1O1RA

Structure of fpt bound to ggpp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Biochemical and Structural Studies with Prenyl Diphosphate Analogues Provide Insights into Isoprenoid Recognition by Protein Farnesyl Transferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 123
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o1rA00
4GTRA 3SFYA 3HXCA 3DSVA 3HXFA 1SA4A 4GTQA 1N95A 2H6HA 3Q73A 4YDOA 1O1RA 3E30A 1TN8A 4LNGA 1S64A 4YDEA 4GTTA 4GTSA 4GTMA 1JCSA 3Q75A 3KSQA 4GTPA 3KSLA 1N4SA 1TNBA 4GTVA 1O1TA 1TNZA 3PZ3A 2BEDA 3E34A 2R2LA 1FPPA 1TNOA 4L9PA 3HXDA 4GTOA 1MZCA 4EHMA 1D8EA 3E32A 3DSTA 3E33A 1FT2A 3DSUA 1QBQA 3EU5A 1NL4A 2ZIRA 1TNYA 1DCEA 3DPYA 3PZ2A 1N4RA 3PZ1A 1JCRA 3C72A 1KZPA 3SFXA 3PZ4A 1D8DA 1TN7A 3Q7FA 2H6GA 2IEJA 1X81A 3Q7AA 1S63A 4MBGA 3HXBA 1LD8A 1LD7A 3DSXA 4LNBA 1N9AA 1O5MA 1LTXA 1O1SA 3DRAA 1SA5A 2ZISA 2F0YA 3E37A 3Q78A 3DSWA 1N4PA 3HXEA 2H6FA 3EUVA 1KZOA 1TN6A 1N94A 2H6IA 1FT1A 1N4QA 1JCQA 3Q79A 1NI1A 1TNUA 3DSSA
chains in the Genus database with same CATH superfamily
2ZU6B 2R5SA 1OCRE 3U3WA 4HRLA 4O6FA 3ZIMA 1IQUA 2CHXA 3SBSA 3EJNA 1K1BA 5CBNA 5KJMA 2E2EA 4EBAG 3R9AB 4XI0A 3EU9A 3CVQA 3L6AA 4U8VD 4I17A 3UM2A 4DX6D 1SW6A 2P9IG 3HXDA 3PRZA 4MKTA 3CK7A 5CMYA 4F53A 4IN3B 1FT2A 2XGOA 5G05C 4B0ZA 5E75A 1NL4A 1DCEA 5EYPF 3E4BA 1IXVA 3CVLA 2BKKB 4BY6A 1X5BA 3FDHA 1N52A 3EHQA 1QYMA 5LP0A 4N2SA 3DSXA 4KYOB 1B89A 2Y1LE 1HU3A 4L2LA 3LJNA 4FULA 4RSYA 3I4RB 3Q4AB 4D10C 3VLEA 1N4PA 2FF4A 2PQRA 3CHRA 3NOGD 5B1BE 5D2MC 3Q79A 4UQYA 3HG0D 3DPDA 1HS6A 4O1OA 3F6QA 2PL2A 4GYWA 5KCMA 4I1AA 4OAUC 2MRIA 2AWIA 2RG8A 3DXKG 1EPUA 1K8KG 4U95D 3PE4A 4E85A 4U7EB 3JCKC 4DUIA 4U63A 3ZN3A 3EHRA 5BXOA 3JYSA 2DZOA 2WQ7A 3CKCA 4KVOA 4GMRA 4GZ6A 2XPIA 2FO7A 4MRUA 2OCCE 2Y0BG 2MOWA 4BT8A 2XQ0A 4DPRA 1H2VC 4APOA 2IONA 4EPZA 3S7BA 1SQMA 4BEPA 2GRQB 3KEAA 1Q2ZA 2R05A 5AARA 3X2QE 4EZKA 2I1JA 4I6JA 4YDWA 3JXJA 3UT7A 3FH7A 4KMOA 4PS8A 4A3TA 3NAWA 4AEZC 3QC1A 1IHBA 2OVBA 2WXIA 4NRHB 1D9SA 3QARA 3ZGQA 1OT8A 2OEVA 1FT1A 1NA0A 3MKQA 4Y6CA 3ZPJA 4HI8A 3DSVA 4A55A 4NURA 5EIBE 4M7CA 1TJFA 2H6HA 1IQRA 4U8YD 1H19A 3FULA 1HO8A 3LDZA 5FQ4A 3UI2A 2XHEA 4LERA 2VJ8A 4L7TA 3UX4A 5LX8A 4O1PA 3ABLE 2HYZA 2VQ2A 2WMNA 3LKUA 1EDUA 4XZ4A 5CCMA 5T3RA 3HRAA 2LNIA 3QOUA 1Z5SC 2L0IA 4U8HA 2P9SG 3E33A 3CSFA 2XCBA 1RW2A 2AW6A 4L1BA 2VTBB 5G04J 3SHFA 3GZSA 2WXGA 2GRLA 3UTMA 4HOTA 4ATGA 1KZPA 2J07A 5FZRA 3LVRE 3Q7FA 3RSEG 4AVXA 1BLXB 1S63A 3TWXA 1N0RA 2OOEA 2QFCA 5CECB 2I9CA 4N3AA 1XGWA 3MKRA 3PEVB 1KLXA 4HOSA 4YDYA 4GB9A 1N11A 4G25A 5KJLA 3T5VA 2F0YA 4Z68A 3TL5A 2DZNA 3SNXA 4FLBA 2NXPA 5CBOA 3FUMA 4GYYA 4OVUA 4JD2G 2BF0X 3C3RA 4AV7A 4JPSA 2R17C 5LCWC 1Z6TA 3L22A 3U4TA 5JHAA 5CRVA 4J8SA 4GTRA 4R7LA 5ARFA 5C1DA 4F1PA 4ANVA 4YDOA 2IY0C 3FTZA 3AJIA 4I2WA 4UQXA 2IF4A 4YDEA 2C2LA 3PNTB 2AXUA 4AOFA 3TXNA 2IJGX 4XIFA 3ASOE 4GU5A 4KXKB 1ELWA 3FUFA 2KATA 4I6GA 1FPPA 2LSVA 5M72A 4J8EA 5A7DB 3J5PA 5EKQD 3V79K 2P9UG 3EHNA 3L17A 2J09A 2RD0A 3TWUA 2FO1E 1N4RA 4HB5A 4ILIA 1BD8A 4WNDA 5CERB 1IYGA 1BPOA 4BERA 1OCZE 3L82A 3J5QB 2L6JA 3MX3A 3CGHA 2X6KA 2YINA 4RQIA 4JA9A 3CQGB 3ASFA 3I5PA 5CEDB 4GA1A 2CFUA 5FQ8A 4TUUA 3EDTB 1LD7A 2GW1A 2B6CA 2XEHA 3EHMA 3SD5A 4XKBA 2E0IA 2WXRA 2BTDA 2KCLA 4ZHBA 2ZISA 1Z3YA 4FHJA 2IO3C 2J4BA 1KT1A 3DBSA 3PE3A 2GRPB 4K5BA 2KXPC 4M3OA 3CHPA 1SA4A 2V0PA 3FTWA 4U07A 3Q73A 2GROB 4K5CA 5CHEE 5LFAA 3PREA 4URKA 2IO2C 3EIJA 4QFVA 3IKOB 2WXFA 3LVQE 2J49A 3SBTB 1MHQA 2RFMA 3B7RL 3MJWA 3ZKJA 4AXHA 3FWVA 4HXIA 4OYSA 2V8SE 4LSZE 3ZNGA 1EF1C 4ZFHA 3D9LA 4MS6A 3IHVA 3HDXA 3VLFA 4QQIA 3T5XA 3TG5A 3FEXA 4GMLA 4LEUA 3FUEA 3NB2A 2CG3A 4RLYA 5D0OD 5D0QD 3DSWA 4HQDA 1DNPA 5JJ6A 3ML8A 3JUEA 4J7WA 3SY2A 3RIBA 2LSUA 2Q7FA 4HVBA 4N5CA 1N95A 2XGSA 4LCTA 5J90A 1HX8A 2XRZA 3TWSA 3TWQA 5IY5E 5ENTD 4BTBA 4H7XA 2VGXA 3CVVA 2OV8A 1JPLA 1G3NB 5ITZF 1Y6IA 4OAVB 2YQ8A 3IEGA 4XEIG 3Q75A 1TR4A 5HQ8A 3FUIA 1N0QA 4EQFA 1ELKA 4WAFA 4FHKA 3TWWA 1H2TC 3L08A 5KNGA 2P9PG 2Y4TA 4UI9J 5ANLA 3TWTA 2JABA 3LS8A 3AG1E 5EILA 4I9EA 3QKYA 4N2QA 4C0EA 1DC2A 3B7BA 3BUAA 5ENQD 3TG4A 3OTNA 3UKRG 4GYOA 3FU6A 2J8SD 5FIOA 1X81A 4G1TA 4I6EA 3V31A 3FTYA 2XRYA 1JUQA 4CYMD 1PC2A 3Q5MA 4GA0A 2XS1A 1MX6A 3JQ1A 4DI4A 2KCVA 3DEOA 1N94A 4IULA 5FQ7A 3RJVA 4ATZD 3L9TA 1S70B 4C9BB 5LOZA 1HXIA 2L6BA 4BX8A 2YNQA 3HXCA 4LUNU 5FTPA 1ZU2A 2VYIA 5J08A 3CHMA 2M63A 1UN9A 2OEWA 4TXQA 4RVBA 2HO1A 3RO3A 4CGVA 2LUHA 2A4ZA 3SFZA 3R7QA 4GTSA 4BSXA 1JCSA 2HM8A 1N54A 4BX9A 3KSLA 3D9JA 3W9GA 1TNBA 3ZFWA 3R7RA 4J8DA 2AJAA 4EHMA 4F6RD 3Q15A 1E8XA 4KVMA 1KPSB 3Q9UC 3EU5A 5AIJA 4FADA 3AU5A 5BV0A 3AG3E 4G23A 4JL0A 3OAWA 1MJ0A 3D9MA 2ONDA 3CEQA 4J6IA 4EZJA 3N71A 3TWVA 2DYRE 4HLEA 5G55A 2P9LG 5AQ7A 1LD8A 3FTUA 3ULYA 4UQZA 4JXTA 3ASHA 2KCKA 5BPPA 2LAIA 3VTYA 4HOQA 4G26A 4C0MA 3AS5A 1RZ4A 4NIKA 1HH8A 5ENPD 5BUZA 4HRNA 2L0TB 3KD7A 3NBNB 1NZNA 5KNHD 1TN6A 1MX4A 4N39A 5FINA 1OY3D 3V30A 4UWFA 3ZHEB 3RK6A 3SFYA 4UWKA 2J08A 2Y4UA 2VSOE 4G8KA 4ILHB 1IHGA 3CR3A 3ZW3A 4FP7A 2WXQA 2WXMA 2X38A 1DCQA 1L5JA 1FVHA 3CHSA 3QWPA 5FZQA 4EZLA 4BT9A 1OWPA 1HZ4A 2MYOA 3LJ3A 4UI9K 4OVVA 3FU5A 2ETAA 3HYMB 1V54E 3KSQA 4A3VA 4AM9A 3S2AA 1TJCA 4DX1A 2BEDA 1ZB1A 3E34A 3ZYLA 2R2LA 4L9PA 1ELRA 3DSTA 3FTVA 4A1SA 1UG3A 5EYLA 3DSUA 4B8CB 4WNGA 3L16A 3P2BA 4LNUD 5AJLA 2AXVA 2B0OE 1TYQG 1H6KA 3CSTA 3NZSA 2PNNA 4BSZB 4GMJA 3QB2A 2VGEA 2XEVA 2I1KA 1NFIE 4JA7A 5KWDA 2VTBA 2DIWA 5EX0A 3CQCB 3DRAA 3PVLA 4DI3A 5KJKA 3ASDA 4PH4B 4U0UA 3DWLG 2H6IA 3PDNA 1UW4B 3C3QA 1OWMA 3ZYQA 4GPKA 2XCCA 3UUXA 5AQ9A 2DCPA 4MLPA 5JJ7A 3T8KA 3CVYA 5A6CA 5CRUA 3GZ2A 4RG6A 2XPZA 3GYZA 3CVNA 2UY1B 3FTXA 4J8YA 2WXKA 1TNZA 3D9NA 2JEKA 1E90A 3SI5A 4XI9A 3FUDA 3TJPA 3JQ0A 2WVIA 1D8EA 1OXJA 3KEZA 2LXLA 4B94A 4JEUA 2QZAA 3PZ2A 3ZU7B 2CHZA 2LXMA 4JC8A 3U64A 5KBAA 4DLOA 1Y8MA 2V5QC 2F8XK 3QWWA 4WNEA 1OUVA 4HBDA 3UIOC 4Q69A 4FA6A 5BT1A 5CMWA 1KT0A 1MQSA 4CCAA 1H6OA 1A17A 1O1SA 3E37A 4P29A 4CT4A 4IYPA 2KBXA 2R02A 2VSYA 4HORA 1N4QA 5G05J 1H6PA 1XNFA 4U0ZA 3PUKA 1QNFA 2X3MA 5FWQA 4I1MA 4HS2A 1WG0A 3L54A 1MYOA 4J0UA 1YA0A 1WAO1 2PM6A 2CG2A 5EDSA 4N5QA 4F1SA 3NZUA 2RFAA 3ASNE 3UQ3A 4EBAA 4DX5D 4JHKA 4L2YA 1N4SA 5JA4D 4A63B 3MZLB 1TEZA 3PZ3A 2WXHA 4U96D 5DIZA 3PUJA 3TWRA 2HE0A 3UT4A 2ZGGA 3E32A 3G2VA 3FTSA 4F3VA 3APCA 3RRMB 5HS0A 3DPYA 3D9KA 4NQ0A 3B13A 2XPYA 3FU0A 2F8YA 3FUHA 1D8DA 4BFRA 3CVUA 3S7FA 2H6GA 2CHWA 3IXEA 3Q7AA 3P1UA 2VSNA 5A23A 3I3NA 3UIPC 3HXBA 2KZTB 3CK8A 3K9IA 4FJZA 5HKPA 4I43A 2J9QA 3QNKA 2EIME 3HVEA 3G2TA 4K03A 2WMOA 5BXUA 3Q78A 2EIJE 3CVPA 1BU9A 3HXEA 2IOLA 1E7VA 3EUVA 4BESA 4CDRA 4ABNA 3ZYKA 3G2SA 1E8WA 3UM3A 3ASGA 4DX2A 5G04C 3O4ZA 2ZXWE 5AYWD 4XE0A 4W9RA 3DEPA 4ILGA 3I4GA 5HI7A 4DX7D 3PEUB 5JJTA 3DXMG 5ARGA 1SZ9A 3MV2B 2C0LA 4PDXA 3FHEA 3UPVA 3FH5A 4GTVA 1O1TA 3VLDA 4Q96A 3RRUA 2P9NG 3NF1A 2YHEA 1AWCB 4TXPA 3T9KA 2V4HC 3HIZA 4DJAA 3LYAA 3TXMA 2A5EA 3MV3B 3KAEA 2ZIRA 4HNAD 1TNYA 4GZ3A 4HRMB 5AQBA 2BUGA 2PQNA 3SGHA 1JWFA 1WDYA 3U9WA 1PY1A 3MEKA 4MBGA 3SZ7A 2I2OA 2WM9A 4WWPA 3AS8A 3QWVA 3IBEA 3ZXSA 2VSXE 4J8FA 4ACLA 3UINC 3C3OA 1NP7A 1W3BA 4B93B 2JLBA 1YYHA 3B7SA 3ZRHA 1H0AA 4E6HA 1HG5A 5FZSA 3FY4A 4KT6B 1S0PA 5KJNA 1HE8A 4UWLA 3DSSA 4GTPA 4G8LA 2IOSA 4ANUA 5C2YA 3FFLA 5EIDA 5T8IA 4YVQC 5EN5D 1YMPA 4IRUA 3UMVA 5BW8C 4WWNA 3U66A 4HLLA 2WXJA 4JB8P 5FT9A 2C0MA 3ZUVB 3ESLA 3QDNA 3B95A 2NC9A 1K1AA 2ETCA 3MA5A 1GW6A 3ESKA 3ZXPA 1NA3A 4TRQA 4CDNA 3TAXA 2XS8A 5LCWJ 3ZYMA 3L13A 3ML9A 3CHOA 2WB2A 3CK9A 2QYJA 5D66A 2I6HA 5AQAA 4AJWA 3APFA 4LRZA 1U3DA 3APDA 4V3IA 3FUJA 2XZDG 2FEZA 1IKND 2EILE 1QZ2A 2VGYA 2DBAA 3URZA 3G2WA 4LNBA 1O5MA 3ONKA 4Q94A 1SVXA 4X8QA 2NYJA 4PUCA 2ILRA 3AG2E 4HOUA 1TNUA 2KC7A 3UM1A 2FBNA 3LEWA 2ZGDA 2R03A 2WQ6A 3AG4E 1O1RA 3E30A 2L9BA 2QC9A 3UXGA 1DVPA 3WXXA 4UWHA 4AP2A 3CKBA 3EIQC 4APFA 3ZHEA 4G24A 4GAAA 3O48A 5CCLA 4FJYA 4YVOA 3QK0A 1U3CA 1TNOA 5BV1A 1MZCA 4K0RA 3VTXA 3JUIA 1OWOA 4L23A 2FI7A 3Q9NC 2LO6A 5HRYA 1FVFA 4A1GA 1QBQA 3V2OA 3BU8A 3T8MA 1Z3XA 3GZ1A 1JCRA 3SFXA 4WWOA 2IFUA 2LAHA 2X6JA 2XZTG 4TUMA 3MKQB 4DLQA 3D9HA 3AAAC 4NACA 3WG7E 4KZCA 4FC8A 1U2VG 5T4YA 4JHRA 4N3CA 1OCCE 2P2CP 4UI9C 1KZOA 1K3ZD 1HF8A 2X6FA 2CFZA 1PAQA 2XEEA 1FCHA 5E76A 5CEAA 3ENEA 4I9CA 3C98A 4ME2A 3UM0A 2A5UA 1BI8B 4B8AA 4LNGA 1S64A 4PS7A 3BQOA 4JW1A 5ENRD 4YNDA 1OWLA 1LF8A 3W9FA 1UOHA 2R59A 4ACKA 4G11A 3NOCD 2RKKA 1A5EA 1HFAA 4B89A 5H7PA 4CEMA 4WNFA 3QAQA 3CHQA 3QJZA 3PNLB 3CVXA 5ENNA 3OXLA 1E7UA 2UY1A 4KBQA 3IV0A 5G2NA 4CGWA 3AS4A 2QYUA 1VDYA 4TV3A 4JHJA 3NQPA 4N3BA 3BG0B 3OXFA 4C48B 5ENSD 2BKGA 1SZAA 3D9OA 2WQHA 5B1AE 4XX5A 2XENA 5BNWA 2WXOA 4GA2A 2V4LA 5JMND 4LG6A 3S7DA 2H6FA 3SQVA 3RU0A 1UJKA 5B3SE 4TXRA 3ZVVA 1INZA 3HXFA 4GTQA 3LCAA 4I2ZA 2X6HA 2NSZA 2P58C 1TN8A 5FQ6A 5FJYA 3RAUA 2GRMA 3TGOA 4GTMA 3C5RA 3FEYA 1E96B 3IHYA 5ANRA 4BWRA 5AJDA 3UT8A 2J4DA 4G2VA 5AAOA 4GZDA 4JEHA 3AU4A 4FU3A 4GTOA 3G2UA 4GZ5A 4AY5A 4DRXE 2XGMA 3D3MA 4GPMA 1WY6A 2OVFA 1MX2A 3RO2A 3B7UX 2Y69E 1YCSB 4BETA 3PZ1A 2ETBA 2PM7A 3CV0A 3C72A 4HI9A 4DK5A 3D9PA 1AP7A 4UWGA 2EIKE 4KZ0A 3GW4A 5AN8A 2DVWA 3ULQA 3FU3A 3Q47B 5JHBA 1N9AA 3LXUX 3BEEA 4RG9A 3B7TA 1SA5A 3ABME 3LPZA 3PH0C 2GGFA 1BI7B 4UUCA 4H7YA 3KS2A 1H2UA 2YHCA 3SF4A 2MHKA 3FUKA 3ZEFA 1OWNA 2IQCA 3LY9A 4CZ2D 4JVSA 1ZBPA 3PS6A 1NI1A 1OCOE 2KZTA 3MGBA 2QY7A 3SO8A 3D9IA 4FLHA 3HHMA 4ANXA 3UKUG 2HR2A 4O60A 3Q49B 4Y6WA 1E8ZA 3ONLA 3FUNA 4GTTA 1WM5A 5EX3A 2AVPA 3MCXA 4F7AA 1UN8A 3ISMC 3R9MA 2EINE 3HVEB 2P9KG 5DBKA 3ULEG 4I1OB 2X6IA 2PZIA 4EECA 4GZCA 3PZDA 2AXZA 2F37A 3RKVA 3RRNB 2WXLA 2IU1A 4XKCA 3OXGA 4K5AB 2GRRB 4JZYA 3CLJA 1E8YA 2Y3AA 1V55E 1EYHA 3CVWA 3FH8A 2FULA 3LY8A 1P5QA 2UWJG 2KM4A 2GRNB 2DWZA 3FP3A 3PZ4A 4AY6A 1TN7A 2IEJA 2DYSE 4GCNA 1JWGA 4CRWA 2V5FA 4CDMA 4U04A 3BG1B 5AENA 2WPVA 1LTXA 2EQXA 1QQEA 4HFGA 4GCOA 1UJJA 4U0SA 3LY7A 3S7JA 4BTAA 1HG2A 2WXPA 4CT0A 3ABKE 3V2XA 3JXIA 4PS3A 2VGXB 3MYVA 3CIAA 4AIFA 4WUYA 1JCQA 5ENOD 2WXNA 4ANWA
chains in the Genus database with same CATH topology
4GTRA 3SFYA 3HXCA 3DSVA 3HXFA 1SA4A 4GTQA 1N95A 2H6HA 3Q73A 4YDOA 1O1RA 3E30A 1TN8A 4LNGA 1S64A 4YDEA 4GTTA 4GTSA 4GTMA 1JCSA 3Q75A 3KSQA 4GTPA 3KSLA 1N4SA 1TNBA 4GTVA 1O1TA 1TNZA 3PZ3A 2BEDA 3E34A 2R2LA 1FPPA 1TNOA 4L9PA 3HXDA 4GTOA 1MZCA 4EHMA 1D8EA 3E32A 3DSTA 3E33A 1FT2A 3DSUA 1QBQA 3EU5A 1NL4A 2ZIRA 1TNYA 1DCEA 3DPYA 3PZ2A 1N4RA 3PZ1A 1JCRA 3C72A 1KZPA 3SFXA 3PZ4A 1D8DA 1TN7A 3Q7FA 2H6GA 2IEJA 1X81A 3Q7AA 1S63A 4MBGA 3HXBA 1LD8A 1LD7A 3DSXA 4LNBA 1N9AA 1O5MA 1LTXA 1O1SA 3DRAA 1SA5A 2ZISA 2F0YA 3E37A 3Q78A 3DSWA 1N4PA 3HXEA 2H6FA 3EUVA 1KZOA 1TN6A 1N94A 2H6IA 1FT1A 1N4QA 1JCQA 3Q79A 1NI1A 1TNUA 3DSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTR A;  3SFY A;  3HXC A;  3DSV A;  3HXF A;  1SA4 A;  4GTQ A;  1N95 A;  2H6H A;  3Q73 A;  4YDO A;  1O1R A;  3E30 A;  1TN8 A;  4LNG A;  1S64 A;  4YDE A;  4GTT A;  4GTS A;  4GTM A;  1JCS A;  3Q75 A;  3KSQ A;  4GTP A;  3KSL A;  1N4S A;  1TNB A;  4GTV A;  1O1T A;  1TNZ A;  3PZ3 A;  2BED A;  3E34 A;  2R2L A;  1FPP A;  1TNO A;  4L9P A;  3HXD A;  4GTO A;  1MZC A;  4EHM A;  1D8E A;  3E32 A;  3DST A;  3E33 A;  1FT2 A;  3DSU A;  1QBQ A;  3EU5 A;  1NL4 A;  2ZIR A;  1TNY A;  1DCE A;  3DPY A;  3PZ2 A;  1N4R A;  3PZ1 A;  1JCR A;  3C72 A;  1KZP A;  3SFX A;  3PZ4 A;  1D8D A;  1TN7 A;  3Q7F A;  2H6G A;  2IEJ A;  1X81 A;  3Q7A A;  1S63 A;  4MBG A;  3HXB A;  1LD8 A;  1LD7 A;  3DSX A;  4LNB A;  1N9A A;  1O5M A;  1LTX A;  1O1S A;  3DRA A;  1SA5 A;  2ZIS A;  2F0Y A;  3E37 A;  3Q78 A;  3DSW A;  1N4P A;  3HXE A;  2H6F A;  3EUV A;  1KZO A;  1TN6 A;  1N94 A;  2H6I A;  1FT1 A;  1N4Q A;  1JCQ A;  3Q79 A;  1NI1 A;  1TNU A;  3DSS A; 
#chains in the Genus database with same CATH topology
 2ZU6 B;  2R5S A;  1OCR E;  3U3W A;  4HRL A;  4O6F A;  3ZIM A;  1IQU A;  2CHX A;  3SBS A;  3EJN A;  1K1B A;  5CBN A;  5KJM A;  2E2E A;  4EBA G;  3R9A B;  4XI0 A;  3EU9 A;  3CVQ A;  3L6A A;  4U8V D;  4I17 A;  3UM2 A;  4DX6 D;  1SW6 A;  2P9I G;  3HXD A;  3PRZ A;  4MKT A;  3CK7 A;  5CMY A;  4F53 A;  4IN3 B;  1FT2 A;  2XGO A;  5G05 C;  4B0Z A;  5E75 A;  1NL4 A;  1DCE A;  5EYP F;  3E4B A;  1IXV A;  3CVL A;  2BKK B;  4BY6 A;  1X5B A;  3FDH A;  1N52 A;  3EHQ A;  1QYM A;  5LP0 A;  4N2S A;  3DSX A;  4KYO B;  1B89 A;  2Y1L E;  1HU3 A;  4L2L A;  3LJN A;  4FUL A;  4RSY A;  3I4R B;  3Q4A B;  4D10 C;  3VLE A;  1N4P A;  2FF4 A;  2PQR A;  3CHR A;  3NOG D;  5B1B E;  5D2M C;  3Q79 A;  4UQY A;  3HG0 D;  3DPD A;  1HS6 A;  4O1O A;  3F6Q A;  2PL2 A;  4GYW A;  5KCM A;  4I1A A;  4OAU C;  2MRI A;  2AWI A;  2RG8 A;  3DXK G;  1EPU A;  1K8K G;  4U95 D;  3PE4 A;  4E85 A;  4U7E B;  3JCK C;  4DUI A;  4U63 A;  3ZN3 A;  3EHR A;  5BXO A;  3JYS A;  2DZO A;  2WQ7 A;  3CKC A;  4KVO A;  4GMR A;  4GZ6 A;  2XPI A;  2FO7 A;  4MRU A;  2OCC E;  2Y0B G;  2MOW A;  4BT8 A;  2XQ0 A;  4DPR A;  1H2V C;  4APO A;  2ION A;  4EPZ A;  3S7B A;  1SQM A;  4BEP A;  2GRQ B;  3KEA A;  1Q2Z A;  2R05 A;  5AAR A;  3X2Q E;  4EZK A;  2I1J A;  4I6J A;  4YDW A;  3JXJ A;  3UT7 A;  3FH7 A;  4KMO A;  4PS8 A;  4A3T A;  3NAW A;  4AEZ C;  3QC1 A;  1IHB A;  2OVB A;  2WXI A;  4NRH B;  1D9S A;  3QAR A;  3ZGQ A;  1OT8 A;  2OEV A;  1FT1 A;  1NA0 A;  3MKQ A;  4Y6C A;  3ZPJ A;  4HI8 A;  3DSV A;  4A55 A;  4NUR A;  5EIB E;  4M7C A;  1TJF A;  2H6H A;  1IQR A;  4U8Y D;  1H19 A;  3FUL A;  1HO8 A;  3LDZ A;  5FQ4 A;  3UI2 A;  2XHE A;  4LER A;  2VJ8 A;  4L7T A;  3UX4 A;  5LX8 A;  4O1P A;  3ABL E;  2HYZ A;  2VQ2 A;  2WMN A;  3LKU A;  1EDU A;  4XZ4 A;  5CCM A;  5T3R A;  3HRA A;  2LNI A;  3QOU A;  1Z5S C;  2L0I A;  4U8H A;  2P9S G;  3E33 A;  3CSF A;  2XCB A;  1RW2 A;  2AW6 A;  4L1B A;  2VTB B;  5G04 J;  3SHF A;  3GZS A;  2WXG A;  2GRL A;  3UTM A;  4HOT A;  4ATG A;  1KZP A;  2J07 A;  5FZR A;  3LVR E;  3Q7F A;  3RSE G;  4AVX A;  1BLX B;  1S63 A;  3TWX A;  1N0R A;  2OOE A;  2QFC A;  5CEC B;  2I9C A;  4N3A A;  1XGW A;  3MKR A;  3PEV B;  1KLX A;  4HOS A;  4YDY A;  4GB9 A;  1N11 A;  4G25 A;  5KJL A;  3T5V A;  2F0Y A;  4Z68 A;  3TL5 A;  2DZN A;  3SNX A;  4FLB A;  2NXP A;  5CBO A;  3FUM A;  4GYY A;  4OVU A;  4JD2 G;  2BF0 X;  3C3R A;  4AV7 A;  4JPS A;  2R17 C;  5LCW C;  1Z6T A;  3L22 A;  3U4T A;  5JHA A;  5CRV A;  4J8S A;  4GTR A;  4R7L A;  5ARF A;  5C1D A;  4F1P A;  4ANV A;  4YDO A;  2IY0 C;  3FTZ A;  3AJI A;  4I2W A;  4UQX A;  2IF4 A;  4YDE A;  2C2L A;  3PNT B;  2AXU A;  4AOF A;  3TXN A;  2IJG X;  4XIF A;  3ASO E;  4GU5 A;  4KXK B;  1ELW A;  3FUF A;  2KAT A;  4I6G A;  1FPP A;  2LSV A;  5M72 A;  4J8E A;  5A7D B;  3J5P A;  5EKQ D;  3V79 K;  2P9U G;  3EHN A;  3L17 A;  2J09 A;  2RD0 A;  3TWU A;  2FO1 E;  1N4R A;  4HB5 A;  4ILI A;  1BD8 A;  4WND A;  5CER B;  1IYG A;  1BPO A;  4BER A;  1OCZ E;  3L82 A;  3J5Q B;  2L6J A;  3MX3 A;  3CGH A;  2X6K A;  2YIN A;  4RQI A;  4JA9 A;  3CQG B;  3ASF A;  3I5P A;  5CED B;  4GA1 A;  2CFU A;  5FQ8 A;  4TUU A;  3EDT B;  1LD7 A;  2GW1 A;  2B6C A;  2XEH A;  3EHM A;  3SD5 A;  4XKB A;  2E0I A;  2WXR A;  2BTD A;  2KCL A;  4ZHB A;  2ZIS A;  1Z3Y A;  4FHJ A;  2IO3 C;  2J4B A;  1KT1 A;  3DBS A;  3PE3 A;  2GRP B;  4K5B A;  2KXP C;  4M3O A;  3CHP A;  1SA4 A;  2V0P A;  3FTW A;  4U07 A;  3Q73 A;  2GRO B;  4K5C A;  5CHE E;  5LFA A;  3PRE A;  4URK A;  2IO2 C;  3EIJ A;  4QFV A;  3IKO B;  2WXF A;  3LVQ E;  2J49 A;  3SBT B;  1MHQ A;  2RFM A;  3B7R L;  3MJW A;  3ZKJ A;  4AXH A;  3FWV A;  4HXI A;  4OYS A;  2V8S E;  4LSZ E;  3ZNG A;  1EF1 C;  4ZFH A;  3D9L A;  4MS6 A;  3IHV A;  3HDX A;  3VLF A;  4QQI A;  3T5X A;  3TG5 A;  3FEX A;  4GML A;  4LEU A;  3FUE A;  3NB2 A;  2CG3 A;  4RLY A;  5D0O D;  5D0Q D;  3DSW A;  4HQD A;  1DNP A;  5JJ6 A;  3ML8 A;  3JUE A;  4J7W A;  3SY2 A;  3RIB A;  2LSU A;  2Q7F A;  4HVB A;  4N5C A;  1N95 A;  2XGS A;  4LCT A;  5J90 A;  1HX8 A;  2XRZ A;  3TWS A;  3TWQ A;  5IY5 E;  5ENT D;  4BTB A;  4H7X A;  2VGX A;  3CVV A;  2OV8 A;  1JPL A;  1G3N B;  5ITZ F;  1Y6I A;  4OAV B;  2YQ8 A;  3IEG A;  4XEI G;  3Q75 A;  1TR4 A;  5HQ8 A;  3FUI A;  1N0Q A;  4EQF A;  1ELK A;  4WAF A;  4FHK A;  3TWW A;  1H2T C;  3L08 A;  5KNG A;  2P9P G;  2Y4T A;  4UI9 J;  5ANL A;  3TWT A;  2JAB A;  3LS8 A;  3AG1 E;  5EIL A;  4I9E A;  3QKY A;  4N2Q A;  4C0E A;  1DC2 A;  3B7B A;  3BUA A;  5ENQ D;  3TG4 A;  3OTN A;  3UKR G;  4GYO A;  3FU6 A;  2J8S D;  5FIO A;  1X81 A;  4G1T A;  4I6E A;  3V31 A;  3FTY A;  2XRY A;  1JUQ A;  4CYM D;  1PC2 A;  3Q5M A;  4GA0 A;  2XS1 A;  1MX6 A;  3JQ1 A;  4DI4 A;  2KCV A;  3DEO A;  1N94 A;  4IUL A;  5FQ7 A;  3RJV A;  4ATZ D;  3L9T A;  1S70 B;  4C9B B;  5LOZ A;  1HXI A;  2L6B A;  4BX8 A;  2YNQ A;  3HXC A;  4LUN U;  5FTP A;  1ZU2 A;  2VYI A;  5J08 A;  3CHM A;  2M63 A;  1UN9 A;  2OEW A;  4TXQ A;  4RVB A;  2HO1 A;  3RO3 A;  4CGV A;  2LUH A;  2A4Z A;  3SFZ A;  3R7Q A;  4GTS A;  4BSX A;  1JCS A;  2HM8 A;  1N54 A;  4BX9 A;  3KSL A;  3D9J A;  3W9G A;  1TNB A;  3ZFW A;  3R7R A;  4J8D A;  2AJA A;  4EHM A;  4F6R D;  3Q15 A;  1E8X A;  4KVM A;  1KPS B;  3Q9U C;  3EU5 A;  5AIJ A;  4FAD A;  3AU5 A;  5BV0 A;  3AG3 E;  4G23 A;  4JL0 A;  3OAW A;  1MJ0 A;  3D9M A;  2OND A;  3CEQ A;  4J6I A;  4EZJ A;  3N71 A;  3TWV A;  2DYR E;  4HLE A;  5G55 A;  2P9L G;  5AQ7 A;  1LD8 A;  3FTU A;  3ULY A;  4UQZ A;  4JXT A;  3ASH A;  2KCK A;  5BPP A;  2LAI A;  3VTY A;  4HOQ A;  4G26 A;  4C0M A;  3AS5 A;  1RZ4 A;  4NIK A;  1HH8 A;  5ENP D;  5BUZ A;  4HRN A;  2L0T B;  3KD7 A;  3NBN B;  1NZN A;  5KNH D;  1TN6 A;  1MX4 A;  4N39 A;  5FIN A;  1OY3 D;  3V30 A;  4UWF A;  3ZHE B;  3RK6 A;  3SFY A;  4UWK A;  2J08 A;  2Y4U A;  2VSO E;  4G8K A;  4ILH B;  1IHG A;  3CR3 A;  3ZW3 A;  4FP7 A;  2WXQ A;  2WXM A;  2X38 A;  1DCQ A;  1L5J A;  1FVH A;  3CHS A;  3QWP A;  5FZQ A;  4EZL A;  4BT9 A;  1OWP A;  1HZ4 A;  2MYO A;  3LJ3 A;  4UI9 K;  4OVV A;  3FU5 A;  2ETA A;  3HYM B;  1V54 E;  3KSQ A;  4A3V A;  4AM9 A;  3S2A A;  1TJC A;  4DX1 A;  2BED A;  1ZB1 A;  3E34 A;  3ZYL A;  2R2L A;  4L9P A;  1ELR A;  3DST A;  3FTV A;  4A1S A;  1UG3 A;  5EYL A;  3DSU A;  4B8C B;  4WNG A;  3L16 A;  3P2B A;  4LNU D;  5AJL A;  2AXV A;  2B0O E;  1TYQ G;  1H6K A;  3CST A;  3NZS A;  2PNN A;  4BSZ B;  4GMJ A;  3QB2 A;  2VGE A;  2XEV A;  2I1K A;  1NFI E;  4JA7 A;  5KWD A;  2VTB A;  2DIW A;  5EX0 A;  3CQC B;  3DRA A;  3PVL A;  4DI3 A;  5KJK A;  3ASD A;  4PH4 B;  4U0U A;  3DWL G;  2H6I A;  3PDN A;  1UW4 B;  3C3Q A;  1OWM A;  3ZYQ A;  4GPK A;  2XCC A;  3UUX A;  5AQ9 A;  2DCP A;  4MLP A;  5JJ7 A;  3T8K A;  3CVY A;  5A6C A;  5CRU A;  3GZ2 A;  4RG6 A;  2XPZ A;  3GYZ A;  3CVN A;  2UY1 B;  3FTX A;  4J8Y A;  2WXK A;  1TNZ A;  3D9N A;  2JEK A;  1E90 A;  3SI5 A;  4XI9 A;  3FUD A;  3TJP A;  3JQ0 A;  2WVI A;  1D8E A;  1OXJ A;  3KEZ A;  2LXL A;  4B94 A;  4JEU A;  2QZA A;  3PZ2 A;  3ZU7 B;  2CHZ A;  2LXM A;  4JC8 A;  3U64 A;  5KBA A;  4DLO A;  1Y8M A;  2V5Q C;  2F8X K;  3QWW A;  4WNE A;  1OUV A;  4HBD A;  3UIO C;  4Q69 A;  4FA6 A;  5BT1 A;  5CMW A;  1KT0 A;  1MQS A;  4CCA A;  1H6O A;  1A17 A;  1O1S A;  3E37 A;  4P29 A;  4CT4 A;  4IYP A;  2KBX A;  2R02 A;  2VSY A;  4HOR A;  1N4Q A;  5G05 J;  1H6P A;  1XNF A;  4U0Z A;  3PUK A;  1QNF A;  2X3M A;  5FWQ A;  4I1M A;  4HS2 A;  1WG0 A;  3L54 A;  1MYO A;  4J0U A;  1YA0 A;  1WAO 1;  2PM6 A;  2CG2 A;  5EDS A;  4N5Q A;  4F1S A;  3NZU A;  2RFA A;  3ASN E;  3UQ3 A;  4EBA A;  4DX5 D;  4JHK A;  4L2Y A;  1N4S A;  5JA4 D;  4A63 B;  3MZL B;  1TEZ A;  3PZ3 A;  2WXH A;  4U96 D;  5DIZ A;  3PUJ A;  3TWR A;  2HE0 A;  3UT4 A;  2ZGG A;  3E32 A;  3G2V A;  3FTS A;  4F3V A;  3APC A;  3RRM B;  5HS0 A;  3DPY A;  3D9K A;  4NQ0 A;  3B13 A;  2XPY A;  3FU0 A;  2F8Y A;  3FUH A;  1D8D A;  4BFR A;  3CVU A;  3S7F A;  2H6G A;  2CHW A;  3IXE A;  3Q7A A;  3P1U A;  2VSN A;  5A23 A;  3I3N A;  3UIP C;  3HXB A;  2KZT B;  3CK8 A;  3K9I A;  4FJZ A;  5HKP A;  4I43 A;  2J9Q A;  3QNK A;  2EIM E;  3HVE A;  3G2T A;  4K03 A;  2WMO A;  5BXU A;  3Q78 A;  2EIJ E;  3CVP A;  1BU9 A;  3HXE A;  2IOL A;  1E7V A;  3EUV A;  4BES A;  4CDR A;  4ABN A;  3ZYK A;  3G2S A;  1E8W A;  3UM3 A;  3ASG A;  4DX2 A;  5G04 C;  3O4Z A;  2ZXW E;  5AYW D;  4XE0 A;  4W9R A;  3DEP A;  4ILG A;  3I4G A;  5HI7 A;  4DX7 D;  3PEU B;  5JJT A;  3DXM G;  5ARG A;  1SZ9 A;  3MV2 B;  2C0L A;  4PDX A;  3FHE A;  3UPV A;  3FH5 A;  4GTV A;  1O1T A;  3VLD A;  4Q96 A;  3RRU A;  2P9N G;  3NF1 A;  2YHE A;  1AWC B;  4TXP A;  3T9K A;  2V4H C;  3HIZ A;  4DJA A;  3LYA A;  3TXM A;  2A5E A;  3MV3 B;  3KAE A;  2ZIR A;  4HNA D;  1TNY A;  4GZ3 A;  4HRM B;  5AQB A;  2BUG A;  2PQN A;  3SGH A;  1JWF A;  1WDY A;  3U9W A;  1PY1 A;  3MEK A;  4MBG A;  3SZ7 A;  2I2O A;  2WM9 A;  4WWP A;  3AS8 A;  3QWV A;  3IBE A;  3ZXS A;  2VSX E;  4J8F A;  4ACL A;  3UIN C;  3C3O A;  1NP7 A;  1W3B A;  4B93 B;  2JLB A;  1YYH A;  3B7S A;  3ZRH A;  1H0A A;  4E6H A;  1HG5 A;  5FZS A;  3FY4 A;  4KT6 B;  1S0P A;  5KJN A;  1HE8 A;  4UWL A;  3DSS A;  4GTP A;  4G8L A;  2IOS A;  4ANU A;  5C2Y A;  3FFL A;  5EID A;  5T8I A;  4YVQ C;  5EN5 D;  1YMP A;  4IRU A;  3UMV A;  5BW8 C;  4WWN A;  3U66 A;  4HLL A;  2WXJ A;  4JB8 P;  5FT9 A;  2C0M A;  3ZUV B;  3ESL A;  3QDN A;  3B95 A;  2NC9 A;  1K1A A;  2ETC A;  3MA5 A;  1GW6 A;  3ESK A;  3ZXP A;  1NA3 A;  4TRQ A;  4CDN A;  3TAX A;  2XS8 A;  5LCW J;  3ZYM A;  3L13 A;  3ML9 A;  3CHO A;  2WB2 A;  3CK9 A;  2QYJ A;  5D66 A;  2I6H A;  5AQA A;  4AJW A;  3APF A;  4LRZ A;  1U3D A;  3APD A;  4V3I A;  3FUJ A;  2XZD G;  2FEZ A;  1IKN D;  2EIL E;  1QZ2 A;  2VGY A;  2DBA A;  3URZ A;  3G2W A;  4LNB A;  1O5M A;  3ONK A;  4Q94 A;  1SVX A;  4X8Q A;  2NYJ A;  4PUC A;  2ILR A;  3AG2 E;  4HOU A;  1TNU A;  2KC7 A;  3UM1 A;  2FBN A;  3LEW A;  2ZGD A;  2R03 A;  2WQ6 A;  3AG4 E;  1O1R A;  3E30 A;  2L9B A;  2QC9 A;  3UXG A;  1DVP A;  3WXX A;  4UWH A;  4AP2 A;  3CKB A;  3EIQ C;  4APF A;  3ZHE A;  4G24 A;  4GAA A;  3O48 A;  5CCL A;  4FJY A;  4YVO A;  3QK0 A;  1U3C A;  1TNO A;  5BV1 A;  1MZC A;  4K0R A;  3VTX A;  3JUI A;  1OWO A;  4L23 A;  2FI7 A;  3Q9N C;  2LO6 A;  5HRY A;  1FVF A;  4A1G A;  1QBQ A;  3V2O A;  3BU8 A;  3T8M A;  1Z3X A;  3GZ1 A;  1JCR A;  3SFX A;  4WWO A;  2IFU A;  2LAH A;  2X6J A;  2XZT G;  4TUM A;  3MKQ B;  4DLQ A;  3D9H A;  3AAA C;  4NAC A;  3WG7 E;  4KZC A;  4FC8 A;  1U2V G;  5T4Y A;  4JHR A;  4N3C A;  1OCC E;  2P2C P;  4UI9 C;  1KZO A;  1K3Z D;  1HF8 A;  2X6F A;  2CFZ A;  1PAQ A;  2XEE A;  1FCH A;  5E76 A;  5CEA A;  3ENE A;  4I9C A;  3C98 A;  4ME2 A;  3UM0 A;  2A5U A;  1BI8 B;  4B8A A;  4LNG A;  1S64 A;  4PS7 A;  3BQO A;  4JW1 A;  5ENR D;  4YND A;  1OWL A;  1LF8 A;  3W9F A;  1UOH A;  2R59 A;  4ACK A;  4G11 A;  3NOC D;  2RKK A;  1A5E A;  1HFA A;  4B89 A;  5H7P A;  4CEM A;  4WNF A;  3QAQ A;  3CHQ A;  3QJZ A;  3PNL B;  3CVX A;  5ENN A;  3OXL A;  1E7U A;  2UY1 A;  4KBQ A;  3IV0 A;  5G2N A;  4CGW A;  3AS4 A;  2QYU A;  1VDY A;  4TV3 A;  4JHJ A;  3NQP A;  4N3B A;  3BG0 B;  3OXF A;  4C48 B;  5ENS D;  2BKG A;  1SZA A;  3D9O A;  2WQH A;  5B1A E;  4XX5 A;  2XEN A;  5BNW A;  2WXO A;  4GA2 A;  2V4L A;  5JMN D;  4LG6 A;  3S7D A;  2H6F A;  3SQV A;  3RU0 A;  1UJK A;  5B3S E;  4TXR A;  3ZVV A;  1INZ A;  3HXF A;  4GTQ A;  3LCA A;  4I2Z A;  2X6H A;  2NSZ A;  2P58 C;  1TN8 A;  5FQ6 A;  5FJY A;  3RAU A;  2GRM A;  3TGO A;  4GTM A;  3C5R A;  3FEY A;  1E96 B;  3IHY A;  5ANR A;  4BWR A;  5AJD A;  3UT8 A;  2J4D A;  4G2V A;  5AAO A;  4GZD A;  4JEH A;  3AU4 A;  4FU3 A;  4GTO A;  3G2U A;  4GZ5 A;  4AY5 A;  4DRX E;  2XGM A;  3D3M A;  4GPM A;  1WY6 A;  2OVF A;  1MX2 A;  3RO2 A;  3B7U X;  2Y69 E;  1YCS B;  4BET A;  3PZ1 A;  2ETB A;  2PM7 A;  3CV0 A;  3C72 A;  4HI9 A;  4DK5 A;  3D9P A;  1AP7 A;  4UWG A;  2EIK E;  4KZ0 A;  3GW4 A;  5AN8 A;  2DVW A;  3ULQ A;  3FU3 A;  3Q47 B;  5JHB A;  1N9A A;  3LXU X;  3BEE A;  4RG9 A;  3B7T A;  1SA5 A;  3ABM E;  3LPZ A;  3PH0 C;  2GGF A;  1BI7 B;  4UUC A;  4H7Y A;  3KS2 A;  1H2U A;  2YHC A;  3SF4 A;  2MHK A;  3FUK A;  3ZEF A;  1OWN A;  2IQC A;  3LY9 A;  4CZ2 D;  4JVS A;  1ZBP A;  3PS6 A;  1NI1 A;  1OCO E;  2KZT A;  3MGB A;  2QY7 A;  3SO8 A;  3D9I A;  4FLH A;  3HHM A;  4ANX A;  3UKU G;  2HR2 A;  4O60 A;  3Q49 B;  4Y6W A;  1E8Z A;  3ONL A;  3FUN A;  4GTT A;  1WM5 A;  5EX3 A;  2AVP A;  3MCX A;  4F7A A;  1UN8 A;  3ISM C;  3R9M A;  2EIN E;  3HVE B;  2P9K G;  5DBK A;  3ULE G;  4I1O B;  2X6I A;  2PZI A;  4EEC A;  4GZC A;  3PZD A;  2AXZ A;  2F37 A;  3RKV A;  3RRN B;  2WXL A;  2IU1 A;  4XKC A;  3OXG A;  4K5A B;  2GRR B;  4JZY A;  3CLJ A;  1E8Y A;  2Y3A A;  1V55 E;  1EYH A;  3CVW A;  3FH8 A;  2FUL A;  3LY8 A;  1P5Q A;  2UWJ G;  2KM4 A;  2GRN B;  2DWZ A;  3FP3 A;  3PZ4 A;  4AY6 A;  1TN7 A;  2IEJ A;  2DYS E;  4GCN A;  1JWG A;  4CRW A;  2V5F A;  4CDM A;  4U04 A;  3BG1 B;  5AEN A;  2WPV A;  1LTX A;  2EQX A;  1QQE A;  4HFG A;  4GCO A;  1UJJ A;  4U0S A;  3LY7 A;  3S7J A;  4BTA A;  1HG2 A;  2WXP A;  4CT0 A;  3ABK E;  3V2X A;  3JXI A;  4PS3 A;  2VGX B;  3MYV A;  3CIA A;  4AIF A;  4WUY A;  1JCQ A;  5ENO D;  2WXN A;  4ANW A; 
#chains in the Genus database with same CATH homology
 4GTR A;  3SFY A;  3HXC A;  3DSV A;  3HXF A;  1SA4 A;  4GTQ A;  1N95 A;  2H6H A;  3Q73 A;  4YDO A;  1O1R A;  3E30 A;  1TN8 A;  4LNG A;  1S64 A;  4YDE A;  4GTT A;  4GTS A;  4GTM A;  1JCS A;  3Q75 A;  3KSQ A;  4GTP A;  3KSL A;  1N4S A;  1TNB A;  4GTV A;  1O1T A;  1TNZ A;  3PZ3 A;  2BED A;  3E34 A;  2R2L A;  1FPP A;  1TNO A;  4L9P A;  3HXD A;  4GTO A;  1MZC A;  4EHM A;  1D8E A;  3E32 A;  3DST A;  3E33 A;  1FT2 A;  3DSU A;  1QBQ A;  3EU5 A;  1NL4 A;  2ZIR A;  1TNY A;  1DCE A;  3DPY A;  3PZ2 A;  1N4R A;  3PZ1 A;  1JCR A;  3C72 A;  1KZP A;  3SFX A;  3PZ4 A;  1D8D A;  1TN7 A;  3Q7F A;  2H6G A;  2IEJ A;  1X81 A;  3Q7A A;  1S63 A;  4MBG A;  3HXB A;  1LD8 A;  1LD7 A;  3DSX A;  4LNB A;  1N9A A;  1O5M A;  1LTX A;  1O1S A;  3DRA A;  1SA5 A;  2ZIS A;  2F0Y A;  3E37 A;  3Q78 A;  3DSW A;  1N4P A;  3HXE A;  2H6F A;  3EUV A;  1KZO A;  1TN6 A;  1N94 A;  2H6I A;  1FT1 A;  1N4Q A;  1JCQ A;  3Q79 A;  1NI1 A;  1TNU A;  3DSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...