1O1RA

Structure of fpt bound to ggpp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
315
structure length
315
Chain Sequence
b'GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Biochemical and Structural Studies with Prenyl Diphosphate Analogues Provide Insights into Isoprenoid Recognition by Protein Farnesyl Transferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 123
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o1rA00
1X81A 1QBQA 3PZ2A 3DSWA 1TN7A 1JCQA 1SA5A 4L9PA 3Q79A 3DSSA 3KSLA 3Q78A 1N4SA 1FT2A 1O1SA 3HXCA 1TNZA 4GTPA 3EUVA 1N4RA 3C72A 1D8EA 1N9AA 3HXBA 4MBGA 3DPYA 2ZISA 4LNBA 4GTSA 1LD7A 4GTOA 2H6FA 1S64A 3SFYA 3Q7FA 1TNYA 3E34A 3HXDA 3E33A 1KZOA 3Q7AA 2F0YA 2H6IA 3KSQA 1NL4A 3DSVA 3E32A 4GTRA 3PZ3A 1TN6A 4GTQA 1N4PA 1TNBA 3DSTA 1TNUA 1O1RA 4YDOA 2IEJA 1O1TA 1LD8A 4YDEA 3Q73A 3HXFA 3EU5A 1FT1A 3DSXA 1O5MA 3DSUA 1N95A 1S63A 3SFXA 3Q75A 1JCSA 1N94A 1NI1A 2H6HA 2R2LA 2BEDA 1LTXA 3E30A 4GTTA 4GTVA 1D8DA 3PZ1A 3PZ4A 4GTMA 1DCEA 3DRAA 1SA4A 3E37A 1JCRA 1N4QA 4EHMA 1TNOA 1TN8A 1FPPA 3HXEA 1MZCA 2ZIRA 1KZPA 4LNGA 2H6GA
chains in the Genus database with same CATH superfamily
4DPRA 4UI9J 3FUIA 3I4GA 3GW4A 3NBNB 5E75A 2WXGA 2YHCA 4UWGA 4FHJA 5KWDA 3PDNA 3L6AA 3PUJA 2VGEA 3UUXA 3R9MA 4NQ0A 4KBQA 3P1UA 4C48B 3Q7FA 3KEAA 3ZXPA 1TNYA 4CDRA 4XIFA 3PE3A 3UM0A 1OXJA 3IXEA 3ULYA 5AYWD 3SHFA 1DVPA 1UW4B 1QNFA 4XKCA 1N4PA 1SW6A 5M72A 2V5QC 4HQDA 1U3CA 4F53A 2QFCA 4C9BB 3ESLA 4HB5A 4F7AA 3PVLA 3HRAA 2MRIA 2AJAA 4NACA 3CVQA 3MJWA 2PZIA 5FQ7A 5KCMA 3L17A 1OY3D 2I1JA 3CVNA 3LXUX 1ZU2A 3LVRE 2GRLA 2Y69E 3D3MA 1H6KA 1UOHA 1DNPA 2CG3A 3UTMA 3X2QE 1FPPA 1H2TC 4I6GA 5H7PA 3L54A 3LYAA 4BT8A 5ARGA 2WXPA 1UJKA 4O1PA 2CFZA 2WQ7A 2WQ6A 3MYVA 3OXFA 1SZ9A 3DSSA 1UJJA 5CRUA 2VYIA 2MOWA 4QFVA 5ENNA 1O1SA 4F1PA 3AS5A 4GTPA 2XEVA 4CZ2D 4A1GA 3OXGA 3MKQB 4MRUA 3FUHA 3BEEA 1YA0A 4E6HA 4IRUA 4PS3A 4GZ5A 3LY9A 4I6EA 3CKCA 3TXNA 2EIJE 5BXUA 1NL4A 4GPMA 4TRQA 2V8SE 4TV3A 1E8ZA 5KNGA 3ZHEB 2X6IA 3HVEB 2CHXA 5KNHD 3RU0A 4HS2A 2LXMA 4U63A 3AS8A 2DBAA 2EILE 3G2SA 3D9PA 4P29A 2I1KA 2PM7A 3QWPA 1Y6IA 4RQIA 4LERA 3AG2E 4Q69A 2R05A 3E30A 2ILRA 4LNUD 2L6JA 4C0MA 4WNFA 3B95A 3CSFA 3FUJA 2FULA 3MCXA 3AG1E 3PNTB 1KZPA 4FA6A 4UWLA 5D2MC 4NIKA 5FTPA 3UT4A 4KZ0A 2E2EA 4DUIA 2OV8A 1PC2A 4JC8A 3ZPJA 2GRNB 1ZB1A 2IONA 4GPKA 2P9KG 1ELKA 5LCWJ 1HG5A 3FU3A 4BX9A 3FUKA 3JXIA 2VTBB 3VTYA 1HS6A 2RFAA 3FTZA 3PZDA 1DCQA 5AARA 3ABKE 3NOGD 4FLHA 3CK8A 2BTDA 5ENRD 1MJ0A 3UT7A 3QOUA 5CCMA 2V5FA 3DSVA 3JYSA 4K5CA 4Q94A 4G23A 4GMJA 2XHEA 4PUCA 4YDOA 4MLPA 2XGMA 1PAQA 3SQVA 4HOQA 2QYUA 3FY4A 2CHWA 3B7RL 5ENTD 4ILHB 1YYHA 3Q75A 3C5RA 2XS8A 3AAAC 3L22A 3LS8A 1WAO1 4XI0A 5KJMA 3PH0C 5G05C 4Y6CA 2KCLA 3PZ4A 4RSYA 4J8FA 2MHKA 4DLQA 2QY7A 4I9EA 1QQEA 3TWTA 4U8YD 5JJ6A 5EX3A 4U95D 2GRQB 2PQRA 4CGWA 2P9LG 3LKUA 5ANRA 1UN9A 4GU5A 4JHRA 5HI7A 1YMPA 2HM8A 4GMRA 1NA0A 3TG5A 4CYMD 4JEUA 4B8CB 4GA2A 4LRZA 1RW2A 4MBGA 1U3DA 4ANXA 5CERB 4BTBA 2WB2A 1WM5A 1IQRA 4V3IA 5AQBA 4DJAA 4OVVA 3BUAA 3CVXA 3E34A 3HXDA 2Y4UA 3QB2A 3SF4A 5ENPD 1N0RA 3ZNGA 1TNBA 3MGBA 5EDSA 3CLJA 5AJLA 2IEJA 3BU8A 2P9IG 2IO3C 2WMOA 1D9SA 3LY8A 2NSZA 5J90A 4JA7A 3ZKJA 2L0TB 4B94A 4I1AA 4I9CA 3R7QA 3G2UA 1IHGA 4FLBA 2H6HA 2XEHA 2OVBA 5AIJA 1SQMA 3AU5A 2WPVA 2J9QA 2M63A 3ZFWA 5FINA 3FP3A 5ANLA 3VTXA 4HOUA 5BUZA 4ZFHA 5ENQD 3DBSA 4U04A 2I6HA 1JUQA 3IKOB 2XPIA 2GRRB 3ASDA 4L9PA 2IQCA 1KT0A 4G2VA 4U96D 4O6FA 3IEGA 3D9HA 5EKQD 3D9LA 3CVYA 3SI5A 5JHBA 3UPVA 3BG1B 3ENEA 4J0UA 4E85A 4UQXA 1HO8A 4GA1A 3D9OA 1N0QA 4AJWA 4KT6B 2VGYA 3LDZA 1Y8MA 4FJZA 3ONKA 3N71A 3ULQA 3FDHA 2NXPA 4Y6WA 4AIFA 2I9CA 3CHMA 2AW6A 3AJIA 4IN3B 3PEUB 4G24A 3ML9A 2CG2A 3TL5A 3D9JA 5FQ4A 4I2ZA 3PUKA 2VGXA 4JEHA 1NI1A 3RIBA 2OOEA 2BKKB 3SBTB 2XQ0A 3EHQA 2NC9A 4GTTA 3IHYA 4GTVA 3LPZA 5BPPA 2EQXA 3B7BA 1MZCA 2AXZA 4LNGA 1E8WA 4L2LA 2L9BA 2FBNA 2KM4A 3TWXA 2Y0BG 3L9TA 4DLOA 3Q79A 3EHRA 3W9FA 4LUNU 4GZ3A 4I1MA 5D0OD 2Y4TA 4FULA 1N52A 3C72A 5EX0A 1IXVA 5LOZA 1E8YA 5FZRA 4TXPA 2KXPC 4UUCA 1H2VC 1S64A 3T8KA 3AG3E 2PM6A 3IV0A 2XCBA 2C0MA 4L2YA 3MKRA 1IHBA 1Q2ZA 4CEMA 2CFUA 3PZ3A 3VLFA 3U66A 3RJVA 1MYOA 3HDXA 1BI8B 5T3RA 3EU5A 4GYOA 1BPOA 1ELRA 3QC1A 4G25A 2XRYA 4FJYA 4AY5A 1LF8A 4BWRA 2WXQA 4ILIA 2X3MA 3UXGA 4GCNA 3T5XA 4N2QA 3ASOE 1AWCB 4HLLA 1DCEA 2IF4A 4K03A 4LSZE 2F8YA 4HORA 4WNEA 3GYZA 4G1TA 5EILA 2H6GA 3B7TA 3OAWA 4FU3A 2HYZA 1OCOE 4IYPA 4AOFA 2CHZA 4ACLA 5LP0A 4CDMA 3Q78A 1N4SA 2FO1E 3UM2A 4JHKA 5ITZF 1TNZA 3U4TA 3Q49B 5G55A 2DCPA 4WWNA 3ABLE 3J5PA 4JVSA 3V2OA 3QNKA 2Q7FA 1Z3XA 5JMND 3EHNA 3QKYA 4YNDA 3GZ1A 1IYGA 4XX5A 2X6FA 2PQNA 2EINE 2HE0A 3HYMB 1V55E 2IY0C 2A5EA 3CSTA 2IU1A 2RFMA 3DEOA 1U2VG 2KZTA 3TWSA 5AQAA 1AP7A 3NB2A 4U0SA 1LD8A 4X8QA 5KJNA 4MS6A 4B0ZA 1QZ2A 2J07A 4EPZA 4N5CA 4HI8A 3ML8A 4AY6A 3U9WA 2NYJA 1S63A 1WDYA 4DX6D 5J08A 3C98A 1OWPA 2GRPB 5CECB 4H7YA 3O48A 2BEDA 3FHEA 5FZSA 2P2CP 4ABNA 2KBXA 4FHKA 1P5QA 5FT9A 4U8VD 4D10C 3FU5A 1SA4A 2J09A 1N4QA 3CHRA 2ZGGA 3SGHA 4C0EA 1TYQG 1E7UA 3Q5MA 1ZBPA 3ZGQA 2IOSA 3SY2A 3EHMA 4UQYA 4AV7A 5B3SE 4EZJA 2WXNA 3CVVA 1K3ZD 1JCQA 4JL0A 2UWJG 1Z5SC 3UT8A 3ZYLA 4EBAG 2JEKA 3BG0B 4L7TA 1ELWA 3APFA 2YINA 2J08A 2WXOA 2VJ8A 2WVIA 1PY1A 4JPSA 3ZW3A 3AS4A 2XEEA 3EDTB 3LEWA 4Q96A 2DZOA 4GTOA 1MX6A 4M3OA 4XEIG 3ULEG 3ZU7B 1NZNA 3U3WA 3EIQC 3NAWA 3PREA 4ANUA 3CKBA 1KZOA 2KC7A 3MV2B 4A3TA 3FUEA 3UINC 2AXVA 5C2YA 4I43A 5EN5D 1JPLA 3MZLB 5EIDA 4IULA 3S7FA 5KBAA 4M7CA 2AXUA 4N3BA 3PS6A 2I2OA 5KJKA 3UKUG 1FT1A 3NOCD 2WMNA 2R03A 2WXFA 1N94A 4TUMA 5D66A 3Q47B 1MHQA 1LTXA 1L5JA 4U0ZA 2P9PG 1RZ4A 5BV0A 2MYOA 2QC9A 1EDUA 5CEDB 3G2VA 4HI9A 2FEZA 4HRLA 1KPSB 5LFAA 5A23A 3KS2A 4KZCA 2KATA 3ASGA 3C3QA 2BKGA 1Z3YA 3KSLA 3Q9NC 3U64A 1FT2A 3I3NA 2WXHA 3HXCA 2Y3AA 4DI4A 2JABA 4BSZB 4LCTA 1QYMA 2RKKA 2ZISA 3JXJA 4YVOA 1N11A 5BNWA 4B93B 4GMLA 5AN8A 3QAQA 3LY7A 4TXQA 1JWFA 1WY6A 1YCSB 4ACKA 1GW6A 2RD0A 5CMWA 4N3CA 1UG3A 3TWWA 3ZYKA 3SD5A 2YHEA 5T8IA 4UWHA 3CEQA 4TXRA 5FIOA 2A4ZA 3L16A 1N95A 3OXLA 5AAOA 3UIPC 3ZXSA 4J8EA 2LAHA 4GCOA 3HIZA 5CBOA 2IFUA 2WXJA 2UY1A 3TGOA 2FI7A 4ZHBA 3QDNA 3JUEA 5E76A 5FQ8A 4BESA 2WXRA 2P9NG 3HXEA 4FP7A 4U07A 4UI9C 4BX8A 3MA5A 4WUYA 2L6BA 1OWMA 3CQGB 2HR2A 3PRZA 5C1DA 2WXMA 2LSUA 5HKPA 3TWVA 2VGXB 5BT1A 3FH5A 2XGOA 5ENOD 1N4RA 1HFAA 3FFLA 2ETCA 1MQSA 4A55A 2PL2A 1D8EA 4K0RA 3NZUA 4LNBA 4N3AA 4GTSA 4AXHA 4BSXA 3HG0D 5HRYA 2OEWA 3URZA 3E33A 3CIAA 3FULA 3FUNA 2P58C 2J49A 3CVPA 5CBNA 1O1RA 5AENA 3CQCB 3TJPA 2XS1A 1O1TA 4YDEA 2QYJA 1E8XA 4HLEA 3UM1A 3RK6A 4BERA 4AM9A 3J5QB 1E90A 3SO8A 2AWIA 3DSXA 3DSUA 2IJGX 3C3RA 3SFXA 1JCSA 2V4HC 1XNFA 5JHAA 3CV0A 4U0UA 3S2AA 3JQ1A 5G05J 2WXIA 3V31A 3O4ZA 3PZ1A 4EQFA 4N5QA 1FVHA 4A1SA 3DRAA 1TNOA 5EYPF 2IOLA 5B1BE 3L08A 1BD8A 2LNIA 1X5BA 3WG7E 3CK9A 3NZSA 2P9UG 3TWUA 2FF4A 1BU9A 3ZIMA 4JZYA 2PNNA 3RRUA 4WNGA 3R7RA 3UIOC 3FH8A 4ILGA 4UWFA 3EUVA 2ETBA 4GZ6A 5G04J 4ANWA 1TEZA 2IO2C 3CVLA 1LD7A 3SFZA 4K5AB 4GYWA 2Y1LE 3EU9A 4GAAA 5FZQA 2ZU6B 3LVQE 3TWQA 4FADA 4YVQC 2QZAA 5ENSD 1JWGA 4RG6A 4Z68A 5JA4D 4CT4A 5BXOA 4L23A 4GTQA 4PS7A 1INZA 4BETA 4DX7D 3C3OA 5A6CA 3D9NA 1Z6TA 2WXLA 5CEAA 4HXIA 2C0LA 3AU4A 2AVPA 5JJ7A 3Q9UC 4DI3A 2R2LA 2VSXE 3DXMG 3CHSA 3ZUVB 4N2SA 4EHMA 3T8MA 4KXKB 3MV3B 4OAUC 1NP7A 5FWQA 3ZYMA 4O60A 2KZTB 4F1SA 2J4DA 3FTUA 4DX2A 1H6OA 4LG6A 3NQPA 4G8KA 2ETAA 5DIZA 5CCLA 5LCWC 5KJLA 4BY6A 2VSYA 2C2LA 3UM3A 3FTYA 4K5BA 3FUMA 1OCZE 3RRNB 4XE0A 1N54A 5AJDA 3CVWA 3BQOA 3LJ3A 1EF1C 3SNXA 2E0IA 3S7BA 5JJTA 3GZ2A 2H6IA 2L0IA 3JCKC 1OWOA 3ISMC 1EYHA 1TJFA 1XGWA 4KVOA 3FWVA 4YDWA 3JUIA 4JXTA 3FU6A 5BV1A 3L13A 3GZSA 2ZXWE 3E4BA 3VLDA 2X6HA 3ZN3A 3FTSA 5G2NA 3IBEA 3UQ3A 4A63B 3I4RB 1HG2A 2LXLA 2OEVA 3CGHA 1SZAA 3CHPA 4GA0A 4GZCA 1OWNA 1S0PA 3Q15A 4W9RA 1JCRA 1K8KG 4DRXE 2GGFA 2VQ2A 2ZIRA 3SBSA 1OUVA 3CHQA 3V79K 3PZ2A 4CRWA 4GZDA 4RLYA 4QQIA 5B1AE 1DC2A 4A3VA 5HS0A 3LJNA 4G8LA 4JW1A 3ABME 3DEPA 2DYSE 2XGSA 3K9IA 4RVBA 2LSVA 2LUHA 2X6JA 1K1AA 3KAEA 4ATZD 3ASHA 3SFYA 2KCVA 3RAUA 1SVXA 3ASNE 3PE4A 4KMOA 1B89A 2DWZA 3FU0A 3D9IA 4LEUA 4U8HA 3TG4A 2R59A 5AQ7A 4HRNA 3QWWA 4HOSA 1EPUA 2XZDG 1MX4A 5BW8C 4XZ4A 2FO7A 4DX1A 2WXKA 3KEZA 3UX4A 1K1BA 2F8XK 1HF8A 3MKQA 3DPDA 3OTNA 4NRHB 4WNDA 1H19A 3CVUA 2V4LA 3TWRA 3W9GA 1D8DA 4PS8A 4EECA 3E37A 4XI9A 4H7XA 3V30A 4R7LA 4APOA 4EZLA 1H2UA 3JQ0A 3R9AB 1H6PA 3ZHEA 3HVEA 3Q4AB 1TN7A 2V0PA 4WWPA 2B0OE 1SA5A 2BUGA 3CK7A 1S70B 3FUFA 5CRVA 4AEZC 5T4YA 3NF1A 4B89A 3APDA 4L1BA 1KLXA 1OCCE 1TR4A 3D9KA 4OAVB 2BF0X 1A5EA 3APCA 2UY1B 3PNLB 2P9SG 5D0QD 2XPZA 2B6CA 4GB9A 3KD7A 3QWVA 1MX2A 3FUDA 3G2WA 3E32A 3RO2A 3UKRG 3UMVA 2GRMA 3DSTA 3I5PA 2RG8A 2R02A 4CGVA 2DZNA 4JD2G 3B7UX 3Q73A 4N39A 3ZVVA 5HQ8A 1E7VA 3T5VA 1O5MA 5EYLA 3FEYA 3UI2A 5A7DB 4I17A 2VTBA 5IY5E 1HXIA 2DVWA 4MKTA 1HE8A 1FCHA 1BI7B 4J6IA 3DWLG 5AQ9A 4ME2A 2GROB 3T9KA 4HOTA 3QARA 5G04C 4I1OB 1TN8A 4AP2A 4KVMA 4BT9A 3RRMB 4PDXA 1HU3A 4HFGA 5CHEE 4BTAA 1QBQA 3DSWA 1UN8A 2F37A 4U7EB 4TUUA 4OVUA 2LAIA 2R17C 1HX8A 2WM9A 3FTXA 2X6KA 2DIWA 3IHVA 4J8DA 4UI9K 3HXBA 3DPYA 4OYSA 2XPYA 1KT1A 2H6FA 3PEVB 2J8SD 2EIME 4J8YA 1W3BA 3RKVA 3ESKA 2VSNA 4WWOA 4NURA 3G2TA 4ANVA 2EIKE 2F0YA 4I6JA 3KSQA 4PH4B 2KCKA 1IKND 1TN6A 3S7JA 3HXFA 3SZ7A 5DBKA 3CHOA 4HBDA 3RSEG 4WAFA 3CR3A 3ZRHA 3ZYQA 2R5SA 3B13A 1TJCA 4HNAD 3VLEA 3LCAA 3P2BA 2XENA 1V54E 3MX3A 2JLBA 5FJYA 4GTMA 4AVXA 2X38A 2ZGDA 4J7WA 3D9MA 2VSOE 3WXXA 3ASFA 2ONDA 4EZKA 1FVFA 3HHMA 4APFA 2A5UA 1X81A 4B8AA 3B7SA 4UWKA 1WG0A 1NFIE 5LX8A 4DK5A 3QK0A 3ONLA 4KYOB 5ARFA 1G3NB 4XKBA 3S7DA 5FQ6A 4DX5D 3EIJA 2GW1A 1VDYA 4YDYA 2YQ8A 3L82A 4URKA 1N9AA 4I2WA 4G11A 4UQZA 3ZEFA 4JB8P 2DYRE 4O1OA 3TXMA 2LO6A 4BFRA 3FTVA 5CMYA 3Q7AA 2XCCA 4FC8A 1NA3A 2WQHA 4JA9A 1E96B 1BLXB 4GTRA 4F6RD 4CDNA 1TNUA 3AG4E 4BEPA 4J8SA 3QJZA 2HO1A 2OVFA 4EBAA 3FTWA 4GYYA 4HRMB 3TAXA 3EJNA 1HZ4A 2XZTG 3FH7A 3MEKA 4F3VA 4CCAA 2XRZA 3V2XA 4ATGA 4CT0A 3DXKG 1OT8A 4G26A 1HH8A 1OCRE 5EIBE 1IQUA 4JHJA 2YNQA 2OCCE 1H0AA 3RO3A 4RG9A 4HVBA 3F6QA 1A17A 2J4BA 1OWLA 3FEXA
chains in the Genus database with same CATH topology
1X81A 1QBQA 3PZ2A 3DSWA 1TN7A 1JCQA 1SA5A 4L9PA 3Q79A 3DSSA 3KSLA 3Q78A 1N4SA 1FT2A 1O1SA 3HXCA 1TNZA 4GTPA 3EUVA 1N4RA 3C72A 1D8EA 1N9AA 3HXBA 4MBGA 3DPYA 2ZISA 4LNBA 4GTSA 1LD7A 4GTOA 2H6FA 1S64A 3SFYA 3Q7FA 1TNYA 3E34A 3HXDA 3E33A 1KZOA 3Q7AA 2F0YA 2H6IA 3KSQA 1NL4A 3DSVA 3E32A 4GTRA 3PZ3A 1TN6A 4GTQA 1N4PA 1TNBA 3DSTA 1TNUA 1O1RA 4YDOA 2IEJA 1O1TA 1LD8A 4YDEA 3Q73A 3HXFA 3EU5A 1FT1A 3DSXA 1O5MA 3DSUA 1N95A 1S63A 3SFXA 3Q75A 1JCSA 1N94A 1NI1A 2H6HA 2R2LA 2BEDA 1LTXA 3E30A 4GTTA 4GTVA 1D8DA 3PZ1A 3PZ4A 4GTMA 1DCEA 3DRAA 1SA4A 3E37A 1JCRA 1N4QA 4EHMA 1TNOA 1TN8A 1FPPA 3HXEA 1MZCA 2ZIRA 1KZPA 4LNGA 2H6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X81 A;  1QBQ A;  3PZ2 A;  3DSW A;  1TN7 A;  1JCQ A;  1SA5 A;  4L9P A;  3Q79 A;  3DSS A;  3KSL A;  3Q78 A;  1N4S A;  1FT2 A;  1O1S A;  3HXC A;  1TNZ A;  4GTP A;  3EUV A;  1N4R A;  3C72 A;  1D8E A;  1N9A A;  3HXB A;  4MBG A;  3DPY A;  2ZIS A;  4LNB A;  4GTS A;  1LD7 A;  4GTO A;  2H6F A;  1S64 A;  3SFY A;  3Q7F A;  1TNY A;  3E34 A;  3HXD A;  3E33 A;  1KZO A;  3Q7A A;  2F0Y A;  2H6I A;  3KSQ A;  1NL4 A;  3DSV A;  3E32 A;  4GTR A;  3PZ3 A;  1TN6 A;  4GTQ A;  1N4P A;  1TNB A;  3DST A;  1TNU A;  1O1R A;  4YDO A;  2IEJ A;  1O1T A;  1LD8 A;  4YDE A;  3Q73 A;  3HXF A;  3EU5 A;  1FT1 A;  3DSX A;  1O5M A;  3DSU A;  1N95 A;  1S63 A;  3SFX A;  3Q75 A;  1JCS A;  1N94 A;  1NI1 A;  2H6H A;  2R2L A;  2BED A;  1LTX A;  3E30 A;  4GTT A;  4GTV A;  1D8D A;  3PZ1 A;  3PZ4 A;  4GTM A;  1DCE A;  3DRA A;  1SA4 A;  3E37 A;  1JCR A;  1N4Q A;  4EHM A;  1TNO A;  1TN8 A;  1FPP A;  3HXE A;  1MZC A;  2ZIR A;  1KZP A;  4LNG A;  2H6G A; 
#chains in the Genus database with same CATH topology
 4DPR A;  4UI9 J;  3FUI A;  3I4G A;  3GW4 A;  3NBN B;  5E75 A;  2WXG A;  2YHC A;  4UWG A;  4FHJ A;  5KWD A;  3PDN A;  3L6A A;  3PUJ A;  2VGE A;  3UUX A;  3R9M A;  4NQ0 A;  4KBQ A;  3P1U A;  4C48 B;  3Q7F A;  3KEA A;  3ZXP A;  1TNY A;  4CDR A;  4XIF A;  3PE3 A;  3UM0 A;  1OXJ A;  3IXE A;  3ULY A;  5AYW D;  3SHF A;  1DVP A;  1UW4 B;  1QNF A;  4XKC A;  1N4P A;  1SW6 A;  5M72 A;  2V5Q C;  4HQD A;  1U3C A;  4F53 A;  2QFC A;  4C9B B;  3ESL A;  4HB5 A;  4F7A A;  3PVL A;  3HRA A;  2MRI A;  2AJA A;  4NAC A;  3CVQ A;  3MJW A;  2PZI A;  5FQ7 A;  5KCM A;  3L17 A;  1OY3 D;  2I1J A;  3CVN A;  3LXU X;  1ZU2 A;  3LVR E;  2GRL A;  2Y69 E;  3D3M A;  1H6K A;  1UOH A;  1DNP A;  2CG3 A;  3UTM A;  3X2Q E;  1FPP A;  1H2T C;  4I6G A;  5H7P A;  3L54 A;  3LYA A;  4BT8 A;  5ARG A;  2WXP A;  1UJK A;  4O1P A;  2CFZ A;  2WQ7 A;  2WQ6 A;  3MYV A;  3OXF A;  1SZ9 A;  3DSS A;  1UJJ A;  5CRU A;  2VYI A;  2MOW A;  4QFV A;  5ENN A;  1O1S A;  4F1P A;  3AS5 A;  4GTP A;  2XEV A;  4CZ2 D;  4A1G A;  3OXG A;  3MKQ B;  4MRU A;  3FUH A;  3BEE A;  1YA0 A;  4E6H A;  4IRU A;  4PS3 A;  4GZ5 A;  3LY9 A;  4I6E A;  3CKC A;  3TXN A;  2EIJ E;  5BXU A;  1NL4 A;  4GPM A;  4TRQ A;  2V8S E;  4TV3 A;  1E8Z A;  5KNG A;  3ZHE B;  2X6I A;  3HVE B;  2CHX A;  5KNH D;  3RU0 A;  4HS2 A;  2LXM A;  4U63 A;  3AS8 A;  2DBA A;  2EIL E;  3G2S A;  3D9P A;  4P29 A;  2I1K A;  2PM7 A;  3QWP A;  1Y6I A;  4RQI A;  4LER A;  3AG2 E;  4Q69 A;  2R05 A;  3E30 A;  2ILR A;  4LNU D;  2L6J A;  4C0M A;  4WNF A;  3B95 A;  3CSF A;  3FUJ A;  2FUL A;  3MCX A;  3AG1 E;  3PNT B;  1KZP A;  4FA6 A;  4UWL A;  5D2M C;  4NIK A;  5FTP A;  3UT4 A;  4KZ0 A;  2E2E A;  4DUI A;  2OV8 A;  1PC2 A;  4JC8 A;  3ZPJ A;  2GRN B;  1ZB1 A;  2ION A;  4GPK A;  2P9K G;  1ELK A;  5LCW J;  1HG5 A;  3FU3 A;  4BX9 A;  3FUK A;  3JXI A;  2VTB B;  3VTY A;  1HS6 A;  2RFA A;  3FTZ A;  3PZD A;  1DCQ A;  5AAR A;  3ABK E;  3NOG D;  4FLH A;  3CK8 A;  2BTD A;  5ENR D;  1MJ0 A;  3UT7 A;  3QOU A;  5CCM A;  2V5F A;  3DSV A;  3JYS A;  4K5C A;  4Q94 A;  4G23 A;  4GMJ A;  2XHE A;  4PUC A;  4YDO A;  4MLP A;  2XGM A;  1PAQ A;  3SQV A;  4HOQ A;  2QYU A;  3FY4 A;  2CHW A;  3B7R L;  5ENT D;  4ILH B;  1YYH A;  3Q75 A;  3C5R A;  2XS8 A;  3AAA C;  3L22 A;  3LS8 A;  1WAO 1;  4XI0 A;  5KJM A;  3PH0 C;  5G05 C;  4Y6C A;  2KCL A;  3PZ4 A;  4RSY A;  4J8F A;  2MHK A;  4DLQ A;  2QY7 A;  4I9E A;  1QQE A;  3TWT A;  4U8Y D;  5JJ6 A;  5EX3 A;  4U95 D;  2GRQ B;  2PQR A;  4CGW A;  2P9L G;  3LKU A;  5ANR A;  1UN9 A;  4GU5 A;  4JHR A;  5HI7 A;  1YMP A;  2HM8 A;  4GMR A;  1NA0 A;  3TG5 A;  4CYM D;  4JEU A;  4B8C B;  4GA2 A;  4LRZ A;  1RW2 A;  4MBG A;  1U3D A;  4ANX A;  5CER B;  4BTB A;  2WB2 A;  1WM5 A;  1IQR A;  4V3I A;  5AQB A;  4DJA A;  4OVV A;  3BUA A;  3CVX A;  3E34 A;  3HXD A;  2Y4U A;  3QB2 A;  3SF4 A;  5ENP D;  1N0R A;  3ZNG A;  1TNB A;  3MGB A;  5EDS A;  3CLJ A;  5AJL A;  2IEJ A;  3BU8 A;  2P9I G;  2IO3 C;  2WMO A;  1D9S A;  3LY8 A;  2NSZ A;  5J90 A;  4JA7 A;  3ZKJ A;  2L0T B;  4B94 A;  4I1A A;  4I9C A;  3R7Q A;  3G2U A;  1IHG A;  4FLB A;  2H6H A;  2XEH A;  2OVB A;  5AIJ A;  1SQM A;  3AU5 A;  2WPV A;  2J9Q A;  2M63 A;  3ZFW A;  5FIN A;  3FP3 A;  5ANL A;  3VTX A;  4HOU A;  5BUZ A;  4ZFH A;  5ENQ D;  3DBS A;  4U04 A;  2I6H A;  1JUQ A;  3IKO B;  2XPI A;  2GRR B;  3ASD A;  4L9P A;  2IQC A;  1KT0 A;  4G2V A;  4U96 D;  4O6F A;  3IEG A;  3D9H A;  5EKQ D;  3D9L A;  3CVY A;  3SI5 A;  5JHB A;  3UPV A;  3BG1 B;  3ENE A;  4J0U A;  4E85 A;  4UQX A;  1HO8 A;  4GA1 A;  3D9O A;  1N0Q A;  4AJW A;  4KT6 B;  2VGY A;  3LDZ A;  1Y8M A;  4FJZ A;  3ONK A;  3N71 A;  3ULQ A;  3FDH A;  2NXP A;  4Y6W A;  4AIF A;  2I9C A;  3CHM A;  2AW6 A;  3AJI A;  4IN3 B;  3PEU B;  4G24 A;  3ML9 A;  2CG2 A;  3TL5 A;  3D9J A;  5FQ4 A;  4I2Z A;  3PUK A;  2VGX A;  4JEH A;  1NI1 A;  3RIB A;  2OOE A;  2BKK B;  3SBT B;  2XQ0 A;  3EHQ A;  2NC9 A;  4GTT A;  3IHY A;  4GTV A;  3LPZ A;  5BPP A;  2EQX A;  3B7B A;  1MZC A;  2AXZ A;  4LNG A;  1E8W A;  4L2L A;  2L9B A;  2FBN A;  2KM4 A;  3TWX A;  2Y0B G;  3L9T A;  4DLO A;  3Q79 A;  3EHR A;  3W9F A;  4LUN U;  4GZ3 A;  4I1M A;  5D0O D;  2Y4T A;  4FUL A;  1N52 A;  3C72 A;  5EX0 A;  1IXV A;  5LOZ A;  1E8Y A;  5FZR A;  4TXP A;  2KXP C;  4UUC A;  1H2V C;  1S64 A;  3T8K A;  3AG3 E;  2PM6 A;  3IV0 A;  2XCB A;  2C0M A;  4L2Y A;  3MKR A;  1IHB A;  1Q2Z A;  4CEM A;  2CFU A;  3PZ3 A;  3VLF A;  3U66 A;  3RJV A;  1MYO A;  3HDX A;  1BI8 B;  5T3R A;  3EU5 A;  4GYO A;  1BPO A;  1ELR A;  3QC1 A;  4G25 A;  2XRY A;  4FJY A;  4AY5 A;  1LF8 A;  4BWR A;  2WXQ A;  4ILI A;  2X3M A;  3UXG A;  4GCN A;  3T5X A;  4N2Q A;  3ASO E;  1AWC B;  4HLL A;  1DCE A;  2IF4 A;  4K03 A;  4LSZ E;  2F8Y A;  4HOR A;  4WNE A;  3GYZ A;  4G1T A;  5EIL A;  2H6G A;  3B7T A;  3OAW A;  4FU3 A;  2HYZ A;  1OCO E;  4IYP A;  4AOF A;  2CHZ A;  4ACL A;  5LP0 A;  4CDM A;  3Q78 A;  1N4S A;  2FO1 E;  3UM2 A;  4JHK A;  5ITZ F;  1TNZ A;  3U4T A;  3Q49 B;  5G55 A;  2DCP A;  4WWN A;  3ABL E;  3J5P A;  4JVS A;  3V2O A;  3QNK A;  2Q7F A;  1Z3X A;  5JMN D;  3EHN A;  3QKY A;  4YND A;  3GZ1 A;  1IYG A;  4XX5 A;  2X6F A;  2PQN A;  2EIN E;  2HE0 A;  3HYM B;  1V55 E;  2IY0 C;  2A5E A;  3CST A;  2IU1 A;  2RFM A;  3DEO A;  1U2V G;  2KZT A;  3TWS A;  5AQA A;  1AP7 A;  3NB2 A;  4U0S A;  1LD8 A;  4X8Q A;  5KJN A;  4MS6 A;  4B0Z A;  1QZ2 A;  2J07 A;  4EPZ A;  4N5C A;  4HI8 A;  3ML8 A;  4AY6 A;  3U9W A;  2NYJ A;  1S63 A;  1WDY A;  4DX6 D;  5J08 A;  3C98 A;  1OWP A;  2GRP B;  5CEC B;  4H7Y A;  3O48 A;  2BED A;  3FHE A;  5FZS A;  2P2C P;  4ABN A;  2KBX A;  4FHK A;  1P5Q A;  5FT9 A;  4U8V D;  4D10 C;  3FU5 A;  1SA4 A;  2J09 A;  1N4Q A;  3CHR A;  2ZGG A;  3SGH A;  4C0E A;  1TYQ G;  1E7U A;  3Q5M A;  1ZBP A;  3ZGQ A;  2IOS A;  3SY2 A;  3EHM A;  4UQY A;  4AV7 A;  5B3S E;  4EZJ A;  2WXN A;  3CVV A;  1K3Z D;  1JCQ A;  4JL0 A;  2UWJ G;  1Z5S C;  3UT8 A;  3ZYL A;  4EBA G;  2JEK A;  3BG0 B;  4L7T A;  1ELW A;  3APF A;  2YIN A;  2J08 A;  2WXO A;  2VJ8 A;  2WVI A;  1PY1 A;  4JPS A;  3ZW3 A;  3AS4 A;  2XEE A;  3EDT B;  3LEW A;  4Q96 A;  2DZO A;  4GTO A;  1MX6 A;  4M3O A;  4XEI G;  3ULE G;  3ZU7 B;  1NZN A;  3U3W A;  3EIQ C;  3NAW A;  3PRE A;  4ANU A;  3CKB A;  1KZO A;  2KC7 A;  3MV2 B;  4A3T A;  3FUE A;  3UIN C;  2AXV A;  5C2Y A;  4I43 A;  5EN5 D;  1JPL A;  3MZL B;  5EID A;  4IUL A;  3S7F A;  5KBA A;  4M7C A;  2AXU A;  4N3B A;  3PS6 A;  2I2O A;  5KJK A;  3UKU G;  1FT1 A;  3NOC D;  2WMN A;  2R03 A;  2WXF A;  1N94 A;  4TUM A;  5D66 A;  3Q47 B;  1MHQ A;  1LTX A;  1L5J A;  4U0Z A;  2P9P G;  1RZ4 A;  5BV0 A;  2MYO A;  2QC9 A;  1EDU A;  5CED B;  3G2V A;  4HI9 A;  2FEZ A;  4HRL A;  1KPS B;  5LFA A;  5A23 A;  3KS2 A;  4KZC A;  2KAT A;  3ASG A;  3C3Q A;  2BKG A;  1Z3Y A;  3KSL A;  3Q9N C;  3U64 A;  1FT2 A;  3I3N A;  2WXH A;  3HXC A;  2Y3A A;  4DI4 A;  2JAB A;  4BSZ B;  4LCT A;  1QYM A;  2RKK A;  2ZIS A;  3JXJ A;  4YVO A;  1N11 A;  5BNW A;  4B93 B;  4GML A;  5AN8 A;  3QAQ A;  3LY7 A;  4TXQ A;  1JWF A;  1WY6 A;  1YCS B;  4ACK A;  1GW6 A;  2RD0 A;  5CMW A;  4N3C A;  1UG3 A;  3TWW A;  3ZYK A;  3SD5 A;  2YHE A;  5T8I A;  4UWH A;  3CEQ A;  4TXR A;  5FIO A;  2A4Z A;  3L16 A;  1N95 A;  3OXL A;  5AAO A;  3UIP C;  3ZXS A;  4J8E A;  2LAH A;  4GCO A;  3HIZ A;  5CBO A;  2IFU A;  2WXJ A;  2UY1 A;  3TGO A;  2FI7 A;  4ZHB A;  3QDN A;  3JUE A;  5E76 A;  5FQ8 A;  4BES A;  2WXR A;  2P9N G;  3HXE A;  4FP7 A;  4U07 A;  4UI9 C;  4BX8 A;  3MA5 A;  4WUY A;  2L6B A;  1OWM A;  3CQG B;  2HR2 A;  3PRZ A;  5C1D A;  2WXM A;  2LSU A;  5HKP A;  3TWV A;  2VGX B;  5BT1 A;  3FH5 A;  2XGO A;  5ENO D;  1N4R A;  1HFA A;  3FFL A;  2ETC A;  1MQS A;  4A55 A;  2PL2 A;  1D8E A;  4K0R A;  3NZU A;  4LNB A;  4N3A A;  4GTS A;  4AXH A;  4BSX A;  3HG0 D;  5HRY A;  2OEW A;  3URZ A;  3E33 A;  3CIA A;  3FUL A;  3FUN A;  2P58 C;  2J49 A;  3CVP A;  5CBN A;  1O1R A;  5AEN A;  3CQC B;  3TJP A;  2XS1 A;  1O1T A;  4YDE A;  2QYJ A;  1E8X A;  4HLE A;  3UM1 A;  3RK6 A;  4BER A;  4AM9 A;  3J5Q B;  1E90 A;  3SO8 A;  2AWI A;  3DSX A;  3DSU A;  2IJG X;  3C3R A;  3SFX A;  1JCS A;  2V4H C;  1XNF A;  5JHA A;  3CV0 A;  4U0U A;  3S2A A;  3JQ1 A;  5G05 J;  2WXI A;  3V31 A;  3O4Z A;  3PZ1 A;  4EQF A;  4N5Q A;  1FVH A;  4A1S A;  3DRA A;  1TNO A;  5EYP F;  2IOL A;  5B1B E;  3L08 A;  1BD8 A;  2LNI A;  1X5B A;  3WG7 E;  3CK9 A;  3NZS A;  2P9U G;  3TWU A;  2FF4 A;  1BU9 A;  3ZIM A;  4JZY A;  2PNN A;  3RRU A;  4WNG A;  3R7R A;  3UIO C;  3FH8 A;  4ILG A;  4UWF A;  3EUV A;  2ETB A;  4GZ6 A;  5G04 J;  4ANW A;  1TEZ A;  2IO2 C;  3CVL A;  1LD7 A;  3SFZ A;  4K5A B;  4GYW A;  2Y1L E;  3EU9 A;  4GAA A;  5FZQ A;  2ZU6 B;  3LVQ E;  3TWQ A;  4FAD A;  4YVQ C;  2QZA A;  5ENS D;  1JWG A;  4RG6 A;  4Z68 A;  5JA4 D;  4CT4 A;  5BXO A;  4L23 A;  4GTQ A;  4PS7 A;  1INZ A;  4BET A;  4DX7 D;  3C3O A;  5A6C A;  3D9N A;  1Z6T A;  2WXL A;  5CEA A;  4HXI A;  2C0L A;  3AU4 A;  2AVP A;  5JJ7 A;  3Q9U C;  4DI3 A;  2R2L A;  2VSX E;  3DXM G;  3CHS A;  3ZUV B;  4N2S A;  4EHM A;  3T8M A;  4KXK B;  3MV3 B;  4OAU C;  1NP7 A;  5FWQ A;  3ZYM A;  4O60 A;  2KZT B;  4F1S A;  2J4D A;  3FTU A;  4DX2 A;  1H6O A;  4LG6 A;  3NQP A;  4G8K A;  2ETA A;  5DIZ A;  5CCL A;  5LCW C;  5KJL A;  4BY6 A;  2VSY A;  2C2L A;  3UM3 A;  3FTY A;  4K5B A;  3FUM A;  1OCZ E;  3RRN B;  4XE0 A;  1N54 A;  5AJD A;  3CVW A;  3BQO A;  3LJ3 A;  1EF1 C;  3SNX A;  2E0I A;  3S7B A;  5JJT A;  3GZ2 A;  2H6I A;  2L0I A;  3JCK C;  1OWO A;  3ISM C;  1EYH A;  1TJF A;  1XGW A;  4KVO A;  3FWV A;  4YDW A;  3JUI A;  4JXT A;  3FU6 A;  5BV1 A;  3L13 A;  3GZS A;  2ZXW E;  3E4B A;  3VLD A;  2X6H A;  3ZN3 A;  3FTS A;  5G2N A;  3IBE A;  3UQ3 A;  4A63 B;  3I4R B;  1HG2 A;  2LXL A;  2OEV A;  3CGH A;  1SZA A;  3CHP A;  4GA0 A;  4GZC A;  1OWN A;  1S0P A;  3Q15 A;  4W9R A;  1JCR A;  1K8K G;  4DRX E;  2GGF A;  2VQ2 A;  2ZIR A;  3SBS A;  1OUV A;  3CHQ A;  3V79 K;  3PZ2 A;  4CRW A;  4GZD A;  4RLY A;  4QQI A;  5B1A E;  1DC2 A;  4A3V A;  5HS0 A;  3LJN A;  4G8L A;  4JW1 A;  3ABM E;  3DEP A;  2DYS E;  2XGS A;  3K9I A;  4RVB A;  2LSV A;  2LUH A;  2X6J A;  1K1A A;  3KAE A;  4ATZ D;  3ASH A;  3SFY A;  2KCV A;  3RAU A;  1SVX A;  3ASN E;  3PE4 A;  4KMO A;  1B89 A;  2DWZ A;  3FU0 A;  3D9I A;  4LEU A;  4U8H A;  3TG4 A;  2R59 A;  5AQ7 A;  4HRN A;  3QWW A;  4HOS A;  1EPU A;  2XZD G;  1MX4 A;  5BW8 C;  4XZ4 A;  2FO7 A;  4DX1 A;  2WXK A;  3KEZ A;  3UX4 A;  1K1B A;  2F8X K;  1HF8 A;  3MKQ A;  3DPD A;  3OTN A;  4NRH B;  4WND A;  1H19 A;  3CVU A;  2V4L A;  3TWR A;  3W9G A;  1D8D A;  4PS8 A;  4EEC A;  3E37 A;  4XI9 A;  4H7X A;  3V30 A;  4R7L A;  4APO A;  4EZL A;  1H2U A;  3JQ0 A;  3R9A B;  1H6P A;  3ZHE A;  3HVE A;  3Q4A B;  1TN7 A;  2V0P A;  4WWP A;  2B0O E;  1SA5 A;  2BUG A;  3CK7 A;  1S70 B;  3FUF A;  5CRV A;  4AEZ C;  5T4Y A;  3NF1 A;  4B89 A;  3APD A;  4L1B A;  1KLX A;  1OCC E;  1TR4 A;  3D9K A;  4OAV B;  2BF0 X;  1A5E A;  3APC A;  2UY1 B;  3PNL B;  2P9S G;  5D0Q D;  2XPZ A;  2B6C A;  4GB9 A;  3KD7 A;  3QWV A;  1MX2 A;  3FUD A;  3G2W A;  3E32 A;  3RO2 A;  3UKR G;  3UMV A;  2GRM A;  3DST A;  3I5P A;  2RG8 A;  2R02 A;  4CGV A;  2DZN A;  4JD2 G;  3B7U X;  3Q73 A;  4N39 A;  3ZVV A;  5HQ8 A;  1E7V A;  3T5V A;  1O5M A;  5EYL A;  3FEY A;  3UI2 A;  5A7D B;  4I17 A;  2VTB A;  5IY5 E;  1HXI A;  2DVW A;  4MKT A;  1HE8 A;  1FCH A;  1BI7 B;  4J6I A;  3DWL G;  5AQ9 A;  4ME2 A;  2GRO B;  3T9K A;  4HOT A;  3QAR A;  5G04 C;  4I1O B;  1TN8 A;  4AP2 A;  4KVM A;  4BT9 A;  3RRM B;  4PDX A;  1HU3 A;  4HFG A;  5CHE E;  4BTA A;  1QBQ A;  3DSW A;  1UN8 A;  2F37 A;  4U7E B;  4TUU A;  4OVU A;  2LAI A;  2R17 C;  1HX8 A;  2WM9 A;  3FTX A;  2X6K A;  2DIW A;  3IHV A;  4J8D A;  4UI9 K;  3HXB A;  3DPY A;  4OYS A;  2XPY A;  1KT1 A;  2H6F A;  3PEV B;  2J8S D;  2EIM E;  4J8Y A;  1W3B A;  3RKV A;  3ESK A;  2VSN A;  4WWO A;  4NUR A;  3G2T A;  4ANV A;  2EIK E;  2F0Y A;  4I6J A;  3KSQ A;  4PH4 B;  2KCK A;  1IKN D;  1TN6 A;  3S7J A;  3HXF A;  3SZ7 A;  5DBK A;  3CHO A;  4HBD A;  3RSE G;  4WAF A;  3CR3 A;  3ZRH A;  3ZYQ A;  2R5S A;  3B13 A;  1TJC A;  4HNA D;  3VLE A;  3LCA A;  3P2B A;  2XEN A;  1V54 E;  3MX3 A;  2JLB A;  5FJY A;  4GTM A;  4AVX A;  2X38 A;  2ZGD A;  4J7W A;  3D9M A;  2VSO E;  3WXX A;  3ASF A;  2OND A;  4EZK A;  1FVF A;  3HHM A;  4APF A;  2A5U A;  1X81 A;  4B8A A;  3B7S A;  4UWK A;  1WG0 A;  1NFI E;  5LX8 A;  4DK5 A;  3QK0 A;  3ONL A;  4KYO B;  5ARF A;  1G3N B;  4XKB A;  3S7D A;  5FQ6 A;  4DX5 D;  3EIJ A;  2GW1 A;  1VDY A;  4YDY A;  2YQ8 A;  3L82 A;  4URK A;  1N9A A;  4I2W A;  4G11 A;  4UQZ A;  3ZEF A;  4JB8 P;  2DYR E;  4O1O A;  3TXM A;  2LO6 A;  4BFR A;  3FTV A;  5CMY A;  3Q7A A;  2XCC A;  4FC8 A;  1NA3 A;  2WQH A;  4JA9 A;  1E96 B;  1BLX B;  4GTR A;  4F6R D;  4CDN A;  1TNU A;  3AG4 E;  4BEP A;  4J8S A;  3QJZ A;  2HO1 A;  2OVF A;  4EBA A;  3FTW A;  4GYY A;  4HRM B;  3TAX A;  3EJN A;  1HZ4 A;  2XZT G;  3FH7 A;  3MEK A;  4F3V A;  4CCA A;  2XRZ A;  3V2X A;  4ATG A;  4CT0 A;  3DXK G;  1OT8 A;  4G26 A;  1HH8 A;  1OCR E;  5EIB E;  1IQU A;  4JHJ A;  2YNQ A;  2OCC E;  1H0A A;  3RO3 A;  4RG9 A;  4HVB A;  3F6Q A;  1A17 A;  2J4B A;  1OWL A;  3FEX A; 
#chains in the Genus database with same CATH homology
 1X81 A;  1QBQ A;  3PZ2 A;  3DSW A;  1TN7 A;  1JCQ A;  1SA5 A;  4L9P A;  3Q79 A;  3DSS A;  3KSL A;  3Q78 A;  1N4S A;  1FT2 A;  1O1S A;  3HXC A;  1TNZ A;  4GTP A;  3EUV A;  1N4R A;  3C72 A;  1D8E A;  1N9A A;  3HXB A;  4MBG A;  3DPY A;  2ZIS A;  4LNB A;  4GTS A;  1LD7 A;  4GTO A;  2H6F A;  1S64 A;  3SFY A;  3Q7F A;  1TNY A;  3E34 A;  3HXD A;  3E33 A;  1KZO A;  3Q7A A;  2F0Y A;  2H6I A;  3KSQ A;  1NL4 A;  3DSV A;  3E32 A;  4GTR A;  3PZ3 A;  1TN6 A;  4GTQ A;  1N4P A;  1TNB A;  3DST A;  1TNU A;  1O1R A;  4YDO A;  2IEJ A;  1O1T A;  1LD8 A;  4YDE A;  3Q73 A;  3HXF A;  3EU5 A;  1FT1 A;  3DSX A;  1O5M A;  3DSU A;  1N95 A;  1S63 A;  3SFX A;  3Q75 A;  1JCS A;  1N94 A;  1NI1 A;  2H6H A;  2R2L A;  2BED A;  1LTX A;  3E30 A;  4GTT A;  4GTV A;  1D8D A;  3PZ1 A;  3PZ4 A;  4GTM A;  1DCE A;  3DRA A;  1SA4 A;  3E37 A;  1JCR A;  1N4Q A;  4EHM A;  1TNO A;  1TN8 A;  1FPP A;  3HXE A;  1MZC A;  2ZIR A;  1KZP A;  4LNG A;  2H6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...