1O1RA

Structure of fpt bound to ggpp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Biochemical and Structural Studies with Prenyl Diphosphate Analogues Provide Insights into Isoprenoid Recognition by Protein Farnesyl Transferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 123
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o1rA00
3DSUA 4GTRA 3SFXA 3Q73A 1KZOA 1DCEA 3Q79A 4LNBA 1NI1A 1FT1A 1O1SA 1N4PA 3DSTA 3PZ4A 3E30A 3DSWA 1QBQA 1LTXA 1O1RA 3Q7AA 1LD8A 3DSXA 3DPYA 3Q78A 3EUVA 3Q75A 1N4QA 3E37A 1TNUA 1KZPA 2R2LA 1SA5A 4GTSA 4LNGA 3SFYA 4MBGA 1TN7A 1O5MA 1SA4A 3HXFA 4GTMA 3KSLA 1N9AA 3PZ1A 1LD7A 3C72A 4GTQA 1TNOA 2H6GA 1N95A 4YDOA 4YDEA 1FPPA 1S63A 1S64A 3DRAA 1TNYA 3DSSA 4GTOA 2H6HA 2H6FA 3Q7FA 2F0YA 3PZ3A 1N4SA 1O1TA 1NL4A 3DSVA 4EHMA 3HXEA 4GTVA 1MZCA 1JCSA 1TN6A 2ZIRA 3HXBA 1X81A 1JCQA 2BEDA 2IEJA 1TN8A 3KSQA 3E32A 3EU5A 1D8EA 1JCRA 3PZ2A 1D8DA 1TNZA 1N4RA 4GTPA 3HXCA 2H6IA 3HXDA 3E33A 4GTTA 1TNBA 1N94A 2ZISA 3E34A 4L9PA 1FT2A
chains in the Genus database with same CATH superfamily
1WAO1 2WXQA 2YQ8A 3G2WA 3NOCD 1D9SA 4AIFA 3Q4AB 1UG3A 1BU9A 1SZAA 1GW6A 1O1RA 2XS1A 5KCMA 4XX5A 1JPLA 2KC7A 3EUVA 3CVNA 3SI5A 1SA5A 4GTSA 4JL0A 4ANUA 5CBNA 2X38A 2V5QC 3CV0A 1IHGA 3UIOC 4BTBA 1JWGA 1ZBPA 3IV0A 1Y8MA 1INZA 3MJWA 2J08A 1H6OA 4FC8A 3FTXA 1SW6A 2MRIA 3CVPA 4YDEA 2WPVA 4U7EB 2WXFA 4I6GA 3UUXA 4I9CA 3OXFA 3TWUA 3FUDA 3URZA 5AAOA 4JW1A 3FH7A 2WXNA 5KBAA 4WNDA 3UX4A 3CHSA 3JUEA 3LY8A 1N54A 4CGWA 2X6JA 3NBNB 4KZCA 3ZXPA 1JCQA 5T8IA 3ONKA 4HLLA 5B3SE 3SZ7A 2GRQB 3ZKJA 3KSQA 1BI8B 3AJIA 1HE8A 2B6CA 1E8XA 4I9EA 4M3OA 2LAIA 2BUGA 1E8YA 3UXGA 5AQ7A 2NSZA 1MHQA 3OXGA 2MOWA 4JZYA 5ENTD 3V2OA 5T3RA 3C3OA 4R7LA 5ENSD 4JHKA 1NI1A 5JJTA 2AVPA 3PREA 5AJDA 5FQ8A 2VGXB 3RU0A 3GZ2A 4DX7D 1LD8A 2OVBA 4PUCA 3Q75A 4K5BA 3B13A 3PS6A 2PNNA 3I5PA 3UINC 1IXVA 3QWPA 4APOA 3ABME 4BETA 1TJCA 3T9KA 1V55E 1EDUA 2RKKA 1ZB1A 3CIAA 3RSEG 1UW4B 4EPZA 3AG2E 2RD0A 4YDWA 4O60A 2XHEA 2XPYA 3LYAA 4F6RD 3CK9A 4DX1A 4AM9A 3ZEFA 4XKCA 3NB2A 4FLHA 5BNWA 5AENA 1OWLA 2LSVA 5BUZA 3UKUG 2P9PG 4FHJA 1P5QA 4FA6A 5C1DA 5KNHD 5FZSA 2WXRA 2OV8A 4BT9A 2FULA 5JHBA 3DSWA 2P9UG 5JA4D 1LTXA 3UM3A 1U3DA 4GB9A 2Y69E 5D66A 2YHEA 3JYSA 2R2LA 4XEIG 1ELRA 1QZ2A 3ASGA 3LVRE 4XI0A 3CHQA 3QDNA 2WXOA 3CVVA 2V8SE 3EJNA 3CLJA 5A23A 1LD7A 1A17A 4ZHBA 3SY2A 5D0OD 1S63A 5BW8C 3DRAA 4JVSA 4C0EA 3PVLA 4BFRA 3TL5A 2OVFA 3HG0D 2XGMA 2KCKA 2A5UA 1PC2A 3P2BA 4U8HA 3V2XA 3HYMB 4GAAA 5JHAA 4RSYA 4B0ZA 5G05J 5BV0A 4KBQA 2DZOA 2IOSA 2GRLA 5ENOD 4UUCA 4RLYA 1D8EA 1IQRA 3DWLG 2QYJA 1BI7B 4JA7A 4F53A 3MCXA 2VSOE 5C2YA 4D10C 2IO2C 1H2VC 3D9MA 3PZ4A 4HRLA 4HRMB 4WUYA 2HR2A 5M72A 3DSXA 3QNKA 3FU6A 4PS8A 3AG4E 5FIOA 3FDHA 1HG2A 1KZPA 3EHQA 3PRZA 4RG9A 3FHEA 2AXVA 4I1AA 5AIJA 1TN7A 4HRNA 4W9RA 3FEYA 3HXFA 3SHFA 3ABLE 4CT4A 1SZ9A 2M63A 3NAWA 3RO2A 4J8SA 3CK8A 4GTQA 2ETBA 3CR3A 4GZDA 2J4BA 1S70B 3ZPJA 4MKTA 4BSZB 3UT7A 2WXJA 3EHRA 2WXPA 4ANWA 4OAVB 2GRNB 2L0TB 1L5JA 1EYHA 3RIBA 1N52A 2A5EA 4TXPA 3Q47B 3ML8A 4A55A 4N2SA 2WM9A 5FT9A 2IEJA 4I6JA 4DLOA 1TN8A 3W9FA 2XPZA 1YYHA 3CQGB 3D3MA 1BPOA 3LXUX 2XENA 4HNAD 4UWKA 2KATA 3RAUA 1ZU2A 3FUJA 4A1GA 2LSUA 4BERA 2GROB 1E8ZA 4HOUA 2C0MA 4J8DA 5FZQA 4LRZA 4L7TA 5EYLA 2X6KA 3ZHEB 4HOSA 1K1BA 3TJPA 2DYSE 3Q7AA 3DPYA 2WQ7A 3CVLA 2VTBA 1FCHA 4BX9A 5CERB 3APCA 4QFVA 3ZFWA 4ACLA 5ARFA 3PNTB 3LKUA 2ZU6B 1MX2A 2VJ8A 3GZSA 3T5XA 4XKBA 5CRVA 1HG5A 3PH0C 5LCWC 2I1JA 3V79K 4ANVA 2X6FA 3C5RA 3KSLA 4TV3A 2X6HA 3SBSA 5A7DB 2L0IA 1DVPA 3RJVA 5HS0A 4GYYA 1TR4A 2OEWA 3FUFA 3FP3A 4KXKB 4GZ5A 1OCRE 3G2SA 1PAQA 1Z6TA 4O6FA 5KJKA 3DBSA 3J5QB 4G8LA 1K1AA 3UM2A 2BF0X 2UY1A 4E6HA 2CFUA 1DCQA 4FHKA 4GA2A 5FQ6A 2J4DA 3FUNA 2IF4A 4EBAG 3FH8A 4FADA 2LNIA 3L82A 4GZCA 2PL2A 5LX8A 1SVXA 2XEVA 5D0QD 5LP0A 3E33A 3B7UX 4G2VA 4LG6A 3DXMG 1G3NB 4L9PA 1FT2A 3O48A 4A1SA 4GA1A 2PM6A 3VLDA 2FI7A 1DCEA 4C48B 2HYZA 3UPVA 2KCLA 3E30A 4G8KA 2XS8A 5E76A 4AOFA 4LERA 4EQFA 4HXIA 3RO3A 1H19A 2WB2A 4HOQA 3V31A 4HOTA 2KBXA 4LNGA 3HDXA 3PDNA 4AEZC 4A3VA 3FUMA 2EQXA 4O1OA 5ENQD 1EF1C 3RKVA 3FH5A 1KT0A 3VLFA 3B7SA 1OCCE 1MQSA 1N95A 1ELWA 1S0PA 4TRQA 5KWDA 3AG3E 2R17C 2H6FA 4Y6WA 3DEPA 5CEDB 4GPMA 4DLQA 1N4SA 1YA0A 1NL4A 4UI9C 2GW1A 4L23A 3HHMA 3QOUA 2LXMA 3ZYLA 3QWWA 4ILIA 4DX6D 2A4ZA 4Z68A 2J09A 4UQXA 1NZNA 2V5FA 1UJJA 3TWVA 2ZXWE 4M7CA 1LF8A 1XNFA 1H0AA 1IHBA 1N94A 3IHYA 3S7FA 3JXIA 3AS8A 1E7UA 3UT4A 1FT1A 2YNQA 4HI8A 4AVXA 4WWPA 2JLBA 2EIME 2L6BA 3APDA 1QBQA 4IULA 1Z3YA 3UM0A 2FF4A 5BXOA 3W9GA 3JXJA 3FULA 4KYOB 5BV1A 3FUHA 3ULYA 4OAUC 2E0IA 4GPKA 5LOZA 1NA3A 3UTMA 1X5BA 1MX4A 4GTMA 2I2OA 4WNFA 2AXZA 5AQ9A 2GRMA 4BEPA 3ZU7B 4L2YA 5CMYA 4NURA 1TNYA 2LUHA 1WM5A 4J0UA 5IY5E 3GZ1A 3OTNA 4U95D 2H6HA 3PUKA 4AJWA 3CKCA 1QQEA 4RVBA 4GMJA 4H7YA 1RW2A 3Q49B 3LEWA 2CG2A 3J5PA 2CG3A 3ESLA 5B1BE 4I2WA 4CT0A 3ZVVA 3SNXA 3HXEA 3CSFA 3R9MA 4LNUD 1KLXA 3ZNGA 2Q7FA 5EDSA 2ZIRA 3TWTA 3ONLA 3MYVA 3ML9A 5EILA 4C9BB 1UN9A 4JD2G 1WDYA 2EIJE 3P1UA 5EYPF 4UQZA 4TUMA 3TWWA 3UKRG 4CCAA 2MHKA 1Q2ZA 3APFA 4LNBA 1AWCB 3SGHA 1HH8A 1HU3A 2XGSA 2YHCA 4X8QA 3ZXSA 2FBNA 3L22A 5JJ7A 1HS6A 3RRUA 4U8VD 4YNDA 4GCNA 3MKQA 3AS4A 5ENNA 3E37A 2C0LA 2VYIA 3LS8A 1HFAA 3CGHA 4PDXA 2GRPB 3I3NA 4EECA 1HZ4A 3BG1B 5HRYA 3NZSA 1MX6A 4O1PA 2DWZA 2KZTA 4WWNA 3C3QA 2R05A 4BESA 2WVIA 4RQIA 1N11A 3MZLB 4BTAA 2R03A 4GTOA 3D9OA 2PM7A 3VLEA 1OWNA 2X3MA 1JWFA 3UT8A 2DVWA 4MLPA 4FLBA 1OXJA 1K8KG 2IONA 2AXUA 5HI7A 2PQNA 1KT1A 2V4HC 5FJYA 3GYZA 2NYJA 3V30A 3ASFA 3PNLB 3S7BA 2E2EA 3SFZA 1N0QA 1RZ4A 4K03A 4KVMA 5T4YA 4FU3A 2BTDA 3EHNA 2ONDA 2WXHA 4GYWA 4AY6A 4IRUA 1EPUA 3SF4A 3ZYQA 3LJ3A 4Q69A 3LPZA 1H6KA 2XEHA 1H2UA 3G2UA 2OOEA 3Q78A 4CRWA 4GZ3A 1N4QA 1E96B 3UM1A 4YDYA 2EILE 3B7BA 4MBGA 3CEQA 3IKOB 4JA9A 1H2TC 1YMPA 2OEVA 4AV7A 4N3CA 2L9BA 4UWGA 5CBOA 2DYRE 4K0RA 4A3TA 2DIWA 2YINA 4JEHA 4BWRA 4ILHB 4YDOA 1S64A 3IEGA 4TXRA 2R59A 4JPSA 2I1KA 2RG8A 4DJAA 4G23A 5KJMA 4N2QA 2J8SD 2AJAA 3FUIA 2PZIA 3CK7A 3EU5A 3L08A 3PZ2A 4EBAA 1D8DA 4V3IA 3HXCA 4TUUA 1A5EA 4G24A 1PY1A 4N3AA 3ULQA 3QJZA 2XCBA 3UQ3A 1Y6IA 4I43A 3CVYA 3U64A 4BY6A 2P2CP 2IOLA 3PUJA 3CHPA 4FP7A 3NF1A 4HFGA 4DX5D 2P9SG 5FZRA 3D9JA 2QZAA 2EINE 3IBEA 2HE0A 2WMNA 4HS2A 4G25A 3TWXA 3HVEA 1MJ0A 1IKND 3R7RA 3AG1E 3RRNB 2L6JA 4I1OB 4B8CB 1JUQA 3BUAA 3QC1A 4MS6A 2P9NG 5BXUA 5CMWA 2XPIA 2XZTG 4H7XA 4XI9A 4HLEA 1W3BA 4AP2A 4ANXA 3F6QA 3ENEA 2WXMA 3UIPC 3NQPA 4I6EA 4HI9A 2FO7A 2VTBB 4KZ0A 3CVUA 5AN8A 2XQ0A 1KPSB 3PZ3A 3DEOA 1U3CA 5FQ7A 2Y0BG 4KMOA 2CHWA 4JB8P 3SQVA 1XGWA 1UOHA 2WQHA 2Y3AA 4UWHA 3WXXA 3FEXA 4J8EA 3N71A 2BEDA 3MV2B 4YVQC 3RK6A 4BX8A 4JHJA 4J8YA 3CSTA 1N4RA 4GTPA 2H6IA 3L16A 4QQIA 2UY1B 1TNBA 4KVOA 2ZISA 2LXLA 3D9PA 3L17A 3CHOA 2C2LA 2P9IG 3Q73A 1AP7A 3S7JA 5AJLA 4B93B 3TG4A 4C0MA 4U07A 3X2QE 5H7PA 2P58C 5CECB 2WXIA 3C98A 3WG7E 5EIBE 3KEAA 4PS7A 2IO3C 3CKBA 5ANRA 3ZGQA 1SA4A 3KEZA 3FTUA 5EN5D 2WXLA 3CHMA 4U0ZA 4CZ2D 1QYMA 3FTYA 1NA0A 1SQMA 4GMRA 3JUIA 4DUIA 4ATZD 3UMVA 4EZLA 5JMND 1OY3D 4CDRA 3EIQC 2WQ6A 2IFUA 4TXQA 4JEUA 3ASDA 3DSVA 3NZUA 1HXIA 2XRYA 4OVVA 2KXPC 2V4LA 4LUNU 4K5AB 2NXPA 3B7RL 4KT6B 4XE0A 1IYGA 3CHRA 2ETCA 2XZDG 2EIKE 1UJKA 4U96D 3U66A 3I4RB 3DSUA 2GRRB 4HB5A 2F37A 4XIFA 5G55A 1O1SA 3SO8A 4DRXE 3MEKA 5KJNA 4ATGA 3LDZA 4U0UA 4NRHB 2QYUA 3QK0A 3AAAC 3FTZA 4CDMA 3G2VA 3JQ0A 3LJNA 2RFMA 5B1AE 2PQRA 5AARA 4GCOA 3AU5A 4U0SA 2XEEA 1N9AA 3UI2A 2IJGX 1E7VA 3MV3B 3SBTB 1OUVA 3EU9A 4G1TA 3D9LA 5LFAA 2VSYA 2R5SA 4P29A 3LY9A 5G04C 3LVQE 2IU1A 2ZGGA 2KCVA 4FULA 1UN8A 4GTVA 3DXKG 3FU3A 4U04A 2WXGA 3Q15A 3FTWA 4I2ZA 1OWOA 2CFZA 4EZKA 3U3WA 4AXHA 5KJLA 4ACKA 2VGXA 1WG0A 3LCAA 3QWVA 3TGOA 3IHVA 1DNPA 2VSXE 3BU8A 2XRZA 3FUKA 2Y1LE 4U63A 3TG5A 1YCSB 4G26A 3Q79A 1NFIE 4APFA 4RG6A 4PH4B 4BT8A 3HIZA 4DPRA 5FINA 5ANLA 4ILGA 4GA0A 2R02A 3SFYA 3HRAA 4NACA 2LAHA 3BG0B 3O4ZA 1BLXB 1TEZA 3CVQA 3L13A 2HM8A 3R9AB 1OCOE 3BQOA 1FPPA 3MKQB 3FUEA 5A6CA 2GGFA 3D9HA 3ZIMA 4N3BA 3KS2A 5HQ8A 4HVBA 4URKA 1B89A 1IQUA 3ABKE 3MA5A 4N5QA 1O1TA 3B95A 5D2MC 3PZDA 4CDNA 3FTSA 4YVOA 1ELKA 3JCKC 4HBDA 4WWOA 4Y6CA 2KZTB 4ME2A 3EHMA 3ESKA 1QNFA 3G2TA 3LY7A 4JC8A 1Z5SC 1JCRA 1HX8A 2OCCE 4F1PA 3Q9NC 4J7WA 2F8XK 5DIZA 5ARGA 3FU0A 3SFXA 3TWQA 4MRUA 3ISMC 3RRMB 2J49A 3U9WA 3TWSA 3L9TA 4L1BA 4G11A 4N39A 2ILRA 1TNUA 2Y4UA 3FY4A 5J90A 1OWMA 2WMOA 4DK5A 4N5CA 5CHEE 3T5VA 3D9NA 4L2LA 3PZ1A 5EX0A 5KNGA 1OCZE 4OYSA 4F3VA 2H6GA 3L54A 2CHZA 5DBKA 3OAWA 4BSXA 4LSZE 4Q94A 2P9LG 3BEEA 3DSSA 4F1SA 3VTXA 5AYWD 2DBAA 1E90A 2F0YA 3MKRA 2V0PA 2F8YA 1OT8A 5FQ4A 4EHMA 3NOGD 5CCMA 3EIJA 2VSNA 4E85A 4WNEA 4I17A 1X81A 2KM4A 5LCWJ 3C3RA 4B94A 1N0RA 3R7QA 3ZW3A 3TWRA 3E32A 3QARA 4OVUA 3TXNA 4IN3B 5E75A 1TYQG 5JJ6A 3ASHA 3E34A 3JQ1A 4GU5A 2WXKA 2MYOA 2Y4TA 4GTRA 1E8WA 3QKYA 3MGBA 4A63B 1KZOA 4K5CA 5HKPA 3DSTA 3FU5A 5G2NA 3CVWA 5FWQA 3SD5A 2ETAA 4B8AA 3ZUVB 5ITZF 4CEMA 5CRUA 3ASOE 2FO1E 3AU4A 2IY0C 2I9CA 4UI9K 3PE4A 4DX2A 5FTPA 1O5MA 3PEUB 3T8MA 4CGVA 3D9IA 2AWIA 5BT1A 2I6HA 3ULEG 1FVHA 2QC9A 2J07A 3HVEB 3C72A 3TXMA 1DC2A 4HORA 4PS3A 4CYMD 3S7DA 4J8FA 3FWVA 4FJYA 2DZNA 5CCLA 3OXLA 3FTVA 4WAFA 5ENPD 1K3ZD 3Q9UC 5G05C 5AQAA 3Q7FA 2P9KG 4LEUA 4IYPA 4DI3A 3L6AA 3D9KA 4Q96A 3CVXA 2XGOA 4LCTA 4JXTA 3KAEA 3EDTB 2QY7A 2NC9A 2X6IA 1WY6A 1MZCA 1JCSA 1TN6A 1Z3XA 2VGEA 3K9IA 3AS5A 3IXEA 3B7TA 3QAQA 4B89A 3ZHEA 2RFAA 1TNZA 3HXDA 1TJFA 2ZGDA 1OWPA 4AY5A 4EZJA 5AQBA 4ABNA 1MYOA 4DI4A 5CEAA 3FFLA 2LO6A 4HQDA 3PEVB 4UI9J 1N4PA 2FEZA 2JEKA 2B0OE 2XCCA 4F7AA 3ASNE 2AW6A 3U4TA 3GW4A 3ZRHA 1HO8A 1V54E 4JHRA 1U2VG 2CHXA 4UWLA 3DPDA 3CQCB 4U8YD 2UWJG 4J6IA 2IQCA 4GYOA 3S2AA 2DCPA 5BPPA 3E4BA 3QB2A 1TNOA 3MX3A 2BKKB 4ZFHA 1NP7A 3PE3A 1FVFA 3ZN3A 2BKGA 5EKQD 3VTYA 2JABA 5EX3A 1HF8A 4GZ6A 2J9QA 3KD7A 1H6PA 4WNGA 3ZYKA 4I1MA 3ZYMA 3T8KA 5J08A 3Q5MA 4NQ0A 2QFCA 4NIKA 4GMLA 1BD8A 1VDYA 4UQYA 3HXBA 5G04J 3I4GA 4XZ4A 2HO1A 4UWFA 5ENRD 5EIDA 4GTTA 2VGYA 2VQ2A 3TAXA 4FJZA
chains in the Genus database with same CATH topology
3DSUA 4GTRA 3SFXA 3Q73A 1KZOA 1DCEA 3Q79A 4LNBA 1NI1A 1FT1A 1O1SA 1N4PA 3DSTA 3PZ4A 3E30A 3DSWA 1QBQA 1LTXA 1O1RA 3Q7AA 1LD8A 3DSXA 3DPYA 3Q78A 3EUVA 3Q75A 1N4QA 3E37A 1TNUA 1KZPA 2R2LA 1SA5A 4GTSA 4LNGA 3SFYA 4MBGA 1TN7A 1O5MA 1SA4A 3HXFA 4GTMA 3KSLA 1N9AA 3PZ1A 1LD7A 3C72A 4GTQA 1TNOA 2H6GA 1N95A 4YDOA 4YDEA 1FPPA 1S63A 1S64A 3DRAA 1TNYA 3DSSA 4GTOA 2H6HA 2H6FA 3Q7FA 2F0YA 3PZ3A 1N4SA 1O1TA 1NL4A 3DSVA 4EHMA 3HXEA 4GTVA 1MZCA 1JCSA 1TN6A 2ZIRA 3HXBA 1X81A 1JCQA 2BEDA 2IEJA 1TN8A 3KSQA 3E32A 3EU5A 1D8EA 1JCRA 3PZ2A 1D8DA 1TNZA 1N4RA 4GTPA 3HXCA 2H6IA 3HXDA 3E33A 4GTTA 1TNBA 1N94A 2ZISA 3E34A 4L9PA 1FT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSU A;  4GTR A;  3SFX A;  3Q73 A;  1KZO A;  1DCE A;  3Q79 A;  4LNB A;  1NI1 A;  1FT1 A;  1O1S A;  1N4P A;  3DST A;  3PZ4 A;  3E30 A;  3DSW A;  1QBQ A;  1LTX A;  1O1R A;  3Q7A A;  1LD8 A;  3DSX A;  3DPY A;  3Q78 A;  3EUV A;  3Q75 A;  1N4Q A;  3E37 A;  1TNU A;  1KZP A;  2R2L A;  1SA5 A;  4GTS A;  4LNG A;  3SFY A;  4MBG A;  1TN7 A;  1O5M A;  1SA4 A;  3HXF A;  4GTM A;  3KSL A;  1N9A A;  3PZ1 A;  1LD7 A;  3C72 A;  4GTQ A;  1TNO A;  2H6G A;  1N95 A;  4YDO A;  4YDE A;  1FPP A;  1S63 A;  1S64 A;  3DRA A;  1TNY A;  3DSS A;  4GTO A;  2H6H A;  2H6F A;  3Q7F A;  2F0Y A;  3PZ3 A;  1N4S A;  1O1T A;  1NL4 A;  3DSV A;  4EHM A;  3HXE A;  4GTV A;  1MZC A;  1JCS A;  1TN6 A;  2ZIR A;  3HXB A;  1X81 A;  1JCQ A;  2BED A;  2IEJ A;  1TN8 A;  3KSQ A;  3E32 A;  3EU5 A;  1D8E A;  1JCR A;  3PZ2 A;  1D8D A;  1TNZ A;  1N4R A;  4GTP A;  3HXC A;  2H6I A;  3HXD A;  3E33 A;  4GTT A;  1TNB A;  1N94 A;  2ZIS A;  3E34 A;  4L9P A;  1FT2 A; 
#chains in the Genus database with same CATH topology
 1WAO 1;  2WXQ A;  2YQ8 A;  3G2W A;  3NOC D;  1D9S A;  4AIF A;  3Q4A B;  1UG3 A;  1BU9 A;  1SZA A;  1GW6 A;  1O1R A;  2XS1 A;  5KCM A;  4XX5 A;  1JPL A;  2KC7 A;  3EUV A;  3CVN A;  3SI5 A;  1SA5 A;  4GTS A;  4JL0 A;  4ANU A;  5CBN A;  2X38 A;  2V5Q C;  3CV0 A;  1IHG A;  3UIO C;  4BTB A;  1JWG A;  1ZBP A;  3IV0 A;  1Y8M A;  1INZ A;  3MJW A;  2J08 A;  1H6O A;  4FC8 A;  3FTX A;  1SW6 A;  2MRI A;  3CVP A;  4YDE A;  2WPV A;  4U7E B;  2WXF A;  4I6G A;  3UUX A;  4I9C A;  3OXF A;  3TWU A;  3FUD A;  3URZ A;  5AAO A;  4JW1 A;  3FH7 A;  2WXN A;  5KBA A;  4WND A;  3UX4 A;  3CHS A;  3JUE A;  3LY8 A;  1N54 A;  4CGW A;  2X6J A;  3NBN B;  4KZC A;  3ZXP A;  1JCQ A;  5T8I A;  3ONK A;  4HLL A;  5B3S E;  3SZ7 A;  2GRQ B;  3ZKJ A;  3KSQ A;  1BI8 B;  3AJI A;  1HE8 A;  2B6C A;  1E8X A;  4I9E A;  4M3O A;  2LAI A;  2BUG A;  1E8Y A;  3UXG A;  5AQ7 A;  2NSZ A;  1MHQ A;  3OXG A;  2MOW A;  4JZY A;  5ENT D;  3V2O A;  5T3R A;  3C3O A;  4R7L A;  5ENS D;  4JHK A;  1NI1 A;  5JJT A;  2AVP A;  3PRE A;  5AJD A;  5FQ8 A;  2VGX B;  3RU0 A;  3GZ2 A;  4DX7 D;  1LD8 A;  2OVB A;  4PUC A;  3Q75 A;  4K5B A;  3B13 A;  3PS6 A;  2PNN A;  3I5P A;  3UIN C;  1IXV A;  3QWP A;  4APO A;  3ABM E;  4BET A;  1TJC A;  3T9K A;  1V55 E;  1EDU A;  2RKK A;  1ZB1 A;  3CIA A;  3RSE G;  1UW4 B;  4EPZ A;  3AG2 E;  2RD0 A;  4YDW A;  4O60 A;  2XHE A;  2XPY A;  3LYA A;  4F6R D;  3CK9 A;  4DX1 A;  4AM9 A;  3ZEF A;  4XKC A;  3NB2 A;  4FLH A;  5BNW A;  5AEN A;  1OWL A;  2LSV A;  5BUZ A;  3UKU G;  2P9P G;  4FHJ A;  1P5Q A;  4FA6 A;  5C1D A;  5KNH D;  5FZS A;  2WXR A;  2OV8 A;  4BT9 A;  2FUL A;  5JHB A;  3DSW A;  2P9U G;  5JA4 D;  1LTX A;  3UM3 A;  1U3D A;  4GB9 A;  2Y69 E;  5D66 A;  2YHE A;  3JYS A;  2R2L A;  4XEI G;  1ELR A;  1QZ2 A;  3ASG A;  3LVR E;  4XI0 A;  3CHQ A;  3QDN A;  2WXO A;  3CVV A;  2V8S E;  3EJN A;  3CLJ A;  5A23 A;  1LD7 A;  1A17 A;  4ZHB A;  3SY2 A;  5D0O D;  1S63 A;  5BW8 C;  3DRA A;  4JVS A;  4C0E A;  3PVL A;  4BFR A;  3TL5 A;  2OVF A;  3HG0 D;  2XGM A;  2KCK A;  2A5U A;  1PC2 A;  3P2B A;  4U8H A;  3V2X A;  3HYM B;  4GAA A;  5JHA A;  4RSY A;  4B0Z A;  5G05 J;  5BV0 A;  4KBQ A;  2DZO A;  2IOS A;  2GRL A;  5ENO D;  4UUC A;  4RLY A;  1D8E A;  1IQR A;  3DWL G;  2QYJ A;  1BI7 B;  4JA7 A;  4F53 A;  3MCX A;  2VSO E;  5C2Y A;  4D10 C;  2IO2 C;  1H2V C;  3D9M A;  3PZ4 A;  4HRL A;  4HRM B;  4WUY A;  2HR2 A;  5M72 A;  3DSX A;  3QNK A;  3FU6 A;  4PS8 A;  3AG4 E;  5FIO A;  3FDH A;  1HG2 A;  1KZP A;  3EHQ A;  3PRZ A;  4RG9 A;  3FHE A;  2AXV A;  4I1A A;  5AIJ A;  1TN7 A;  4HRN A;  4W9R A;  3FEY A;  3HXF A;  3SHF A;  3ABL E;  4CT4 A;  1SZ9 A;  2M63 A;  3NAW A;  3RO2 A;  4J8S A;  3CK8 A;  4GTQ A;  2ETB A;  3CR3 A;  4GZD A;  2J4B A;  1S70 B;  3ZPJ A;  4MKT A;  4BSZ B;  3UT7 A;  2WXJ A;  3EHR A;  2WXP A;  4ANW A;  4OAV B;  2GRN B;  2L0T B;  1L5J A;  1EYH A;  3RIB A;  1N52 A;  2A5E A;  4TXP A;  3Q47 B;  3ML8 A;  4A55 A;  4N2S A;  2WM9 A;  5FT9 A;  2IEJ A;  4I6J A;  4DLO A;  1TN8 A;  3W9F A;  2XPZ A;  1YYH A;  3CQG B;  3D3M A;  1BPO A;  3LXU X;  2XEN A;  4HNA D;  4UWK A;  2KAT A;  3RAU A;  1ZU2 A;  3FUJ A;  4A1G A;  2LSU A;  4BER A;  2GRO B;  1E8Z A;  4HOU A;  2C0M A;  4J8D A;  5FZQ A;  4LRZ A;  4L7T A;  5EYL A;  2X6K A;  3ZHE B;  4HOS A;  1K1B A;  3TJP A;  2DYS E;  3Q7A A;  3DPY A;  2WQ7 A;  3CVL A;  2VTB A;  1FCH A;  4BX9 A;  5CER B;  3APC A;  4QFV A;  3ZFW A;  4ACL A;  5ARF A;  3PNT B;  3LKU A;  2ZU6 B;  1MX2 A;  2VJ8 A;  3GZS A;  3T5X A;  4XKB A;  5CRV A;  1HG5 A;  3PH0 C;  5LCW C;  2I1J A;  3V79 K;  4ANV A;  2X6F A;  3C5R A;  3KSL A;  4TV3 A;  2X6H A;  3SBS A;  5A7D B;  2L0I A;  1DVP A;  3RJV A;  5HS0 A;  4GYY A;  1TR4 A;  2OEW A;  3FUF A;  3FP3 A;  4KXK B;  4GZ5 A;  1OCR E;  3G2S A;  1PAQ A;  1Z6T A;  4O6F A;  5KJK A;  3DBS A;  3J5Q B;  4G8L A;  1K1A A;  3UM2 A;  2BF0 X;  2UY1 A;  4E6H A;  2CFU A;  1DCQ A;  4FHK A;  4GA2 A;  5FQ6 A;  2J4D A;  3FUN A;  2IF4 A;  4EBA G;  3FH8 A;  4FAD A;  2LNI A;  3L82 A;  4GZC A;  2PL2 A;  5LX8 A;  1SVX A;  2XEV A;  5D0Q D;  5LP0 A;  3E33 A;  3B7U X;  4G2V A;  4LG6 A;  3DXM G;  1G3N B;  4L9P A;  1FT2 A;  3O48 A;  4A1S A;  4GA1 A;  2PM6 A;  3VLD A;  2FI7 A;  1DCE A;  4C48 B;  2HYZ A;  3UPV A;  2KCL A;  3E30 A;  4G8K A;  2XS8 A;  5E76 A;  4AOF A;  4LER A;  4EQF A;  4HXI A;  3RO3 A;  1H19 A;  2WB2 A;  4HOQ A;  3V31 A;  4HOT A;  2KBX A;  4LNG A;  3HDX A;  3PDN A;  4AEZ C;  4A3V A;  3FUM A;  2EQX A;  4O1O A;  5ENQ D;  1EF1 C;  3RKV A;  3FH5 A;  1KT0 A;  3VLF A;  3B7S A;  1OCC E;  1MQS A;  1N95 A;  1ELW A;  1S0P A;  4TRQ A;  5KWD A;  3AG3 E;  2R17 C;  2H6F A;  4Y6W A;  3DEP A;  5CED B;  4GPM A;  4DLQ A;  1N4S A;  1YA0 A;  1NL4 A;  4UI9 C;  2GW1 A;  4L23 A;  3HHM A;  3QOU A;  2LXM A;  3ZYL A;  3QWW A;  4ILI A;  4DX6 D;  2A4Z A;  4Z68 A;  2J09 A;  4UQX A;  1NZN A;  2V5F A;  1UJJ A;  3TWV A;  2ZXW E;  4M7C A;  1LF8 A;  1XNF A;  1H0A A;  1IHB A;  1N94 A;  3IHY A;  3S7F A;  3JXI A;  3AS8 A;  1E7U A;  3UT4 A;  1FT1 A;  2YNQ A;  4HI8 A;  4AVX A;  4WWP A;  2JLB A;  2EIM E;  2L6B A;  3APD A;  1QBQ A;  4IUL A;  1Z3Y A;  3UM0 A;  2FF4 A;  5BXO A;  3W9G A;  3JXJ A;  3FUL A;  4KYO B;  5BV1 A;  3FUH A;  3ULY A;  4OAU C;  2E0I A;  4GPK A;  5LOZ A;  1NA3 A;  3UTM A;  1X5B A;  1MX4 A;  4GTM A;  2I2O A;  4WNF A;  2AXZ A;  5AQ9 A;  2GRM A;  4BEP A;  3ZU7 B;  4L2Y A;  5CMY A;  4NUR A;  1TNY A;  2LUH A;  1WM5 A;  4J0U A;  5IY5 E;  3GZ1 A;  3OTN A;  4U95 D;  2H6H A;  3PUK A;  4AJW A;  3CKC A;  1QQE A;  4RVB A;  4GMJ A;  4H7Y A;  1RW2 A;  3Q49 B;  3LEW A;  2CG2 A;  3J5P A;  2CG3 A;  3ESL A;  5B1B E;  4I2W A;  4CT0 A;  3ZVV A;  3SNX A;  3HXE A;  3CSF A;  3R9M A;  4LNU D;  1KLX A;  3ZNG A;  2Q7F A;  5EDS A;  2ZIR A;  3TWT A;  3ONL A;  3MYV A;  3ML9 A;  5EIL A;  4C9B B;  1UN9 A;  4JD2 G;  1WDY A;  2EIJ E;  3P1U A;  5EYP F;  4UQZ A;  4TUM A;  3TWW A;  3UKR G;  4CCA A;  2MHK A;  1Q2Z A;  3APF A;  4LNB A;  1AWC B;  3SGH A;  1HH8 A;  1HU3 A;  2XGS A;  2YHC A;  4X8Q A;  3ZXS A;  2FBN A;  3L22 A;  5JJ7 A;  1HS6 A;  3RRU A;  4U8V D;  4YND A;  4GCN A;  3MKQ A;  3AS4 A;  5ENN A;  3E37 A;  2C0L A;  2VYI A;  3LS8 A;  1HFA A;  3CGH A;  4PDX A;  2GRP B;  3I3N A;  4EEC A;  1HZ4 A;  3BG1 B;  5HRY A;  3NZS A;  1MX6 A;  4O1P A;  2DWZ A;  2KZT A;  4WWN A;  3C3Q A;  2R05 A;  4BES A;  2WVI A;  4RQI A;  1N11 A;  3MZL B;  4BTA A;  2R03 A;  4GTO A;  3D9O A;  2PM7 A;  3VLE A;  1OWN A;  2X3M A;  1JWF A;  3UT8 A;  2DVW A;  4MLP A;  4FLB A;  1OXJ A;  1K8K G;  2ION A;  2AXU A;  5HI7 A;  2PQN A;  1KT1 A;  2V4H C;  5FJY A;  3GYZ A;  2NYJ A;  3V30 A;  3ASF A;  3PNL B;  3S7B A;  2E2E A;  3SFZ A;  1N0Q A;  1RZ4 A;  4K03 A;  4KVM A;  5T4Y A;  4FU3 A;  2BTD A;  3EHN A;  2OND A;  2WXH A;  4GYW A;  4AY6 A;  4IRU A;  1EPU A;  3SF4 A;  3ZYQ A;  3LJ3 A;  4Q69 A;  3LPZ A;  1H6K A;  2XEH A;  1H2U A;  3G2U A;  2OOE A;  3Q78 A;  4CRW A;  4GZ3 A;  1N4Q A;  1E96 B;  3UM1 A;  4YDY A;  2EIL E;  3B7B A;  4MBG A;  3CEQ A;  3IKO B;  4JA9 A;  1H2T C;  1YMP A;  2OEV A;  4AV7 A;  4N3C A;  2L9B A;  4UWG A;  5CBO A;  2DYR E;  4K0R A;  4A3T A;  2DIW A;  2YIN A;  4JEH A;  4BWR A;  4ILH B;  4YDO A;  1S64 A;  3IEG A;  4TXR A;  2R59 A;  4JPS A;  2I1K A;  2RG8 A;  4DJA A;  4G23 A;  5KJM A;  4N2Q A;  2J8S D;  2AJA A;  3FUI A;  2PZI A;  3CK7 A;  3EU5 A;  3L08 A;  3PZ2 A;  4EBA A;  1D8D A;  4V3I A;  3HXC A;  4TUU A;  1A5E A;  4G24 A;  1PY1 A;  4N3A A;  3ULQ A;  3QJZ A;  2XCB A;  3UQ3 A;  1Y6I A;  4I43 A;  3CVY A;  3U64 A;  4BY6 A;  2P2C P;  2IOL A;  3PUJ A;  3CHP A;  4FP7 A;  3NF1 A;  4HFG A;  4DX5 D;  2P9S G;  5FZR A;  3D9J A;  2QZA A;  2EIN E;  3IBE A;  2HE0 A;  2WMN A;  4HS2 A;  4G25 A;  3TWX A;  3HVE A;  1MJ0 A;  1IKN D;  3R7R A;  3AG1 E;  3RRN B;  2L6J A;  4I1O B;  4B8C B;  1JUQ A;  3BUA A;  3QC1 A;  4MS6 A;  2P9N G;  5BXU A;  5CMW A;  2XPI A;  2XZT G;  4H7X A;  4XI9 A;  4HLE A;  1W3B A;  4AP2 A;  4ANX A;  3F6Q A;  3ENE A;  2WXM A;  3UIP C;  3NQP A;  4I6E A;  4HI9 A;  2FO7 A;  2VTB B;  4KZ0 A;  3CVU A;  5AN8 A;  2XQ0 A;  1KPS B;  3PZ3 A;  3DEO A;  1U3C A;  5FQ7 A;  2Y0B G;  4KMO A;  2CHW A;  4JB8 P;  3SQV A;  1XGW A;  1UOH A;  2WQH A;  2Y3A A;  4UWH A;  3WXX A;  3FEX A;  4J8E A;  3N71 A;  2BED A;  3MV2 B;  4YVQ C;  3RK6 A;  4BX8 A;  4JHJ A;  4J8Y A;  3CST A;  1N4R A;  4GTP A;  2H6I A;  3L16 A;  4QQI A;  2UY1 B;  1TNB A;  4KVO A;  2ZIS A;  2LXL A;  3D9P A;  3L17 A;  3CHO A;  2C2L A;  2P9I G;  3Q73 A;  1AP7 A;  3S7J A;  5AJL A;  4B93 B;  3TG4 A;  4C0M A;  4U07 A;  3X2Q E;  5H7P A;  2P58 C;  5CEC B;  2WXI A;  3C98 A;  3WG7 E;  5EIB E;  3KEA A;  4PS7 A;  2IO3 C;  3CKB A;  5ANR A;  3ZGQ A;  1SA4 A;  3KEZ A;  3FTU A;  5EN5 D;  2WXL A;  3CHM A;  4U0Z A;  4CZ2 D;  1QYM A;  3FTY A;  1NA0 A;  1SQM A;  4GMR A;  3JUI A;  4DUI A;  4ATZ D;  3UMV A;  4EZL A;  5JMN D;  1OY3 D;  4CDR A;  3EIQ C;  2WQ6 A;  2IFU A;  4TXQ A;  4JEU A;  3ASD A;  3DSV A;  3NZU A;  1HXI A;  2XRY A;  4OVV A;  2KXP C;  2V4L A;  4LUN U;  4K5A B;  2NXP A;  3B7R L;  4KT6 B;  4XE0 A;  1IYG A;  3CHR A;  2ETC A;  2XZD G;  2EIK E;  1UJK A;  4U96 D;  3U66 A;  3I4R B;  3DSU A;  2GRR B;  4HB5 A;  2F37 A;  4XIF A;  5G55 A;  1O1S A;  3SO8 A;  4DRX E;  3MEK A;  5KJN A;  4ATG A;  3LDZ A;  4U0U A;  4NRH B;  2QYU A;  3QK0 A;  3AAA C;  3FTZ A;  4CDM A;  3G2V A;  3JQ0 A;  3LJN A;  2RFM A;  5B1A E;  2PQR A;  5AAR A;  4GCO A;  3AU5 A;  4U0S A;  2XEE A;  1N9A A;  3UI2 A;  2IJG X;  1E7V A;  3MV3 B;  3SBT B;  1OUV A;  3EU9 A;  4G1T A;  3D9L A;  5LFA A;  2VSY A;  2R5S A;  4P29 A;  3LY9 A;  5G04 C;  3LVQ E;  2IU1 A;  2ZGG A;  2KCV A;  4FUL A;  1UN8 A;  4GTV A;  3DXK G;  3FU3 A;  4U04 A;  2WXG A;  3Q15 A;  3FTW A;  4I2Z A;  1OWO A;  2CFZ A;  4EZK A;  3U3W A;  4AXH A;  5KJL A;  4ACK A;  2VGX A;  1WG0 A;  3LCA A;  3QWV A;  3TGO A;  3IHV A;  1DNP A;  2VSX E;  3BU8 A;  2XRZ A;  3FUK A;  2Y1L E;  4U63 A;  3TG5 A;  1YCS B;  4G26 A;  3Q79 A;  1NFI E;  4APF A;  4RG6 A;  4PH4 B;  4BT8 A;  3HIZ A;  4DPR A;  5FIN A;  5ANL A;  4ILG A;  4GA0 A;  2R02 A;  3SFY A;  3HRA A;  4NAC A;  2LAH A;  3BG0 B;  3O4Z A;  1BLX B;  1TEZ A;  3CVQ A;  3L13 A;  2HM8 A;  3R9A B;  1OCO E;  3BQO A;  1FPP A;  3MKQ B;  3FUE A;  5A6C A;  2GGF A;  3D9H A;  3ZIM A;  4N3B A;  3KS2 A;  5HQ8 A;  4HVB A;  4URK A;  1B89 A;  1IQU A;  3ABK E;  3MA5 A;  4N5Q A;  1O1T A;  3B95 A;  5D2M C;  3PZD A;  4CDN A;  3FTS A;  4YVO A;  1ELK A;  3JCK C;  4HBD A;  4WWO A;  4Y6C A;  2KZT B;  4ME2 A;  3EHM A;  3ESK A;  1QNF A;  3G2T A;  3LY7 A;  4JC8 A;  1Z5S C;  1JCR A;  1HX8 A;  2OCC E;  4F1P A;  3Q9N C;  4J7W A;  2F8X K;  5DIZ A;  5ARG A;  3FU0 A;  3SFX A;  3TWQ A;  4MRU A;  3ISM C;  3RRM B;  2J49 A;  3U9W A;  3TWS A;  3L9T A;  4L1B A;  4G11 A;  4N39 A;  2ILR A;  1TNU A;  2Y4U A;  3FY4 A;  5J90 A;  1OWM A;  2WMO A;  4DK5 A;  4N5C A;  5CHE E;  3T5V A;  3D9N A;  4L2L A;  3PZ1 A;  5EX0 A;  5KNG A;  1OCZ E;  4OYS A;  4F3V A;  2H6G A;  3L54 A;  2CHZ A;  5DBK A;  3OAW A;  4BSX A;  4LSZ E;  4Q94 A;  2P9L G;  3BEE A;  3DSS A;  4F1S A;  3VTX A;  5AYW D;  2DBA A;  1E90 A;  2F0Y A;  3MKR A;  2V0P A;  2F8Y A;  1OT8 A;  5FQ4 A;  4EHM A;  3NOG D;  5CCM A;  3EIJ A;  2VSN A;  4E85 A;  4WNE A;  4I17 A;  1X81 A;  2KM4 A;  5LCW J;  3C3R A;  4B94 A;  1N0R A;  3R7Q A;  3ZW3 A;  3TWR A;  3E32 A;  3QAR A;  4OVU A;  3TXN A;  4IN3 B;  5E75 A;  1TYQ G;  5JJ6 A;  3ASH A;  3E34 A;  3JQ1 A;  4GU5 A;  2WXK A;  2MYO A;  2Y4T A;  4GTR A;  1E8W A;  3QKY A;  3MGB A;  4A63 B;  1KZO A;  4K5C A;  5HKP A;  3DST A;  3FU5 A;  5G2N A;  3CVW A;  5FWQ A;  3SD5 A;  2ETA A;  4B8A A;  3ZUV B;  5ITZ F;  4CEM A;  5CRU A;  3ASO E;  2FO1 E;  3AU4 A;  2IY0 C;  2I9C A;  4UI9 K;  3PE4 A;  4DX2 A;  5FTP A;  1O5M A;  3PEU B;  3T8M A;  4CGV A;  3D9I A;  2AWI A;  5BT1 A;  2I6H A;  3ULE G;  1FVH A;  2QC9 A;  2J07 A;  3HVE B;  3C72 A;  3TXM A;  1DC2 A;  4HOR A;  4PS3 A;  4CYM D;  3S7D A;  4J8F A;  3FWV A;  4FJY A;  2DZN A;  5CCL A;  3OXL A;  3FTV A;  4WAF A;  5ENP D;  1K3Z D;  3Q9U C;  5G05 C;  5AQA A;  3Q7F A;  2P9K G;  4LEU A;  4IYP A;  4DI3 A;  3L6A A;  3D9K A;  4Q96 A;  3CVX A;  2XGO A;  4LCT A;  4JXT A;  3KAE A;  3EDT B;  2QY7 A;  2NC9 A;  2X6I A;  1WY6 A;  1MZC A;  1JCS A;  1TN6 A;  1Z3X A;  2VGE A;  3K9I A;  3AS5 A;  3IXE A;  3B7T A;  3QAQ A;  4B89 A;  3ZHE A;  2RFA A;  1TNZ A;  3HXD A;  1TJF A;  2ZGD A;  1OWP A;  4AY5 A;  4EZJ A;  5AQB A;  4ABN A;  1MYO A;  4DI4 A;  5CEA A;  3FFL A;  2LO6 A;  4HQD A;  3PEV B;  4UI9 J;  1N4P A;  2FEZ A;  2JEK A;  2B0O E;  2XCC A;  4F7A A;  3ASN E;  2AW6 A;  3U4T A;  3GW4 A;  3ZRH A;  1HO8 A;  1V54 E;  4JHR A;  1U2V G;  2CHX A;  4UWL A;  3DPD A;  3CQC B;  4U8Y D;  2UWJ G;  4J6I A;  2IQC A;  4GYO A;  3S2A A;  2DCP A;  5BPP A;  3E4B A;  3QB2 A;  1TNO A;  3MX3 A;  2BKK B;  4ZFH A;  1NP7 A;  3PE3 A;  1FVF A;  3ZN3 A;  2BKG A;  5EKQ D;  3VTY A;  2JAB A;  5EX3 A;  1HF8 A;  4GZ6 A;  2J9Q A;  3KD7 A;  1H6P A;  4WNG A;  3ZYK A;  4I1M A;  3ZYM A;  3T8K A;  5J08 A;  3Q5M A;  4NQ0 A;  2QFC A;  4NIK A;  4GML A;  1BD8 A;  1VDY A;  4UQY A;  3HXB A;  5G04 J;  3I4G A;  4XZ4 A;  2HO1 A;  4UWF A;  5ENR D;  5EID A;  4GTT A;  2VGY A;  2VQ2 A;  3TAX A;  4FJZ A; 
#chains in the Genus database with same CATH homology
 3DSU A;  4GTR A;  3SFX A;  3Q73 A;  1KZO A;  1DCE A;  3Q79 A;  4LNB A;  1NI1 A;  1FT1 A;  1O1S A;  1N4P A;  3DST A;  3PZ4 A;  3E30 A;  3DSW A;  1QBQ A;  1LTX A;  1O1R A;  3Q7A A;  1LD8 A;  3DSX A;  3DPY A;  3Q78 A;  3EUV A;  3Q75 A;  1N4Q A;  3E37 A;  1TNU A;  1KZP A;  2R2L A;  1SA5 A;  4GTS A;  4LNG A;  3SFY A;  4MBG A;  1TN7 A;  1O5M A;  1SA4 A;  3HXF A;  4GTM A;  3KSL A;  1N9A A;  3PZ1 A;  1LD7 A;  3C72 A;  4GTQ A;  1TNO A;  2H6G A;  1N95 A;  4YDO A;  4YDE A;  1FPP A;  1S63 A;  1S64 A;  3DRA A;  1TNY A;  3DSS A;  4GTO A;  2H6H A;  2H6F A;  3Q7F A;  2F0Y A;  3PZ3 A;  1N4S A;  1O1T A;  1NL4 A;  3DSV A;  4EHM A;  3HXE A;  4GTV A;  1MZC A;  1JCS A;  1TN6 A;  2ZIR A;  3HXB A;  1X81 A;  1JCQ A;  2BED A;  2IEJ A;  1TN8 A;  3KSQ A;  3E32 A;  3EU5 A;  1D8E A;  1JCR A;  3PZ2 A;  1D8D A;  1TNZ A;  1N4R A;  4GTP A;  3HXC A;  2H6I A;  3HXD A;  3E33 A;  4GTT A;  1TNB A;  1N94 A;  2ZIS A;  3E34 A;  4L9P A;  1FT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...