3UIOC

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
molecule keywords SUMO-conjugating enzyme UBC9
total genus 50
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2011-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 3uioC00
2IY0C 3UIOC 2GRPB 1KPSB 2IO2C 2GRQB 2GRNB 3UIPC 2GROB 1Z5SC 3UINC 2GRRB 2IO3C 5D2MC
chains in the Genus database with same CATH superfamily
2P9UG 1OY3D 3GZ2A 3MYVA 3ONKA 2WPVA 4YVQC 2LAIA 4NIKA 5CRVA 4KVMA 1HG2A 3ZYLA 3E32A 5T3RA 4HVBA 1FT2A 2GGFA 3F6QA 5LOZA 3SO8A 3HYMB 2BTDA 2WMOA 5EX0A 2WQ7A 3TWUA 2AWIA 2GROB 3DSWA 4URKA 1SVXA 3WG7E 4L23A 1OXJA 2ETBA 3TJPA 2ETCA 3E4BA 2Y3AA 3ONLA 3VTYA 5AIJA 3ENEA 4I1OB 3UM2A 4BSZB 1E90A 3QARA 3R7QA 3ULYA 2V8SE 3QWWA 2AXVA 3E33A 3PE4A 5EDSA 3PUJA 5JJTA 1X81A 3TWVA 1YA0A 2F8XK 2KXPC 3B13A 4DX6D 4I6EA 4Q69A 2VGXB 1HF8A 1K1BA 4C9BB 4EZLA 3ZYQA 3TWRA 1O1SA 5G2NA 4GTQA 2ZXWE 3G2UA 4PH4B 2PQRA 4JA9A 3PNLB 5KNHD 2V0PA 4WUYA 4U8HA 5BW8C 4A55A 3P2BA 1K1AA 5T8IA 3PH0C 5AQ9A 5CCMA 3QC1A 2P9PG 4I6JA 2QYJA 3FHEA 5BXOA 3UPVA 3FUJA 5JHAA 4A1GA 4GA2A 4L1BA 1O1RA 5KJKA 1NFIE 4ANXA 2ONDA 2WXHA 2H6GA 1Q2ZA 2I2OA 1TN7A 4J8EA 1E8YA 3MJWA 3CVVA 3CVYA 2BF0X 3RO2A 3G2SA 3AJIA 1MX4A 3P1UA 1PAQA 2IOLA 2F37A 1A17A 4O1OA 2KATA 3CVPA 4Q96A 4G23A 2CFZA 3C3RA 2A5EA 3J5QB 4IULA 4N5CA 4GZDA 4AEZC 3IV0A 2GW1A 5J90A 1NA3A 2FI7A 4WAFA 3TWXA 1IHBA 3FTYA 2J09A 3TXMA 2XPIA 3BU8A 3Q9UC 3HXDA 3AG3E 5AARA 4U8VD 1HX8A 5JA4D 4GTRA 4GA0A 3B7RL 2J07A 2PQNA 2J4BA 3UINC 4K03A 3G2TA 3CIAA 4OVUA 3PUKA 4RLYA 4APFA 2WXQA 1TJFA 5FIOA 4EBAA 1Y6IA 1O5MA 4TRQA 5BV0A 2KZTA 4B89A 4PDXA 3V30A 3ZPJA 4OAUC 3CV0A 1FCHA 4HOTA 4AXHA 2DYRE 5EX3A 4CCAA 3IXEA 1H2TC 3KS2A 4G8KA 3ZEFA 4PS8A 1H6OA 5CECB 2L9BA 3I4RB 5T4YA 4JB8P 3R9MA 2WXRA 1TEZA 1TYQG 1IHGA 3Q79A 2HO1A 4I2WA 3AG2E 4TV3A 2J4DA 1FT1A 5FZQA 5HQ8A 2P9NG 2FF4A 1HS6A 3LKUA 3FH5A 3DRAA 4L7TA 5BPPA 1NL4A 4ME2A 3S7DA 3FTXA 3FP3A 4DLOA 2PL2A 2QYUA 1ELWA 1WAO1 1LD7A 1H0AA 5IY5E 3KSQA 1HXIA 2I6HA 2J08A 1EYHA 4LRZA 4G26A 3ZIMA 2OEVA 4UWLA 3D9LA 4M3OA 3QNKA 3UTMA 2LXLA 1HU3A 2YINA 3IHYA 3DSUA 4HLEA 3QWPA 3MA5A 1MX6A 3QWVA 4BT8A 2IONA 4APOA 1YCSB 3ABLE 2H6IA 4OYSA 2C0MA 1SZAA 3JXJA 4DI4A 3C3OA 2KC7A 3KD7A 2FO1E 3JUIA 3APDA 4ACLA 2XEEA 3ZHEA 2EIME 4TUUA 2IF4A 3NOCD 4FU3A 2DBAA 4AM9A 4HS2A 4ANWA 4UQXA 3FWVA 4KMOA 4DUIA 3DEOA 5G04C 3CSTA 1Z5SC 3PS6A 4JC8A 5E75A 3KSLA 1QZ2A 3JYSA 5BT1A 2VQ2A 1SZ9A 1DC2A 3ZYKA 1S70B 3PE3A 4KXKB 3D9HA 3TG4A 4E85A 3QDNA 4CGVA 2AVPA 2LO6A 1K3ZD 5EYPF 3MKQA 3CHMA 4CRWA 5JJ7A 2I9CA 3D3MA 3Q78A 4Y6WA 2FBNA 5KCMA 1IQRA 3DXMG 3FUEA 3JQ1A 4Y6CA 3EHNA 3ZYMA 2GRQB 1WDYA 4DPRA 1TNBA 3SFZA 1BD8A 2OVBA 4QFVA 2XQ0A 5HRYA 3L9TA 5DIZA 3TWSA 4CZ2D 4X8QA 1WG0A 3LEWA 4DRXE 1E8ZA 4ILGA 2KCKA 4HB5A 3BQOA 3KEAA 3V79K 4ANVA 3MKQB 4UI9J 2Y69E 3ABME 2R02A 1V54E 1MQSA 3Q9NC 5KWDA 1W3BA 3U66A 4FULA 2CG3A 2HM8A 3MEKA 4ZFHA 4HI9A 2IU1A 4GTVA 2CFUA 2VTBB 5EKQD 3HRAA 3CKBA 3DSTA 1E96B 4I9EA 4FP7A 5ENNA 2ZGDA 2AXZA 4BETA 3QAQA 5LFAA 2WM9A 4U04A 4HQDA 2KZTB 4J0UA 2CHWA 5H7PA 2H6HA 3FUMA 3B7SA 3SFYA 3ZHEB 4BY6A 5CHEE 1Z3YA 3NZUA 4CEMA 4DX2A 2V5FA 2P9LG 2GRRB 3EU5A 2Y0BG 1JCQA 4KZ0A 2DIWA 4F53A 5AENA 2XPYA 4HOUA 2MOWA 3VLDA 3HVEB 5A7DB 3UT8A 3CVXA 2YNQA 4UI9K 2XGSA 1V55E 1N94A 3O48A 4Q94A 3GZ1A 1KT1A 3IHVA 1B89A 2B0OE 1EPUA 3ABKE 3B7BA 3KEZA 4FJZA 2L0IA 4GZ3A 4F3VA 1XNFA 1OUVA 4K5CA 4GB9A 2WXLA 3EUVA 2XCBA 1UW4B 4ILIA 3IKOB 5CBOA 2Y1LE 4MS6A 3UM3A 2AJAA 1UJJA 5CMYA 3I4GA 4FADA 3Q4AB 3ZFWA 4L2LA 3NB2A 3CHRA 4H7XA 1ZBPA 4I1MA 3QK0A 5AJDA 1SW6A 4O6FA 3V2OA 3AU5A 1TN8A 4K5AB 2GRNB 3IBEA 2YHCA 4UWKA 2WMNA 3UIPC 5M72A 3S7BA 2BUGA 4F6RD 2RFAA 4NQ0A 3UIOC 1BPOA 3MKRA 1SA5A 4XEIG 4P29A 3FU5A 3CVQA 2L0TB 3DBSA 5KJLA 2GRMA 4GTPA 1U3CA 2OCCE 2HE0A 4JHJA 4GYWA 3RO3A 4PUCA 4DLQA 3L22A 2PM7A 3ML8A 3EHRA 3CGHA 4YNDA 4WNFA 3SHFA 4GAAA 3ISMC 4PS7A 2DWZA 1JCSA 3I3NA 4XIFA 4BTBA 1N54A 1Z6TA 3LY8A 4XX5A 3W9FA 3OXFA 4N2SA 3S7JA 2VSOE 3MV3B 3QKYA 1DCQA 4KZCA 2IQCA 4C0EA 3SF4A 4KBQA 1OCZE 3ZGQA 3FEXA 3ZUVB 5KBAA 3MV2B 3FDHA 4JHRA 4A3TA 2JABA 2FO7A 3RRUA 3FUKA 3LY7A 3Q75A 2RFMA 2P9KG 4EZKA 4YDWA 2AW6A 3ESKA 4KYOB 2UWJG 4NRHB 4TXQA 3BUAA 5LP0A 1BI8B 5A6CA 2E2EA 3ZVVA 4ACKA 3CVLA 1WM5A 3I5PA 2QFCA 3AS4A 1KZPA 1UJKA 2IJGX 2CHXA 1A5EA 2MRIA 4B0ZA 3C5RA 4GPKA 3ASDA 4WWPA 3JUEA 2LSVA 4GTMA 3CKCA 2OEWA 3AS5A 5G05J 3MGBA 3MX3A 4LCTA 3FTZA 2P9SG 1E8WA 1WY6A 3FUNA 2F8YA 2ZIRA 1JWGA 4MBGA 3ASGA 1BU9A 2Q7FA 2XRYA 3AS8A 2A4ZA 4I9CA 2XS8A 3L54A 3EIQC 3DEPA 1XGWA 1QQEA 3ZRHA 2NC9A 4WNGA 3SI5A 4JW1A 1QYMA 4GCOA 4KVOA 2L6BA 3LVRE 3FEYA 1KZOA 1RW2A 3AG1E 4G24A 3UQ3A 3CQCB 4D10C 3D9IA 3QJZA 3QB2A 4BFRA 3AG4E 4IYPA 1OWMA 4AP2A 2NXPA 4EQFA 4GA1A 4N2QA 4CDNA 5EIBE 2WXNA 4UQZA 3FU0A 3HIZA 2LAHA 3PZ1A 5AN8A 1KLXA 3UMVA 2H6FA 3FTUA 3DSVA 5A23A 3CLJA 1H2VC 4JPSA 5D66A 3R7RA 4ANUA 3FY4A 3CR3A 4I6GA 3TWQA 2X38A 2AXUA 3PZ4A 5B1BE 4BX9A 5CBNA 3ZXSA 2EQXA 4AOFA 5FINA 4BWRA 4LG6A 4NACA 4AIFA 5CERB 4UI9C 3VLEA 4G1TA 4DK5A 2XPZA 1P5QA 5ENSD 3OAWA 2WXJA 4UWFA 4XZ4A 3UI2A 4J7WA 3TG5A 5D0OD 1TNZA 4FC8A 4RG9A 5AQ7A 3UKUG 1YYHA 1OWNA 3RKVA 4LNBA 5EIDA 1SA4A 1BI7B 2EILE 4HRMB 4J8YA 3TWTA 2DCPA 3D9PA 1IYGA 4N3CA 4F7AA 1BLXB 3LS8A 3EU9A 5LCWC 4BTAA 3FFLA 4A3VA 2C0LA 4JEUA 1LD8A 3DWLG 1UN8A 5DBKA 4ABNA 1JPLA 3D9KA 4HXIA 1HH8A 5KNGA 3ULEG 4J8FA 3NF1A 4L9PA 2WQ6A 2VGEA 4CDRA 3WXXA 4KT6B 4AVXA 2R05A 1FPPA 3EJNA 3D9NA 4HLLA 4JVSA 1QNFA 3RK6A 2R17C 1MYOA 4LUNU 3RIBA 3DXKG 2C2LA 3VLFA 3BG0B 3HG0D 3O4ZA 2FULA 3J5PA 4K5BA 3LDZA 3HXBA 2HYZA 4O60A 2XZTG 4B8CB 3E34A 4I2ZA 4N3AA 5FWQA 3GYZA 1IQUA 4RSYA 4L2YA 3CHPA 1AWCB 1ELRA 1NI1A 1QBQA 5HKPA 2LUHA 4GZ6A 4UQYA 4G11A 2NSZA 5HS0A 2EINE 3LJ3A 2VTBA 4HRLA 4CDMA 2ETAA 3D9MA 2BKGA 3ZN3A 2XHEA 3C98A 4C0MA 3BG1B 5HI7A 2Y4UA 3B7UX 3D9JA 3N71A 2X6IA 3CK9A 4JD2G 1KT0A 3V31A 4OAVB 3EHQA 2VGXA 2OVFA 3PRZA 4F1PA 3NBNB 3MCXA 4JHKA 3L82A 1PY1A 4GMJA 1OWLA 4U0UA 3LJNA 3X2QE 5AYWD 2ZU6B 4U07A 1TR4A 1HFAA 5FZSA 2IO2C 1O1TA 3U4TA 5AQBA 4LNUD 3SZ7A 4GTOA 2QY7A 1N0RA 5ENRD 4HOSA 1NZNA 2A5UA 2V4LA 1OT8A 1EDUA 1HZ4A 3APFA 3UXGA 2WXFA 4V3IA 3CQGB 2I1KA 5B3SE 4U7EB 2VYIA 2ILRA 3HXFA 4CYMD 1E8XA 3T5VA 5ENOD 4HOQA 2XCCA 3IEGA 3CVWA 3JQ0A 4GYOA 4XE0A 4ATZD 4GTTA 2XEHA 5E76A 2WVIA 4EZJA 2GRPB 5JJ6A 4C48B 2RG8A 3ZU7B 3JXIA 3ASHA 4UWGA 2QC9A 1KPSB 5EYLA 4GYYA 3BEEA 5KJNA 1Z3XA 4LEUA 1FVHA 1FVFA 2VSXE 3CK7A 1S0PA 3E37A 4CT0A 1OCCE 4JEHA 5FQ4A 4TUMA 3APCA 2X6FA 4DI3A 3RAUA 3PZDA 3PEVB 3R9AB 4JZYA 4N39A 5G04J 4LERA 3RSEG 1EF1C 4F1SA 2VJ8A 5D2MC 4G8LA 1K8KG 4GMLA 1D8DA 4YDOA 5EILA 1TN6A 5ENQD 1TNYA 4GZCA 3NQPA 4BESA 4M7CA 1H6KA 4E6HA 2EIKE 5KJMA 2I1JA 3QOUA 4U95D 3ESLA 1LF8A 3LYAA 4DX5D 2XGMA 4FA6A 3RRMB 1N9AA 1AP7A 3ZW3A 5CCLA 4HORA 2X6JA 3CHOA 3T8MA 4XI0A 3UT7A 4GPMA 3HXCA 3DPYA 4BSXA 4J8DA 4EECA 4ZHBA 3DPDA 3LPZA 4HI8A 2V5QC 3AU4A 1LTXA 4JA7A 3UM1A 3SBTB 3FU3A 1N95A 3Q49B 2M63A 5BNWA 2PM6A 4N5QA 5CMWA 2HR2A 3T8KA 1UG3A 2J9QA 1N52A 3MZLB 3NAWA 3HVEA 4GCNA 5B1AE 3UUXA 2F0YA 4ATGA 3PNTB 3ASFA 2Y4TA 4MRUA 2P58C 4YDYA 1UN9A 1SQMA 3Q7FA 1IXVA 4WNDA 4HFGA 4MLPA 3FUDA 2P2CP 3SQVA 4BERA 4DX7D 4YDEA 4HBDA 4WWNA 4TXRA 2R5SA 1TNOA 4K0RA 3U64A 2R59A 4B94A 2MHKA 3C3QA 1H2UA 2YHEA 3EHMA 5BXUA 3TL5A 2LNIA 4J8SA 1NA0A 4U0SA 4U8YD 3UT4A 4DJAA 2VSNA 5D0QD 5ARGA 2LSUA 4U63A 3SFXA 2BKKB 3GZSA 3ML9A 3V2XA 2XZDG 4EBAG 2BEDA 3CEQA 4OVVA 3PREA 4RQIA 2J8SD 3HHMA 3FULA 3LY9A 1DNPA 1ZU2A 4FHKA 3E30A 5ENPD 4G25A 4GMRA 3FH8A 1D8EA 2XS1A 3PVLA 5LX8A 5ANRA 3UM0A 3CVNA 3CHQA 4I1AA 5FT9A 4FLHA 3ZXPA 1H6PA 5AJLA 4IRUA 3PDNA 1N4RA 3S7FA 1YMPA 2OV8A 4GZ5A 3AAAC 2CG2A 5ENTD 1OWPA 2MYOA 3TWWA 3L08A 2X6HA 2JLBA 4YVOA 5BUZA 4HRNA 1ZB1A 1HE8A 1DVPA 2WXIA 2KCLA 2B6CA 2EIJE 3FTVA 3S2AA 3EDTB 2WXGA 1ELKA 3SY2A 5FTPA 3HXEA 4J6IA 4QQIA 2PNNA 4NURA 3L6AA 2WQHA 3B95A 3TAXA 1OWOA 3FTWA 2IOSA 1MHQA 2JEKA 3L16A 3G2VA 4BEPA 5ARFA 5ANLA 3T9KA 4AJWA 3DSSA 4W9RA 2KCVA 3CVUA 3K9IA 5C2YA 4XKCA 5AQAA 4BX8A 5C1DA 3C72A 3CK8A 3OXGA 2NYJA 1HO8A 4FHJA 2CHZA 2PZIA 2IFUA 4UWHA 1S63A 3PEUB 2WXPA 3GW4A 1N11A 4AY5A 3TGOA 3OTNA 3TXNA 3G2WA 3URZA 5FQ8A 3SGHA 3U3WA 3HDXA 2FEZA 4PS3A 4WNEA 3CSFA 1JWFA 3B7TA 3RU0A 4DX1A 5JHBA 1JCRA 4RG6A 2KBXA 1VDYA 1MX2A 2R2LA 2DYSE 4XI9A 3NOGD 2LXMA 2E0IA 1OCOE 4MKTA 1JUQA 3FU6A 3LVQE 1X5BA 5FQ6A 5CRUA 1OCRE 4U96D 4B8AA 3SNXA 4CT4A 3ZNGA 1H19A 4GTSA 4ILHB 1N4PA 2X3MA 2XEVA 3CHSA 4LNGA 4WWOA 4I17A 2IY0C 3FUFA 2ZISA 3Q73A 2XRZA 5EN5D 3L17A 1S64A 3RJVA 3UX4A 4FLBA 2RD0A 1U2VG 5FJYA 2RKKA 2UY1A 2DZOA 1E7UA 4EHMA 4EPZA 1TJCA 5CEAA 2OOEA 1UOHA 2VSYA 3FTSA 2QZAA 3T5XA 2WXMA 4U0ZA 3L13A 4JL0A 4RVBA 4XKBA 1TNUA 4FJYA 3U9WA 4BT9A 2DZNA 2KM4A 3Q7AA 3ASNE 3SD5A 1Y8MA 4G2VA 4AV7A 3LXUX 4GU5A 3ULQA 1IKND 4HNAD 3ASOE 3JCKC 3ZKJA 2WXOA 1D9SA 1DCEA 2ZGGA 3EIJA 5FQ7A 5AAOA 1NP7A 4R7LA 2GRLA 5CEDB 1L5JA 3UKRG 2J49A 2R03A 1N4QA 3SBSA 5G05C 3RRNB 4A63B 5J08A 5FZRA 4B93B 2VGYA 3FUIA 5BV1A 4TXPA 3W9GA 2DVWA 2P9IG 1MJ0A 3Q47B 5LCWJ 1GW6A 3PZ2A 2XGOA 1RZ4A 3FH7A 1HG5A 4JXTA 3Q5MA 3PZ3A 3OXLA 2V4HC 2IO3C 5JMND 1N4SA 2L6JA 2WXKA 5G55A 1MZCA 2UY1B 3KAEA 4A1SA 2WB2A 4CGWA 1INZA 4O1PA 4H7YA 3VTXA 1G3NB 3Q15A 2XENA 3D9OA 2X6KA 4I43A 4UUCA 3FUHA 1E7VA 2YQ8A 5ITZF 1N0QA 4AY6A 3LCAA 1PC2A 3DSXA 3NZSA 4Z68A 2IEJA 4IN3B 1U3DA 4LSZE 4N3BA
chains in the Genus database with same CATH topology
2IY0C 3UIOC 2GRPB 1KPSB 2IO2C 2GRQB 2GRNB 3UIPC 2GROB 1Z5SC 3UINC 2GRRB 2IO3C 5D2MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY0 C;  3UIO C;  2GRP B;  1KPS B;  2IO2 C;  2GRQ B;  2GRN B;  3UIP C;  2GRO B;  1Z5S C;  3UIN C;  2GRR B;  2IO3 C;  5D2M C; 
#chains in the Genus database with same CATH topology
 2P9U G;  1OY3 D;  3GZ2 A;  3MYV A;  3ONK A;  2WPV A;  4YVQ C;  2LAI A;  4NIK A;  5CRV A;  4KVM A;  1HG2 A;  3ZYL A;  3E32 A;  5T3R A;  4HVB A;  1FT2 A;  2GGF A;  3F6Q A;  5LOZ A;  3SO8 A;  3HYM B;  2BTD A;  2WMO A;  5EX0 A;  2WQ7 A;  3TWU A;  2AWI A;  2GRO B;  3DSW A;  4URK A;  1SVX A;  3WG7 E;  4L23 A;  1OXJ A;  2ETB A;  3TJP A;  2ETC A;  3E4B A;  2Y3A A;  3ONL A;  3VTY A;  5AIJ A;  3ENE A;  4I1O B;  3UM2 A;  4BSZ B;  1E90 A;  3QAR A;  3R7Q A;  3ULY A;  2V8S E;  3QWW A;  2AXV A;  3E33 A;  3PE4 A;  5EDS A;  3PUJ A;  5JJT A;  1X81 A;  3TWV A;  1YA0 A;  2F8X K;  2KXP C;  3B13 A;  4DX6 D;  4I6E A;  4Q69 A;  2VGX B;  1HF8 A;  1K1B A;  4C9B B;  4EZL A;  3ZYQ A;  3TWR A;  1O1S A;  5G2N A;  4GTQ A;  2ZXW E;  3G2U A;  4PH4 B;  2PQR A;  4JA9 A;  3PNL B;  5KNH D;  2V0P A;  4WUY A;  4U8H A;  5BW8 C;  4A55 A;  3P2B A;  1K1A A;  5T8I A;  3PH0 C;  5AQ9 A;  5CCM A;  3QC1 A;  2P9P G;  4I6J A;  2QYJ A;  3FHE A;  5BXO A;  3UPV A;  3FUJ A;  5JHA A;  4A1G A;  4GA2 A;  4L1B A;  1O1R A;  5KJK A;  1NFI E;  4ANX A;  2OND A;  2WXH A;  2H6G A;  1Q2Z A;  2I2O A;  1TN7 A;  4J8E A;  1E8Y A;  3MJW A;  3CVV A;  3CVY A;  2BF0 X;  3RO2 A;  3G2S A;  3AJI A;  1MX4 A;  3P1U A;  1PAQ A;  2IOL A;  2F37 A;  1A17 A;  4O1O A;  2KAT A;  3CVP A;  4Q96 A;  4G23 A;  2CFZ A;  3C3R A;  2A5E A;  3J5Q B;  4IUL A;  4N5C A;  4GZD A;  4AEZ C;  3IV0 A;  2GW1 A;  5J90 A;  1NA3 A;  2FI7 A;  4WAF A;  3TWX A;  1IHB A;  3FTY A;  2J09 A;  3TXM A;  2XPI A;  3BU8 A;  3Q9U C;  3HXD A;  3AG3 E;  5AAR A;  4U8V D;  1HX8 A;  5JA4 D;  4GTR A;  4GA0 A;  3B7R L;  2J07 A;  2PQN A;  2J4B A;  3UIN C;  4K03 A;  3G2T A;  3CIA A;  4OVU A;  3PUK A;  4RLY A;  4APF A;  2WXQ A;  1TJF A;  5FIO A;  4EBA A;  1Y6I A;  1O5M A;  4TRQ A;  5BV0 A;  2KZT A;  4B89 A;  4PDX A;  3V30 A;  3ZPJ A;  4OAU C;  3CV0 A;  1FCH A;  4HOT A;  4AXH A;  2DYR E;  5EX3 A;  4CCA A;  3IXE A;  1H2T C;  3KS2 A;  4G8K A;  3ZEF A;  4PS8 A;  1H6O A;  5CEC B;  2L9B A;  3I4R B;  5T4Y A;  4JB8 P;  3R9M A;  2WXR A;  1TEZ A;  1TYQ G;  1IHG A;  3Q79 A;  2HO1 A;  4I2W A;  3AG2 E;  4TV3 A;  2J4D A;  1FT1 A;  5FZQ A;  5HQ8 A;  2P9N G;  2FF4 A;  1HS6 A;  3LKU A;  3FH5 A;  3DRA A;  4L7T A;  5BPP A;  1NL4 A;  4ME2 A;  3S7D A;  3FTX A;  3FP3 A;  4DLO A;  2PL2 A;  2QYU A;  1ELW A;  1WAO 1;  1LD7 A;  1H0A A;  5IY5 E;  3KSQ A;  1HXI A;  2I6H A;  2J08 A;  1EYH A;  4LRZ A;  4G26 A;  3ZIM A;  2OEV A;  4UWL A;  3D9L A;  4M3O A;  3QNK A;  3UTM A;  2LXL A;  1HU3 A;  2YIN A;  3IHY A;  3DSU A;  4HLE A;  3QWP A;  3MA5 A;  1MX6 A;  3QWV A;  4BT8 A;  2ION A;  4APO A;  1YCS B;  3ABL E;  2H6I A;  4OYS A;  2C0M A;  1SZA A;  3JXJ A;  4DI4 A;  3C3O A;  2KC7 A;  3KD7 A;  2FO1 E;  3JUI A;  3APD A;  4ACL A;  2XEE A;  3ZHE A;  2EIM E;  4TUU A;  2IF4 A;  3NOC D;  4FU3 A;  2DBA A;  4AM9 A;  4HS2 A;  4ANW A;  4UQX A;  3FWV A;  4KMO A;  4DUI A;  3DEO A;  5G04 C;  3CST A;  1Z5S C;  3PS6 A;  4JC8 A;  5E75 A;  3KSL A;  1QZ2 A;  3JYS A;  5BT1 A;  2VQ2 A;  1SZ9 A;  1DC2 A;  3ZYK A;  1S70 B;  3PE3 A;  4KXK B;  3D9H A;  3TG4 A;  4E85 A;  3QDN A;  4CGV A;  2AVP A;  2LO6 A;  1K3Z D;  5EYP F;  3MKQ A;  3CHM A;  4CRW A;  5JJ7 A;  2I9C A;  3D3M A;  3Q78 A;  4Y6W A;  2FBN A;  5KCM A;  1IQR A;  3DXM G;  3FUE A;  3JQ1 A;  4Y6C A;  3EHN A;  3ZYM A;  2GRQ B;  1WDY A;  4DPR A;  1TNB A;  3SFZ A;  1BD8 A;  2OVB A;  4QFV A;  2XQ0 A;  5HRY A;  3L9T A;  5DIZ A;  3TWS A;  4CZ2 D;  4X8Q A;  1WG0 A;  3LEW A;  4DRX E;  1E8Z A;  4ILG A;  2KCK A;  4HB5 A;  3BQO A;  3KEA A;  3V79 K;  4ANV A;  3MKQ B;  4UI9 J;  2Y69 E;  3ABM E;  2R02 A;  1V54 E;  1MQS A;  3Q9N C;  5KWD A;  1W3B A;  3U66 A;  4FUL A;  2CG3 A;  2HM8 A;  3MEK A;  4ZFH A;  4HI9 A;  2IU1 A;  4GTV A;  2CFU A;  2VTB B;  5EKQ D;  3HRA A;  3CKB A;  3DST A;  1E96 B;  4I9E A;  4FP7 A;  5ENN A;  2ZGD A;  2AXZ A;  4BET A;  3QAQ A;  5LFA A;  2WM9 A;  4U04 A;  4HQD A;  2KZT B;  4J0U A;  2CHW A;  5H7P A;  2H6H A;  3FUM A;  3B7S A;  3SFY A;  3ZHE B;  4BY6 A;  5CHE E;  1Z3Y A;  3NZU A;  4CEM A;  4DX2 A;  2V5F A;  2P9L G;  2GRR B;  3EU5 A;  2Y0B G;  1JCQ A;  4KZ0 A;  2DIW A;  4F53 A;  5AEN A;  2XPY A;  4HOU A;  2MOW A;  3VLD A;  3HVE B;  5A7D B;  3UT8 A;  3CVX A;  2YNQ A;  4UI9 K;  2XGS A;  1V55 E;  1N94 A;  3O48 A;  4Q94 A;  3GZ1 A;  1KT1 A;  3IHV A;  1B89 A;  2B0O E;  1EPU A;  3ABK E;  3B7B A;  3KEZ A;  4FJZ A;  2L0I A;  4GZ3 A;  4F3V A;  1XNF A;  1OUV A;  4K5C A;  4GB9 A;  2WXL A;  3EUV A;  2XCB A;  1UW4 B;  4ILI A;  3IKO B;  5CBO A;  2Y1L E;  4MS6 A;  3UM3 A;  2AJA A;  1UJJ A;  5CMY A;  3I4G A;  4FAD A;  3Q4A B;  3ZFW A;  4L2L A;  3NB2 A;  3CHR A;  4H7X A;  1ZBP A;  4I1M A;  3QK0 A;  5AJD A;  1SW6 A;  4O6F A;  3V2O A;  3AU5 A;  1TN8 A;  4K5A B;  2GRN B;  3IBE A;  2YHC A;  4UWK A;  2WMN A;  3UIP C;  5M72 A;  3S7B A;  2BUG A;  4F6R D;  2RFA A;  4NQ0 A;  3UIO C;  1BPO A;  3MKR A;  1SA5 A;  4XEI G;  4P29 A;  3FU5 A;  3CVQ A;  2L0T B;  3DBS A;  5KJL A;  2GRM A;  4GTP A;  1U3C A;  2OCC E;  2HE0 A;  4JHJ A;  4GYW A;  3RO3 A;  4PUC A;  4DLQ A;  3L22 A;  2PM7 A;  3ML8 A;  3EHR A;  3CGH A;  4YND A;  4WNF A;  3SHF A;  4GAA A;  3ISM C;  4PS7 A;  2DWZ A;  1JCS A;  3I3N A;  4XIF A;  4BTB A;  1N54 A;  1Z6T A;  3LY8 A;  4XX5 A;  3W9F A;  3OXF A;  4N2S A;  3S7J A;  2VSO E;  3MV3 B;  3QKY A;  1DCQ A;  4KZC A;  2IQC A;  4C0E A;  3SF4 A;  4KBQ A;  1OCZ E;  3ZGQ A;  3FEX A;  3ZUV B;  5KBA A;  3MV2 B;  3FDH A;  4JHR A;  4A3T A;  2JAB A;  2FO7 A;  3RRU A;  3FUK A;  3LY7 A;  3Q75 A;  2RFM A;  2P9K G;  4EZK A;  4YDW A;  2AW6 A;  3ESK A;  4KYO B;  2UWJ G;  4NRH B;  4TXQ A;  3BUA A;  5LP0 A;  1BI8 B;  5A6C A;  2E2E A;  3ZVV A;  4ACK A;  3CVL A;  1WM5 A;  3I5P A;  2QFC A;  3AS4 A;  1KZP A;  1UJK A;  2IJG X;  2CHX A;  1A5E A;  2MRI A;  4B0Z A;  3C5R A;  4GPK A;  3ASD A;  4WWP A;  3JUE A;  2LSV A;  4GTM A;  3CKC A;  2OEW A;  3AS5 A;  5G05 J;  3MGB A;  3MX3 A;  4LCT A;  3FTZ A;  2P9S G;  1E8W A;  1WY6 A;  3FUN A;  2F8Y A;  2ZIR A;  1JWG A;  4MBG A;  3ASG A;  1BU9 A;  2Q7F A;  2XRY A;  3AS8 A;  2A4Z A;  4I9C A;  2XS8 A;  3L54 A;  3EIQ C;  3DEP A;  1XGW A;  1QQE A;  3ZRH A;  2NC9 A;  4WNG A;  3SI5 A;  4JW1 A;  1QYM A;  4GCO A;  4KVO A;  2L6B A;  3LVR E;  3FEY A;  1KZO A;  1RW2 A;  3AG1 E;  4G24 A;  3UQ3 A;  3CQC B;  4D10 C;  3D9I A;  3QJZ A;  3QB2 A;  4BFR A;  3AG4 E;  4IYP A;  1OWM A;  4AP2 A;  2NXP A;  4EQF A;  4GA1 A;  4N2Q A;  4CDN A;  5EIB E;  2WXN A;  4UQZ A;  3FU0 A;  3HIZ A;  2LAH A;  3PZ1 A;  5AN8 A;  1KLX A;  3UMV A;  2H6F A;  3FTU A;  3DSV A;  5A23 A;  3CLJ A;  1H2V C;  4JPS A;  5D66 A;  3R7R A;  4ANU A;  3FY4 A;  3CR3 A;  4I6G A;  3TWQ A;  2X38 A;  2AXU A;  3PZ4 A;  5B1B E;  4BX9 A;  5CBN A;  3ZXS A;  2EQX A;  4AOF A;  5FIN A;  4BWR A;  4LG6 A;  4NAC A;  4AIF A;  5CER B;  4UI9 C;  3VLE A;  4G1T A;  4DK5 A;  2XPZ A;  1P5Q A;  5ENS D;  3OAW A;  2WXJ A;  4UWF A;  4XZ4 A;  3UI2 A;  4J7W A;  3TG5 A;  5D0O D;  1TNZ A;  4FC8 A;  4RG9 A;  5AQ7 A;  3UKU G;  1YYH A;  1OWN A;  3RKV A;  4LNB A;  5EID A;  1SA4 A;  1BI7 B;  2EIL E;  4HRM B;  4J8Y A;  3TWT A;  2DCP A;  3D9P A;  1IYG A;  4N3C A;  4F7A A;  1BLX B;  3LS8 A;  3EU9 A;  5LCW C;  4BTA A;  3FFL A;  4A3V A;  2C0L A;  4JEU A;  1LD8 A;  3DWL G;  1UN8 A;  5DBK A;  4ABN A;  1JPL A;  3D9K A;  4HXI A;  1HH8 A;  5KNG A;  3ULE G;  4J8F A;  3NF1 A;  4L9P A;  2WQ6 A;  2VGE A;  4CDR A;  3WXX A;  4KT6 B;  4AVX A;  2R05 A;  1FPP A;  3EJN A;  3D9N A;  4HLL A;  4JVS A;  1QNF A;  3RK6 A;  2R17 C;  1MYO A;  4LUN U;  3RIB A;  3DXK G;  2C2L A;  3VLF A;  3BG0 B;  3HG0 D;  3O4Z A;  2FUL A;  3J5P A;  4K5B A;  3LDZ A;  3HXB A;  2HYZ A;  4O60 A;  2XZT G;  4B8C B;  3E34 A;  4I2Z A;  4N3A A;  5FWQ A;  3GYZ A;  1IQU A;  4RSY A;  4L2Y A;  3CHP A;  1AWC B;  1ELR A;  1NI1 A;  1QBQ A;  5HKP A;  2LUH A;  4GZ6 A;  4UQY A;  4G11 A;  2NSZ A;  5HS0 A;  2EIN E;  3LJ3 A;  2VTB A;  4HRL A;  4CDM A;  2ETA A;  3D9M A;  2BKG A;  3ZN3 A;  2XHE A;  3C98 A;  4C0M A;  3BG1 B;  5HI7 A;  2Y4U A;  3B7U X;  3D9J A;  3N71 A;  2X6I A;  3CK9 A;  4JD2 G;  1KT0 A;  3V31 A;  4OAV B;  3EHQ A;  2VGX A;  2OVF A;  3PRZ A;  4F1P A;  3NBN B;  3MCX A;  4JHK A;  3L82 A;  1PY1 A;  4GMJ A;  1OWL A;  4U0U A;  3LJN A;  3X2Q E;  5AYW D;  2ZU6 B;  4U07 A;  1TR4 A;  1HFA A;  5FZS A;  2IO2 C;  1O1T A;  3U4T A;  5AQB A;  4LNU D;  3SZ7 A;  4GTO A;  2QY7 A;  1N0R A;  5ENR D;  4HOS A;  1NZN A;  2A5U A;  2V4L A;  1OT8 A;  1EDU A;  1HZ4 A;  3APF A;  3UXG A;  2WXF A;  4V3I A;  3CQG B;  2I1K A;  5B3S E;  4U7E B;  2VYI A;  2ILR A;  3HXF A;  4CYM D;  1E8X A;  3T5V A;  5ENO D;  4HOQ A;  2XCC A;  3IEG A;  3CVW A;  3JQ0 A;  4GYO A;  4XE0 A;  4ATZ D;  4GTT A;  2XEH A;  5E76 A;  2WVI A;  4EZJ A;  2GRP B;  5JJ6 A;  4C48 B;  2RG8 A;  3ZU7 B;  3JXI A;  3ASH A;  4UWG A;  2QC9 A;  1KPS B;  5EYL A;  4GYY A;  3BEE A;  5KJN A;  1Z3X A;  4LEU A;  1FVH A;  1FVF A;  2VSX E;  3CK7 A;  1S0P A;  3E37 A;  4CT0 A;  1OCC E;  4JEH A;  5FQ4 A;  4TUM A;  3APC A;  2X6F A;  4DI3 A;  3RAU A;  3PZD A;  3PEV B;  3R9A B;  4JZY A;  4N39 A;  5G04 J;  4LER A;  3RSE G;  1EF1 C;  4F1S A;  2VJ8 A;  5D2M C;  4G8L A;  1K8K G;  4GML A;  1D8D A;  4YDO A;  5EIL A;  1TN6 A;  5ENQ D;  1TNY A;  4GZC A;  3NQP A;  4BES A;  4M7C A;  1H6K A;  4E6H A;  2EIK E;  5KJM A;  2I1J A;  3QOU A;  4U95 D;  3ESL A;  1LF8 A;  3LYA A;  4DX5 D;  2XGM A;  4FA6 A;  3RRM B;  1N9A A;  1AP7 A;  3ZW3 A;  5CCL A;  4HOR A;  2X6J A;  3CHO A;  3T8M A;  4XI0 A;  3UT7 A;  4GPM A;  3HXC A;  3DPY A;  4BSX A;  4J8D A;  4EEC A;  4ZHB A;  3DPD A;  3LPZ A;  4HI8 A;  2V5Q C;  3AU4 A;  1LTX A;  4JA7 A;  3UM1 A;  3SBT B;  3FU3 A;  1N95 A;  3Q49 B;  2M63 A;  5BNW A;  2PM6 A;  4N5Q A;  5CMW A;  2HR2 A;  3T8K A;  1UG3 A;  2J9Q A;  1N52 A;  3MZL B;  3NAW A;  3HVE A;  4GCN A;  5B1A E;  3UUX A;  2F0Y A;  4ATG A;  3PNT B;  3ASF A;  2Y4T A;  4MRU A;  2P58 C;  4YDY A;  1UN9 A;  1SQM A;  3Q7F A;  1IXV A;  4WND A;  4HFG A;  4MLP A;  3FUD A;  2P2C P;  3SQV A;  4BER A;  4DX7 D;  4YDE A;  4HBD A;  4WWN A;  4TXR A;  2R5S A;  1TNO A;  4K0R A;  3U64 A;  2R59 A;  4B94 A;  2MHK A;  3C3Q A;  1H2U A;  2YHE A;  3EHM A;  5BXU A;  3TL5 A;  2LNI A;  4J8S A;  1NA0 A;  4U0S A;  4U8Y D;  3UT4 A;  4DJA A;  2VSN A;  5D0Q D;  5ARG A;  2LSU A;  4U63 A;  3SFX A;  2BKK B;  3GZS A;  3ML9 A;  3V2X A;  2XZD G;  4EBA G;  2BED A;  3CEQ A;  4OVV A;  3PRE A;  4RQI A;  2J8S D;  3HHM A;  3FUL A;  3LY9 A;  1DNP A;  1ZU2 A;  4FHK A;  3E30 A;  5ENP D;  4G25 A;  4GMR A;  3FH8 A;  1D8E A;  2XS1 A;  3PVL A;  5LX8 A;  5ANR A;  3UM0 A;  3CVN A;  3CHQ A;  4I1A A;  5FT9 A;  4FLH A;  3ZXP A;  1H6P A;  5AJL A;  4IRU A;  3PDN A;  1N4R A;  3S7F A;  1YMP A;  2OV8 A;  4GZ5 A;  3AAA C;  2CG2 A;  5ENT D;  1OWP A;  2MYO A;  3TWW A;  3L08 A;  2X6H A;  2JLB A;  4YVO A;  5BUZ A;  4HRN A;  1ZB1 A;  1HE8 A;  1DVP A;  2WXI A;  2KCL A;  2B6C A;  2EIJ E;  3FTV A;  3S2A A;  3EDT B;  2WXG A;  1ELK A;  3SY2 A;  5FTP A;  3HXE A;  4J6I A;  4QQI A;  2PNN A;  4NUR A;  3L6A A;  2WQH A;  3B95 A;  3TAX A;  1OWO A;  3FTW A;  2IOS A;  1MHQ A;  2JEK A;  3L16 A;  3G2V A;  4BEP A;  5ARF A;  5ANL A;  3T9K A;  4AJW A;  3DSS A;  4W9R A;  2KCV A;  3CVU A;  3K9I A;  5C2Y A;  4XKC A;  5AQA A;  4BX8 A;  5C1D A;  3C72 A;  3CK8 A;  3OXG A;  2NYJ A;  1HO8 A;  4FHJ A;  2CHZ A;  2PZI A;  2IFU A;  4UWH A;  1S63 A;  3PEU B;  2WXP A;  3GW4 A;  1N11 A;  4AY5 A;  3TGO A;  3OTN A;  3TXN A;  3G2W A;  3URZ A;  5FQ8 A;  3SGH A;  3U3W A;  3HDX A;  2FEZ A;  4PS3 A;  4WNE A;  3CSF A;  1JWF A;  3B7T A;  3RU0 A;  4DX1 A;  5JHB A;  1JCR A;  4RG6 A;  2KBX A;  1VDY A;  1MX2 A;  2R2L A;  2DYS E;  4XI9 A;  3NOG D;  2LXM A;  2E0I A;  1OCO E;  4MKT A;  1JUQ A;  3FU6 A;  3LVQ E;  1X5B A;  5FQ6 A;  5CRU A;  1OCR E;  4U96 D;  4B8A A;  3SNX A;  4CT4 A;  3ZNG A;  1H19 A;  4GTS A;  4ILH B;  1N4P A;  2X3M A;  2XEV A;  3CHS A;  4LNG A;  4WWO A;  4I17 A;  2IY0 C;  3FUF A;  2ZIS A;  3Q73 A;  2XRZ A;  5EN5 D;  3L17 A;  1S64 A;  3RJV A;  3UX4 A;  4FLB A;  2RD0 A;  1U2V G;  5FJY A;  2RKK A;  2UY1 A;  2DZO A;  1E7U A;  4EHM A;  4EPZ A;  1TJC A;  5CEA A;  2OOE A;  1UOH A;  2VSY A;  3FTS A;  2QZA A;  3T5X A;  2WXM A;  4U0Z A;  3L13 A;  4JL0 A;  4RVB A;  4XKB A;  1TNU A;  4FJY A;  3U9W A;  4BT9 A;  2DZN A;  2KM4 A;  3Q7A A;  3ASN E;  3SD5 A;  1Y8M A;  4G2V A;  4AV7 A;  3LXU X;  4GU5 A;  3ULQ A;  1IKN D;  4HNA D;  3ASO E;  3JCK C;  3ZKJ A;  2WXO A;  1D9S A;  1DCE A;  2ZGG A;  3EIJ A;  5FQ7 A;  5AAO A;  1NP7 A;  4R7L A;  2GRL A;  5CED B;  1L5J A;  3UKR G;  2J49 A;  2R03 A;  1N4Q A;  3SBS A;  5G05 C;  3RRN B;  4A63 B;  5J08 A;  5FZR A;  4B93 B;  2VGY A;  3FUI A;  5BV1 A;  4TXP A;  3W9G A;  2DVW A;  2P9I G;  1MJ0 A;  3Q47 B;  5LCW J;  1GW6 A;  3PZ2 A;  2XGO A;  1RZ4 A;  3FH7 A;  1HG5 A;  4JXT A;  3Q5M A;  3PZ3 A;  3OXL A;  2V4H C;  2IO3 C;  5JMN D;  1N4S A;  2L6J A;  2WXK A;  5G55 A;  1MZC A;  2UY1 B;  3KAE A;  4A1S A;  2WB2 A;  4CGW A;  1INZ A;  4O1P A;  4H7Y A;  3VTX A;  1G3N B;  3Q15 A;  2XEN A;  3D9O A;  2X6K A;  4I43 A;  4UUC A;  3FUH A;  1E7V A;  2YQ8 A;  5ITZ F;  1N0Q A;  4AY6 A;  3LCA A;  1PC2 A;  3DSX A;  3NZS A;  4Z68 A;  2IEJ A;  4IN3 B;  1U3D A;  4LSZ E;  4N3B A; 
#chains in the Genus database with same CATH homology
 2IY0 C;  3UIO C;  2GRP B;  1KPS B;  2IO2 C;  2GRQ B;  2GRN B;  3UIP C;  2GRO B;  1Z5S C;  3UIN C;  2GRR B;  2IO3 C;  5D2M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...