3UIOC

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/isomerase/protein binding
molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2011-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 3uioC00
2GRNB 1KPSB 2IO2C 1Z5SC 3UIPC 3UIOC 2GRQB 5D2MC 2IO3C 3UINC 2GRPB 2IY0C 2GROB 2GRRB
chains in the Genus database with same CATH superfamily
2FBNA 4EQFA 3VLEA 3EHNA 1IKND 2VYIA 2KBXA 4OAVB 3OTNA 3LCAA 2A5UA 2FI7A 3EHMA 3U4TA 1FT1A 1TEZA 2L6JA 3TWUA 4ZFHA 3PZ1A 3SQVA 3SZ7A 3MKRA 2J49A 1U3DA 4HOSA 3ASDA 4JL0A 3UMVA 3MKQB 3OXFA 3UXGA 2WPVA 4WNDA 3SY2A 1EYHA 3PDNA 4F3VA 2BKKB 3LDZA 3AS5A 1O1TA 5JA4D 2WXRA 4GAAA 1KT1A 2I2OA 3TWTA 3UIOC 4F6RD 4ZHBA 1HF8A 5ENSD 3NF1A 3RRUA 4AOFA 4L23A 3UT4A 2X38A 3FUHA 2Y4UA 2YNQA 3Q7FA 1WAO1 3ZXPA 4C0EA 1YCSB 3ZRHA 2F37A 1ZBPA 1D8DA 4YDEA 2FEZA 4IULA 3LPZA 1MJ0A 3FU5A 3ZYLA 2AWIA 3QWPA 3ZXSA 3TXNA 4HBDA 2KXPC 5DBKA 1GW6A 4XI0A 3E4BA 2ZGDA 3E30A 4YDWA 3ZHEA 4HXIA 3D9OA 4G8LA 2Y3AA 3JQ0A 4TXPA 3RU0A 1D9SA 4U0ZA 2XS8A 3LJNA 2NC9A 1E96B 3DWLG 2QY7A 3FU6A 2XZDG 4AP2A 4X8QA 4HB5A 2XRYA 2WXHA 3TJPA 4O60A 4HRNA 3UKRG 1JCSA 2L6BA 1TN6A 5FZQA 4U0SA 3ASHA 4E85A 2OVFA 1TNZA 3CQGB 3BG0B 1UW4B 4OYSA 5T3RA 1DCEA 3FUKA 4CGVA 4AEZC 3SI5A 4GZ5A 3ZW3A 3CVPA 1HXIA 4JEUA 3V2OA 3DBSA 4YVQC 3QDNA 3CSTA 4ACKA 3TWXA 1NP7A 4FC8A 5KCMA 5CHEE 2XPIA 2X3MA 3TG4A 1OCRE 3CVNA 4J8EA 4KVOA 3APDA 4BX9A 3ULQA 3CHOA 3CQCB 3QNKA 2P9IG 2KCKA 3MCXA 5J08A 3C3RA 3D3MA 2XPYA 2F8YA 3NOCD 5T8IA 4L7TA 3LY7A 2Q7FA 3E32A 3SO8A 4DX7D 2GRNB 5LP0A 1KLXA 3DSVA 3UM0A 1N0QA 3C3OA 3LVQE 3HDXA 3DPDA 4EBAA 2YHCA 1TNUA 2R03A 2BKGA 3X2QE 1OUVA 4DI3A 5BT1A 4URKA 2X6KA 2Y69E 3C5RA 5J90A 3PZ4A 4APFA 4FJZA 1ZB1A 2XEVA 4K0RA 5ENNA 4JA7A 1YYHA 3AU5A 4AJWA 3LS8A 3ABME 2XEEA 4EZLA 4GZ6A 1LD8A 4BESA 4LUNU 5ARFA 2ETAA 5G55A 4L2LA 4GTTA 1NA0A 3APFA 1A5EA 1SW6A 2X6FA 2IO2C 3QJZA 3O48A 2Y1LE 5EIDA 2C2LA 3AG2E 3IBEA 4GMJA 4AIFA 4EBAG 3RSEG 3DXMG 3UINC 4MS6A 3B95A 5AQ9A 3R9MA 2VSYA 5CRUA 3V2XA 5LCWJ 5BV1A 2WXLA 1WG0A 2H6GA 4LG6A 1KZOA 3ZNGA 4KT6B 1HG5A 2LSUA 3Q75A 2DCPA 3PZDA 1N11A 3TAXA 3D9HA 4WWPA 1O1RA 4F53A 3PVLA 5AAOA 2KZTB 3QOUA 2J07A 3IV0A 4UWHA 2LXLA 1H2VC 4FULA 1OCZE 2RD0A 3FWVA 2IF4A 3L6AA 3T8MA 3G2SA 3TWRA 3UUXA 2PZIA 4A1SA 5CERB 5FT9A 3APCA 1IYGA 2V8SE 5KJKA 2V5QC 5G05J 2KCVA 3DSUA 4NRHB 1OWPA 3ZEFA 2XCBA 3S7FA 3HXCA 3KAEA 5KBAA 2VSNA 5CCMA 4G8KA 4Q94A 2YQ8A 4DLOA 2FF4A 5HQ8A 3IEGA 2ZGGA 4BTBA 3PRZA 4M3OA 4ACLA 1E8XA 5D0OD 1HFAA 3ASGA 2XGOA 5E76A 1MZCA 3JQ1A 2V4HC 3MV3B 3TWSA 4LEUA 4CGWA 2IOLA 3FTSA 3NQPA 4U95D 5AYWD 4UWKA 4LERA 3FEXA 4ANUA 1O5MA 3JUIA 2IO3C 4PH4B 1ZU2A 2P9SG 3PUKA 3B7RL 5FINA 5H7PA 2F0YA 3J5QB 5C2YA 1K8KG 5CECB 1S64A 3ULYA 2L9BA 3ABLE 4CDNA 3HHMA 1VDYA 3PEUB 4I9EA 3ASOE 3T5VA 2ETCA 5HRYA 4GA2A 2ONDA 4HRLA 4LNGA 3HXEA 4HOQA 3RRMB 5AENA 2XENA 4GTSA 2VGXB 3W9FA 2FO7A 1UN9A 1OXJA 1INZA 1OCCE 3FUMA 2DYSE 3QWVA 3FDHA 1NFIE 4G1TA 3QC1A 3UT8A 4XKCA 1RW2A 2UY1A 1BLXB 4RG9A 3CR3A 3T9KA 3QK0A 3CSFA 3L17A 1V55E 2XGSA 1ELKA 3I4RB 3U64A 1BI8B 1X81A 1G3NB 3TWVA 4HLEA 5KJNA 3FUFA 4K5AB 3V79K 4G25A 4LNUD 5A7DB 5BPPA 3B7TA 4TRQA 4GPMA 1IHBA 1OWNA 1N9AA 5EDSA 4RG6A 1JUQA 2DVWA 4KZCA 5E75A 3DSSA 4GPKA 5EYLA 4I2WA 4BTAA 3CVYA 1QNFA 3RJVA 1NA3A 1SA4A 3NBNB 4ILHB 2R5SA 3CHQA 3ZGQA 3JUEA 2I9CA 5KJLA 4MRUA 2PQNA 4U8VD 2X6JA 3CIAA 3SD5A 5JHBA 2AXUA 5EIBE 1S63A 5JJTA 5AJDA 2HR2A 4QQIA 2I1KA 3G2WA 3DXKG 4U96D 4C48B 4XIFA 4I1OB 3TG5A 1ELWA 4J0UA 3HRAA 3S2AA 5EILA 4B94A 5D66A 2J9QA 4YDOA 4RQIA 2AXZA 4G11A 3MEKA 5FWQA 3CK8A 5HS0A 3ASNE 4FU3A 4FHKA 3UT7A 2WQ6A 2OEWA 4N2QA 2VGEA 1X5BA 5ENRD 3WG7E 3RO3A 4N2SA 2J4DA 2WMOA 4JHJA 3HXBA 4A63B 3HVEB 4K5CA 2DWZA 2XEHA 2R2LA 3CHRA 3VTXA 5BXUA 4LRZA 4NQ0A 4EZKA 4UQXA 5G04J 1YA0A 3MA5A 5CEAA 2KM4A 4GU5A 2H6FA 5FTPA 4LCTA 2WXIA 4WWNA 1E7VA 3AG3E 3NB2A 1LTXA 4N5QA 5ARGA 3S7DA 1TNBA 4WWOA 3EHRA 3CKBA 5CEDB 3RAUA 2XHEA 3Q9NC 4B8CB 3ULEG 3PEVB 3RRNB 2QYJA 3MZLB 2MHKA 3OXGA 3CV0A 4CCAA 2UWJG 2WXGA 2GGFA 3AU4A 3HXFA 2RFAA 4IYPA 3U66A 2PL2A 4HVBA 4N5CA 1TNOA 4ABNA 3SFZA 2CHXA 1Z5SC 4A1GA 4I2ZA 4BX8A 1LF8A 4MLPA 1SZ9A 2CFUA 2PQRA 3PE4A 3NZUA 4TXRA 3TGOA 4ANVA 3FUIA 4BSZB 3OXLA 2AJAA 2NXPA 4LNBA 4MBGA 4XKBA 1E8YA 2WVIA 5HI7A 2WQHA 5FIOA 4HLLA 2XS1A 4BERA 1BD8A 1OCOE 2X6HA 1TN7A 3MYVA 4GA1A 4NIKA 3PZ2A 4FHJA 4A55A 2B0OE 3D9KA 1H6KA 2NSZA 2EIME 3MJWA 5A23A 4PS3A 1HU3A 2IOSA 2GRMA 3T5XA 3WXXA 1FPPA 3L82A 3AG4E 4U8YD 4I6JA 4AY5A 4JHKA 1UN8A 3LVRE 3PS6A 5DIZA 4DUIA 3ZN3A 2LO6A 4YNDA 2WXNA 1B89A 3ZIMA 3PNLB 2KCLA 2HO1A 4HOUA 4HFGA 2Y0BG 4WUYA 2MRIA 3SBSA 1JCQA 3W9GA 5CRVA 3ASFA 4G24A 4RLYA 4JEHA 4O6FA 4U04A 4G23A 4RVBA 2IQCA 3GZSA 2ILRA 4YDYA 1UOHA 5LOZA 3KSLA 3FH7A 5CMYA 3CEQA 3JXIA 1OY3D 3E34A 2HE0A 4E6HA 2VTBA 4FP7A 2QZAA 1KZPA 4W9RA 4UWGA 1YMPA 5FQ4A 1HE8A 2IY0C 4G26A 4ANXA 5CMWA 1SZAA 4PUCA 4UI9J 1TJCA 3UIPC 4KZ0A 4UQYA 3UTMA 1HG2A 3V31A 4JB8P 2LUHA 3ENEA 3UI2A 5ENQD 3CVXA 3FY4A 5JHAA 2FULA 4WAFA 5FQ8A 4R7LA 3Q9UC 2GW1A 4GTQA 3F6QA 5JMND 4GTOA 2E0IA 4U07A 4F7AA 2WXJA 2L0TB 1H0AA 1P5QA 3MKQA 3SF4A 4G2VA 3FFLA 1JPLA 2IONA 4O1PA 3FU0A 3D9NA 4B89A 2VSOE 4XE0A 3ISMC 3G2UA 1DNPA 1OT8A 1IQUA 4C9BB 2RG8A 2I1JA 5B1BE 4EECA 1MX4A 5LX8A 3DEPA 4A3VA 3FH8A 4U63A 4ANWA 4BSXA 2JEKA 3GZ2A 4ATGA 3LY9A 2M63A 1H6OA 2LAHA 4LSZE 3CHPA 5LFAA 4FA6A 4FLHA 5LCWC 2CG3A 3LY8A 4J8YA 5IY5E 4APOA 1IHGA 4UWLA 4CRWA 2DBAA 1UJJA 5B3SE 4IN3B 3ZHEB 1IQRA 2IFUA 3DSTA 3P1UA 4XEIG 3DEOA 3L9TA 3FTYA 3UQ3A 1ELRA 4GMRA 3MGBA 1D8EA 1QQEA 4J8SA 2OVBA 4JZYA 3MV2B 2X6IA 3JCKC 2QYUA 3C72A 4BFRA 3FTVA 4CEMA 4EPZA 1V54E 2OV8A 3CKCA 5AQBA 4BEPA 4MKTA 1SQMA 1Q2ZA 4JC8A 3D9JA 4UWFA 1JWGA 3OAWA 2XGMA 4L2YA 3ZKJA 2AW6A 4OVVA 2P9PG 1N52A 5BUZA 5KJMA 3CVUA 3D9LA 1FT2A 1WDYA 4I6GA 2CFZA 2ETBA 5G05C 3ZPJA 1FVHA 2R59A 5CCLA 3CK9A 2GRRB 4ME2A 2GRQB 2JLBA 2GROB 1KPSB 4AY6A 5M72A 4IRUA 5ENOD 2JABA 1MYOA 4TXQA 2ZISA 4CZ2D 4GYYA 2J8SD 4U8HA 3SNXA 3GZ1A 1BI7B 2A5EA 3LJ3A 4CYMD 3EUVA 5ANLA 5EKQD 4QFVA 2HM8A 3GW4A 1FCHA 1TNYA 2WXPA 3LXUX 3QAQA 4BETA 3NZSA 2AXVA 2VGYA 3FU3A 1N4RA 4I9CA 3S7BA 2V4LA 2BEDA 4GTPA 3LEWA 4OVUA 1N0RA 3AAAC 5KNGA 3EDTB 4JPSA 3CVVA 2KC7A 4JW1A 4HQDA 4DK5A 1PY1A 4HS2A 3CVQA 5AIJA 4UI9K 4KBQA 3CK7A 5CBOA 3B7UX 4KXKB 5BNWA 4F1PA 3ABKE 4N3BA 1QZ2A 3RKVA 3IKOB 3ZUVB 2DIWA 4H7YA 4N39A 3HG0D 3EIQC 4I43A 5B1AE 3SHFA 2MYOA 2PM7A 1H6PA 4I6EA 1XGWA 4GTMA 4GCOA 3KEZA 3IHVA 2WM9A 2IU1A 4WNEA 3VLDA 2ZU6B 3PUJA 2EILE 2LNIA 3EIJA 3BEEA 4KMOA 3SBTB 4PDXA 5ENTD 1HX8A 4BT8A 3RK6A 4EZJA 4GZDA 2ZIRA 1OWOA 3RO2A 1PAQA 1AP7A 1TR4A 2LXMA 1MQSA 1N4SA 2KATA 3UPVA 2AVPA 4CDRA 5G2NA 3MX3A 4GA0A 4GZ3A 1NL4A 1SVXA 3DSWA 1N94A 2WMNA 4J8FA 2KZTA 3U9WA 1N4PA 4YVOA 5D0QD 3D9PA 5BV0A 3GYZA 3PZ3A 3Q73A 1UG3A 3CHMA 3PE3A 4AV7A 3KSQA 2YHEA 2GRPB 4B8AA 1H2UA 3URZA 4N3CA 3FUEA 2CG2A 1S0PA 1HH8A 3DPYA 4V3IA 3EU9A 4Q96A 3N71A 1RZ4A 3FTWA 4I17A 2CHWA 3VTYA 5CBNA 3C3QA 3UM2A 4RSYA 4JD2G 2WXMA 4ILGA 2WXQA 1AWCB 1MX6A 2J08A 1SA5A 3I3NA 4DX2A 3L16A 5ITZF 5ENPD 4ILIA 3QARA 2VQ2A 4U7EB 1E8WA 4UQZA 3RIBA 5EX0A 2YINA 2V0PA 5D2MC 2F8XK 1HZ4A 4XX5A 3PH0C 3HXDA 2PNNA 4J7WA 2XCCA 2MOWA 3Q15A 3BG1B 4HOTA 3Q79A 3FUNA 4C0MA 1A17A 4B93B 3AS8A 4EHMA 3HIZA 1Z6TA 1BU9A 2UY1B 2P58C 2VGXA 1H2TC 2WXFA 4TUMA 5G04C 1EF1C 2OCCE 1N95A 2DYRE 3IHYA 3ZFWA 1FVFA 4JVSA 4I1MA 2C0MA 3AS4A 4UUCA 2RKKA 3SFXA 4A3TA 3T8KA 4CDMA 2DZNA 2OOEA 3D9MA 3TWWA 2WXKA 1JCRA 1N54A 3ZVVA 2B6CA 3C98A 5AQ7A 1K3ZD 1S70B 2WB2A 4HRMB 2FO1E 1EDUA 3EHQA 1OWLA 1QYMA 3UM1A 4XZ4A 3DSXA 2H6IA 1HO8A 2P9KG 3O4ZA 4GMLA 3ONLA 4FADA 2WQ7A 2IEJA 2P9UG 3FTUA 1O1SA 5FZRA 4HI9A 2BTDA 1WM5A 1NI1A 3Q7AA 2OEVA 4NACA 3CGHA 3I5PA 3ZYMA 1U3CA 3VLFA 4BY6A 2GRLA 4J6IA 3FUDA 4FLBA 4I1AA 4GTRA 3JXJA 5KWDA 3ML9A 3Q5MA 1MHQA 3FH5A 2CHZA 1LD7A 3JYSA 3J5PA 3ZYQA 3Q78A 4OAUC 2R17C 4L1BA 2QFCA 2J09A 3FUJA 5FQ6A 2J4BA 4BT9A 3BUAA 2DZOA 1TN8A 5BXOA 5C1DA 2ZXWE 3B13A 3FHEA 4CT0A 3TL5A 1K1BA 2R02A 4KYOB 4U0UA 3G2TA 1WY6A 4TV3A 3FTZA 4GB9A 5JJ6A 5T4YA 3LYAA 3R7QA 2I6HA 2H6HA 3FULA 3I4GA 5AARA 3KD7A 2XQ0A 4Y6CA 2EINE 5BW8C 1DCQA 2BF0X 3Q47B 4JHRA 4WNGA 2C0LA 1Z3YA 2IJGX 4AVXA 3BU8A 1OWMA 3G2VA 4N3AA 5EX3A 3HVEA 3R9AB 4K5BA 3CLJA 2EQXA 3AG1E 3E37A 2WXOA 2EIKE 3CVLA 4DLQA 3B7BA 3CHSA 2HYZA 4BWRA 2VJ8A 4L9PA 5JJ7A 4Y6WA 3IXEA 4M7CA 3K9IA 3TXMA 2XPZA 4DJAA 1IXVA 4HI8A 5HKPA 1L5JA 3QB2A 4UI9C 2LSVA 3S7JA 1N4QA 2L0IA 3FEYA 2BUGA 4O1OA 4Q69A 1Z3XA 3L08A 3QKYA 2P9LG 3SFYA 2P9NG 3CVWA 3KS2A 4B0ZA 5AQAA 4Z68A 4DX5D 4DX1A 4F1SA 4P29A 4GZCA 3ML8A 4NURA 2QC9A 2NYJA 5FJYA 4AM9A 3D9IA 2P2CP 1E8ZA 1DC2A 1PC2A 4JA9A 1Y8MA 2V5FA 3U3WA 1KT0A 4GYWA 4WNFA 3Q4AB 3Q49B 1K1AA 3KEAA 5AN8A 3ESLA 3L54A 4GTVA 3PREA 3AJIA 3LKUA 4JXTA 1U2VG 2XRZA 3SGHA 4PS8A 1XNFA 3L13A 1UJKA 4J8DA 4GCNA 5KNHD 2Y4TA 5AJLA 1W3BA 3QWWA 1DVPA 3PNTB 4TUUA 1Y6IA 1JWFA 1H19A 3ESKA 2E2EA 3UKUG 4DPRA 3P2BA 2PM6A 3B7SA 1NZNA 2R05A 3BQOA 4D10C 3FP3A 2XZTG 3EU5A 3ONKA 3R7RA 2RFMA 4GYOA 5EN5D 3DRAA 3ZU7B 3NOGD 5ANRA 4ATZD 3EJNA 4K03A 3FTXA 3UM3A 4DI4A 4HNAD 5EYPF 3TWQA 1TYQG 4DX6D 1TJFA 1E7UA 2A4ZA 5FQ7A 5FZSA 1QBQA 4XI9A 1BPOA 1HS6A 3HYMB 3L22A 2VTBB 3V30A 4H7XA 1EPUA 1E90A 4AXHA 2VSXE 4FJYA 2EIJE 4KVMA 4HORA 5A6CA 4PS7A 1MX2A 3ZYKA 3UX4A 2LAIA 3E33A 4DRXE 4CT4A 3NAWA
chains in the Genus database with same CATH topology
2GRNB 1KPSB 2IO2C 1Z5SC 3UIPC 3UIOC 2GRQB 5D2MC 2IO3C 3UINC 2GRPB 2IY0C 2GROB 2GRRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRN B;  1KPS B;  2IO2 C;  1Z5S C;  3UIP C;  3UIO C;  2GRQ B;  5D2M C;  2IO3 C;  3UIN C;  2GRP B;  2IY0 C;  2GRO B;  2GRR B; 
#chains in the Genus database with same CATH topology
 2FBN A;  4EQF A;  3VLE A;  3EHN A;  1IKN D;  2VYI A;  2KBX A;  4OAV B;  3OTN A;  3LCA A;  2A5U A;  2FI7 A;  3EHM A;  3U4T A;  1FT1 A;  1TEZ A;  2L6J A;  3TWU A;  4ZFH A;  3PZ1 A;  3SQV A;  3SZ7 A;  3MKR A;  2J49 A;  1U3D A;  4HOS A;  3ASD A;  4JL0 A;  3UMV A;  3MKQ B;  3OXF A;  3UXG A;  2WPV A;  4WND A;  3SY2 A;  1EYH A;  3PDN A;  4F3V A;  2BKK B;  3LDZ A;  3AS5 A;  1O1T A;  5JA4 D;  2WXR A;  4GAA A;  1KT1 A;  2I2O A;  3TWT A;  3UIO C;  4F6R D;  4ZHB A;  1HF8 A;  5ENS D;  3NF1 A;  3RRU A;  4AOF A;  4L23 A;  3UT4 A;  2X38 A;  3FUH A;  2Y4U A;  2YNQ A;  3Q7F A;  1WAO 1;  3ZXP A;  4C0E A;  1YCS B;  3ZRH A;  2F37 A;  1ZBP A;  1D8D A;  4YDE A;  2FEZ A;  4IUL A;  3LPZ A;  1MJ0 A;  3FU5 A;  3ZYL A;  2AWI A;  3QWP A;  3ZXS A;  3TXN A;  4HBD A;  2KXP C;  5DBK A;  1GW6 A;  4XI0 A;  3E4B A;  2ZGD A;  3E30 A;  4YDW A;  3ZHE A;  4HXI A;  3D9O A;  4G8L A;  2Y3A A;  3JQ0 A;  4TXP A;  3RU0 A;  1D9S A;  4U0Z A;  2XS8 A;  3LJN A;  2NC9 A;  1E96 B;  3DWL G;  2QY7 A;  3FU6 A;  2XZD G;  4AP2 A;  4X8Q A;  4HB5 A;  2XRY A;  2WXH A;  3TJP A;  4O60 A;  4HRN A;  3UKR G;  1JCS A;  2L6B A;  1TN6 A;  5FZQ A;  4U0S A;  3ASH A;  4E85 A;  2OVF A;  1TNZ A;  3CQG B;  3BG0 B;  1UW4 B;  4OYS A;  5T3R A;  1DCE A;  3FUK A;  4CGV A;  4AEZ C;  3SI5 A;  4GZ5 A;  3ZW3 A;  3CVP A;  1HXI A;  4JEU A;  3V2O A;  3DBS A;  4YVQ C;  3QDN A;  3CST A;  4ACK A;  3TWX A;  1NP7 A;  4FC8 A;  5KCM A;  5CHE E;  2XPI A;  2X3M A;  3TG4 A;  1OCR E;  3CVN A;  4J8E A;  4KVO A;  3APD A;  4BX9 A;  3ULQ A;  3CHO A;  3CQC B;  3QNK A;  2P9I G;  2KCK A;  3MCX A;  5J08 A;  3C3R A;  3D3M A;  2XPY A;  2F8Y A;  3NOC D;  5T8I A;  4L7T A;  3LY7 A;  2Q7F A;  3E32 A;  3SO8 A;  4DX7 D;  2GRN B;  5LP0 A;  1KLX A;  3DSV A;  3UM0 A;  1N0Q A;  3C3O A;  3LVQ E;  3HDX A;  3DPD A;  4EBA A;  2YHC A;  1TNU A;  2R03 A;  2BKG A;  3X2Q E;  1OUV A;  4DI3 A;  5BT1 A;  4URK A;  2X6K A;  2Y69 E;  3C5R A;  5J90 A;  3PZ4 A;  4APF A;  4FJZ A;  1ZB1 A;  2XEV A;  4K0R A;  5ENN A;  4JA7 A;  1YYH A;  3AU5 A;  4AJW A;  3LS8 A;  3ABM E;  2XEE A;  4EZL A;  4GZ6 A;  1LD8 A;  4BES A;  4LUN U;  5ARF A;  2ETA A;  5G55 A;  4L2L A;  4GTT A;  1NA0 A;  3APF A;  1A5E A;  1SW6 A;  2X6F A;  2IO2 C;  3QJZ A;  3O48 A;  2Y1L E;  5EID A;  2C2L A;  3AG2 E;  3IBE A;  4GMJ A;  4AIF A;  4EBA G;  3RSE G;  3DXM G;  3UIN C;  4MS6 A;  3B95 A;  5AQ9 A;  3R9M A;  2VSY A;  5CRU A;  3V2X A;  5LCW J;  5BV1 A;  2WXL A;  1WG0 A;  2H6G A;  4LG6 A;  1KZO A;  3ZNG A;  4KT6 B;  1HG5 A;  2LSU A;  3Q75 A;  2DCP A;  3PZD A;  1N11 A;  3TAX A;  3D9H A;  4WWP A;  1O1R A;  4F53 A;  3PVL A;  5AAO A;  2KZT B;  3QOU A;  2J07 A;  3IV0 A;  4UWH A;  2LXL A;  1H2V C;  4FUL A;  1OCZ E;  2RD0 A;  3FWV A;  2IF4 A;  3L6A A;  3T8M A;  3G2S A;  3TWR A;  3UUX A;  2PZI A;  4A1S A;  5CER B;  5FT9 A;  3APC A;  1IYG A;  2V8S E;  5KJK A;  2V5Q C;  5G05 J;  2KCV A;  3DSU A;  4NRH B;  1OWP A;  3ZEF A;  2XCB A;  3S7F A;  3HXC A;  3KAE A;  5KBA A;  2VSN A;  5CCM A;  4G8K A;  4Q94 A;  2YQ8 A;  4DLO A;  2FF4 A;  5HQ8 A;  3IEG A;  2ZGG A;  4BTB A;  3PRZ A;  4M3O A;  4ACL A;  1E8X A;  5D0O D;  1HFA A;  3ASG A;  2XGO A;  5E76 A;  1MZC A;  3JQ1 A;  2V4H C;  3MV3 B;  3TWS A;  4LEU A;  4CGW A;  2IOL A;  3FTS A;  3NQP A;  4U95 D;  5AYW D;  4UWK A;  4LER A;  3FEX A;  4ANU A;  1O5M A;  3JUI A;  2IO3 C;  4PH4 B;  1ZU2 A;  2P9S G;  3PUK A;  3B7R L;  5FIN A;  5H7P A;  2F0Y A;  3J5Q B;  5C2Y A;  1K8K G;  5CEC B;  1S64 A;  3ULY A;  2L9B A;  3ABL E;  4CDN A;  3HHM A;  1VDY A;  3PEU B;  4I9E A;  3ASO E;  3T5V A;  2ETC A;  5HRY A;  4GA2 A;  2OND A;  4HRL A;  4LNG A;  3HXE A;  4HOQ A;  3RRM B;  5AEN A;  2XEN A;  4GTS A;  2VGX B;  3W9F A;  2FO7 A;  1UN9 A;  1OXJ A;  1INZ A;  1OCC E;  3FUM A;  2DYS E;  3QWV A;  3FDH A;  1NFI E;  4G1T A;  3QC1 A;  3UT8 A;  4XKC A;  1RW2 A;  2UY1 A;  1BLX B;  4RG9 A;  3CR3 A;  3T9K A;  3QK0 A;  3CSF A;  3L17 A;  1V55 E;  2XGS A;  1ELK A;  3I4R B;  3U64 A;  1BI8 B;  1X81 A;  1G3N B;  3TWV A;  4HLE A;  5KJN A;  3FUF A;  4K5A B;  3V79 K;  4G25 A;  4LNU D;  5A7D B;  5BPP A;  3B7T A;  4TRQ A;  4GPM A;  1IHB A;  1OWN A;  1N9A A;  5EDS A;  4RG6 A;  1JUQ A;  2DVW A;  4KZC A;  5E75 A;  3DSS A;  4GPK A;  5EYL A;  4I2W A;  4BTA A;  3CVY A;  1QNF A;  3RJV A;  1NA3 A;  1SA4 A;  3NBN B;  4ILH B;  2R5S A;  3CHQ A;  3ZGQ A;  3JUE A;  2I9C A;  5KJL A;  4MRU A;  2PQN A;  4U8V D;  2X6J A;  3CIA A;  3SD5 A;  5JHB A;  2AXU A;  5EIB E;  1S63 A;  5JJT A;  5AJD A;  2HR2 A;  4QQI A;  2I1K A;  3G2W A;  3DXK G;  4U96 D;  4C48 B;  4XIF A;  4I1O B;  3TG5 A;  1ELW A;  4J0U A;  3HRA A;  3S2A A;  5EIL A;  4B94 A;  5D66 A;  2J9Q A;  4YDO A;  4RQI A;  2AXZ A;  4G11 A;  3MEK A;  5FWQ A;  3CK8 A;  5HS0 A;  3ASN E;  4FU3 A;  4FHK A;  3UT7 A;  2WQ6 A;  2OEW A;  4N2Q A;  2VGE A;  1X5B A;  5ENR D;  3WG7 E;  3RO3 A;  4N2S A;  2J4D A;  2WMO A;  4JHJ A;  3HXB A;  4A63 B;  3HVE B;  4K5C A;  2DWZ A;  2XEH A;  2R2L A;  3CHR A;  3VTX A;  5BXU A;  4LRZ A;  4NQ0 A;  4EZK A;  4UQX A;  5G04 J;  1YA0 A;  3MA5 A;  5CEA A;  2KM4 A;  4GU5 A;  2H6F A;  5FTP A;  4LCT A;  2WXI A;  4WWN A;  1E7V A;  3AG3 E;  3NB2 A;  1LTX A;  4N5Q A;  5ARG A;  3S7D A;  1TNB A;  4WWO A;  3EHR A;  3CKB A;  5CED B;  3RAU A;  2XHE A;  3Q9N C;  4B8C B;  3ULE G;  3PEV B;  3RRN B;  2QYJ A;  3MZL B;  2MHK A;  3OXG A;  3CV0 A;  4CCA A;  2UWJ G;  2WXG A;  2GGF A;  3AU4 A;  3HXF A;  2RFA A;  4IYP A;  3U66 A;  2PL2 A;  4HVB A;  4N5C A;  1TNO A;  4ABN A;  3SFZ A;  2CHX A;  1Z5S C;  4A1G A;  4I2Z A;  4BX8 A;  1LF8 A;  4MLP A;  1SZ9 A;  2CFU A;  2PQR A;  3PE4 A;  3NZU A;  4TXR A;  3TGO A;  4ANV A;  3FUI A;  4BSZ B;  3OXL A;  2AJA A;  2NXP A;  4LNB A;  4MBG A;  4XKB A;  1E8Y A;  2WVI A;  5HI7 A;  2WQH A;  5FIO A;  4HLL A;  2XS1 A;  4BER A;  1BD8 A;  1OCO E;  2X6H A;  1TN7 A;  3MYV A;  4GA1 A;  4NIK A;  3PZ2 A;  4FHJ A;  4A55 A;  2B0O E;  3D9K A;  1H6K A;  2NSZ A;  2EIM E;  3MJW A;  5A23 A;  4PS3 A;  1HU3 A;  2IOS A;  2GRM A;  3T5X A;  3WXX A;  1FPP A;  3L82 A;  3AG4 E;  4U8Y D;  4I6J A;  4AY5 A;  4JHK A;  1UN8 A;  3LVR E;  3PS6 A;  5DIZ A;  4DUI A;  3ZN3 A;  2LO6 A;  4YND A;  2WXN A;  1B89 A;  3ZIM A;  3PNL B;  2KCL A;  2HO1 A;  4HOU A;  4HFG A;  2Y0B G;  4WUY A;  2MRI A;  3SBS A;  1JCQ A;  3W9G A;  5CRV A;  3ASF A;  4G24 A;  4RLY A;  4JEH A;  4O6F A;  4U04 A;  4G23 A;  4RVB A;  2IQC A;  3GZS A;  2ILR A;  4YDY A;  1UOH A;  5LOZ A;  3KSL A;  3FH7 A;  5CMY A;  3CEQ A;  3JXI A;  1OY3 D;  3E34 A;  2HE0 A;  4E6H A;  2VTB A;  4FP7 A;  2QZA A;  1KZP A;  4W9R A;  4UWG A;  1YMP A;  5FQ4 A;  1HE8 A;  2IY0 C;  4G26 A;  4ANX A;  5CMW A;  1SZA A;  4PUC A;  4UI9 J;  1TJC A;  3UIP C;  4KZ0 A;  4UQY A;  3UTM A;  1HG2 A;  3V31 A;  4JB8 P;  2LUH A;  3ENE A;  3UI2 A;  5ENQ D;  3CVX A;  3FY4 A;  5JHA A;  2FUL A;  4WAF A;  5FQ8 A;  4R7L A;  3Q9U C;  2GW1 A;  4GTQ A;  3F6Q A;  5JMN D;  4GTO A;  2E0I A;  4U07 A;  4F7A A;  2WXJ A;  2L0T B;  1H0A A;  1P5Q A;  3MKQ A;  3SF4 A;  4G2V A;  3FFL A;  1JPL A;  2ION A;  4O1P A;  3FU0 A;  3D9N A;  4B89 A;  2VSO E;  4XE0 A;  3ISM C;  3G2U A;  1DNP A;  1OT8 A;  1IQU A;  4C9B B;  2RG8 A;  2I1J A;  5B1B E;  4EEC A;  1MX4 A;  5LX8 A;  3DEP A;  4A3V A;  3FH8 A;  4U63 A;  4ANW A;  4BSX A;  2JEK A;  3GZ2 A;  4ATG A;  3LY9 A;  2M63 A;  1H6O A;  2LAH A;  4LSZ E;  3CHP A;  5LFA A;  4FA6 A;  4FLH A;  5LCW C;  2CG3 A;  3LY8 A;  4J8Y A;  5IY5 E;  4APO A;  1IHG A;  4UWL A;  4CRW A;  2DBA A;  1UJJ A;  5B3S E;  4IN3 B;  3ZHE B;  1IQR A;  2IFU A;  3DST A;  3P1U A;  4XEI G;  3DEO A;  3L9T A;  3FTY A;  3UQ3 A;  1ELR A;  4GMR A;  3MGB A;  1D8E A;  1QQE A;  4J8S A;  2OVB A;  4JZY A;  3MV2 B;  2X6I A;  3JCK C;  2QYU A;  3C72 A;  4BFR A;  3FTV A;  4CEM A;  4EPZ A;  1V54 E;  2OV8 A;  3CKC A;  5AQB A;  4BEP A;  4MKT A;  1SQM A;  1Q2Z A;  4JC8 A;  3D9J A;  4UWF A;  1JWG A;  3OAW A;  2XGM A;  4L2Y A;  3ZKJ A;  2AW6 A;  4OVV A;  2P9P G;  1N52 A;  5BUZ A;  5KJM A;  3CVU A;  3D9L A;  1FT2 A;  1WDY A;  4I6G A;  2CFZ A;  2ETB A;  5G05 C;  3ZPJ A;  1FVH A;  2R59 A;  5CCL A;  3CK9 A;  2GRR B;  4ME2 A;  2GRQ B;  2JLB A;  2GRO B;  1KPS B;  4AY6 A;  5M72 A;  4IRU A;  5ENO D;  2JAB A;  1MYO A;  4TXQ A;  2ZIS A;  4CZ2 D;  4GYY A;  2J8S D;  4U8H A;  3SNX A;  3GZ1 A;  1BI7 B;  2A5E A;  3LJ3 A;  4CYM D;  3EUV A;  5ANL A;  5EKQ D;  4QFV A;  2HM8 A;  3GW4 A;  1FCH A;  1TNY A;  2WXP A;  3LXU X;  3QAQ A;  4BET A;  3NZS A;  2AXV A;  2VGY A;  3FU3 A;  1N4R A;  4I9C A;  3S7B A;  2V4L A;  2BED A;  4GTP A;  3LEW A;  4OVU A;  1N0R A;  3AAA C;  5KNG A;  3EDT B;  4JPS A;  3CVV A;  2KC7 A;  4JW1 A;  4HQD A;  4DK5 A;  1PY1 A;  4HS2 A;  3CVQ A;  5AIJ A;  4UI9 K;  4KBQ A;  3CK7 A;  5CBO A;  3B7U X;  4KXK B;  5BNW A;  4F1P A;  3ABK E;  4N3B A;  1QZ2 A;  3RKV A;  3IKO B;  3ZUV B;  2DIW A;  4H7Y A;  4N39 A;  3HG0 D;  3EIQ C;  4I43 A;  5B1A E;  3SHF A;  2MYO A;  2PM7 A;  1H6P A;  4I6E A;  1XGW A;  4GTM A;  4GCO A;  3KEZ A;  3IHV A;  2WM9 A;  2IU1 A;  4WNE A;  3VLD A;  2ZU6 B;  3PUJ A;  2EIL E;  2LNI A;  3EIJ A;  3BEE A;  4KMO A;  3SBT B;  4PDX A;  5ENT D;  1HX8 A;  4BT8 A;  3RK6 A;  4EZJ A;  4GZD A;  2ZIR A;  1OWO A;  3RO2 A;  1PAQ A;  1AP7 A;  1TR4 A;  2LXM A;  1MQS A;  1N4S A;  2KAT A;  3UPV A;  2AVP A;  4CDR A;  5G2N A;  3MX3 A;  4GA0 A;  4GZ3 A;  1NL4 A;  1SVX A;  3DSW A;  1N94 A;  2WMN A;  4J8F A;  2KZT A;  3U9W A;  1N4P A;  4YVO A;  5D0Q D;  3D9P A;  5BV0 A;  3GYZ A;  3PZ3 A;  3Q73 A;  1UG3 A;  3CHM A;  3PE3 A;  4AV7 A;  3KSQ A;  2YHE A;  2GRP B;  4B8A A;  1H2U A;  3URZ A;  4N3C A;  3FUE A;  2CG2 A;  1S0P A;  1HH8 A;  3DPY A;  4V3I A;  3EU9 A;  4Q96 A;  3N71 A;  1RZ4 A;  3FTW A;  4I17 A;  2CHW A;  3VTY A;  5CBN A;  3C3Q A;  3UM2 A;  4RSY A;  4JD2 G;  2WXM A;  4ILG A;  2WXQ A;  1AWC B;  1MX6 A;  2J08 A;  1SA5 A;  3I3N A;  4DX2 A;  3L16 A;  5ITZ F;  5ENP D;  4ILI A;  3QAR A;  2VQ2 A;  4U7E B;  1E8W A;  4UQZ A;  3RIB A;  5EX0 A;  2YIN A;  2V0P A;  5D2M C;  2F8X K;  1HZ4 A;  4XX5 A;  3PH0 C;  3HXD A;  2PNN A;  4J7W A;  2XCC A;  2MOW A;  3Q15 A;  3BG1 B;  4HOT A;  3Q79 A;  3FUN A;  4C0M A;  1A17 A;  4B93 B;  3AS8 A;  4EHM A;  3HIZ A;  1Z6T A;  1BU9 A;  2UY1 B;  2P58 C;  2VGX A;  1H2T C;  2WXF A;  4TUM A;  5G04 C;  1EF1 C;  2OCC E;  1N95 A;  2DYR E;  3IHY A;  3ZFW A;  1FVF A;  4JVS A;  4I1M A;  2C0M A;  3AS4 A;  4UUC A;  2RKK A;  3SFX A;  4A3T A;  3T8K A;  4CDM A;  2DZN A;  2OOE A;  3D9M A;  3TWW A;  2WXK A;  1JCR A;  1N54 A;  3ZVV A;  2B6C A;  3C98 A;  5AQ7 A;  1K3Z D;  1S70 B;  2WB2 A;  4HRM B;  2FO1 E;  1EDU A;  3EHQ A;  1OWL A;  1QYM A;  3UM1 A;  4XZ4 A;  3DSX A;  2H6I A;  1HO8 A;  2P9K G;  3O4Z A;  4GML A;  3ONL A;  4FAD A;  2WQ7 A;  2IEJ A;  2P9U G;  3FTU A;  1O1S A;  5FZR A;  4HI9 A;  2BTD A;  1WM5 A;  1NI1 A;  3Q7A A;  2OEV A;  4NAC A;  3CGH A;  3I5P A;  3ZYM A;  1U3C A;  3VLF A;  4BY6 A;  2GRL A;  4J6I A;  3FUD A;  4FLB A;  4I1A A;  4GTR A;  3JXJ A;  5KWD A;  3ML9 A;  3Q5M A;  1MHQ A;  3FH5 A;  2CHZ A;  1LD7 A;  3JYS A;  3J5P A;  3ZYQ A;  3Q78 A;  4OAU C;  2R17 C;  4L1B A;  2QFC A;  2J09 A;  3FUJ A;  5FQ6 A;  2J4B A;  4BT9 A;  3BUA A;  2DZO A;  1TN8 A;  5BXO A;  5C1D A;  2ZXW E;  3B13 A;  3FHE A;  4CT0 A;  3TL5 A;  1K1B A;  2R02 A;  4KYO B;  4U0U A;  3G2T A;  1WY6 A;  4TV3 A;  3FTZ A;  4GB9 A;  5JJ6 A;  5T4Y A;  3LYA A;  3R7Q A;  2I6H A;  2H6H A;  3FUL A;  3I4G A;  5AAR A;  3KD7 A;  2XQ0 A;  4Y6C A;  2EIN E;  5BW8 C;  1DCQ A;  2BF0 X;  3Q47 B;  4JHR A;  4WNG A;  2C0L A;  1Z3Y A;  2IJG X;  4AVX A;  3BU8 A;  1OWM A;  3G2V A;  4N3A A;  5EX3 A;  3HVE A;  3R9A B;  4K5B A;  3CLJ A;  2EQX A;  3AG1 E;  3E37 A;  2WXO A;  2EIK E;  3CVL A;  4DLQ A;  3B7B A;  3CHS A;  2HYZ A;  4BWR A;  2VJ8 A;  4L9P A;  5JJ7 A;  4Y6W A;  3IXE A;  4M7C A;  3K9I A;  3TXM A;  2XPZ A;  4DJA A;  1IXV A;  4HI8 A;  5HKP A;  1L5J A;  3QB2 A;  4UI9 C;  2LSV A;  3S7J A;  1N4Q A;  2L0I A;  3FEY A;  2BUG A;  4O1O A;  4Q69 A;  1Z3X A;  3L08 A;  3QKY A;  2P9L G;  3SFY A;  2P9N G;  3CVW A;  3KS2 A;  4B0Z A;  5AQA A;  4Z68 A;  4DX5 D;  4DX1 A;  4F1S A;  4P29 A;  4GZC A;  3ML8 A;  4NUR A;  2QC9 A;  2NYJ A;  5FJY A;  4AM9 A;  3D9I A;  2P2C P;  1E8Z A;  1DC2 A;  1PC2 A;  4JA9 A;  1Y8M A;  2V5F A;  3U3W A;  1KT0 A;  4GYW A;  4WNF A;  3Q4A B;  3Q49 B;  1K1A A;  3KEA A;  5AN8 A;  3ESL A;  3L54 A;  4GTV A;  3PRE A;  3AJI A;  3LKU A;  4JXT A;  1U2V G;  2XRZ A;  3SGH A;  4PS8 A;  1XNF A;  3L13 A;  1UJK A;  4J8D A;  4GCN A;  5KNH D;  2Y4T A;  5AJL A;  1W3B A;  3QWW A;  1DVP A;  3PNT B;  4TUU A;  1Y6I A;  1JWF A;  1H19 A;  3ESK A;  2E2E A;  3UKU G;  4DPR A;  3P2B A;  2PM6 A;  3B7S A;  1NZN A;  2R05 A;  3BQO A;  4D10 C;  3FP3 A;  2XZT G;  3EU5 A;  3ONK A;  3R7R A;  2RFM A;  4GYO A;  5EN5 D;  3DRA A;  3ZU7 B;  3NOG D;  5ANR A;  4ATZ D;  3EJN A;  4K03 A;  3FTX A;  3UM3 A;  4DI4 A;  4HNA D;  5EYP F;  3TWQ A;  1TYQ G;  4DX6 D;  1TJF A;  1E7U A;  2A4Z A;  5FQ7 A;  5FZS A;  1QBQ A;  4XI9 A;  1BPO A;  1HS6 A;  3HYM B;  3L22 A;  2VTB B;  3V30 A;  4H7X A;  1EPU A;  1E90 A;  4AXH A;  2VSX E;  4FJY A;  2EIJ E;  4KVM A;  4HOR A;  5A6C A;  4PS7 A;  1MX2 A;  3ZYK A;  3UX4 A;  2LAI A;  3E33 A;  4DRX E;  4CT4 A;  3NAW A; 
#chains in the Genus database with same CATH homology
 2GRN B;  1KPS B;  2IO2 C;  1Z5S C;  3UIP C;  3UIO C;  2GRQ B;  5D2M C;  2IO3 C;  3UIN C;  2GRP B;  2IY0 C;  2GRO B;  2GRR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...