3UIOC

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
total genus 50
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2011-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 3uioC00
5D2MC 1Z5SC 1KPSB 2IO2C 2GRPB 2GROB 2IY0C 3UINC 2GRRB 3UIPC 2IO3C 2GRQB 2GRNB 3UIOC
chains in the Genus database with same CATH superfamily
3PUKA 4H7XA 3FUNA 3CHPA 5AARA 2FO1E 3APCA 2CHZA 3ZIMA 2AW6A 1E8ZA 4BTAA 5EIDA 5AN8A 3BU8A 3L82A 3SY2A 2WQ7A 4XZ4A 2VTBA 2EIKE 3CVNA 5CEDB 3C3RA 5BNWA 4N2QA 4Y6WA 4PH4B 3L22A 1FT1A 1S70B 2L6JA 3DSUA 4GCOA 1U3CA 1BD8A 3G2UA 1OCOE 3ZN3A 2Y4UA 2Y69E 4DX2A 1ZB1A 4K5CA 5ARGA 5HRYA 2GRLA 2KCVA 3ZVVA 3FU3A 4LEUA 3L9TA 5ITZF 3ZXSA 3HG0D 2XS1A 4GU5A 4HXIA 4IULA 3ENEA 3VLDA 2BUGA 3UT8A 3DEOA 4TUUA 3SFZA 4MRUA 3GYZA 3QJZA 4CYMD 2X6KA 4G2VA 1INZA 3AAAC 3PRZA 3T9KA 3D9PA 2WPVA 1H6PA 3FUJA 3PH0C 2V8SE 3L54A 4A55A 5J90A 1SW6A 3RRNB 2XCCA 4LCTA 5JHBA 2P9IG 4UQYA 3FTUA 3IXEA 1U2VG 3FH8A 2IONA 1UG3A 5BV0A 2XEHA 3FTSA 4I1OB 2DIWA 5T8IA 4FLHA 3FTWA 2QC9A 2I1KA 5AQBA 3QOUA 4ABNA 2LO6A 2IFUA 4A1GA 5J08A 4GMRA 2AWIA 3LEWA 3LJ3A 2ZXWE 3NB2A 5BW8C 5AQ7A 4U8VD 2X6FA 2GRNB 4HBDA 4WAFA 4HRMB 4DX1A 2LAIA 1N4SA 4G24A 5B1AE 4HFGA 1QBQA 3L13A 4I1MA 3CIAA 5ENRD 2CHWA 3UQ3A 4KT6B 2ONDA 4N2SA 3P1UA 1NA3A 4GTQA 5JJ7A 5BXOA 1HXIA 2AJAA 3HHMA 4H7YA 1OY3D 3CEQA 3P2BA 3UKUG 4G8LA 1WAO1 1N0RA 4PUCA 2XEVA 1NFIE 4AY6A 3HYMB 4HI9A 4O1PA 1O1SA 1OWOA 1PAQA 4RVBA 2UY1A 4OYSA 4TXPA 4UWGA 1KT1A 3LY9A 3HIZA 3UIOC 3DXKG 4K0RA 4O6FA 4AOFA 3C72A 5FZSA 3T5XA 5EX3A 4BY6A 3FY4A 2YNQA 3O4ZA 3I4GA 4TUMA 1MZCA 5FINA 3QAQA 3TWQA 3RIBA 3K9IA 1TJCA 5LX8A 2WXGA 5IY5E 1FVHA 3ZYMA 4ATZD 2AVPA 5G55A 2YQ8A 3NZUA 3S7BA 2FF4A 2VSNA 1OCRE 3MGBA 3ESKA 3NF1A 1HX8A 2IO3C 3DSTA 4I6EA 2EQXA 2C0LA 4KYOB 2QZAA 3PNTB 3DEPA 1HH8A 2ZIRA 3B7UX 2LAHA 2LSVA 3IHVA 4RLYA 2J08A 4WWNA 4K03A 4EQFA 2IEJA 3L17A 4J6IA 2UY1B 2DWZA 2VGXB 4W9RA 4RG9A 4FHJA 5FTPA 5BUZA 5D0QD 4OAUC 4GZ5A 3KSLA 4Q94A 1ZBPA 5G04J 4PS8A 3ISMC 4ILGA 3C3OA 4WNDA 3V2OA 2AXUA 4IN3B 2NXPA 3AS5A 3FUEA 4U8HA 3U3WA 2L6BA 2RKKA 4C48B 3EHMA 1E7UA 4X8QA 4FJYA 3F6QA 4YVOA 2PL2A 2GGFA 1O1RA 4TV3A 4WUYA 3B7SA 4KVMA 1KPSB 2NSZA 4CT0A 4BSXA 2J9QA 3TWRA 1BI8B 2MOWA 5ENSD 3FP3A 3B7TA 4PS7A 3LY7A 4O60A 3TWUA 4ZHBA 1LD8A 3DSWA 3HVEA 4XEIG 2FI7A 1GW6A 1RZ4A 1A17A 4XX5A 3OTNA 4BSZB 5FQ8A 3EU9A 1TN8A 3PE4A 2EIME 3QNKA 4K5BA 4WNGA 4I9CA 4CGWA 3S7DA 2PM6A 1TJFA 5ENPD 4I2WA 5C2YA 3SHFA 3LCAA 2IU1A 4AY5A 1JWFA 5D66A 4I9EA 1IXVA 1DCQA 2IY0C 4GYOA 2KCKA 1E96B 5ENTD 3EHQA 1YYHA 3AU5A 2WVIA 1S64A 3HXDA 5EX0A 3MCXA 2GRMA 4N3CA 4YNDA 4ZFHA 4UI9J 1H0AA 1OT8A 5BXUA 2R02A 4BT8A 3CVWA 4ILIA 4EZLA 4DRXE 1N0QA 4CEMA 1JCSA 4FADA 5E75A 2P58C 1DCEA 5DBKA 4C9BB 1AP7A 2ETAA 2XENA 3TWWA 3PNLB 4WWOA 3TG4A 4LSZE 4EPZA 1W3BA 2WXMA 3I3NA 2P9NG 3QC1A 2PZIA 3PVLA 4DUIA 2CG3A 4U0UA 3E30A 3TG5A 4K5AB 3FUKA 4CDRA 5KNGA 1E8WA 3QKYA 4G1TA 4HRNA 4HNAD 3HXFA 3Q15A 1H19A 3SZ7A 3AG3E 3D9NA 2R59A 1D8DA 1N52A 4TRQA 5EDSA 3S2AA 2I2OA 2B6CA 4GA2A 3JQ1A 4F3VA 4D10C 2GROB 2IJGX 4I2ZA 3IEGA 1E7VA 1N11A 3VTYA 3Q75A 2H6IA 4C0EA 2PNNA 1XGWA 1Z3XA 4GCNA 4MLPA 1KLXA 1D9SA 3CK7A 1OCZE 3OXFA 5H7PA 1ZU2A 3NAWA 1V55E 3CK8A 1DNPA 4QFVA 1SA5A 3UINC 3BUAA 3ULEG 2L9BA 3EIJA 3EUVA 1HF8A 3Q9NC 3DBSA 3HXBA 1QZ2A 3CHMA 2H6HA 1HG5A 1E8XA 2KBXA 3LVQE 2GRQB 3L16A 3DPDA 5FZRA 4HOUA 5G2NA 3UM3A 4L23A 5E76A 1OWLA 2JEKA 5AQ9A 2F0YA 1H6KA 4GMLA 4JXTA 2EILE 3O48A 1VDYA 4JD2G 3MJWA 3ONLA 1MX4A 1FVFA 3BEEA 1OWNA 2OEVA 2MRIA 4U63A 4A63B 1UN8A 3ABKE 4F7AA 3G2TA 1S0PA 3ZFWA 2J8SD 3PS6A 3JUIA 2V5FA 2GRPB 3TWVA 4EHMA 4J8SA 5B1BE 4JVSA 3ULQA 5EYLA 5KJMA 2BKGA 4N3BA 3Q79A 3U4TA 3ZPJA 4B89A 2XZDG 4IYPA 3ULYA 1OWMA 1QYMA 3HXEA 4DLOA 1UJJA 2V0PA 3ASGA 3IHYA 4HRLA 5T3RA 2DYRE 2WXQA 1WDYA 4NQ0A 3NOCD 5KBAA 3LPZA 2X6HA 1A5EA 3QWVA 3U64A 1L5JA 3Q49B 4NURA 4GPMA 2DBAA 1WY6A 3JQ0A 4XKBA 4ME2A 5DIZA 2F8YA 4FLBA 2DZOA 3HDXA 3ZUVB 4LERA 3KSQA 4G23A 4LNUD 1WG0A 5CMYA 4KZ0A 1H2TC 5ENNA 1MQSA 2DVWA 4YDEA 2WXHA 3APDA 3QB2A 2XRZA 3E37A 3FUDA 1K3ZD 2C2LA 3CK9A 5HI7A 4BX8A 1OCCE 2I6HA 3AJIA 4AEZC 1N4QA 3RK6A 1K1AA 2P2CP 4M7CA 2R17C 3PUJA 4UWKA 5AQAA 4CDMA 2ZGDA 4G26A 4UQZA 3ASFA 4ILHB 1K8KG 4I43A 3ZHEB 3UPVA 4TXRA 2H6FA 4DX5D 2WB2A 3ZRHA 4UUCA 3AU4A 1KT0A 4AM9A 2RFAA 5AJLA 3SQVA 2X3MA 3E33A 4HS2A 3TXNA 4L2YA 4B0ZA 4ANUA 3KEZA 2WQHA 1TR4A 2I9CA 4PS3A 4KZCA 4Q96A 2DCPA 5LFAA 2VGXA 2FULA 3WXXA 3CKCA 3AS4A 3SO8A 3LYAA 3G2VA 2XGOA 1OWPA 2HM8A 3EIQC 3TXMA 3HXCA 1EYHA 3U66A 1N4PA 3RRMB 4A1SA 1TNUA 4U8YD 2KM4A 4YDOA 3KEAA 2L0TB 3ASDA 3LXUX 5FIOA 2LXMA 1U3DA 3IV0A 3ONKA 1B89A 1H2VC 3MV3B 3ZYKA 2R2LA 4L9PA 1UOHA 4XI0A 3GZSA 5CEAA 3JXIA 4UQXA 4Q69A 4FHKA 3B7RL 4KVOA 1PC2A 4J8FA 3QWPA 4HOTA 4EBAG 2KZTA 3Q47B 4B8CB 3CHSA 3ABME 3FUFA 3DPYA 3MA5A 1DVPA 3FULA 1Z6TA 3G2WA 3LVRE 3GZ1A 2VGEA 3FUMA 1EF1C 3SNXA 4FJZA 3D9LA 3FU6A 3SBTB 2ZISA 5CHEE 4JC8A 4MS6A 3UX4A 4ACKA 1E8YA 1TNZA 2ZU6B 1HO8A 4CDNA 5G05C 4J8YA 2GW1A 3FHEA 4FP7A 3ABLE 5EYPF 2QFCA 1TEZA 3FEXA 5CBOA 2F37A 4URKA 4NIKA 2J4DA 4N3AA 4U96D 3I4RB 4P29A 4GAAA 4WNEA 4GTRA 5LCWC 3CLJA 3IKOB 1EDUA 2KZTB 3ML8A 4JHRA 3W9GA 4QQIA 2H6GA 3DSXA 4L1BA 4I6JA 2KC7A 2A4ZA 4CCAA 3C5RA 5CRUA 4DI3A 3RU0A 2XZTG 4BEPA 3D9HA 3FTVA 2OEWA 4F1PA 2VSOE 2P9KG 2WXFA 3FUHA 3SBSA 1HE8A 3PZ3A 4GYYA 5JMND 2WXKA 4GA0A 3RKVA 4GZDA 2MHKA 2BEDA 3C98A 5M72A 3E34A 5CBNA 3Q7FA 1X81A 3E32A 4U07A 5BPPA 5JJ6A 1QNFA 2VJ8A 1E90A 2VQ2A 3AG1E 3TAXA 3OXLA 5B3SE 4OVVA 3UM1A 5A7DB 1IQUA 3TWXA 5CCMA 4YDWA 2OOEA 2WXIA 4DX7D 2VSXE 1N54A 3MKRA 4ACLA 1ELWA 5G04C 3RJVA 3ZNGA 4L7TA 2YHCA 1G3NB 1OUVA 1FT2A 4U0ZA 3IBEA 3AG2E 4M3OA 1NI1A 2IO2C 1ELRA 3VLEA 4B93B 4N5QA 2HR2A 3AS8A 1UW4B 4RSYA 4E85A 2CFZA 4U04A 4UWFA 1HFAA 2X6JA 4I17A 3TGOA 3L6AA 4GB9A 4ATGA 4EBAA 1HS6A 1D8EA 1IHBA 2KXPC 3G2SA 3BG1B 1O5MA 4PDXA 2J07A 3BG0B 1H2UA 5ANLA 3ZW3A 1TN7A 4MKTA 1MX2A 1SZ9A 3MEKA 2P9UG 1K1BA 3CSTA 4JEUA 5JA4D 5HS0A 5JHAA 1KZOA 4AJWA 3CVQA 4XI9A 1HG2A 3GW4A 3CQGB 5KJKA 3FDHA 4AVXA 3QK0A 3SF4A 3EHNA 2WXPA 4N5CA 3FFLA 2WXNA 2DYSE 3JXJA 5LOZA 3DWLG 3JYSA 3RO2A 3S7JA 2PQRA 4V3IA 5HQ8A 4HB5A 3UIPC 2XCBA 5BT1A 3QWWA 2A5UA 2FBNA 3FTZA 4FU3A 3CHOA 5JJTA 2V4HC 3R9MA 3D9IA 2QYJA 3RAUA 3MYVA 5D2MC 3X2QE 3OAWA 4JA7A 2XPYA 3PEVB 3PZ2A 2IOSA 2XS8A 4ANXA 1JCRA 4GTPA 5CRVA 1JCQA 2XPZA 4Y6CA 5KJLA 3B13A 4G25A 1YA0A 3SFXA 1Y6IA 3CQCB 3LS8A 3CVLA 4GMJA 4BWRA 4JA9A 3CVVA 2ETCA 4HORA 1BU9A 5FT9A 4XKCA 3L08A 3FH5A 4FULA 3D9MA 4LRZA 4WWPA 2OVFA 3WG7E 1O1TA 3MV2B 3CSFA 1HZ4A 2I1JA 4LNGA 3W9FA 1TNBA 2QYUA 4F6RD 5CECB 2R5SA 3ZHEA 2HYZA 4OVUA 4B94A 3UM2A 2WXOA 4JL0A 3EDTB 2KATA 3CHRA 3RRUA 4GZ6A 4DJAA 3ASHA 2X38A 5AENA 3J5PA 4DK5A 2MYOA 4BESA 2LXLA 3PREA 4HOQA 2VYIA 4E6HA 4BFRA 3Q4AB 2XQ0A 3E4BA 1MX6A 2AXZA 4UWLA 4APFA 3CKBA 4GZ3A 3ZYLA 2E2EA 5ARFA 2XRYA 3V2XA 5A23A 2XEEA 4F1SA 2AXVA 2IF4A 5EN5D 2RD0A 3RSEG 4ANVA 4DX6D 2VTBB 1QQEA 3EHRA 1SA4A 3J5QB 2VSYA 3LY8A 1N4RA 3CGHA 3TL5A 3KD7A 2J4BA 3FTYA 5C1DA 1JWGA 3R9AB 2CFUA 3PZ4A 3UT7A 3SFYA 2IQCA 4JHJA 3TJPA 3JUEA 5KWDA 3ESLA 5KNHD 2Q7FA 5T4YA 2WXJA 2XGMA 4JZYA 5D0OD 3UMVA 3CVPA 2FEZA 4RQIA 2NYJA 4HQDA 4XE0A 2A5EA 3MX3A 3ASOE 3CVYA 4J8DA 3S7FA 4ANWA 4FA6A 3T8MA 3UXGA 3I5PA 1LD7A 5AIJA 5FQ4A 5KCMA 4JPSA 4WNFA 4JEHA 2XHEA 4APOA 1JPLA 2UWJG 2OV8A 2WM9A 3PE3A 1FCHA 4GTOA 3VTXA 4JB8P 2X6IA 4NRHB 5G05J 1Y8MA 4DLQA 2BKKB 1MYOA 3Q7AA 2ETBA 4LNBA 3T8KA 4A3VA 3LDZA 1V54E 5FQ7A 3B7BA 3FUIA 3V31A 3VLFA 2M63A 1YCSB 5FQ6A 2J09A 1TNYA 3NZSA 2WQ6A 5CCLA 3NBNB 5ANRA 4BTBA 4RG6A 3PEUB 4GPKA 1X5BA 5AYWD 3UI2A 1N94A 1MJ0A 4IRUA 2FO7A 3ZKJA 5LCWJ 5FZQA 3UM0A 1Q2ZA 4F53A 4C0MA 4G11A 2BTDA 4LG6A 1NP7A 3Q5MA 5A6CA 4R7LA 2CHXA 2R03A 4AIFA 4JW1A 4B8AA 3UT4A 3JCKC 2RFMA 5BV1A 4DI4A 2YHEA 2B0OE 1TN6A 4CZ2D 3QDNA 1P5QA 4MBGA 4CGVA 3ASNE 2E0IA 1S63A 3OXGA 2C0MA 4UWHA 4YVQC 4AP2A 2ILRA 2OCCE 4O1OA 5EKQD 2CG2A 1PY1A 3N71A 1LTXA 2LUHA 3TWSA 3D9JA 4GTVA 2V5QC 3UUXA 1BLXB 2JABA 1XNFA 3PDNA 5ENQD 5FWQA 3D9KA 3SI5A 1IQRA 2WXLA 5FJYA 3Q73A 4GYWA 4J8EA 4I1AA 2OVBA 3CHQA 1NZNA 4U0SA 3ZU7B 3Q78A 4N39A 2EINE 3FU5A 4EZKA 3FEYA 4UI9K 1Z5SC 1UJKA 3ZXPA 2P9LG 3QARA 2Y4TA 3DXMG 2PQNA 4NACA 3MKQA 2HE0A 3DSSA 1JUQA 3PZ1A 5CMWA 5HKPA 2RG8A 2HO1A 4HOSA 3NOGD 1YMPA 3TWTA 4EECA 1N9AA 4L2LA 2V4LA 3ZEFA 2ZGGA 4J7WA 2F8XK 4GZCA 3UKRG 4LUNU 1BPOA 2WMNA 2Y1LE 1H6OA 2P9SG 2JLBA 3R7QA 4KBQA 3D9OA 3KAEA 2R05A 4GTTA 1HU3A 3LJNA 3B95A 1UN9A 2VGYA 4TXQA 1TNOA 2GRRB 4BX9A 3SD5A 4AV7A 4OAVB 4BERA 2KCLA 1NA0A 1IKND 2LNIA 2DZNA 1OXJA 3HRAA 3BQOA 1EPUA 5EILA 2NC9A 3DSVA 3FU0A 3ZYQA 3SGHA 3MKQB 4BETA 2BF0X 1RW2A 1IYGA 3KS2A 5AJDA 1LF8A 5AAOA 3CVUA 3ZGQA 3FWVA 3D3MA 3V79K 2IOLA 3CV0A 3CVXA 5ENOD 4J0UA 1DC2A 2J49A 4U95D 3DRAA 4HI8A 3EJNA 4BT9A 4HLLA 4AXHA 3HVEB 4EZJA 1SQMA 1TYQG 4CRWA 3FH7A 5EIBE 3MZLB 3ML9A 4HLEA 3NQPA 2Y3AA 1IHGA 5KJNA 1Z3YA 3EU5A 4U7EB 3PZDA 1KZPA 3APFA 3R7RA 2XGSA 4DPRA 2L0IA 1FPPA 2QY7A 2P9PG 4KMOA 3AG4E 4GTSA 3LKUA 3T5VA 4GA1A 1ELKA 3V30A 4FC8A 1SVXA 4XIFA 4G8KA 3RO3A 3URZA 4A3TA 4KXKB 3U9WA 1SZAA 1NL4A 1AWCB 2EIJE 4JHKA 4HVBA 3UTMA 1N95A 5CERB 2WXRA 1WM5A 1BI7B 3Q9UC 4Z68A 3C3QA 2WMOA 3FTXA 4GTMA 1MHQA 4UI9C 2LSUA 2YINA 4I6GA 2Y0BG 3CR3A 2XPIA 3GZ2A 4YDYA 5LP0A 4CT4A 2PM7A
chains in the Genus database with same CATH topology
5D2MC 1Z5SC 1KPSB 2IO2C 2GRPB 2GROB 2IY0C 3UINC 2GRRB 3UIPC 2IO3C 2GRQB 2GRNB 3UIOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2M C;  1Z5S C;  1KPS B;  2IO2 C;  2GRP B;  2GRO B;  2IY0 C;  3UIN C;  2GRR B;  3UIP C;  2IO3 C;  2GRQ B;  2GRN B;  3UIO C; 
#chains in the Genus database with same CATH topology
 3PUK A;  4H7X A;  3FUN A;  3CHP A;  5AAR A;  2FO1 E;  3APC A;  2CHZ A;  3ZIM A;  2AW6 A;  1E8Z A;  4BTA A;  5EID A;  5AN8 A;  3BU8 A;  3L82 A;  3SY2 A;  2WQ7 A;  4XZ4 A;  2VTB A;  2EIK E;  3CVN A;  5CED B;  3C3R A;  5BNW A;  4N2Q A;  4Y6W A;  4PH4 B;  3L22 A;  1FT1 A;  1S70 B;  2L6J A;  3DSU A;  4GCO A;  1U3C A;  1BD8 A;  3G2U A;  1OCO E;  3ZN3 A;  2Y4U A;  2Y69 E;  4DX2 A;  1ZB1 A;  4K5C A;  5ARG A;  5HRY A;  2GRL A;  2KCV A;  3ZVV A;  3FU3 A;  4LEU A;  3L9T A;  5ITZ F;  3ZXS A;  3HG0 D;  2XS1 A;  4GU5 A;  4HXI A;  4IUL A;  3ENE A;  3VLD A;  2BUG A;  3UT8 A;  3DEO A;  4TUU A;  3SFZ A;  4MRU A;  3GYZ A;  3QJZ A;  4CYM D;  2X6K A;  4G2V A;  1INZ A;  3AAA C;  3PRZ A;  3T9K A;  3D9P A;  2WPV A;  1H6P A;  3FUJ A;  3PH0 C;  2V8S E;  3L54 A;  4A55 A;  5J90 A;  1SW6 A;  3RRN B;  2XCC A;  4LCT A;  5JHB A;  2P9I G;  4UQY A;  3FTU A;  3IXE A;  1U2V G;  3FH8 A;  2ION A;  1UG3 A;  5BV0 A;  2XEH A;  3FTS A;  4I1O B;  2DIW A;  5T8I A;  4FLH A;  3FTW A;  2QC9 A;  2I1K A;  5AQB A;  3QOU A;  4ABN A;  2LO6 A;  2IFU A;  4A1G A;  5J08 A;  4GMR A;  2AWI A;  3LEW A;  3LJ3 A;  2ZXW E;  3NB2 A;  5BW8 C;  5AQ7 A;  4U8V D;  2X6F A;  2GRN B;  4HBD A;  4WAF A;  4HRM B;  4DX1 A;  2LAI A;  1N4S A;  4G24 A;  5B1A E;  4HFG A;  1QBQ A;  3L13 A;  4I1M A;  3CIA A;  5ENR D;  2CHW A;  3UQ3 A;  4KT6 B;  2OND A;  4N2S A;  3P1U A;  1NA3 A;  4GTQ A;  5JJ7 A;  5BXO A;  1HXI A;  2AJA A;  3HHM A;  4H7Y A;  1OY3 D;  3CEQ A;  3P2B A;  3UKU G;  4G8L A;  1WAO 1;  1N0R A;  4PUC A;  2XEV A;  1NFI E;  4AY6 A;  3HYM B;  4HI9 A;  4O1P A;  1O1S A;  1OWO A;  1PAQ A;  4RVB A;  2UY1 A;  4OYS A;  4TXP A;  4UWG A;  1KT1 A;  3LY9 A;  3HIZ A;  3UIO C;  3DXK G;  4K0R A;  4O6F A;  4AOF A;  3C72 A;  5FZS A;  3T5X A;  5EX3 A;  4BY6 A;  3FY4 A;  2YNQ A;  3O4Z A;  3I4G A;  4TUM A;  1MZC A;  5FIN A;  3QAQ A;  3TWQ A;  3RIB A;  3K9I A;  1TJC A;  5LX8 A;  2WXG A;  5IY5 E;  1FVH A;  3ZYM A;  4ATZ D;  2AVP A;  5G55 A;  2YQ8 A;  3NZU A;  3S7B A;  2FF4 A;  2VSN A;  1OCR E;  3MGB A;  3ESK A;  3NF1 A;  1HX8 A;  2IO3 C;  3DST A;  4I6E A;  2EQX A;  2C0L A;  4KYO B;  2QZA A;  3PNT B;  3DEP A;  1HH8 A;  2ZIR A;  3B7U X;  2LAH A;  2LSV A;  3IHV A;  4RLY A;  2J08 A;  4WWN A;  4K03 A;  4EQF A;  2IEJ A;  3L17 A;  4J6I A;  2UY1 B;  2DWZ A;  2VGX B;  4W9R A;  4RG9 A;  4FHJ A;  5FTP A;  5BUZ A;  5D0Q D;  4OAU C;  4GZ5 A;  3KSL A;  4Q94 A;  1ZBP A;  5G04 J;  4PS8 A;  3ISM C;  4ILG A;  3C3O A;  4WND A;  3V2O A;  2AXU A;  4IN3 B;  2NXP A;  3AS5 A;  3FUE A;  4U8H A;  3U3W A;  2L6B A;  2RKK A;  4C48 B;  3EHM A;  1E7U A;  4X8Q A;  4FJY A;  3F6Q A;  4YVO A;  2PL2 A;  2GGF A;  1O1R A;  4TV3 A;  4WUY A;  3B7S A;  4KVM A;  1KPS B;  2NSZ A;  4CT0 A;  4BSX A;  2J9Q A;  3TWR A;  1BI8 B;  2MOW A;  5ENS D;  3FP3 A;  3B7T A;  4PS7 A;  3LY7 A;  4O60 A;  3TWU A;  4ZHB A;  1LD8 A;  3DSW A;  3HVE A;  4XEI G;  2FI7 A;  1GW6 A;  1RZ4 A;  1A17 A;  4XX5 A;  3OTN A;  4BSZ B;  5FQ8 A;  3EU9 A;  1TN8 A;  3PE4 A;  2EIM E;  3QNK A;  4K5B A;  4WNG A;  4I9C A;  4CGW A;  3S7D A;  2PM6 A;  1TJF A;  5ENP D;  4I2W A;  5C2Y A;  3SHF A;  3LCA A;  2IU1 A;  4AY5 A;  1JWF A;  5D66 A;  4I9E A;  1IXV A;  1DCQ A;  2IY0 C;  4GYO A;  2KCK A;  1E96 B;  5ENT D;  3EHQ A;  1YYH A;  3AU5 A;  2WVI A;  1S64 A;  3HXD A;  5EX0 A;  3MCX A;  2GRM A;  4N3C A;  4YND A;  4ZFH A;  4UI9 J;  1H0A A;  1OT8 A;  5BXU A;  2R02 A;  4BT8 A;  3CVW A;  4ILI A;  4EZL A;  4DRX E;  1N0Q A;  4CEM A;  1JCS A;  4FAD A;  5E75 A;  2P58 C;  1DCE A;  5DBK A;  4C9B B;  1AP7 A;  2ETA A;  2XEN A;  3TWW A;  3PNL B;  4WWO A;  3TG4 A;  4LSZ E;  4EPZ A;  1W3B A;  2WXM A;  3I3N A;  2P9N G;  3QC1 A;  2PZI A;  3PVL A;  4DUI A;  2CG3 A;  4U0U A;  3E30 A;  3TG5 A;  4K5A B;  3FUK A;  4CDR A;  5KNG A;  1E8W A;  3QKY A;  4G1T A;  4HRN A;  4HNA D;  3HXF A;  3Q15 A;  1H19 A;  3SZ7 A;  3AG3 E;  3D9N A;  2R59 A;  1D8D A;  1N52 A;  4TRQ A;  5EDS A;  3S2A A;  2I2O A;  2B6C A;  4GA2 A;  3JQ1 A;  4F3V A;  4D10 C;  2GRO B;  2IJG X;  4I2Z A;  3IEG A;  1E7V A;  1N11 A;  3VTY A;  3Q75 A;  2H6I A;  4C0E A;  2PNN A;  1XGW A;  1Z3X A;  4GCN A;  4MLP A;  1KLX A;  1D9S A;  3CK7 A;  1OCZ E;  3OXF A;  5H7P A;  1ZU2 A;  3NAW A;  1V55 E;  3CK8 A;  1DNP A;  4QFV A;  1SA5 A;  3UIN C;  3BUA A;  3ULE G;  2L9B A;  3EIJ A;  3EUV A;  1HF8 A;  3Q9N C;  3DBS A;  3HXB A;  1QZ2 A;  3CHM A;  2H6H A;  1HG5 A;  1E8X A;  2KBX A;  3LVQ E;  2GRQ B;  3L16 A;  3DPD A;  5FZR A;  4HOU A;  5G2N A;  3UM3 A;  4L23 A;  5E76 A;  1OWL A;  2JEK A;  5AQ9 A;  2F0Y A;  1H6K A;  4GML A;  4JXT A;  2EIL E;  3O48 A;  1VDY A;  4JD2 G;  3MJW A;  3ONL A;  1MX4 A;  1FVF A;  3BEE A;  1OWN A;  2OEV A;  2MRI A;  4U63 A;  4A63 B;  1UN8 A;  3ABK E;  4F7A A;  3G2T A;  1S0P A;  3ZFW A;  2J8S D;  3PS6 A;  3JUI A;  2V5F A;  2GRP B;  3TWV A;  4EHM A;  4J8S A;  5B1B E;  4JVS A;  3ULQ A;  5EYL A;  5KJM A;  2BKG A;  4N3B A;  3Q79 A;  3U4T A;  3ZPJ A;  4B89 A;  2XZD G;  4IYP A;  3ULY A;  1OWM A;  1QYM A;  3HXE A;  4DLO A;  1UJJ A;  2V0P A;  3ASG A;  3IHY A;  4HRL A;  5T3R A;  2DYR E;  2WXQ A;  1WDY A;  4NQ0 A;  3NOC D;  5KBA A;  3LPZ A;  2X6H A;  1A5E A;  3QWV A;  3U64 A;  1L5J A;  3Q49 B;  4NUR A;  4GPM A;  2DBA A;  1WY6 A;  3JQ0 A;  4XKB A;  4ME2 A;  5DIZ A;  2F8Y A;  4FLB A;  2DZO A;  3HDX A;  3ZUV B;  4LER A;  3KSQ A;  4G23 A;  4LNU D;  1WG0 A;  5CMY A;  4KZ0 A;  1H2T C;  5ENN A;  1MQS A;  2DVW A;  4YDE A;  2WXH A;  3APD A;  3QB2 A;  2XRZ A;  3E37 A;  3FUD A;  1K3Z D;  2C2L A;  3CK9 A;  5HI7 A;  4BX8 A;  1OCC E;  2I6H A;  3AJI A;  4AEZ C;  1N4Q A;  3RK6 A;  1K1A A;  2P2C P;  4M7C A;  2R17 C;  3PUJ A;  4UWK A;  5AQA A;  4CDM A;  2ZGD A;  4G26 A;  4UQZ A;  3ASF A;  4ILH B;  1K8K G;  4I43 A;  3ZHE B;  3UPV A;  4TXR A;  2H6F A;  4DX5 D;  2WB2 A;  3ZRH A;  4UUC A;  3AU4 A;  1KT0 A;  4AM9 A;  2RFA A;  5AJL A;  3SQV A;  2X3M A;  3E33 A;  4HS2 A;  3TXN A;  4L2Y A;  4B0Z A;  4ANU A;  3KEZ A;  2WQH A;  1TR4 A;  2I9C A;  4PS3 A;  4KZC A;  4Q96 A;  2DCP A;  5LFA A;  2VGX A;  2FUL A;  3WXX A;  3CKC A;  3AS4 A;  3SO8 A;  3LYA A;  3G2V A;  2XGO A;  1OWP A;  2HM8 A;  3EIQ C;  3TXM A;  3HXC A;  1EYH A;  3U66 A;  1N4P A;  3RRM B;  4A1S A;  1TNU A;  4U8Y D;  2KM4 A;  4YDO A;  3KEA A;  2L0T B;  3ASD A;  3LXU X;  5FIO A;  2LXM A;  1U3D A;  3IV0 A;  3ONK A;  1B89 A;  1H2V C;  3MV3 B;  3ZYK A;  2R2L A;  4L9P A;  1UOH A;  4XI0 A;  3GZS A;  5CEA A;  3JXI A;  4UQX A;  4Q69 A;  4FHK A;  3B7R L;  4KVO A;  1PC2 A;  4J8F A;  3QWP A;  4HOT A;  4EBA G;  2KZT A;  3Q47 B;  4B8C B;  3CHS A;  3ABM E;  3FUF A;  3DPY A;  3MA5 A;  1DVP A;  3FUL A;  1Z6T A;  3G2W A;  3LVR E;  3GZ1 A;  2VGE A;  3FUM A;  1EF1 C;  3SNX A;  4FJZ A;  3D9L A;  3FU6 A;  3SBT B;  2ZIS A;  5CHE E;  4JC8 A;  4MS6 A;  3UX4 A;  4ACK A;  1E8Y A;  1TNZ A;  2ZU6 B;  1HO8 A;  4CDN A;  5G05 C;  4J8Y A;  2GW1 A;  3FHE A;  4FP7 A;  3ABL E;  5EYP F;  2QFC A;  1TEZ A;  3FEX A;  5CBO A;  2F37 A;  4URK A;  4NIK A;  2J4D A;  4N3A A;  4U96 D;  3I4R B;  4P29 A;  4GAA A;  4WNE A;  4GTR A;  5LCW C;  3CLJ A;  3IKO B;  1EDU A;  2KZT B;  3ML8 A;  4JHR A;  3W9G A;  4QQI A;  2H6G A;  3DSX A;  4L1B A;  4I6J A;  2KC7 A;  2A4Z A;  4CCA A;  3C5R A;  5CRU A;  4DI3 A;  3RU0 A;  2XZT G;  4BEP A;  3D9H A;  3FTV A;  2OEW A;  4F1P A;  2VSO E;  2P9K G;  2WXF A;  3FUH A;  3SBS A;  1HE8 A;  3PZ3 A;  4GYY A;  5JMN D;  2WXK A;  4GA0 A;  3RKV A;  4GZD A;  2MHK A;  2BED A;  3C98 A;  5M72 A;  3E34 A;  5CBN A;  3Q7F A;  1X81 A;  3E32 A;  4U07 A;  5BPP A;  5JJ6 A;  1QNF A;  2VJ8 A;  1E90 A;  2VQ2 A;  3AG1 E;  3TAX A;  3OXL A;  5B3S E;  4OVV A;  3UM1 A;  5A7D B;  1IQU A;  3TWX A;  5CCM A;  4YDW A;  2OOE A;  2WXI A;  4DX7 D;  2VSX E;  1N54 A;  3MKR A;  4ACL A;  1ELW A;  5G04 C;  3RJV A;  3ZNG A;  4L7T A;  2YHC A;  1G3N B;  1OUV A;  1FT2 A;  4U0Z A;  3IBE A;  3AG2 E;  4M3O A;  1NI1 A;  2IO2 C;  1ELR A;  3VLE A;  4B93 B;  4N5Q A;  2HR2 A;  3AS8 A;  1UW4 B;  4RSY A;  4E85 A;  2CFZ A;  4U04 A;  4UWF A;  1HFA A;  2X6J A;  4I17 A;  3TGO A;  3L6A A;  4GB9 A;  4ATG A;  4EBA A;  1HS6 A;  1D8E A;  1IHB A;  2KXP C;  3G2S A;  3BG1 B;  1O5M A;  4PDX A;  2J07 A;  3BG0 B;  1H2U A;  5ANL A;  3ZW3 A;  1TN7 A;  4MKT A;  1MX2 A;  1SZ9 A;  3MEK A;  2P9U G;  1K1B A;  3CST A;  4JEU A;  5JA4 D;  5HS0 A;  5JHA A;  1KZO A;  4AJW A;  3CVQ A;  4XI9 A;  1HG2 A;  3GW4 A;  3CQG B;  5KJK A;  3FDH A;  4AVX A;  3QK0 A;  3SF4 A;  3EHN A;  2WXP A;  4N5C A;  3FFL A;  2WXN A;  2DYS E;  3JXJ A;  5LOZ A;  3DWL G;  3JYS A;  3RO2 A;  3S7J A;  2PQR A;  4V3I A;  5HQ8 A;  4HB5 A;  3UIP C;  2XCB A;  5BT1 A;  3QWW A;  2A5U A;  2FBN A;  3FTZ A;  4FU3 A;  3CHO A;  5JJT A;  2V4H C;  3R9M A;  3D9I A;  2QYJ A;  3RAU A;  3MYV A;  5D2M C;  3X2Q E;  3OAW A;  4JA7 A;  2XPY A;  3PEV B;  3PZ2 A;  2IOS A;  2XS8 A;  4ANX A;  1JCR A;  4GTP A;  5CRV A;  1JCQ A;  2XPZ A;  4Y6C A;  5KJL A;  3B13 A;  4G25 A;  1YA0 A;  3SFX A;  1Y6I A;  3CQC B;  3LS8 A;  3CVL A;  4GMJ A;  4BWR A;  4JA9 A;  3CVV A;  2ETC A;  4HOR A;  1BU9 A;  5FT9 A;  4XKC A;  3L08 A;  3FH5 A;  4FUL A;  3D9M A;  4LRZ A;  4WWP A;  2OVF A;  3WG7 E;  1O1T A;  3MV2 B;  3CSF A;  1HZ4 A;  2I1J A;  4LNG A;  3W9F A;  1TNB A;  2QYU A;  4F6R D;  5CEC B;  2R5S A;  3ZHE A;  2HYZ A;  4OVU A;  4B94 A;  3UM2 A;  2WXO A;  4JL0 A;  3EDT B;  2KAT A;  3CHR A;  3RRU A;  4GZ6 A;  4DJA A;  3ASH A;  2X38 A;  5AEN A;  3J5P A;  4DK5 A;  2MYO A;  4BES A;  2LXL A;  3PRE A;  4HOQ A;  2VYI A;  4E6H A;  4BFR A;  3Q4A B;  2XQ0 A;  3E4B A;  1MX6 A;  2AXZ A;  4UWL A;  4APF A;  3CKB A;  4GZ3 A;  3ZYL A;  2E2E A;  5ARF A;  2XRY A;  3V2X A;  5A23 A;  2XEE A;  4F1S A;  2AXV A;  2IF4 A;  5EN5 D;  2RD0 A;  3RSE G;  4ANV A;  4DX6 D;  2VTB B;  1QQE A;  3EHR A;  1SA4 A;  3J5Q B;  2VSY A;  3LY8 A;  1N4R A;  3CGH A;  3TL5 A;  3KD7 A;  2J4B A;  3FTY A;  5C1D A;  1JWG A;  3R9A B;  2CFU A;  3PZ4 A;  3UT7 A;  3SFY A;  2IQC A;  4JHJ A;  3TJP A;  3JUE A;  5KWD A;  3ESL A;  5KNH D;  2Q7F A;  5T4Y A;  2WXJ A;  2XGM A;  4JZY A;  5D0O D;  3UMV A;  3CVP A;  2FEZ A;  4RQI A;  2NYJ A;  4HQD A;  4XE0 A;  2A5E A;  3MX3 A;  3ASO E;  3CVY A;  4J8D A;  3S7F A;  4ANW A;  4FA6 A;  3T8M A;  3UXG A;  3I5P A;  1LD7 A;  5AIJ A;  5FQ4 A;  5KCM A;  4JPS A;  4WNF A;  4JEH A;  2XHE A;  4APO A;  1JPL A;  2UWJ G;  2OV8 A;  2WM9 A;  3PE3 A;  1FCH A;  4GTO A;  3VTX A;  4JB8 P;  2X6I A;  4NRH B;  5G05 J;  1Y8M A;  4DLQ A;  2BKK B;  1MYO A;  3Q7A A;  2ETB A;  4LNB A;  3T8K A;  4A3V A;  3LDZ A;  1V54 E;  5FQ7 A;  3B7B A;  3FUI A;  3V31 A;  3VLF A;  2M63 A;  1YCS B;  5FQ6 A;  2J09 A;  1TNY A;  3NZS A;  2WQ6 A;  5CCL A;  3NBN B;  5ANR A;  4BTB A;  4RG6 A;  3PEU B;  4GPK A;  1X5B A;  5AYW D;  3UI2 A;  1N94 A;  1MJ0 A;  4IRU A;  2FO7 A;  3ZKJ A;  5LCW J;  5FZQ A;  3UM0 A;  1Q2Z A;  4F53 A;  4C0M A;  4G11 A;  2BTD A;  4LG6 A;  1NP7 A;  3Q5M A;  5A6C A;  4R7L A;  2CHX A;  2R03 A;  4AIF A;  4JW1 A;  4B8A A;  3UT4 A;  3JCK C;  2RFM A;  5BV1 A;  4DI4 A;  2YHE A;  2B0O E;  1TN6 A;  4CZ2 D;  3QDN A;  1P5Q A;  4MBG A;  4CGV A;  3ASN E;  2E0I A;  1S63 A;  3OXG A;  2C0M A;  4UWH A;  4YVQ C;  4AP2 A;  2ILR A;  2OCC E;  4O1O A;  5EKQ D;  2CG2 A;  1PY1 A;  3N71 A;  1LTX A;  2LUH A;  3TWS A;  3D9J A;  4GTV A;  2V5Q C;  3UUX A;  1BLX B;  2JAB A;  1XNF A;  3PDN A;  5ENQ D;  5FWQ A;  3D9K A;  3SI5 A;  1IQR A;  2WXL A;  5FJY A;  3Q73 A;  4GYW A;  4J8E A;  4I1A A;  2OVB A;  3CHQ A;  1NZN A;  4U0S A;  3ZU7 B;  3Q78 A;  4N39 A;  2EIN E;  3FU5 A;  4EZK A;  3FEY A;  4UI9 K;  1Z5S C;  1UJK A;  3ZXP A;  2P9L G;  3QAR A;  2Y4T A;  3DXM G;  2PQN A;  4NAC A;  3MKQ A;  2HE0 A;  3DSS A;  1JUQ A;  3PZ1 A;  5CMW A;  5HKP A;  2RG8 A;  2HO1 A;  4HOS A;  3NOG D;  1YMP A;  3TWT A;  4EEC A;  1N9A A;  4L2L A;  2V4L A;  3ZEF A;  2ZGG A;  4J7W A;  2F8X K;  4GZC A;  3UKR G;  4LUN U;  1BPO A;  2WMN A;  2Y1L E;  1H6O A;  2P9S G;  2JLB A;  3R7Q A;  4KBQ A;  3D9O A;  3KAE A;  2R05 A;  4GTT A;  1HU3 A;  3LJN A;  3B95 A;  1UN9 A;  2VGY A;  4TXQ A;  1TNO A;  2GRR B;  4BX9 A;  3SD5 A;  4AV7 A;  4OAV B;  4BER A;  2KCL A;  1NA0 A;  1IKN D;  2LNI A;  2DZN A;  1OXJ A;  3HRA A;  3BQO A;  1EPU A;  5EIL A;  2NC9 A;  3DSV A;  3FU0 A;  3ZYQ A;  3SGH A;  3MKQ B;  4BET A;  2BF0 X;  1RW2 A;  1IYG A;  3KS2 A;  5AJD A;  1LF8 A;  5AAO A;  3CVU A;  3ZGQ A;  3FWV A;  3D3M A;  3V79 K;  2IOL A;  3CV0 A;  3CVX A;  5ENO D;  4J0U A;  1DC2 A;  2J49 A;  4U95 D;  3DRA A;  4HI8 A;  3EJN A;  4BT9 A;  4HLL A;  4AXH A;  3HVE B;  4EZJ A;  1SQM A;  1TYQ G;  4CRW A;  3FH7 A;  5EIB E;  3MZL B;  3ML9 A;  4HLE A;  3NQP A;  2Y3A A;  1IHG A;  5KJN A;  1Z3Y A;  3EU5 A;  4U7E B;  3PZD A;  1KZP A;  3APF A;  3R7R A;  2XGS A;  4DPR A;  2L0I A;  1FPP A;  2QY7 A;  2P9P G;  4KMO A;  3AG4 E;  4GTS A;  3LKU A;  3T5V A;  4GA1 A;  1ELK A;  3V30 A;  4FC8 A;  1SVX A;  4XIF A;  4G8K A;  3RO3 A;  3URZ A;  4A3T A;  4KXK B;  3U9W A;  1SZA A;  1NL4 A;  1AWC B;  2EIJ E;  4JHK A;  4HVB A;  3UTM A;  1N95 A;  5CER B;  2WXR A;  1WM5 A;  1BI7 B;  3Q9U C;  4Z68 A;  3C3Q A;  2WMO A;  3FTX A;  4GTM A;  1MHQ A;  4UI9 C;  2LSU A;  2YIN A;  4I6G A;  2Y0B G;  3CR3 A;  2XPI A;  3GZ2 A;  4YDY A;  5LP0 A;  4CT4 A;  2PM7 A; 
#chains in the Genus database with same CATH homology
 5D2M C;  1Z5S C;  1KPS B;  2IO2 C;  2GRP B;  2GRO B;  2IY0 C;  3UIN C;  2GRR B;  3UIP C;  2IO3 C;  2GRQ B;  2GRN B;  3UIO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...