1OCOE

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
109
structure length
109
Chain Sequence
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 42
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1ocoE00
1OCCE 1OCOE 3AG3E 2Y69E 3ASOE 5IY5E 3ABKE 3AG1E 1V55E 1V54E 3AG4E 1OCRE 3ASNE 5B1BE 2EIME 5B1AE 2EILE 3ABLE 3WG7E 2ZXWE 1OCZE 2DYSE 2OCCE 2EIKE 3ABME 3X2QE 3AG2E 2DYRE 2EIJE 5B3SE 2EINE
chains in the Genus database with same CATH superfamily
3RRMB 2P58C 4U07A 4UWFA 4ILGA 5H7PA 3L08A 4HRMB 3FUFA 4GA2A 2EILE 4E6HA 3AU4A 2BF0X 4YDEA 2X6IA 3ESLA 2LNIA 4AVXA 2YINA 2WM9A 2AXVA 4J8FA 3IHVA 1UW4B 1ELRA 5CECB 2WXMA 2ILRA 4HS2A 1JWGA 3RK6A 2RKKA 5ARGA 5B1AE 3WG7E 3TJPA 4GZ6A 5ENOD 4LSZE 5EIDA 4O60A 1OY3D 3ML9A 5FQ4A 3CHOA 3EHQA 3EHMA 4YDYA 4ANWA 4EZKA 2WQ7A 4HORA 4WWNA 1TNBA 4N5QA 5DBKA 3PE4A 3FUIA 2WB2A 3ZUVB 4LNUD 3CVNA 1H6OA 5AN8A 3MV3B 5ITZF 3U9WA 3L6AA 4EQFA 3BG1B 4EBAA 4F6RD 3UM1A 2WXQA 4PDXA 3FUDA 2ETBA 2AJAA 2HYZA 2XCCA 4BESA 2EIME 4WNEA 1TYQG 1N4QA 1HF8A 4GTPA 3FTVA 1SVXA 5CEDB 2WXKA 3UXGA 2RFAA 5LP0A 3ZRHA 3I4RB 5KNHD 3HG0D 1QBQA 4MS6A 5AQ9A 3VTXA 5ENQD 2OEWA 3HXDA 3PEVB 3D9MA 4XE0A 2OVBA 5D66A 2VSYA 4GTRA 3L22A 3CVVA 4K0RA 3FTZA 4WWOA 4TRQA 2AXZA 3TWSA 3ML8A 2DIWA 2V4HC 2JABA 2I9CA 3SBSA 3EHNA 2CG3A 3D9JA 4GMRA 3UKRG 3VLEA 2WXFA 4AP2A 2XGSA 2KCVA 5AARA 2V8SE 2MOWA 3ZPJA 4U8YD 2FF4A 3J5PA 3TG4A 4KVOA 1YYHA 2KZTA 4G2VA 4A55A 2A5UA 3L82A 2WXIA 3ISMC 2LSUA 1RW2A 1L5JA 5G2NA 3S2AA 4G25A 3ABME 2P9LG 1NA0A 5EYPF 3HXCA 3ULQA 2F37A 4J6IA 2UY1B 5JA4D 1FT1A 4ME2A 2WMOA 5HQ8A 3CVWA 1D8DA 3Q15A 3UT4A 2XQ0A 4PS7A 4Y6WA 2VSXE 3PE3A 5LCWJ 1JCQA 1Y6IA 2J4BA 2J49A 3KAEA 2Y4TA 3SY2A 2GRLA 4KBQA 2P9PG 1TR4A 2NYJA 3JQ1A 4I17A 4C9BB 3C3OA 1NL4A 4DX5D 5EX3A 3ZHEB 3UIOC 2RG8A 3FTYA 3LEWA 2NC9A 2H6GA 3BQOA 2LSVA 4CCAA 4ANVA 4AXHA 4JW1A 1EF1C 1N4PA 3BU8A 5LCWC 4U8HA 4DI4A 2I1JA 2R17C 4GTVA 2KATA 3LPZA 3DWLG 1N4SA 3SBTB 4K5AB 4J0UA 2OOEA 3KSLA 3AS4A 3PZ1A 2MRIA 1UJJA 3ZGQA 3QWVA 4GA0A 1S63A 2AWIA 3CVQA 3R9AB 4CRWA 4APOA 2XHEA 4GCOA 3NOGD 3S7FA 4CYMD 4GTQA 1TJFA 3B7RL 3PZDA 4MLPA 3BG0B 4UI9K 4J8DA 4LERA 4JXTA 2BUGA 3FFLA 1JUQA 4L2LA 4ZHBA 3QOUA 3TWUA 1YCSB 1W3BA 3Q7AA 5FZRA 1MX6A 4X8QA 1JWFA 1TNZA 5ANRA 3NZSA 4N3CA 4DLQA 5EX0A 4L7TA 1N9AA 4AIFA 2WMNA 5BW8C 1ZB1A 5FTPA 5JJ6A 5AAOA 2DZNA 1FPPA 3MEKA 1XGWA 3C72A 5AENA 3FDHA 3ZVVA 3HRAA 2FULA 4BT8A 4DX1A 1MJ0A 3TGOA 3D9LA 3VLFA 2R2LA 4OYSA 4U0UA 3SQVA 2WXNA 4YDWA 2J8SD 1BI7B 5B1BE 2JLBA 3Q79A 3NB2A 4N3AA 4U95D 2QZAA 4B93B 4L23A 3J5QB 2PM7A 2EIKE 1HE8A 2GROB 5JHAA 3DSVA 4GMJA 4LCTA 3D3MA 1OXJA 3UPVA 4J8EA 4FULA 5KBAA 3ZU7B 3RRUA 1E90A 3HYMB 4HI8A 4I6JA 3D9OA 2GGFA 4U8VD 3UQ3A 3W9FA 3IXEA 2F0YA 1AWCB 1DVPA 4GPMA 3MKQB 3AS5A 1OCCE 3CVUA 3FTWA 4ACKA 4JEUA 3MCXA 3CVYA 3D9PA 3E33A 3LXUX 2ZISA 4IRUA 4GTTA 2XRYA 2L6JA 3LYAA 4URKA 1H2UA 3UINC 4N3BA 3FU3A 2L9BA 3O48A 5D2MC 3AS8A 3AG3E 4JEHA 3CLJA 2XENA 4FJZA 5ANLA 2J08A 4UQZA 5E76A 3U64A 1N52A 3FUEA 3GW4A 3CSTA 3F6QA 1E8ZA 3FUJA 2XGOA 3CKCA 4RLYA 3FP3A 1UOHA 1OWPA 4Q96A 3PREA 1E7VA 1UN9A 1JPLA 2VJ8A 4A3TA 1TNYA 4G26A 3SHFA 4YNDA 4AY5A 4UWHA 3QWPA 1HG2A 4JVSA 4YVOA 4UQYA 1HZ4A 2FBNA 1TNUA 4J7WA 4C0MA 1WY6A 2Y3AA 3LS8A 4LRZA 3CKBA 4I1AA 4HOQA 1TN7A 2L0IA 5J90A 5DIZA 4FLBA 5G04C 4GZCA 4G8KA 3ZNGA 3P2BA 5HI7A 3CV0A 3T8MA 3L17A 3B7SA 5FWQA 3C98A 2C0MA 4UWLA 5HRYA 4I1OB 4UQXA 4ATZD 4OAVB 4DUIA 2GRRB 4ILIA 3EUVA 2LO6A 2X3MA 3KD7A 3MZLB 5BPPA 3CHPA 3B95A 5ARFA 2DWZA 4HLEA 1N94A 4GTSA 1YA0A 3DPYA 4I6GA 4KZ0A 1OWLA 2UWJG 1EYHA 2P9NG 2XEVA 2VTBB 2Y4UA 3E30A 3T5VA 2XPIA 4M3OA 2FO1E 3O4ZA 2MHKA 2H6FA 5AQBA 4DX2A 4BSZB 4AM9A 2LAIA 4GZ5A 3TG5A 4HOTA 4CEMA 4B8CB 1N11A 2OEVA 5KJKA 4D10C 5A23A 3FU0A 2OCCE 3ESKA 3FEYA 5D0OD 2IOSA 3ZKJA 3KEAA 5CMYA 4ILHB 2PZIA 2IFUA 4FJYA 1D8EA 1TJCA 2WXOA 3DSUA 4LEUA 2WXGA 3CHSA 3DPDA 5AJDA 1OWOA 2VQ2A 2J4DA 2HO1A 5A7DB 3SFZA 3T9KA 5JJ7A 3EU5A 1ELKA 4APFA 4NQ0A 3OAWA 3MYVA 1K1BA 2E0IA 3NBNB 3HIZA 3RSEG 3TWRA 4U63A 4WNFA 4AV7A 2WVIA 1MHQA 5CBNA 3EIQC 3BEEA 3FUHA 3CGHA 1N54A 3B13A 5CMWA 1U3DA 5ENSD 3Q9NC 3DEOA 4RVBA 2CHXA 4ANUA 3N71A 4G1TA 2KC7A 1SZ9A 4TXRA 3LCAA 4TUMA 3CHRA 1AP7A 5FQ8A 3PZ4A 3CVPA 4I2WA 3Q47B 4WAFA 3Q73A 4CGVA 4MRUA 4OVVA 3ABLE 4L1BA 4MKTA 3CK7A 3LDZA 1S0PA 1H19A 2CFUA 4F1PA 4ANXA 1NI1A 2BTDA 2PQNA 4DRXE 4HOUA 1QZ2A 4GB9A 1KZOA 3SI5A 1UN8A 3RJVA 1Z5SC 3T5XA 3TWWA 1IYGA 3PVLA 5CRVA 4WWPA 3E34A 2BKGA 3LY9A 1S64A 2Q7FA 2P9UG 2WQ6A 4AOFA 1SA5A 2WXHA 3NQPA 4JB8P 2DYRE 2R5SA 1O1SA 2I1KA 1YMPA 4XI9A 5BXUA 5AQ7A 5KJLA 4KVMA 4TV3A 3ULYA 3DSWA 3LJNA 3L54A 3DXKG 4E85A 4FU3A 1MQSA 3FHEA 4GZ3A 3Q4AB 4H7YA 5FINA 3RKVA 3DSTA 3TWQA 2FO7A 5ENRD 5G05J 3EJNA 3CVLA 3D9IA 4B94A 3S7DA 1N4RA 4GU5A 1FCHA 2KXPC 3KEZA 3VTYA 2C0LA 2C2LA 3UMVA 3PH0C 1N0QA 4A1GA 3C3RA 4KZCA 3SO8A 2F8XK 4QQIA 5BT1A 4UWGA 2M63A 1WM5A 3R7RA 4FA6A 1A17A 3CQGB 4PS3A 4EZLA 3CHMA 1PY1A 2QYJA 4PH4B 2WPVA 1IKND 3FH5A 2IONA 3SNXA 3AG1E 1NP7A 4DX6D 1PAQA 1TNOA 3NZUA 4JZYA 2H6IA 3DSSA 4R7LA 3ZYQA 3K9IA 3WXXA 3APFA 4IULA 4KMOA 3Q75A 3UUXA 1JCSA 1SQMA 2DVWA 3IEGA 3GZSA 1QQEA 2KCLA 4U0ZA 5EILA 5AQAA 4Z68A 3PUKA 1E7UA 1TN8A 3B7UX 1D9SA 5AYWD 2XEHA 3PUJA 2P9KG 1BI8B 2IO2C 3NF1A 4JA7A 2L0TB 5FQ7A 3QNKA 4TXQA 1NFIE 3LVRE 4FADA 1GW6A 2NXPA 3PEUB 2XS1A 2IJGX 3AG2E 3ZFWA 4HLLA 3EHRA 4HXIA 1SA4A 1ELWA 2BEDA 3ENEA 4JHJA 3SD5A 1HX8A 1X81A 3QAQA 1PC2A 3Q7FA 1O5MA 3IKOB 3FU5A 1UG3A 4BX8A 1K8KG 2GRMA 2ONDA 3FY4A 3FU6A 3W9GA 1LTXA 1ZU2A 5J08A 2GRNB 4XEIG 3VLDA 5CHEE 3TXNA 1H6PA 3I5PA 4NIKA 4DPRA 3EDTB 1JCRA 1WG0A 3APDA 4GCNA 4IYPA 4AJWA 1OWMA 4O1OA 2R59A 3UX4A 3ASFA 4V3IA 4BEPA 4BSXA 4WUYA 3CHQA 3MA5A 1A5EA 3E4BA 5HS0A 2X6KA 1BU9A 5FIOA 4I2ZA 4DJAA 2KBXA 3QC1A 3MKQA 3B7BA 3PRZA 3FUNA 3NAWA 1HFAA 4A63B 2XS8A 3T8KA 5G55A 2Y69E 4XKBA 3V30A 1V55E 3EIJA 4GA1A 1HU3A 4AEZC 3LY8A 1O1TA 2IOLA 3L16A 2CFZA 2X38A 1N0RA 5FJYA 1KLXA 1MZCA 1HO8A 3PNTB 4CT0A 3ASGA 2LUHA 2Y0BG 4I9EA 4I43A 4EZJA 4LNBA 4DLOA 2MYOA 4EHMA 3V79K 1EPUA 4YDOA 3RU0A 3QK0A 4B0ZA 2E2EA 4CDRA 4NRHB 1DC2A 2J9QA 4RQIA 5FQ6A 4N2SA 3DXMG 4XZ4A 1OT8A 3TWXA 3HVEA 4HFGA 4EPZA 4XKCA 5G04J 5CEAA 3V31A 3ZXPA 4DI3A 1Z3XA 4W9RA 3JYSA 2XZTG 3B7TA 5IY5E 1OUVA 5CERB 3PDNA 2J07A 4WNGA 4K5CA 2VGXA 5EYLA 2I6HA 2XGMA 1KT1A 4HQDA 3ZHEA 1P5QA 2XEEA 1ZBPA 5B3SE 3CQCB 4FP7A 3CR3A 3BUAA 3SZ7A 2R02A 3ASNE 2RFMA 5EKQD 3AU5A 4TUUA 4JPSA 1E8XA 5KCMA 3MX3A 5LOZA 1UJKA 2AXUA 1U3CA 2QYUA 4ABNA 1Z6TA 5C1DA 1SZAA 1WDYA 3TXMA 1H2VC 3DRAA 4JHRA 4FC8A 5G05C 1EDUA 2Y1LE 4U0SA 4BETA 2AW6A 4GZDA 3ZN3A 5E75A 2OV8A 1X5BA 3UM0A 3MKRA 4BFRA 1MX4A 3S7JA 1HG5A 5D0QD 4O1PA 1IQRA 1S70B 1TEZA 1IQUA 4HVBA 4B89A 3G2SA 4DK5A 3V2OA 1N95A 2YHCA 4QFVA 4M7CA 3RO3A 4B8AA 3L9TA 2CG2A 1IXVA 2V5QC 2ZXWE 2XPZA 5FT9A 3Q5MA 3CK9A 4HOSA 3ONLA 2ZGGA 4JHKA 1TN6A 3LY7A 2H6HA 3SFXA 3IHYA 1H0AA 1QYMA 3MJWA 4L9PA 1KT0A 3CSFA 3QARA 3ZYMA 4BTAA 1BPOA 4N2QA 2DCPA 3SFYA 4ZFHA 3OXFA 4PUCA 4BWRA 4GTOA 4HB5A 2A5EA 1BLXB 4GPKA 3RO2A 3SGHA 3I4GA 2XZDG 1DNPA 2NSZA 2IU1A 4IN3B 4F1SA 3UM3A 4OAUC 4A3VA 4RG9A 2PNNA 3LVQE 4O6FA 3EU9A 4UUCA 1B89A 3PS6A 4N5CA 4A1SA 4GYWA 4HI9A 4LNGA 3JUEA 4RG6A 3TWVA 4KYOB 2EIJE 4OVUA 2VSNA 3PZ3A 3FWVA 5KNGA 2WXJA 3U3WA 3AG4E 4GTMA 4CGWA 3DSXA 5C2YA 5AIJA 2ETCA 3ONKA 1OCZE 2X6JA 2DYSE 3MV2B 3QWWA 1BD8A 3HDXA 3OXLA 3FH8A 3RRNB 4UWKA 4H7XA 3MGBA 3ZW3A 2X6FA 3JXIA 2B6CA 4UI9J 1FVHA 3E32A 4KXKB 4LG6A 5KJMA 1Q2ZA 1FVFA 5BXOA 2DBAA 4U96D 3UT8A 5CCMA 2PL2A 1KZPA 3JXJA 4F53A 3D9NA 1E8WA 1H6KA 4AY6A 1IHBA 5BUZA 4EBAG 3GZ1A 4PS8A 1O1RA 1KPSB 4ATGA 5AJLA 4CDNA 2WQHA 2ZU6B 2HE0A 3U66A 3C3QA 2YHEA 1MX2A 1K1AA 2HM8A 5BV1A 3PZ2A 4BTBA 2GRPB 1Z3YA 2L6BA 4U7EB 2GW1A 1U2VG 1HXIA 2EINE 3FTXA 3Q49B 3G2VA 1OCRE 2AVPA 4U04A 4J8YA 4GMLA 4YVQC 3GZ2A 3LJ3A 1LD7A 5CCLA 2LXLA 2ZGDA 2CHZA 4FLHA 4G11A 4MBGA 5EN5D 3G2TA 3U4TA 3RAUA 3ZIMA 4JC8A 5LFAA 1OWNA 1V54E 4CT4A 4I6EA 4K5BA 4GYYA 2ZIRA 2X6HA 3HVEB 3JQ0A 2RD0A 2WXRA 4HBDA 5ENNA 2J09A 2V5FA 3E37A 1LF8A 1Y8MA 3HXBA 3TL5A 2VTBA 4BY6A 2IY0C 2A4ZA 3QDNA 5ENPD 4KT6B 2I2OA 3AJIA 3APCA 3C5RA 4JA9A 3FUKA 2VSOE 4XIFA 3GYZA 4C0EA 1WAO1 3QB2A 4CZ2D 3ASHA 3FTUA 3HXFA 2YNQA 3AAAC 1SW6A 4L2YA 2FEZA 3ABKE 4GYOA 5JMND 3L13A 2QY7A 4FHJA 2EQXA 3PNLB 4I9CA 4HRNA 5KWDA 2V0PA 1MYOA 3FULA 3Q78A 3HXEA 4RSYA 5EIBE 2IQCA 4Q94A 4BT9A 2P9SG 5FZQA 2FI7A 2IEJA 3LKUA 5CRUA 5BV0A 3IBEA 4G8LA 4NACA 5FZSA 3CVXA 2CHWA 1NZNA 1LD8A 4NURA 3HHMA 2KCKA 2R03A 2JEKA 3D9KA 5EDSA 3FTSA 4Q69A 2LXMA 2BKKB 4HRLA 5JHBA 3DEPA 5JJTA 3UKUG 2YQ8A 3UIPC 5T3RA 3IV0A 3JCKC 2LAHA 2KM4A 3UM2A 4LUNU 1E96B 5CBOA 4UI9C 1IHGA 5ENTD 4G23A 3JUIA 5BNWA 4WNDA 2GRQB 4BERA 3KS2A 2QFCA 3R7QA 2XRZA 5HKPA 3NOCD 3CK8A 2WXLA 3D9HA 3KSQA 1RZ4A 2WXPA 4FHKA 1VDYA 4N39A 5KJNA 3FUMA 2R05A 3UT7A 2IO3C 1FT2A 2HR2A 2F8YA 1OCOE 2KZTB 3ASDA 4GAAA 4EECA 2XPYA 3FEXA 3I3NA 5T8IA 3TAXA 3FH7A 3P1UA 4I1MA 1XNFA 3QKYA 4G24A 4XI0A 3R9MA 3ZYKA 3V2XA 3OTNA 3UI2A 3RIBA 1H2TC 3X2QE 3Q9UC 1HS6A 2UY1A 3TWTA 5LX8A 2V4LA 1HH8A 2XCBA 4J8SA 4CDMA 1DCQA 4XX5A 3UTMA 2OVFA 3ZEFA 4C48B 1QNFA 2VYIA 2P2CP 3G2UA 2DZOA 2PQRA 2QC9A 3CEQA 4JD2G 1NA3A 5A6CA 2ETAA 2PM6A 4DX7D 1INZA 1G3NB 3ASOE 3CIAA 4Y6CA 3URZA 2VGXB 4F3VA 3OXGA 4ACLA 1E8YA 4P29A 2VGEA 4JL0A 4TXPA 3ZXSA 4BX9A 4F7AA 1K3ZD 2B0OE 3SF4A 1DCEA 3QJZA 3ZYLA 5M72A 3ULEG 2IF4A 2P9IG 4HNAD 3G2WA 4K03A 3S7BA 2VGYA 3DBSA 5T4YA
chains in the Genus database with same CATH topology
1OCCE 1OCOE 3AG3E 2Y69E 3ASOE 5IY5E 3ABKE 3AG1E 1V55E 1V54E 3AG4E 1OCRE 3ASNE 5B1BE 2EIME 5B1AE 2EILE 3ABLE 3WG7E 2ZXWE 1OCZE 2DYSE 2OCCE 2EIKE 3ABME 3X2QE 3AG2E 2DYRE 2EIJE 5B3SE 2EINE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCC E;  1OCO E;  3AG3 E;  2Y69 E;  3ASO E;  5IY5 E;  3ABK E;  3AG1 E;  1V55 E;  1V54 E;  3AG4 E;  1OCR E;  3ASN E;  5B1B E;  2EIM E;  5B1A E;  2EIL E;  3ABL E;  3WG7 E;  2ZXW E;  1OCZ E;  2DYS E;  2OCC E;  2EIK E;  3ABM E;  3X2Q E;  3AG2 E;  2DYR E;  2EIJ E;  5B3S E;  2EIN E; 
#chains in the Genus database with same CATH topology
 3RRM B;  2P58 C;  4U07 A;  4UWF A;  4ILG A;  5H7P A;  3L08 A;  4HRM B;  3FUF A;  4GA2 A;  2EIL E;  4E6H A;  3AU4 A;  2BF0 X;  4YDE A;  2X6I A;  3ESL A;  2LNI A;  4AVX A;  2YIN A;  2WM9 A;  2AXV A;  4J8F A;  3IHV A;  1UW4 B;  1ELR A;  5CEC B;  2WXM A;  2ILR A;  4HS2 A;  1JWG A;  3RK6 A;  2RKK A;  5ARG A;  5B1A E;  3WG7 E;  3TJP A;  4GZ6 A;  5ENO D;  4LSZ E;  5EID A;  4O60 A;  1OY3 D;  3ML9 A;  5FQ4 A;  3CHO A;  3EHQ A;  3EHM A;  4YDY A;  4ANW A;  4EZK A;  2WQ7 A;  4HOR A;  4WWN A;  1TNB A;  4N5Q A;  5DBK A;  3PE4 A;  3FUI A;  2WB2 A;  3ZUV B;  4LNU D;  3CVN A;  1H6O A;  5AN8 A;  3MV3 B;  5ITZ F;  3U9W A;  3L6A A;  4EQF A;  3BG1 B;  4EBA A;  4F6R D;  3UM1 A;  2WXQ A;  4PDX A;  3FUD A;  2ETB A;  2AJA A;  2HYZ A;  2XCC A;  4BES A;  2EIM E;  4WNE A;  1TYQ G;  1N4Q A;  1HF8 A;  4GTP A;  3FTV A;  1SVX A;  5CED B;  2WXK A;  3UXG A;  2RFA A;  5LP0 A;  3ZRH A;  3I4R B;  5KNH D;  3HG0 D;  1QBQ A;  4MS6 A;  5AQ9 A;  3VTX A;  5ENQ D;  2OEW A;  3HXD A;  3PEV B;  3D9M A;  4XE0 A;  2OVB A;  5D66 A;  2VSY A;  4GTR A;  3L22 A;  3CVV A;  4K0R A;  3FTZ A;  4WWO A;  4TRQ A;  2AXZ A;  3TWS A;  3ML8 A;  2DIW A;  2V4H C;  2JAB A;  2I9C A;  3SBS A;  3EHN A;  2CG3 A;  3D9J A;  4GMR A;  3UKR G;  3VLE A;  2WXF A;  4AP2 A;  2XGS A;  2KCV A;  5AAR A;  2V8S E;  2MOW A;  3ZPJ A;  4U8Y D;  2FF4 A;  3J5P A;  3TG4 A;  4KVO A;  1YYH A;  2KZT A;  4G2V A;  4A55 A;  2A5U A;  3L82 A;  2WXI A;  3ISM C;  2LSU A;  1RW2 A;  1L5J A;  5G2N A;  3S2A A;  4G25 A;  3ABM E;  2P9L G;  1NA0 A;  5EYP F;  3HXC A;  3ULQ A;  2F37 A;  4J6I A;  2UY1 B;  5JA4 D;  1FT1 A;  4ME2 A;  2WMO A;  5HQ8 A;  3CVW A;  1D8D A;  3Q15 A;  3UT4 A;  2XQ0 A;  4PS7 A;  4Y6W A;  2VSX E;  3PE3 A;  5LCW J;  1JCQ A;  1Y6I A;  2J4B A;  2J49 A;  3KAE A;  2Y4T A;  3SY2 A;  2GRL A;  4KBQ A;  2P9P G;  1TR4 A;  2NYJ A;  3JQ1 A;  4I17 A;  4C9B B;  3C3O A;  1NL4 A;  4DX5 D;  5EX3 A;  3ZHE B;  3UIO C;  2RG8 A;  3FTY A;  3LEW A;  2NC9 A;  2H6G A;  3BQO A;  2LSV A;  4CCA A;  4ANV A;  4AXH A;  4JW1 A;  1EF1 C;  1N4P A;  3BU8 A;  5LCW C;  4U8H A;  4DI4 A;  2I1J A;  2R17 C;  4GTV A;  2KAT A;  3LPZ A;  3DWL G;  1N4S A;  3SBT B;  4K5A B;  4J0U A;  2OOE A;  3KSL A;  3AS4 A;  3PZ1 A;  2MRI A;  1UJJ A;  3ZGQ A;  3QWV A;  4GA0 A;  1S63 A;  2AWI A;  3CVQ A;  3R9A B;  4CRW A;  4APO A;  2XHE A;  4GCO A;  3NOG D;  3S7F A;  4CYM D;  4GTQ A;  1TJF A;  3B7R L;  3PZD A;  4MLP A;  3BG0 B;  4UI9 K;  4J8D A;  4LER A;  4JXT A;  2BUG A;  3FFL A;  1JUQ A;  4L2L A;  4ZHB A;  3QOU A;  3TWU A;  1YCS B;  1W3B A;  3Q7A A;  5FZR A;  1MX6 A;  4X8Q A;  1JWF A;  1TNZ A;  5ANR A;  3NZS A;  4N3C A;  4DLQ A;  5EX0 A;  4L7T A;  1N9A A;  4AIF A;  2WMN A;  5BW8 C;  1ZB1 A;  5FTP A;  5JJ6 A;  5AAO A;  2DZN A;  1FPP A;  3MEK A;  1XGW A;  3C72 A;  5AEN A;  3FDH A;  3ZVV A;  3HRA A;  2FUL A;  4BT8 A;  4DX1 A;  1MJ0 A;  3TGO A;  3D9L A;  3VLF A;  2R2L A;  4OYS A;  4U0U A;  3SQV A;  2WXN A;  4YDW A;  2J8S D;  1BI7 B;  5B1B E;  2JLB A;  3Q79 A;  3NB2 A;  4N3A A;  4U95 D;  2QZA A;  4B93 B;  4L23 A;  3J5Q B;  2PM7 A;  2EIK E;  1HE8 A;  2GRO B;  5JHA A;  3DSV A;  4GMJ A;  4LCT A;  3D3M A;  1OXJ A;  3UPV A;  4J8E A;  4FUL A;  5KBA A;  3ZU7 B;  3RRU A;  1E90 A;  3HYM B;  4HI8 A;  4I6J A;  3D9O A;  2GGF A;  4U8V D;  3UQ3 A;  3W9F A;  3IXE A;  2F0Y A;  1AWC B;  1DVP A;  4GPM A;  3MKQ B;  3AS5 A;  1OCC E;  3CVU A;  3FTW A;  4ACK A;  4JEU A;  3MCX A;  3CVY A;  3D9P A;  3E33 A;  3LXU X;  2ZIS A;  4IRU A;  4GTT A;  2XRY A;  2L6J A;  3LYA A;  4URK A;  1H2U A;  3UIN C;  4N3B A;  3FU3 A;  2L9B A;  3O48 A;  5D2M C;  3AS8 A;  3AG3 E;  4JEH A;  3CLJ A;  2XEN A;  4FJZ A;  5ANL A;  2J08 A;  4UQZ A;  5E76 A;  3U64 A;  1N52 A;  3FUE A;  3GW4 A;  3CST A;  3F6Q A;  1E8Z A;  3FUJ A;  2XGO A;  3CKC A;  4RLY A;  3FP3 A;  1UOH A;  1OWP A;  4Q96 A;  3PRE A;  1E7V A;  1UN9 A;  1JPL A;  2VJ8 A;  4A3T A;  1TNY A;  4G26 A;  3SHF A;  4YND A;  4AY5 A;  4UWH A;  3QWP A;  1HG2 A;  4JVS A;  4YVO A;  4UQY A;  1HZ4 A;  2FBN A;  1TNU A;  4J7W A;  4C0M A;  1WY6 A;  2Y3A A;  3LS8 A;  4LRZ A;  3CKB A;  4I1A A;  4HOQ A;  1TN7 A;  2L0I A;  5J90 A;  5DIZ A;  4FLB A;  5G04 C;  4GZC A;  4G8K A;  3ZNG A;  3P2B A;  5HI7 A;  3CV0 A;  3T8M A;  3L17 A;  3B7S A;  5FWQ A;  3C98 A;  2C0M A;  4UWL A;  5HRY A;  4I1O B;  4UQX A;  4ATZ D;  4OAV B;  4DUI A;  2GRR B;  4ILI A;  3EUV A;  2LO6 A;  2X3M A;  3KD7 A;  3MZL B;  5BPP A;  3CHP A;  3B95 A;  5ARF A;  2DWZ A;  4HLE A;  1N94 A;  4GTS A;  1YA0 A;  3DPY A;  4I6G A;  4KZ0 A;  1OWL A;  2UWJ G;  1EYH A;  2P9N G;  2XEV A;  2VTB B;  2Y4U A;  3E30 A;  3T5V A;  2XPI A;  4M3O A;  2FO1 E;  3O4Z A;  2MHK A;  2H6F A;  5AQB A;  4DX2 A;  4BSZ B;  4AM9 A;  2LAI A;  4GZ5 A;  3TG5 A;  4HOT A;  4CEM A;  4B8C B;  1N11 A;  2OEV A;  5KJK A;  4D10 C;  5A23 A;  3FU0 A;  2OCC E;  3ESK A;  3FEY A;  5D0O D;  2IOS A;  3ZKJ A;  3KEA A;  5CMY A;  4ILH B;  2PZI A;  2IFU A;  4FJY A;  1D8E A;  1TJC A;  2WXO A;  3DSU A;  4LEU A;  2WXG A;  3CHS A;  3DPD A;  5AJD A;  1OWO A;  2VQ2 A;  2J4D A;  2HO1 A;  5A7D B;  3SFZ A;  3T9K A;  5JJ7 A;  3EU5 A;  1ELK A;  4APF A;  4NQ0 A;  3OAW A;  3MYV A;  1K1B A;  2E0I A;  3NBN B;  3HIZ A;  3RSE G;  3TWR A;  4U63 A;  4WNF A;  4AV7 A;  2WVI A;  1MHQ A;  5CBN A;  3EIQ C;  3BEE A;  3FUH A;  3CGH A;  1N54 A;  3B13 A;  5CMW A;  1U3D A;  5ENS D;  3Q9N C;  3DEO A;  4RVB A;  2CHX A;  4ANU A;  3N71 A;  4G1T A;  2KC7 A;  1SZ9 A;  4TXR A;  3LCA A;  4TUM A;  3CHR A;  1AP7 A;  5FQ8 A;  3PZ4 A;  3CVP A;  4I2W A;  3Q47 B;  4WAF A;  3Q73 A;  4CGV A;  4MRU A;  4OVV A;  3ABL E;  4L1B A;  4MKT A;  3CK7 A;  3LDZ A;  1S0P A;  1H19 A;  2CFU A;  4F1P A;  4ANX A;  1NI1 A;  2BTD A;  2PQN A;  4DRX E;  4HOU A;  1QZ2 A;  4GB9 A;  1KZO A;  3SI5 A;  1UN8 A;  3RJV A;  1Z5S C;  3T5X A;  3TWW A;  1IYG A;  3PVL A;  5CRV A;  4WWP A;  3E34 A;  2BKG A;  3LY9 A;  1S64 A;  2Q7F A;  2P9U G;  2WQ6 A;  4AOF A;  1SA5 A;  2WXH A;  3NQP A;  4JB8 P;  2DYR E;  2R5S A;  1O1S A;  2I1K A;  1YMP A;  4XI9 A;  5BXU A;  5AQ7 A;  5KJL A;  4KVM A;  4TV3 A;  3ULY A;  3DSW A;  3LJN A;  3L54 A;  3DXK G;  4E85 A;  4FU3 A;  1MQS A;  3FHE A;  4GZ3 A;  3Q4A B;  4H7Y A;  5FIN A;  3RKV A;  3DST A;  3TWQ A;  2FO7 A;  5ENR D;  5G05 J;  3EJN A;  3CVL A;  3D9I A;  4B94 A;  3S7D A;  1N4R A;  4GU5 A;  1FCH A;  2KXP C;  3KEZ A;  3VTY A;  2C0L A;  2C2L A;  3UMV A;  3PH0 C;  1N0Q A;  4A1G A;  3C3R A;  4KZC A;  3SO8 A;  2F8X K;  4QQI A;  5BT1 A;  4UWG A;  2M63 A;  1WM5 A;  3R7R A;  4FA6 A;  1A17 A;  3CQG B;  4PS3 A;  4EZL A;  3CHM A;  1PY1 A;  2QYJ A;  4PH4 B;  2WPV A;  1IKN D;  3FH5 A;  2ION A;  3SNX A;  3AG1 E;  1NP7 A;  4DX6 D;  1PAQ A;  1TNO A;  3NZU A;  4JZY A;  2H6I A;  3DSS A;  4R7L A;  3ZYQ A;  3K9I A;  3WXX A;  3APF A;  4IUL A;  4KMO A;  3Q75 A;  3UUX A;  1JCS A;  1SQM A;  2DVW A;  3IEG A;  3GZS A;  1QQE A;  2KCL A;  4U0Z A;  5EIL A;  5AQA A;  4Z68 A;  3PUK A;  1E7U A;  1TN8 A;  3B7U X;  1D9S A;  5AYW D;  2XEH A;  3PUJ A;  2P9K G;  1BI8 B;  2IO2 C;  3NF1 A;  4JA7 A;  2L0T B;  5FQ7 A;  3QNK A;  4TXQ A;  1NFI E;  3LVR E;  4FAD A;  1GW6 A;  2NXP A;  3PEU B;  2XS1 A;  2IJG X;  3AG2 E;  3ZFW A;  4HLL A;  3EHR A;  4HXI A;  1SA4 A;  1ELW A;  2BED A;  3ENE A;  4JHJ A;  3SD5 A;  1HX8 A;  1X81 A;  3QAQ A;  1PC2 A;  3Q7F A;  1O5M A;  3IKO B;  3FU5 A;  1UG3 A;  4BX8 A;  1K8K G;  2GRM A;  2OND A;  3FY4 A;  3FU6 A;  3W9G A;  1LTX A;  1ZU2 A;  5J08 A;  2GRN B;  4XEI G;  3VLD A;  5CHE E;  3TXN A;  1H6P A;  3I5P A;  4NIK A;  4DPR A;  3EDT B;  1JCR A;  1WG0 A;  3APD A;  4GCN A;  4IYP A;  4AJW A;  1OWM A;  4O1O A;  2R59 A;  3UX4 A;  3ASF A;  4V3I A;  4BEP A;  4BSX A;  4WUY A;  3CHQ A;  3MA5 A;  1A5E A;  3E4B A;  5HS0 A;  2X6K A;  1BU9 A;  5FIO A;  4I2Z A;  4DJA A;  2KBX A;  3QC1 A;  3MKQ A;  3B7B A;  3PRZ A;  3FUN A;  3NAW A;  1HFA A;  4A63 B;  2XS8 A;  3T8K A;  5G55 A;  2Y69 E;  4XKB A;  3V30 A;  1V55 E;  3EIJ A;  4GA1 A;  1HU3 A;  4AEZ C;  3LY8 A;  1O1T A;  2IOL A;  3L16 A;  2CFZ A;  2X38 A;  1N0R A;  5FJY A;  1KLX A;  1MZC A;  1HO8 A;  3PNT B;  4CT0 A;  3ASG A;  2LUH A;  2Y0B G;  4I9E A;  4I43 A;  4EZJ A;  4LNB A;  4DLO A;  2MYO A;  4EHM A;  3V79 K;  1EPU A;  4YDO A;  3RU0 A;  3QK0 A;  4B0Z A;  2E2E A;  4CDR A;  4NRH B;  1DC2 A;  2J9Q A;  4RQI A;  5FQ6 A;  4N2S A;  3DXM G;  4XZ4 A;  1OT8 A;  3TWX A;  3HVE A;  4HFG A;  4EPZ A;  4XKC A;  5G04 J;  5CEA A;  3V31 A;  3ZXP A;  4DI3 A;  1Z3X A;  4W9R A;  3JYS A;  2XZT G;  3B7T A;  5IY5 E;  1OUV A;  5CER B;  3PDN A;  2J07 A;  4WNG A;  4K5C A;  2VGX A;  5EYL A;  2I6H A;  2XGM A;  1KT1 A;  4HQD A;  3ZHE A;  1P5Q A;  2XEE A;  1ZBP A;  5B3S E;  3CQC B;  4FP7 A;  3CR3 A;  3BUA A;  3SZ7 A;  2R02 A;  3ASN E;  2RFM A;  5EKQ D;  3AU5 A;  4TUU A;  4JPS A;  1E8X A;  5KCM A;  3MX3 A;  5LOZ A;  1UJK A;  2AXU A;  1U3C A;  2QYU A;  4ABN A;  1Z6T A;  5C1D A;  1SZA A;  1WDY A;  3TXM A;  1H2V C;  3DRA A;  4JHR A;  4FC8 A;  5G05 C;  1EDU A;  2Y1L E;  4U0S A;  4BET A;  2AW6 A;  4GZD A;  3ZN3 A;  5E75 A;  2OV8 A;  1X5B A;  3UM0 A;  3MKR A;  4BFR A;  1MX4 A;  3S7J A;  1HG5 A;  5D0Q D;  4O1P A;  1IQR A;  1S70 B;  1TEZ A;  1IQU A;  4HVB A;  4B89 A;  3G2S A;  4DK5 A;  3V2O A;  1N95 A;  2YHC A;  4QFV A;  4M7C A;  3RO3 A;  4B8A A;  3L9T A;  2CG2 A;  1IXV A;  2V5Q C;  2ZXW E;  2XPZ A;  5FT9 A;  3Q5M A;  3CK9 A;  4HOS A;  3ONL A;  2ZGG A;  4JHK A;  1TN6 A;  3LY7 A;  2H6H A;  3SFX A;  3IHY A;  1H0A A;  1QYM A;  3MJW A;  4L9P A;  1KT0 A;  3CSF A;  3QAR A;  3ZYM A;  4BTA A;  1BPO A;  4N2Q A;  2DCP A;  3SFY A;  4ZFH A;  3OXF A;  4PUC A;  4BWR A;  4GTO A;  4HB5 A;  2A5E A;  1BLX B;  4GPK A;  3RO2 A;  3SGH A;  3I4G A;  2XZD G;  1DNP A;  2NSZ A;  2IU1 A;  4IN3 B;  4F1S A;  3UM3 A;  4OAU C;  4A3V A;  4RG9 A;  2PNN A;  3LVQ E;  4O6F A;  3EU9 A;  4UUC A;  1B89 A;  3PS6 A;  4N5C A;  4A1S A;  4GYW A;  4HI9 A;  4LNG A;  3JUE A;  4RG6 A;  3TWV A;  4KYO B;  2EIJ E;  4OVU A;  2VSN A;  3PZ3 A;  3FWV A;  5KNG A;  2WXJ A;  3U3W A;  3AG4 E;  4GTM A;  4CGW A;  3DSX A;  5C2Y A;  5AIJ A;  2ETC A;  3ONK A;  1OCZ E;  2X6J A;  2DYS E;  3MV2 B;  3QWW A;  1BD8 A;  3HDX A;  3OXL A;  3FH8 A;  3RRN B;  4UWK A;  4H7X A;  3MGB A;  3ZW3 A;  2X6F A;  3JXI A;  2B6C A;  4UI9 J;  1FVH A;  3E32 A;  4KXK B;  4LG6 A;  5KJM A;  1Q2Z A;  1FVF A;  5BXO A;  2DBA A;  4U96 D;  3UT8 A;  5CCM A;  2PL2 A;  1KZP A;  3JXJ A;  4F53 A;  3D9N A;  1E8W A;  1H6K A;  4AY6 A;  1IHB A;  5BUZ A;  4EBA G;  3GZ1 A;  4PS8 A;  1O1R A;  1KPS B;  4ATG A;  5AJL A;  4CDN A;  2WQH A;  2ZU6 B;  2HE0 A;  3U66 A;  3C3Q A;  2YHE A;  1MX2 A;  1K1A A;  2HM8 A;  5BV1 A;  3PZ2 A;  4BTB A;  2GRP B;  1Z3Y A;  2L6B A;  4U7E B;  2GW1 A;  1U2V G;  1HXI A;  2EIN E;  3FTX A;  3Q49 B;  3G2V A;  1OCR E;  2AVP A;  4U04 A;  4J8Y A;  4GML A;  4YVQ C;  3GZ2 A;  3LJ3 A;  1LD7 A;  5CCL A;  2LXL A;  2ZGD A;  2CHZ A;  4FLH A;  4G11 A;  4MBG A;  5EN5 D;  3G2T A;  3U4T A;  3RAU A;  3ZIM A;  4JC8 A;  5LFA A;  1OWN A;  1V54 E;  4CT4 A;  4I6E A;  4K5B A;  4GYY A;  2ZIR A;  2X6H A;  3HVE B;  3JQ0 A;  2RD0 A;  2WXR A;  4HBD A;  5ENN A;  2J09 A;  2V5F A;  3E37 A;  1LF8 A;  1Y8M A;  3HXB A;  3TL5 A;  2VTB A;  4BY6 A;  2IY0 C;  2A4Z A;  3QDN A;  5ENP D;  4KT6 B;  2I2O A;  3AJI A;  3APC A;  3C5R A;  4JA9 A;  3FUK A;  2VSO E;  4XIF A;  3GYZ A;  4C0E A;  1WAO 1;  3QB2 A;  4CZ2 D;  3ASH A;  3FTU A;  3HXF A;  2YNQ A;  3AAA C;  1SW6 A;  4L2Y A;  2FEZ A;  3ABK E;  4GYO A;  5JMN D;  3L13 A;  2QY7 A;  4FHJ A;  2EQX A;  3PNL B;  4I9C A;  4HRN A;  5KWD A;  2V0P A;  1MYO A;  3FUL A;  3Q78 A;  3HXE A;  4RSY A;  5EIB E;  2IQC A;  4Q94 A;  4BT9 A;  2P9S G;  5FZQ A;  2FI7 A;  2IEJ A;  3LKU A;  5CRU A;  5BV0 A;  3IBE A;  4G8L A;  4NAC A;  5FZS A;  3CVX A;  2CHW A;  1NZN A;  1LD8 A;  4NUR A;  3HHM A;  2KCK A;  2R03 A;  2JEK A;  3D9K A;  5EDS A;  3FTS A;  4Q69 A;  2LXM A;  2BKK B;  4HRL A;  5JHB A;  3DEP A;  5JJT A;  3UKU G;  2YQ8 A;  3UIP C;  5T3R A;  3IV0 A;  3JCK C;  2LAH A;  2KM4 A;  3UM2 A;  4LUN U;  1E96 B;  5CBO A;  4UI9 C;  1IHG A;  5ENT D;  4G23 A;  3JUI A;  5BNW A;  4WND A;  2GRQ B;  4BER A;  3KS2 A;  2QFC A;  3R7Q A;  2XRZ A;  5HKP A;  3NOC D;  3CK8 A;  2WXL A;  3D9H A;  3KSQ A;  1RZ4 A;  2WXP A;  4FHK A;  1VDY A;  4N39 A;  5KJN A;  3FUM A;  2R05 A;  3UT7 A;  2IO3 C;  1FT2 A;  2HR2 A;  2F8Y A;  1OCO E;  2KZT B;  3ASD A;  4GAA A;  4EEC A;  2XPY A;  3FEX A;  3I3N A;  5T8I A;  3TAX A;  3FH7 A;  3P1U A;  4I1M A;  1XNF A;  3QKY A;  4G24 A;  4XI0 A;  3R9M A;  3ZYK A;  3V2X A;  3OTN A;  3UI2 A;  3RIB A;  1H2T C;  3X2Q E;  3Q9U C;  1HS6 A;  2UY1 A;  3TWT A;  5LX8 A;  2V4L A;  1HH8 A;  2XCB A;  4J8S A;  4CDM A;  1DCQ A;  4XX5 A;  3UTM A;  2OVF A;  3ZEF A;  4C48 B;  1QNF A;  2VYI A;  2P2C P;  3G2U A;  2DZO A;  2PQR A;  2QC9 A;  3CEQ A;  4JD2 G;  1NA3 A;  5A6C A;  2ETA A;  2PM6 A;  4DX7 D;  1INZ A;  1G3N B;  3ASO E;  3CIA A;  4Y6C A;  3URZ A;  2VGX B;  4F3V A;  3OXG A;  4ACL A;  1E8Y A;  4P29 A;  2VGE A;  4JL0 A;  4TXP A;  3ZXS A;  4BX9 A;  4F7A A;  1K3Z D;  2B0O E;  3SF4 A;  1DCE A;  3QJZ A;  3ZYL A;  5M72 A;  3ULE G;  2IF4 A;  2P9I G;  4HNA D;  3G2W A;  4K03 A;  3S7B A;  2VGY A;  3DBS A;  5T4Y A; 
#chains in the Genus database with same CATH homology
 1OCC E;  1OCO E;  3AG3 E;  2Y69 E;  3ASO E;  5IY5 E;  3ABK E;  3AG1 E;  1V55 E;  1V54 E;  3AG4 E;  1OCR E;  3ASN E;  5B1B E;  2EIM E;  5B1A E;  2EIL E;  3ABL E;  3WG7 E;  2ZXW E;  1OCZ E;  2DYS E;  2OCC E;  2EIK E;  3ABM E;  3X2Q E;  3AG2 E;  2DYR E;  2EIJ E;  5B3S E;  2EIN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...