3UIOC

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
molecule keywords SUMO-conjugating enzyme UBC9
total genus 50
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2011-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 3uioC00
3UINC 2IO2C 5D2MC 3UIOC 2GRNB 2GROB 1Z5SC 2GRPB 3UIPC 2IO3C 2GRQB 2IY0C 2GRRB 1KPSB
chains in the Genus database with same CATH superfamily
2KXPC 3ASOE 3JUIA 3TWQA 4G24A 3FWVA 4HRNA 5CMWA 3IHYA 4LNUD 3RIBA 4I1AA 2WXGA 3D9PA 2NXPA 1HS6A 3DXMG 3LY7A 3E30A 4XI9A 3SGHA 2CG3A 2UWJG 3MKQA 2XEHA 3OXLA 4XKCA 3PNTB 2RG8A 5CBNA 3FUHA 2R2LA 2XGMA 4DPRA 5B1AE 5FQ7A 3LVRE 2R5SA 3EUVA 2VGXA 3CVQA 1BD8A 4BESA 3UT8A 3TL5A 2AWIA 2VSXE 1GW6A 2WXMA 3Q78A 2B0OE 5CEAA 4JHKA 1JUQA 5LOZA 5KCMA 3C98A 3CQCB 4DX2A 5FQ8A 4RG9A 3CQGB 3FTXA 3NOCD 2XPIA 4YDOA 3HVEB 2VSYA 4GTTA 2XRZA 4DLOA 4AEZC 1IQRA 3VTXA 5AJLA 3EHRA 2BF0X 1TN7A 2JEKA 4LNGA 4AXHA 5HQ8A 2L6JA 3L22A 5D0QD 3FH8A 3L54A 4HI9A 3I5PA 2I6HA 3DPDA 1QYMA 1OWNA 4WAFA 4LRZA 1TNOA 1FCHA 2P2CP 4XEIG 3IV0A 4UWFA 1K1BA 2WXKA 4DLQA 1HG5A 4O6FA 1IXVA 1D8DA 3C3OA 2L0IA 3ZYLA 1HO8A 4Y6WA 4J8EA 2BKGA 3FTWA 1MJ0A 4FJYA 4A1SA 2KCVA 4GTMA 5ANLA 4V3IA 3ZW3A 3ULEG 1EPUA 2E2EA 3X2QE 5EYPF 4WNGA 3ASFA 4JD2G 3QOUA 2R03A 3PEUB 4APOA 4AOFA 5BXOA 3UI2A 3AS8A 3P2BA 3Q5MA 5CRVA 1HG2A 2XEVA 3ASDA 3MCXA 3ZFWA 3PZ3A 4D10C 1MQSA 4F1PA 3R9MA 2V4LA 2X6HA 1NZNA 4IRUA 5FJYA 4G26A 1N9AA 3SQVA 1S63A 1BPOA 2CFZA 2ILRA 3L6AA 1H6OA 1TNZA 2A5UA 2I1KA 5BV1A 3CHRA 3KSQA 3TG4A 2QC9A 3SFZA 3Q4AB 2P9NG 5ENQD 2WXRA 3CVVA 3RO3A 2R02A 5ARGA 1N4QA 5KBAA 5EIBE 2V5FA 4AP2A 3TG5A 5BW8C 1TNUA 1WY6A 2ZISA 5D2MC 4B89A 4OVUA 2IO3C 5FQ6A 3EIJA 2LNIA 1UJJA 2LXMA 2WVIA 4OVVA 4WNFA 3U4TA 3UINC 5KJLA 1X81A 3FEYA 3VTYA 5FTPA 5FIOA 1KZPA 3D9MA 3ZEFA 3I3NA 5FWQA 1YCSB 3ZHEA 4G8KA 3FUNA 5KNGA 5KJMA 3D9NA 3UM0A 2XENA 3BQOA 1JCQA 4XIFA 2FEZA 2WMNA 2GRLA 3EHNA 3LPZA 1KLXA 4RLYA 4BX8A 4P29A 4CDNA 5AYWD 2X6IA 1TYQG 4H7XA 4WWOA 3FY4A 1ELRA 2KC7A 3AS4A 3U3WA 1NFIE 4HS2A 4KVMA 4ACLA 3LYAA 3K9IA 1DC2A 3DEOA 2XCBA 4J8SA 1S0PA 4F3VA 4C0EA 2GRRB 3FTVA 3ZU7B 3S2AA 5B1BE 2ETAA 3ZNGA 3KEZA 3B7RL 4JZYA 1BI7B 4PS8A 2AXVA 3T5VA 5E75A 1OCOE 3TAXA 3OAWA 2XQ0A 3RJVA 5BT1A 1U3DA 3DBSA 3EHMA 4HNAD 2FO7A 4GU5A 3FHEA 3JYSA 4UI9J 5ENNA 3GZ1A 4UWGA 3DPYA 4WWPA 2VQ2A 3B7BA 2C0MA 4M7CA 4FA6A 1SZAA 4XKBA 4JVSA 2L9BA 2I2OA 4B8AA 4U63A 4CYMD 5BXUA 2MYOA 3E33A 2X3MA 4C9BB 4AVXA 3NZSA 4GZ6A 1K8KG 2DIWA 4UI9C 3TXMA 4MRUA 4FLHA 1NA3A 4AV7A 3SBTB 4BWRA 3CHOA 2VJ8A 5T4YA 4EZKA 3KD7A 1E8YA 3LXUX 3ABME 1HX8A 5KJNA 4I9CA 1MHQA 2VTBA 3F6QA 4KMOA 3LJ3A 3ULYA 3I4GA 4YDWA 4JA9A 1HE8A 1MZCA 2IQCA 2GRQB 4K03A 1FVFA 3E4BA 4G23A 4JPSA 3QAQA 4I6EA 2OVFA 4KXKB 1JCSA 1E7VA 5E76A 5JMND 3PZ2A 5C1DA 3TJPA 1K3ZD 3OTNA 3VLEA 4YVQC 3ZKJA 5CBOA 2H6IA 2VGYA 3HIZA 4FC8A 4FHJA 4N2SA 1OCRE 1TNYA 3FUIA 1S64A 3D9JA 3PDNA 1EYHA 2YQ8A 3U9WA 1K1AA 4ANWA 5AENA 2R17C 5CEDB 3QKYA 3HXFA 4B8CB 1RW2A 3UKRG 3I4RB 4BETA 2FI7A 4U8VD 3HG0D 3CHPA 5G55A 3CIAA 1N11A 4NACA 4QFVA 4HOQA 2P9KG 4DX7D 4I43A 1B89A 3EJNA 4GMLA 3KSLA 3NZUA 4HFGA 1UN8A 3RAUA 1Z6TA 1HH8A 3KAEA 3SHFA 3QWPA 5CHEE 3CVPA 4MBGA 3FULA 4ILIA 4HXIA 4OAVB 1IHGA 2H6FA 4YVOA 4I1OB 1N52A 2PM6A 4BT8A 1N0RA 4I1MA 4K0RA 4J8FA 4C48B 3BG1B 4HBDA 3CHQA 2V0PA 2YINA 4Q96A 1SQMA 2J8SD 2OCCE 4HOSA 2WXOA 2WXIA 4O60A 3V30A 4N3BA 2WXJA 3B13A 5JJ6A 5AQ7A 3D9KA 3Q79A 3CKBA 2H6HA 3JXIA 1HXIA 2JLBA 3HXCA 2EIME 2ZU6B 4U96D 3FU3A 5T8IA 3C3QA 4WNEA 3RRUA 2A5EA 3DSVA 1X5BA 3PUKA 2EINE 4DRXE 5D0OD 4KVOA 3E32A 3KS2A 4A63B 1HU3A 4TXRA 3AJIA 1OWLA 4J0UA 3Q49B 4IULA 4RG6A 2F0YA 5J90A 3GZ2A 1TEZA 3D9LA 4RSYA 4GCNA 2BKKB 2C2LA 2MHKA 5JJTA 4CT4A 5CCMA 5FINA 2ETCA 3G2VA 3JCKC 5FZQA 4OYSA 3QK0A 2BUGA 4LG6A 4B93B 2X6JA 3RO2A 3NB2A 1E8ZA 3ABKE 1L5JA 4LEUA 2ZGDA 3LS8A 3CVXA 5DIZA 3T5XA 4BT9A 3Q7FA 2M63A 3FUDA 3GZSA 3S7FA 2E0IA 4K5CA 3FFLA 4RVBA 4K5AB 4U0ZA 3Q15A 4GMJA 4RQIA 4F1SA 2R59A 4APFA 4A3VA 1H2TC 2V8SE 4HRMB 3AS5A 3L17A 4U8HA 4A1GA 4EBAG 4EECA 2PM7A 2I9CA 5CRUA 2J08A 4CCAA 4FHKA 4BFRA 4GYWA 2IO2C 2AVPA 2XPYA 3S7JA 3UQ3A 4GTRA 2B6CA 4C0MA 2DZNA 2HYZA 2GRNB 1WDYA 3RSEG 2NSZA 5B3SE 1Y8MA 1ZB1A 4HOUA 3BEEA 3RRMB 1N94A 1JWGA 4PDXA 2XHEA 1SW6A 5ARFA 1UN9A 1AP7A 3AU4A 2MOWA 4GTPA 4CRWA 4IYPA 4XI0A 2LAIA 3LY9A 3PEVB 3W9GA 2J4DA 3P1UA 1OWOA 2KCKA 3GW4A 1KPSB 4E6HA 3UT7A 3N71A 4UWLA 3ZYQA 3LCAA 2NYJA 3R7QA 4FJZA 5BPPA 3APFA 2XS1A 3TWSA 3B7TA 3HXEA 3D9HA 3SF4A 2VYIA 2P9IG 2C0LA 3B7UX 1Z3YA 4N5CA 1N54A 2WPVA 5EX0A 5LX8A 4FLBA 5C2YA 5HRYA 5LP0A 4YDEA 4NURA 3T8KA 3C5RA 3D9IA 4AY6A 4F6RD 4ME2A 3URZA 4MLPA 3PREA 2X6FA 3UKUG 2WXLA 3TWXA 1KZOA 4LUNU 1H19A 1YYHA 4GPKA 3NAWA 4BX9A 3L08A 4GZDA 3CR3A 2Y4TA 2XRYA 3DEPA 4F53A 1MX4A 3VLFA 1OY3D 4J7WA 1D9SA 1E7UA 3MJWA 1N4RA 3FH5A 3NF1A 2IFUA 3L9TA 4UQXA 3CVWA 4U04A 1D8EA 1H6KA 3MEKA 2AW6A 3G2SA 1QQEA 1DNPA 4A3TA 3SY2A 2ONDA 4EPZA 2IF4A 3SD5A 2GRPB 3Q47B 1FPPA 1EDUA 1HFAA 3ONKA 2WXHA 3R9AB 4GZCA 2LAHA 1W3BA 2QFCA 3SFYA 3RK6A 4BTBA 3TWTA 1ZU2A 2BEDA 1P5QA 4MKTA 4BEPA 3TWUA 4O1OA 3QC1A 4ANVA 3FEXA 3PUJA 3B7SA 3QDNA 3CK8A 3ZYKA 4HQDA 3R7RA 3FUFA 2ZXWE 1BU9A 1U3CA 2GROB 4ATZD 5ENSD 3JUEA 1IKND 4GTVA 3EIQC 4BY6A 1JPLA 3DSUA 4AY5A 4GYOA 4TXQA 2EIJE 3TXNA 3V2OA 2J9QA 3NQPA 1U2VG 3UX4A 2CHXA 2OVBA 4G2VA 1G3NB 2P9UG 4KZCA 3ZXPA 1V55E 2P58C 4ZHBA 2Q7FA 3E34A 4ACKA 3LJNA 4EZLA 2XCCA 5CCLA 2KCLA 5G04J 1HF8A 1Y6IA 3IBEA 4N3CA 1E8WA 4DX5D 2V4HC 4L7TA 3HXBA 2WXPA 2XEEA 3ZIMA 3AAAC 4HORA 1IHBA 1LD7A 3Q73A 5FT9A 3CVNA 4I9EA 5BV0A 5AQBA 1LF8A 4BSZB 1DVPA 3CVLA 3RRNB 5LFAA 2IOLA 3G2TA 3Q7AA 1E96B 2PZIA 2LO6A 3W9FA 2Y3AA 5ENTD 2DYSE 3SZ7A 4XZ4A 2RFMA 4EQFA 3WG7E 3AU5A 2IJGX 5JA4D 2WQHA 2XGSA 3S7BA 1PAQA 2Y0BG 4JB8P 1Z3XA 4GZ3A 1LD8A 2XZDG 2WXQA 1IQUA 4UI9K 2YHCA 5LCWJ 4CGVA 1SZ9A 3J5QB 3VLDA 5AQAA 4ABNA 5JHAA 1IYGA 4U0SA 2XGOA 2KBXA 4L2LA 4XX5A 1KT0A 4KZ0A 5ENPD 2OEWA 4GPMA 1SA4A 5EILA 5A6CA 4JC8A 4EHMA 2P9SG 2P9PG 4HVBA 1Q2ZA 4HRLA 2IONA 3PZ4A 4W9RA 3MX3A 2QY7A 3Q9UC 2R05A 4U8YD 1WM5A 4G11A 4JHRA 1QZ2A 2OEVA 4K5BA 1XNFA 3BUAA 3ABLE 3GYZA 2ETBA 4U0UA 3FTYA 2OOEA 2ZIRA 2HE0A 2BTDA 1OXJA 3IXEA 5FZRA 3JQ1A 5AIJA 3NOGD 4GCOA 4JXTA 2UY1A 1TN6A 4GTOA 4HLLA 4TV3A 2F8XK 3FTSA 2PQRA 3UIPC 3CSTA 4GA2A 2F37A 3TWRA 2CFUA 3CEQA 5EIDA 4J6IA 1N4PA 3MKQB 3ESKA 4L1BA 1MX2A 3BG0B 4JA7A 2WXNA 3FU0A 3QJZA 3FTZA 5LCWC 3FU6A 3FDHA 3B95A 3ASGA 1MYOA 4LERA 3Q9NC 4NQ0A 2IU1A 3AG2E 1H2UA 4TUUA 3SFXA 5HS0A 3DRAA 2Y1LE 3UM2A 1A5EA 4WNDA 4ANUA 1UW4B 2AXUA 3CGHA 5EN5D 3DXKG 2HR2A 5BNWA 3ZUVB 3JXJA 2XZTG 4GA0A 4AJWA 1UG3A 4JL0A 5CERB 2P9LG 4M3OA 2ZGGA 3ZVVA 4ANXA 3U64A 3UPVA 2QZAA 4UQYA 2VGEA 5AQ9A 3FUKA 3V79K 3CHSA 2WQ6A 5A23A 4L23A 3APCA 4GZ5A 1MX6A 4PH4B 2FF4A 3L82A 1LTXA 3PS6A 2LUHA 2LSUA 3OXFA 3SO8A 2L0TB 4UUCA 3UXGA 3FU5A 3FTUA 2GW1A 5FZSA 3ZN3A 1FT2A 3EU5A 4G1TA 3TWVA 3AG4E 1OUVA 3TGOA 2HM8A 1SA5A 3L16A 3UUXA 4URKA 1TJCA 4CDMA 4JEHA 3RU0A 3UM1A 2DBAA 2J07A 4BSXA 1TJFA 3QB2A 3HRAA 4TXPA 2I1JA 4R7LA 1N0QA 1S70B 2PNNA 3HXDA 3LVQE 4I2WA 3ASNE 4FP7A 4GA1A 5EX3A 5EDSA 4UWHA 3BU8A 3EDTB 4Z68A 1N95A 4UWKA 3UM3A 1NI1A 3Q75A 3CVUA 1WAO1 3MV2B 3IHVA 3IKOB 3MGBA 4AM9A 4WUYA 4DX1A 4NIKA 2JABA 1BI8B 2EQXA 3CK9A 3ZHEB 3CHMA 3FUEA 5CECB 2VSOE 2CHZA 4TRQA 2OV8A 2QYUA 3ZYMA 4HI8A 5ENOD 3ZPJA 5H7PA 4PS3A 3APDA 2EILE 3O4ZA 3CV0A 5A7DB 4TUMA 2DVWA 3DSWA 3FUJA 5G05J 3LDZA 2J49A 3PZ1A 1TN8A 4Y6CA 1NA0A 3ISMC 3CKCA 1E8XA 4N3AA 4KT6B 4L2YA 2IY0C 3ML9A 2WM9A 3ZRHA 2IEJA 2WQ7A 5KNHD 4GB9A 5HI7A 1DCEA 3JQ0A 1OCCE 2DWZA 3MA5A 2GRMA 1DCQA 4BERA 3QNKA 2J09A 3HYMB 3LY8A 1TR4A 3FUMA 1H6PA 4HB5A 2LSVA 2H6GA 4JW1A 2GGFA 4EZJA 4QQIA 4CZ2D 4B94A 1EF1C 4I2ZA 2YNQA 2RD0A 2MRIA 3RKVA 3WXXA 3LEWA 5G05C 3PH0C 5ANRA 3ASHA 2KZTB 1RZ4A 4FADA 3QARA 5KJKA 5AAOA 3MYVA 3ZGQA 3SI5A 4N2QA 4A55A 5M72A 3C3RA 4XE0A 2L6BA 3ZXSA 1TNBA 4OAUC 4DX6D 1WG0A 3SBSA 3AG3E 4EBAA 4GMRA 3HVEA 3ULQA 3PNLB 4N5QA 3CSFA 2WB2A 3PZDA 5EYLA 4G25A 3FH7A 2DYRE 4H7YA 4ILHB 1HZ4A 4MS6A 1PC2A 3UTMA 1E90A 1H2VC 1NL4A 1OT8A 4YNDA 3QWWA 4NRHB 2VTBB 3E37A 4B0ZA 5G04C 3D9OA 3CVYA 4G8LA 3MV3B 3CLJA 4HLEA 4X8QA 1UOHA 1Z5SC 2X38A 2F8YA 2WMOA 2AJAA 2A4ZA 4CT0A 4ATGA 4DJAA 4FU3A 5AARA 1NP7A 2UY1B 2QYJA 4I17A 5T3RA 3CK7A 3C72A 3NBNB 3V2XA 4N39A 2Y4UA 1PY1A 1UJKA 3IEGA 5ITZF 4L9PA 4J8YA 3ONLA 2YHEA 3UIOC 4LNBA 5EKQD 4Q69A 3DSTA 1ELWA 1O1TA 4F7AA 2CG2A 1JCRA 3O48A 4DI3A 3ENEA 5IY5E 4IN3B 4E85A 1OWPA 4I6GA 5J08A 3G2UA 2FULA 4GTSA 1INZA 2XS8A 2FO1E 1KT1A 4U07A 2VGXB 1JWFA 1BLXB 3AG1E 3PRZA 1OCZE 3OXGA 4U95D 4HOTA 5ENRD 1O5MA 3D3MA 1H0AA 4KBQA 2Y69E 3UT4A 4LCTA 2FBNA 3HDXA 1XGWA 4JHJA 2WXFA 3PE4A 3DWLG 4WWNA 5JHBA 2PL2A 1YA0A 4KYOB 2NC9A 4PS7A 4FULA 1AWCB 3ESLA 3J5PA 4J8DA 3MKRA 1ELKA 4PUCA 4CGWA 4O1PA 5AN8A 3MZLB 3U66A 4GTQA 3PVLA 1VDYA 1FT1A 2VSNA 1ZBPA 3TWWA 3PE3A 2X6KA 1OWMA 4CDRA 3DSXA 3EU9A 2RKKA 3G2WA 2XPZA 2J4BA 3QWVA 2CHWA 3T8MA 4DK5A 3UMVA 3FP3A 4AIFA 5BUZA 3LKUA 1FVHA 3L13A 3S7DA 5DBKA 1A17A 1V54E 4DUIA 1O1SA 3V31A 5FQ4A 2IOSA 2RFAA 4GYYA 1YMPA 1SVXA 5D66A 3SNXA 2DZOA 3DSSA 5G2NA 2KZTA 2V5QC 4LSZE 3EHQA 4Q94A 4YDYA 3T9KA 3ML8A 5HKPA 1N4SA 4ILGA 5KWDA 4BTAA 2EIKE 2HO1A 4DI4A 1O1RA 5CMYA 2KATA 4ZFHA 3KEAA 4CEMA 4JEUA 2PQNA 3HHMA 2DCPA 2LXLA 4UQZA 1QNFA 5AJDA 2KM4A 4GAAA 2AXZA 4I6JA 5JJ7A 4U7EB 1QBQA
chains in the Genus database with same CATH topology
3UINC 2IO2C 5D2MC 3UIOC 2GRNB 2GROB 1Z5SC 2GRPB 3UIPC 2IO3C 2GRQB 2IY0C 2GRRB 1KPSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIN C;  2IO2 C;  5D2M C;  3UIO C;  2GRN B;  2GRO B;  1Z5S C;  2GRP B;  3UIP C;  2IO3 C;  2GRQ B;  2IY0 C;  2GRR B;  1KPS B; 
#chains in the Genus database with same CATH topology
 2KXP C;  3ASO E;  3JUI A;  3TWQ A;  4G24 A;  3FWV A;  4HRN A;  5CMW A;  3IHY A;  4LNU D;  3RIB A;  4I1A A;  2WXG A;  3D9P A;  2NXP A;  1HS6 A;  3DXM G;  3LY7 A;  3E30 A;  4XI9 A;  3SGH A;  2CG3 A;  2UWJ G;  3MKQ A;  2XEH A;  3OXL A;  4XKC A;  3PNT B;  2RG8 A;  5CBN A;  3FUH A;  2R2L A;  2XGM A;  4DPR A;  5B1A E;  5FQ7 A;  3LVR E;  2R5S A;  3EUV A;  2VGX A;  3CVQ A;  1BD8 A;  4BES A;  3UT8 A;  3TL5 A;  2AWI A;  2VSX E;  1GW6 A;  2WXM A;  3Q78 A;  2B0O E;  5CEA A;  4JHK A;  1JUQ A;  5LOZ A;  5KCM A;  3C98 A;  3CQC B;  4DX2 A;  5FQ8 A;  4RG9 A;  3CQG B;  3FTX A;  3NOC D;  2XPI A;  4YDO A;  3HVE B;  2VSY A;  4GTT A;  2XRZ A;  4DLO A;  4AEZ C;  1IQR A;  3VTX A;  5AJL A;  3EHR A;  2BF0 X;  1TN7 A;  2JEK A;  4LNG A;  4AXH A;  5HQ8 A;  2L6J A;  3L22 A;  5D0Q D;  3FH8 A;  3L54 A;  4HI9 A;  3I5P A;  2I6H A;  3DPD A;  1QYM A;  1OWN A;  4WAF A;  4LRZ A;  1TNO A;  1FCH A;  2P2C P;  4XEI G;  3IV0 A;  4UWF A;  1K1B A;  2WXK A;  4DLQ A;  1HG5 A;  4O6F A;  1IXV A;  1D8D A;  3C3O A;  2L0I A;  3ZYL A;  1HO8 A;  4Y6W A;  4J8E A;  2BKG A;  3FTW A;  1MJ0 A;  4FJY A;  4A1S A;  2KCV A;  4GTM A;  5ANL A;  4V3I A;  3ZW3 A;  3ULE G;  1EPU A;  2E2E A;  3X2Q E;  5EYP F;  4WNG A;  3ASF A;  4JD2 G;  3QOU A;  2R03 A;  3PEU B;  4APO A;  4AOF A;  5BXO A;  3UI2 A;  3AS8 A;  3P2B A;  3Q5M A;  5CRV A;  1HG2 A;  2XEV A;  3ASD A;  3MCX A;  3ZFW A;  3PZ3 A;  4D10 C;  1MQS A;  4F1P A;  3R9M A;  2V4L A;  2X6H A;  1NZN A;  4IRU A;  5FJY A;  4G26 A;  1N9A A;  3SQV A;  1S63 A;  1BPO A;  2CFZ A;  2ILR A;  3L6A A;  1H6O A;  1TNZ A;  2A5U A;  2I1K A;  5BV1 A;  3CHR A;  3KSQ A;  3TG4 A;  2QC9 A;  3SFZ A;  3Q4A B;  2P9N G;  5ENQ D;  2WXR A;  3CVV A;  3RO3 A;  2R02 A;  5ARG A;  1N4Q A;  5KBA A;  5EIB E;  2V5F A;  4AP2 A;  3TG5 A;  5BW8 C;  1TNU A;  1WY6 A;  2ZIS A;  5D2M C;  4B89 A;  4OVU A;  2IO3 C;  5FQ6 A;  3EIJ A;  2LNI A;  1UJJ A;  2LXM A;  2WVI A;  4OVV A;  4WNF A;  3U4T A;  3UIN C;  5KJL A;  1X81 A;  3FEY A;  3VTY A;  5FTP A;  5FIO A;  1KZP A;  3D9M A;  3ZEF A;  3I3N A;  5FWQ A;  1YCS B;  3ZHE A;  4G8K A;  3FUN A;  5KNG A;  5KJM A;  3D9N A;  3UM0 A;  2XEN A;  3BQO A;  1JCQ A;  4XIF A;  2FEZ A;  2WMN A;  2GRL A;  3EHN A;  3LPZ A;  1KLX A;  4RLY A;  4BX8 A;  4P29 A;  4CDN A;  5AYW D;  2X6I A;  1TYQ G;  4H7X A;  4WWO A;  3FY4 A;  1ELR A;  2KC7 A;  3AS4 A;  3U3W A;  1NFI E;  4HS2 A;  4KVM A;  4ACL A;  3LYA A;  3K9I A;  1DC2 A;  3DEO A;  2XCB A;  4J8S A;  1S0P A;  4F3V A;  4C0E A;  2GRR B;  3FTV A;  3ZU7 B;  3S2A A;  5B1B E;  2ETA A;  3ZNG A;  3KEZ A;  3B7R L;  4JZY A;  1BI7 B;  4PS8 A;  2AXV A;  3T5V A;  5E75 A;  1OCO E;  3TAX A;  3OAW A;  2XQ0 A;  3RJV A;  5BT1 A;  1U3D A;  3DBS A;  3EHM A;  4HNA D;  2FO7 A;  4GU5 A;  3FHE A;  3JYS A;  4UI9 J;  5ENN A;  3GZ1 A;  4UWG A;  3DPY A;  4WWP A;  2VQ2 A;  3B7B A;  2C0M A;  4M7C A;  4FA6 A;  1SZA A;  4XKB A;  4JVS A;  2L9B A;  2I2O A;  4B8A A;  4U63 A;  4CYM D;  5BXU A;  2MYO A;  3E33 A;  2X3M A;  4C9B B;  4AVX A;  3NZS A;  4GZ6 A;  1K8K G;  2DIW A;  4UI9 C;  3TXM A;  4MRU A;  4FLH A;  1NA3 A;  4AV7 A;  3SBT B;  4BWR A;  3CHO A;  2VJ8 A;  5T4Y A;  4EZK A;  3KD7 A;  1E8Y A;  3LXU X;  3ABM E;  1HX8 A;  5KJN A;  4I9C A;  1MHQ A;  2VTB A;  3F6Q A;  4KMO A;  3LJ3 A;  3ULY A;  3I4G A;  4YDW A;  4JA9 A;  1HE8 A;  1MZC A;  2IQC A;  2GRQ B;  4K03 A;  1FVF A;  3E4B A;  4G23 A;  4JPS A;  3QAQ A;  4I6E A;  2OVF A;  4KXK B;  1JCS A;  1E7V A;  5E76 A;  5JMN D;  3PZ2 A;  5C1D A;  3TJP A;  1K3Z D;  3OTN A;  3VLE A;  4YVQ C;  3ZKJ A;  5CBO A;  2H6I A;  2VGY A;  3HIZ A;  4FC8 A;  4FHJ A;  4N2S A;  1OCR E;  1TNY A;  3FUI A;  1S64 A;  3D9J A;  3PDN A;  1EYH A;  2YQ8 A;  3U9W A;  1K1A A;  4ANW A;  5AEN A;  2R17 C;  5CED B;  3QKY A;  3HXF A;  4B8C B;  1RW2 A;  3UKR G;  3I4R B;  4BET A;  2FI7 A;  4U8V D;  3HG0 D;  3CHP A;  5G55 A;  3CIA A;  1N11 A;  4NAC A;  4QFV A;  4HOQ A;  2P9K G;  4DX7 D;  4I43 A;  1B89 A;  3EJN A;  4GML A;  3KSL A;  3NZU A;  4HFG A;  1UN8 A;  3RAU A;  1Z6T A;  1HH8 A;  3KAE A;  3SHF A;  3QWP A;  5CHE E;  3CVP A;  4MBG A;  3FUL A;  4ILI A;  4HXI A;  4OAV B;  1IHG A;  2H6F A;  4YVO A;  4I1O B;  1N52 A;  2PM6 A;  4BT8 A;  1N0R A;  4I1M A;  4K0R A;  4J8F A;  4C48 B;  3BG1 B;  4HBD A;  3CHQ A;  2V0P A;  2YIN A;  4Q96 A;  1SQM A;  2J8S D;  2OCC E;  4HOS A;  2WXO A;  2WXI A;  4O60 A;  3V30 A;  4N3B A;  2WXJ A;  3B13 A;  5JJ6 A;  5AQ7 A;  3D9K A;  3Q79 A;  3CKB A;  2H6H A;  3JXI A;  1HXI A;  2JLB A;  3HXC A;  2EIM E;  2ZU6 B;  4U96 D;  3FU3 A;  5T8I A;  3C3Q A;  4WNE A;  3RRU A;  2A5E A;  3DSV A;  1X5B A;  3PUK A;  2EIN E;  4DRX E;  5D0O D;  4KVO A;  3E32 A;  3KS2 A;  4A63 B;  1HU3 A;  4TXR A;  3AJI A;  1OWL A;  4J0U A;  3Q49 B;  4IUL A;  4RG6 A;  2F0Y A;  5J90 A;  3GZ2 A;  1TEZ A;  3D9L A;  4RSY A;  4GCN A;  2BKK B;  2C2L A;  2MHK A;  5JJT A;  4CT4 A;  5CCM A;  5FIN A;  2ETC A;  3G2V A;  3JCK C;  5FZQ A;  4OYS A;  3QK0 A;  2BUG A;  4LG6 A;  4B93 B;  2X6J A;  3RO2 A;  3NB2 A;  1E8Z A;  3ABK E;  1L5J A;  4LEU A;  2ZGD A;  3LS8 A;  3CVX A;  5DIZ A;  3T5X A;  4BT9 A;  3Q7F A;  2M63 A;  3FUD A;  3GZS A;  3S7F A;  2E0I A;  4K5C A;  3FFL A;  4RVB A;  4K5A B;  4U0Z A;  3Q15 A;  4GMJ A;  4RQI A;  4F1S A;  2R59 A;  4APF A;  4A3V A;  1H2T C;  2V8S E;  4HRM B;  3AS5 A;  3L17 A;  4U8H A;  4A1G A;  4EBA G;  4EEC A;  2PM7 A;  2I9C A;  5CRU A;  2J08 A;  4CCA A;  4FHK A;  4BFR A;  4GYW A;  2IO2 C;  2AVP A;  2XPY A;  3S7J A;  3UQ3 A;  4GTR A;  2B6C A;  4C0M A;  2DZN A;  2HYZ A;  2GRN B;  1WDY A;  3RSE G;  2NSZ A;  5B3S E;  1Y8M A;  1ZB1 A;  4HOU A;  3BEE A;  3RRM B;  1N94 A;  1JWG A;  4PDX A;  2XHE A;  1SW6 A;  5ARF A;  1UN9 A;  1AP7 A;  3AU4 A;  2MOW A;  4GTP A;  4CRW A;  4IYP A;  4XI0 A;  2LAI A;  3LY9 A;  3PEV B;  3W9G A;  2J4D A;  3P1U A;  1OWO A;  2KCK A;  3GW4 A;  1KPS B;  4E6H A;  3UT7 A;  3N71 A;  4UWL A;  3ZYQ A;  3LCA A;  2NYJ A;  3R7Q A;  4FJZ A;  5BPP A;  3APF A;  2XS1 A;  3TWS A;  3B7T A;  3HXE A;  3D9H A;  3SF4 A;  2VYI A;  2P9I G;  2C0L A;  3B7U X;  1Z3Y A;  4N5C A;  1N54 A;  2WPV A;  5EX0 A;  5LX8 A;  4FLB A;  5C2Y A;  5HRY A;  5LP0 A;  4YDE A;  4NUR A;  3T8K A;  3C5R A;  3D9I A;  4AY6 A;  4F6R D;  4ME2 A;  3URZ A;  4MLP A;  3PRE A;  2X6F A;  3UKU G;  2WXL A;  3TWX A;  1KZO A;  4LUN U;  1H19 A;  1YYH A;  4GPK A;  3NAW A;  4BX9 A;  3L08 A;  4GZD A;  3CR3 A;  2Y4T A;  2XRY A;  3DEP A;  4F53 A;  1MX4 A;  3VLF A;  1OY3 D;  4J7W A;  1D9S A;  1E7U A;  3MJW A;  1N4R A;  3FH5 A;  3NF1 A;  2IFU A;  3L9T A;  4UQX A;  3CVW A;  4U04 A;  1D8E A;  1H6K A;  3MEK A;  2AW6 A;  3G2S A;  1QQE A;  1DNP A;  4A3T A;  3SY2 A;  2OND A;  4EPZ A;  2IF4 A;  3SD5 A;  2GRP B;  3Q47 B;  1FPP A;  1EDU A;  1HFA A;  3ONK A;  2WXH A;  3R9A B;  4GZC A;  2LAH A;  1W3B A;  2QFC A;  3SFY A;  3RK6 A;  4BTB A;  3TWT A;  1ZU2 A;  2BED A;  1P5Q A;  4MKT A;  4BEP A;  3TWU A;  4O1O A;  3QC1 A;  4ANV A;  3FEX A;  3PUJ A;  3B7S A;  3QDN A;  3CK8 A;  3ZYK A;  4HQD A;  3R7R A;  3FUF A;  2ZXW E;  1BU9 A;  1U3C A;  2GRO B;  4ATZ D;  5ENS D;  3JUE A;  1IKN D;  4GTV A;  3EIQ C;  4BY6 A;  1JPL A;  3DSU A;  4AY5 A;  4GYO A;  4TXQ A;  2EIJ E;  3TXN A;  3V2O A;  2J9Q A;  3NQP A;  1U2V G;  3UX4 A;  2CHX A;  2OVB A;  4G2V A;  1G3N B;  2P9U G;  4KZC A;  3ZXP A;  1V55 E;  2P58 C;  4ZHB A;  2Q7F A;  3E34 A;  4ACK A;  3LJN A;  4EZL A;  2XCC A;  5CCL A;  2KCL A;  5G04 J;  1HF8 A;  1Y6I A;  3IBE A;  4N3C A;  1E8W A;  4DX5 D;  2V4H C;  4L7T A;  3HXB A;  2WXP A;  2XEE A;  3ZIM A;  3AAA C;  4HOR A;  1IHB A;  1LD7 A;  3Q73 A;  5FT9 A;  3CVN A;  4I9E A;  5BV0 A;  5AQB A;  1LF8 A;  4BSZ B;  1DVP A;  3CVL A;  3RRN B;  5LFA A;  2IOL A;  3G2T A;  3Q7A A;  1E96 B;  2PZI A;  2LO6 A;  3W9F A;  2Y3A A;  5ENT D;  2DYS E;  3SZ7 A;  4XZ4 A;  2RFM A;  4EQF A;  3WG7 E;  3AU5 A;  2IJG X;  5JA4 D;  2WQH A;  2XGS A;  3S7B A;  1PAQ A;  2Y0B G;  4JB8 P;  1Z3X A;  4GZ3 A;  1LD8 A;  2XZD G;  2WXQ A;  1IQU A;  4UI9 K;  2YHC A;  5LCW J;  4CGV A;  1SZ9 A;  3J5Q B;  3VLD A;  5AQA A;  4ABN A;  5JHA A;  1IYG A;  4U0S A;  2XGO A;  2KBX A;  4L2L A;  4XX5 A;  1KT0 A;  4KZ0 A;  5ENP D;  2OEW A;  4GPM A;  1SA4 A;  5EIL A;  5A6C A;  4JC8 A;  4EHM A;  2P9S G;  2P9P G;  4HVB A;  1Q2Z A;  4HRL A;  2ION A;  3PZ4 A;  4W9R A;  3MX3 A;  2QY7 A;  3Q9U C;  2R05 A;  4U8Y D;  1WM5 A;  4G11 A;  4JHR A;  1QZ2 A;  2OEV A;  4K5B A;  1XNF A;  3BUA A;  3ABL E;  3GYZ A;  2ETB A;  4U0U A;  3FTY A;  2OOE A;  2ZIR A;  2HE0 A;  2BTD A;  1OXJ A;  3IXE A;  5FZR A;  3JQ1 A;  5AIJ A;  3NOG D;  4GCO A;  4JXT A;  2UY1 A;  1TN6 A;  4GTO A;  4HLL A;  4TV3 A;  2F8X K;  3FTS A;  2PQR A;  3UIP C;  3CST A;  4GA2 A;  2F37 A;  3TWR A;  2CFU A;  3CEQ A;  5EID A;  4J6I A;  1N4P A;  3MKQ B;  3ESK A;  4L1B A;  1MX2 A;  3BG0 B;  4JA7 A;  2WXN A;  3FU0 A;  3QJZ A;  3FTZ A;  5LCW C;  3FU6 A;  3FDH A;  3B95 A;  3ASG A;  1MYO A;  4LER A;  3Q9N C;  4NQ0 A;  2IU1 A;  3AG2 E;  1H2U A;  4TUU A;  3SFX A;  5HS0 A;  3DRA A;  2Y1L E;  3UM2 A;  1A5E A;  4WND A;  4ANU A;  1UW4 B;  2AXU A;  3CGH A;  5EN5 D;  3DXK G;  2HR2 A;  5BNW A;  3ZUV B;  3JXJ A;  2XZT G;  4GA0 A;  4AJW A;  1UG3 A;  4JL0 A;  5CER B;  2P9L G;  4M3O A;  2ZGG A;  3ZVV A;  4ANX A;  3U64 A;  3UPV A;  2QZA A;  4UQY A;  2VGE A;  5AQ9 A;  3FUK A;  3V79 K;  3CHS A;  2WQ6 A;  5A23 A;  4L23 A;  3APC A;  4GZ5 A;  1MX6 A;  4PH4 B;  2FF4 A;  3L82 A;  1LTX A;  3PS6 A;  2LUH A;  2LSU A;  3OXF A;  3SO8 A;  2L0T B;  4UUC A;  3UXG A;  3FU5 A;  3FTU A;  2GW1 A;  5FZS A;  3ZN3 A;  1FT2 A;  3EU5 A;  4G1T A;  3TWV A;  3AG4 E;  1OUV A;  3TGO A;  2HM8 A;  1SA5 A;  3L16 A;  3UUX A;  4URK A;  1TJC A;  4CDM A;  4JEH A;  3RU0 A;  3UM1 A;  2DBA A;  2J07 A;  4BSX A;  1TJF A;  3QB2 A;  3HRA A;  4TXP A;  2I1J A;  4R7L A;  1N0Q A;  1S70 B;  2PNN A;  3HXD A;  3LVQ E;  4I2W A;  3ASN E;  4FP7 A;  4GA1 A;  5EX3 A;  5EDS A;  4UWH A;  3BU8 A;  3EDT B;  4Z68 A;  1N95 A;  4UWK A;  3UM3 A;  1NI1 A;  3Q75 A;  3CVU A;  1WAO 1;  3MV2 B;  3IHV A;  3IKO B;  3MGB A;  4AM9 A;  4WUY A;  4DX1 A;  4NIK A;  2JAB A;  1BI8 B;  2EQX A;  3CK9 A;  3ZHE B;  3CHM A;  3FUE A;  5CEC B;  2VSO E;  2CHZ A;  4TRQ A;  2OV8 A;  2QYU A;  3ZYM A;  4HI8 A;  5ENO D;  3ZPJ A;  5H7P A;  4PS3 A;  3APD A;  2EIL E;  3O4Z A;  3CV0 A;  5A7D B;  4TUM A;  2DVW A;  3DSW A;  3FUJ A;  5G05 J;  3LDZ A;  2J49 A;  3PZ1 A;  1TN8 A;  4Y6C A;  1NA0 A;  3ISM C;  3CKC A;  1E8X A;  4N3A A;  4KT6 B;  4L2Y A;  2IY0 C;  3ML9 A;  2WM9 A;  3ZRH A;  2IEJ A;  2WQ7 A;  5KNH D;  4GB9 A;  5HI7 A;  1DCE A;  3JQ0 A;  1OCC E;  2DWZ A;  3MA5 A;  2GRM A;  1DCQ A;  4BER A;  3QNK A;  2J09 A;  3HYM B;  3LY8 A;  1TR4 A;  3FUM A;  1H6P A;  4HB5 A;  2LSV A;  2H6G A;  4JW1 A;  2GGF A;  4EZJ A;  4QQI A;  4CZ2 D;  4B94 A;  1EF1 C;  4I2Z A;  2YNQ A;  2RD0 A;  2MRI A;  3RKV A;  3WXX A;  3LEW A;  5G05 C;  3PH0 C;  5ANR A;  3ASH A;  2KZT B;  1RZ4 A;  4FAD A;  3QAR A;  5KJK A;  5AAO A;  3MYV A;  3ZGQ A;  3SI5 A;  4N2Q A;  4A55 A;  5M72 A;  3C3R A;  4XE0 A;  2L6B A;  3ZXS A;  1TNB A;  4OAU C;  4DX6 D;  1WG0 A;  3SBS A;  3AG3 E;  4EBA A;  4GMR A;  3HVE A;  3ULQ A;  3PNL B;  4N5Q A;  3CSF A;  2WB2 A;  3PZD A;  5EYL A;  4G25 A;  3FH7 A;  2DYR E;  4H7Y A;  4ILH B;  1HZ4 A;  4MS6 A;  1PC2 A;  3UTM A;  1E90 A;  1H2V C;  1NL4 A;  1OT8 A;  4YND A;  3QWW A;  4NRH B;  2VTB B;  3E37 A;  4B0Z A;  5G04 C;  3D9O A;  3CVY A;  4G8L A;  3MV3 B;  3CLJ A;  4HLE A;  4X8Q A;  1UOH A;  1Z5S C;  2X38 A;  2F8Y A;  2WMO A;  2AJA A;  2A4Z A;  4CT0 A;  4ATG A;  4DJA A;  4FU3 A;  5AAR A;  1NP7 A;  2UY1 B;  2QYJ A;  4I17 A;  5T3R A;  3CK7 A;  3C72 A;  3NBN B;  3V2X A;  4N39 A;  2Y4U A;  1PY1 A;  1UJK A;  3IEG A;  5ITZ F;  4L9P A;  4J8Y A;  3ONL A;  2YHE A;  3UIO C;  4LNB A;  5EKQ D;  4Q69 A;  3DST A;  1ELW A;  1O1T A;  4F7A A;  2CG2 A;  1JCR A;  3O48 A;  4DI3 A;  3ENE A;  5IY5 E;  4IN3 B;  4E85 A;  1OWP A;  4I6G A;  5J08 A;  3G2U A;  2FUL A;  4GTS A;  1INZ A;  2XS8 A;  2FO1 E;  1KT1 A;  4U07 A;  2VGX B;  1JWF A;  1BLX B;  3AG1 E;  3PRZ A;  1OCZ E;  3OXG A;  4U95 D;  4HOT A;  5ENR D;  1O5M A;  3D3M A;  1H0A A;  4KBQ A;  2Y69 E;  3UT4 A;  4LCT A;  2FBN A;  3HDX A;  1XGW A;  4JHJ A;  2WXF A;  3PE4 A;  3DWL G;  4WWN A;  5JHB A;  2PL2 A;  1YA0 A;  4KYO B;  2NC9 A;  4PS7 A;  4FUL A;  1AWC B;  3ESL A;  3J5P A;  4J8D A;  3MKR A;  1ELK A;  4PUC A;  4CGW A;  4O1P A;  5AN8 A;  3MZL B;  3U66 A;  4GTQ A;  3PVL A;  1VDY A;  1FT1 A;  2VSN A;  1ZBP A;  3TWW A;  3PE3 A;  2X6K A;  1OWM A;  4CDR A;  3DSX A;  3EU9 A;  2RKK A;  3G2W A;  2XPZ A;  2J4B A;  3QWV A;  2CHW A;  3T8M A;  4DK5 A;  3UMV A;  3FP3 A;  4AIF A;  5BUZ A;  3LKU A;  1FVH A;  3L13 A;  3S7D A;  5DBK A;  1A17 A;  1V54 E;  4DUI A;  1O1S A;  3V31 A;  5FQ4 A;  2IOS A;  2RFA A;  4GYY A;  1YMP A;  1SVX A;  5D66 A;  3SNX A;  2DZO A;  3DSS A;  5G2N A;  2KZT A;  2V5Q C;  4LSZ E;  3EHQ A;  4Q94 A;  4YDY A;  3T9K A;  3ML8 A;  5HKP A;  1N4S A;  4ILG A;  5KWD A;  4BTA A;  2EIK E;  2HO1 A;  4DI4 A;  1O1R A;  5CMY A;  2KAT A;  4ZFH A;  3KEA A;  4CEM A;  4JEU A;  2PQN A;  3HHM A;  2DCP A;  2LXL A;  4UQZ A;  1QNF A;  5AJD A;  2KM4 A;  4GAA A;  2AXZ A;  4I6J A;  5JJ7 A;  4U7E B;  1QBQ A; 
#chains in the Genus database with same CATH homology
 3UIN C;  2IO2 C;  5D2M C;  3UIO C;  2GRN B;  2GRO B;  1Z5S C;  2GRP B;  3UIP C;  2IO3 C;  2GRQ B;  2IY0 C;  2GRR B;  1KPS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...