LUNU 3GZ1A 1IYGA 4RSYA 5AYWD 3T8MA 4OVUA 4B8CB 3U64A 5E76A 1N11A 4JC8A 5HS0A 2R03A 1VDYA 4N3AA 1OCZE 3ZPJA 5FZQA 5EX3A 3DRAA 1N94A 2VGEA 2LSVA 3B13A 2WQ7A 1MJ0A 5DBKA 2WXFA 2KBXA 3CK7A 5EX0A 3QARA 2YINA 4GA1A 4GZ6A 2IO3C 3HXEA 4B94A 3UX4A 4JW1A 1FCHA 1KZPA 1HF8A 3WXXA 3G2VA 3UM3A 3GZSA 1QQEA 5ENRD 3QJZA 3QWWA 3HRAA 3JQ1A 4I17A 4N3BA 3UIOC 4HRNA 2Y69E 5HRYA 2R17C 4BSZB 2KCLA 2WM9A 3PZ3A 1AWCB 1AP7A 4U0SA 4GTVA 4U8YD 2P9PG 5LOZA 2EIKE 2JABA 4HOSA 2NXPA 4J8YA 3IXEA 2C0MA 3CSTA 4GA0A 3S7FA 5AAOA 2CHZA 1YA0A 2CG2A 2DYRE 4L1BA 1ELWA 2JLBA 2VQ2A 3DPDA 3DSTA 4DX2A 3Q4AB 4J8SA 3UM2A 4EZJA 4AY6A 3EHMA 5BXUA 1X81A 2UWJG 3SHFA 2FO1E 3L16A 3ZU7B 2LAIA 1IHGA 4M3OA 1WM5A 3FULA 5CEDB 1KT1A 3FU5A 3LVQE 3ASNE 4B89A 2OEWA 1S64A 1TYQG 2BKGA 1DNPA 2J49A 3CSFA 3KAEA 5FTPA 3GZ2A 4AVXA 3FP3A 1OXJA 2WXLA 3FTZA 5AJDA 5G04C 2AXVA 3LCAA 3SQVA 3UT7A 2DBAA 3IHVA 1EPUA 4A1GA 4EHMA 4A3TA 1H2TC 3NZSA 3FUFA 3R7QA 1INZA 3ZFWA 4EPZA 2KATA 2AXUA 1WG0A 2B6CA 5LCWC 4G11A 3ASDA 2NYJA 5FQ4A 2E2EA 3D3MA 1E8YA 4HI9A 4YVOA 2GRQB 4ANWA 3E4BA 1HFAA 2RG8A 1KPSB 2XS1A 2P2CP 4UI9C 3TXNA 4HLLA 3CHRA 2PQNA 3APFA 5LX8A 5HI7A 4RQIA 4M7CA 3UI2A 5KJMA 3MJWA 2GROB 4GMJA 4NURA 2CFZA 3FH5A 1SZ9A 3HXDA 2CFUA 4HOQA 5C2YA 2AW6A 3RRNB 3IEGA 3C72A 3CHPA 3ASFA 4GTOA 4GZ3A 3SFYA 2ZXWE 1H2VC 4U07A 4I6JA 4AJWA 4AOFA 4HORA 5AQAA 4KT6B 2ZU6B 4XI0A 1LF8A 4LNGA 1H0AA 3LJNA 4GYYA 3FTVA 2PM7A 4RLYA 4YVQC 2IEJA 3EHQA 2DWZA 1TJCA 3TWUA 4EBAA 2PNNA 3EU5A 4WWPA 3Q15A 3RJVA 4W9RA 3CVLA 4GTRA 3AU4A 3QAQA 2LUHA 1N9AA 4F53A 2XCCA 1OWPA 4TXPA 2L6BA 3L08A 2M63A 2QC9A 5BNWA 3CVUA 3DEPA 3R7RA 1K1AA 3B7RL 4BWRA 4I1MA 5AQBA 4U04A 3RRUA 1NA3A 4CGVA 3QDNA 1BLXB 4ZFHA 3L9TA 1V54E 3NOGD 1G3NB 2VTBB 4A63B 1NFIE 2IOSA 3ZHEB 2X6KA 2JEKA 5ARGA 3NF1A 4ATGA 4AY5A 4DLQA 2OV8A 2KM4A 1H6KA 3JXIA 1HH8A 2E0IA 1UOHA 3Q9NC 3KD7A 2GW1A 4UI9J 3V31A 4YNDA 1ZU2A 2ZIRA 2X6FA 3DSSA 3CLJA 1E7VA 2VGXA 3D9OA 4RG9A 3NZUA 2A5UA 2P9IG 5G2NA 1JCSA 3IKOB 4G23A 5ANRA 1N0RA 3SF4A 2KCVA 3G2UA 3SFZA 3E34A 5FWQA 4DX1A 4FA6A 2V5FA 1SQMA 2H6FA 4GCOA 1FT2A 1Z3YA 1NZNA 2XPIA 4JHRA 3AS4A 3OXLA 4KBQA 4GTTA 1LD7A 3PS6A 2IQCA 4YDYA 5G04J 2BF0X 2J07A 3CVVA 5AN8A 3DBSA 5ENQD 3FUNA 2FEZA 1H6OA 1BPOA 4XZ4A 3CHOA 4ILHB 3RAUA 4FJYA 4CRWA 5KJLA 1UW4B 5KWDA 3UM0A 3FTYA 5A7DB 1YMPA 1DC2A 3LEWA 3CHSA 4MS6A 3FEXA 1E8ZA 3ISMC 2ZGDA 5BPPA 3TG5A 2HE0A 2RFAA 3J5PA 2XGMA 3FU3A 2X6HA 1OWNA
chains in the Genus database with same CATH topology
2ZIRA 3PZ1A 1D8DA 3DSSA 2H6IA 3HXEA 4LNGA 1QBQA 1D8EA 1N4QA 1O1RA 3HXCA 1KZPA 4GTQA 1TNBA 1JCSA 3E30A 2BEDA 1TNUA 2IEJA 1SA5A 1SA4A 3EU5A 3E34A 1O1TA 4EHMA 2H6FA 1JCQA 4GTRA 1N95A 1FT2A 3PZ4A 1S63A 3DSUA 1N9AA 1TNOA 3PZ3A 3SFXA 4GTVA 2H6GA 1TN8A 4GTTA 1LD7A 1DCEA 2ZISA 3KSLA 1KZOA 1NL4A 3Q7AA 2H6HA 1TNYA 1TN6A 3DPYA 3DSVA 4GTPA 3HXFA 3Q79A 2R2LA 3Q73A 3Q75A 1LD8A 1JCRA 4GTSA 3KSQA 3DSXA 2F0YA 3E32A 3Q7FA 3E37A 3DSTA 4MBGA 1N4RA 1TN7A 3DSWA 1FPPA 3Q78A 1N4PA 1X81A 4YDOA 3E33A 3EUVA 3DRAA 1N94A 4YDEA 1N4SA 1TNZA 1LTXA 1NI1A 3HXDA 1FT1A 1MZCA 3HXBA 4L9PA 3C72A 4GTMA 1O5MA 3PZ2A 4LNBA 4GTOA 3SFYA 1O1SA 1S64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIR A;  3PZ1 A;  1D8D A;  3DSS A;  2H6I A;  3HXE A;  4LNG A;  1QBQ A;  1D8E A;  1N4Q A;  1O1R A;  3HXC A;  1KZP A;  4GTQ A;  1TNB A;  1JCS A;  3E30 A;  2BED A;  1TNU A;  2IEJ A;  1SA5 A;  1SA4 A;  3EU5 A;  3E34 A;  1O1T A;  4EHM A;  2H6F A;  1JCQ A;  4GTR A;  1N95 A;  1FT2 A;  3PZ4 A;  1S63 A;  3DSU A;  1N9A A;  1TNO A;  3PZ3 A;  3SFX A;  4GTV A;  2H6G A;  1TN8 A;  4GTT A;  1LD7 A;  1DCE A;  2ZIS A;  3KSL A;  1KZO A;  1NL4 A;  3Q7A A;  2H6H A;  1TNY A;  1TN6 A;  3DPY A;  3DSV A;  4GTP A;  3HXF A;  3Q79 A;  2R2L A;  3Q73 A;  3Q75 A;  1LD8 A;  1JCR A;  4GTS A;  3KSQ A;  3DSX A;  2F0Y A;  3E32 A;  3Q7F A;  3E37 A;  3DST A;  4MBG A;  1N4R A;  1TN7 A;  3DSW A;  1FPP A;  3Q78 A;  1N4P A;  1X81 A;  4YDO A;  3E33 A;  3EUV A;  3DRA A;  1N94 A;  4YDE A;  1N4S A;  1TNZ A;  1LTX A;  1NI1 A;  3HXD A;  1FT1 A;  1MZC A;  3HXB A;  4L9P A;  3C72 A;  4GTM A;  1O5M A;  3PZ2 A;  4LNB A;  4GTO A;  3SFY A;  1O1S A;  1S64 A; 
#chains in the Genus database with same CATH topology
 2ION A;  5AQ7 A;  4L2L A;  3B95 A;  3FUJ A;  4V3I A;  2VYI A;  3ZRH A;  4GA2 A;  4FJZ A;  3ULE G;  1D8E A;  3R9M A;  4U8V D;  3U4T A;  1OWO A;  2QFC A;  1E7U A;  4UWG A;  4J7W A;  5KNG A;  3UKR G;  3HIZ A;  4MKT A;  4WWO A;  3ZYK A;  1YCS B;  3FTX A;  4I6E A;  3C98 A;  3ZHE A;  2GRN B;  5AAR A;  5ITZ F;  3Q5M A;  3CVW A;  2LXL A;  2AWI A;  5KBA A;  2R05 A;  2H6H A;  3P2B A;  2WXI A;  4ACK A;  4HOU A;  4GZC A;  3Q75 A;  1N54 A;  5HQ8 A;  3ESL A;  2AVP A;  4A3V A;  3AG3 E;  4KMO A;  4PS7 A;  3ZN3 A;  3Q7F A;  3V79 K;  4TXQ A;  2I6H A;  3E33 A;  1P5Q A;  3F6Q A;  3B7B A;  3MA5 A;  3AAA C;  3MEK A;  1FT1 A;  4TUU A;  3HXB A;  4A1S A;  2CG3 A;  3TGO A;  3NQP A;  1OCO E;  4AP2 A;  3GYZ A;  4WWN A;  1K1B A;  5AJL A;  3UPV A;  1UN8 A;  1Z6T A;  3PE4 A;  4FC8 A;  3PDN A;  4BET A;  3FDH A;  4UI9 K;  3GW4 A;  1IQU A;  4DI3 A;  3NBN B;  4I2Z A;  5LP0 A;  1S70 B;  2Y3A A;  1HG5 A;  4FUL A;  4RG6 A;  2VJ8 A;  4OAV B;  3DEO A;  2WXR A;  1WY6 A;  4URK A;  2ETB A;  1U2V G;  2MRI A;  2IF4 A;  2DYS E;  3VTY A;  2ZIS A;  3FUD A;  3TAX A;  3PZD A;  1NL4 A;  1BI7 B;  3QK0 A;  3TL5 A;  2C0L A;  2L9B A;  4WUY A;  1EYH A;  5A6C A;  3FUK A;  3AG1 E;  2R2L A;  4AIF A;  1LD8 A;  4G25 A;  1JWF A;  4DX6 D;  2LAH A;  3D9J A;  3VLF A;  3CVQ A;  1HU3 A;  3JXJ A;  2ETA A;  3JCK C;  3DSW A;  4JA7 A;  4N2Q A;  3FTU A;  1GW6 A;  4DLO A;  5D0O D;  3TJP A;  4CGW A;  2QYU A;  1TNZ A;  3QC1 A;  2V8S E;  3AS5 A;  4GZD A;  2OEV A;  5M72 A;  4L9P A;  4JVS A;  2WVI A;  2HR2 A;  3LS8 A;  5CRU A;  4BES A;  2J08 A;  4HVB A;  5B3S E;  4L7T A;  4DUI A;  2WPV A;  2XRY A;  3FWV A;  3LXU X;  1YYH A;  4HQD A;  3LJ3 A;  4U95 D;  4Q94 A;  3SY2 A;  1OUV A;  2WMN A;  5JJ6 A;  3PH0 C;  1DCQ A;  2FBN A;  5T4Y A;  1SA4 A;  2J4B A;  3BG1 B;  3HVE B;  4U63 A;  4HLE A;  3WG7 E;  2P9L G;  5EKQ D;  4Y6W A;  5EN5 D;  2WXH A;  1TNO A;  1N0Q A;  3MV2 B;  3MCX A;  4U0Z A;  3SI5 A;  5BT1 A;  3QB2 A;  1UJK A;  3QWP A;  4JZY A;  5A23 A;  5T8I A;  3T8K A;  4CT4 A;  2IO2 C;  1TNY A;  2LNI A;  4I9E A;  2XPY A;  1JCR A;  4CYM D;  4ABN A;  3EDT B;  5CBO A;  3DSX A;  3JUI A;  5H7P A;  1WAO 1;  5BW8 C;  1NP7 A;  4FAD A;  4DX7 D;  3W9G A;  4KZC A;  2R59 A;  4FHJ A;  4J8D A;  1QZ2 A;  3EUV A;  3U3W A;  3VTX A;  5CBN A;  4TUM A;  1OCC E;  4UQY A;  4C0M A;  1MX6 A;  3Q49 B;  4F6R D;  5CCL A;  4IYP A;  3T5X A;  2XEN A;  5JA4 D;  3QNK A;  3AG2 E;  2P9S G;  2DCP A;  3APD A;  3ASO E;  4MLP A;  2Q7F A;  1H6P A;  3RIB A;  4CT0 A;  3X2Q E;  3HDX A;  3E30 A;  2BED A;  5LCW J;  3MKQ B;  4BX9 A;  3MYV A;  3DXK G;  1H2U A;  1OY3 D;  3PVL A;  4I1O B;  4FLB A;  2L6J A;  3SD5 A;  1MX4 A;  5G55 A;  1JCQ A;  2WXO A;  2XZD G;  4EQF A;  3DSU A;  2OND A;  4CEM A;  3FEY A;  4NRH B;  2P9K G;  2J9Q A;  2YNQ A;  4CCA A;  4X8Q A;  3ZYL A;  1Y8M A;  2VGY A;  2XGS A;  3ABM E;  3FH7 A;  4HB5 A;  4GZ5 A;  3JUE A;  3Q73 A;  3LY9 A;  4QFV A;  3MGB A;  5B1B E;  4AXH A;  1E90 A;  4K0R A;  2WB2 A;  3B7U X;  4K5C A;  3AU5 A;  1JWG A;  2HYZ A;  4O6F A;  1TN7 A;  4BY6 A;  4ATZ D;  3L6A A;  4ILI A;  4BFR A;  4JA9 A;  5HKP A;  3QWV A;  2WXJ A;  1N52 A;  4Z68 A;  3CV0 A;  3LPZ A;  2XCB A;  4WNG A;  3CHM A;  3ULQ A;  1O5M A;  3MZL B;  3FUI A;  4F7A A;  4Y6C A;  3ZXP A;  2ETC A;  4FU3 A;  1JUQ A;  2IJG X;  2I1K A;  5ENO D;  3ZEF A;  4R7L A;  4KZ0 A;  3V2O A;  4HI8 A;  1N4Q A;  2F8Y A;  2LSU A;  3U66 A;  4CDN A;  2Y1L E;  3FUH A;  2FF4 A;  5ENT D;  2BUG A;  2MYO A;  2F37 A;  4HBD A;  4U8H A;  3ULY A;  1S63 A;  3SFX A;  1D9S A;  4G1T A;  2FO7 A;  3FHE A;  3UM1 A;  4PDX A;  3BEE A;  3KSL A;  1SW6 A;  2EIM E;  4WND A;  4GPK A;  1OWL A;  2YHE A;  4LNU D;  3PNL B;  1TR4 A;  4IN3 B;  3PEU B;  3HXF A;  2X3M A;  4NQ0 A;  5JJ7 A;  3LYA A;  4ACL A;  3KSQ A;  4E85 A;  3RKV A;  3E32 A;  4GU5 A;  3UQ3 A;  4WNF A;  4F1P A;  1A5E A;  3BU8 A;  2ZGG A;  3CQC B;  3CGH A;  2V4H C;  4GML A;  2I1J A;  2KZT B;  5CCM A;  3UXG A;  2QY7 A;  2C2L A;  3UT8 A;  2FI7 A;  4I9C A;  4IUL A;  4C48 B;  3ZNG A;  1BD8 A;  1XGW A;  3RSE G;  2GRL A;  3PZ2 A;  4GAA A;  1Y6I A;  2B0O E;  5AQ9 A;  2V5Q C;  2WXM A;  1RW2 A;  3VLE A;  1KT0 A;  2A5E A;  4HNA D;  1IQR A;  3G2S A;  1D8D A;  4K5A B;  2DZN A;  1K8K G;  2H6I A;  2Y0B G;  4BT8 A;  3ASH A;  4DX5 D;  1IXV A;  1QBQ A;  3ZIM A;  1O1R A;  3LKU A;  2J4D A;  2XGO A;  3CVP A;  4HOT A;  5CMY A;  3V30 A;  2GRM A;  4FHK A;  4J6I A;  1UN9 A;  1ELK A;  4K5B A;  2V0P A;  4IRU A;  1HO8 A;  5BXO A;  3TWT A;  3UUX A;  1TN8 A;  2YHC A;  2WXN A;  1XNF A;  2KXP C;  4JEH A;  3S7D A;  3G2T A;  3L82 A;  3TWX A;  4JD2 G;  1BU9 A;  4QQI A;  5AIJ A;  4ILG A;  1U3D A;  4AM9 A;  2GGF A;  3LDZ A;  3NB2 A;  3IBE A;  3CK9 A;  1IHB A;  4UWL A;  4JEU A;  4P29 A;  1S0P A;  4EBA G;  3RO3 A;  3EIJ A;  4YDE A;  4J8F A;  2OCC E;  1LTX A;  4GYO A;  5D66 A;  5J08 A;  4XE0 A;  4CDM A;  3S2A A;  2PQR A;  3W9F A;  4LNB A;  4J0U A;  3D9K A;  5D0Q D;  2GRP B;  5JMN D;  3J5Q B;  3UMV A;  4GCN A;  5B1A E;  5ENS D;  3MX3 A;  3HXC A;  3ZGQ A;  3I4G A;  3FH8 A;  4NAC A;  5IY5 E;  5J90 A;  4TV3 A;  2KC7 A;  2VGX B;  3RO2 A;  4XIF A;  4N2S A;  2Y4T A;  3ZW3 A;  1RZ4 A;  2WMO A;  3EU9 A;  4AEZ C;  2H6G A;  4I43 A;  3PUK A;  3KEZ A;  2XS8 A;  2WXP A;  4KVO A;  2PL2 A;  4DJA A;  2L0I A;  2DVW A;  4BER A;  5AEN A;  3Q9U C;  3Q7A A;  3EHN A;  3D9I A;  5DIZ A;  3LY7 A;  4JXT A;  5LFA A;  4LG6 A;  3DWL G;  1MQS A;  5JJT A;  3K9I A;  4Q96 A;  2QYJ A;  2J09 A;  2P58 C;  4FP7 A;  4WNE A;  4CZ2 D;  5CER B;  3L13 A;  3I5P A;  3BUA A;  4OAU C;  4D10 C;  3ZXS A;  3D9P A;  3Q78 A;  4BX8 A;  4O60 A;  4N3C A;  4CDR A;  3CR3 A;  3TG4 A;  3NAW A;  2OVB A;  1N4S A;  2FUL A;  3RRM B;  4GPM A;  4GYW A;  5CEA A;  4WAF A;  3P1U A;  4BTA A;  1OCR E;  4UQX A;  4B93 B;  1O1S A;  3L54 A;  3B7T A;  3KEA A;  4JL0 A;  3JYS A;  3SNX A;  4UUC A;  5EIL A;  4GMR A;  4XX5 A;  4GTQ A;  1TNB A;  4I1A A;  3RU0 A;  1HX8 A;  1TNU A;  3UT4 A;  3AG4 E;  3C5R A;  1PY1 A;  3AS8 A;  4ANX A;  2RD0 A;  4U7E B;  3OAW A;  2MOW A;  5EYP F;  4ME2 A;  4XEI G;  3I3N A;  3ZYQ A;  2L0T B;  1TEZ A;  5FZS A;  4F3V A;  1PAQ A;  2V4L A;  3IV0 A;  2P9N G;  3PUJ A;  3DXM G;  3CHQ A;  2GRR B;  3HVE A;  5FJY A;  3ZUV B;  5BV0 A;  1EF1 C;  1TN6 A;  2WQH A;  3AJI A;  5CHE E;  1L5J A;  2WXK A;  3IHY A;  4HRL A;  2VTB A;  4GTS A;  1H19 A;  4L23 A;  3CEQ A;  3FUM A;  1FVH A;  3U9W A;  4F1S A;  2VSY A;  4G8L A;  3PE3 A;  1N4P A;  2IY0 C;  4YDO A;  5BV1 A;  3TWR A;  1U3C A;  3SBT B;  4LER A;  2UY1 A;  4C9B B;  3TWW A;  1HXI A;  4GB9 A;  2I2O A;  3LY8 A;  2KZT A;  4XKB A;  5CRV A;  1HZ4 A;  3EJN A;  3FU6 A;  1A17 A;  5C1D A;  4HFG A;  2I9C A;  4TXR A;  2ILR A;  3CIA A;  3HYM B;  3D9H A;  3O48 A;  4H7X A;  1SA5 A;  2WXQ A;  3CK8 A;  4U96 D;  4BEP A;  1MX2 A;  1HE8 A;  3SZ7 A;  4Q69 A;  1O1T A;  5ANL A;  3FY4 A;  3R9A B;  2R02 A;  3PEV B;  3ASG A;  4JB8 P;  3NOC D;  1E8X A;  4PUC A;  1SZA A;  3G2W A;  4K03 A;  4KVM A;  5JHB A;  1UJJ A;  2CHX A;  1E96 B;  3O4Z A;  1KZO A;  3EIQ C;  3ML9 A;  3PRE A;  3JQ0 A;  2P9U G;  1FVF A;  3ENE A;  4O1P A;  3ONK A;  4TRQ A;  2PZI A;  4KYO B;  2J8S D;  3Q79 A;  3FTS A;  2OOE A;  2AJA A;  4LEU A;  1KLX A;  4PH4 B;  4N5C A;  3Q47 B;  4OVV A;  4LSZ E;  1SVX A;  2IFU A;  5FIO A;  2XEE A;  4LRZ A;  5CEC B;  2HO1 A;  3TWV A;  3ABK E;  3C3R A;  1K3Z D;  1Q2Z A;  2WXG A;  3TWQ A;  1NI1 A;  3QOU A;  2A4Z A;  4EEC A;  2HM8 A;  4ZHB A;  1MZC A;  4GTM A;  4JHJ A;  4FLH A;  2EIL E;  4O1O A;  4U0U A;  3TXM A;  4NIK A;  3HHM A;  2Y4U A;  3S7J A;  2VSO E;  3EHR A;  3C3Q A;  3T5V A;  3FTW A;  4APO A;  2UY1 B;  2OVF A;  3SBS A;  2X38 A;  4B0Z A;  2NC9 A;  4HRM B;  1ZBP A;  2MHK A;  3CQG B;  3L22 A;  1OWM A;  4L2Y A;  3TWS A;  4E6H A;  1TJF A;  1EDU A;  3MKQ A;  5EID A;  4BT9 A;  4LCT A;  1UG3 A;  4XKC A;  3I4R B;  2IOL A;  5EIB E;  5KJK A;  4UWH A;  3KS2 A;  2XQ0 A;  2XEH A;  3OXG A;  2CHW A;  3FUE A;  2XHE A;  3APC A;  1B89 A;  4C0E A;  4ANU A;  4DK5 A;  1HG2 A;  3CVN A;  3N71 A;  1MHQ A;  4UWF A;  5G05 J;  1MYO A;  3BG0 B;  4PS8 A;  4DPR A;  3D9N A;  3FFL A;  4KXK B;  5KJN A;  2XEV A;  1ZB1 A;  3E37 A;  1DVP A;  4MBG A;  4RVB A;  1PC2 A;  4DRX E;  4ANV A;  4BTB A;  3ZVV A;  4EZL A;  3OXF A;  5ENP D;  4J8E A;  5ARF A;  4DI4 A;  3ZYM A;  4B8A A;  3HG0 D;  3PRZ A;  1HS6 A;  4MRU A;  3OTN A;  3ONL A;  2LXM A;  3B7S A;  2EIN E;  2EIJ E;  2PM6 A;  3PZ1 A;  5FIN A;  4OYS A;  3FU0 A;  5FQ6 A;  2F8X K;  4UQZ A;  5KNH D;  4HXI A;  4N39 A;  1QYM A;  2XRZ A;  4I2W A;  1V55 E;  3VLD A;  2YQ8 A;  1WDY A;  4XI9 A;  3BQO A;  2EQX A;  2RKK A;  1NA0 A;  1Z3X A;  2QZA A;  3L17 A;  4JPS A;  3PZ4 A;  1IKN D;  4A55 A;  3ABL E;  3ZKJ A;  4PS3 A;  2BTD A;  5T3R A;  4HS2 A;  1Z5S C;  1QNF A;  1DCE A;  3UKU G;  5EDS A;  3V2X A;  1E8W A;  2BKK B;  3DSV A;  4G24 A;  1X5B A;  3D9M A;  3URZ A;  5ENN A;  2WQ6 A;  3CKB A;  5FQ8 A;  5BUZ A;  2F0Y A;  2DZO A;  5CMW A;  1N4R A;  2XZT G;  1FPP A;  4G8K A;  4EZK A;  4G26 A;  2VSN A;  5KCM A;  1BI8 B;  4JHK A;  3CKC A;  5FT9 A;  3UIP C;  3RK6 A;  5FQ7 A;  5JHA A;  4AV7 A;  4YDW A;  4N5Q A;  3MKR A;  5FZR A;  3PNT B;  3UTM A;  1ELR A;  5G05 C;  4H7Y A;  4APF A;  3SO8 A;  5D2M C;  4G2V A;  3T9K A;  3CVX A;  2DIW A;  3CVY A;  3MV3 B;  2LO6 A;  3ESK A;  4UWK A;  2X6I A;  5EYL A;  2X6J A;  1N95 A;  5E75 A;  3ML8 A;  2KCK A;  2NSZ A;  3QKY A;  2RFM A;  1OT8 A;  2R5S A;  3LVR E;  2XPZ A;  2IU1 A;  4I6G A;  3C3O A;  1W3B A;  3SGH A;  3DPY A;  2VSX E;  3D9L A;  4BSX A;  3UIN C;  4GTP A;  3S7B A;  1JPL A;  2AXZ A;  4LUN U;  3GZ1 A;  1IYG A;  4RSY A;  5AYW D;  3T8M A;  4OVU A;  4B8C B;  3U64 A;  5E76 A;  1N11 A;  4JC8 A;  5HS0 A;  2R03 A;  1VDY A;  4N3A A;  1OCZ E;  3ZPJ A;  5FZQ A;  5EX3 A;  3DRA A;  1N94 A;  2VGE A;  2LSV A;  3B13 A;  2WQ7 A;  1MJ0 A;  5DBK A;  2WXF A;  2KBX A;  3CK7 A;  5EX0 A;  3QAR A;  2YIN A;  4GA1 A;  4GZ6 A;  2IO3 C;  3HXE A;  4B94 A;  3UX4 A;  4JW1 A;  1FCH A;  1KZP A;  1HF8 A;  3WXX A;  3G2V A;  3UM3 A;  3GZS A;  1QQE A;  5ENR D;  3QJZ A;  3QWW A;  3HRA A;  3JQ1 A;  4I17 A;  4N3B A;  3UIO C;  4HRN A;  2Y69 E;  5HRY A;  2R17 C;  4BSZ B;  2KCL A;  2WM9 A;  3PZ3 A;  1AWC B;  1AP7 A;  4U0S A;  4GTV A;  4U8Y D;  2P9P G;  5LOZ A;  2EIK E;  2JAB A;  4HOS A;  2NXP A;  4J8Y A;  3IXE A;  2C0M A;  3CST A;  4GA0 A;  3S7F A;  5AAO A;  2CHZ A;  1YA0 A;  2CG2 A;  2DYR E;  4L1B A;  1ELW A;  2JLB A;  2VQ2 A;  3DPD A;  3DST A;  4DX2 A;  3Q4A B;  4J8S A;  3UM2 A;  4EZJ A;  4AY6 A;  3EHM A;  5BXU A;  1X81 A;  2UWJ G;  3SHF A;  2FO1 E;  3L16 A;  3ZU7 B;  2LAI A;  1IHG A;  4M3O A;  1WM5 A;  3FUL A;  5CED B;  1KT1 A;  3FU5 A;  3LVQ E;  3ASN E;  4B89 A;  2OEW A;  1S64 A;  1TYQ G;  2BKG A;  1DNP A;  2J49 A;  3CSF A;  3KAE A;  5FTP A;  3GZ2 A;  4AVX A;  3FP3 A;  1OXJ A;  2WXL A;  3FTZ A;  5AJD A;  5G04 C;  2AXV A;  3LCA A;  3SQV A;  3UT7 A;  2DBA A;  3IHV A;  1EPU A;  4A1G A;  4EHM A;  4A3T A;  1H2T C;  3NZS A;  3FUF A;  3R7Q A;  1INZ A;  3ZFW A;  4EPZ A;  2KAT A;  2AXU A;  1WG0 A;  2B6C A;  5LCW C;  4G11 A;  3ASD A;  2NYJ A;  5FQ4 A;  2E2E A;  3D3M A;  1E8Y A;  4HI9 A;  4YVO A;  2GRQ B;  4ANW A;  3E4B A;  1HFA A;  2RG8 A;  1KPS B;  2XS1 A;  2P2C P;  4UI9 C;  3TXN A;  4HLL A;  3CHR A;  2PQN A;  3APF A;  5LX8 A;  5HI7 A;  4RQI A;  4M7C A;  3UI2 A;  5KJM A;  3MJW A;  2GRO B;  4GMJ A;  4NUR A;  2CFZ A;  3FH5 A;  1SZ9 A;  3HXD A;  2CFU A;  4HOQ A;  5C2Y A;  2AW6 A;  3RRN B;  3IEG A;  3C72 A;  3CHP A;  3ASF A;  4GTO A;  4GZ3 A;  3SFY A;  2ZXW E;  1H2V C;  4U07 A;  4I6J A;  4AJW A;  4AOF A;  4HOR A;  5AQA A;  4KT6 B;  2ZU6 B;  4XI0 A;  1LF8 A;  4LNG A;  1H0A A;  3LJN A;  4GYY A;  3FTV A;  2PM7 A;  4RLY A;  4YVQ C;  2IEJ A;  3EHQ A;  2DWZ A;  1TJC A;  3TWU A;  4EBA A;  2PNN A;  3EU5 A;  4WWP A;  3Q15 A;  3RJV A;  4W9R A;  3CVL A;  4GTR A;  3AU4 A;  3QAQ A;  2LUH A;  1N9A A;  4F53 A;  2XCC A;  1OWP A;  4TXP A;  2L6B A;  3L08 A;  2M63 A;  2QC9 A;  5BNW A;  3CVU A;  3DEP A;  3R7R A;  1K1A A;  3B7R L;  4BWR A;  4I1M A;  5AQB A;  4U04 A;  3RRU A;  1NA3 A;  4CGV A;  3QDN A;  1BLX B;  4ZFH A;  3L9T A;  1V54 E;  3NOG D;  1G3N B;  2VTB B;  4A63 B;  1NFI E;  2IOS A;  3ZHE B;  2X6K A;  2JEK A;  5ARG A;  3NF1 A;  4ATG A;  4AY5 A;  4DLQ A;  2OV8 A;  2KM4 A;  1H6K A;  3JXI A;  1HH8 A;  2E0I A;  1UOH A;  3Q9N C;  3KD7 A;  2GW1 A;  4UI9 J;  3V31 A;  4YND A;  1ZU2 A;  2ZIR A;  2X6F A;  3DSS A;  3CLJ A;  1E7V A;  2VGX A;  3D9O A;  4RG9 A;  3NZU A;  2A5U A;  2P9I G;  5G2N A;  1JCS A;  3IKO B;  4G23 A;  5ANR A;  1N0R A;  3SF4 A;  2KCV A;  3G2U A;  3SFZ A;  3E34 A;  5FWQ A;  4DX1 A;  4FA6 A;  2V5F A;  1SQM A;  2H6F A;  4GCO A;  1FT2 A;  1Z3Y A;  1NZN A;  2XPI A;  4JHR A;  3AS4 A;  3OXL A;  4KBQ A;  4GTT A;  1LD7 A;  3PS6 A;  2IQC A;  4YDY A;  5G04 J;  2BF0 X;  2J07 A;  3CVV A;  5AN8 A;  3DBS A;  5ENQ D;  3FUN A;  2FEZ A;  1H6O A;  1BPO A;  4XZ4 A;  3CHO A;  4ILH B;  3RAU A;  4FJY A;  4CRW A;  5KJL A;  1UW4 B;  5KWD A;  3UM0 A;  3FTY A;  5A7D B;  1YMP A;  1DC2 A;  3LEW A;  3CHS A;  4MS6 A;  3FEX A;  1E8Z A;  3ISM C;  2ZGD A;  5BPP A;  3TG5 A;  2HE0 A;  2RFA A;  3J5P A;  2XGM A;  3FU3 A;  2X6H A;  1OWN A; 
#chains in the Genus database with same CATH homology
 2ZIR A;  3PZ1 A;  1D8D A;  3DSS A;  2H6I A;  3HXE A;  4LNG A;  1QBQ A;  1D8E A;  1N4Q A;  1O1R A;  3HXC A;  1KZP A;  4GTQ A;  1TNB A;  1JCS A;  3E30 A;  2BED A;  1TNU A;  2IEJ A;  1SA5 A;  1SA4 A;  3EU5 A;  3E34 A;  1O1T A;  4EHM A;  2H6F A;  1JCQ A;  4GTR A;  1N95 A;  1FT2 A;  3PZ4 A;  1S63 A;  3DSU A;  1N9A A;  1TNO A;  3PZ3 A;  3SFX A;  4GTV A;  2H6G A;  1TN8 A;  4GTT A;  1LD7 A;  1DCE A;  2ZIS A;  3KSL A;  1KZO A;  1NL4 A;  3Q7A A;  2H6H A;  1TNY A;  1TN6 A;  3DPY A;  3DSV A;  4GTP A;  3HXF A;  3Q79 A;  2R2L A;  3Q73 A;  3Q75 A;  1LD8 A;  1JCR A;  4GTS A;  3KSQ A;  3DSX A;  2F0Y A;  3E32 A;  3Q7F A;  3E37 A;  3DST A;  4MBG A;  1N4R A;  1TN7 A;  3DSW A;  1FPP A;  3Q78 A;  1N4P A;  1X81 A;  4YDO A;  3E33 A;  3EUV A;  3DRA A;  1N94 A;  4YDE A;  1N4S A;  1TNZ A;  1LTX A;  1NI1 A;  3HXD A;  1FT1 A;  1MZC A;  3HXB A;  4L9P A;  3C72 A;  4GTM A;  1O5M A;  3PZ2 A;  4LNB A;  4GTO A;  3SFY A;  1O1S A;  1S64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...