3UIOC

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
b'ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
total genus 50
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2011-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 3uioC00
3UIOC 2IO2C 2GROB 1KPSB 1Z5SC 5D2MC 2IO3C 3UINC 2GRQB 2GRRB 2IY0C 3UIPC 2GRNB 2GRPB
chains in the Genus database with same CATH superfamily
1HF8A 1TNOA 2QY7A 3CLJA 4F53A 4YNDA 3BEEA 4HLLA 2Y3AA 4AV7A 3RO2A 3Q78A 3N71A 5BXUA 4URKA 4I6JA 2CFUA 1KPSB 3UPVA 4MKTA 3HYMB 4L1BA 4G8KA 1X81A 4JHKA 4U0UA 4A63B 2PQNA 3KSQA 2V5QC 3FTUA 3AS5A 3MZLB 4WNGA 2LO6A 3UM2A 4I1MA 4JHRA 1IQUA 1MX6A 3HVEB 4PUCA 4CDMA 2EINE 2P9KG 2WXMA 1B89A 3URZA 5ENTD 3L13A 4MRUA 5E75A 3S7FA 3BG1B 4KT6B 2KCVA 1BI8B 2KM4A 4GYOA 2VSOE 3D9HA 3MYVA 1OWPA 2L0TB 1N0RA 3FTVA 4GA0A 4A3TA 4Y6CA 3ESLA 3PS6A 3CVPA 3ZHEA 2PM6A 5ANRA 5KNGA 2PNNA 1BLXB 3QWPA 4GB9A 4J6IA 1YMPA 4IULA 5HQ8A 4RLYA 2XQ0A 3TWVA 3QWVA 5AJLA 5AQAA 3Q7FA 3T5VA 3KD7A 5EX0A 3TXNA 3TL5A 2WXHA 1ZBPA 4MBGA 2WXNA 4WWPA 4HOSA 2LUHA 3RSEG 4Q96A 3MA5A 3UKUG 1IHBA 2YHEA 3CVXA 3TWSA 4JXTA 5EILA 3HG0D 2RFAA 3S7BA 1HXIA 3ZW3A 4G26A 4BTBA 1HE8A 1W3BA 4FJYA 2HE0A 4DUIA 3FDHA 4CYMD 3T5XA 5H7PA 4WNEA 3DXKG 2X6HA 3MV3B 1TNUA 1OCOE 2ZU6B 5FINA 3HHMA 3GZ1A 1BPOA 3ENEA 1ELKA 3IHYA 1K8KG 1TNZA 1DCQA 5CHEE 2ZGGA 3WG7E 3ULYA 1QYMA 3CSFA 4RG9A 2VGXB 4LRZA 1RZ4A 3Q73A 2EQXA 3JXIA 3L16A 1SZAA 3CVWA 3QJZA 2Y4TA 4KBQA 3LDZA 1UN8A 4GCNA 3V31A 5CMYA 2DCPA 3HXBA 5ANLA 2UY1B 4QQIA 4C0MA 5EX3A 3FP3A 2C0MA 2EIKE 3SO8A 4DPRA 4GZCA 2GRNB 2XGSA 3AG2E 4GPKA 2R05A 3Q47B 1QNFA 3AAAC 5G2NA 4CT4A 4GTVA 1E8XA 4XIFA 3P2BA 1DVPA 1NFIE 4WNFA 3L54A 2KBXA 3FUMA 3ISMC 4N5QA 3CSTA 1OWMA 1UOHA 3DSSA 3JCKC 4BT8A 3JUEA 3ZFWA 4I9EA 3NBNB 3CHMA 2WMNA 3R9AB 1IYGA 3KEZA 4TXQA 5DIZA 2XRYA 4KVMA 3S7DA 4U0SA 4GTRA 4XKBA 2Q7FA 3GZSA 2EIME 1FT1A 1H19A 4HQDA 4FU3A 4AY5A 2XGOA 3DPDA 4LUNU 3V2OA 1WAO1 3UM1A 2VSXE 3CR3A 3NOGD 4NIKA 4N39A 1S0PA 5AAOA 4I43A 3R7QA 1HG5A 2OOEA 4CDRA 2GGFA 3LY9A 4J0UA 4J7WA 3SF4A 5AENA 2J4BA 5ENSD 4HLEA 2WXOA 3DSVA 4BESA 1AP7A 5FQ6A 4OVVA 2GRLA 2Y4UA 3C72A 3PE3A 3D9PA 2I1KA 4XEIG 4OVUA 2IO2C 2ONDA 4CCAA 5FQ8A 3WXXA 3B95A 3EU9A 3R7RA 4KVOA 4RSYA 3RO3A 5IY5E 2ETAA 1UN9A 3NZUA 3SFZA 2R2LA 4OAUC 4APOA 4KZCA 4K5BA 2OVFA 4AIFA 4N3AA 3QOUA 2IU1A 4NURA 1OUVA 3B7UX 3ZXPA 4B93B 3JQ0A 4CDNA 2YQ8A 4HB5A 2OEVA 1HH8A 2M63A 4OAVB 3OXLA 3TWUA 3E33A 4UI9C 2I2OA 2RG8A 4L2YA 4BERA 3TGOA 4KXKB 3TWTA 4F7AA 4A1GA 3P1UA 1SA4A 3OTNA 2E2EA 3AG3E 3PNTB 3FUJA 4HNAD 3G2TA 2PL2A 4WWNA 4KMOA 4U07A 3TWWA 4GZ5A 4E85A 1KT0A 1WY6A 3ZKJA 1O1SA 5JJ6A 1N9AA 4ACKA 3Q75A 5KJLA 4BSXA 4APFA 3MKQB 3EU5A 2ZGDA 3FEXA 4LNBA 5HS0A 1Y6IA 3CK8A 3LKUA 1AWCB 2CHWA 5T4YA 4J8SA 1QBQA 1Z5SC 4ABNA 2KZTA 3DRAA 1QQEA 2P9LG 3PEVB 2BKKB 3IHVA 4B94A 1MZCA 3CHSA 4XKCA 1OXJA 3FUDA 1NI1A 4BX8A 4ACLA 3ZPJA 3RJVA 3QK0A 3EIJA 3DSTA 4UQZA 4U8HA 3CGHA 4MLPA 3QC1A 1TJFA 2RKKA 5ENNA 5BV0A 1NA0A 2VGYA 2J9QA 5AIJA 3IEGA 5A7DB 4IN3B 3Q4AB 3UX4A 4GA2A 3PE4A 2XS8A 3RU0A 1O1RA 5ENOD 4PH4B 3SBTB 3FH7A 4BSZB 2NYJA 5BNWA 5J08A 2WM9A 3X2QE 2IFUA 2WB2A 4GTQA 5EIDA 5AARA 5HKPA 4FHKA 3Q7AA 2XS1A 4WUYA 3CHRA 3R9MA 1ZU2A 1JWFA 2OCCE 3EIQC 4CEMA 2P9PG 2ZIRA 5G05C 3E4BA 3HIZA 2FO7A 3CKBA 2KCLA 3CVLA 4DX7D 5AN8A 1TNBA 4YDEA 3PZ2A 1E90A 5HI7A 2DYRE 3HVEA 2IF4A 4G25A 2F0YA 4KZ0A 1KZOA 3U66A 1SZ9A 5BUZA 4HRLA 3PNLB 4TRQA 3FU6A 1NZNA 3QNKA 1N52A 4JC8A 4PS3A 4WWOA 2VQ2A 4BY6A 4G11A 4A1SA 3UMVA 2IO3C 5G05J 4UI9K 2IOLA 2C0LA 3J5PA 1VDYA 1MQSA 3FTWA 3VLDA 4ANWA 2J8SD 4UQYA 3E30A 4JPSA 4XE0A 3LJ3A 3FUHA 4ATGA 3AU4A 4O60A 4N3BA 1UG3A 5ENPD 2WVIA 3U4TA 5LP0A 4ANUA 2XEVA 3BU8A 2R17C 2HYZA 2AWIA 4ZFHA 3V2XA 4EBAA 4HRMB 4A3VA 4GTPA 1H2UA 3ASNE 3FUEA 2GROB 4GTTA 4NRHB 3E32A 3T9KA 4GA1A 2JEKA 2XGMA 4Q94A 2FBNA 4N5CA 4M3OA 3L17A 3SNXA 4FLHA 4V3IA 2VJ8A 3V79K 3KEAA 3U9WA 4HS2A 1G3NB 2LXMA 2XZDG 4LERA 5FZRA 2LSUA 1PY1A 2LAHA 3SGHA 1HZ4A 1V54E 4UUCA 5ARGA 3EHMA 2VGXA 4F3VA 5CEDB 4YVQC 4K03A 3CHQA 3CK7A 4I9CA 2NC9A 3FH8A 1A17A 2J08A 3RAUA 5CMWA 4J8FA 3MGBA 3NZSA 3EDTB 2H6IA 3FU5A 2UY1A 4O1OA 4UWLA 2R03A 3ONLA 3KSLA 5BPPA 3B13A 2V8SE 4CGVA 2VSYA 1D8EA 2FEZA 3D9NA 1TN7A 1OWLA 5CCMA 3FTZA 3Q15A 2B6CA 3ONKA 3S2AA 3UIOC 5T3RA 1QZ2A 4L23A 4TXPA 3B7BA 3SFYA 2GRPB 2WXQA 3CQCB 2XEEA 3C98A 1GW6A 2V0PA 5M72A 3RRNB 1WDYA 4A55A 1YYHA 4JB8P 3ZU7B 4ILIA 5D0OD 3PUKA 4G1TA 5BW8C 4D10C 5C2YA 4GTOA 2EIJE 4I2WA 5EN5D 2IEJA 3CV0A 2QZAA 3KS2A 3ZYLA 4DI3A 3NOCD 2Y69E 1N4RA 4TUMA 2OEWA 3PZ3A 1Y8MA 3V30A 2EILE 4JEHA 2YNQA 2GRMA 4GCOA 3MJWA 1E7VA 2OV8A 3HXDA 3ABKE 4CZ2D 5D66A 4GMRA 4IYPA 3MEKA 2QC9A 2LSVA 3T8KA 2L6JA 2XRZA 1KLXA 2XCCA 2XPZA 5J90A 2V4LA 5CERB 3AS4A 3ZYKA 2Y0BG 1BI7B 4YDYA 4ILGA 4CT0A 3NF1A 1IKND 1E96B 3DEPA 3I4GA 3FFLA 4CRWA 1V55E 1K1AA 3PVLA 2ZXWE 3CK9A 3FU0A 2E0IA 5B1BE 3VTYA 4K5AB 2L0IA 2VTBB 4G23A 3D9JA 5FWQA 4ME2A 2HM8A 3Q79A 3PZDA 4L9PA 4WAFA 4DJAA 3FTYA 4UWFA 5LOZA 4H7YA 4AP2A 4BETA 3VLEA 4W9RA 2V4HC 2NXPA 3IKOB 2X6IA 3LJNA 3TWXA 4BWRA 3NAWA 4XI0A 2WXIA 2DZOA 1EPUA 3MV2B 3ZUVB 5ENQD 4JW1A 4DK5A 4I6EA 4B0ZA 3ZYMA 5CBOA 3MKQA 1YA0A 4YDWA 1PC2A 1Q2ZA 3BUAA 4GMLA 3QB2A 3DEOA 2HR2A 2X6JA 2JABA 1MHQA 1D8DA 2IOSA 4EPZA 3BQOA 4I1AA 2JLBA 4HI9A 4U0ZA 1E7UA 3L82A 1UJJA 3GYZA 4G2VA 3T8MA 4U8YD 3HDXA 1TN6A 2MOWA 1N11A 5DBKA 4UWHA 2CHXA 2OVBA 1OY3D 4G24A 4Q69A 4F1SA 1JCQA 2DZNA 3BG0B 4O6FA 3FUKA 1ELWA 2ETCA 4HVBA 2VSNA 3AG4E 1HU3A 2CG2A 5CRVA 4UWKA 2AXUA 3O48A 5JHAA 4TV3A 4HXIA 2A4ZA 5G04C 3SFXA 5JHBA 2QYJA 3LVRE 2AXZA 4UI9J 1N4SA 3CIAA 2I9CA 4U04A 3LPZA 5AQ7A 4X8QA 3L22A 5JJ7A 3CVVA 2YHCA 3K9IA 1N54A 3UTMA 5C1DA 1H2TC 3LS8A 2AXVA 5CCLA 1TN8A 3FUIA 3W9FA 1S64A 3CEQA 4UWGA 5AYWD 3UUXA 3FUFA 4GPMA 3UT8A 5KJKA 4DX2A 1S63A 4XI9A 5ENRD 1MJ0A 5G04J 3L9TA 3D9KA 1JUQA 4FP7A 3PZ1A 3G2VA 1DNPA 5D2MC 1BD8A 3W9GA 3C3RA 2HO1A 1N0QA 4K0RA 4I1OB 2ILRA 1SA5A 4R7LA 5KCMA 5KJMA 3NB2A 4EHMA 2P58C 4LNGA 3ZIMA 3NQPA 5AQBA 4JA9A 4EBAG 1K1BA 5BV1A 3SQVA 4BT9A 2X3MA 4MS6A 1IQRA 4DX1A 2PQRA 3HXEA 3LVQE 3SBSA 1HO8A 2C2LA 1MYOA 4FADA 4H7XA 3UINC 4YDOA 3PRZA 3OXFA 3L08A 1DCEA 4ANXA 5BXOA 5AQ9A 2MYOA 2R59A 1SQMA 3EJNA 4J8EA 3U64A 4PS7A 1LF8A 5FZQA 1X5BA 1OWOA 1IHGA 2F8YA 2P9NG 5LCWC 1Z6TA 1TNYA 2WXJA 4BEPA 3SZ7A 3G2WA 2FF4A 3U3WA 5FQ7A 4C48B 4FC8A 4XZ4A 1N4QA 2X38A 2X6FA 3TG4A 3VLFA 3D9IA 3OAWA 3HXCA 4FLBA 4O1PA 2P2CP 3FWVA 4GTSA 1LD8A 3CKCA 4K5CA 1OCCE 3GZ2A 3LY8A 4B8CB 4BX9A 3TXMA 3FULA 5LCWJ 4HFGA 5EDSA 4LEUA 4NACA 5EYPF 4AXHA 3Q9UC 4JHJA 1SW6A 5EIBE 3D9LA 4NQ0A 3Q49B 4FULA 4WNDA 2FI7A 1YCSB 2AJAA 3FY4A 1WM5A 4RG6A 1OT8A 5JA4D 4P29A 3ZGQA 3DPYA 3DSXA 2WPVA 1ZB1A 2VYIA 3EHRA 2GRQB 3TJPA 3Q9NC 2PZIA 5FQ4A 3ASFA 2AW6A 1RW2A 5T8IA 3ZVVA 3TWRA 3FH5A 2V5FA 3UQ3A 3TWQA 1U2VG 4JEUA 3IBEA 4AM9A 2F8XK 3AS8A 4B8AA 2A5EA 5D0QD 4JL0A 1H2VC 5JJTA 3EHNA 4AY6A 3SHFA 2WMOA 4GAAA 3MX3A 2WQHA 1O5MA 4GZ3A 4PDXA 4IRUA 5EKQD 4AEZC 2GRRB 4G8LA 3I5PA 5BT1A 1OWNA 4Z68A 1H0AA 1EDUA 4N2QA 1ELRA 4M7CA 3G2SA 3SI5A 1TYQG 4DX5D 4HBDA 3ZXSA 3APCA 2H6GA 3RRMB 4U8VD 2WXPA 3Q5MA 1DC2A 3B7TA 3QARA 4AOFA 2P9UG 4I6GA 3APFA 4GTMA 5A23A 3ZHEB 4HOTA 5HRYA 4ANVA 2CG3A 3E34A 1O1TA 4RQIA 3MCXA 4JVSA 2NSZA 3B7SA 3FTXA 2DYSE 3AJIA 3DBSA 4J8YA 2BUGA 1FVFA 2QFCA 3UT7A 5FT9A 1P5QA 1UJKA 2WQ6A 5EYLA 3LYAA 4KYOB 1NP7A 1LTXA 4I2ZA 2RD0A 5CEAA 3ML8A 3C3OA 3IV0A 3ASGA 2QYUA 2MRIA 4GU5A 1FT2A 3SD5A 3APDA 1XGWA 3DWLG 3JYSA 4GZ6A 4DI4A 4GZDA 3JXJA 2KC7A 4C0EA 1MX4A 2UWJG 5CECB 3G2UA 4XX5A 2R5SA 4DLOA 1HFAA 2XEHA 2WXRA 3PREA 3C3QA 2XPIA 5LX8A 1TR4A 1HX8A 1BU9A 3HXFA 2BF0X 2VGEA 4U7EB 1H6KA 3OXGA 2RFMA 3FHEA 3QAQA 4CGWA 2IONA 3TG5A 2VTBA 3QWWA 3UXGA 2BKGA 4TUUA 2IJGX 1EYHA 3DXMG 5LFAA 3JUIA 3ABLE 1TJCA 5KWDA 4DX6D 2DBAA 4FA6A 2X6KA 4F1PA 3AU5A 2KATA 3ULQA 3PEUB 1WG0A 3CVYA 1OCRE 2BTDA 4Y6WA 2WXGA 1UW4B 1E8ZA 4HRNA 3ABME 5FIOA 4OYSA 5FZSA 4AJWA 2LAIA 4LSZE 2YINA 1FPPA 2I1JA 4GYWA 2J07A 4U95D 1NL4A 4LNUD 3PH0C 3MKRA 3UM3A 2XCBA 4FHJA 3CHOA 2ETBA 4I17A 2MHKA 4PS8A 2WXFA 3AG1E 4FJZA 1NA3A 2ZISA 2L9BA 1SVXA 1LD7A 1L5JA 2LXLA 3CQGB 1Z3XA 1Z3YA 4N3CA 4JA7A 1N4PA 3PZ4A 1KT1A 2WXKA 4BTAA 3FTSA 2GW1A 2Y1LE 4HI8A 2XZTG 3ML9A 4YVOA 4ILHB 3E37A 4EZKA 1XNFA 2KXPC 4HOUA 5ITZF 3L6AA 3O4ZA 2F37A 4EQFA 1H6PA 3CVNA 2XHEA 3QDNA 1A5EA 1OCZE 1PAQA 5FJYA 1JCSA 1N94A 4C9BB 1H6OA 3F6QA 3ZN3A 3B7RL 5KJNA 2PM7A 2LNIA 3CVQA 5FTPA 4EZJA 1D9SA 3D9OA 2KCKA 3ZEFA 4LCTA 1INZA 3PUJA 2IQCA 5ARFA 5JMND 3ZYQA 1IXVA 3FEYA 3VTXA 1KZPA 2DIWA 1K3ZD 2IY0C 2J49A 2H6FA 3RK6A 3IXEA 1TEZA 2A5UA 3DSWA 4LG6A 4GMJA 3ASHA 5B1AE 4GYYA 3I4RB 5E76A 4ZHBA 3ASOE 3GW4A 2P9IG 5A6CA 4BFRA 5G55A 2P9SG 4JZYA 3I3NA 3LY7A 3FUNA 1E8WA 2XPYA 2DWZA 3LEWA 4U63A 3LXUX 3TAXA 1HS6A 4UQXA 3CHPA 3LCAA 3S7JA 3RKVA 1U3CA 3ASDA 3RRUA 4DRXE 2CFZA 1EF1C 1U3DA 4ATZD 3J5QB 3EUVA 3UM0A 4QFVA 1JWGA 4L2LA 4U96D 4AVXA 2H6HA 2DVWA 2FULA 4N2SA 2I6HA 2XENA 3UT4A 2L6BA 3ZNGA 3JQ1A 4DLQA 2AVPA 2B0OE 2R02A 5CBNA 2J09A 3DSUA 1S70B 2BEDA 3QKYA 2KZTB 4EZLA 3HRAA 3CVUA 4E6HA 4RVBA 3ULEG 1JPLA 5KNHD 4F6RD 3C5RA 5AJDA 5CRUA 3UKRG 3D9MA 1N95A 2WQ7A 4EECA 4HORA 4TXRA 1FCHA 2FO1E 1E8YA 1FVHA 3UI2A 3D3MA 3ESKA 5B3SE 2CHZA 4JD2G 2WXLA 1HG2A 3ZRHA 5KBAA 2J4DA 4B89A 4HOQA 3FU3A 3UIPC 3KAEA 3RIBA 3EHQA 4J8DA 3SY2A 1MX2A 1JCRA 4L7TA 3PDNA
chains in the Genus database with same CATH topology
3UIOC 2IO2C 2GROB 1KPSB 1Z5SC 5D2MC 2IO3C 3UINC 2GRQB 2GRRB 2IY0C 3UIPC 2GRNB 2GRPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIO C;  2IO2 C;  2GRO B;  1KPS B;  1Z5S C;  5D2M C;  2IO3 C;  3UIN C;  2GRQ B;  2GRR B;  2IY0 C;  3UIP C;  2GRN B;  2GRP B; 
#chains in the Genus database with same CATH topology
 1HF8 A;  1TNO A;  2QY7 A;  3CLJ A;  4F53 A;  4YND A;  3BEE A;  4HLL A;  2Y3A A;  4AV7 A;  3RO2 A;  3Q78 A;  3N71 A;  5BXU A;  4URK A;  4I6J A;  2CFU A;  1KPS B;  3UPV A;  4MKT A;  3HYM B;  4L1B A;  4G8K A;  1X81 A;  4JHK A;  4U0U A;  4A63 B;  2PQN A;  3KSQ A;  2V5Q C;  3FTU A;  3AS5 A;  3MZL B;  4WNG A;  2LO6 A;  3UM2 A;  4I1M A;  4JHR A;  1IQU A;  1MX6 A;  3HVE B;  4PUC A;  4CDM A;  2EIN E;  2P9K G;  2WXM A;  1B89 A;  3URZ A;  5ENT D;  3L13 A;  4MRU A;  5E75 A;  3S7F A;  3BG1 B;  4KT6 B;  2KCV A;  1BI8 B;  2KM4 A;  4GYO A;  2VSO E;  3D9H A;  3MYV A;  1OWP A;  2L0T B;  1N0R A;  3FTV A;  4GA0 A;  4A3T A;  4Y6C A;  3ESL A;  3PS6 A;  3CVP A;  3ZHE A;  2PM6 A;  5ANR A;  5KNG A;  2PNN A;  1BLX B;  3QWP A;  4GB9 A;  4J6I A;  1YMP A;  4IUL A;  5HQ8 A;  4RLY A;  2XQ0 A;  3TWV A;  3QWV A;  5AJL A;  5AQA A;  3Q7F A;  3T5V A;  3KD7 A;  5EX0 A;  3TXN A;  3TL5 A;  2WXH A;  1ZBP A;  4MBG A;  2WXN A;  4WWP A;  4HOS A;  2LUH A;  3RSE G;  4Q96 A;  3MA5 A;  3UKU G;  1IHB A;  2YHE A;  3CVX A;  3TWS A;  4JXT A;  5EIL A;  3HG0 D;  2RFA A;  3S7B A;  1HXI A;  3ZW3 A;  4G26 A;  4BTB A;  1HE8 A;  1W3B A;  4FJY A;  2HE0 A;  4DUI A;  3FDH A;  4CYM D;  3T5X A;  5H7P A;  4WNE A;  3DXK G;  2X6H A;  3MV3 B;  1TNU A;  1OCO E;  2ZU6 B;  5FIN A;  3HHM A;  3GZ1 A;  1BPO A;  3ENE A;  1ELK A;  3IHY A;  1K8K G;  1TNZ A;  1DCQ A;  5CHE E;  2ZGG A;  3WG7 E;  3ULY A;  1QYM A;  3CSF A;  4RG9 A;  2VGX B;  4LRZ A;  1RZ4 A;  3Q73 A;  2EQX A;  3JXI A;  3L16 A;  1SZA A;  3CVW A;  3QJZ A;  2Y4T A;  4KBQ A;  3LDZ A;  1UN8 A;  4GCN A;  3V31 A;  5CMY A;  2DCP A;  3HXB A;  5ANL A;  2UY1 B;  4QQI A;  4C0M A;  5EX3 A;  3FP3 A;  2C0M A;  2EIK E;  3SO8 A;  4DPR A;  4GZC A;  2GRN B;  2XGS A;  3AG2 E;  4GPK A;  2R05 A;  3Q47 B;  1QNF A;  3AAA C;  5G2N A;  4CT4 A;  4GTV A;  1E8X A;  4XIF A;  3P2B A;  1DVP A;  1NFI E;  4WNF A;  3L54 A;  2KBX A;  3FUM A;  3ISM C;  4N5Q A;  3CST A;  1OWM A;  1UOH A;  3DSS A;  3JCK C;  4BT8 A;  3JUE A;  3ZFW A;  4I9E A;  3NBN B;  3CHM A;  2WMN A;  3R9A B;  1IYG A;  3KEZ A;  4TXQ A;  5DIZ A;  2XRY A;  4KVM A;  3S7D A;  4U0S A;  4GTR A;  4XKB A;  2Q7F A;  3GZS A;  2EIM E;  1FT1 A;  1H19 A;  4HQD A;  4FU3 A;  4AY5 A;  2XGO A;  3DPD A;  4LUN U;  3V2O A;  1WAO 1;  3UM1 A;  2VSX E;  3CR3 A;  3NOG D;  4NIK A;  4N39 A;  1S0P A;  5AAO A;  4I43 A;  3R7Q A;  1HG5 A;  2OOE A;  4CDR A;  2GGF A;  3LY9 A;  4J0U A;  4J7W A;  3SF4 A;  5AEN A;  2J4B A;  5ENS D;  4HLE A;  2WXO A;  3DSV A;  4BES A;  1AP7 A;  5FQ6 A;  4OVV A;  2GRL A;  2Y4U A;  3C72 A;  3PE3 A;  3D9P A;  2I1K A;  4XEI G;  4OVU A;  2IO2 C;  2OND A;  4CCA A;  5FQ8 A;  3WXX A;  3B95 A;  3EU9 A;  3R7R A;  4KVO A;  4RSY A;  3RO3 A;  5IY5 E;  2ETA A;  1UN9 A;  3NZU A;  3SFZ A;  2R2L A;  4OAU C;  4APO A;  4KZC A;  4K5B A;  2OVF A;  4AIF A;  4N3A A;  3QOU A;  2IU1 A;  4NUR A;  1OUV A;  3B7U X;  3ZXP A;  4B93 B;  3JQ0 A;  4CDN A;  2YQ8 A;  4HB5 A;  2OEV A;  1HH8 A;  2M63 A;  4OAV B;  3OXL A;  3TWU A;  3E33 A;  4UI9 C;  2I2O A;  2RG8 A;  4L2Y A;  4BER A;  3TGO A;  4KXK B;  3TWT A;  4F7A A;  4A1G A;  3P1U A;  1SA4 A;  3OTN A;  2E2E A;  3AG3 E;  3PNT B;  3FUJ A;  4HNA D;  3G2T A;  2PL2 A;  4WWN A;  4KMO A;  4U07 A;  3TWW A;  4GZ5 A;  4E85 A;  1KT0 A;  1WY6 A;  3ZKJ A;  1O1S A;  5JJ6 A;  1N9A A;  4ACK A;  3Q75 A;  5KJL A;  4BSX A;  4APF A;  3MKQ B;  3EU5 A;  2ZGD A;  3FEX A;  4LNB A;  5HS0 A;  1Y6I A;  3CK8 A;  3LKU A;  1AWC B;  2CHW A;  5T4Y A;  4J8S A;  1QBQ A;  1Z5S C;  4ABN A;  2KZT A;  3DRA A;  1QQE A;  2P9L G;  3PEV B;  2BKK B;  3IHV A;  4B94 A;  1MZC A;  3CHS A;  4XKC A;  1OXJ A;  3FUD A;  1NI1 A;  4BX8 A;  4ACL A;  3ZPJ A;  3RJV A;  3QK0 A;  3EIJ A;  3DST A;  4UQZ A;  4U8H A;  3CGH A;  4MLP A;  3QC1 A;  1TJF A;  2RKK A;  5ENN A;  5BV0 A;  1NA0 A;  2VGY A;  2J9Q A;  5AIJ A;  3IEG A;  5A7D B;  4IN3 B;  3Q4A B;  3UX4 A;  4GA2 A;  3PE4 A;  2XS8 A;  3RU0 A;  1O1R A;  5ENO D;  4PH4 B;  3SBT B;  3FH7 A;  4BSZ B;  2NYJ A;  5BNW A;  5J08 A;  2WM9 A;  3X2Q E;  2IFU A;  2WB2 A;  4GTQ A;  5EID A;  5AAR A;  5HKP A;  4FHK A;  3Q7A A;  2XS1 A;  4WUY A;  3CHR A;  3R9M A;  1ZU2 A;  1JWF A;  2OCC E;  3EIQ C;  4CEM A;  2P9P G;  2ZIR A;  5G05 C;  3E4B A;  3HIZ A;  2FO7 A;  3CKB A;  2KCL A;  3CVL A;  4DX7 D;  5AN8 A;  1TNB A;  4YDE A;  3PZ2 A;  1E90 A;  5HI7 A;  2DYR E;  3HVE A;  2IF4 A;  4G25 A;  2F0Y A;  4KZ0 A;  1KZO A;  3U66 A;  1SZ9 A;  5BUZ A;  4HRL A;  3PNL B;  4TRQ A;  3FU6 A;  1NZN A;  3QNK A;  1N52 A;  4JC8 A;  4PS3 A;  4WWO A;  2VQ2 A;  4BY6 A;  4G11 A;  4A1S A;  3UMV A;  2IO3 C;  5G05 J;  4UI9 K;  2IOL A;  2C0L A;  3J5P A;  1VDY A;  1MQS A;  3FTW A;  3VLD A;  4ANW A;  2J8S D;  4UQY A;  3E30 A;  4JPS A;  4XE0 A;  3LJ3 A;  3FUH A;  4ATG A;  3AU4 A;  4O60 A;  4N3B A;  1UG3 A;  5ENP D;  2WVI A;  3U4T A;  5LP0 A;  4ANU A;  2XEV A;  3BU8 A;  2R17 C;  2HYZ A;  2AWI A;  4ZFH A;  3V2X A;  4EBA A;  4HRM B;  4A3V A;  4GTP A;  1H2U A;  3ASN E;  3FUE A;  2GRO B;  4GTT A;  4NRH B;  3E32 A;  3T9K A;  4GA1 A;  2JEK A;  2XGM A;  4Q94 A;  2FBN A;  4N5C A;  4M3O A;  3L17 A;  3SNX A;  4FLH A;  4V3I A;  2VJ8 A;  3V79 K;  3KEA A;  3U9W A;  4HS2 A;  1G3N B;  2LXM A;  2XZD G;  4LER A;  5FZR A;  2LSU A;  1PY1 A;  2LAH A;  3SGH A;  1HZ4 A;  1V54 E;  4UUC A;  5ARG A;  3EHM A;  2VGX A;  4F3V A;  5CED B;  4YVQ C;  4K03 A;  3CHQ A;  3CK7 A;  4I9C A;  2NC9 A;  3FH8 A;  1A17 A;  2J08 A;  3RAU A;  5CMW A;  4J8F A;  3MGB A;  3NZS A;  3EDT B;  2H6I A;  3FU5 A;  2UY1 A;  4O1O A;  4UWL A;  2R03 A;  3ONL A;  3KSL A;  5BPP A;  3B13 A;  2V8S E;  4CGV A;  2VSY A;  1D8E A;  2FEZ A;  3D9N A;  1TN7 A;  1OWL A;  5CCM A;  3FTZ A;  3Q15 A;  2B6C A;  3ONK A;  3S2A A;  3UIO C;  5T3R A;  1QZ2 A;  4L23 A;  4TXP A;  3B7B A;  3SFY A;  2GRP B;  2WXQ A;  3CQC B;  2XEE A;  3C98 A;  1GW6 A;  2V0P A;  5M72 A;  3RRN B;  1WDY A;  4A55 A;  1YYH A;  4JB8 P;  3ZU7 B;  4ILI A;  5D0O D;  3PUK A;  4G1T A;  5BW8 C;  4D10 C;  5C2Y A;  4GTO A;  2EIJ E;  4I2W A;  5EN5 D;  2IEJ A;  3CV0 A;  2QZA A;  3KS2 A;  3ZYL A;  4DI3 A;  3NOC D;  2Y69 E;  1N4R A;  4TUM A;  2OEW A;  3PZ3 A;  1Y8M A;  3V30 A;  2EIL E;  4JEH A;  2YNQ A;  2GRM A;  4GCO A;  3MJW A;  1E7V A;  2OV8 A;  3HXD A;  3ABK E;  4CZ2 D;  5D66 A;  4GMR A;  4IYP A;  3MEK A;  2QC9 A;  2LSV A;  3T8K A;  2L6J A;  2XRZ A;  1KLX A;  2XCC A;  2XPZ A;  5J90 A;  2V4L A;  5CER B;  3AS4 A;  3ZYK A;  2Y0B G;  1BI7 B;  4YDY A;  4ILG A;  4CT0 A;  3NF1 A;  1IKN D;  1E96 B;  3DEP A;  3I4G A;  3FFL A;  4CRW A;  1V55 E;  1K1A A;  3PVL A;  2ZXW E;  3CK9 A;  3FU0 A;  2E0I A;  5B1B E;  3VTY A;  4K5A B;  2L0I A;  2VTB B;  4G23 A;  3D9J A;  5FWQ A;  4ME2 A;  2HM8 A;  3Q79 A;  3PZD A;  4L9P A;  4WAF A;  4DJA A;  3FTY A;  4UWF A;  5LOZ A;  4H7Y A;  4AP2 A;  4BET A;  3VLE A;  4W9R A;  2V4H C;  2NXP A;  3IKO B;  2X6I A;  3LJN A;  3TWX A;  4BWR A;  3NAW A;  4XI0 A;  2WXI A;  2DZO A;  1EPU A;  3MV2 B;  3ZUV B;  5ENQ D;  4JW1 A;  4DK5 A;  4I6E A;  4B0Z A;  3ZYM A;  5CBO A;  3MKQ A;  1YA0 A;  4YDW A;  1PC2 A;  1Q2Z A;  3BUA A;  4GML A;  3QB2 A;  3DEO A;  2HR2 A;  2X6J A;  2JAB A;  1MHQ A;  1D8D A;  2IOS A;  4EPZ A;  3BQO A;  4I1A A;  2JLB A;  4HI9 A;  4U0Z A;  1E7U A;  3L82 A;  1UJJ A;  3GYZ A;  4G2V A;  3T8M A;  4U8Y D;  3HDX A;  1TN6 A;  2MOW A;  1N11 A;  5DBK A;  4UWH A;  2CHX A;  2OVB A;  1OY3 D;  4G24 A;  4Q69 A;  4F1S A;  1JCQ A;  2DZN A;  3BG0 B;  4O6F A;  3FUK A;  1ELW A;  2ETC A;  4HVB A;  2VSN A;  3AG4 E;  1HU3 A;  2CG2 A;  5CRV A;  4UWK A;  2AXU A;  3O48 A;  5JHA A;  4TV3 A;  4HXI A;  2A4Z A;  5G04 C;  3SFX A;  5JHB A;  2QYJ A;  3LVR E;  2AXZ A;  4UI9 J;  1N4S A;  3CIA A;  2I9C A;  4U04 A;  3LPZ A;  5AQ7 A;  4X8Q A;  3L22 A;  5JJ7 A;  3CVV A;  2YHC A;  3K9I A;  1N54 A;  3UTM A;  5C1D A;  1H2T C;  3LS8 A;  2AXV A;  5CCL A;  1TN8 A;  3FUI A;  3W9F A;  1S64 A;  3CEQ A;  4UWG A;  5AYW D;  3UUX A;  3FUF A;  4GPM A;  3UT8 A;  5KJK A;  4DX2 A;  1S63 A;  4XI9 A;  5ENR D;  1MJ0 A;  5G04 J;  3L9T A;  3D9K A;  1JUQ A;  4FP7 A;  3PZ1 A;  3G2V A;  1DNP A;  5D2M C;  1BD8 A;  3W9G A;  3C3R A;  2HO1 A;  1N0Q A;  4K0R A;  4I1O B;  2ILR A;  1SA5 A;  4R7L A;  5KCM A;  5KJM A;  3NB2 A;  4EHM A;  2P58 C;  4LNG A;  3ZIM A;  3NQP A;  5AQB A;  4JA9 A;  4EBA G;  1K1B A;  5BV1 A;  3SQV A;  4BT9 A;  2X3M A;  4MS6 A;  1IQR A;  4DX1 A;  2PQR A;  3HXE A;  3LVQ E;  3SBS A;  1HO8 A;  2C2L A;  1MYO A;  4FAD A;  4H7X A;  3UIN C;  4YDO A;  3PRZ A;  3OXF A;  3L08 A;  1DCE A;  4ANX A;  5BXO A;  5AQ9 A;  2MYO A;  2R59 A;  1SQM A;  3EJN A;  4J8E A;  3U64 A;  4PS7 A;  1LF8 A;  5FZQ A;  1X5B A;  1OWO A;  1IHG A;  2F8Y A;  2P9N G;  5LCW C;  1Z6T A;  1TNY A;  2WXJ A;  4BEP A;  3SZ7 A;  3G2W A;  2FF4 A;  3U3W A;  5FQ7 A;  4C48 B;  4FC8 A;  4XZ4 A;  1N4Q A;  2X38 A;  2X6F A;  3TG4 A;  3VLF A;  3D9I A;  3OAW A;  3HXC A;  4FLB A;  4O1P A;  2P2C P;  3FWV A;  4GTS A;  1LD8 A;  3CKC A;  4K5C A;  1OCC E;  3GZ2 A;  3LY8 A;  4B8C B;  4BX9 A;  3TXM A;  3FUL A;  5LCW J;  4HFG A;  5EDS A;  4LEU A;  4NAC A;  5EYP F;  4AXH A;  3Q9U C;  4JHJ A;  1SW6 A;  5EIB E;  3D9L A;  4NQ0 A;  3Q49 B;  4FUL A;  4WND A;  2FI7 A;  1YCS B;  2AJA A;  3FY4 A;  1WM5 A;  4RG6 A;  1OT8 A;  5JA4 D;  4P29 A;  3ZGQ A;  3DPY A;  3DSX A;  2WPV A;  1ZB1 A;  2VYI A;  3EHR A;  2GRQ B;  3TJP A;  3Q9N C;  2PZI A;  5FQ4 A;  3ASF A;  2AW6 A;  1RW2 A;  5T8I A;  3ZVV A;  3TWR A;  3FH5 A;  2V5F A;  3UQ3 A;  3TWQ A;  1U2V G;  4JEU A;  3IBE A;  4AM9 A;  2F8X K;  3AS8 A;  4B8A A;  2A5E A;  5D0Q D;  4JL0 A;  1H2V C;  5JJT A;  3EHN A;  4AY6 A;  3SHF A;  2WMO A;  4GAA A;  3MX3 A;  2WQH A;  1O5M A;  4GZ3 A;  4PDX A;  4IRU A;  5EKQ D;  4AEZ C;  2GRR B;  4G8L A;  3I5P A;  5BT1 A;  1OWN A;  4Z68 A;  1H0A A;  1EDU A;  4N2Q A;  1ELR A;  4M7C A;  3G2S A;  3SI5 A;  1TYQ G;  4DX5 D;  4HBD A;  3ZXS A;  3APC A;  2H6G A;  3RRM B;  4U8V D;  2WXP A;  3Q5M A;  1DC2 A;  3B7T A;  3QAR A;  4AOF A;  2P9U G;  4I6G A;  3APF A;  4GTM A;  5A23 A;  3ZHE B;  4HOT A;  5HRY A;  4ANV A;  2CG3 A;  3E34 A;  1O1T A;  4RQI A;  3MCX A;  4JVS A;  2NSZ A;  3B7S A;  3FTX A;  2DYS E;  3AJI A;  3DBS A;  4J8Y A;  2BUG A;  1FVF A;  2QFC A;  3UT7 A;  5FT9 A;  1P5Q A;  1UJK A;  2WQ6 A;  5EYL A;  3LYA A;  4KYO B;  1NP7 A;  1LTX A;  4I2Z A;  2RD0 A;  5CEA A;  3ML8 A;  3C3O A;  3IV0 A;  3ASG A;  2QYU A;  2MRI A;  4GU5 A;  1FT2 A;  3SD5 A;  3APD A;  1XGW A;  3DWL G;  3JYS A;  4GZ6 A;  4DI4 A;  4GZD A;  3JXJ A;  2KC7 A;  4C0E A;  1MX4 A;  2UWJ G;  5CEC B;  3G2U A;  4XX5 A;  2R5S A;  4DLO A;  1HFA A;  2XEH A;  2WXR A;  3PRE A;  3C3Q A;  2XPI A;  5LX8 A;  1TR4 A;  1HX8 A;  1BU9 A;  3HXF A;  2BF0 X;  2VGE A;  4U7E B;  1H6K A;  3OXG A;  2RFM A;  3FHE A;  3QAQ A;  4CGW A;  2ION A;  3TG5 A;  2VTB A;  3QWW A;  3UXG A;  2BKG A;  4TUU A;  2IJG X;  1EYH A;  3DXM G;  5LFA A;  3JUI A;  3ABL E;  1TJC A;  5KWD A;  4DX6 D;  2DBA A;  4FA6 A;  2X6K A;  4F1P A;  3AU5 A;  2KAT A;  3ULQ A;  3PEU B;  1WG0 A;  3CVY A;  1OCR E;  2BTD A;  4Y6W A;  2WXG A;  1UW4 B;  1E8Z A;  4HRN A;  3ABM E;  5FIO A;  4OYS A;  5FZS A;  4AJW A;  2LAI A;  4LSZ E;  2YIN A;  1FPP A;  2I1J A;  4GYW A;  2J07 A;  4U95 D;  1NL4 A;  4LNU D;  3PH0 C;  3MKR A;  3UM3 A;  2XCB A;  4FHJ A;  3CHO A;  2ETB A;  4I17 A;  2MHK A;  4PS8 A;  2WXF A;  3AG1 E;  4FJZ A;  1NA3 A;  2ZIS A;  2L9B A;  1SVX A;  1LD7 A;  1L5J A;  2LXL A;  3CQG B;  1Z3X A;  1Z3Y A;  4N3C A;  4JA7 A;  1N4P A;  3PZ4 A;  1KT1 A;  2WXK A;  4BTA A;  3FTS A;  2GW1 A;  2Y1L E;  4HI8 A;  2XZT G;  3ML9 A;  4YVO A;  4ILH B;  3E37 A;  4EZK A;  1XNF A;  2KXP C;  4HOU A;  5ITZ F;  3L6A A;  3O4Z A;  2F37 A;  4EQF A;  1H6P A;  3CVN A;  2XHE A;  3QDN A;  1A5E A;  1OCZ E;  1PAQ A;  5FJY A;  1JCS A;  1N94 A;  4C9B B;  1H6O A;  3F6Q A;  3ZN3 A;  3B7R L;  5KJN A;  2PM7 A;  2LNI A;  3CVQ A;  5FTP A;  4EZJ A;  1D9S A;  3D9O A;  2KCK A;  3ZEF A;  4LCT A;  1INZ A;  3PUJ A;  2IQC A;  5ARF A;  5JMN D;  3ZYQ A;  1IXV A;  3FEY A;  3VTX A;  1KZP A;  2DIW A;  1K3Z D;  2IY0 C;  2J49 A;  2H6F A;  3RK6 A;  3IXE A;  1TEZ A;  2A5U A;  3DSW A;  4LG6 A;  4GMJ A;  3ASH A;  5B1A E;  4GYY A;  3I4R B;  5E76 A;  4ZHB A;  3ASO E;  3GW4 A;  2P9I G;  5A6C A;  4BFR A;  5G55 A;  2P9S G;  4JZY A;  3I3N A;  3LY7 A;  3FUN A;  1E8W A;  2XPY A;  2DWZ A;  3LEW A;  4U63 A;  3LXU X;  3TAX A;  1HS6 A;  4UQX A;  3CHP A;  3LCA A;  3S7J A;  3RKV A;  1U3C A;  3ASD A;  3RRU A;  4DRX E;  2CFZ A;  1EF1 C;  1U3D A;  4ATZ D;  3J5Q B;  3EUV A;  3UM0 A;  4QFV A;  1JWG A;  4L2L A;  4U96 D;  4AVX A;  2H6H A;  2DVW A;  2FUL A;  4N2S A;  2I6H A;  2XEN A;  3UT4 A;  2L6B A;  3ZNG A;  3JQ1 A;  4DLQ A;  2AVP A;  2B0O E;  2R02 A;  5CBN A;  2J09 A;  3DSU A;  1S70 B;  2BED A;  3QKY A;  2KZT B;  4EZL A;  3HRA A;  3CVU A;  4E6H A;  4RVB A;  3ULE G;  1JPL A;  5KNH D;  4F6R D;  3C5R A;  5AJD A;  5CRU A;  3UKR G;  3D9M A;  1N95 A;  2WQ7 A;  4EEC A;  4HOR A;  4TXR A;  1FCH A;  2FO1 E;  1E8Y A;  1FVH A;  3UI2 A;  3D3M A;  3ESK A;  5B3S E;  2CHZ A;  4JD2 G;  2WXL A;  1HG2 A;  3ZRH A;  5KBA A;  2J4D A;  4B89 A;  4HOQ A;  3FU3 A;  3UIP C;  3KAE A;  3RIB A;  3EHQ A;  4J8D A;  3SY2 A;  1MX2 A;  1JCR A;  4L7T A;  3PDN A; 
#chains in the Genus database with same CATH homology
 3UIO C;  2IO2 C;  2GRO B;  1KPS B;  1Z5S C;  5D2M C;  2IO3 C;  3UIN C;  2GRQ B;  2GRR B;  2IY0 C;  3UIP C;  2GRN B;  2GRP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...