1O1RA

Structure of fpt bound to ggpp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies with Prenyl Diphosphate Analogues Provide Insights into Isoprenoid Recognition by Protein Farnesyl Transferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
total genus 123
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o1rA00
1FT1A 1S64A 2H6GA 3KSQA 1D8EA 4GTOA 3PZ1A 4LNBA 3DSUA 3E30A 2BEDA 2IEJA 1N4SA 3Q78A 1LD7A 1TNUA 1O1SA 2R2LA 1FPPA 3PZ4A 3PZ3A 1N9AA 1TN7A 3DSWA 1SA4A 3HXEA 3Q75A 1SA5A 3E34A 1O1RA 3HXCA 1S63A 3DPYA 3DSSA 4GTTA 1TN6A 3SFYA 1TNZA 3EUVA 1TNYA 3SFXA 3E32A 2H6HA 4GTSA 2ZISA 1TN8A 1N4QA 4GTPA 4GTQA 3HXDA 3Q79A 3E37A 1FT2A 1JCQA 2F0YA 3DSXA 4YDOA 1KZOA 2ZIRA 3Q7FA 3Q73A 1X81A 3DSVA 3EU5A 1N4RA 1NL4A 1LTXA 3Q7AA 4EHMA 1N95A 1TNOA 1QBQA 3HXFA 4GTVA 1O5MA 4LNGA 3HXBA 4GTMA 2H6IA 1KZPA 1LD8A 3KSLA 3PZ2A 1N94A 1TNBA 1O1TA 4GTRA 1N4PA 2H6FA 4L9PA 4MBGA 1MZCA 1DCEA 3C72A 1JCRA 1D8DA 1NI1A 1JCSA 4YDEA 3E33A 3DSTA 3DRAA
chains in the Genus database with same CATH superfamily
3RSEG 2QY7A 4FLBA 2FO1E 4GA0A 5D0OD 2IEJA 2CFZA 3Q78A 3I5PA 3GW4A 4ACLA 2DIWA 3FY4A 4HI9A 1NP7A 4LEUA 1HU3A 3B7SA 1HO8A 2LAIA 4DLOA 3UM3A 3HIZA 3AU5A 4A55A 3BEEA 4O60A 2L0TB 3LXUX 4CT4A 3UPVA 5AQ9A 4IYPA 3PH0C 4HFGA 4U96D 3V79K 3RO3A 4J7WA 3ONKA 2V0PA 2VTBB 3IHVA 3APCA 5M72A 1INZA 5BT1A 5BXUA 1JWGA 2JLBA 4BSZB 2KATA 3J5QB 1MHQA 4A1SA 4EHMA 3UM0A 2QZAA 3EIQC 2HYZA 3X2QE 2WM9A 3SHFA 1O5MA 4LERA 2FO7A 1E8ZA 2Y4UA 4DX1A 5G04C 4FC8A 4RQIA 2DZNA 5KNHD 4DJAA 5EYPF 3HHMA 1DCEA 3DEOA 4AY5A 3ZPJA 2LXLA 4JHKA 1SZ9A 4AVXA 4G2VA 1QYMA 2RG8A 3ASOE 3Q5MA 4U04A 3FTUA 4F6RD 2WXKA 1MYOA 5CMYA 3ZN3A 3FEXA 3U64A 4JB8P 3QNKA 3CQCB 3LKUA 3FUJA 4G11A 3CK7A 4RVBA 5LOZA 5FT9A 1ZB1A 2V8SE 5JHBA 4CGVA 1V54E 3D9NA 4W9RA 1H0AA 3CK8A 3UT4A 1BPOA 2XPIA 4EECA 4BT9A 3UUXA 3EUVA 2DYRE 2XHEA 3KD7A 2KCLA 5JMND 5CEAA 3AAAC 4BTBA 5A6CA 5HI7A 2VGXB 4K03A 4YDOA 3I3NA 2I1JA 1X81A 3PDNA 4F1PA 3EHQA 1WM5A 4B89A 4NURA 3PZDA 1SVXA 3MA5A 1K1BA 2GROB 3R9MA 3NZUA 3DXKG 4YNDA 4XI9A 1N94A 1OCOE 3EIJA 1A5EA 3FUIA 4IN3B 2P9KG 4AV7A 3AG1E 3TL5A 1E7UA 1Y8MA 1FT1A 2Y4TA 2LSVA 4U63A 3TGOA 5ARGA 5FQ7A 2XGSA 2A5EA 5KJNA 2XZTG 3CK9A 2UY1B 3PZ3A 3SZ7A 3LY9A 3TJPA 3U9WA 4Q94A 1UJJA 2KM4A 2XS8A 3FDHA 1GW6A 4CGWA 3UQ3A 3AJIA 4URKA 4L2LA 2P9NG 4N5CA 2PM6A 4ME2A 3LCAA 1H6OA 4FJYA 4BEPA 4LUNU 4WAFA 3ASGA 3URZA 2KBXA 3QC1A 5KCMA 5ENNA 3N71A 3WXXA 4XEIG 5ENQD 2E0IA 2Y69E 2RFAA 5EIDA 3LPZA 2GRQB 3ISMC 2P9PG 4F53A 3PEUB 5KWDA 1H2UA 3CKCA 1FCHA 3D9PA 4GTMA 4ANWA 1N0RA 3HYMB 2J8SD 3TWUA 1PY1A 1Z3XA 3EHRA 4NACA 5AJDA 3C3QA 3GYZA 2BEDA 2VSNA 4DPRA 3D9MA 1IKND 2VQ2A 3Q4AB 1HH8A 3VLFA 3T5VA 4PS8A 4F1SA 2V4HC 1TJCA 4N5QA 3Q9NC 4EBAA 3AG4E 3ZUVB 5LCWC 1TYQG 1UG3A 5HS0A 2F8YA 3W9FA 2V5FA 3AS5A 3P2BA 2ZXWE 1OCZE 3SBTB 2ETCA 3SO8A 3SI5A 1HG2A 5T4YA 4NQ0A 4O6FA 5ITZF 5ANRA 4PUCA 3JQ0A 4ANUA 2J4DA 3PRZA 2ETAA 3G2UA 3QJZA 2KZTB 4DX7D 3HXDA 3Q79A 2Q7FA 3E37A 3ZU7B 2FULA 1Q2ZA 2WXGA 1KZOA 3CQGB 1HF8A 4UQXA 3BG0B 1WY6A 4BFRA 1QBQA 5AAOA 1QNFA 5IY5E 5BUZA 3KSLA 2XRYA 1N4PA 3FH8A 4L9PA 1Y6IA 4FHKA 4I1OB 4HOQA 3C72A 4APFA 4B8AA 3PNTB 4JHRA 3LJ3A 4GPKA 2VJ8A 1DC2A 1MX2A 2DYSE 3CVQA 3FU5A 2X6KA 1TNUA 1XNFA 3K9IA 4FHJA 2EQXA 2R2LA 2AXVA 2XQ0A 3LJNA 3PZ4A 2J08A 2CHZA 2EIME 3TWTA 1YA0A 4MS6A 3C3RA 3PUKA 3Q15A 4L23A 2OEVA 4O1PA 2OCCE 5B1AE 3CGHA 3DPYA 4DI3A 3IKOB 4I1AA 4ILHB 2VSXE 3TWXA 3SGHA 4V3IA 3L16A 4J8FA 3CHSA 2DCPA 3ZYQA 4U8YD 1E8YA 3U3WA 3UTMA 3LVRE 2BF0X 3D3MA 4TXRA 2KXPC 2BKKB 3CVNA 1U3CA 5C2YA 4TRQA 1DVPA 3QK0A 5AIJA 1HS6A 1NFIE 3T8KA 1K8KG 4R7LA 5CEDB 1UW4B 5CERB 2J49A 4UI9K 3J5PA 2PQNA 4P29A 4K5AB 2RKKA 3JUEA 1P5QA 3O4ZA 3FULA 4Y6WA 4MBGA 5G55A 3HVEA 1H2TC 3TXNA 1E8WA 2FEZA 2Y1LE 5JJ7A 3QWPA 4RG6A 3DXMG 5AYWD 2X6HA 3KSQA 4GTOA 3D9JA 2X6JA 4LNBA 5JHAA 1IQUA 2XCBA 5CCLA 1FVFA 3FUEA 3FTSA 5E76A 4FADA 1O1SA 3ZYLA 4CDRA 5CBOA 1KT1A 3ZHEA 2B6CA 2MYOA 3B95A 1TN7A 4I6GA 4BSXA 3FEYA 2RFMA 1YMPA 1OXJA 4MKTA 3Q47B 4AIFA 3APDA 5BV0A 2KCVA 4JEHA 2R05A 3BQOA 3L9TA 1HE8A 4HVBA 4HOSA 1TNZA 4BT8A 5T8IA 4J8EA 3DPDA 4GCNA 3T9KA 2H6HA 3L13A 1OCRE 2CG2A 3DBSA 3ONLA 3FUMA 2ZIRA 4U07A 1N4RA 1FVHA 5FQ8A 4ANVA 3ZXPA 1LTXA 4YVQC 3MKRA 3R9AB 1QZ2A 4GZCA 1KZPA 3B7RL 4JEUA 1TNBA 2WXPA 2H6FA 5FQ4A 3T8MA 3KS2A 3SBSA 3I4RB 4AP2A 2HO1A 4WNFA 1JCSA 2WXJA 3Q9UC 3CVXA 5G04J 3APFA 2XZDG 4J8DA 3FTWA 3GZSA 3V2XA 3TWSA 3DSUA 2QYUA 4DI4A 4UWHA 3ZEFA 3FFLA 3PE3A 2X38A 4C0MA 3B7UX 3KEAA 2OOEA 3EU9A 4YDWA 3D9OA 2HR2A 4LCTA 2YQ8A 2XS1A 3ASHA 3E34A 1BI7B 1XGWA 4JA7A 5B3SE 1YYHA 5ENTD 4N2QA 4N39A 4DK5A 4XI0A 3LYAA 2AXUA 4F3VA 1TN8A 4G23A 5KNGA 2WQHA 5AARA 2F0YA 2I6HA 5JJ6A 5A23A 3ABME 4FU3A 4C9BB 4XKBA 1SZAA 2Y3AA 4N2SA 2R59A 5FWQA 2EIJE 2WXOA 2WXLA 4KT6B 2XGMA 3IHYA 1IQRA 4J0UA 3D9HA 5T3RA 5LP0A 4I9CA 2MRIA 2IO3C 2EILE 3B13A 1UJKA 3S7DA 1ELWA 1IYGA 4KVOA 4GMRA 5KJLA 3OXLA 1OY3D 4BERA 5HKPA 4EZJA 4IULA 4A3TA 3DRAA 2DBAA 2OEWA 4B8CB 4I6JA 4TV3A 4I1MA 2OVFA 2NXPA 3E4BA 3T5XA 4G8KA 4WNDA 2WXNA 3OXGA 5EIBE 4RG9A 3F6QA 2P9IG 2C2LA 3UKUG 2LO6A 2PM7A 3DEPA 5CHEE 2J07A 4ZHBA 2P58C 5BV1A 2WXHA 4G8LA 3U4TA 3C98A 3PVLA 5J90A 3CVVA 4WNEA 1TJFA 3FUHA 3E32A 1SW6A 2IONA 2I9CA 1JCQA 5ENRD 2CG3A 4HLLA 5G05C 3FU3A 1V55E 3AG2E 3MV3B 1H6PA 4TUMA 5FZQA 4J8YA 4HB5A 4LNGA 3PREA 2LSUA 5BPPA 3CV0A 3KAEA 5AQAA 1O1TA 4FLHA 2ZGDA 2WPVA 5FJYA 3FTVA 2WXRA 3LVQE 5KJKA 3ML8A 3RRNB 3PZ1A 2C0LA 2CFUA 4M3OA 3LY8A 2L6JA 2DZOA 5H7PA 1H19A 5KJMA 4ACKA 4UQZA 4LSZE 1UOHA 4ILGA 5JA4D 3UX4A 4BY6A 3ASDA 2IF4A 2P9LG 5AQ7A 2JEKA 3TWQA 5A7DB 3TWRA 2P9SG 4A1GA 4UI9J 1ZU2A 3ZFWA 1KT0A 3QKYA 4QFVA 2VGYA 4OAVB 2R03A 5FIOA 1DCQA 4GPMA 2MOWA 3EJNA 3SNXA 3PEVB 3LY7A 2UWJG 4RSYA 5FINA 4GMJA 2CHXA 4WNGA 3C3OA 4CRWA 4UQYA 2XEHA 3GZ1A 1NZNA 4BESA 4AOFA 4ZFHA 1H6KA 3TWWA 3PZ2A 3QDNA 4U0ZA 2R5SA 4HXIA 3PNLB 4FJZA 3CVLA 1WDYA 4UWGA 3SY2A 4G25A 3S2AA 4UWFA 2QYJA 4YVOA 3HVEB 3FU0A 4CCAA 3CHPA 2J4BA 3R7QA 1VDYA 3LS8A 4AM9A 2V4LA 3OXFA 2ZU6B 4PH4B 2WXFA 3CVUA 3ABKE 2CHWA 2YINA 3RRMB 1OCCE 4L7TA 3HXCA 4KZ0A 4LRZA 4BTAA 4KZCA 4I6EA 3FP3A 3HG0D 4TXQA 3ZHEB 4F7AA 3B7TA 2XCCA 3V30A 3PS6A 5C1DA 4GTSA 2IO2C 1U2VG 4GTPA 1RW2A 4GYYA 1EYHA 2PQRA 4HI8A 5ENSD 5D0QD 2BTDA 4H7XA 2V5QC 2YHCA 1H2VC 3ESLA 4XKCA 2GGFA 4HRLA 2R17C 4Q69A 4GA1A 2OV8A 4FULA 3HXFA 5LCWJ 3UM2A 2XEVA 3ZKJA 3HRAA 2XEEA 4B93B 2H6IA 4JA9A 4Q96A 2FF4A 3GZ2A 2KCKA 3QWVA 5G2NA 3SD5A 3FUDA 1K1AA 3D9KA 4YDEA 2I1KA 4PS3A 1S64A 3BU8A 3ULYA 1X5BA 3NF1A 4PS7A 5JJTA 3E30A 4UI9C 4HOUA 1LD7A 3G2SA 4O1OA 2EINE 3MKQB 2YNQA 3IV0A 3G2WA 4WWPA 1WAO1 4K5CA 5BNWA 1SA4A 3TWVA 3RJVA 3ZNGA 4GYWA 1OWLA 4JW1A 4GTTA 4B0ZA 3L82A 4G26A 4BX9A 4OVVA 5EX0A 1K3ZD 4GU5A 1E8XA 2VSOE 5EYLA 4KXKB 3QOUA 4DX5D 3JUIA 3JQ1A 1RZ4A 3HDXA 3ZXSA 3MJWA 2HE0A 4ABNA 4XZ4A 3UINC 3R7RA 1LF8A 1E96B 4MRUA 3CVWA 1NL4A 2XPYA 1ELKA 1N95A 1AWCB 1IHBA 5LFAA 3NOCD 3ABLE 2XRZA 3ZIMA 5EILA 1NA3A 4HOTA 4DX2A 5AQBA 2X3MA 3CIAA 4K5BA 3JYSA 5E75A 2XENA 1OWMA 1PC2A 2J9QA 3UKRG 2AWIA 1G3NB 3LDZA 2WMOA 4KYOB 4KMOA 4J8SA 1D8EA 1BI8B 2KZTA 4MLPA 3MGBA 3FTZA 1Z5SC 2GRNB 3FH5A 3D9LA 5AN8A 1FPPA 3RAUA 2X6IA 3NZSA 2RD0A 5LX8A 3G2VA 3EHNA 3DSWA 4CEMA 3CR3A 3HXEA 3FTXA 2JABA 5ARFA 2VYIA 3IEGA 4GB9A 3MEKA 3VTYA 3SFYA 4U0UA 4J6IA 1TNYA 3CLJA 4I2WA 2ETBA 2XPZA 4EQFA 3NQPA 1MJ0A 4U0SA 3L17A 1SQMA 3ZVVA 4LG6A 3TG4A 3IBEA 1EDUA 2E2EA 2MHKA 1IHGA 5DIZA 2LUHA 2BUGA 1MQSA 3NBNB 4HS2A 1EPUA 3EU5A 3NB2A 2EIKE 4M7CA 3G2TA 4TXPA 2WXIA 1OT8A 5CCMA 5HRYA 4E85A 4U95D 3ASNE 3AU4A 2L9BA 2GW1A 3RKVA 4IRUA 4GAAA 4HRMB 3QARA 4GA2A 3RIBA 4CT0A 2AW6A 3BUAA 2I2OA 4G1TA 3FHEA 3ESKA 2NC9A 2F8XK 5DBKA 5D66A 2IFUA 5G05J 5CRUA 4PDXA 1EF1C 1N4SA 3UI2A 3JXIA 3L54A 4HRNA 2PZIA 4ATGA 2P9UG 1MX4A 3JXJA 1W3BA 3L22A 1N9AA 4UUCA 3V2OA 4DX6D 1S0PA 3Q49B 5AJLA 3I4GA 3Q75A 5ANLA 1S63A 3DSSA 2XGOA 3CSFA 3RU0A 4GCOA 5FQ6A 2UY1A 3ZW3A 1OUVA 4AY6A 3TG5A 1Z3YA 4Z68A 4GTQA 4KBQA 3WG7E 4WWOA 4A3VA 4WWNA 4JL0A 4JD2G 4XIFA 1OWNA 3Q73A 4HBDA 2DWZA 3DSVA 1U3DA 2L6BA 5FZRA 5CMWA 2WB2A 4I17A 4L2YA 2OVBA 3C5RA 4AJWA 4GZ6A 3FH7A 2WXMA 1YCSB 3HXBA 1S70B 2WMNA 3CHRA 1QQEA 1LD8A 4OVUA 2GRMA 2GRLA 4G24A 1L5JA 3D9IA 4GZ3A 1HXIA 4L1BA 2GRRB 5AENA 4GZDA 3DSTA 1WG0A 2A4ZA 3JCKC 3UM1A 3QAQA 4APOA 3MX3A 3ZYKA 1OWPA 4I9EA 3ZRHA 2C0MA 3ML9A 5CECB 5FZSA 2F37A 4BETA 3UIOC 1KLXA 4HLEA 1PAQA 4B94A 3UT8A 2B0OE 2GRPB 3KEZA 3MCXA 4ANXA 2IU1A 2R02A 4OAUC 3UMVA 2Y0BG 4UWKA 1TN6A 4ILIA 3S7JA 3AS8A 1TEZA 2VTBA 4FA6A 2AXZA 4D10C 4JZYA 4EBAG 3ZGQA 2M63A 3CSTA 1BLXB 4N3AA 1MX6A 3TAXA 1UN9A 1NA0A 5HQ8A 2ILRA 2HM8A 5EKQD 4DLQA 1FT2A 4EPZA 1E7VA 3DWLG 3FUKA 3Q7FA 4CDMA 2VGEA 3OAWA 3QWWA 3IXEA 1D9SA 4UWLA 3Q7AA 4AEZC 4EZKA 3LEWA 1BU9A 3EDTB 2AJAA 3L6AA 2IQCA 3MV2B 3AG3E 3CEQA 3O48A 3MYVA 4RLYA 4XX5A 2ZGGA 5ENPD 1HFAA 3B7BA 4EZLA 1Z6TA 2J09A 3RRUA 1NI1A 3FU6A 2QFCA 4N3BA 1BD8A 2H6GA 4BWRA 3PE4A 3CVYA 3CHOA 2VSYA 3CKBA 4NIKA 4BX8A 5B1BE 1UN8A 1E90A 5CRVA 4QQIA 4JHJA 1B89A 4ATZD 3FTYA 4U7EB 2IOLA 5BW8C 4DRXE 4KVMA 4U8VD 1N54A 2P2CP 1KPSB 4FP7A 1N11A 4C0EA 4HNAD 5J08A 4JXTA 3CHMA 3OTNA 1O1RA 4U8HA 3ULEG 3S7BA 3UIPC 4TUUA 3SF4A 2QC9A 5EN5D 3CVPA 5FTPA 3SFXA 3S7FA 4GZ5A 4N3CA 4GYOA 2NSZA 2WQ6A 4XE0A 2WXQA 3DSXA 1HG5A 3ENEA 1DNPA 3ZYMA 2PNNA 5BXOA 5D2MC 3ULQA 2IOSA 4CDNA 2AVPA 4JVSA 4GTVA 1N52A 4I43A 4JC8A 3VLEA 4K0RA 2LNIA 3FWVA 2WQ7A 1A17A 1MZCA 3NOGD 3RK6A 2LXMA 3UT7A 4CZ2D 3BG1B 4YDYA 4X8QA 4HORA 2NYJA 4GMLA 1N0QA 4AXHA 5ENOD 3W9GA 1ZBPA 2FI7A 3QB2A 2KC7A 3AS4A 3RO2A 4DUIA 5EDSA 4LNUD 3VTXA 2PL2A 4H7YA 1SA5A 2A5UA 4I2ZA 3FUFA 3L08A 4C48B 2VGXA 3MZLB 5KBAA 4CYMD 3V31A 2ZISA 1IXVA 3EHMA 1N4QA 2L0IA 2IY0C 4E6HA 1JUQA 3ASFA 4JPSA 3NAWA 2IJGX 4WUYA 3MKQA 1ELRA 4HQDA 3U66A 5EX3A 1OWOA 1JPLA 4NRHB 2LAHA 1TR4A 1TNOA 2ONDA 2FBNA 4A63B 2BKGA 4OYSA 3CHQA 1AP7A 3SFZA 2DVWA 5CBNA 3FUNA 4GTRA 1JWFA 2X6FA 3PUJA 3VLDA 3TXMA 3SQVA 4Y6CA 1HX8A 3P1UA 3UXGA 2YHEA 1D8DA 1JCRA 3E33A 1HZ4A 2WVIA
chains in the Genus database with same CATH topology
1FT1A 1S64A 2H6GA 3KSQA 1D8EA 4GTOA 3PZ1A 4LNBA 3DSUA 3E30A 2BEDA 2IEJA 1N4SA 3Q78A 1LD7A 1TNUA 1O1SA 2R2LA 1FPPA 3PZ4A 3PZ3A 1N9AA 1TN7A 3DSWA 1SA4A 3HXEA 3Q75A 1SA5A 3E34A 1O1RA 3HXCA 1S63A 3DPYA 3DSSA 4GTTA 1TN6A 3SFYA 1TNZA 3EUVA 1TNYA 3SFXA 3E32A 2H6HA 4GTSA 2ZISA 1TN8A 1N4QA 4GTPA 4GTQA 3HXDA 3Q79A 3E37A 1FT2A 1JCQA 2F0YA 3DSXA 4YDOA 1KZOA 2ZIRA 3Q7FA 3Q73A 1X81A 3DSVA 3EU5A 1N4RA 1NL4A 1LTXA 3Q7AA 4EHMA 1N95A 1TNOA 1QBQA 3HXFA 4GTVA 1O5MA 4LNGA 3HXBA 4GTMA 2H6IA 1KZPA 1LD8A 3KSLA 3PZ2A 1N94A 1TNBA 1O1TA 4GTRA 1N4PA 2H6FA 4L9PA 4MBGA 1MZCA 1DCEA 3C72A 1JCRA 1D8DA 1NI1A 1JCSA 4YDEA 3E33A 3DSTA 3DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FT1 A;  1S64 A;  2H6G A;  3KSQ A;  1D8E A;  4GTO A;  3PZ1 A;  4LNB A;  3DSU A;  3E30 A;  2BED A;  2IEJ A;  1N4S A;  3Q78 A;  1LD7 A;  1TNU A;  1O1S A;  2R2L A;  1FPP A;  3PZ4 A;  3PZ3 A;  1N9A A;  1TN7 A;  3DSW A;  1SA4 A;  3HXE A;  3Q75 A;  1SA5 A;  3E34 A;  1O1R A;  3HXC A;  1S63 A;  3DPY A;  3DSS A;  4GTT A;  1TN6 A;  3SFY A;  1TNZ A;  3EUV A;  1TNY A;  3SFX A;  3E32 A;  2H6H A;  4GTS A;  2ZIS A;  1TN8 A;  1N4Q A;  4GTP A;  4GTQ A;  3HXD A;  3Q79 A;  3E37 A;  1FT2 A;  1JCQ A;  2F0Y A;  3DSX A;  4YDO A;  1KZO A;  2ZIR A;  3Q7F A;  3Q73 A;  1X81 A;  3DSV A;  3EU5 A;  1N4R A;  1NL4 A;  1LTX A;  3Q7A A;  4EHM A;  1N95 A;  1TNO A;  1QBQ A;  3HXF A;  4GTV A;  1O5M A;  4LNG A;  3HXB A;  4GTM A;  2H6I A;  1KZP A;  1LD8 A;  3KSL A;  3PZ2 A;  1N94 A;  1TNB A;  1O1T A;  4GTR A;  1N4P A;  2H6F A;  4L9P A;  4MBG A;  1MZC A;  1DCE A;  3C72 A;  1JCR A;  1D8D A;  1NI1 A;  1JCS A;  4YDE A;  3E33 A;  3DST A;  3DRA A; 
#chains in the Genus database with same CATH topology
 3RSE G;  2QY7 A;  4FLB A;  2FO1 E;  4GA0 A;  5D0O D;  2IEJ A;  2CFZ A;  3Q78 A;  3I5P A;  3GW4 A;  4ACL A;  2DIW A;  3FY4 A;  4HI9 A;  1NP7 A;  4LEU A;  1HU3 A;  3B7S A;  1HO8 A;  2LAI A;  4DLO A;  3UM3 A;  3HIZ A;  3AU5 A;  4A55 A;  3BEE A;  4O60 A;  2L0T B;  3LXU X;  4CT4 A;  3UPV A;  5AQ9 A;  4IYP A;  3PH0 C;  4HFG A;  4U96 D;  3V79 K;  3RO3 A;  4J7W A;  3ONK A;  2V0P A;  2VTB B;  3IHV A;  3APC A;  5M72 A;  1INZ A;  5BT1 A;  5BXU A;  1JWG A;  2JLB A;  4BSZ B;  2KAT A;  3J5Q B;  1MHQ A;  4A1S A;  4EHM A;  3UM0 A;  2QZA A;  3EIQ C;  2HYZ A;  3X2Q E;  2WM9 A;  3SHF A;  1O5M A;  4LER A;  2FO7 A;  1E8Z A;  2Y4U A;  4DX1 A;  5G04 C;  4FC8 A;  4RQI A;  2DZN A;  5KNH D;  4DJA A;  5EYP F;  3HHM A;  1DCE A;  3DEO A;  4AY5 A;  3ZPJ A;  2LXL A;  4JHK A;  1SZ9 A;  4AVX A;  4G2V A;  1QYM A;  2RG8 A;  3ASO E;  3Q5M A;  4U04 A;  3FTU A;  4F6R D;  2WXK A;  1MYO A;  5CMY A;  3ZN3 A;  3FEX A;  3U64 A;  4JB8 P;  3QNK A;  3CQC B;  3LKU A;  3FUJ A;  4G11 A;  3CK7 A;  4RVB A;  5LOZ A;  5FT9 A;  1ZB1 A;  2V8S E;  5JHB A;  4CGV A;  1V54 E;  3D9N A;  4W9R A;  1H0A A;  3CK8 A;  3UT4 A;  1BPO A;  2XPI A;  4EEC A;  4BT9 A;  3UUX A;  3EUV A;  2DYR E;  2XHE A;  3KD7 A;  2KCL A;  5JMN D;  5CEA A;  3AAA C;  4BTB A;  5A6C A;  5HI7 A;  2VGX B;  4K03 A;  4YDO A;  3I3N A;  2I1J A;  1X81 A;  3PDN A;  4F1P A;  3EHQ A;  1WM5 A;  4B89 A;  4NUR A;  3PZD A;  1SVX A;  3MA5 A;  1K1B A;  2GRO B;  3R9M A;  3NZU A;  3DXK G;  4YND A;  4XI9 A;  1N94 A;  1OCO E;  3EIJ A;  1A5E A;  3FUI A;  4IN3 B;  2P9K G;  4AV7 A;  3AG1 E;  3TL5 A;  1E7U A;  1Y8M A;  1FT1 A;  2Y4T A;  2LSV A;  4U63 A;  3TGO A;  5ARG A;  5FQ7 A;  2XGS A;  2A5E A;  5KJN A;  2XZT G;  3CK9 A;  2UY1 B;  3PZ3 A;  3SZ7 A;  3LY9 A;  3TJP A;  3U9W A;  4Q94 A;  1UJJ A;  2KM4 A;  2XS8 A;  3FDH A;  1GW6 A;  4CGW A;  3UQ3 A;  3AJI A;  4URK A;  4L2L A;  2P9N G;  4N5C A;  2PM6 A;  4ME2 A;  3LCA A;  1H6O A;  4FJY A;  4BEP A;  4LUN U;  4WAF A;  3ASG A;  3URZ A;  2KBX A;  3QC1 A;  5KCM A;  5ENN A;  3N71 A;  3WXX A;  4XEI G;  5ENQ D;  2E0I A;  2Y69 E;  2RFA A;  5EID A;  3LPZ A;  2GRQ B;  3ISM C;  2P9P G;  4F53 A;  3PEU B;  5KWD A;  1H2U A;  3CKC A;  1FCH A;  3D9P A;  4GTM A;  4ANW A;  1N0R A;  3HYM B;  2J8S D;  3TWU A;  1PY1 A;  1Z3X A;  3EHR A;  4NAC A;  5AJD A;  3C3Q A;  3GYZ A;  2BED A;  2VSN A;  4DPR A;  3D9M A;  1IKN D;  2VQ2 A;  3Q4A B;  1HH8 A;  3VLF A;  3T5V A;  4PS8 A;  4F1S A;  2V4H C;  1TJC A;  4N5Q A;  3Q9N C;  4EBA A;  3AG4 E;  3ZUV B;  5LCW C;  1TYQ G;  1UG3 A;  5HS0 A;  2F8Y A;  3W9F A;  2V5F A;  3AS5 A;  3P2B A;  2ZXW E;  1OCZ E;  3SBT B;  2ETC A;  3SO8 A;  3SI5 A;  1HG2 A;  5T4Y A;  4NQ0 A;  4O6F A;  5ITZ F;  5ANR A;  4PUC A;  3JQ0 A;  4ANU A;  2J4D A;  3PRZ A;  2ETA A;  3G2U A;  3QJZ A;  2KZT B;  4DX7 D;  3HXD A;  3Q79 A;  2Q7F A;  3E37 A;  3ZU7 B;  2FUL A;  1Q2Z A;  2WXG A;  1KZO A;  3CQG B;  1HF8 A;  4UQX A;  3BG0 B;  1WY6 A;  4BFR A;  1QBQ A;  5AAO A;  1QNF A;  5IY5 E;  5BUZ A;  3KSL A;  2XRY A;  1N4P A;  3FH8 A;  4L9P A;  1Y6I A;  4FHK A;  4I1O B;  4HOQ A;  3C72 A;  4APF A;  4B8A A;  3PNT B;  4JHR A;  3LJ3 A;  4GPK A;  2VJ8 A;  1DC2 A;  1MX2 A;  2DYS E;  3CVQ A;  3FU5 A;  2X6K A;  1TNU A;  1XNF A;  3K9I A;  4FHJ A;  2EQX A;  2R2L A;  2AXV A;  2XQ0 A;  3LJN A;  3PZ4 A;  2J08 A;  2CHZ A;  2EIM E;  3TWT A;  1YA0 A;  4MS6 A;  3C3R A;  3PUK A;  3Q15 A;  4L23 A;  2OEV A;  4O1P A;  2OCC E;  5B1A E;  3CGH A;  3DPY A;  4DI3 A;  3IKO B;  4I1A A;  4ILH B;  2VSX E;  3TWX A;  3SGH A;  4V3I A;  3L16 A;  4J8F A;  3CHS A;  2DCP A;  3ZYQ A;  4U8Y D;  1E8Y A;  3U3W A;  3UTM A;  3LVR E;  2BF0 X;  3D3M A;  4TXR A;  2KXP C;  2BKK B;  3CVN A;  1U3C A;  5C2Y A;  4TRQ A;  1DVP A;  3QK0 A;  5AIJ A;  1HS6 A;  1NFI E;  3T8K A;  1K8K G;  4R7L A;  5CED B;  1UW4 B;  5CER B;  2J49 A;  4UI9 K;  3J5P A;  2PQN A;  4P29 A;  4K5A B;  2RKK A;  3JUE A;  1P5Q A;  3O4Z A;  3FUL A;  4Y6W A;  4MBG A;  5G55 A;  3HVE A;  1H2T C;  3TXN A;  1E8W A;  2FEZ A;  2Y1L E;  5JJ7 A;  3QWP A;  4RG6 A;  3DXM G;  5AYW D;  2X6H A;  3KSQ A;  4GTO A;  3D9J A;  2X6J A;  4LNB A;  5JHA A;  1IQU A;  2XCB A;  5CCL A;  1FVF A;  3FUE A;  3FTS A;  5E76 A;  4FAD A;  1O1S A;  3ZYL A;  4CDR A;  5CBO A;  1KT1 A;  3ZHE A;  2B6C A;  2MYO A;  3B95 A;  1TN7 A;  4I6G A;  4BSX A;  3FEY A;  2RFM A;  1YMP A;  1OXJ A;  4MKT A;  3Q47 B;  4AIF A;  3APD A;  5BV0 A;  2KCV A;  4JEH A;  2R05 A;  3BQO A;  3L9T A;  1HE8 A;  4HVB A;  4HOS A;  1TNZ A;  4BT8 A;  5T8I A;  4J8E A;  3DPD A;  4GCN A;  3T9K A;  2H6H A;  3L13 A;  1OCR E;  2CG2 A;  3DBS A;  3ONL A;  3FUM A;  2ZIR A;  4U07 A;  1N4R A;  1FVH A;  5FQ8 A;  4ANV A;  3ZXP A;  1LTX A;  4YVQ C;  3MKR A;  3R9A B;  1QZ2 A;  4GZC A;  1KZP A;  3B7R L;  4JEU A;  1TNB A;  2WXP A;  2H6F A;  5FQ4 A;  3T8M A;  3KS2 A;  3SBS A;  3I4R B;  4AP2 A;  2HO1 A;  4WNF A;  1JCS A;  2WXJ A;  3Q9U C;  3CVX A;  5G04 J;  3APF A;  2XZD G;  4J8D A;  3FTW A;  3GZS A;  3V2X A;  3TWS A;  3DSU A;  2QYU A;  4DI4 A;  4UWH A;  3ZEF A;  3FFL A;  3PE3 A;  2X38 A;  4C0M A;  3B7U X;  3KEA A;  2OOE A;  3EU9 A;  4YDW A;  3D9O A;  2HR2 A;  4LCT A;  2YQ8 A;  2XS1 A;  3ASH A;  3E34 A;  1BI7 B;  1XGW A;  4JA7 A;  5B3S E;  1YYH A;  5ENT D;  4N2Q A;  4N39 A;  4DK5 A;  4XI0 A;  3LYA A;  2AXU A;  4F3V A;  1TN8 A;  4G23 A;  5KNG A;  2WQH A;  5AAR A;  2F0Y A;  2I6H A;  5JJ6 A;  5A23 A;  3ABM E;  4FU3 A;  4C9B B;  4XKB A;  1SZA A;  2Y3A A;  4N2S A;  2R59 A;  5FWQ A;  2EIJ E;  2WXO A;  2WXL A;  4KT6 B;  2XGM A;  3IHY A;  1IQR A;  4J0U A;  3D9H A;  5T3R A;  5LP0 A;  4I9C A;  2MRI A;  2IO3 C;  2EIL E;  3B13 A;  1UJK A;  3S7D A;  1ELW A;  1IYG A;  4KVO A;  4GMR A;  5KJL A;  3OXL A;  1OY3 D;  4BER A;  5HKP A;  4EZJ A;  4IUL A;  4A3T A;  3DRA A;  2DBA A;  2OEW A;  4B8C B;  4I6J A;  4TV3 A;  4I1M A;  2OVF A;  2NXP A;  3E4B A;  3T5X A;  4G8K A;  4WND A;  2WXN A;  3OXG A;  5EIB E;  4RG9 A;  3F6Q A;  2P9I G;  2C2L A;  3UKU G;  2LO6 A;  2PM7 A;  3DEP A;  5CHE E;  2J07 A;  4ZHB A;  2P58 C;  5BV1 A;  2WXH A;  4G8L A;  3U4T A;  3C98 A;  3PVL A;  5J90 A;  3CVV A;  4WNE A;  1TJF A;  3FUH A;  3E32 A;  1SW6 A;  2ION A;  2I9C A;  1JCQ A;  5ENR D;  2CG3 A;  4HLL A;  5G05 C;  3FU3 A;  1V55 E;  3AG2 E;  3MV3 B;  1H6P A;  4TUM A;  5FZQ A;  4J8Y A;  4HB5 A;  4LNG A;  3PRE A;  2LSU A;  5BPP A;  3CV0 A;  3KAE A;  5AQA A;  1O1T A;  4FLH A;  2ZGD A;  2WPV A;  5FJY A;  3FTV A;  2WXR A;  3LVQ E;  5KJK A;  3ML8 A;  3RRN B;  3PZ1 A;  2C0L A;  2CFU A;  4M3O A;  3LY8 A;  2L6J A;  2DZO A;  5H7P A;  1H19 A;  5KJM A;  4ACK A;  4UQZ A;  4LSZ E;  1UOH A;  4ILG A;  5JA4 D;  3UX4 A;  4BY6 A;  3ASD A;  2IF4 A;  2P9L G;  5AQ7 A;  2JEK A;  3TWQ A;  5A7D B;  3TWR A;  2P9S G;  4A1G A;  4UI9 J;  1ZU2 A;  3ZFW A;  1KT0 A;  3QKY A;  4QFV A;  2VGY A;  4OAV B;  2R03 A;  5FIO A;  1DCQ A;  4GPM A;  2MOW A;  3EJN A;  3SNX A;  3PEV B;  3LY7 A;  2UWJ G;  4RSY A;  5FIN A;  4GMJ A;  2CHX A;  4WNG A;  3C3O A;  4CRW A;  4UQY A;  2XEH A;  3GZ1 A;  1NZN A;  4BES A;  4AOF A;  4ZFH A;  1H6K A;  3TWW A;  3PZ2 A;  3QDN A;  4U0Z A;  2R5S A;  4HXI A;  3PNL B;  4FJZ A;  3CVL A;  1WDY A;  4UWG A;  3SY2 A;  4G25 A;  3S2A A;  4UWF A;  2QYJ A;  4YVO A;  3HVE B;  3FU0 A;  4CCA A;  3CHP A;  2J4B A;  3R7Q A;  1VDY A;  3LS8 A;  4AM9 A;  2V4L A;  3OXF A;  2ZU6 B;  4PH4 B;  2WXF A;  3CVU A;  3ABK E;  2CHW A;  2YIN A;  3RRM B;  1OCC E;  4L7T A;  3HXC A;  4KZ0 A;  4LRZ A;  4BTA A;  4KZC A;  4I6E A;  3FP3 A;  3HG0 D;  4TXQ A;  3ZHE B;  4F7A A;  3B7T A;  2XCC A;  3V30 A;  3PS6 A;  5C1D A;  4GTS A;  2IO2 C;  1U2V G;  4GTP A;  1RW2 A;  4GYY A;  1EYH A;  2PQR A;  4HI8 A;  5ENS D;  5D0Q D;  2BTD A;  4H7X A;  2V5Q C;  2YHC A;  1H2V C;  3ESL A;  4XKC A;  2GGF A;  4HRL A;  2R17 C;  4Q69 A;  4GA1 A;  2OV8 A;  4FUL A;  3HXF A;  5LCW J;  3UM2 A;  2XEV A;  3ZKJ A;  3HRA A;  2XEE A;  4B93 B;  2H6I A;  4JA9 A;  4Q96 A;  2FF4 A;  3GZ2 A;  2KCK A;  3QWV A;  5G2N A;  3SD5 A;  3FUD A;  1K1A A;  3D9K A;  4YDE A;  2I1K A;  4PS3 A;  1S64 A;  3BU8 A;  3ULY A;  1X5B A;  3NF1 A;  4PS7 A;  5JJT A;  3E30 A;  4UI9 C;  4HOU A;  1LD7 A;  3G2S A;  4O1O A;  2EIN E;  3MKQ B;  2YNQ A;  3IV0 A;  3G2W A;  4WWP A;  1WAO 1;  4K5C A;  5BNW A;  1SA4 A;  3TWV A;  3RJV A;  3ZNG A;  4GYW A;  1OWL A;  4JW1 A;  4GTT A;  4B0Z A;  3L82 A;  4G26 A;  4BX9 A;  4OVV A;  5EX0 A;  1K3Z D;  4GU5 A;  1E8X A;  2VSO E;  5EYL A;  4KXK B;  3QOU A;  4DX5 D;  3JUI A;  3JQ1 A;  1RZ4 A;  3HDX A;  3ZXS A;  3MJW A;  2HE0 A;  4ABN A;  4XZ4 A;  3UIN C;  3R7R A;  1LF8 A;  1E96 B;  4MRU A;  3CVW A;  1NL4 A;  2XPY A;  1ELK A;  1N95 A;  1AWC B;  1IHB A;  5LFA A;  3NOC D;  3ABL E;  2XRZ A;  3ZIM A;  5EIL A;  1NA3 A;  4HOT A;  4DX2 A;  5AQB A;  2X3M A;  3CIA A;  4K5B A;  3JYS A;  5E75 A;  2XEN A;  1OWM A;  1PC2 A;  2J9Q A;  3UKR G;  2AWI A;  1G3N B;  3LDZ A;  2WMO A;  4KYO B;  4KMO A;  4J8S A;  1D8E A;  1BI8 B;  2KZT A;  4MLP A;  3MGB A;  3FTZ A;  1Z5S C;  2GRN B;  3FH5 A;  3D9L A;  5AN8 A;  1FPP A;  3RAU A;  2X6I A;  3NZS A;  2RD0 A;  5LX8 A;  3G2V A;  3EHN A;  3DSW A;  4CEM A;  3CR3 A;  3HXE A;  3FTX A;  2JAB A;  5ARF A;  2VYI A;  3IEG A;  4GB9 A;  3MEK A;  3VTY A;  3SFY A;  4U0U A;  4J6I A;  1TNY A;  3CLJ A;  4I2W A;  2ETB A;  2XPZ A;  4EQF A;  3NQP A;  1MJ0 A;  4U0S A;  3L17 A;  1SQM A;  3ZVV A;  4LG6 A;  3TG4 A;  3IBE A;  1EDU A;  2E2E A;  2MHK A;  1IHG A;  5DIZ A;  2LUH A;  2BUG A;  1MQS A;  3NBN B;  4HS2 A;  1EPU A;  3EU5 A;  3NB2 A;  2EIK E;  4M7C A;  3G2T A;  4TXP A;  2WXI A;  1OT8 A;  5CCM A;  5HRY A;  4E85 A;  4U95 D;  3ASN E;  3AU4 A;  2L9B A;  2GW1 A;  3RKV A;  4IRU A;  4GAA A;  4HRM B;  3QAR A;  4GA2 A;  3RIB A;  4CT0 A;  2AW6 A;  3BUA A;  2I2O A;  4G1T A;  3FHE A;  3ESK A;  2NC9 A;  2F8X K;  5DBK A;  5D66 A;  2IFU A;  5G05 J;  5CRU A;  4PDX A;  1EF1 C;  1N4S A;  3UI2 A;  3JXI A;  3L54 A;  4HRN A;  2PZI A;  4ATG A;  2P9U G;  1MX4 A;  3JXJ A;  1W3B A;  3L22 A;  1N9A A;  4UUC A;  3V2O A;  4DX6 D;  1S0P A;  3Q49 B;  5AJL A;  3I4G A;  3Q75 A;  5ANL A;  1S63 A;  3DSS A;  2XGO A;  3CSF A;  3RU0 A;  4GCO A;  5FQ6 A;  2UY1 A;  3ZW3 A;  1OUV A;  4AY6 A;  3TG5 A;  1Z3Y A;  4Z68 A;  4GTQ A;  4KBQ A;  3WG7 E;  4WWO A;  4A3V A;  4WWN A;  4JL0 A;  4JD2 G;  4XIF A;  1OWN A;  3Q73 A;  4HBD A;  2DWZ A;  3DSV A;  1U3D A;  2L6B A;  5FZR A;  5CMW A;  2WB2 A;  4I17 A;  4L2Y A;  2OVB A;  3C5R A;  4AJW A;  4GZ6 A;  3FH7 A;  2WXM A;  1YCS B;  3HXB A;  1S70 B;  2WMN A;  3CHR A;  1QQE A;  1LD8 A;  4OVU A;  2GRM A;  2GRL A;  4G24 A;  1L5J A;  3D9I A;  4GZ3 A;  1HXI A;  4L1B A;  2GRR B;  5AEN A;  4GZD A;  3DST A;  1WG0 A;  2A4Z A;  3JCK C;  3UM1 A;  3QAQ A;  4APO A;  3MX3 A;  3ZYK A;  1OWP A;  4I9E A;  3ZRH A;  2C0M A;  3ML9 A;  5CEC B;  5FZS A;  2F37 A;  4BET A;  3UIO C;  1KLX A;  4HLE A;  1PAQ A;  4B94 A;  3UT8 A;  2B0O E;  2GRP B;  3KEZ A;  3MCX A;  4ANX A;  2IU1 A;  2R02 A;  4OAU C;  3UMV A;  2Y0B G;  4UWK A;  1TN6 A;  4ILI A;  3S7J A;  3AS8 A;  1TEZ A;  2VTB A;  4FA6 A;  2AXZ A;  4D10 C;  4JZY A;  4EBA G;  3ZGQ A;  2M63 A;  3CST A;  1BLX B;  4N3A A;  1MX6 A;  3TAX A;  1UN9 A;  1NA0 A;  5HQ8 A;  2ILR A;  2HM8 A;  5EKQ D;  4DLQ A;  1FT2 A;  4EPZ A;  1E7V A;  3DWL G;  3FUK A;  3Q7F A;  4CDM A;  2VGE A;  3OAW A;  3QWW A;  3IXE A;  1D9S A;  4UWL A;  3Q7A A;  4AEZ C;  4EZK A;  3LEW A;  1BU9 A;  3EDT B;  2AJA A;  3L6A A;  2IQC A;  3MV2 B;  3AG3 E;  3CEQ A;  3O48 A;  3MYV A;  4RLY A;  4XX5 A;  2ZGG A;  5ENP D;  1HFA A;  3B7B A;  4EZL A;  1Z6T A;  2J09 A;  3RRU A;  1NI1 A;  3FU6 A;  2QFC A;  4N3B A;  1BD8 A;  2H6G A;  4BWR A;  3PE4 A;  3CVY A;  3CHO A;  2VSY A;  3CKB A;  4NIK A;  4BX8 A;  5B1B E;  1UN8 A;  1E90 A;  5CRV A;  4QQI A;  4JHJ A;  1B89 A;  4ATZ D;  3FTY A;  4U7E B;  2IOL A;  5BW8 C;  4DRX E;  4KVM A;  4U8V D;  1N54 A;  2P2C P;  1KPS B;  4FP7 A;  1N11 A;  4C0E A;  4HNA D;  5J08 A;  4JXT A;  3CHM A;  3OTN A;  1O1R A;  4U8H A;  3ULE G;  3S7B A;  3UIP C;  4TUU A;  3SF4 A;  2QC9 A;  5EN5 D;  3CVP A;  5FTP A;  3SFX A;  3S7F A;  4GZ5 A;  4N3C A;  4GYO A;  2NSZ A;  2WQ6 A;  4XE0 A;  2WXQ A;  3DSX A;  1HG5 A;  3ENE A;  1DNP A;  3ZYM A;  2PNN A;  5BXO A;  5D2M C;  3ULQ A;  2IOS A;  4CDN A;  2AVP A;  4JVS A;  4GTV A;  1N52 A;  4I43 A;  4JC8 A;  3VLE A;  4K0R A;  2LNI A;  3FWV A;  2WQ7 A;  1A17 A;  1MZC A;  3NOG D;  3RK6 A;  2LXM A;  3UT7 A;  4CZ2 D;  3BG1 B;  4YDY A;  4X8Q A;  4HOR A;  2NYJ A;  4GML A;  1N0Q A;  4AXH A;  5ENO D;  3W9G A;  1ZBP A;  2FI7 A;  3QB2 A;  2KC7 A;  3AS4 A;  3RO2 A;  4DUI A;  5EDS A;  4LNU D;  3VTX A;  2PL2 A;  4H7Y A;  1SA5 A;  2A5U A;  4I2Z A;  3FUF A;  3L08 A;  4C48 B;  2VGX A;  3MZL B;  5KBA A;  4CYM D;  3V31 A;  2ZIS A;  1IXV A;  3EHM A;  1N4Q A;  2L0I A;  2IY0 C;  4E6H A;  1JUQ A;  3ASF A;  4JPS A;  3NAW A;  2IJG X;  4WUY A;  3MKQ A;  1ELR A;  4HQD A;  3U66 A;  5EX3 A;  1OWO A;  1JPL A;  4NRH B;  2LAH A;  1TR4 A;  1TNO A;  2OND A;  2FBN A;  4A63 B;  2BKG A;  4OYS A;  3CHQ A;  1AP7 A;  3SFZ A;  2DVW A;  5CBN A;  3FUN A;  4GTR A;  1JWF A;  2X6F A;  3PUJ A;  3VLD A;  3TXM A;  3SQV A;  4Y6C A;  1HX8 A;  3P1U A;  3UXG A;  2YHE A;  1D8D A;  1JCR A;  3E33 A;  1HZ4 A;  2WVI A; 
#chains in the Genus database with same CATH homology
 1FT1 A;  1S64 A;  2H6G A;  3KSQ A;  1D8E A;  4GTO A;  3PZ1 A;  4LNB A;  3DSU A;  3E30 A;  2BED A;  2IEJ A;  1N4S A;  3Q78 A;  1LD7 A;  1TNU A;  1O1S A;  2R2L A;  1FPP A;  3PZ4 A;  3PZ3 A;  1N9A A;  1TN7 A;  3DSW A;  1SA4 A;  3HXE A;  3Q75 A;  1SA5 A;  3E34 A;  1O1R A;  3HXC A;  1S63 A;  3DPY A;  3DSS A;  4GTT A;  1TN6 A;  3SFY A;  1TNZ A;  3EUV A;  1TNY A;  3SFX A;  3E32 A;  2H6H A;  4GTS A;  2ZIS A;  1TN8 A;  1N4Q A;  4GTP A;  4GTQ A;  3HXD A;  3Q79 A;  3E37 A;  1FT2 A;  1JCQ A;  2F0Y A;  3DSX A;  4YDO A;  1KZO A;  2ZIR A;  3Q7F A;  3Q73 A;  1X81 A;  3DSV A;  3EU5 A;  1N4R A;  1NL4 A;  1LTX A;  3Q7A A;  4EHM A;  1N95 A;  1TNO A;  1QBQ A;  3HXF A;  4GTV A;  1O5M A;  4LNG A;  3HXB A;  4GTM A;  2H6I A;  1KZP A;  1LD8 A;  3KSL A;  3PZ2 A;  1N94 A;  1TNB A;  1O1T A;  4GTR A;  1N4P A;  2H6F A;  4L9P A;  4MBG A;  1MZC A;  1DCE A;  3C72 A;  1JCR A;  1D8D A;  1NI1 A;  1JCS A;  4YDE A;  3E33 A;  3DST A;  3DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...