1OCOE

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
109
structure length
109
Chain Sequence
b'SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1ocoE00
3ABME 3ASOE 2EINE 3AG4E 2ZXWE 5B1AE 1OCCE 1OCRE 2EIJE 1V54E 2EILE 3AG2E 2DYRE 2EIKE 3ABKE 2OCCE 1OCZE 1OCOE 2DYSE 5B3SE 3X2QE 2Y69E 1V55E 3WG7E 5B1BE 5IY5E 3AG1E 3ABLE 2EIME 3AG3E 3ASNE
chains in the Genus database with same CATH superfamily
5HKPA 1JWGA 1MX2A 4YDEA 3ZYKA 3PNLB 3PZDA 1BD8A 3T8MA 3PUKA 2WMNA 2XPYA 3JUIA 3MJWA 1SQMA 2OVBA 4E6HA 4PS7A 1K1BA 3ABLE 2HO1A 3IV0A 3D9IA 4URKA 1H6KA 1TNUA 3IHVA 4A3VA 3UQ3A 4J8FA 4NIKA 2GRQB 3CSTA 3E37A 3UM1A 3G2SA 4UQXA 5EX3A 2IU1A 4IULA 3FU0A 4U63A 2GRMA 2ZXWE 3KSLA 5FQ7A 3K9IA 1HO8A 2AXZA 2RD0A 4XIFA 3CVNA 3J5PA 3AG2E 2EIKE 3B95A 2WVIA 4HQDA 2AXUA 2XENA 3RO3A 1AWCB 5AENA 2WXOA 5ENPD 4G11A 4B0ZA 4GZ3A 3JUEA 1WM5A 3ZVVA 2KZTB 3AU5A 2PZIA 5KNGA 4J8DA 1Y6IA 3URZA 2KATA 2FBNA 5J08A 3PRZA 4E85A 4DI3A 1IXVA 4V3IA 2XCBA 1S70B 2FF4A 3CEQA 4G2VA 2I1JA 3TGOA 3U66A 3C3RA 3N71A 4G25A 4K5AB 4CDRA 3QDNA 4RQIA 3C3OA 3L08A 4LEUA 5CCMA 3ASDA 2C2LA 2EILE 4DX5D 4I9CA 4M3OA 5G04C 1Q2ZA 4JEHA 3CLJA 1N9AA 2CFUA 4BY6A 2E2EA 1S64A 4U95D 1SZAA 4WUYA 2DCPA 3B13A 1OWMA 3SF4A 4ATZD 1EYHA 1JCSA 1UOHA 3WG7E 3EHMA 3CR3A 2Y1LE 3EHQA 2DBAA 2CHXA 1QQEA 5ANLA 4KMOA 4N2QA 3I4RB 2WXGA 2Y4UA 4APOA 2LNIA 3J5QB 3LPZA 3SZ7A 1E8XA 2LAIA 5AIJA 4HORA 4HOSA 4BX9A 3CVUA 3Q5MA 1UJKA 2J8SD 4DX7D 4TRQA 5AYWD 3FUDA 4I43A 5KJMA 5CEDB 5ENRD 3D9JA 3ESKA 4Q69A 1YA0A 4L2LA 1DCEA 2LUHA 2NXPA 3MV2B 5FQ8A 3KS2A 4XE0A 4KZCA 1D8DA 5B3SE 1H2UA 4GA1A 4GZCA 3V2OA 2Y0BG 2XGSA 4GZ5A 3R9MA 2XQ0A 3KEAA 3HXEA 3ZN3A 5DIZA 2Q7FA 4QQIA 1OUVA 4J0UA 2WXHA 2FEZA 4MS6A 4ILGA 5CRVA 5BUZA 1KLXA 3FTSA 2R03A 2DVWA 3E33A 1HS6A 4NRHB 1QZ2A 2RFMA 4JHKA 2WXPA 5EKQD 2WXLA 3HVEB 1H2TC 4AIFA 1SA4A 1MHQA 4LRZA 4TXRA 4AVXA 5DBKA 2QZAA 5T3RA 2YQ8A 3B7UX 5LOZA 1WG0A 4PS3A 4CT0A 3LJNA 4DX1A 4DLQA 3AS4A 3NAWA 3EIJA 4HOUA 2F37A 3P1UA 3PEUB 3TWXA 3S7FA 2L0TB 1HG2A 5G2NA 3UT4A 5KBAA 5KJLA 3GW4A 3IHYA 5AQAA 1XGWA 5FJYA 3ISMC 2IONA 4G24A 3RIBA 2NSZA 3TWQA 3S7JA 2X3MA 1TN6A 3CK9A 4JD2G 1RW2A 2XGOA 2WXKA 3TJPA 3AG1E 3EDTB 2F8XK 4GPKA 5AN8A 3TWRA 4RG9A 5KJNA 3LS8A 4EECA 3FH7A 4DX6D 1QNFA 3ZNGA 3ZPJA 2J49A 3SGHA 2P9IG 1N52A 3VTYA 1D8EA 4WNFA 3HXBA 3ZGQA 2UY1B 1WDYA 2ZGGA 3GZSA 2UWJG 1N4RA 4HOTA 4UUCA 3L22A 1U3CA 2QYUA 4BSXA 4Q94A 4TXPA 2GRPB 4CDMA 1P5QA 4P29A 3QAQA 3LCAA 3FEYA 3ULEG 3ZYLA 3UMVA 3MZLB 4I6EA 1E8YA 5BV0A 2BUGA 3L16A 2PNNA 3I4GA 1HF8A 1TJFA 4BETA 3T9KA 3CQCB 2I6HA 3CVVA 3PZ1A 3U64A 4RG6A 5CMYA 4WNDA 3RO2A 4DX2A 3DXKG 4GYOA 4ILHB 2BKKB 3D3MA 3NBNB 2AW6A 1NFIE 4FJYA 5CRUA 3ZUVB 3OXLA 2IQCA 5AQ9A 1IHBA 3BU8A 2HM8A 2KCKA 5EYPF 3NQPA 5AQ7A 3ML8A 5JJ6A 1N94A 2YINA 5ANRA 1LTXA 4B89A 1WY6A 2P58C 3ZFWA 3ASHA 3O48A 3ONLA 2Y3AA 2AWIA 4XKBA 1G3NB 1E96B 5A23A 3LEWA 4L9PA 3T5XA 3CVXA 3FU5A 4IN3B 4ZFHA 2IJGX 2EQXA 1JUQA 4CYMD 1E8ZA 1TNBA 2H6GA 4HBDA 2H6IA 2LO6A 3BG0B 2VSYA 4FHJA 4AY5A 3UM0A 1OWLA 2YHCA 4GZDA 4C48B 4OAUC 4UWKA 2AXVA 5BV1A 1V54E 1JCRA 1TEZA 4Y6CA 2WXIA 2QY7A 1V55E 4BSZB 2VGEA 4PS8A 1SW6A 1Z6TA 2ZIRA 4OAVB 1A5EA 1NL4A 1BLXB 4N2SA 3CV0A 3V30A 2V4HC 2PM6A 4FULA 1LD7A 4B94A 1YMPA 5ENTD 5G05C 3O4ZA 2NC9A 2XZDG 3Q47B 2GGFA 4DJAA 3FP3A 3Q78A 2VSOE 3CHSA 3JYSA 3LVRE 3NF1A 1X81A 1LF8A 1BI7B 4EQFA 3DEOA 4J8SA 2DWZA 4RVBA 2DYRE 1H6OA 1OXJA 3SFXA 2MHKA 4DLOA 3WXXA 2X6HA 3DXMG 4DI4A 3SY2A 3ASNE 3EIQC 2MYOA 1IHGA 4U0SA 3OXFA 2X6JA 5BT1A 1MX4A 2R2LA 2V8SE 3UPVA 4TXQA 1HX8A 2VSXE 1D9SA 4I2WA 4GTMA 2L0IA 3FUJA 2NYJA 3EHRA 2VGXA 5BXOA 5FZSA 4GCNA 3HG0D 4JEUA 4UQZA 3FTUA 4L23A 3IKOB 2X38A 3JQ0A 3Q9NC 4HI8A 1E7VA 3OXGA 4J8YA 4BTBA 1UG3A 4O6FA 1OWPA 3RKVA 5BW8C 4J6IA 3V79K 3CIAA 3FTWA 3U9WA 4TUMA 5EX0A 1ELWA 4FLBA 2XGMA 4LNUD 3LY7A 5ENQD 3KAEA 3E4BA 1MYOA 2J09A 1EDUA 2RKKA 3FFLA 2XPIA 3S7BA 2XCCA 4F3VA 1IKND 1X5BA 5AQBA 5CERB 2BF0X 3Q7AA 4GAAA 2IY0C 3W9GA 4A55A 3CGHA 3FUEA 3MCXA 4KBQA 2DIWA 2P9LG 3TWVA 2I2OA 1H2VC 4ANXA 5EN5D 3G2WA 4AY6A 3DSVA 2QYJA 3TWTA 5LCWC 3LYAA 3S2AA 2IO2C 2R05A 4CEMA 3L6AA 3UM2A 2FO1E 2QC9A 4OVVA 2VJ8A 5J90A 4JZYA 3V31A 3U4TA 4WWNA 1WAO1 2L6JA 4AXHA 3S7DA 5IY5E 3NZUA 1S63A 5AAOA 5FTPA 4BWRA 3RRNB 3TL5A 2B6CA 1N4SA 3PZ3A 1K8KG 5FZRA 4WWOA 4JHRA 4OYSA 4HXIA 3C98A 3DBSA 2YNQA 4HOQA 1NP7A 2FULA 2ETCA 4H7YA 4N5QA 3Q49B 4I9EA 4I2ZA 3LVQE 3UI2A 3E32A 4ILIA 4JC8A 4CCAA 3FU6A 3QB2A 4B93B 2R02A 1N95A 1FT1A 3OTNA 4KT6B 5JJTA 3SI5A 4BX8A 3ZIMA 1H0AA 2OOEA 1DCQA 4U07A 2XZTG 2QFCA 3B7BA 3ZXPA 2M63A 3DSUA 2OVFA 3ZYQA 5KJKA 3CSFA 5AARA 4KVMA 3HXCA 4WNEA 5LX8A 1FT2A 2WQ6A 4ACKA 3SFZA 4UI9J 4HRMB 4U0ZA 4U8VD 1MQSA 3CHOA 3UT8A 3PS6A 4K5BA 2EIJE 4XI9A 4HLLA 2KCLA 4N39A 5FZQA 3FH5A 1AP7A 2PM7A 4H7XA 4TUUA 1H6PA 1DC2A 3PH0C 4BT8A 5G55A 5FQ6A 4HNAD 1UW4B 1TNYA 1HU3A 3Q4AB 3PEVB 4U04A 2J08A 3BG1B 3GYZA 3DPYA 3SNXA 5C1DA 3DSTA 4BFRA 3D9LA 4MRUA 3HHMA 5AJDA 4CDNA 4LCTA 3BEEA 2LAHA 1VDYA 3MKQB 3TXMA 3BUAA 4ANUA 2Y4TA 2CHWA 1GW6A 3UX4A 4PDXA 2WMOA 2RFAA 2GRNB 3F6QA 5ENOD 2VQ2A 4GZ6A 2KCVA 1UN9A 2OV8A 4QFVA 3MEKA 1LD8A 3APDA 3CKCA 3GZ1A 2DYSE 3D9KA 2WXRA 3Q9UC 4I1OB 4G8LA 3APCA 4LUNU 4DUIA 3LKUA 3MKQA 3PNTB 3DSXA 4C0MA 3FEXA 3MX3A 4UWFA 4CT4A 4KZ0A 3HRAA 3QWPA 4YDOA 3JQ1A 4W9RA 3LJ3A 2Y69E 2JLBA 4XKCA 4GTQA 3ENEA 3EUVA 2GRLA 3CHQA 3FUKA 4G1TA 3PZ4A 4NQ0A 3LY9A 1E7UA 5JHBA 1NZNA 2C0MA 4JW1A 4G26A 1TYQG 4FC8A 1A17A 4YDYA 5E76A 1O1RA 2WXFA 3TWUA 3DEPA 4Z68A 5HI7A 3DSSA 2ETAA 4YVOA 4FP7A 1SA5A 3RRMB 4GMLA 2WM9A 2XS1A 4DRXE 4EZKA 1UN8A 2J9QA 3CVLA 4N5CA 5HQ8A 3QK0A 3AG4E 4F6RD 2HYZA 1K3ZD 2KXPC 4JA9A 3B7RL 4JB8P 3QNKA 2BKGA 1N4QA 1YYHA 2CG2A 5D2MC 3D9OA 3CVQA 3FHEA 4UWGA 4U8HA 3RRUA 2IF4A 4HI9A 3UT7A 1E8WA 2XRZA 3AG3E 4FLHA 3HIZA 3C72A 3R9AB 2B0OE 4ATGA 2C0LA 4ANWA 3R7QA 1UJJA 3GZ2A 2PQNA 1ZBPA 3SQVA 4B8CB 2GW1A 2LXMA 5ITZF 3X2QE 3OAWA 4EHMA 1YCSB 3PE3A 2BEDA 1S0PA 3PUJA 4BTAA 4HLEA 3APFA 1Y8MA 4GCOA 3Q75A 3SHFA 3R7RA 3FTXA 3FUNA 2KBXA 3L13A 1OCRE 4JHJA 3VLFA 3FWVA 3NOCD 3B7TA 3CQGB 4I6GA 3MYVA 1PAQA 2GROB 4HRLA 2WXMA 2WPVA 1O1TA 3SBTB 5KNHD 1EF1C 4AM9A 5FWQA 5D0QD 3TWWA 1OWNA 1U2VG 3TWSA 4LNBA 4FADA 1ZB1A 3FTZA 3I5PA 2XPZA 1E90A 4O60A 5T8IA 2XS8A 4EPZA 4O1PA 1HE8A 4Q96A 4WNGA 3FUMA 3MGBA 5G05J 3KSQA 4J7WA 4AOFA 3SO8A 4U0UA 3Q79A 2AVPA 2J07A 3D9HA 3UKUG 4XZ4A 4BEPA 1TN8A 2FI7A 4KYOB 3JCKC 4JVSA 2RG8A 4LG6A 3EJNA 5C2YA 5ENNA 4RLYA 2VTBA 1TN7A 4A63B 2VGXB 5JHAA 5CECB 4FHKA 5CBOA 4IYPA 1Z3XA 2WQ7A 1B89A 3ZHEA 3C3QA 4NACA 1PY1A 3EU9A 1KT0A 5B1BE 5M72A 4UWLA 3ABME 4XX5A 3FUIA 3E34A 1HFAA 5JMND 3SBSA 2J4BA 4YNDA 1FVFA 3W9FA 4L1BA 3KD7A 2XEVA 3IEGA 3CHMA 4LERA 3NB2A 2FO7A 5CHEE 3CKBA 3ASOE 4YDWA 2MOWA 4F1SA 2WXNA 3SD5A 3VTXA 4LNGA 4J8EA 4U7EB 1KT1A 4CGVA 1IQUA 1INZA 3VLDA 3UXGA 2X6IA 4PUCA 4N3CA 1MJ0A 2WB2A 4X8QA 2A5EA 2WQHA 4JXTA 3ML9A 4UWHA 2OEVA 3QWWA 2KM4A 3CVWA 1NI1A 1O5MA 1L5JA 5H7PA 2P9UG 2OCCE 4DPRA 4GU5A 2A5UA 5FIOA 4GMRA 3ZRHA 4AEZC 3RJVA 3D9MA 4A1GA 4I1MA 5G04J 3DSWA 5AJLA 5EIDA 2ZISA 4GTRA 1OT8A 4FU3A 2XEEA 3MV3B 2KZTA 4ME2A 3HDXA 3MKRA 4GMJA 3JXJA 2P9PG 1JPLA 4HS2A 4BT9A 2XEHA 2EINE 3AS8A 2IFUA 2JABA 3UIOC 3QKYA 4HFGA 5LCWJ 1N0RA 3LXUX 3PZ2A 3ULQA 2P9KG 4I1AA 4U96D 4GTVA 3Q7FA 4FA6A 5EIBE 3DRAA 2IOLA 4HVBA 3RU0A 5A7DB 3QOUA 3PDNA 3D9PA 5KCMA 4EBAA 2R17C 1ELRA 2LSVA 4L2YA 4L7TA 1U3DA 3QJZA 1FCHA 5T4YA 3L54A 3E30A 3TG4A 4GB9A 3SFYA 4MBGA 3ASFA 2PQRA 3TG5A 3HYMB 3G2VA 2IOSA 3AJIA 4K5CA 3RSEG 1BI8B 4N3AA 2LSUA 3ABKE 4JA7A 2ILRA 2V0PA 3KEZA 4ZHBA 3ZKJA 1NA0A 4MLPA 2L6BA 4RSYA 3AAAC 2I1KA 5B1AE 2WXQA 1OCCE 2I9CA 2WXJA 2F8YA 2A4ZA 3ULYA 3FUFA 3I3NA 3CK7A 2R59A 2V4LA 4YVQC 5KWDA 4R7LA 3FTYA 5ARGA 1TNZA 5JA4D 4CZ2D 1ZU2A 1H19A 4WWPA 4ANVA 1IQRA 1BU9A 4GYWA 4OVUA 4GA2A 3V2XA 3FDHA 3L9TA 4UI9C 3DPDA 1PC2A 4APFA 3RAUA 4HB5A 3TXNA 3CHRA 3EU5A 3CVYA 2P2CP 2GRRB 5E75A 4C9BB 2LXLA 1OY3D 1XNFA 3L17A 4K03A 4KXKB 1JWFA 2YHEA 4DK5A 2DZOA 4EZJA 3T5VA 4K0RA 4F53A 3UKRG 2VYIA 4FJZA 3FULA 5EDSA 2BTDA 1BPOA 2OEWA 1HG5A 1N0QA 3HVEA 3MA5A 4B8AA 2XHEA 5ENSD 1SZ9A 2P9NG 5BNWA 4BESA 2CFZA 3AS5A 5FINA 2KC7A 3PE4A 2ETBA 5BPPA 2H6FA 1TJCA 4GTSA 4MKTA 4AJWA 2AJAA 3RK6A 4G23A 3G2TA 3P2BA 2PL2A 1N54A 5JJ7A 2EIME 5CBNA 1FPPA 2DZNA 5D66A 1RZ4A 2V5QC 4LSZE 3Q15A 3D9NA 5EILA 1MZCA 3FTVA 5D0OD 3JXIA 4Y6WA 3VLEA 3NOGD 2CHZA 3HXDA 3EHNA 4O1OA 4F7AA 3PREA 2P9SG 3CVPA 1FVHA 2H6HA 4EBAG 5FQ4A 5FT9A 5LP0A 4IRUA 4NURA 2HE0A 4XI0A 4EZLA 4A3TA 4JL0A 3FU3A 4UQYA 2F0YA 2JEKA 2UY1A 3ZW3A 1MX6A 3LY8A 4BERA 1W3BA 3U3WA 1OCOE 1HH8A 3UINC 1HZ4A 4ABNA 5A6CA 2MRIA 3ASGA 2IO3C 4I17A 4D10C 2VSNA 3FY4A 5EYLA 4GPMA 2CG3A 3IBEA 5CMWA 4U8YD 3ZXSA 1Z5SC 4G8KA 3AU4A 5LFAA 4I6JA 3CK8A 1Z3YA 2XRYA 3UTMA 1EPUA 1DNPA 4GYYA 1KZOA 4JPSA 4GTPA 3FH8A 1O1SA 4F1PA 4GTOA 1KZPA 4UI9K 3CHPA 1N4PA 2ZU6B 3QC1A 1DVPA 3FUHA 3T8KA 2L9BA 3ONKA 5ARFA 3ESLA 3UM3A 3PVLA 1HXIA 1K1AA 2HR2A 4GTTA 1N11A 2E0IA 2X6FA 4A1SA 1OWOA 4KVOA 2ZGDA 4GA0A 1OCZE 1TR4A 3B7SA 4XEIG 1JCQA 1QYMA 2J4DA 5BXUA 5HRYA 2IEJA 3QWVA 2VGYA 5CCLA 2VTBB 2R5SA 3TAXA 4ACLA 3QARA 1IYGA 5HS0A 4WAFA 4HRNA 4M7CA 3IXEA 4CGWA 1ELKA 4PH4B 3BQOA 1TNOA 3C5RA 3L82A 3ZHEB 4AP2A 5CEAA 4AV7A 1SVXA 4N3BA 3Q73A 2X6KA 3ZYMA 4TV3A 1NA3A 2ONDA 4CRWA 3HXFA 2V5FA 3DWLG 1KPSB 3NZSA 3ZEFA 3UIPC 3ZU7B 3LDZA 1QBQA 3UUXA 4C0EA 3G2UA
chains in the Genus database with same CATH topology
3ABME 3ASOE 2EINE 3AG4E 2ZXWE 5B1AE 1OCCE 1OCRE 2EIJE 1V54E 2EILE 3AG2E 2DYRE 2EIKE 3ABKE 2OCCE 1OCZE 1OCOE 2DYSE 5B3SE 3X2QE 2Y69E 1V55E 3WG7E 5B1BE 5IY5E 3AG1E 3ABLE 2EIME 3AG3E 3ASNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABM E;  3ASO E;  2EIN E;  3AG4 E;  2ZXW E;  5B1A E;  1OCC E;  1OCR E;  2EIJ E;  1V54 E;  2EIL E;  3AG2 E;  2DYR E;  2EIK E;  3ABK E;  2OCC E;  1OCZ E;  1OCO E;  2DYS E;  5B3S E;  3X2Q E;  2Y69 E;  1V55 E;  3WG7 E;  5B1B E;  5IY5 E;  3AG1 E;  3ABL E;  2EIM E;  3AG3 E;  3ASN E; 
#chains in the Genus database with same CATH topology
 5HKP A;  1JWG A;  1MX2 A;  4YDE A;  3ZYK A;  3PNL B;  3PZD A;  1BD8 A;  3T8M A;  3PUK A;  2WMN A;  2XPY A;  3JUI A;  3MJW A;  1SQM A;  2OVB A;  4E6H A;  4PS7 A;  1K1B A;  3ABL E;  2HO1 A;  3IV0 A;  3D9I A;  4URK A;  1H6K A;  1TNU A;  3IHV A;  4A3V A;  3UQ3 A;  4J8F A;  4NIK A;  2GRQ B;  3CST A;  3E37 A;  3UM1 A;  3G2S A;  4UQX A;  5EX3 A;  2IU1 A;  4IUL A;  3FU0 A;  4U63 A;  2GRM A;  2ZXW E;  3KSL A;  5FQ7 A;  3K9I A;  1HO8 A;  2AXZ A;  2RD0 A;  4XIF A;  3CVN A;  3J5P A;  3AG2 E;  2EIK E;  3B95 A;  2WVI A;  4HQD A;  2AXU A;  2XEN A;  3RO3 A;  1AWC B;  5AEN A;  2WXO A;  5ENP D;  4G11 A;  4B0Z A;  4GZ3 A;  3JUE A;  1WM5 A;  3ZVV A;  2KZT B;  3AU5 A;  2PZI A;  5KNG A;  4J8D A;  1Y6I A;  3URZ A;  2KAT A;  2FBN A;  5J08 A;  3PRZ A;  4E85 A;  4DI3 A;  1IXV A;  4V3I A;  2XCB A;  1S70 B;  2FF4 A;  3CEQ A;  4G2V A;  2I1J A;  3TGO A;  3U66 A;  3C3R A;  3N71 A;  4G25 A;  4K5A B;  4CDR A;  3QDN A;  4RQI A;  3C3O A;  3L08 A;  4LEU A;  5CCM A;  3ASD A;  2C2L A;  2EIL E;  4DX5 D;  4I9C A;  4M3O A;  5G04 C;  1Q2Z A;  4JEH A;  3CLJ A;  1N9A A;  2CFU A;  4BY6 A;  2E2E A;  1S64 A;  4U95 D;  1SZA A;  4WUY A;  2DCP A;  3B13 A;  1OWM A;  3SF4 A;  4ATZ D;  1EYH A;  1JCS A;  1UOH A;  3WG7 E;  3EHM A;  3CR3 A;  2Y1L E;  3EHQ A;  2DBA A;  2CHX A;  1QQE A;  5ANL A;  4KMO A;  4N2Q A;  3I4R B;  2WXG A;  2Y4U A;  4APO A;  2LNI A;  3J5Q B;  3LPZ A;  3SZ7 A;  1E8X A;  2LAI A;  5AIJ A;  4HOR A;  4HOS A;  4BX9 A;  3CVU A;  3Q5M A;  1UJK A;  2J8S D;  4DX7 D;  4TRQ A;  5AYW D;  3FUD A;  4I43 A;  5KJM A;  5CED B;  5ENR D;  3D9J A;  3ESK A;  4Q69 A;  1YA0 A;  4L2L A;  1DCE A;  2LUH A;  2NXP A;  3MV2 B;  5FQ8 A;  3KS2 A;  4XE0 A;  4KZC A;  1D8D A;  5B3S E;  1H2U A;  4GA1 A;  4GZC A;  3V2O A;  2Y0B G;  2XGS A;  4GZ5 A;  3R9M A;  2XQ0 A;  3KEA A;  3HXE A;  3ZN3 A;  5DIZ A;  2Q7F A;  4QQI A;  1OUV A;  4J0U A;  2WXH A;  2FEZ A;  4MS6 A;  4ILG A;  5CRV A;  5BUZ A;  1KLX A;  3FTS A;  2R03 A;  2DVW A;  3E33 A;  1HS6 A;  4NRH B;  1QZ2 A;  2RFM A;  4JHK A;  2WXP A;  5EKQ D;  2WXL A;  3HVE B;  1H2T C;  4AIF A;  1SA4 A;  1MHQ A;  4LRZ A;  4TXR A;  4AVX A;  5DBK A;  2QZA A;  5T3R A;  2YQ8 A;  3B7U X;  5LOZ A;  1WG0 A;  4PS3 A;  4CT0 A;  3LJN A;  4DX1 A;  4DLQ A;  3AS4 A;  3NAW A;  3EIJ A;  4HOU A;  2F37 A;  3P1U A;  3PEU B;  3TWX A;  3S7F A;  2L0T B;  1HG2 A;  5G2N A;  3UT4 A;  5KBA A;  5KJL A;  3GW4 A;  3IHY A;  5AQA A;  1XGW A;  5FJY A;  3ISM C;  2ION A;  4G24 A;  3RIB A;  2NSZ A;  3TWQ A;  3S7J A;  2X3M A;  1TN6 A;  3CK9 A;  4JD2 G;  1RW2 A;  2XGO A;  2WXK A;  3TJP A;  3AG1 E;  3EDT B;  2F8X K;  4GPK A;  5AN8 A;  3TWR A;  4RG9 A;  5KJN A;  3LS8 A;  4EEC A;  3FH7 A;  4DX6 D;  1QNF A;  3ZNG A;  3ZPJ A;  2J49 A;  3SGH A;  2P9I G;  1N52 A;  3VTY A;  1D8E A;  4WNF A;  3HXB A;  3ZGQ A;  2UY1 B;  1WDY A;  2ZGG A;  3GZS A;  2UWJ G;  1N4R A;  4HOT A;  4UUC A;  3L22 A;  1U3C A;  2QYU A;  4BSX A;  4Q94 A;  4TXP A;  2GRP B;  4CDM A;  1P5Q A;  4P29 A;  3QAQ A;  3LCA A;  3FEY A;  3ULE G;  3ZYL A;  3UMV A;  3MZL B;  4I6E A;  1E8Y A;  5BV0 A;  2BUG A;  3L16 A;  2PNN A;  3I4G A;  1HF8 A;  1TJF A;  4BET A;  3T9K A;  3CQC B;  2I6H A;  3CVV A;  3PZ1 A;  3U64 A;  4RG6 A;  5CMY A;  4WND A;  3RO2 A;  4DX2 A;  3DXK G;  4GYO A;  4ILH B;  2BKK B;  3D3M A;  3NBN B;  2AW6 A;  1NFI E;  4FJY A;  5CRU A;  3ZUV B;  3OXL A;  2IQC A;  5AQ9 A;  1IHB A;  3BU8 A;  2HM8 A;  2KCK A;  5EYP F;  3NQP A;  5AQ7 A;  3ML8 A;  5JJ6 A;  1N94 A;  2YIN A;  5ANR A;  1LTX A;  4B89 A;  1WY6 A;  2P58 C;  3ZFW A;  3ASH A;  3O48 A;  3ONL A;  2Y3A A;  2AWI A;  4XKB A;  1G3N B;  1E96 B;  5A23 A;  3LEW A;  4L9P A;  3T5X A;  3CVX A;  3FU5 A;  4IN3 B;  4ZFH A;  2IJG X;  2EQX A;  1JUQ A;  4CYM D;  1E8Z A;  1TNB A;  2H6G A;  4HBD A;  2H6I A;  2LO6 A;  3BG0 B;  2VSY A;  4FHJ A;  4AY5 A;  3UM0 A;  1OWL A;  2YHC A;  4GZD A;  4C48 B;  4OAU C;  4UWK A;  2AXV A;  5BV1 A;  1V54 E;  1JCR A;  1TEZ A;  4Y6C A;  2WXI A;  2QY7 A;  1V55 E;  4BSZ B;  2VGE A;  4PS8 A;  1SW6 A;  1Z6T A;  2ZIR A;  4OAV B;  1A5E A;  1NL4 A;  1BLX B;  4N2S A;  3CV0 A;  3V30 A;  2V4H C;  2PM6 A;  4FUL A;  1LD7 A;  4B94 A;  1YMP A;  5ENT D;  5G05 C;  3O4Z A;  2NC9 A;  2XZD G;  3Q47 B;  2GGF A;  4DJA A;  3FP3 A;  3Q78 A;  2VSO E;  3CHS A;  3JYS A;  3LVR E;  3NF1 A;  1X81 A;  1LF8 A;  1BI7 B;  4EQF A;  3DEO A;  4J8S A;  2DWZ A;  4RVB A;  2DYR E;  1H6O A;  1OXJ A;  3SFX A;  2MHK A;  4DLO A;  3WXX A;  2X6H A;  3DXM G;  4DI4 A;  3SY2 A;  3ASN E;  3EIQ C;  2MYO A;  1IHG A;  4U0S A;  3OXF A;  2X6J A;  5BT1 A;  1MX4 A;  2R2L A;  2V8S E;  3UPV A;  4TXQ A;  1HX8 A;  2VSX E;  1D9S A;  4I2W A;  4GTM A;  2L0I A;  3FUJ A;  2NYJ A;  3EHR A;  2VGX A;  5BXO A;  5FZS A;  4GCN A;  3HG0 D;  4JEU A;  4UQZ A;  3FTU A;  4L23 A;  3IKO B;  2X38 A;  3JQ0 A;  3Q9N C;  4HI8 A;  1E7V A;  3OXG A;  4J8Y A;  4BTB A;  1UG3 A;  4O6F A;  1OWP A;  3RKV A;  5BW8 C;  4J6I A;  3V79 K;  3CIA A;  3FTW A;  3U9W A;  4TUM A;  5EX0 A;  1ELW A;  4FLB A;  2XGM A;  4LNU D;  3LY7 A;  5ENQ D;  3KAE A;  3E4B A;  1MYO A;  2J09 A;  1EDU A;  2RKK A;  3FFL A;  2XPI A;  3S7B A;  2XCC A;  4F3V A;  1IKN D;  1X5B A;  5AQB A;  5CER B;  2BF0 X;  3Q7A A;  4GAA A;  2IY0 C;  3W9G A;  4A55 A;  3CGH A;  3FUE A;  3MCX A;  4KBQ A;  2DIW A;  2P9L G;  3TWV A;  2I2O A;  1H2V C;  4ANX A;  5EN5 D;  3G2W A;  4AY6 A;  3DSV A;  2QYJ A;  3TWT A;  5LCW C;  3LYA A;  3S2A A;  2IO2 C;  2R05 A;  4CEM A;  3L6A A;  3UM2 A;  2FO1 E;  2QC9 A;  4OVV A;  2VJ8 A;  5J90 A;  4JZY A;  3V31 A;  3U4T A;  4WWN A;  1WAO 1;  2L6J A;  4AXH A;  3S7D A;  5IY5 E;  3NZU A;  1S63 A;  5AAO A;  5FTP A;  4BWR A;  3RRN B;  3TL5 A;  2B6C A;  1N4S A;  3PZ3 A;  1K8K G;  5FZR A;  4WWO A;  4JHR A;  4OYS A;  4HXI A;  3C98 A;  3DBS A;  2YNQ A;  4HOQ A;  1NP7 A;  2FUL A;  2ETC A;  4H7Y A;  4N5Q A;  3Q49 B;  4I9E A;  4I2Z A;  3LVQ E;  3UI2 A;  3E32 A;  4ILI A;  4JC8 A;  4CCA A;  3FU6 A;  3QB2 A;  4B93 B;  2R02 A;  1N95 A;  1FT1 A;  3OTN A;  4KT6 B;  5JJT A;  3SI5 A;  4BX8 A;  3ZIM A;  1H0A A;  2OOE A;  1DCQ A;  4U07 A;  2XZT G;  2QFC A;  3B7B A;  3ZXP A;  2M63 A;  3DSU A;  2OVF A;  3ZYQ A;  5KJK A;  3CSF A;  5AAR A;  4KVM A;  3HXC A;  4WNE A;  5LX8 A;  1FT2 A;  2WQ6 A;  4ACK A;  3SFZ A;  4UI9 J;  4HRM B;  4U0Z A;  4U8V D;  1MQS A;  3CHO A;  3UT8 A;  3PS6 A;  4K5B A;  2EIJ E;  4XI9 A;  4HLL A;  2KCL A;  4N39 A;  5FZQ A;  3FH5 A;  1AP7 A;  2PM7 A;  4H7X A;  4TUU A;  1H6P A;  1DC2 A;  3PH0 C;  4BT8 A;  5G55 A;  5FQ6 A;  4HNA D;  1UW4 B;  1TNY A;  1HU3 A;  3Q4A B;  3PEV B;  4U04 A;  2J08 A;  3BG1 B;  3GYZ A;  3DPY A;  3SNX A;  5C1D A;  3DST A;  4BFR A;  3D9L A;  4MRU A;  3HHM A;  5AJD A;  4CDN A;  4LCT A;  3BEE A;  2LAH A;  1VDY A;  3MKQ B;  3TXM A;  3BUA A;  4ANU A;  2Y4T A;  2CHW A;  1GW6 A;  3UX4 A;  4PDX A;  2WMO A;  2RFA A;  2GRN B;  3F6Q A;  5ENO D;  2VQ2 A;  4GZ6 A;  2KCV A;  1UN9 A;  2OV8 A;  4QFV A;  3MEK A;  1LD8 A;  3APD A;  3CKC A;  3GZ1 A;  2DYS E;  3D9K A;  2WXR A;  3Q9U C;  4I1O B;  4G8L A;  3APC A;  4LUN U;  4DUI A;  3LKU A;  3MKQ A;  3PNT B;  3DSX A;  4C0M A;  3FEX A;  3MX3 A;  4UWF A;  4CT4 A;  4KZ0 A;  3HRA A;  3QWP A;  4YDO A;  3JQ1 A;  4W9R A;  3LJ3 A;  2Y69 E;  2JLB A;  4XKC A;  4GTQ A;  3ENE A;  3EUV A;  2GRL A;  3CHQ A;  3FUK A;  4G1T A;  3PZ4 A;  4NQ0 A;  3LY9 A;  1E7U A;  5JHB A;  1NZN A;  2C0M A;  4JW1 A;  4G26 A;  1TYQ G;  4FC8 A;  1A17 A;  4YDY A;  5E76 A;  1O1R A;  2WXF A;  3TWU A;  3DEP A;  4Z68 A;  5HI7 A;  3DSS A;  2ETA A;  4YVO A;  4FP7 A;  1SA5 A;  3RRM B;  4GML A;  2WM9 A;  2XS1 A;  4DRX E;  4EZK A;  1UN8 A;  2J9Q A;  3CVL A;  4N5C A;  5HQ8 A;  3QK0 A;  3AG4 E;  4F6R D;  2HYZ A;  1K3Z D;  2KXP C;  4JA9 A;  3B7R L;  4JB8 P;  3QNK A;  2BKG A;  1N4Q A;  1YYH A;  2CG2 A;  5D2M C;  3D9O A;  3CVQ A;  3FHE A;  4UWG A;  4U8H A;  3RRU A;  2IF4 A;  4HI9 A;  3UT7 A;  1E8W A;  2XRZ A;  3AG3 E;  4FLH A;  3HIZ A;  3C72 A;  3R9A B;  2B0O E;  4ATG A;  2C0L A;  4ANW A;  3R7Q A;  1UJJ A;  3GZ2 A;  2PQN A;  1ZBP A;  3SQV A;  4B8C B;  2GW1 A;  2LXM A;  5ITZ F;  3X2Q E;  3OAW A;  4EHM A;  1YCS B;  3PE3 A;  2BED A;  1S0P A;  3PUJ A;  4BTA A;  4HLE A;  3APF A;  1Y8M A;  4GCO A;  3Q75 A;  3SHF A;  3R7R A;  3FTX A;  3FUN A;  2KBX A;  3L13 A;  1OCR E;  4JHJ A;  3VLF A;  3FWV A;  3NOC D;  3B7T A;  3CQG B;  4I6G A;  3MYV A;  1PAQ A;  2GRO B;  4HRL A;  2WXM A;  2WPV A;  1O1T A;  3SBT B;  5KNH D;  1EF1 C;  4AM9 A;  5FWQ A;  5D0Q D;  3TWW A;  1OWN A;  1U2V G;  3TWS A;  4LNB A;  4FAD A;  1ZB1 A;  3FTZ A;  3I5P A;  2XPZ A;  1E90 A;  4O60 A;  5T8I A;  2XS8 A;  4EPZ A;  4O1P A;  1HE8 A;  4Q96 A;  4WNG A;  3FUM A;  3MGB A;  5G05 J;  3KSQ A;  4J7W A;  4AOF A;  3SO8 A;  4U0U A;  3Q79 A;  2AVP A;  2J07 A;  3D9H A;  3UKU G;  4XZ4 A;  4BEP A;  1TN8 A;  2FI7 A;  4KYO B;  3JCK C;  4JVS A;  2RG8 A;  4LG6 A;  3EJN A;  5C2Y A;  5ENN A;  4RLY A;  2VTB A;  1TN7 A;  4A63 B;  2VGX B;  5JHA A;  5CEC B;  4FHK A;  5CBO A;  4IYP A;  1Z3X A;  2WQ7 A;  1B89 A;  3ZHE A;  3C3Q A;  4NAC A;  1PY1 A;  3EU9 A;  1KT0 A;  5B1B E;  5M72 A;  4UWL A;  3ABM E;  4XX5 A;  3FUI A;  3E34 A;  1HFA A;  5JMN D;  3SBS A;  2J4B A;  4YND A;  1FVF A;  3W9F A;  4L1B A;  3KD7 A;  2XEV A;  3IEG A;  3CHM A;  4LER A;  3NB2 A;  2FO7 A;  5CHE E;  3CKB A;  3ASO E;  4YDW A;  2MOW A;  4F1S A;  2WXN A;  3SD5 A;  3VTX A;  4LNG A;  4J8E A;  4U7E B;  1KT1 A;  4CGV A;  1IQU A;  1INZ A;  3VLD A;  3UXG A;  2X6I A;  4PUC A;  4N3C A;  1MJ0 A;  2WB2 A;  4X8Q A;  2A5E A;  2WQH A;  4JXT A;  3ML9 A;  4UWH A;  2OEV A;  3QWW A;  2KM4 A;  3CVW A;  1NI1 A;  1O5M A;  1L5J A;  5H7P A;  2P9U G;  2OCC E;  4DPR A;  4GU5 A;  2A5U A;  5FIO A;  4GMR A;  3ZRH A;  4AEZ C;  3RJV A;  3D9M A;  4A1G A;  4I1M A;  5G04 J;  3DSW A;  5AJL A;  5EID A;  2ZIS A;  4GTR A;  1OT8 A;  4FU3 A;  2XEE A;  3MV3 B;  2KZT A;  4ME2 A;  3HDX A;  3MKR A;  4GMJ A;  3JXJ A;  2P9P G;  1JPL A;  4HS2 A;  4BT9 A;  2XEH A;  2EIN E;  3AS8 A;  2IFU A;  2JAB A;  3UIO C;  3QKY A;  4HFG A;  5LCW J;  1N0R A;  3LXU X;  3PZ2 A;  3ULQ A;  2P9K G;  4I1A A;  4U96 D;  4GTV A;  3Q7F A;  4FA6 A;  5EIB E;  3DRA A;  2IOL A;  4HVB A;  3RU0 A;  5A7D B;  3QOU A;  3PDN A;  3D9P A;  5KCM A;  4EBA A;  2R17 C;  1ELR A;  2LSV A;  4L2Y A;  4L7T A;  1U3D A;  3QJZ A;  1FCH A;  5T4Y A;  3L54 A;  3E30 A;  3TG4 A;  4GB9 A;  3SFY A;  4MBG A;  3ASF A;  2PQR A;  3TG5 A;  3HYM B;  3G2V A;  2IOS A;  3AJI A;  4K5C A;  3RSE G;  1BI8 B;  4N3A A;  2LSU A;  3ABK E;  4JA7 A;  2ILR A;  2V0P A;  3KEZ A;  4ZHB A;  3ZKJ A;  1NA0 A;  4MLP A;  2L6B A;  4RSY A;  3AAA C;  2I1K A;  5B1A E;  2WXQ A;  1OCC E;  2I9C A;  2WXJ A;  2F8Y A;  2A4Z A;  3ULY A;  3FUF A;  3I3N A;  3CK7 A;  2R59 A;  2V4L A;  4YVQ C;  5KWD A;  4R7L A;  3FTY A;  5ARG A;  1TNZ A;  5JA4 D;  4CZ2 D;  1ZU2 A;  1H19 A;  4WWP A;  4ANV A;  1IQR A;  1BU9 A;  4GYW A;  4OVU A;  4GA2 A;  3V2X A;  3FDH A;  3L9T A;  4UI9 C;  3DPD A;  1PC2 A;  4APF A;  3RAU A;  4HB5 A;  3TXN A;  3CHR A;  3EU5 A;  3CVY A;  2P2C P;  2GRR B;  5E75 A;  4C9B B;  2LXL A;  1OY3 D;  1XNF A;  3L17 A;  4K03 A;  4KXK B;  1JWF A;  2YHE A;  4DK5 A;  2DZO A;  4EZJ A;  3T5V A;  4K0R A;  4F53 A;  3UKR G;  2VYI A;  4FJZ A;  3FUL A;  5EDS A;  2BTD A;  1BPO A;  2OEW A;  1HG5 A;  1N0Q A;  3HVE A;  3MA5 A;  4B8A A;  2XHE A;  5ENS D;  1SZ9 A;  2P9N G;  5BNW A;  4BES A;  2CFZ A;  3AS5 A;  5FIN A;  2KC7 A;  3PE4 A;  2ETB A;  5BPP A;  2H6F A;  1TJC A;  4GTS A;  4MKT A;  4AJW A;  2AJA A;  3RK6 A;  4G23 A;  3G2T A;  3P2B A;  2PL2 A;  1N54 A;  5JJ7 A;  2EIM E;  5CBN A;  1FPP A;  2DZN A;  5D66 A;  1RZ4 A;  2V5Q C;  4LSZ E;  3Q15 A;  3D9N A;  5EIL A;  1MZC A;  3FTV A;  5D0O D;  3JXI A;  4Y6W A;  3VLE A;  3NOG D;  2CHZ A;  3HXD A;  3EHN A;  4O1O A;  4F7A A;  3PRE A;  2P9S G;  3CVP A;  1FVH A;  2H6H A;  4EBA G;  5FQ4 A;  5FT9 A;  5LP0 A;  4IRU A;  4NUR A;  2HE0 A;  4XI0 A;  4EZL A;  4A3T A;  4JL0 A;  3FU3 A;  4UQY A;  2F0Y A;  2JEK A;  2UY1 A;  3ZW3 A;  1MX6 A;  3LY8 A;  4BER A;  1W3B A;  3U3W A;  1OCO E;  1HH8 A;  3UIN C;  1HZ4 A;  4ABN A;  5A6C A;  2MRI A;  3ASG A;  2IO3 C;  4I17 A;  4D10 C;  2VSN A;  3FY4 A;  5EYL A;  4GPM A;  2CG3 A;  3IBE A;  5CMW A;  4U8Y D;  3ZXS A;  1Z5S C;  4G8K A;  3AU4 A;  5LFA A;  4I6J A;  3CK8 A;  1Z3Y A;  2XRY A;  3UTM A;  1EPU A;  1DNP A;  4GYY A;  1KZO A;  4JPS A;  4GTP A;  3FH8 A;  1O1S A;  4F1P A;  4GTO A;  1KZP A;  4UI9 K;  3CHP A;  1N4P A;  2ZU6 B;  3QC1 A;  1DVP A;  3FUH A;  3T8K A;  2L9B A;  3ONK A;  5ARF A;  3ESL A;  3UM3 A;  3PVL A;  1HXI A;  1K1A A;  2HR2 A;  4GTT A;  1N11 A;  2E0I A;  2X6F A;  4A1S A;  1OWO A;  4KVO A;  2ZGD A;  4GA0 A;  1OCZ E;  1TR4 A;  3B7S A;  4XEI G;  1JCQ A;  1QYM A;  2J4D A;  5BXU A;  5HRY A;  2IEJ A;  3QWV A;  2VGY A;  5CCL A;  2VTB B;  2R5S A;  3TAX A;  4ACL A;  3QAR A;  1IYG A;  5HS0 A;  4WAF A;  4HRN A;  4M7C A;  3IXE A;  4CGW A;  1ELK A;  4PH4 B;  3BQO A;  1TNO A;  3C5R A;  3L82 A;  3ZHE B;  4AP2 A;  5CEA A;  4AV7 A;  1SVX A;  4N3B A;  3Q73 A;  2X6K A;  3ZYM A;  4TV3 A;  1NA3 A;  2OND A;  4CRW A;  3HXF A;  2V5F A;  3DWL G;  1KPS B;  3NZS A;  3ZEF A;  3UIP C;  3ZU7 B;  3LDZ A;  1QBQ A;  3UUX A;  4C0E A;  3G2U A; 
#chains in the Genus database with same CATH homology
 3ABM E;  3ASO E;  2EIN E;  3AG4 E;  2ZXW E;  5B1A E;  1OCC E;  1OCR E;  2EIJ E;  1V54 E;  2EIL E;  3AG2 E;  2DYR E;  2EIK E;  3ABK E;  2OCC E;  1OCZ E;  1OCO E;  2DYS E;  5B3S E;  3X2Q E;  2Y69 E;  1V55 E;  3WG7 E;  5B1B E;  5IY5 E;  3AG1 E;  3ABL E;  2EIM E;  3AG3 E;  3ASN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...