1TNBA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a substrate kksktkcvif peptide derived from tc21
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
314
structure length
314
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords geranylgeranyltransferase type I alpha subunit
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 122
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnbA00
4GTPA 3HXCA 1X81A 1NI1A 1D8EA 1JCQA 3E30A 1FT1A 1DCEA 4GTOA 1N95A 1TNYA 3DSSA 4GTSA 3C72A 4GTVA 1N9AA 4EHMA 1TN7A 1N4SA 3DSXA 3Q79A 1O5MA 2BEDA 4LNBA 3KSQA 1D8DA 3EUVA 2H6IA 3PZ1A 3PZ3A 4LNGA 3HXBA 3DPYA 3E37A 1S63A 3Q7AA 3DSUA 3DRAA 4YDOA 1SA5A 1KZPA 3PZ2A 1LD7A 3SFYA 1N94A 1TN8A 3HXEA 3DSVA 1SA4A 1LTXA 1JCSA 1JCRA 3E32A 1FPPA 4GTRA 3HXDA 4GTMA 2IEJA 2F0YA 1KZOA 3Q75A 1LD8A 1N4QA 3Q7FA 4MBGA 3EU5A 1N4RA 1S64A 1O1RA 3Q78A 1TNBA 4L9PA 1MZCA 1NL4A 1O1SA 2ZISA 4GTQA 3E34A 3DSWA 3Q73A 3KSLA 1O1TA 1FT2A 2H6GA 4GTTA 1TNOA 4YDEA 2ZIRA 1TNUA 1TN6A 3DSTA 2H6HA 3SFXA 2H6FA 3PZ4A 3E33A 2R2LA 3HXFA 1N4PA 1QBQA 1TNZA
chains in the Genus database with same CATH superfamily
3AAAC 4DUIA 4UI9J 2BKGA 2FBNA 3CK8A 2MYOA 3E30A 1TNYA 4GTVA 1PY1A 4U8HA 1E96B 2RD0A 4EHMA 3LKUA 3IXEA 4ILIA 3DSXA 3NZSA 1FCHA 3ZFWA 3ZIMA 4DX6D 4DX2A 3TWUA 3BG1B 3ISMC 2ZGGA 1S63A 1OWMA 4ACKA 5LCWJ 2ONDA 1KZPA 2AXUA 3APCA 3GW4A 5BW8C 2A5EA 3URZA 1JCSA 3CVNA 3S2AA 3VTXA 3PEUB 2WXKA 1XNFA 3HXDA 3KEAA 2XGMA 5M72A 3ONLA 5AQ7A 4APFA 5J90A 3EU5A 2KM4A 4RQIA 4ABNA 1BD8A 2KCLA 3DXMG 5JJTA 3BEEA 3Q78A 2E0IA 1A5EA 4FHJA 1N52A 1Z5SC 3I4RB 5JHBA 2ZISA 3D9MA 3UPVA 3KSLA 4AJWA 2DIWA 5A6CA 2H6GA 2AJAA 3SBSA 4C48B 3DSTA 3C5RA 3WG7E 5D2MC 2R2LA 3TGOA 1N4PA 3B7TA 5E76A 4ANXA 3R9AB 2XCCA 4N5CA 1JPLA 4MLPA 1WY6A 5BXOA 5BPPA 3ML8A 1D8EA 5ENPD 3RJVA 4CGVA 4J8DA 5ENQD 5H7PA 1HU3A 5HI7A 2X6JA 1SZ9A 3PE4A 2XS8A 1YCSB 2XRYA 2PNNA 5AQBA 2P9LG 1UG3A 2HM8A 3CK7A 3ASNE 2P9SG 2A4ZA 3PUJA 5CEDB 3ZHEB 2VSYA 3FH5A 3ZVVA 5LX8A 1LD8A 4UI9C 3B13A 4MS6A 3IHVA 3EHMA 3FH8A 3EU9A 3BUAA 4W9RA 1N11A 2VGEA 2XGSA 5CHEE 1O1RA 2P9PG 1Z3YA 3GZ1A 2XS1A 4F7AA 4HOSA 3E34A 3UXGA 3APFA 2KBXA 4AM9A 3L17A 3DEPA 3PS6A 1V54E 3FFLA 3DXKG 5T8IA 1TNOA 4GCNA 2GRPB 5LCWC 3TXMA 5IY5E 3S7JA 2X3MA 3CHMA 1P5QA 2I9CA 1IYGA 1INZA 3L08A 2L0TB 4DX1A 3CV0A 3C3OA 3U9WA 4UQYA 1NI1A 2KATA 4GTOA 1EYHA 4F53A 3CVYA 3C72A 4UWLA 3LEWA 2UWJG 4JHRA 2BEDA 1B89A 1SW6A 3JXIA 4KZCA 3FTWA 3TL5A 3PZ3A 1IHBA 4LG6A 4KMOA 3ZHEA 2A5UA 4YDOA 3JUEA 3RKVA 4QQIA 4DPRA 1H6OA 2RKKA 1U3CA 3D9PA 4GZ6A 3HXEA 2FULA 4G25A 2VSOE 1LTXA 3D3MA 1EF1C 3V2OA 3D9LA 2PM7A 4V3IA 1KLXA 4BFRA 3ZXPA 3HRAA 3BQOA 2JABA 4U8YD 4YDYA 4WUYA 2IOLA 5AIJA 3V31A 5B1AE 4XKCA 3FTYA 3T5VA 4B93B 4BY6A 3I5PA 2F8XK 2VTBA 3Q4AB 4E6HA 2J8SD 4OVVA 2QY7A 3PE3A 1K3ZD 2H6FA 3SQVA 3PZ4A 4NURA 5AAOA 3RIBA 3K9IA 2P9KG 3CIAA 3TWSA 2FO1E 4L2LA 2Y4UA 3CVQA 3HXCA 4N3BA 4JPSA 3PEVB 5CEAA 5KWDA 4KVOA 3ZGQA 2V4HC 4U0ZA 2CFZA 3MYVA 1U3DA 3ZKJA 2LAHA 3OTNA 3PNTB 5FWQA 4WWPA 4I1MA 3LY7A 4LNBA 2PQRA 3TAXA 1HFAA 3G2SA 2XPIA 1RW2A 2CHZA 3FTZA 2J08A 3ABLE 2I2OA 2DBAA 4NACA 3HVEB 4TV3A 4CDRA 3GZ2A 5LP0A 3UIPC 2PM6A 3AG4E 4HNAD 3L13A 2P9UG 1BPOA 1MX6A 3CK9A 4GU5A 4AXHA 4DK5A 3ZPJA 4TRQA 1OWPA 2IU1A 3SGHA 5D0QD 1HX8A 1YYHA 4JVSA 3TWQA 2VGXB 1QZ2A 3HHMA 1DNPA 5ENTD 2OVBA 3ZYLA 4KYOB 1WDYA 5KBAA 1LF8A 1HH8A 4CCAA 4B89A 3IBEA 2ETBA 3UT4A 5FINA 4FP7A 4ZHBA 4N2SA 3SO8A 3LCAA 3R7RA 2WMNA 3UM2A 3CVXA 5FQ4A 2BTDA 4GTSA 2P9IG 3C3RA 4AIFA 1SZAA 3D9HA 2V5FA 4EZLA 2IJGX 2XRZA 5FQ6A 3EHNA 3NZUA 1MHQA 4K0RA 4KVMA 5EYPF 3BG0B 1WAO1 3HVEA 3B7UX 2LO6A 2XHEA 3SFYA 2XEHA 3LS8A 4CDMA 1JCRA 3S7FA 1SVXA 3SHFA 5KJLA 2F37A 3FTSA 3UIOC 1VDYA 4HI9A 4PS3A 4B94A 1ZBPA 1YMPA 3G2VA 2Y1LE 4C0EA 3JXJA 4DX7D 2V4LA 2VGXA 1JWGA 3RSEG 3ZYQA 3V2XA 3IHYA 1O1SA 4IYPA 4DJAA 4HOUA 1O1TA 5AJDA 2P58C 4GPMA 4YDEA 4H7XA 2WXPA 3QWVA 4IRUA 2MRIA 4L7TA 1E8WA 4K03A 4GA2A 4K5BA 3KD7A 3NF1A 1NZNA 3EDTB 2LUHA 3OXLA 2J9QA 3QWWA 4K5CA 1OWOA 5DIZA 5FZRA 1N0QA 1N9AA 4A3TA 4U63A 3TXNA 1X5BA 1H2VC 3Q5MA 4HRLA 1G3NB 2HR2A 2R02A 3FUKA 3KSQA 4B8AA 3UQ3A 5G2NA 3UMVA 4UWFA 4Y6WA 4JEUA 3UINC 3DEOA 3O48A 1KPSB 4J8FA 4ILHB 3DRAA 3J5QB 5JJ6A 4HOTA 1FVFA 4U07A 5BT1A 2C0LA 3CKBA 4QFVA 2XGOA 4I6GA 3RU0A 2KZTB 5G05C 3L6AA 2MHKA 2NC9A 5C2YA 4AY6A 1N4QA 4URKA 2RFAA 4I2ZA 1NA0A 4GB9A 4D10C 3R9MA 3EHQA 3O4ZA 3W9FA 3NQPA 4U8VD 1HXIA 2NSZA 3QJZA 4RG9A 3UI2A 2B0OE 2WXOA 4KBQA 4X8QA 4MRUA 1KT1A 4HFGA 1K1AA 5KJMA 3CVPA 4N39A 5E75A 3ASFA 4FADA 3IEGA 5EDSA 4ANUA 4IULA 3JYSA 4FC8A 3CVUA 3LXUX 4WNGA 3AU5A 4U04A 3MX3A 4HBDA 3PRZA 1HZ4A 1OWLA 1N4SA 5FT9A 3TWVA 1D8DA 3L54A 3MCXA 2IQCA 2KC7A 5A23A 2KZTA 3J5PA 1SA5A 2Q7FA 2WXRA 3C98A 4JA7A 4JXTA 2BUGA 2WXHA 3SFZA 3AG1E 2VSNA 2VGYA 3HYMB 4LERA 5ANRA 1KZOA 3MGBA 4JL0A 3UX4A 4CGWA 4HORA 2KCVA 1Y8MA 1S64A 2WXQA 3QWPA 2GRQB 4BSXA 3FUHA 4F1PA 3ULQA 4ANWA 4DRXE 4ANVA 3TG5A 2EILE 3TWWA 2EQXA 4BERA 5KJNA 1E8YA 2GROB 2R05A 3HIZA 1K1BA 2PL2A 1E90A 2H6HA 4BTBA 3RRUA 1EDUA 3Q9NC 4G23A 2DYSE 4G26A 5JMND 5EIBE 3LY8A 3HXFA 3N71A 5KCMA 4AEZC 4L23A 2R5SA 4BETA 3UKRG 1E7VA 4OAUC 4WWOA 4G2VA 1FVHA 3FUEA 4A3VA 4H7YA 2IFUA 4AVXA 1FT1A 3C3QA 4JW1A 5HKPA 1H6KA 2OV8A 4BTAA 1O5MA 3QK0A 4HOQA 3SD5A 3EUVA 4HB5A 3DBSA 4G8KA 4N5QA 3D9KA 2AXZA 3LPZA 4HLEA 1ELRA 1E8ZA 1UJJA 3FUFA 4LSZE 3QOUA 2WVIA 5CECB 2UY1B 3DSVA 3UKUG 1OWNA 3S7DA 4CT0A 1OT8A 2F0YA 4PH4B 4Q94A 3UM1A 4JA9A 2RFMA 4MBGA 4GZCA 4HXIA 1MX2A 1OCCE 5BNWA 3AG2E 1N0RA 4EPZA 3CEQA 2FO7A 4XZ4A 3ASHA 3AS8A 3ABKE 3LY9A 4EZKA 4UWHA 1HE8A 4CRWA 2E2EA 1TJFA 1V55E 2LAIA 4XEIG 2DZNA 2C2LA 3E4BA 4WNDA 5AYWD 3CHQA 5B3SE 3D9OA 3FU5A 4I9EA 2EINE 1D9SA 2AW6A 2VJ8A 3U3WA 3I4GA 2AXVA 4I2WA 3FHEA 1N95A 4OAVB 4PS8A 2EIJE 1JWFA 4P29A 3CHRA 1BI7B 3SZ7A 4L1BA 4O1OA 4JB8P 3SNXA 3E37A 4G24A 2VYIA 2OVFA 2OOEA 4Y6CA 4KZ0A 1AWCB 3NAWA 4KT6B 3GYZA 4GZ5A 1BU9A 4N3CA 3E32A 4CDNA 3FU0A 1NFIE 5DBKA 3DWLG 4TXPA 4EQFA 2WB2A 3T9KA 4O6FA 1E8XA 4CYMD 4Z68A 3QNKA 3L16A 5FIOA 4L9PA 2Y4TA 3QKYA 4U96D 2OEVA 4FHKA 3MKQB 4AP2A 3MKRA 2HO1A 1TN6A 4M7CA 2OCCE 3NOGD 3SFXA 4NQ0A 4NRHB 3E33A 1HF8A 2XQ0A 4GMRA 1ZU2A 1K8KG 5EILA 4ATZD 3ML9A 1Y6IA 2V5QC 4R7LA 5CBOA 3DSSA 4HRNA 4Q96A 2JEKA 3FTVA 4FLBA 3UTMA 1JUQA 4YVQC 5AN8A 3MA5A 2X6FA 5G05J 1TN7A 3WXXA 3VLFA 1Z6TA 3MEKA 4DI3A 4I17A 2I1JA 1ELWA 1HG2A 3DPYA 5G04J 3KEZA 1UOHA 3PDNA 5HS0A 4B0ZA 2J09A 2YHEA 3OAWA 3SY2A 3ZUVB 1IXVA 3CHOA 5CCLA 4RG6A 1S0PA 2BKKB 3FP3A 2WQ7A 3ONKA 3ABME 2GGFA 4F3VA 4RLYA 4I1AA 1MJ0A 2LXLA 3LJNA 4TUMA 3Q75A 5CERB 4YNDA 3T8KA 1SQMA 2CG2A 2WXMA 5HQ8A 4AY5A 3LYAA 3P1UA 2FEZA 2M63A 3MKQA 2WXJA 4GCOA 3ZXSA 3PREA 4U0SA 2DYRE 3ZYKA 3FUNA 4JHKA 3AS4A 1QNFA 3NBNB 3PUKA 2ZIRA 4IN3B 4K5AB 1UN9A 1YA0A 1TR4A 2XEVA 1HS6A 4UQXA 3ZU7B 3CHPA 1QYMA 3KAEA 4XI0A 5JHAA 4AV7A 4M3OA 2LSUA 4WNFA 2LNIA 3VLDA 4DLQA 1UJKA 3X2QE 3RAUA 5T3RA 3OXFA 1Z3XA 4AOFA 1DCQA 2YNQA 2PQNA 3FTXA 2FI7A 2WM9A 3D9JA 4WWNA 3ENEA 5FJYA 2X6IA 4BESA 3LDZA 5AENA 3FDHA 2EIME 2GW1A 1SA4A 1HG5A 5AQ9A 3F6QA 5AJLA 2WPVA 2WXIA 4WNEA 4B8CB 3FUIA 3HDXA 5FTPA 4XI9A 2IEJA 1HO8A 2WXGA 3APDA 5KNGA 3CSFA 3RO3A 3ULYA 4EBAG 3FTUA 3IKOB 2ETAA 2RG8A 1IKND 2HYZA 5KJKA 2R59A 3EIJA 3TWRA 2WMOA 3FEYA 4GTQA 1OXJA 4FU3A 2XENA 5G04C 4N2QA 2V8SE 5BUZA 5FZSA 2J4DA 4HS2A 3CVWA 4FULA 1A17A 4C9BB 2IY0C 4APOA 4F6RD 4E85A 1PAQA 4HVBA 2XPZA 3W9GA 4HRMB 3VTYA 4GYWA 4XIFA 3Q79A 2WXFA 5FQ7A 5J08A 4ATGA 3PZ1A 3DPDA 1NA3A 4HI8A 2IONA 2KXPC 1LD7A 1N54A 2I1KA 2L6BA 4FJYA 3UT8A 1U2VG 1FPPA 3PZDA 5AQAA 3PVLA 4GTMA 5EKQD 2JLBA 4FLHA 4UWKA 1QQEA 1OCOE 3SI5A 1H0AA 1MX4A 5JA4D 2R03A 1N4RA 3RO2A 3S7BA 5ANLA 4GAAA 5CMYA 1TNBA 1TJCA 4O60A 3B7RL 3SBTB 4GA1A 2ILRA 3MZLB 5BXUA 3B95A 3FULA 2GRRB 4A55A 4L2YA 2QYUA 4WAFA 4TUUA 5FZQA 3U66A 3LJ3A 1TNZA 3VLEA 3TJPA 4DLOA 3CR3A 4CZ2D 4GTPA 4EZJA 1MQSA 2B6CA 4G8LA 4GYOA 4JHJA 1X81A 2P9NG 2GRNB 1AP7A 4I43A 5EIDA 3R7QA 4U7EB 2MOWA 2L9BA 2H6IA 2AWIA 4HLLA 2CHXA 4RSYA 2R17C 3RRMB 3QC1A 4OVUA 3PZ2A 3QB2A 3ESKA 2J49A 3AU4A 2DCPA 1TYQG 1H2UA 3CHSA 2XCBA 2X6HA 4O1PA 1W3BA 3PNLB 2VQ2A 3KS2A 3I3NA 4KXKB 2X38A 3BU8A 3B7SA 2Y3AA 4JEHA 3ZEFA 3NB2A 3G2WA 4J8EA 2VSXE 4I6EA 2XZTG 2VTBB 4LRZA 3V79K 1UN8A 5BV0A 4J8SA 4U0UA 5A7DB 3ESLA 3DSWA 5CBNA 3U4TA 5EYLA 4I9CA 2ZGDA 3CQGB 2QYJA 4GTTA 4LEUA 3B7BA 5ENSD 4XE0A 4J0UA 1KT0A 2FF4A 3FH7A 1QBQA 3CGHA 2L0IA 2DWZA 5EX3A 3QDNA 3PH0C 4LCTA 3AS5A 3NOCD 3Q9UC 1OCZE 1JCQA 4J7WA 4N3AA 4GMLA 3V30A 3QARA 3Q49B 2ETCA 2ZXWE 1UW4B 3ASOE 3ASDA 1ELKA 1WG0A 4TXQA 4DI4A 3FUJA 1H2TC 4C0MA 2Y0BG 4YVOA 3U64A 4PUCA 3Q7AA 3CLJA 3JCKC 4GYYA 5ARGA 3DSUA 4Q69A 1TN8A 3AJIA 3TG4A 3EHRA 3Q15A 4GTRA 3D9NA 2UY1A 4A63B 1IQUA 2WQ6A 1TEZA 4DX5D 2IOSA 3CSTA 3G2UA 3ZYMA 4J6IA 1H6PA 2LSVA 4BT8A 2YHCA 4G11A 1MZCA 5FQ8A 4BWRA 4PS7A 2L6JA 4UQZA 4XX5A 2LXMA 3L82A 5T4YA 4GPKA 3LVQE 2QC9A 3GZSA 4JD2G 4BEPA 3EJNA 3L9TA 2CG3A 3UT7A 4BX9A 2IO2C 4TXRA 3MV2B 1OCRE 4U95D 4UWGA 3FU3A 3MV3B 4ZFHA 1ZB1A 4GA0A 3L22A 2HE0A 4EECA 2DZOA 4A1SA 4GZDA 4ACLA 5B1BE 2GRMA 4FJZA 4LNGA 3HXBA 4UUCA 4RVBA 4F1SA 3ZW3A 4A1GA 4MKTA 5CRUA 2QFCA 3IV0A 1L5JA 3FEXA 1BLXB 5HRYA 1N94A 2WXLA 3ASGA 4ME2A 5EN5D 2CHWA 5ARFA 3CVLA 1NP7A 2EIKE 4UI9K 5LFAA 3UM3A 3Q47B 5CCMA 2X6KA 2NYJA 5BV1A 2WQHA 3ZN3A 2PZIA 1Q2ZA 1RZ4A 5ENRD 3T5XA 4GMJA 2YQ8A 3OXGA 4JZYA 5G55A 3SF4A 4YDWA 3QAQA 2ZU6B 4CT4A 1NL4A 1E7UA 4G1TA 5ENNA 5JJ7A 3LVRE 4BX8A 4PDXA 1FT2A 2KCKA 1S70B 1TNUA 1GW6A 1DVPA 2I6HA 2XZDG 3RRNB 3UM0A 4HQDA 5CMWA 5ENOD 1PC2A 3UUXA 1DC2A 4FA6A 3FY4A 4BSZB 3EIQC 4NIKA 5LOZA 3ZRHA 3JUIA 3AG3E 3JQ0A 1WM5A 1DCEA 4ILGA 3FUMA 4LNUD 5C1DA 3MJWA 5D66A 3CVVA 1OY3D 1XGWA 3FUDA 2IF4A 2GRLA 5KNHD 2XPYA 4J8YA 2F8YA 4GZ3A 1H19A 2J4BA 1IQRA 4I1OB 1EPUA 5AARA 4OYSA 2WXNA 5EX0A 3T8MA 2QZAA 3ULEG 2P2CP 2CFUA 3D9IA 2C0MA 3TWTA 3JQ1A 4LUNU 2BF0X 2V0PA 2AVPA 3G2TA 2NXPA 2Y69E 3FU6A 3Q7FA 1OUVA 3HG0D 2DVWA 5CRVA 3CKCA 3FWVA 2J07A 4CEMA 4I6JA 3TWXA 5ITZF 4EBAA 3Q73A 2IO3C 3P2BA 3ZNGA 4XKBA 4JC8A 5D0OD 1BI8B 2XEEA 1MYOA 2YINA 3CQCB 4BT9A 3RK6A 1IHGA 2OEWA
chains in the Genus database with same CATH topology
4GTPA 3HXCA 1X81A 1NI1A 1D8EA 1JCQA 3E30A 1FT1A 1DCEA 4GTOA 1N95A 1TNYA 3DSSA 4GTSA 3C72A 4GTVA 1N9AA 4EHMA 1TN7A 1N4SA 3DSXA 3Q79A 1O5MA 2BEDA 4LNBA 3KSQA 1D8DA 3EUVA 2H6IA 3PZ1A 3PZ3A 4LNGA 3HXBA 3DPYA 3E37A 1S63A 3Q7AA 3DSUA 3DRAA 4YDOA 1SA5A 1KZPA 3PZ2A 1LD7A 3SFYA 1N94A 1TN8A 3HXEA 3DSVA 1SA4A 1LTXA 1JCSA 1JCRA 3E32A 1FPPA 4GTRA 3HXDA 4GTMA 2IEJA 2F0YA 1KZOA 3Q75A 1LD8A 1N4QA 3Q7FA 4MBGA 3EU5A 1N4RA 1S64A 1O1RA 3Q78A 1TNBA 4L9PA 1MZCA 1NL4A 1O1SA 2ZISA 4GTQA 3E34A 3DSWA 3Q73A 3KSLA 1O1TA 1FT2A 2H6GA 4GTTA 1TNOA 4YDEA 2ZIRA 1TNUA 1TN6A 3DSTA 2H6HA 3SFXA 2H6FA 3PZ4A 3E33A 2R2LA 3HXFA 1N4PA 1QBQA 1TNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTP A;  3HXC A;  1X81 A;  1NI1 A;  1D8E A;  1JCQ A;  3E30 A;  1FT1 A;  1DCE A;  4GTO A;  1N95 A;  1TNY A;  3DSS A;  4GTS A;  3C72 A;  4GTV A;  1N9A A;  4EHM A;  1TN7 A;  1N4S A;  3DSX A;  3Q79 A;  1O5M A;  2BED A;  4LNB A;  3KSQ A;  1D8D A;  3EUV A;  2H6I A;  3PZ1 A;  3PZ3 A;  4LNG A;  3HXB A;  3DPY A;  3E37 A;  1S63 A;  3Q7A A;  3DSU A;  3DRA A;  4YDO A;  1SA5 A;  1KZP A;  3PZ2 A;  1LD7 A;  3SFY A;  1N94 A;  1TN8 A;  3HXE A;  3DSV A;  1SA4 A;  1LTX A;  1JCS A;  1JCR A;  3E32 A;  1FPP A;  4GTR A;  3HXD A;  4GTM A;  2IEJ A;  2F0Y A;  1KZO A;  3Q75 A;  1LD8 A;  1N4Q A;  3Q7F A;  4MBG A;  3EU5 A;  1N4R A;  1S64 A;  1O1R A;  3Q78 A;  1TNB A;  4L9P A;  1MZC A;  1NL4 A;  1O1S A;  2ZIS A;  4GTQ A;  3E34 A;  3DSW A;  3Q73 A;  3KSL A;  1O1T A;  1FT2 A;  2H6G A;  4GTT A;  1TNO A;  4YDE A;  2ZIR A;  1TNU A;  1TN6 A;  3DST A;  2H6H A;  3SFX A;  2H6F A;  3PZ4 A;  3E33 A;  2R2L A;  3HXF A;  1N4P A;  1QBQ A;  1TNZ A; 
#chains in the Genus database with same CATH topology
 3AAA C;  4DUI A;  4UI9 J;  2BKG A;  2FBN A;  3CK8 A;  2MYO A;  3E30 A;  1TNY A;  4GTV A;  1PY1 A;  4U8H A;  1E96 B;  2RD0 A;  4EHM A;  3LKU A;  3IXE A;  4ILI A;  3DSX A;  3NZS A;  1FCH A;  3ZFW A;  3ZIM A;  4DX6 D;  4DX2 A;  3TWU A;  3BG1 B;  3ISM C;  2ZGG A;  1S63 A;  1OWM A;  4ACK A;  5LCW J;  2OND A;  1KZP A;  2AXU A;  3APC A;  3GW4 A;  5BW8 C;  2A5E A;  3URZ A;  1JCS A;  3CVN A;  3S2A A;  3VTX A;  3PEU B;  2WXK A;  1XNF A;  3HXD A;  3KEA A;  2XGM A;  5M72 A;  3ONL A;  5AQ7 A;  4APF A;  5J90 A;  3EU5 A;  2KM4 A;  4RQI A;  4ABN A;  1BD8 A;  2KCL A;  3DXM G;  5JJT A;  3BEE A;  3Q78 A;  2E0I A;  1A5E A;  4FHJ A;  1N52 A;  1Z5S C;  3I4R B;  5JHB A;  2ZIS A;  3D9M A;  3UPV A;  3KSL A;  4AJW A;  2DIW A;  5A6C A;  2H6G A;  2AJA A;  3SBS A;  4C48 B;  3DST A;  3C5R A;  3WG7 E;  5D2M C;  2R2L A;  3TGO A;  1N4P A;  3B7T A;  5E76 A;  4ANX A;  3R9A B;  2XCC A;  4N5C A;  1JPL A;  4MLP A;  1WY6 A;  5BXO A;  5BPP A;  3ML8 A;  1D8E A;  5ENP D;  3RJV A;  4CGV A;  4J8D A;  5ENQ D;  5H7P A;  1HU3 A;  5HI7 A;  2X6J A;  1SZ9 A;  3PE4 A;  2XS8 A;  1YCS B;  2XRY A;  2PNN A;  5AQB A;  2P9L G;  1UG3 A;  2HM8 A;  3CK7 A;  3ASN E;  2P9S G;  2A4Z A;  3PUJ A;  5CED B;  3ZHE B;  2VSY A;  3FH5 A;  3ZVV A;  5LX8 A;  1LD8 A;  4UI9 C;  3B13 A;  4MS6 A;  3IHV A;  3EHM A;  3FH8 A;  3EU9 A;  3BUA A;  4W9R A;  1N11 A;  2VGE A;  2XGS A;  5CHE E;  1O1R A;  2P9P G;  1Z3Y A;  3GZ1 A;  2XS1 A;  4F7A A;  4HOS A;  3E34 A;  3UXG A;  3APF A;  2KBX A;  4AM9 A;  3L17 A;  3DEP A;  3PS6 A;  1V54 E;  3FFL A;  3DXK G;  5T8I A;  1TNO A;  4GCN A;  2GRP B;  5LCW C;  3TXM A;  5IY5 E;  3S7J A;  2X3M A;  3CHM A;  1P5Q A;  2I9C A;  1IYG A;  1INZ A;  3L08 A;  2L0T B;  4DX1 A;  3CV0 A;  3C3O A;  3U9W A;  4UQY A;  1NI1 A;  2KAT A;  4GTO A;  1EYH A;  4F53 A;  3CVY A;  3C72 A;  4UWL A;  3LEW A;  2UWJ G;  4JHR A;  2BED A;  1B89 A;  1SW6 A;  3JXI A;  4KZC A;  3FTW A;  3TL5 A;  3PZ3 A;  1IHB A;  4LG6 A;  4KMO A;  3ZHE A;  2A5U A;  4YDO A;  3JUE A;  3RKV A;  4QQI A;  4DPR A;  1H6O A;  2RKK A;  1U3C A;  3D9P A;  4GZ6 A;  3HXE A;  2FUL A;  4G25 A;  2VSO E;  1LTX A;  3D3M A;  1EF1 C;  3V2O A;  3D9L A;  2PM7 A;  4V3I A;  1KLX A;  4BFR A;  3ZXP A;  3HRA A;  3BQO A;  2JAB A;  4U8Y D;  4YDY A;  4WUY A;  2IOL A;  5AIJ A;  3V31 A;  5B1A E;  4XKC A;  3FTY A;  3T5V A;  4B93 B;  4BY6 A;  3I5P A;  2F8X K;  2VTB A;  3Q4A B;  4E6H A;  2J8S D;  4OVV A;  2QY7 A;  3PE3 A;  1K3Z D;  2H6F A;  3SQV A;  3PZ4 A;  4NUR A;  5AAO A;  3RIB A;  3K9I A;  2P9K G;  3CIA A;  3TWS A;  2FO1 E;  4L2L A;  2Y4U A;  3CVQ A;  3HXC A;  4N3B A;  4JPS A;  3PEV B;  5CEA A;  5KWD A;  4KVO A;  3ZGQ A;  2V4H C;  4U0Z A;  2CFZ A;  3MYV A;  1U3D A;  3ZKJ A;  2LAH A;  3OTN A;  3PNT B;  5FWQ A;  4WWP A;  4I1M A;  3LY7 A;  4LNB A;  2PQR A;  3TAX A;  1HFA A;  3G2S A;  2XPI A;  1RW2 A;  2CHZ A;  3FTZ A;  2J08 A;  3ABL E;  2I2O A;  2DBA A;  4NAC A;  3HVE B;  4TV3 A;  4CDR A;  3GZ2 A;  5LP0 A;  3UIP C;  2PM6 A;  3AG4 E;  4HNA D;  3L13 A;  2P9U G;  1BPO A;  1MX6 A;  3CK9 A;  4GU5 A;  4AXH A;  4DK5 A;  3ZPJ A;  4TRQ A;  1OWP A;  2IU1 A;  3SGH A;  5D0Q D;  1HX8 A;  1YYH A;  4JVS A;  3TWQ A;  2VGX B;  1QZ2 A;  3HHM A;  1DNP A;  5ENT D;  2OVB A;  3ZYL A;  4KYO B;  1WDY A;  5KBA A;  1LF8 A;  1HH8 A;  4CCA A;  4B89 A;  3IBE A;  2ETB A;  3UT4 A;  5FIN A;  4FP7 A;  4ZHB A;  4N2S A;  3SO8 A;  3LCA A;  3R7R A;  2WMN A;  3UM2 A;  3CVX A;  5FQ4 A;  2BTD A;  4GTS A;  2P9I G;  3C3R A;  4AIF A;  1SZA A;  3D9H A;  2V5F A;  4EZL A;  2IJG X;  2XRZ A;  5FQ6 A;  3EHN A;  3NZU A;  1MHQ A;  4K0R A;  4KVM A;  5EYP F;  3BG0 B;  1WAO 1;  3HVE A;  3B7U X;  2LO6 A;  2XHE A;  3SFY A;  2XEH A;  3LS8 A;  4CDM A;  1JCR A;  3S7F A;  1SVX A;  3SHF A;  5KJL A;  2F37 A;  3FTS A;  3UIO C;  1VDY A;  4HI9 A;  4PS3 A;  4B94 A;  1ZBP A;  1YMP A;  3G2V A;  2Y1L E;  4C0E A;  3JXJ A;  4DX7 D;  2V4L A;  2VGX A;  1JWG A;  3RSE G;  3ZYQ A;  3V2X A;  3IHY A;  1O1S A;  4IYP A;  4DJA A;  4HOU A;  1O1T A;  5AJD A;  2P58 C;  4GPM A;  4YDE A;  4H7X A;  2WXP A;  3QWV A;  4IRU A;  2MRI A;  4L7T A;  1E8W A;  4K03 A;  4GA2 A;  4K5B A;  3KD7 A;  3NF1 A;  1NZN A;  3EDT B;  2LUH A;  3OXL A;  2J9Q A;  3QWW A;  4K5C A;  1OWO A;  5DIZ A;  5FZR A;  1N0Q A;  1N9A A;  4A3T A;  4U63 A;  3TXN A;  1X5B A;  1H2V C;  3Q5M A;  4HRL A;  1G3N B;  2HR2 A;  2R02 A;  3FUK A;  3KSQ A;  4B8A A;  3UQ3 A;  5G2N A;  3UMV A;  4UWF A;  4Y6W A;  4JEU A;  3UIN C;  3DEO A;  3O48 A;  1KPS B;  4J8F A;  4ILH B;  3DRA A;  3J5Q B;  5JJ6 A;  4HOT A;  1FVF A;  4U07 A;  5BT1 A;  2C0L A;  3CKB A;  4QFV A;  2XGO A;  4I6G A;  3RU0 A;  2KZT B;  5G05 C;  3L6A A;  2MHK A;  2NC9 A;  5C2Y A;  4AY6 A;  1N4Q A;  4URK A;  2RFA A;  4I2Z A;  1NA0 A;  4GB9 A;  4D10 C;  3R9M A;  3EHQ A;  3O4Z A;  3W9F A;  3NQP A;  4U8V D;  1HXI A;  2NSZ A;  3QJZ A;  4RG9 A;  3UI2 A;  2B0O E;  2WXO A;  4KBQ A;  4X8Q A;  4MRU A;  1KT1 A;  4HFG A;  1K1A A;  5KJM A;  3CVP A;  4N39 A;  5E75 A;  3ASF A;  4FAD A;  3IEG A;  5EDS A;  4ANU A;  4IUL A;  3JYS A;  4FC8 A;  3CVU A;  3LXU X;  4WNG A;  3AU5 A;  4U04 A;  3MX3 A;  4HBD A;  3PRZ A;  1HZ4 A;  1OWL A;  1N4S A;  5FT9 A;  3TWV A;  1D8D A;  3L54 A;  3MCX A;  2IQC A;  2KC7 A;  5A23 A;  2KZT A;  3J5P A;  1SA5 A;  2Q7F A;  2WXR A;  3C98 A;  4JA7 A;  4JXT A;  2BUG A;  2WXH A;  3SFZ A;  3AG1 E;  2VSN A;  2VGY A;  3HYM B;  4LER A;  5ANR A;  1KZO A;  3MGB A;  4JL0 A;  3UX4 A;  4CGW A;  4HOR A;  2KCV A;  1Y8M A;  1S64 A;  2WXQ A;  3QWP A;  2GRQ B;  4BSX A;  3FUH A;  4F1P A;  3ULQ A;  4ANW A;  4DRX E;  4ANV A;  3TG5 A;  2EIL E;  3TWW A;  2EQX A;  4BER A;  5KJN A;  1E8Y A;  2GRO B;  2R05 A;  3HIZ A;  1K1B A;  2PL2 A;  1E90 A;  2H6H A;  4BTB A;  3RRU A;  1EDU A;  3Q9N C;  4G23 A;  2DYS E;  4G26 A;  5JMN D;  5EIB E;  3LY8 A;  3HXF A;  3N71 A;  5KCM A;  4AEZ C;  4L23 A;  2R5S A;  4BET A;  3UKR G;  1E7V A;  4OAU C;  4WWO A;  4G2V A;  1FVH A;  3FUE A;  4A3V A;  4H7Y A;  2IFU A;  4AVX A;  1FT1 A;  3C3Q A;  4JW1 A;  5HKP A;  1H6K A;  2OV8 A;  4BTA A;  1O5M A;  3QK0 A;  4HOQ A;  3SD5 A;  3EUV A;  4HB5 A;  3DBS A;  4G8K A;  4N5Q A;  3D9K A;  2AXZ A;  3LPZ A;  4HLE A;  1ELR A;  1E8Z A;  1UJJ A;  3FUF A;  4LSZ E;  3QOU A;  2WVI A;  5CEC B;  2UY1 B;  3DSV A;  3UKU G;  1OWN A;  3S7D A;  4CT0 A;  1OT8 A;  2F0Y A;  4PH4 B;  4Q94 A;  3UM1 A;  4JA9 A;  2RFM A;  4MBG A;  4GZC A;  4HXI A;  1MX2 A;  1OCC E;  5BNW A;  3AG2 E;  1N0R A;  4EPZ A;  3CEQ A;  2FO7 A;  4XZ4 A;  3ASH A;  3AS8 A;  3ABK E;  3LY9 A;  4EZK A;  4UWH A;  1HE8 A;  4CRW A;  2E2E A;  1TJF A;  1V55 E;  2LAI A;  4XEI G;  2DZN A;  2C2L A;  3E4B A;  4WND A;  5AYW D;  3CHQ A;  5B3S E;  3D9O A;  3FU5 A;  4I9E A;  2EIN E;  1D9S A;  2AW6 A;  2VJ8 A;  3U3W A;  3I4G A;  2AXV A;  4I2W A;  3FHE A;  1N95 A;  4OAV B;  4PS8 A;  2EIJ E;  1JWF A;  4P29 A;  3CHR A;  1BI7 B;  3SZ7 A;  4L1B A;  4O1O A;  4JB8 P;  3SNX A;  3E37 A;  4G24 A;  2VYI A;  2OVF A;  2OOE A;  4Y6C A;  4KZ0 A;  1AWC B;  3NAW A;  4KT6 B;  3GYZ A;  4GZ5 A;  1BU9 A;  4N3C A;  3E32 A;  4CDN A;  3FU0 A;  1NFI E;  5DBK A;  3DWL G;  4TXP A;  4EQF A;  2WB2 A;  3T9K A;  4O6F A;  1E8X A;  4CYM D;  4Z68 A;  3QNK A;  3L16 A;  5FIO A;  4L9P A;  2Y4T A;  3QKY A;  4U96 D;  2OEV A;  4FHK A;  3MKQ B;  4AP2 A;  3MKR A;  2HO1 A;  1TN6 A;  4M7C A;  2OCC E;  3NOG D;  3SFX A;  4NQ0 A;  4NRH B;  3E33 A;  1HF8 A;  2XQ0 A;  4GMR A;  1ZU2 A;  1K8K G;  5EIL A;  4ATZ D;  3ML9 A;  1Y6I A;  2V5Q C;  4R7L A;  5CBO A;  3DSS A;  4HRN A;  4Q96 A;  2JEK A;  3FTV A;  4FLB A;  3UTM A;  1JUQ A;  4YVQ C;  5AN8 A;  3MA5 A;  2X6F A;  5G05 J;  1TN7 A;  3WXX A;  3VLF A;  1Z6T A;  3MEK A;  4DI3 A;  4I17 A;  2I1J A;  1ELW A;  1HG2 A;  3DPY A;  5G04 J;  3KEZ A;  1UOH A;  3PDN A;  5HS0 A;  4B0Z A;  2J09 A;  2YHE A;  3OAW A;  3SY2 A;  3ZUV B;  1IXV A;  3CHO A;  5CCL A;  4RG6 A;  1S0P A;  2BKK B;  3FP3 A;  2WQ7 A;  3ONK A;  3ABM E;  2GGF A;  4F3V A;  4RLY A;  4I1A A;  1MJ0 A;  2LXL A;  3LJN A;  4TUM A;  3Q75 A;  5CER B;  4YND A;  3T8K A;  1SQM A;  2CG2 A;  2WXM A;  5HQ8 A;  4AY5 A;  3LYA A;  3P1U A;  2FEZ A;  2M63 A;  3MKQ A;  2WXJ A;  4GCO A;  3ZXS A;  3PRE A;  4U0S A;  2DYR E;  3ZYK A;  3FUN A;  4JHK A;  3AS4 A;  1QNF A;  3NBN B;  3PUK A;  2ZIR A;  4IN3 B;  4K5A B;  1UN9 A;  1YA0 A;  1TR4 A;  2XEV A;  1HS6 A;  4UQX A;  3ZU7 B;  3CHP A;  1QYM A;  3KAE A;  4XI0 A;  5JHA A;  4AV7 A;  4M3O A;  2LSU A;  4WNF A;  2LNI A;  3VLD A;  4DLQ A;  1UJK A;  3X2Q E;  3RAU A;  5T3R A;  3OXF A;  1Z3X A;  4AOF A;  1DCQ A;  2YNQ A;  2PQN A;  3FTX A;  2FI7 A;  2WM9 A;  3D9J A;  4WWN A;  3ENE A;  5FJY A;  2X6I A;  4BES A;  3LDZ A;  5AEN A;  3FDH A;  2EIM E;  2GW1 A;  1SA4 A;  1HG5 A;  5AQ9 A;  3F6Q A;  5AJL A;  2WPV A;  2WXI A;  4WNE A;  4B8C B;  3FUI A;  3HDX A;  5FTP A;  4XI9 A;  2IEJ A;  1HO8 A;  2WXG A;  3APD A;  5KNG A;  3CSF A;  3RO3 A;  3ULY A;  4EBA G;  3FTU A;  3IKO B;  2ETA A;  2RG8 A;  1IKN D;  2HYZ A;  5KJK A;  2R59 A;  3EIJ A;  3TWR A;  2WMO A;  3FEY A;  4GTQ A;  1OXJ A;  4FU3 A;  2XEN A;  5G04 C;  4N2Q A;  2V8S E;  5BUZ A;  5FZS A;  2J4D A;  4HS2 A;  3CVW A;  4FUL A;  1A17 A;  4C9B B;  2IY0 C;  4APO A;  4F6R D;  4E85 A;  1PAQ A;  4HVB A;  2XPZ A;  3W9G A;  4HRM B;  3VTY A;  4GYW A;  4XIF A;  3Q79 A;  2WXF A;  5FQ7 A;  5J08 A;  4ATG A;  3PZ1 A;  3DPD A;  1NA3 A;  4HI8 A;  2ION A;  2KXP C;  1LD7 A;  1N54 A;  2I1K A;  2L6B A;  4FJY A;  3UT8 A;  1U2V G;  1FPP A;  3PZD A;  5AQA A;  3PVL A;  4GTM A;  5EKQ D;  2JLB A;  4FLH A;  4UWK A;  1QQE A;  1OCO E;  3SI5 A;  1H0A A;  1MX4 A;  5JA4 D;  2R03 A;  1N4R A;  3RO2 A;  3S7B A;  5ANL A;  4GAA A;  5CMY A;  1TNB A;  1TJC A;  4O60 A;  3B7R L;  3SBT B;  4GA1 A;  2ILR A;  3MZL B;  5BXU A;  3B95 A;  3FUL A;  2GRR B;  4A55 A;  4L2Y A;  2QYU A;  4WAF A;  4TUU A;  5FZQ A;  3U66 A;  3LJ3 A;  1TNZ A;  3VLE A;  3TJP A;  4DLO A;  3CR3 A;  4CZ2 D;  4GTP A;  4EZJ A;  1MQS A;  2B6C A;  4G8L A;  4GYO A;  4JHJ A;  1X81 A;  2P9N G;  2GRN B;  1AP7 A;  4I43 A;  5EID A;  3R7Q A;  4U7E B;  2MOW A;  2L9B A;  2H6I A;  2AWI A;  4HLL A;  2CHX A;  4RSY A;  2R17 C;  3RRM B;  3QC1 A;  4OVU A;  3PZ2 A;  3QB2 A;  3ESK A;  2J49 A;  3AU4 A;  2DCP A;  1TYQ G;  1H2U A;  3CHS A;  2XCB A;  2X6H A;  4O1P A;  1W3B A;  3PNL B;  2VQ2 A;  3KS2 A;  3I3N A;  4KXK B;  2X38 A;  3BU8 A;  3B7S A;  2Y3A A;  4JEH A;  3ZEF A;  3NB2 A;  3G2W A;  4J8E A;  2VSX E;  4I6E A;  2XZT G;  2VTB B;  4LRZ A;  3V79 K;  1UN8 A;  5BV0 A;  4J8S A;  4U0U A;  5A7D B;  3ESL A;  3DSW A;  5CBN A;  3U4T A;  5EYL A;  4I9C A;  2ZGD A;  3CQG B;  2QYJ A;  4GTT A;  4LEU A;  3B7B A;  5ENS D;  4XE0 A;  4J0U A;  1KT0 A;  2FF4 A;  3FH7 A;  1QBQ A;  3CGH A;  2L0I A;  2DWZ A;  5EX3 A;  3QDN A;  3PH0 C;  4LCT A;  3AS5 A;  3NOC D;  3Q9U C;  1OCZ E;  1JCQ A;  4J7W A;  4N3A A;  4GML A;  3V30 A;  3QAR A;  3Q49 B;  2ETC A;  2ZXW E;  1UW4 B;  3ASO E;  3ASD A;  1ELK A;  1WG0 A;  4TXQ A;  4DI4 A;  3FUJ A;  1H2T C;  4C0M A;  2Y0B G;  4YVO A;  3U64 A;  4PUC A;  3Q7A A;  3CLJ A;  3JCK C;  4GYY A;  5ARG A;  3DSU A;  4Q69 A;  1TN8 A;  3AJI A;  3TG4 A;  3EHR A;  3Q15 A;  4GTR A;  3D9N A;  2UY1 A;  4A63 B;  1IQU A;  2WQ6 A;  1TEZ A;  4DX5 D;  2IOS A;  3CST A;  3G2U A;  3ZYM A;  4J6I A;  1H6P A;  2LSV A;  4BT8 A;  2YHC A;  4G11 A;  1MZC A;  5FQ8 A;  4BWR A;  4PS7 A;  2L6J A;  4UQZ A;  4XX5 A;  2LXM A;  3L82 A;  5T4Y A;  4GPK A;  3LVQ E;  2QC9 A;  3GZS A;  4JD2 G;  4BEP A;  3EJN A;  3L9T A;  2CG3 A;  3UT7 A;  4BX9 A;  2IO2 C;  4TXR A;  3MV2 B;  1OCR E;  4U95 D;  4UWG A;  3FU3 A;  3MV3 B;  4ZFH A;  1ZB1 A;  4GA0 A;  3L22 A;  2HE0 A;  4EEC A;  2DZO A;  4A1S A;  4GZD A;  4ACL A;  5B1B E;  2GRM A;  4FJZ A;  4LNG A;  3HXB A;  4UUC A;  4RVB A;  4F1S A;  3ZW3 A;  4A1G A;  4MKT A;  5CRU A;  2QFC A;  3IV0 A;  1L5J A;  3FEX A;  1BLX B;  5HRY A;  1N94 A;  2WXL A;  3ASG A;  4ME2 A;  5EN5 D;  2CHW A;  5ARF A;  3CVL A;  1NP7 A;  2EIK E;  4UI9 K;  5LFA A;  3UM3 A;  3Q47 B;  5CCM A;  2X6K A;  2NYJ A;  5BV1 A;  2WQH A;  3ZN3 A;  2PZI A;  1Q2Z A;  1RZ4 A;  5ENR D;  3T5X A;  4GMJ A;  2YQ8 A;  3OXG A;  4JZY A;  5G55 A;  3SF4 A;  4YDW A;  3QAQ A;  2ZU6 B;  4CT4 A;  1NL4 A;  1E7U A;  4G1T A;  5ENN A;  5JJ7 A;  3LVR E;  4BX8 A;  4PDX A;  1FT2 A;  2KCK A;  1S70 B;  1TNU A;  1GW6 A;  1DVP A;  2I6H A;  2XZD G;  3RRN B;  3UM0 A;  4HQD A;  5CMW A;  5ENO D;  1PC2 A;  3UUX A;  1DC2 A;  4FA6 A;  3FY4 A;  4BSZ B;  3EIQ C;  4NIK A;  5LOZ A;  3ZRH A;  3JUI A;  3AG3 E;  3JQ0 A;  1WM5 A;  1DCE A;  4ILG A;  3FUM A;  4LNU D;  5C1D A;  3MJW A;  5D66 A;  3CVV A;  1OY3 D;  1XGW A;  3FUD A;  2IF4 A;  2GRL A;  5KNH D;  2XPY A;  4J8Y A;  2F8Y A;  4GZ3 A;  1H19 A;  2J4B A;  1IQR A;  4I1O B;  1EPU A;  5AAR A;  4OYS A;  2WXN A;  5EX0 A;  3T8M A;  2QZA A;  3ULE G;  2P2C P;  2CFU A;  3D9I A;  2C0M A;  3TWT A;  3JQ1 A;  4LUN U;  2BF0 X;  2V0P A;  2AVP A;  3G2T A;  2NXP A;  2Y69 E;  3FU6 A;  3Q7F A;  1OUV A;  3HG0 D;  2DVW A;  5CRV A;  3CKC A;  3FWV A;  2J07 A;  4CEM A;  4I6J A;  3TWX A;  5ITZ F;  4EBA A;  3Q73 A;  2IO3 C;  3P2B A;  3ZNG A;  4XKB A;  4JC8 A;  5D0O D;  1BI8 B;  2XEE A;  1MYO A;  2YIN A;  3CQC B;  4BT9 A;  3RK6 A;  1IHG A;  2OEW A; 
#chains in the Genus database with same CATH homology
 4GTP A;  3HXC A;  1X81 A;  1NI1 A;  1D8E A;  1JCQ A;  3E30 A;  1FT1 A;  1DCE A;  4GTO A;  1N95 A;  1TNY A;  3DSS A;  4GTS A;  3C72 A;  4GTV A;  1N9A A;  4EHM A;  1TN7 A;  1N4S A;  3DSX A;  3Q79 A;  1O5M A;  2BED A;  4LNB A;  3KSQ A;  1D8D A;  3EUV A;  2H6I A;  3PZ1 A;  3PZ3 A;  4LNG A;  3HXB A;  3DPY A;  3E37 A;  1S63 A;  3Q7A A;  3DSU A;  3DRA A;  4YDO A;  1SA5 A;  1KZP A;  3PZ2 A;  1LD7 A;  3SFY A;  1N94 A;  1TN8 A;  3HXE A;  3DSV A;  1SA4 A;  1LTX A;  1JCS A;  1JCR A;  3E32 A;  1FPP A;  4GTR A;  3HXD A;  4GTM A;  2IEJ A;  2F0Y A;  1KZO A;  3Q75 A;  1LD8 A;  1N4Q A;  3Q7F A;  4MBG A;  3EU5 A;  1N4R A;  1S64 A;  1O1R A;  3Q78 A;  1TNB A;  4L9P A;  1MZC A;  1NL4 A;  1O1S A;  2ZIS A;  4GTQ A;  3E34 A;  3DSW A;  3Q73 A;  3KSL A;  1O1T A;  1FT2 A;  2H6G A;  4GTT A;  1TNO A;  4YDE A;  2ZIR A;  1TNU A;  1TN6 A;  3DST A;  2H6H A;  3SFX A;  2H6F A;  3PZ4 A;  3E33 A;  2R2L A;  3HXF A;  1N4P A;  1QBQ A;  1TNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...