1O1RA

Structure of fpt bound to ggpp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
publication title Biochemical and Structural Studies with Prenyl Diphosphate Analogues Provide Insights into Isoprenoid Recognition by Protein Farnesyl Transferase
pubmed doi rcsb
source organism Rattus norvegicus
total genus 123
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o1rA00
1FT1A 1O1TA 1NL4A 3DPYA 4GTQA 1N94A 4GTPA 4LNBA 1N4PA 1N9AA 4MBGA 1TNYA 1S63A 1S64A 3E32A 4YDEA 1TNOA 2ZIRA 3Q7FA 4GTOA 1DCEA 1TNZA 1SA5A 3DSWA 1JCSA 3E30A 3HXDA 3HXBA 1MZCA 4GTRA 3E37A 2H6HA 3DSVA 3DSUA 3PZ3A 2BEDA 1SA4A 3C72A 3PZ1A 1D8DA 1NI1A 2H6FA 1LD8A 1FT2A 3EUVA 3SFYA 1JCRA 3HXCA 3Q7AA 1FPPA 1KZPA 1LD7A 1TN7A 2R2LA 4GTMA 4LNGA 3E34A 1X81A 3E33A 4GTTA 1TN6A 3Q73A 1O5MA 1D8EA 1O1RA 3DSXA 1TNUA 4EHMA 3Q78A 1N4SA 4GTSA 3HXFA 3Q79A 3DRAA 3HXEA 1TNBA 2ZISA 4L9PA 2IEJA 4YDOA 1JCQA 2F0YA 4GTVA 1KZOA 3PZ4A 3KSQA 1N95A 3Q75A 3SFXA 1O1SA 2H6GA 3PZ2A 3DSSA 2H6IA 3EU5A 1LTXA 3KSLA 1TN8A 1N4RA 3DSTA 1N4QA 1QBQA
chains in the Genus database with same CATH superfamily
3U3WA 1O1TA 4LUNU 3BEEA 1H6PA 1Z3YA 3PDNA 3V30A 4HOQA 3JUIA 4B89A 3OAWA 1FCHA 1EDUA 2A5UA 2XGMA 4RQIA 3B7UX 4HI8A 3DXKG 2DIWA 1MQSA 5JJ7A 4MS6A 5KWDA 3VLDA 3APFA 4ANWA 4A3TA 1SZAA 3R9AB 5AYWD 4PS3A 1FPPA 4JW1A 3AG3E 4GMJA 4XI0A 4GCNA 4MKTA 3AG4E 2KZTB 4KMOA 2HE0A 4PS7A 3G2UA 4CDNA 4F1PA 4EHMA 3ONKA 2WXKA 3ABKE 5EKQD 1JPLA 4FJZA 4Y6CA 1TNBA 4QQIA 4UWHA 2C0MA 2HYZA 1OWOA 5EX0A 5G55A 5KJLA 1HFAA 3IKOB 4FA6A 3LJNA 2EIJE 4C0EA 3SFXA 5D0QD 2H6GA 2B0OE 5A6CA 2GRPB 5E75A 5CCMA 2CFUA 5KNHD 4DUIA 3C98A 3MJWA 2L0TB 4AY5A 4L2YA 4GTQA 4I17A 3FTUA 4GTPA 3U9WA 3N71A 2HO1A 1TNYA 3FUDA 2WXOA 2OEWA 3Q7FA 1DCQA 4CRWA 4XZ4A 3ZRHA 4HVBA 4GTRA 3CLJA 2UY1B 4IYPA 2ONDA 2MYOA 4CZ2D 2PZIA 4XIFA 1E8XA 2R02A 4FU3A 4DX6D 2XENA 3UX4A 1MHQA 4J8SA 3CHOA 1OWLA 2QYJA 3PEUB 3FH8A 3ABME 4E85A 1BLXB 4NRHB 4EQFA 5DIZA 3DSXA 4GCOA 2MRIA 5CERB 4KT6B 3ASHA 4L9PA 4I2WA 1YCSB 3V79K 4TXQA 5BV0A 5CRUA 3L16A 3ZHEB 2IF4A 1BI7B 3QC1A 3ASGA 3HVEB 3CHPA 3B95A 2FEZA 5ENSD 4UI9C 4ANVA 3U66A 3ZUVB 2J08A 3PH0C 3SY2A 4KVOA 2WXJA 5C1DA 2AXZA 3G2VA 3LVRE 1NL4A 1HO8A 5CBNA 2Q7FA 5EIBE 4DJAA 4YDEA 4J0UA 2Y1LE 3JCKC 4APFA 4AIFA 4JPSA 1DCEA 3GZSA 3HXBA 5ENOD 4JHJA 3DSVA 3FHEA 3V31A 1JWGA 3ZNGA 5B3SE 4JC8A 1FVHA 4EBAG 2PM6A 1OY3D 1N54A 3ZIMA 2NXPA 2X3MA 3ESKA 5T8IA 3EIQC 3Q7AA 2ETCA 5LOZA 3TWSA 2V8SE 2XHEA 2P9SG 2R03A 3P2BA 4LNGA 3C3RA 3E33A 2WXPA 5EIDA 1OWPA 3PE4A 4GA1A 5A7DB 3J5PA 1E7VA 3EIJA 2J07A 3TWWA 3TXNA 1V54E 3ZW3A 2P58C 4KZCA 1Z5SC 4DK5A 3LXUX 1KZOA 1N95A 1BU9A 2DVWA 3URZA 4UQXA 2L6BA 3UM2A 3TWQA 4RG9A 3D9KA 1QZ2A 4K03A 3KSLA 3MKQB 2B6CA 3HVEA 5JHAA 1H6OA 4WNEA 5ENRD 4BETA 1E96B 3LCAA 4H7XA 4I6JA 2DCPA 4OAVB 3TXMA 2P2CP 2PL2A 1PAQA 2LSVA 5FINA 3AS5A 4BT8A 4Z68A 3RAUA 4OVUA 1UG3A 3L82A 4UWLA 2DYSE 3I3NA 3QWWA 4WWNA 1NP7A 1WY6A 4I6GA 3PZ3A 4KYOB 3C3QA 2J4DA 1XGWA 4ZFHA 1KT0A 3RIBA 2CHWA 1Z3XA 3SFYA 4XI9A 4AJWA 4A1GA 4URKA 2DWZA 4BFRA 3AJIA 4FULA 1Z6TA 1TN6A 1SW6A 4AXHA 2RFAA 1NZNA 3QWPA 3AU4A 2X6JA 3AAAC 3FUKA 4N2QA 4BSXA 3E4BA 1S0PA 3FY4A 3PEVB 4HB5A 3ULQA 2X6FA 4UWGA 2GGFA 2DYRE 4F1SA 2R17C 4U8YD 4K0RA 5B1BE 4I9EA 3JYSA 2OCCE 3CSTA 5ANLA 3ZVVA 4WNFA 5HI7A 4UI9J 3PZ4A 4ANUA 2XGSA 2WB2A 4BERA 2J8SD 3SGHA 5D2MC 3IBEA 5CEDB 3L17A 3FH5A 5BV1A 3I4GA 4BX8A 3RO2A 5HQ8A 1N4QA 2MOWA 2ETBA 4I6EA 3ENEA 3UM3A 1TJFA 5KNGA 4J6IA 4BESA 5ENNA 5EDSA 2P9KG 1JWFA 3ZYMA 4XX5A 1SA5A 4ACKA 4UQYA 3NF1A 3Q4AB 2IY0C 1RZ4A 1TJCA 3DBSA 3V2XA 2JEKA 2I6HA 3PRZA 3C3OA 2RFMA 1MYOA 3APDA 3U64A 3C72A 4B94A 4DI4A 5D66A 3ASFA 3EUVA 4UI9K 3OXFA 3B7RL 4YDWA 3MZLB 1KZPA 3W9FA 4N2SA 3IXEA 5C2YA 4HRNA 3CSFA 3TWVA 4KXKB 2WMOA 4G23A 4F53A 3DEOA 3TL5A 1K8KG 3HYMB 4NIKA 3FU3A 4G26A 3D9MA 3CK8A 4IN3B 4Q94A 5HRYA 4HLEA 5ENTD 1K1BA 5KBAA 4J7WA 1ZB1A 2J49A 1HG2A 4K5CA 4U07A 1IHGA 3CVPA 3JQ0A 4YNDA 1U3DA 4U8HA 1TN8A 3ZYLA 4KBQA 4KVMA 3FEXA 2PQRA 2X6KA 3SBTB 1U3CA 5JA4D 2ZGDA 3VTXA 4GZDA 3DPDA 2V5QC 4C9BB 4EZLA 1S63A 2I9CA 3NBNB 1Y8MA 4JEHA 4GPKA 1MZCA 2LO6A 4GZ3A 3D9IA 4M7CA 3QB2A 2R5SA 1U2VG 4FLHA 5ARFA 3CK9A 4FHJA 4O6FA 4GZ6A 4I1OB 1N11A 4AV7A 2E0IA 3QKYA 2V0PA 3G2TA 1INZA 3ZKJA 4GYOA 4GTTA 4LCTA 2V4LA 3LKUA 2IJGX 5FQ6A 4JHKA 5EILA 4AM9A 1OCRE 4A63B 3ML9A 3HRAA 3UTMA 5AARA 4FLBA 2WXRA 4FP7A 1K3ZD 2YINA 3RJVA 1IQUA 2VGXB 3AS8A 1O1SA 2WXIA 4BTBA 2ZXWE 2Y0BG 1ELWA 1E8YA 2DZNA 4R7LA 4UQZA 4ANXA 4GYWA 4GA2A 2OV8A 2EILE 3CVWA 3AG2E 3MV3B 2GRMA 3VLFA 4CCAA 3RKVA 4NURA 2I1JA 3D3MA 4WUYA 1ELKA 4PUCA 3P1UA 1HS6A 4I9CA 2H6HA 3FUIA 4GMLA 4U96D 3RSEG 3D9JA 3AS4A 3QK0A 4HORA 4UWFA 2H6FA 3KEAA 3Q49B 3B7TA 1BPOA 1NA3A 4GPMA 3Q15A 2XPIA 2KATA 4RG6A 4J8FA 3L54A 5FWQA 2GRNB 4NQ0A 4AEZC 4U04A 3CQCB 4AOFA 4JHRA 3UMVA 3QWVA 3PNTB 3FTYA 4G8LA 3V2OA 3BG1B 1N52A 4ABNA 5AJDA 2LXLA 4U63A 4GA0A 3D9HA 3L13A 4D10C 1NA0A 3R9MA 2IO2C 4DI3A 5T3RA 2P9NG 4I43A 3IHVA 3UINC 3KSQA 4ZHBA 2KXPC 1HU3A 2KZTA 4JEUA 4CYMD 2VGXA 4JL0A 1MX6A 3FTVA 2XGOA 2R59A 5FZSA 2J9QA 3SI5A 2AW6A 1QYMA 3T9KA 3R7RA 2PQNA 5BPPA 5FQ8A 3TAXA 2AWIA 2VJ8A 3FTSA 3CQGB 1P5QA 4G8KA 1YYHA 1X5BA 3NB2A 3SD5A 5CCLA 4YVQC 2WXHA 3QJZA 5CEAA 3D9OA 3ZGQA 1OWMA 3ONLA 2YHEA 4F6RD 2R2LA 3RK6A 2KCVA 2VGEA 2P9PG 3CHQA 4FC8A 3HG0D 4MLPA 2OVFA 2UY1A 4OYSA 3MGBA 2DZOA 1SZ9A 2F0YA 3VTYA 2WXQA 4HOTA 3PNLB 2L6JA 5FTPA 3PZ2A 1VDYA 4JB8P 1AP7A 5G04C 5FZQA 1IQRA 2HR2A 3BG0B 5KJKA 4LERA 2WVIA 5CRVA 3UPVA 4ME2A 4L2LA 1QBQA 3UIOC 3T8KA 5G05C 3SFZA 4G1TA 3LJ3A 4ILGA 2IOSA 4L23A 4NACA 4JA7A 2GRLA 5CMWA 3ZFWA 1N9AA 3TWUA 2XEEA 2X6IA 4DX1A 1TNOA 4M3OA 3ZHEA 3ZEFA 4HS2A 3CVNA 3DSUA 2BEDA 5J90A 3HDXA 4L1BA 3KS2A 2BKGA 3PZ1A 2QZAA 1G3NB 1MX4A 4U0UA 4TV3A 3PVLA 2XZDG 3CVVA 4N39A 4PH4B 1D9SA 5ENPD 2DBAA 2IO3C 3FTXA 1HE8A 2FBNA 4GTSA 4BWRA 4FHKA 2Y3AA 5AQ7A 1E8ZA 1W3BA 5FQ4A 1QNFA 3JQ1A 2WXGA 4U7EB 4BSZB 3PS6A 4RSYA 2IOLA 4U8VD 3GZ2A 3PUKA 2CFZA 5JHBA 3FTWA 3QOUA 4HOUA 3UM0A 5ENQD 4AVXA 5CBOA 3CHSA 1HXIA 2OVBA 1N4RA 3QARA 3L22A 1H2TC 2QC9A 2CG2A 2IONA 5EYPF 4F3VA 3D9NA 3ZXPA 1OCOE 4GB9A 1TEZA 5D0OD 2LXMA 3FU0A 3DXMG 4FADA 2XCBA 4ILHB 2YQ8A 3UT4A 3EJNA 3ZYQA 4XEIG 3UKUG 4B0ZA 4BY6A 5H7PA 4WNDA 4C0MA 4OVVA 2AXVA 5IY5E 3OXLA 3KAEA 4MRUA 1SA4A 4DX2A 3PZDA 4ATGA 3MKQA 3KEZA 3K9IA 4HNAD 2XEHA 1WAO1 3HXCA 3FU5A 4A3VA 1TN7A 2WQHA 3CK7A 1UW4B 1X81A 3CKBA 4U0SA 5B1AE 3CVYA 4XKCA 2BF0X 2L0IA 2UWJG 3FULA 3ESLA 1O5MA 4O1OA 2XS8A 2NSZA 2V4HC 3DRAA 4LG6A 3UIPC 4J8EA 3HHMA 3I4RB 2EIKE 4A1SA 3FFLA 3FWVA 1WDYA 5G04J 3JXIA 4PDXA 5BUZA 3BQOA 3DEPA 1MJ0A 3EU5A 2M63A 1N0RA 1L5JA 4N3AA 4WWOA 5G05J 3S7JA 5ARGA 2FF4A 4HOSA 5ANRA 4TRQA 5BNWA 1UJJA 4BTAA 3SNXA 2I2OA 3L9TA 2PM7A 2ZIRA 3EHNA 3SO8A 5JJ6A 1TNZA 1JCSA 3MV2B 4TXRA 3DWLG 3ULYA 3F6QA 5AN8A 2IQCA 3E37A 2EQXA 3FP3A 1FVFA 3OTNA 5G2NA 2V5FA 2GRRB 2C0LA 4HRMB 1D8DA 4U95D 2WXLA 1NI1A 1H19A 3J5QB 1E90A 3RO3A 4W9RA 5KJNA 3ABLE 2LUHA 2GROB 4AP2A 3LVQE 4DLQA 4I2ZA 5HKPA 3FDHA 3IV0A 3RRUA 3GZ1A 1OXJA 1K1AA 5EX3A 3UKRG 1YA0A 1AWCB 3FH7A 3FUHA 1NFIE 3QAQA 4J8DA 4K5AB 1H6KA 4YDOA 4BEPA 4XKBA 4Y6WA 2VSNA 1DC2A 3Q75A 3GW4A 2YHCA 3B7SA 3EDTB 5FQ7A 2F8XK 3ASOE 2FULA 5T4YA 1S70B 3LS8A 2Y4TA 3ZN3A 1ELRA 3DSTA 4G2VA 4GZ5A 4O60A 3LEWA 3UT8A 3TG5A 4ACLA 2QYUA 1UN8A 1SVXA 4GU5A 4LNBA 1QQEA 3IHYA 1HG5A 3EHQA 5BXOA 5EYLA 3HXDA 2XEVA 3RRMB 1BD8A 2IU1A 4YVOA 1LD8A 3PE3A 3NZSA 5FIOA 5BXUA 1OCZE 3LY7A 2R05A 2XRZA 3SBSA 5J08A 4GTMA 3E34A 4V3IA 2AXUA 3L6AA 3UUXA 5AQBA 2C2LA 3Q73A 2FI7A 3EHMA 1D8EA 1O1RA 3TWRA 3D9PA 3S7DA 1TNUA 2Y4UA 2P9IG 3LYAA 3RU0A 4B8AA 4IULA 3HXEA 1IKND 4WNGA 3T5XA 2HM8A 4A55A 4QFVA 5AQAA 4TUUA 3NOGD 4YDYA 2EINE 3APCA 2KC7A 2LAIA 4P29A 3ASNE 3T8MA 2P9LG 1LTXA 5LFAA 2FO1E 4RVBA 4N5QA 1LF8A 2XCCA 4BT9A 1FT1A 3ASDA 3CVUA 3BUAA 1HZ4A 5JJTA 3L08A 4CGWA 3B7BA 3JXJA 1WM5A 5M72A 2A4ZA 2Y69E 3B13A 4N3CA 3Q9NC 3CGHA 2VSOE 4JA9A 4GTOA 4TUMA 3NZUA 4EZKA 2X38A 4HQDA 3CR3A 2LSUA 2KM4A 2J09A 2XPYA 4F7AA 1ZBPA 1KPSB 2CHZA 1HX8A 5AAOA 3S2AA 4LEUA 3ZXSA 1GW6A 3KD7A 2XPZA 2ZGGA 3CHRA 2AJAA 1OWNA 1N4SA 4UWKA 2WXNA 2EIME 1EPUA 5KJMA 1XNFA 5FT9A 3CVQA 3MA5A 1H2UA 2IFUA 2KCLA 2PNNA 5JMND 4LSZE 4L7TA 2JABA 2IEJA 5FZRA 2XRYA 5LX8A 1KT1A 4IRUA 3SHFA 4APOA 3NQPA 2VYIA 4LRZA 4GAAA 2XQ0A 3TG4A 3DSSA 1A5EA 2H6IA 3ZYKA 5AQ9A 4CT4A 2JLBA 3FUEA 3S7FA 1UJKA 2F8YA 5LP0A 1H0AA 4GMRA 4E6HA 3FUJA 4HLLA 1N94A 4G11A 2ETAA 3VLEA 3PREA 4DX7D 4MBGA 3D9LA 3UQ3A 1PY1A 3T5VA 4BX9A 2WQ6A 2F37A 1TYQG 2NC9A 4JZYA 4RLYA 5A23A 1OUVA 3ULEG 3LY9A 3NAWA 4CDRA 1N0QA 3LY8A 4JD2G 1DNPA 4B93B 2CG3A 3BU8A 5DBKA 2BKKB 2VGYA 3O4ZA 2ILRA 3FU6A 1OCCE 4CT0A 5LCWC 4EBAA 1V55E 2NYJA 3TGOA 4O1PA 3CHMA 4UUCA 4G24A 2AVPA 3CVXA 1UOHA 2FO7A 3MX3A 3HXFA 2GW1A 3Q79A 4JVSA 4X8QA 4TXPA 3R7QA 2WXMA 3FEYA 4EECA 2XS1A 4AY6A 1JCQA 2MHKA 1EYHA 3W9GA 1EF1C 4LNUD 3WG7E 5BW8C 5FJYA 2WM9A 3SF4A 4HXIA 1UN9A 3C5RA 1H2VC 3OXGA 4G25A 3LPZA 3DPYA 1A17A 2OEVA 3CKCA 2VTBB 5CECB 1WG0A 3SZ7A 5EN5D 3E32A 4EZJA 5CHEE 2XZTG 3DSWA 3MCXA 3E30A 2X6HA 3S7BA 4FJYA 4DPRA 3QDNA 3U4TA 2KCKA 2WPVA 1HH8A 4C48B 1RW2A 5AIJA 3ISMC 2VSXE 2RKKA 1E8WA 1FT2A 3X2QE 2ZU6B 3CV0A 4GYYA 2P9UG 1IHBA 4JXTA 3NOCD 4WAFA 4CGVA 2E2EA 3QNKA 4HFGA 1OT8A 2WMNA 3MYVA 3Q78A 3LDZA 3TJPA 4DRXE 3EU9A 2ZISA 1HF8A 3MEKA 3CEQA 3TWXA 4GTVA 4KZ0A 2BUGA 3MKRA 3FUMA 4CEMA 4PS8A 1IYGA 3PUJA 4HRLA 1MX2A 5AENA 3ZU7B 4ATZD 3HIZA 1DVPA 2RG8A 4DLOA 3Q9UC 3O48A 2WQ7A 1E7UA 1KLXA 3FUFA 3UM1A 3Q47B 4ILIA 4CDMA 4WWPA 3FUNA 3ZPJA 1N4PA 3FTZA 2BTDA 1S64A 3GYZA 4OAUC 4XE0A 2WXFA 4U0ZA 2LAHA 3CIAA 2YNQA 4I1MA 3UXGA 2VTBA 3Q5MA 5CMYA 2I1KA 3AG1E 3IEGA 2L9BA 3RRNB 2LNIA 3UT7A 1ZU2A 3SQVA 3ML8A 4B8CB 1SQMA 3I5PA 3AU5A 3JUEA 1JCRA 2VSYA 4Q96A 2J4BA 1LD7A 4N5CA 5AJLA 5LCWJ 1Q2ZA 3G2SA 1BI8B 1TR4A 5E76A 4HI9A 2KBXA 2A5EA 4GZCA 1YMPA 4J8YA 4EPZA 3WXXA 1B89A 2RD0A 2QY7A 3G2WA 1IXVA 1PC2A 5BT1A 4N3BA 2VQ2A 4K5BA 1Y6IA 1JUQA 5HS0A 4HBDA 3UI2A 2CHXA 2OOEA 3EHRA 3CVLA 2GRQB 3TWTA 5KCMA 4Q69A 4H7YA 4DX5D 2QFCA 5ITZF 4I1AA
chains in the Genus database with same CATH topology
1FT1A 1O1TA 1NL4A 3DPYA 4GTQA 1N94A 4GTPA 4LNBA 1N4PA 1N9AA 4MBGA 1TNYA 1S63A 1S64A 3E32A 4YDEA 1TNOA 2ZIRA 3Q7FA 4GTOA 1DCEA 1TNZA 1SA5A 3DSWA 1JCSA 3E30A 3HXDA 3HXBA 1MZCA 4GTRA 3E37A 2H6HA 3DSVA 3DSUA 3PZ3A 2BEDA 1SA4A 3C72A 3PZ1A 1D8DA 1NI1A 2H6FA 1LD8A 1FT2A 3EUVA 3SFYA 1JCRA 3HXCA 3Q7AA 1FPPA 1KZPA 1LD7A 1TN7A 2R2LA 4GTMA 4LNGA 3E34A 1X81A 3E33A 4GTTA 1TN6A 3Q73A 1O5MA 1D8EA 1O1RA 3DSXA 1TNUA 4EHMA 3Q78A 1N4SA 4GTSA 3HXFA 3Q79A 3DRAA 3HXEA 1TNBA 2ZISA 4L9PA 2IEJA 4YDOA 1JCQA 2F0YA 4GTVA 1KZOA 3PZ4A 3KSQA 1N95A 3Q75A 3SFXA 1O1SA 2H6GA 3PZ2A 3DSSA 2H6IA 3EU5A 1LTXA 3KSLA 1TN8A 1N4RA 3DSTA 1N4QA 1QBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FT1 A;  1O1T A;  1NL4 A;  3DPY A;  4GTQ A;  1N94 A;  4GTP A;  4LNB A;  1N4P A;  1N9A A;  4MBG A;  1TNY A;  1S63 A;  1S64 A;  3E32 A;  4YDE A;  1TNO A;  2ZIR A;  3Q7F A;  4GTO A;  1DCE A;  1TNZ A;  1SA5 A;  3DSW A;  1JCS A;  3E30 A;  3HXD A;  3HXB A;  1MZC A;  4GTR A;  3E37 A;  2H6H A;  3DSV A;  3DSU A;  3PZ3 A;  2BED A;  1SA4 A;  3C72 A;  3PZ1 A;  1D8D A;  1NI1 A;  2H6F A;  1LD8 A;  1FT2 A;  3EUV A;  3SFY A;  1JCR A;  3HXC A;  3Q7A A;  1FPP A;  1KZP A;  1LD7 A;  1TN7 A;  2R2L A;  4GTM A;  4LNG A;  3E34 A;  1X81 A;  3E33 A;  4GTT A;  1TN6 A;  3Q73 A;  1O5M A;  1D8E A;  1O1R A;  3DSX A;  1TNU A;  4EHM A;  3Q78 A;  1N4S A;  4GTS A;  3HXF A;  3Q79 A;  3DRA A;  3HXE A;  1TNB A;  2ZIS A;  4L9P A;  2IEJ A;  4YDO A;  1JCQ A;  2F0Y A;  4GTV A;  1KZO A;  3PZ4 A;  3KSQ A;  1N95 A;  3Q75 A;  3SFX A;  1O1S A;  2H6G A;  3PZ2 A;  3DSS A;  2H6I A;  3EU5 A;  1LTX A;  3KSL A;  1TN8 A;  1N4R A;  3DST A;  1N4Q A;  1QBQ A; 
#chains in the Genus database with same CATH topology
 3U3W A;  1O1T A;  4LUN U;  3BEE A;  1H6P A;  1Z3Y A;  3PDN A;  3V30 A;  4HOQ A;  3JUI A;  4B89 A;  3OAW A;  1FCH A;  1EDU A;  2A5U A;  2XGM A;  4RQI A;  3B7U X;  4HI8 A;  3DXK G;  2DIW A;  1MQS A;  5JJ7 A;  4MS6 A;  5KWD A;  3VLD A;  3APF A;  4ANW A;  4A3T A;  1SZA A;  3R9A B;  5AYW D;  4PS3 A;  1FPP A;  4JW1 A;  3AG3 E;  4GMJ A;  4XI0 A;  4GCN A;  4MKT A;  3AG4 E;  2KZT B;  4KMO A;  2HE0 A;  4PS7 A;  3G2U A;  4CDN A;  4F1P A;  4EHM A;  3ONK A;  2WXK A;  3ABK E;  5EKQ D;  1JPL A;  4FJZ A;  4Y6C A;  1TNB A;  4QQI A;  4UWH A;  2C0M A;  2HYZ A;  1OWO A;  5EX0 A;  5G55 A;  5KJL A;  1HFA A;  3IKO B;  4FA6 A;  3LJN A;  2EIJ E;  4C0E A;  3SFX A;  5D0Q D;  2H6G A;  2B0O E;  5A6C A;  2GRP B;  5E75 A;  5CCM A;  2CFU A;  5KNH D;  4DUI A;  3C98 A;  3MJW A;  2L0T B;  4AY5 A;  4L2Y A;  4GTQ A;  4I17 A;  3FTU A;  4GTP A;  3U9W A;  3N71 A;  2HO1 A;  1TNY A;  3FUD A;  2WXO A;  2OEW A;  3Q7F A;  1DCQ A;  4CRW A;  4XZ4 A;  3ZRH A;  4HVB A;  4GTR A;  3CLJ A;  2UY1 B;  4IYP A;  2OND A;  2MYO A;  4CZ2 D;  2PZI A;  4XIF A;  1E8X A;  2R02 A;  4FU3 A;  4DX6 D;  2XEN A;  3UX4 A;  1MHQ A;  4J8S A;  3CHO A;  1OWL A;  2QYJ A;  3PEU B;  3FH8 A;  3ABM E;  4E85 A;  1BLX B;  4NRH B;  4EQF A;  5DIZ A;  3DSX A;  4GCO A;  2MRI A;  5CER B;  4KT6 B;  3ASH A;  4L9P A;  4I2W A;  1YCS B;  3V79 K;  4TXQ A;  5BV0 A;  5CRU A;  3L16 A;  3ZHE B;  2IF4 A;  1BI7 B;  3QC1 A;  3ASG A;  3HVE B;  3CHP A;  3B95 A;  2FEZ A;  5ENS D;  4UI9 C;  4ANV A;  3U66 A;  3ZUV B;  2J08 A;  3PH0 C;  3SY2 A;  4KVO A;  2WXJ A;  5C1D A;  2AXZ A;  3G2V A;  3LVR E;  1NL4 A;  1HO8 A;  5CBN A;  2Q7F A;  5EIB E;  4DJA A;  4YDE A;  4J0U A;  2Y1L E;  3JCK C;  4APF A;  4AIF A;  4JPS A;  1DCE A;  3GZS A;  3HXB A;  5ENO D;  4JHJ A;  3DSV A;  3FHE A;  3V31 A;  1JWG A;  3ZNG A;  5B3S E;  4JC8 A;  1FVH A;  4EBA G;  2PM6 A;  1OY3 D;  1N54 A;  3ZIM A;  2NXP A;  2X3M A;  3ESK A;  5T8I A;  3EIQ C;  3Q7A A;  2ETC A;  5LOZ A;  3TWS A;  2V8S E;  2XHE A;  2P9S G;  2R03 A;  3P2B A;  4LNG A;  3C3R A;  3E33 A;  2WXP A;  5EID A;  1OWP A;  3PE4 A;  4GA1 A;  5A7D B;  3J5P A;  1E7V A;  3EIJ A;  2J07 A;  3TWW A;  3TXN A;  1V54 E;  3ZW3 A;  2P58 C;  4KZC A;  1Z5S C;  4DK5 A;  3LXU X;  1KZO A;  1N95 A;  1BU9 A;  2DVW A;  3URZ A;  4UQX A;  2L6B A;  3UM2 A;  3TWQ A;  4RG9 A;  3D9K A;  1QZ2 A;  4K03 A;  3KSL A;  3MKQ B;  2B6C A;  3HVE A;  5JHA A;  1H6O A;  4WNE A;  5ENR D;  4BET A;  1E96 B;  3LCA A;  4H7X A;  4I6J A;  2DCP A;  4OAV B;  3TXM A;  2P2C P;  2PL2 A;  1PAQ A;  2LSV A;  5FIN A;  3AS5 A;  4BT8 A;  4Z68 A;  3RAU A;  4OVU A;  1UG3 A;  3L82 A;  4UWL A;  2DYS E;  3I3N A;  3QWW A;  4WWN A;  1NP7 A;  1WY6 A;  4I6G A;  3PZ3 A;  4KYO B;  3C3Q A;  2J4D A;  1XGW A;  4ZFH A;  1KT0 A;  3RIB A;  2CHW A;  1Z3X A;  3SFY A;  4XI9 A;  4AJW A;  4A1G A;  4URK A;  2DWZ A;  4BFR A;  3AJI A;  4FUL A;  1Z6T A;  1TN6 A;  1SW6 A;  4AXH A;  2RFA A;  1NZN A;  3QWP A;  3AU4 A;  2X6J A;  3AAA C;  3FUK A;  4N2Q A;  4BSX A;  3E4B A;  1S0P A;  3FY4 A;  3PEV B;  4HB5 A;  3ULQ A;  2X6F A;  4UWG A;  2GGF A;  2DYR E;  4F1S A;  2R17 C;  4U8Y D;  4K0R A;  5B1B E;  4I9E A;  3JYS A;  2OCC E;  3CST A;  5ANL A;  3ZVV A;  4WNF A;  5HI7 A;  4UI9 J;  3PZ4 A;  4ANU A;  2XGS A;  2WB2 A;  4BER A;  2J8S D;  3SGH A;  5D2M C;  3IBE A;  5CED B;  3L17 A;  3FH5 A;  5BV1 A;  3I4G A;  4BX8 A;  3RO2 A;  5HQ8 A;  1N4Q A;  2MOW A;  2ETB A;  4I6E A;  3ENE A;  3UM3 A;  1TJF A;  5KNG A;  4J6I A;  4BES A;  5ENN A;  5EDS A;  2P9K G;  1JWF A;  3ZYM A;  4XX5 A;  1SA5 A;  4ACK A;  4UQY A;  3NF1 A;  3Q4A B;  2IY0 C;  1RZ4 A;  1TJC A;  3DBS A;  3V2X A;  2JEK A;  2I6H A;  3PRZ A;  3C3O A;  2RFM A;  1MYO A;  3APD A;  3U64 A;  3C72 A;  4B94 A;  4DI4 A;  5D66 A;  3ASF A;  3EUV A;  4UI9 K;  3OXF A;  3B7R L;  4YDW A;  3MZL B;  1KZP A;  3W9F A;  4N2S A;  3IXE A;  5C2Y A;  4HRN A;  3CSF A;  3TWV A;  4KXK B;  2WMO A;  4G23 A;  4F53 A;  3DEO A;  3TL5 A;  1K8K G;  3HYM B;  4NIK A;  3FU3 A;  4G26 A;  3D9M A;  3CK8 A;  4IN3 B;  4Q94 A;  5HRY A;  4HLE A;  5ENT D;  1K1B A;  5KBA A;  4J7W A;  1ZB1 A;  2J49 A;  1HG2 A;  4K5C A;  4U07 A;  1IHG A;  3CVP A;  3JQ0 A;  4YND A;  1U3D A;  4U8H A;  1TN8 A;  3ZYL A;  4KBQ A;  4KVM A;  3FEX A;  2PQR A;  2X6K A;  3SBT B;  1U3C A;  5JA4 D;  2ZGD A;  3VTX A;  4GZD A;  3DPD A;  2V5Q C;  4C9B B;  4EZL A;  1S63 A;  2I9C A;  3NBN B;  1Y8M A;  4JEH A;  4GPK A;  1MZC A;  2LO6 A;  4GZ3 A;  3D9I A;  4M7C A;  3QB2 A;  2R5S A;  1U2V G;  4FLH A;  5ARF A;  3CK9 A;  4FHJ A;  4O6F A;  4GZ6 A;  4I1O B;  1N11 A;  4AV7 A;  2E0I A;  3QKY A;  2V0P A;  3G2T A;  1INZ A;  3ZKJ A;  4GYO A;  4GTT A;  4LCT A;  2V4L A;  3LKU A;  2IJG X;  5FQ6 A;  4JHK A;  5EIL A;  4AM9 A;  1OCR E;  4A63 B;  3ML9 A;  3HRA A;  3UTM A;  5AAR A;  4FLB A;  2WXR A;  4FP7 A;  1K3Z D;  2YIN A;  3RJV A;  1IQU A;  2VGX B;  3AS8 A;  1O1S A;  2WXI A;  4BTB A;  2ZXW E;  2Y0B G;  1ELW A;  1E8Y A;  2DZN A;  4R7L A;  4UQZ A;  4ANX A;  4GYW A;  4GA2 A;  2OV8 A;  2EIL E;  3CVW A;  3AG2 E;  3MV3 B;  2GRM A;  3VLF A;  4CCA A;  3RKV A;  4NUR A;  2I1J A;  3D3M A;  4WUY A;  1ELK A;  4PUC A;  3P1U A;  1HS6 A;  4I9C A;  2H6H A;  3FUI A;  4GML A;  4U96 D;  3RSE G;  3D9J A;  3AS4 A;  3QK0 A;  4HOR A;  4UWF A;  2H6F A;  3KEA A;  3Q49 B;  3B7T A;  1BPO A;  1NA3 A;  4GPM A;  3Q15 A;  2XPI A;  2KAT A;  4RG6 A;  4J8F A;  3L54 A;  5FWQ A;  2GRN B;  4NQ0 A;  4AEZ C;  4U04 A;  3CQC B;  4AOF A;  4JHR A;  3UMV A;  3QWV A;  3PNT B;  3FTY A;  4G8L A;  3V2O A;  3BG1 B;  1N52 A;  4ABN A;  5AJD A;  2LXL A;  4U63 A;  4GA0 A;  3D9H A;  3L13 A;  4D10 C;  1NA0 A;  3R9M A;  2IO2 C;  4DI3 A;  5T3R A;  2P9N G;  4I43 A;  3IHV A;  3UIN C;  3KSQ A;  4ZHB A;  2KXP C;  1HU3 A;  2KZT A;  4JEU A;  4CYM D;  2VGX A;  4JL0 A;  1MX6 A;  3FTV A;  2XGO A;  2R59 A;  5FZS A;  2J9Q A;  3SI5 A;  2AW6 A;  1QYM A;  3T9K A;  3R7R A;  2PQN A;  5BPP A;  5FQ8 A;  3TAX A;  2AWI A;  2VJ8 A;  3FTS A;  3CQG B;  1P5Q A;  4G8K A;  1YYH A;  1X5B A;  3NB2 A;  3SD5 A;  5CCL A;  4YVQ C;  2WXH A;  3QJZ A;  5CEA A;  3D9O A;  3ZGQ A;  1OWM A;  3ONL A;  2YHE A;  4F6R D;  2R2L A;  3RK6 A;  2KCV A;  2VGE A;  2P9P G;  3CHQ A;  4FC8 A;  3HG0 D;  4MLP A;  2OVF A;  2UY1 A;  4OYS A;  3MGB A;  2DZO A;  1SZ9 A;  2F0Y A;  3VTY A;  2WXQ A;  4HOT A;  3PNL B;  2L6J A;  5FTP A;  3PZ2 A;  1VDY A;  4JB8 P;  1AP7 A;  5G04 C;  5FZQ A;  1IQR A;  2HR2 A;  3BG0 B;  5KJK A;  4LER A;  2WVI A;  5CRV A;  3UPV A;  4ME2 A;  4L2L A;  1QBQ A;  3UIO C;  3T8K A;  5G05 C;  3SFZ A;  4G1T A;  3LJ3 A;  4ILG A;  2IOS A;  4L23 A;  4NAC A;  4JA7 A;  2GRL A;  5CMW A;  3ZFW A;  1N9A A;  3TWU A;  2XEE A;  2X6I A;  4DX1 A;  1TNO A;  4M3O A;  3ZHE A;  3ZEF A;  4HS2 A;  3CVN A;  3DSU A;  2BED A;  5J90 A;  3HDX A;  4L1B A;  3KS2 A;  2BKG A;  3PZ1 A;  2QZA A;  1G3N B;  1MX4 A;  4U0U A;  4TV3 A;  3PVL A;  2XZD G;  3CVV A;  4N39 A;  4PH4 B;  1D9S A;  5ENP D;  2DBA A;  2IO3 C;  3FTX A;  1HE8 A;  2FBN A;  4GTS A;  4BWR A;  4FHK A;  2Y3A A;  5AQ7 A;  1E8Z A;  1W3B A;  5FQ4 A;  1QNF A;  3JQ1 A;  2WXG A;  4U7E B;  4BSZ B;  3PS6 A;  4RSY A;  2IOL A;  4U8V D;  3GZ2 A;  3PUK A;  2CFZ A;  5JHB A;  3FTW A;  3QOU A;  4HOU A;  3UM0 A;  5ENQ D;  4AVX A;  5CBO A;  3CHS A;  1HXI A;  2OVB A;  1N4R A;  3QAR A;  3L22 A;  1H2T C;  2QC9 A;  2CG2 A;  2ION A;  5EYP F;  4F3V A;  3D9N A;  3ZXP A;  1OCO E;  4GB9 A;  1TEZ A;  5D0O D;  2LXM A;  3FU0 A;  3DXM G;  4FAD A;  2XCB A;  4ILH B;  2YQ8 A;  3UT4 A;  3EJN A;  3ZYQ A;  4XEI G;  3UKU G;  4B0Z A;  4BY6 A;  5H7P A;  4WND A;  4C0M A;  4OVV A;  2AXV A;  5IY5 E;  3OXL A;  3KAE A;  4MRU A;  1SA4 A;  4DX2 A;  3PZD A;  4ATG A;  3MKQ A;  3KEZ A;  3K9I A;  4HNA D;  2XEH A;  1WAO 1;  3HXC A;  3FU5 A;  4A3V A;  1TN7 A;  2WQH A;  3CK7 A;  1UW4 B;  1X81 A;  3CKB A;  4U0S A;  5B1A E;  3CVY A;  4XKC A;  2BF0 X;  2L0I A;  2UWJ G;  3FUL A;  3ESL A;  1O5M A;  4O1O A;  2XS8 A;  2NSZ A;  2V4H C;  3DRA A;  4LG6 A;  3UIP C;  4J8E A;  3HHM A;  3I4R B;  2EIK E;  4A1S A;  3FFL A;  3FWV A;  1WDY A;  5G04 J;  3JXI A;  4PDX A;  5BUZ A;  3BQO A;  3DEP A;  1MJ0 A;  3EU5 A;  2M63 A;  1N0R A;  1L5J A;  4N3A A;  4WWO A;  5G05 J;  3S7J A;  5ARG A;  2FF4 A;  4HOS A;  5ANR A;  4TRQ A;  5BNW A;  1UJJ A;  4BTA A;  3SNX A;  2I2O A;  3L9T A;  2PM7 A;  2ZIR A;  3EHN A;  3SO8 A;  5JJ6 A;  1TNZ A;  1JCS A;  3MV2 B;  4TXR A;  3DWL G;  3ULY A;  3F6Q A;  5AN8 A;  2IQC A;  3E37 A;  2EQX A;  3FP3 A;  1FVF A;  3OTN A;  5G2N A;  2V5F A;  2GRR B;  2C0L A;  4HRM B;  1D8D A;  4U95 D;  2WXL A;  1NI1 A;  1H19 A;  3J5Q B;  1E90 A;  3RO3 A;  4W9R A;  5KJN A;  3ABL E;  2LUH A;  2GRO B;  4AP2 A;  3LVQ E;  4DLQ A;  4I2Z A;  5HKP A;  3FDH A;  3IV0 A;  3RRU A;  3GZ1 A;  1OXJ A;  1K1A A;  5EX3 A;  3UKR G;  1YA0 A;  1AWC B;  3FH7 A;  3FUH A;  1NFI E;  3QAQ A;  4J8D A;  4K5A B;  1H6K A;  4YDO A;  4BEP A;  4XKB A;  4Y6W A;  2VSN A;  1DC2 A;  3Q75 A;  3GW4 A;  2YHC A;  3B7S A;  3EDT B;  5FQ7 A;  2F8X K;  3ASO E;  2FUL A;  5T4Y A;  1S70 B;  3LS8 A;  2Y4T A;  3ZN3 A;  1ELR A;  3DST A;  4G2V A;  4GZ5 A;  4O60 A;  3LEW A;  3UT8 A;  3TG5 A;  4ACL A;  2QYU A;  1UN8 A;  1SVX A;  4GU5 A;  4LNB A;  1QQE A;  3IHY A;  1HG5 A;  3EHQ A;  5BXO A;  5EYL A;  3HXD A;  2XEV A;  3RRM B;  1BD8 A;  2IU1 A;  4YVO A;  1LD8 A;  3PE3 A;  3NZS A;  5FIO A;  5BXU A;  1OCZ E;  3LY7 A;  2R05 A;  2XRZ A;  3SBS A;  5J08 A;  4GTM A;  3E34 A;  4V3I A;  2AXU A;  3L6A A;  3UUX A;  5AQB A;  2C2L A;  3Q73 A;  2FI7 A;  3EHM A;  1D8E A;  1O1R A;  3TWR A;  3D9P A;  3S7D A;  1TNU A;  2Y4U A;  2P9I G;  3LYA A;  3RU0 A;  4B8A A;  4IUL A;  3HXE A;  1IKN D;  4WNG A;  3T5X A;  2HM8 A;  4A55 A;  4QFV A;  5AQA A;  4TUU A;  3NOG D;  4YDY A;  2EIN E;  3APC A;  2KC7 A;  2LAI A;  4P29 A;  3ASN E;  3T8M A;  2P9L G;  1LTX A;  5LFA A;  2FO1 E;  4RVB A;  4N5Q A;  1LF8 A;  2XCC A;  4BT9 A;  1FT1 A;  3ASD A;  3CVU A;  3BUA A;  1HZ4 A;  5JJT A;  3L08 A;  4CGW A;  3B7B A;  3JXJ A;  1WM5 A;  5M72 A;  2A4Z A;  2Y69 E;  3B13 A;  4N3C A;  3Q9N C;  3CGH A;  2VSO E;  4JA9 A;  4GTO A;  4TUM A;  3NZU A;  4EZK A;  2X38 A;  4HQD A;  3CR3 A;  2LSU A;  2KM4 A;  2J09 A;  2XPY A;  4F7A A;  1ZBP A;  1KPS B;  2CHZ A;  1HX8 A;  5AAO A;  3S2A A;  4LEU A;  3ZXS A;  1GW6 A;  3KD7 A;  2XPZ A;  2ZGG A;  3CHR A;  2AJA A;  1OWN A;  1N4S A;  4UWK A;  2WXN A;  2EIM E;  1EPU A;  5KJM A;  1XNF A;  5FT9 A;  3CVQ A;  3MA5 A;  1H2U A;  2IFU A;  2KCL A;  2PNN A;  5JMN D;  4LSZ E;  4L7T A;  2JAB A;  2IEJ A;  5FZR A;  2XRY A;  5LX8 A;  1KT1 A;  4IRU A;  3SHF A;  4APO A;  3NQP A;  2VYI A;  4LRZ A;  4GAA A;  2XQ0 A;  3TG4 A;  3DSS A;  1A5E A;  2H6I A;  3ZYK A;  5AQ9 A;  4CT4 A;  2JLB A;  3FUE A;  3S7F A;  1UJK A;  2F8Y A;  5LP0 A;  1H0A A;  4GMR A;  4E6H A;  3FUJ A;  4HLL A;  1N94 A;  4G11 A;  2ETA A;  3VLE A;  3PRE A;  4DX7 D;  4MBG A;  3D9L A;  3UQ3 A;  1PY1 A;  3T5V A;  4BX9 A;  2WQ6 A;  2F37 A;  1TYQ G;  2NC9 A;  4JZY A;  4RLY A;  5A23 A;  1OUV A;  3ULE G;  3LY9 A;  3NAW A;  4CDR A;  1N0Q A;  3LY8 A;  4JD2 G;  1DNP A;  4B93 B;  2CG3 A;  3BU8 A;  5DBK A;  2BKK B;  2VGY A;  3O4Z A;  2ILR A;  3FU6 A;  1OCC E;  4CT0 A;  5LCW C;  4EBA A;  1V55 E;  2NYJ A;  3TGO A;  4O1P A;  3CHM A;  4UUC A;  4G24 A;  2AVP A;  3CVX A;  1UOH A;  2FO7 A;  3MX3 A;  3HXF A;  2GW1 A;  3Q79 A;  4JVS A;  4X8Q A;  4TXP A;  3R7Q A;  2WXM A;  3FEY A;  4EEC A;  2XS1 A;  4AY6 A;  1JCQ A;  2MHK A;  1EYH A;  3W9G A;  1EF1 C;  4LNU D;  3WG7 E;  5BW8 C;  5FJY A;  2WM9 A;  3SF4 A;  4HXI A;  1UN9 A;  3C5R A;  1H2V C;  3OXG A;  4G25 A;  3LPZ A;  3DPY A;  1A17 A;  2OEV A;  3CKC A;  2VTB B;  5CEC B;  1WG0 A;  3SZ7 A;  5EN5 D;  3E32 A;  4EZJ A;  5CHE E;  2XZT G;  3DSW A;  3MCX A;  3E30 A;  2X6H A;  3S7B A;  4FJY A;  4DPR A;  3QDN A;  3U4T A;  2KCK A;  2WPV A;  1HH8 A;  4C48 B;  1RW2 A;  5AIJ A;  3ISM C;  2VSX E;  2RKK A;  1E8W A;  1FT2 A;  3X2Q E;  2ZU6 B;  3CV0 A;  4GYY A;  2P9U G;  1IHB A;  4JXT A;  3NOC D;  4WAF A;  4CGV A;  2E2E A;  3QNK A;  4HFG A;  1OT8 A;  2WMN A;  3MYV A;  3Q78 A;  3LDZ A;  3TJP A;  4DRX E;  3EU9 A;  2ZIS A;  1HF8 A;  3MEK A;  3CEQ A;  3TWX A;  4GTV A;  4KZ0 A;  2BUG A;  3MKR A;  3FUM A;  4CEM A;  4PS8 A;  1IYG A;  3PUJ A;  4HRL A;  1MX2 A;  5AEN A;  3ZU7 B;  4ATZ D;  3HIZ A;  1DVP A;  2RG8 A;  4DLO A;  3Q9U C;  3O48 A;  2WQ7 A;  1E7U A;  1KLX A;  3FUF A;  3UM1 A;  3Q47 B;  4ILI A;  4CDM A;  4WWP A;  3FUN A;  3ZPJ A;  1N4P A;  3FTZ A;  2BTD A;  1S64 A;  3GYZ A;  4OAU C;  4XE0 A;  2WXF A;  4U0Z A;  2LAH A;  3CIA A;  2YNQ A;  4I1M A;  3UXG A;  2VTB A;  3Q5M A;  5CMY A;  2I1K A;  3AG1 E;  3IEG A;  2L9B A;  3RRN B;  2LNI A;  3UT7 A;  1ZU2 A;  3SQV A;  3ML8 A;  4B8C B;  1SQM A;  3I5P A;  3AU5 A;  3JUE A;  1JCR A;  2VSY A;  4Q96 A;  2J4B A;  1LD7 A;  4N5C A;  5AJL A;  5LCW J;  1Q2Z A;  3G2S A;  1BI8 B;  1TR4 A;  5E76 A;  4HI9 A;  2KBX A;  2A5E A;  4GZC A;  1YMP A;  4J8Y A;  4EPZ A;  3WXX A;  1B89 A;  2RD0 A;  2QY7 A;  3G2W A;  1IXV A;  1PC2 A;  5BT1 A;  4N3B A;  2VQ2 A;  4K5B A;  1Y6I A;  1JUQ A;  5HS0 A;  4HBD A;  3UI2 A;  2CHX A;  2OOE A;  3EHR A;  3CVL A;  2GRQ B;  3TWT A;  5KCM A;  4Q69 A;  4H7Y A;  4DX5 D;  2QFC A;  5ITZ F;  4I1A A; 
#chains in the Genus database with same CATH homology
 1FT1 A;  1O1T A;  1NL4 A;  3DPY A;  4GTQ A;  1N94 A;  4GTP A;  4LNB A;  1N4P A;  1N9A A;  4MBG A;  1TNY A;  1S63 A;  1S64 A;  3E32 A;  4YDE A;  1TNO A;  2ZIR A;  3Q7F A;  4GTO A;  1DCE A;  1TNZ A;  1SA5 A;  3DSW A;  1JCS A;  3E30 A;  3HXD A;  3HXB A;  1MZC A;  4GTR A;  3E37 A;  2H6H A;  3DSV A;  3DSU A;  3PZ3 A;  2BED A;  1SA4 A;  3C72 A;  3PZ1 A;  1D8D A;  1NI1 A;  2H6F A;  1LD8 A;  1FT2 A;  3EUV A;  3SFY A;  1JCR A;  3HXC A;  3Q7A A;  1FPP A;  1KZP A;  1LD7 A;  1TN7 A;  2R2L A;  4GTM A;  4LNG A;  3E34 A;  1X81 A;  3E33 A;  4GTT A;  1TN6 A;  3Q73 A;  1O5M A;  1D8E A;  1O1R A;  3DSX A;  1TNU A;  4EHM A;  3Q78 A;  1N4S A;  4GTS A;  3HXF A;  3Q79 A;  3DRA A;  3HXE A;  1TNB A;  2ZIS A;  4L9P A;  2IEJ A;  4YDO A;  1JCQ A;  2F0Y A;  4GTV A;  1KZO A;  3PZ4 A;  3KSQ A;  1N95 A;  3Q75 A;  3SFX A;  1O1S A;  2H6G A;  3PZ2 A;  3DSS A;  2H6I A;  3EU5 A;  1LTX A;  3KSL A;  1TN8 A;  1N4R A;  3DST A;  1N4Q A;  1QBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...