3UIOC

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
total genus 50
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2011-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 3uioC00
3UIOC 2GRNB 2GRRB 3UIPC 1KPSB 1Z5SC 2IY0C 2GRPB 2GROB 2GRQB 3UINC 5D2MC 2IO2C 2IO3C
chains in the Genus database with same CATH superfamily
2HO1A 3CHRA 3ZYQA 4GPMA 3CIAA 3FULA 1B89A 5AAOA 5HQ8A 1YMPA 2LSUA 3FEYA 3CGHA 2P9UG 1ZU2A 3D9JA 3MJWA 4HOTA 4B93B 3SFXA 2Y69E 1NP7A 4GU5A 3V30A 1TJCA 3APCA 5T8IA 3FTXA 2XQ0A 4N3AA 3PZDA 3DWLG 5A23A 2OV8A 4DX1A 3SY2A 5D66A 2KXPC 5EILA 4LERA 3BG0B 2HR2A 2R2LA 3TXNA 3ZPJA 3HRAA 3ABLE 5G2NA 3ONLA 4GTVA 2QYUA 4XEIG 4PS8A 3NAWA 4CYMD 2FF4A 4KVOA 3UXGA 5EX0A 4Q69A 3Q47B 5LCWC 4HQDA 5FT9A 4R7LA 4GMJA 4G11A 2QYJA 5D0QD 4CT4A 2MYOA 3DRAA 5ANLA 5JHBA 5FINA 4CDMA 1FT1A 4HVBA 4PS3A 3Q49B 5E76A 4RVBA 1MX6A 3ZVVA 2YINA 1Y6IA 3IHVA 4DK5A 4N3CA 4A1SA 4GYWA 4HOUA 4CRWA 1HG2A 3ZNGA 1OWLA 2VSYA 4B8AA 1H19A 3LY7A 1BI7B 4LG6A 2FO1E 2LAHA 2QC9A 2ETAA 1DCEA 4ILIA 3FUDA 1LD7A 4EZLA 3CHPA 1SA5A 1E96B 2AWIA 1OY3D 4I2WA 1ZB1A 3MKRA 2BTDA 4M7CA 3UT7A 3HXEA 2P9IG 2XCCA 4CGVA 3FTZA 3I4GA 1NA0A 1IYGA 2C0MA 3KSQA 3R7QA 2IU1A 2KATA 4BX8A 4AOFA 3IV0A 2GRRB 3IKOB 1N9AA 1YA0A 3GZSA 4UWKA 4YDWA 1KZOA 2VGXB 3PE3A 4JC8A 2LXLA 3ESLA 3K9IA 2LUHA 4ATGA 3D3MA 1LTXA 4HI9A 4QQIA 2J09A 2R17C 3SZ7A 2QY7A 3G2VA 4JVSA 4XI0A 1FCHA 2LXMA 3V2OA 4FLHA 4G8LA 3JYSA 3UPVA 4JB8P 2I6HA 3SQVA 2EIKE 5C1DA 2HM8A 4WNDA 3QNKA 3JUIA 1TEZA 2PZIA 4GZ3A 4HNAD 1HS6A 4AEZC 3ZXPA 4FLBA 1K1AA 4FA6A 2X3MA 3AG3E 1IXVA 3OXGA 4KVMA 4F53A 3ZEFA 5BT1A 3ZYKA 2F8YA 2FULA 4GPKA 4G23A 1EPUA 4MKTA 5LCWJ 3PREA 1TNOA 4PDXA 2WQHA 1N4RA 3D9LA 3UM3A 4ANVA 4UI9C 5AENA 4EPZA 1N4QA 4BFRA 2Y3AA 3LS8A 2MOWA 3NBNB 5CECB 3APDA 2OEVA 3LCAA 2DWZA 3RRUA 1DC2A 5EN5D 3TWUA 3ABKE 2XPIA 4F1SA 3GZ1A 4H7XA 2HYZA 5J90A 4AY6A 3FU3A 3HIZA 4N3BA 2A5EA 4N2SA 4JA9A 4NACA 4JEHA 4E6HA 4DLQA 5LOZA 1V54E 2WXQA 3ESKA 5CBNA 4WNFA 3DBSA 2IO2C 4FP7A 2E0IA 3FP3A 4OVUA 5FQ8A 3P1UA 3DPDA 1OT8A 4J7WA 4JHRA 5AQAA 5AJDA 4MLPA 1FT2A 3VLFA 3FUFA 4GCNA 1A5EA 2QFCA 1NA3A 3BQOA 1WDYA 3LVQE 4XE0A 5B3SE 2ZISA 3L9TA 2WPVA 1JPLA 2XGOA 3U3WA 5T4YA 1AWCB 4GTQA 5EYLA 3ASNE 1UN9A 3NOGD 5JA4D 3TWQA 4LEUA 4MBGA 4HBDA 3CHSA 2R02A 3ZW3A 3FUJA 3CSTA 3S7BA 1TNYA 3B7TA 1MHQA 2L9BA 4DX2A 4BEPA 3LY9A 3QOUA 2CHXA 3AAAC 3LEWA 3P2BA 2Y0BG 2ONDA 2LAIA 5KWDA 2VGYA 3J5PA 2BF0X 4ZHBA 1FVFA 1V55E 3ULEG 1DNPA 3ZKJA 3G2UA 4P29A 2FI7A 3L08A 4J0UA 1W3BA 4BETA 4LSZE 5FIOA 3ISMC 5D0OD 3ZIMA 2P9PG 1TN7A 2VGXA 4UWGA 4Z68A 4Y6CA 5AIJA 1MYOA 5ENQD 4U07A 3ZGQA 3AU5A 5FZQA 4HRMB 4LCTA 3O4ZA 4G8KA 4TXRA 4JD2G 1QBQA 4ACLA 3NOCD 5FJYA 4K03A 1JWFA 4JA7A 2A5UA 4L7TA 1ELWA 4K0RA 4HOQA 5AARA 2IO3C 3QAQA 1JCRA 3UM1A 4K5CA 2AVPA 2ILRA 1N0RA 4ME2A 4GYYA 3DSSA 3JXJA 3CVXA 2RD0A 4HI8A 3OXFA 2XGSA 3MCXA 2L0IA 4CEMA 5G55A 1MX2A 4WAFA 4KBQA 5BUZA 2X6KA 5KJKA 1WG0A 4HORA 4FJYA 3EIJA 3ZFWA 4A3TA 3OAWA 2RG8A 3CVNA 4B0ZA 3CK7A 3EHNA 5KJNA 1MZCA 2YQ8A 1PAQA 3Q9UC 4I1AA 1AP7A 3VTXA 3PH0C 3ZRHA 4MS6A 2X38A 4I6EA 3MV3B 3SFYA 3FH8A 3QC1A 4AV7A 3FFLA 4FULA 4FC8A 3QWPA 2YHCA 4M3OA 4ZFHA 1ELKA 5LP0A 3QDNA 3FTYA 3EUVA 3JUEA 3ZYLA 4C0MA 4U0UA 2EIJE 3E4BA 1S70B 3SD5A 3DSWA 1UW4B 4BERA 5AN8A 4LNGA 1HZ4A 4EECA 4J8SA 2WVIA 3QWWA 4AP2A 2F0YA 4DLOA 1MJ0A 4BSXA 4J8EA 3IHYA 2CG2A 1IHBA 2ZGGA 4GCOA 1Z5SC 2L6BA 4ATZD 2M63A 4E85A 3SO8A 2V8SE 1HF8A 2BKKB 4I6JA 3TWVA 3FHEA 3ZYMA 2R05A 5AYWD 3FTVA 1E8WA 3CKCA 2DIWA 3PEUB 1QNFA 4APFA 4RQIA 1O1SA 1N0QA 5BPPA 1Z3XA 1XGWA 4B94A 1E90A 4EZJA 5EYPF 4TRQA 2LSVA 3JQ1A 1HFAA 2I9CA 1U3CA 1OCOE 2XZTG 4IN3B 4EHMA 2XENA 3EHMA 4G26A 3HYMB 1BPOA 3UINC 4V3IA 2C0LA 3TWSA 4DJAA 4K5AB 3PS6A 3BUAA 3SFZA 3MEKA 1OCRE 3D9OA 2A4ZA 4FJZA 4BTBA 3CVYA 4KXKB 2OEWA 2AXUA 4DI4A 3AS8A 2GW1A 1A17A 4U95D 3N71A 3LKUA 4JXTA 3CVLA 1FVHA 4XKCA 4O60A 2XGMA 4GTMA 1UJKA 4U8VD 3TXMA 3TWXA 5CMWA 1H2TC 5CEAA 3S7DA 2DCPA 1K1BA 1N4SA 2XHEA 3SI5A 3PZ4A 4GZ5A 3CHOA 2ZIRA 5EKQD 4FU3A 2CHZA 1BI8B 2V5QC 2YHEA 1SZAA 2GGFA 3ML9A 4I1MA 4KT6B 3AG4E 1X5BA 4L2LA 1PY1A 3FU5A 3ULYA 4JPSA 5EDSA 4URKA 1SQMA 4JZYA 1Y8MA 1L5JA 4ANXA 4BX9A 3DPYA 5FQ7A 3LY8A 1WAO1 2DYSE 3FY4A 1YCSB 1S64A 5KNHD 3VTYA 3D9MA 5FTPA 3MGBA 1NI1A 3URZA 2XRYA 1H2VC 4A1GA 3MX3A 2WXKA 5ENNA 4G24A 2JLBA 3Q79A 2WXRA 3SBSA 3PZ2A 1DCQA 5KCMA 4GTRA 2H6FA 2R5SA 2WMNA 1ZBPA 4J6IA 3QKYA 1E8ZA 4DI3A 3CQCB 3UT8A 3BU8A 4LNUD 4AM9A 3NQPA 1TYQG 4OAVB 4OVVA 3D9PA 3J5QB 3T8KA 1OWOA 1N54A 5CCMA 2XRZA 1H6OA 4D10C 4Y6WA 3KS2A 3GZ2A 4U8HA 3DEOA 3RIBA 4FADA 1IKND 1Z6TA 2WB2A 1OWNA 5A7DB 2PM6A 4YDEA 4AIFA 1DVPA 4U0ZA 2DYRE 2L6JA 2GRNB 1QQEA 2WXLA 1UJJA 4RSYA 5E75A 5EX3A 3MKQB 3L54A 3ML8A 3TG5A 3MA5A 3PNLB 1RZ4A 2LO6A 3C72A 2ETCA 3ASHA 2L0TB 4C0EA 4N5QA 3LVRE 3KEAA 3D9IA 2WXMA 3TWRA 2IQCA 1IQRA 1MQSA 4GA0A 4HLEA 3Q73A 4IULA 5BV1A 2IF4A 1EF1C 4BT9A 3JXIA 4WNGA 2DZNA 2RKKA 1TN8A 3CVQA 2BKGA 5B1AE 3Q9NC 2PQNA 2I1JA 2OVFA 3VLEA 3KD7A 2V0PA 3JQ0A 1INZA 2GRMA 3GW4A 1NFIE 3D9KA 5CBOA 4AY5A 4ABNA 3UIPC 4HFGA 5ENSD 3SNXA 3DEPA 3L82A 2IFUA 3V31A 2CFZA 4TXQA 4U96D 4CCAA 2VTBB 2WM9A 3CK9A 3EIQC 1HG5A 4EZKA 2WXNA 4N39A 1G3NB 4I2ZA 2AXVA 4A63B 4O1PA 3S2AA 3FWVA 3EDTB 4YDYA 2I1KA 3B13A 5ENOD 3L16A 3B95A 1O1RA 2AXZA 4C48B 2DBAA 3I3NA 3ZUVB 5CCLA 4TV3A 4BT8A 1OWMA 3MV2B 1E8YA 3LJNA 5ANRA 3Q7AA 3LJ3A 4UQXA 1NL4A 3EHQA 4GYOA 1LD8A 4U8YD 3SBTB 5T3RA 5AQ7A 1HU3A 3ENEA 3AU4A 4JHKA 5AJLA 3CQGB 3Q75A 2WQ7A 5EIDA 3FH7A 4UQYA 4YVQC 3E37A 5BXOA 3HG0D 3FUKA 3RKVA 4XIFA 1O5MA 1SW6A 2VYIA 3ASDA 3PDNA 3HXDA 4UWLA 4CT0A 4HXIA 1XNFA 4I9CA 2J07A 3CLJA 3SGHA 5BNWA 2F8XK 2IOLA 2B0OE 4KYOB 2CG3A 1RW2A 3L22A 5CRVA 3U4TA 2LNIA 1YYHA 2DVWA 4RG6A 5CERB 2WQ6A 4DPRA 4G1TA 1GW6A 4FHKA 1D8EA 3AS4A 2B6CA 4BSZB 5DBKA 3PEVB 4EBAA 4I9EA 4WNEA 2PQRA 4YNDA 3CSFA 2V4HC 2H6IA 2PNNA 2FBNA 2X6IA 2H6GA 3NF1A 3ULQA 2GRPB 4LUNU 3PZ1A 3CHMA 5BXUA 4ILHB 3AS5A 2UY1B 4ANWA 4CGWA 4J8YA 5ENTD 1HX8A 2XCBA 4BTAA 5CRUA 4U0SA 4NURA 3TL5A 4GZ6A 3U64A 4WWPA 2P9SG 4OYSA 4KMOA 3T5VA 4C9BB 2VQ2A 1U2VG 4JL0A 4U63A 3UM0A 4EBAG 2EIME 3L13A 3EHRA 5LFAA 3EU5A 4XX5A 3R9AB 1N95A 2KM4A 1UG3A 2XPZA 3CEQA 5JJ7A 4ACKA 2V5FA 3RRMB 3NZSA 2FEZA 4PH4B 3V79K 1BU9A 3KEZA 2XEVA 4AVXA 3T5XA 1KT1A 1MX4A 4J8FA 3FU0A 2YNQA 2ZXWE 4EQFA 4RG9A 2P2CP 5J08A 5JHAA 2J4DA 3SF4A 4NQ0A 4PUCA 2IEJA 2VTBA 1OCZE 3VLDA 3CV0A 4X8QA 3QK0A 4IYPA 2CFUA 2MHKA 1K8KG 4RLYA 4ILGA 1UN8A 2IY0C 3QWVA 2WXHA 3SHFA 3FU6A 4Q94A 2X6HA 3S7FA 3CK8A 4WWNA 1HH8A 4GMRA 4G25A 4YVOA 5FZRA 3TJPA 4HLLA 5FQ6A 4BWRA 4L9PA 3FUIA 3E33A 4WUYA 3UKUG 2JABA 1TNUA 3RO2A 4UQZA 4L1BA 1OXJA 3PNTB 4AJWA 3FDHA 4F3VA 4GAAA 1IQUA 3DXKG 3E30A 2WXIA 2KZTB 1TN6A 3ZXSA 3UMVA 3APFA 3DXMG 1N4PA 1BLXB 1BD8A 2WXOA 5ENPD 1LF8A 1HO8A 5ARGA 3QARA 3U66A 2MRIA 4GB9A 5G04C 5JJTA 3G2SA 4JW1A 3PUKA 1O1TA 1NZNA 3T9KA 3UUXA 5D2MC 3S7JA 3PZ3A 3PUJA 3W9FA 3ASFA 4UUCA 4B89A 3ONKA 1KT0A 2F37A 3B7RL 3BEEA 3ASGA 4F6RD 3RSEG 4L23A 4GTSA 2X6FA 2IJGX 5G05J 3LYAA 5LX8A 3NZUA 4XKBA 3HDXA 1N11A 2KC7A 1H6KA 2EILE 2WXPA 1OCCE 4KZCA 2WXFA 1TJFA 1TR4A 2Q7FA 3EJNA 3F6QA 3G2TA 2VSNA 2WXJA 2QZAA 3ZHEB 4F7AA 2GROB 2ZGDA 1TNZA 5A6CA 4NRHB 4DUIA 2J49A 4PS7A 1PC2A 3FUEA 1JCQA 5HI7A 1D9SA 2GRQB 1FPPA 4I43A 3UI2A 3LPZA 3HXFA 4I1OB 4YDOA 4N5CA 3KSLA 4OAUC 4A3VA 3FH5A 3CVUA 2UY1A 3TAXA 1EYHA 2IONA 4L2YA 3E32A 4B8CB 4JHJA 3JCKC 3HVEB 3RU0A 2I2OA 3UIOC 5ARFA 2FO7A 3RO3A 3U9WA 4GMLA 1H2UA 3OXLA 3FTSA 2XEHA 5KJLA 2NYJA 1QYMA 4O1OA 5BW8C 5KJMA 3DSXA 2HE0A 3CR3A 3PRZA 2P9NG 5CMYA 2DZOA 3R7RA 3AG1E 3Q5MA 3DSVA 3C98A 3O48A 2XEEA 5B1BE 2EINE 2P9KG 2PM7A 3NB2A 3C3QA 4DX5D 4DRXE 3GYZA 1HE8A 4J8DA 3W9GA 1KLXA 2X6JA 3CHQA 3EU9A 3HXBA 3Q15A 3ZN3A 2BUGA 4U7EB 4MRUA 3RK6A 3UQ3A 2WXGA 5M72A 4CDNA 3MYVA 2XZDG 5BV0A 4O6FA 3B7UX 5HRYA 4TUMA 3FUHA 3CVVA 4LRZA 2UWJG 2H6HA 1N94A 3TGOA 2Y1LE 3KAEA 3QB2A 4CDRA 5G04J 3T8MA 4IRUA 4HS2A 3DSUA 4GTTA 1Z3YA 2XPYA 1EDUA 3FEXA 3D9HA 2OOEA 5ITZF 4GA1A 1KZPA 2KCVA 3L17A 4W9RA 3HHMA 5KBAA 3CVWA 3IBEA 3BG1B 1H6PA 3AG2E 4HRNA 3FTUA 4I6GA 2KZTA 2VJ8A 2RFMA 3C3RA 5FQ4A 5HS0A 3B7SA 3MZLB 3X2QE 1UOHA 3TWTA 2XS8A 3WXXA 1E7VA 2E2EA 5C2YA 4BESA 2J08A 3Q78A 5JMND 1E7UA 2BEDA 3L6AA 2NC9A 4XZ4A 3IEGA 1WM5A 2AJAA 3I5PA 4XI9A 2V4LA 3RRNB 2NSZA 5AQBA 1SA4A 2P58C 4HRLA 3TWWA 5FWQA 4FHJA 4ANUA 3UM2A 2R03A 1Q2ZA 3DSTA 4APOA 4KZ0A 1JUQA 2P9LG 4NIKA 4K5BA 4G2VA 4BY6A 3HXCA 5EIBE 4DX6D 1OUVA 4UWFA 4TXPA 3ASOE 1IHGA 4A55A 3OTNA 4LNBA 3D9NA 4N2QA 5HKPA 3E34A 1SZ9A 4HOSA 3ZHEA 1U3DA 2J8SD 3LDZA 3ABME 2Y4UA 3LXUX 5AQ9A 4UI9K 5ENRD 5IY5E 2VGEA 3RJVA 4GZCA 3RAUA 4H7YA 3CVPA 4AXHA 2VSOE 1JWGA 2WMOA 3PE4A 5DIZA 2VSXE 3IXEA 5CEDB 2JEKA 2OCCE 3UKRG 2CHWA 2Y4TA 4QFVA 1VDYA 4WWOA 2KBXA 3QJZA 4JEUA 3HVEA 2ETBA 3WG7E 4UI9J 4GA2A 4GTPA 1JCSA 2OVBA 2NXPA 3V2XA 5CHEE 4U04A 2GRLA 2J4BA 2J9QA 1QZ2A 4GZDA 2KCLA 2EQXA 4HB5A 1OWPA 3FUNA 3UT4A 1H0AA 3C3OA 3G2WA 3ZU7B 1P5QA 2PL2A 1KPSB 4I17A 2ZU6B 4Q96A 5FZSA 3R9MA 3Q7FA 4DX7D 2XS1A 3AJIA 3TG4A 3B7BA 2C2LA 3UX4A 3FTWA 3MKQA 2RFAA 4GTOA 3FUMA 1WY6A 2KCKA 1TNBA 5G05C 3I4RB 4F1PA 1S0PA 1S63A 3Q4AB 1D8DA 2R59A 1ELRA 1N52A 2AW6A 3UTMA 3PVLA 1SVXA 1X81A 4CZ2D 5H7PA 5KNGA 4UWHA 3C5RA 1HXIA 1K3ZD 1E8XA 2IOSA 4TUUA 3CKBA 5JJ6A
chains in the Genus database with same CATH topology
3UIOC 2GRNB 2GRRB 3UIPC 1KPSB 1Z5SC 2IY0C 2GRPB 2GROB 2GRQB 3UINC 5D2MC 2IO2C 2IO3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIO C;  2GRN B;  2GRR B;  3UIP C;  1KPS B;  1Z5S C;  2IY0 C;  2GRP B;  2GRO B;  2GRQ B;  3UIN C;  5D2M C;  2IO2 C;  2IO3 C; 
#chains in the Genus database with same CATH topology
 2HO1 A;  3CHR A;  3ZYQ A;  4GPM A;  3CIA A;  3FUL A;  1B89 A;  5AAO A;  5HQ8 A;  1YMP A;  2LSU A;  3FEY A;  3CGH A;  2P9U G;  1ZU2 A;  3D9J A;  3MJW A;  4HOT A;  4B93 B;  3SFX A;  2Y69 E;  1NP7 A;  4GU5 A;  3V30 A;  1TJC A;  3APC A;  5T8I A;  3FTX A;  2XQ0 A;  4N3A A;  3PZD A;  3DWL G;  5A23 A;  2OV8 A;  4DX1 A;  3SY2 A;  5D66 A;  2KXP C;  5EIL A;  4LER A;  3BG0 B;  2HR2 A;  2R2L A;  3TXN A;  3ZPJ A;  3HRA A;  3ABL E;  5G2N A;  3ONL A;  4GTV A;  2QYU A;  4XEI G;  4PS8 A;  3NAW A;  4CYM D;  2FF4 A;  4KVO A;  3UXG A;  5EX0 A;  4Q69 A;  3Q47 B;  5LCW C;  4HQD A;  5FT9 A;  4R7L A;  4GMJ A;  4G11 A;  2QYJ A;  5D0Q D;  4CT4 A;  2MYO A;  3DRA A;  5ANL A;  5JHB A;  5FIN A;  4CDM A;  1FT1 A;  4HVB A;  4PS3 A;  3Q49 B;  5E76 A;  4RVB A;  1MX6 A;  3ZVV A;  2YIN A;  1Y6I A;  3IHV A;  4DK5 A;  4N3C A;  4A1S A;  4GYW A;  4HOU A;  4CRW A;  1HG2 A;  3ZNG A;  1OWL A;  2VSY A;  4B8A A;  1H19 A;  3LY7 A;  1BI7 B;  4LG6 A;  2FO1 E;  2LAH A;  2QC9 A;  2ETA A;  1DCE A;  4ILI A;  3FUD A;  1LD7 A;  4EZL A;  3CHP A;  1SA5 A;  1E96 B;  2AWI A;  1OY3 D;  4I2W A;  1ZB1 A;  3MKR A;  2BTD A;  4M7C A;  3UT7 A;  3HXE A;  2P9I G;  2XCC A;  4CGV A;  3FTZ A;  3I4G A;  1NA0 A;  1IYG A;  2C0M A;  3KSQ A;  3R7Q A;  2IU1 A;  2KAT A;  4BX8 A;  4AOF A;  3IV0 A;  2GRR B;  3IKO B;  1N9A A;  1YA0 A;  3GZS A;  4UWK A;  4YDW A;  1KZO A;  2VGX B;  3PE3 A;  4JC8 A;  2LXL A;  3ESL A;  3K9I A;  2LUH A;  4ATG A;  3D3M A;  1LTX A;  4HI9 A;  4QQI A;  2J09 A;  2R17 C;  3SZ7 A;  2QY7 A;  3G2V A;  4JVS A;  4XI0 A;  1FCH A;  2LXM A;  3V2O A;  4FLH A;  4G8L A;  3JYS A;  3UPV A;  4JB8 P;  2I6H A;  3SQV A;  2EIK E;  5C1D A;  2HM8 A;  4WND A;  3QNK A;  3JUI A;  1TEZ A;  2PZI A;  4GZ3 A;  4HNA D;  1HS6 A;  4AEZ C;  3ZXP A;  4FLB A;  1K1A A;  4FA6 A;  2X3M A;  3AG3 E;  1IXV A;  3OXG A;  4KVM A;  4F53 A;  3ZEF A;  5BT1 A;  3ZYK A;  2F8Y A;  2FUL A;  4GPK A;  4G23 A;  1EPU A;  4MKT A;  5LCW J;  3PRE A;  1TNO A;  4PDX A;  2WQH A;  1N4R A;  3D9L A;  3UM3 A;  4ANV A;  4UI9 C;  5AEN A;  4EPZ A;  1N4Q A;  4BFR A;  2Y3A A;  3LS8 A;  2MOW A;  3NBN B;  5CEC B;  3APD A;  2OEV A;  3LCA A;  2DWZ A;  3RRU A;  1DC2 A;  5EN5 D;  3TWU A;  3ABK E;  2XPI A;  4F1S A;  3GZ1 A;  4H7X A;  2HYZ A;  5J90 A;  4AY6 A;  3FU3 A;  3HIZ A;  4N3B A;  2A5E A;  4N2S A;  4JA9 A;  4NAC A;  4JEH A;  4E6H A;  4DLQ A;  5LOZ A;  1V54 E;  2WXQ A;  3ESK A;  5CBN A;  4WNF A;  3DBS A;  2IO2 C;  4FP7 A;  2E0I A;  3FP3 A;  4OVU A;  5FQ8 A;  3P1U A;  3DPD A;  1OT8 A;  4J7W A;  4JHR A;  5AQA A;  5AJD A;  4MLP A;  1FT2 A;  3VLF A;  3FUF A;  4GCN A;  1A5E A;  2QFC A;  1NA3 A;  3BQO A;  1WDY A;  3LVQ E;  4XE0 A;  5B3S E;  2ZIS A;  3L9T A;  2WPV A;  1JPL A;  2XGO A;  3U3W A;  5T4Y A;  1AWC B;  4GTQ A;  5EYL A;  3ASN E;  1UN9 A;  3NOG D;  5JA4 D;  3TWQ A;  4LEU A;  4MBG A;  4HBD A;  3CHS A;  2R02 A;  3ZW3 A;  3FUJ A;  3CST A;  3S7B A;  1TNY A;  3B7T A;  1MHQ A;  2L9B A;  4DX2 A;  4BEP A;  3LY9 A;  3QOU A;  2CHX A;  3AAA C;  3LEW A;  3P2B A;  2Y0B G;  2OND A;  2LAI A;  5KWD A;  2VGY A;  3J5P A;  2BF0 X;  4ZHB A;  1FVF A;  1V55 E;  3ULE G;  1DNP A;  3ZKJ A;  3G2U A;  4P29 A;  2FI7 A;  3L08 A;  4J0U A;  1W3B A;  4BET A;  4LSZ E;  5FIO A;  3ISM C;  5D0O D;  3ZIM A;  2P9P G;  1TN7 A;  2VGX A;  4UWG A;  4Z68 A;  4Y6C A;  5AIJ A;  1MYO A;  5ENQ D;  4U07 A;  3ZGQ A;  3AU5 A;  5FZQ A;  4HRM B;  4LCT A;  3O4Z A;  4G8K A;  4TXR A;  4JD2 G;  1QBQ A;  4ACL A;  3NOC D;  5FJY A;  4K03 A;  1JWF A;  4JA7 A;  2A5U A;  4L7T A;  1ELW A;  4K0R A;  4HOQ A;  5AAR A;  2IO3 C;  3QAQ A;  1JCR A;  3UM1 A;  4K5C A;  2AVP A;  2ILR A;  1N0R A;  4ME2 A;  4GYY A;  3DSS A;  3JXJ A;  3CVX A;  2RD0 A;  4HI8 A;  3OXF A;  2XGS A;  3MCX A;  2L0I A;  4CEM A;  5G55 A;  1MX2 A;  4WAF A;  4KBQ A;  5BUZ A;  2X6K A;  5KJK A;  1WG0 A;  4HOR A;  4FJY A;  3EIJ A;  3ZFW A;  4A3T A;  3OAW A;  2RG8 A;  3CVN A;  4B0Z A;  3CK7 A;  3EHN A;  5KJN A;  1MZC A;  2YQ8 A;  1PAQ A;  3Q9U C;  4I1A A;  1AP7 A;  3VTX A;  3PH0 C;  3ZRH A;  4MS6 A;  2X38 A;  4I6E A;  3MV3 B;  3SFY A;  3FH8 A;  3QC1 A;  4AV7 A;  3FFL A;  4FUL A;  4FC8 A;  3QWP A;  2YHC A;  4M3O A;  4ZFH A;  1ELK A;  5LP0 A;  3QDN A;  3FTY A;  3EUV A;  3JUE A;  3ZYL A;  4C0M A;  4U0U A;  2EIJ E;  3E4B A;  1S70 B;  3SD5 A;  3DSW A;  1UW4 B;  4BER A;  5AN8 A;  4LNG A;  1HZ4 A;  4EEC A;  4J8S A;  2WVI A;  3QWW A;  4AP2 A;  2F0Y A;  4DLO A;  1MJ0 A;  4BSX A;  4J8E A;  3IHY A;  2CG2 A;  1IHB A;  2ZGG A;  4GCO A;  1Z5S C;  2L6B A;  4ATZ D;  2M63 A;  4E85 A;  3SO8 A;  2V8S E;  1HF8 A;  2BKK B;  4I6J A;  3TWV A;  3FHE A;  3ZYM A;  2R05 A;  5AYW D;  3FTV A;  1E8W A;  3CKC A;  2DIW A;  3PEU B;  1QNF A;  4APF A;  4RQI A;  1O1S A;  1N0Q A;  5BPP A;  1Z3X A;  1XGW A;  4B94 A;  1E90 A;  4EZJ A;  5EYP F;  4TRQ A;  2LSV A;  3JQ1 A;  1HFA A;  2I9C A;  1U3C A;  1OCO E;  2XZT G;  4IN3 B;  4EHM A;  2XEN A;  3EHM A;  4G26 A;  3HYM B;  1BPO A;  3UIN C;  4V3I A;  2C0L A;  3TWS A;  4DJA A;  4K5A B;  3PS6 A;  3BUA A;  3SFZ A;  3MEK A;  1OCR E;  3D9O A;  2A4Z A;  4FJZ A;  4BTB A;  3CVY A;  4KXK B;  2OEW A;  2AXU A;  4DI4 A;  3AS8 A;  2GW1 A;  1A17 A;  4U95 D;  3N71 A;  3LKU A;  4JXT A;  3CVL A;  1FVH A;  4XKC A;  4O60 A;  2XGM A;  4GTM A;  1UJK A;  4U8V D;  3TXM A;  3TWX A;  5CMW A;  1H2T C;  5CEA A;  3S7D A;  2DCP A;  1K1B A;  1N4S A;  2XHE A;  3SI5 A;  3PZ4 A;  4GZ5 A;  3CHO A;  2ZIR A;  5EKQ D;  4FU3 A;  2CHZ A;  1BI8 B;  2V5Q C;  2YHE A;  1SZA A;  2GGF A;  3ML9 A;  4I1M A;  4KT6 B;  3AG4 E;  1X5B A;  4L2L A;  1PY1 A;  3FU5 A;  3ULY A;  4JPS A;  5EDS A;  4URK A;  1SQM A;  4JZY A;  1Y8M A;  1L5J A;  4ANX A;  4BX9 A;  3DPY A;  5FQ7 A;  3LY8 A;  1WAO 1;  2DYS E;  3FY4 A;  1YCS B;  1S64 A;  5KNH D;  3VTY A;  3D9M A;  5FTP A;  3MGB A;  1NI1 A;  3URZ A;  2XRY A;  1H2V C;  4A1G A;  3MX3 A;  2WXK A;  5ENN A;  4G24 A;  2JLB A;  3Q79 A;  2WXR A;  3SBS A;  3PZ2 A;  1DCQ A;  5KCM A;  4GTR A;  2H6F A;  2R5S A;  2WMN A;  1ZBP A;  4J6I A;  3QKY A;  1E8Z A;  4DI3 A;  3CQC B;  3UT8 A;  3BU8 A;  4LNU D;  4AM9 A;  3NQP A;  1TYQ G;  4OAV B;  4OVV A;  3D9P A;  3J5Q B;  3T8K A;  1OWO A;  1N54 A;  5CCM A;  2XRZ A;  1H6O A;  4D10 C;  4Y6W A;  3KS2 A;  3GZ2 A;  4U8H A;  3DEO A;  3RIB A;  4FAD A;  1IKN D;  1Z6T A;  2WB2 A;  1OWN A;  5A7D B;  2PM6 A;  4YDE A;  4AIF A;  1DVP A;  4U0Z A;  2DYR E;  2L6J A;  2GRN B;  1QQE A;  2WXL A;  1UJJ A;  4RSY A;  5E75 A;  5EX3 A;  3MKQ B;  3L54 A;  3ML8 A;  3TG5 A;  3MA5 A;  3PNL B;  1RZ4 A;  2LO6 A;  3C72 A;  2ETC A;  3ASH A;  2L0T B;  4C0E A;  4N5Q A;  3LVR E;  3KEA A;  3D9I A;  2WXM A;  3TWR A;  2IQC A;  1IQR A;  1MQS A;  4GA0 A;  4HLE A;  3Q73 A;  4IUL A;  5BV1 A;  2IF4 A;  1EF1 C;  4BT9 A;  3JXI A;  4WNG A;  2DZN A;  2RKK A;  1TN8 A;  3CVQ A;  2BKG A;  5B1A E;  3Q9N C;  2PQN A;  2I1J A;  2OVF A;  3VLE A;  3KD7 A;  2V0P A;  3JQ0 A;  1INZ A;  2GRM A;  3GW4 A;  1NFI E;  3D9K A;  5CBO A;  4AY5 A;  4ABN A;  3UIP C;  4HFG A;  5ENS D;  3SNX A;  3DEP A;  3L82 A;  2IFU A;  3V31 A;  2CFZ A;  4TXQ A;  4U96 D;  4CCA A;  2VTB B;  2WM9 A;  3CK9 A;  3EIQ C;  1HG5 A;  4EZK A;  2WXN A;  4N39 A;  1G3N B;  4I2Z A;  2AXV A;  4A63 B;  4O1P A;  3S2A A;  3FWV A;  3EDT B;  4YDY A;  2I1K A;  3B13 A;  5ENO D;  3L16 A;  3B95 A;  1O1R A;  2AXZ A;  4C48 B;  2DBA A;  3I3N A;  3ZUV B;  5CCL A;  4TV3 A;  4BT8 A;  1OWM A;  3MV2 B;  1E8Y A;  3LJN A;  5ANR A;  3Q7A A;  3LJ3 A;  4UQX A;  1NL4 A;  3EHQ A;  4GYO A;  1LD8 A;  4U8Y D;  3SBT B;  5T3R A;  5AQ7 A;  1HU3 A;  3ENE A;  3AU4 A;  4JHK A;  5AJL A;  3CQG B;  3Q75 A;  2WQ7 A;  5EID A;  3FH7 A;  4UQY A;  4YVQ C;  3E37 A;  5BXO A;  3HG0 D;  3FUK A;  3RKV A;  4XIF A;  1O5M A;  1SW6 A;  2VYI A;  3ASD A;  3PDN A;  3HXD A;  4UWL A;  4CT0 A;  4HXI A;  1XNF A;  4I9C A;  2J07 A;  3CLJ A;  3SGH A;  5BNW A;  2F8X K;  2IOL A;  2B0O E;  4KYO B;  2CG3 A;  1RW2 A;  3L22 A;  5CRV A;  3U4T A;  2LNI A;  1YYH A;  2DVW A;  4RG6 A;  5CER B;  2WQ6 A;  4DPR A;  4G1T A;  1GW6 A;  4FHK A;  1D8E A;  3AS4 A;  2B6C A;  4BSZ B;  5DBK A;  3PEV B;  4EBA A;  4I9E A;  4WNE A;  2PQR A;  4YND A;  3CSF A;  2V4H C;  2H6I A;  2PNN A;  2FBN A;  2X6I A;  2H6G A;  3NF1 A;  3ULQ A;  2GRP B;  4LUN U;  3PZ1 A;  3CHM A;  5BXU A;  4ILH B;  3AS5 A;  2UY1 B;  4ANW A;  4CGW A;  4J8Y A;  5ENT D;  1HX8 A;  2XCB A;  4BTA A;  5CRU A;  4U0S A;  4NUR A;  3TL5 A;  4GZ6 A;  3U64 A;  4WWP A;  2P9S G;  4OYS A;  4KMO A;  3T5V A;  4C9B B;  2VQ2 A;  1U2V G;  4JL0 A;  4U63 A;  3UM0 A;  4EBA G;  2EIM E;  3L13 A;  3EHR A;  5LFA A;  3EU5 A;  4XX5 A;  3R9A B;  1N95 A;  2KM4 A;  1UG3 A;  2XPZ A;  3CEQ A;  5JJ7 A;  4ACK A;  2V5F A;  3RRM B;  3NZS A;  2FEZ A;  4PH4 B;  3V79 K;  1BU9 A;  3KEZ A;  2XEV A;  4AVX A;  3T5X A;  1KT1 A;  1MX4 A;  4J8F A;  3FU0 A;  2YNQ A;  2ZXW E;  4EQF A;  4RG9 A;  2P2C P;  5J08 A;  5JHA A;  2J4D A;  3SF4 A;  4NQ0 A;  4PUC A;  2IEJ A;  2VTB A;  1OCZ E;  3VLD A;  3CV0 A;  4X8Q A;  3QK0 A;  4IYP A;  2CFU A;  2MHK A;  1K8K G;  4RLY A;  4ILG A;  1UN8 A;  2IY0 C;  3QWV A;  2WXH A;  3SHF A;  3FU6 A;  4Q94 A;  2X6H A;  3S7F A;  3CK8 A;  4WWN A;  1HH8 A;  4GMR A;  4G25 A;  4YVO A;  5FZR A;  3TJP A;  4HLL A;  5FQ6 A;  4BWR A;  4L9P A;  3FUI A;  3E33 A;  4WUY A;  3UKU G;  2JAB A;  1TNU A;  3RO2 A;  4UQZ A;  4L1B A;  1OXJ A;  3PNT B;  4AJW A;  3FDH A;  4F3V A;  4GAA A;  1IQU A;  3DXK G;  3E30 A;  2WXI A;  2KZT B;  1TN6 A;  3ZXS A;  3UMV A;  3APF A;  3DXM G;  1N4P A;  1BLX B;  1BD8 A;  2WXO A;  5ENP D;  1LF8 A;  1HO8 A;  5ARG A;  3QAR A;  3U66 A;  2MRI A;  4GB9 A;  5G04 C;  5JJT A;  3G2S A;  4JW1 A;  3PUK A;  1O1T A;  1NZN A;  3T9K A;  3UUX A;  5D2M C;  3S7J A;  3PZ3 A;  3PUJ A;  3W9F A;  3ASF A;  4UUC A;  4B89 A;  3ONK A;  1KT0 A;  2F37 A;  3B7R L;  3BEE A;  3ASG A;  4F6R D;  3RSE G;  4L23 A;  4GTS A;  2X6F A;  2IJG X;  5G05 J;  3LYA A;  5LX8 A;  3NZU A;  4XKB A;  3HDX A;  1N11 A;  2KC7 A;  1H6K A;  2EIL E;  2WXP A;  1OCC E;  4KZC A;  2WXF A;  1TJF A;  1TR4 A;  2Q7F A;  3EJN A;  3F6Q A;  3G2T A;  2VSN A;  2WXJ A;  2QZA A;  3ZHE B;  4F7A A;  2GRO B;  2ZGD A;  1TNZ A;  5A6C A;  4NRH B;  4DUI A;  2J49 A;  4PS7 A;  1PC2 A;  3FUE A;  1JCQ A;  5HI7 A;  1D9S A;  2GRQ B;  1FPP A;  4I43 A;  3UI2 A;  3LPZ A;  3HXF A;  4I1O B;  4YDO A;  4N5C A;  3KSL A;  4OAU C;  4A3V A;  3FH5 A;  3CVU A;  2UY1 A;  3TAX A;  1EYH A;  2ION A;  4L2Y A;  3E32 A;  4B8C B;  4JHJ A;  3JCK C;  3HVE B;  3RU0 A;  2I2O A;  3UIO C;  5ARF A;  2FO7 A;  3RO3 A;  3U9W A;  4GML A;  1H2U A;  3OXL A;  3FTS A;  2XEH A;  5KJL A;  2NYJ A;  1QYM A;  4O1O A;  5BW8 C;  5KJM A;  3DSX A;  2HE0 A;  3CR3 A;  3PRZ A;  2P9N G;  5CMY A;  2DZO A;  3R7R A;  3AG1 E;  3Q5M A;  3DSV A;  3C98 A;  3O48 A;  2XEE A;  5B1B E;  2EIN E;  2P9K G;  2PM7 A;  3NB2 A;  3C3Q A;  4DX5 D;  4DRX E;  3GYZ A;  1HE8 A;  4J8D A;  3W9G A;  1KLX A;  2X6J A;  3CHQ A;  3EU9 A;  3HXB A;  3Q15 A;  3ZN3 A;  2BUG A;  4U7E B;  4MRU A;  3RK6 A;  3UQ3 A;  2WXG A;  5M72 A;  4CDN A;  3MYV A;  2XZD G;  5BV0 A;  4O6F A;  3B7U X;  5HRY A;  4TUM A;  3FUH A;  3CVV A;  4LRZ A;  2UWJ G;  2H6H A;  1N94 A;  3TGO A;  2Y1L E;  3KAE A;  3QB2 A;  4CDR A;  5G04 J;  3T8M A;  4IRU A;  4HS2 A;  3DSU A;  4GTT A;  1Z3Y A;  2XPY A;  1EDU A;  3FEX A;  3D9H A;  2OOE A;  5ITZ F;  4GA1 A;  1KZP A;  2KCV A;  3L17 A;  4W9R A;  3HHM A;  5KBA A;  3CVW A;  3IBE A;  3BG1 B;  1H6P A;  3AG2 E;  4HRN A;  3FTU A;  4I6G A;  2KZT A;  2VJ8 A;  2RFM A;  3C3R A;  5FQ4 A;  5HS0 A;  3B7S A;  3MZL B;  3X2Q E;  1UOH A;  3TWT A;  2XS8 A;  3WXX A;  1E7V A;  2E2E A;  5C2Y A;  4BES A;  2J08 A;  3Q78 A;  5JMN D;  1E7U A;  2BED A;  3L6A A;  2NC9 A;  4XZ4 A;  3IEG A;  1WM5 A;  2AJA A;  3I5P A;  4XI9 A;  2V4L A;  3RRN B;  2NSZ A;  5AQB A;  1SA4 A;  2P58 C;  4HRL A;  3TWW A;  5FWQ A;  4FHJ A;  4ANU A;  3UM2 A;  2R03 A;  1Q2Z A;  3DST A;  4APO A;  4KZ0 A;  1JUQ A;  2P9L G;  4NIK A;  4K5B A;  4G2V A;  4BY6 A;  3HXC A;  5EIB E;  4DX6 D;  1OUV A;  4UWF A;  4TXP A;  3ASO E;  1IHG A;  4A55 A;  3OTN A;  4LNB A;  3D9N A;  4N2Q A;  5HKP A;  3E34 A;  1SZ9 A;  4HOS A;  3ZHE A;  1U3D A;  2J8S D;  3LDZ A;  3ABM E;  2Y4U A;  3LXU X;  5AQ9 A;  4UI9 K;  5ENR D;  5IY5 E;  2VGE A;  3RJV A;  4GZC A;  3RAU A;  4H7Y A;  3CVP A;  4AXH A;  2VSO E;  1JWG A;  2WMO A;  3PE4 A;  5DIZ A;  2VSX E;  3IXE A;  5CED B;  2JEK A;  2OCC E;  3UKR G;  2CHW A;  2Y4T A;  4QFV A;  1VDY A;  4WWO A;  2KBX A;  3QJZ A;  4JEU A;  3HVE A;  2ETB A;  3WG7 E;  4UI9 J;  4GA2 A;  4GTP A;  1JCS A;  2OVB A;  2NXP A;  3V2X A;  5CHE E;  4U04 A;  2GRL A;  2J4B A;  2J9Q A;  1QZ2 A;  4GZD A;  2KCL A;  2EQX A;  4HB5 A;  1OWP A;  3FUN A;  3UT4 A;  1H0A A;  3C3O A;  3G2W A;  3ZU7 B;  1P5Q A;  2PL2 A;  1KPS B;  4I17 A;  2ZU6 B;  4Q96 A;  5FZS A;  3R9M A;  3Q7F A;  4DX7 D;  2XS1 A;  3AJI A;  3TG4 A;  3B7B A;  2C2L A;  3UX4 A;  3FTW A;  3MKQ A;  2RFA A;  4GTO A;  3FUM A;  1WY6 A;  2KCK A;  1TNB A;  5G05 C;  3I4R B;  4F1P A;  1S0P A;  1S63 A;  3Q4A B;  1D8D A;  2R59 A;  1ELR A;  1N52 A;  2AW6 A;  3UTM A;  3PVL A;  1SVX A;  1X81 A;  4CZ2 D;  5H7P A;  5KNG A;  4UWH A;  3C5R A;  1HXI A;  1K3Z D;  1E8X A;  2IOS A;  4TUU A;  3CKB A;  5JJ6 A; 
#chains in the Genus database with same CATH homology
 3UIO C;  2GRN B;  2GRR B;  3UIP C;  1KPS B;  1Z5S C;  2IY0 C;  2GRP B;  2GRO B;  2GRQ B;  3UIN C;  5D2M C;  2IO2 C;  2IO3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...