1OCOE

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
109
structure length
109
Chain Sequence
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
total genus 42
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1ocoE00
3ASNE 5B1AE 2Y69E 2EIJE 2DYSE 3WG7E 3ABME 2OCCE 3AG1E 1OCCE 2DYRE 1OCRE 1OCOE 3X2QE 2ZXWE 2EIKE 5IY5E 1OCZE 3ASOE 2EILE 2EINE 1V55E 3ABKE 3ABLE 5B3SE 3AG3E 5B1BE 3AG4E 3AG2E 1V54E 2EIME
chains in the Genus database with same CATH superfamily
4AEZC 3DPDA 2IFUA 1DNPA 3QB2A 1QBQA 1S63A 4L2LA 3G2WA 1SA4A 3MYVA 3PZ1A 4I1MA 1MJ0A 1TN8A 1EYHA 1UG3A 4DRXE 4L1BA 5IY5E 4KT6B 1N4RA 2ZIRA 2EINE 3FP3A 2RKKA 1O1SA 4N3BA 1E8WA 3RIBA 4WWPA 4ABNA 4FULA 4WWOA 3RAUA 1MX2A 1N0QA 3FFLA 4LSZE 2F8XK 4CYMD 2J9QA 2XGSA 3PNLB 1OWLA 3DSSA 1D8DA 1NP7A 3IXEA 3SGHA 4HI9A 1SVXA 3CHPA 3EHRA 2WXRA 2ETAA 3EJNA 1TJCA 2WXOA 3Q75A 4N2SA 3PEVB 3EU9A 3KSLA 3ZRHA 4UWGA 1ELWA 2X6JA 3AU5A 3F6QA 3LS8A 2R02A 3FUIA 4GTMA 1HXIA 3CKBA 2QZAA 3O4ZA 1OCCE 3RRMB 4O1PA 3ZNGA 2Q7FA 3C3QA 3X2QE 3QAQA 2PM6A 5FZSA 4K5CA 3QKYA 2DCPA 3V30A 3QK0A 5H7PA 1BD8A 4AP2A 4DLQA 1FCHA 1H0AA 2AJAA 4G24A 1HG2A 1XNFA 2XQ0A 2L6JA 1OWMA 3E37A 3ZEFA 3V31A 3KSQA 3TWTA 4ANUA 4JVSA 3Q4AB 3HXFA 4N3CA 2QY7A 5ENQD 2HYZA 5JA4D 3CVXA 3GZ2A 3CVLA 1LD7A 3FUFA 4PH4B 3SI5A 4LNBA 3G2UA 2XENA 2WXLA 4DX6D 2KCLA 3DXMG 3JUEA 2UY1B 4GYYA 2J8SD 5T3RA 5AQBA 3DEOA 4D10C 4FLBA 1HF8A 4WNFA 4AXHA 2WXIA 5BV1A 3ML8A 4AOFA 3EUVA 3OXLA 4C0EA 4BX8A 2XHEA 1TR4A 3TWQA 1A17A 2X38A 3LY9A 5JJ7A 2OEWA 4BT8A 1K3ZD 3DXKG 1TJFA 3QOUA 4J0UA 2L0IA 4KZ0A 3EU5A 3BUAA 3SBTB 2X6IA 4BTAA 4Q94A 3L6AA 4UI9J 3KEAA 4GZ3A 4GB9A 5D2MC 1DC2A 2AXUA 3N71A 3LKUA 2DIWA 2KCKA 3I4GA 5ENPD 2WXJA 3ULQA 4ACLA 5FTPA 2H6FA 2E0IA 3E34A 3TWWA 1JCRA 1NA3A 5HQ8A 3ZHEB 2JEKA 4ANXA 4BSZB 2Y69E 4XEIG 2NYJA 1JWGA 2PM7A 2OVBA 2L9BA 5AJDA 4HOQA 3OTNA 1U2VG 3Q73A 3TGOA 3Q15A 4GU5A 4E6HA 1N0RA 4I6GA 5CCLA 3PZ2A 4U8VD 5JHAA 2YQ8A 4F53A 4YVQC 4GYOA 1RZ4A 4AM9A 3RU0A 3UT7A 3UIOC 1OY3D 2B0OE 1Z6TA 3RSEG 3U64A 5CBOA 1PY1A 4Q69A 2XS8A 4ACKA 5JMND 2DWZA 1QQEA 4O6FA 4B8AA 1ZU2A 4U07A 2KZTB 4YDEA 2PQNA 1GW6A 3FUMA 5AQ9A 1K1BA 3MX3A 4CZ2D 1S64A 2NSZA 5CERB 2J49A 3CVUA 2VGXB 2XCBA 1DCEA 2RFMA 4JEHA 3QNKA 4O60A 1Y8MA 4ANVA 3NZSA 4ANWA 4G26A 1WAO1 2GGFA 2GRPB 1HU3A 3LCAA 1D9SA 4HLLA 2ILRA 5G04C 4QFVA 4N3AA 2FULA 4FHJA 4UQYA 5EDSA 1TNYA 3I4RB 5M72A 3RO2A 2BTDA 3KS2A 1E8YA 4RG6A 1H2TC 2QYJA 1SQMA 2IF4A 4UWKA 2XPZA 4U7EB 5T8IA 1DVPA 3C98A 4GMJA 1AWCB 4LRZA 2CHWA 1OCZE 3UM3A 2AWIA 2CHZA 3PRZA 5HRYA 3UT8A 4UQXA 3LVRE 4BSXA 5J90A 4C48B 1OWNA 3EHNA 5KJNA 2JLBA 3D9MA 3EIQC 4DX7D 1A5EA 5D0QD 4JEUA 4Q96A 4I9CA 2EIKE 4K0RA 4JC8A 1OT8A 2R2LA 1LD8A 5G04J 3FUNA 2BKKB 1FVFA 4A1SA 3RO3A 5HKPA 3NF1A 4LNGA 3FTUA 2YHEA 4LERA 2DYSE 4NURA 1H6OA 4FP7A 2Y0BG 3MKQB 3CVPA 3MCXA 2RFAA 3ONLA 3NOGD 3MEKA 2M63A 2WXHA 2R59A 5B3SE 4GZ5A 4BFRA 3CVYA 3PUJA 5CCMA 1SZAA 3UKRG 5BV0A 4TRQA 4EQFA 4NQ0A 2J07A 4J8FA 5A7DB 3JYSA 2P58C 3PDNA 5CMYA 2AW6A 4U0ZA 4DPRA 4BTBA 3ABLE 1BI8B 2IY0C 1HE8A 1VDYA 4FJZA 4U8HA 3UT4A 4C0MA 3TG5A 1UJJA 3HHMA 2GRMA 2IOSA 3G2TA 3VTXA 1QZ2A 1H2VC 4OAVB 3AU4A 3MKRA 2XZTG 3TXMA 3SF4A 4CDNA 2R17C 4KMOA 3SO8A 2IOLA 5T4YA 1MQSA 2GRLA 3S7BA 2VGYA 2P9PG 2VTBB 1OCRE 3P2BA 4GCNA 3Q9NC 4MBGA 3SFXA 3NQPA 1H6PA 3UKUG 1HFAA 3CSFA 4YDYA 2OEVA 1OWOA 1ELKA 5CMWA 4FA6A 2CFUA 4I2ZA 1FPPA 4EZKA 2EQXA 3KD7A 3CHOA 5HS0A 4YDOA 3JCKC 3AAAC 3ZVVA 1IQUA 2P2CP 1HH8A 4JHRA 2IQCA 2CG2A 3U9WA 4CT0A 4GTTA 3CSTA 2BEDA 3Q78A 4IYPA 4WNDA 3UM2A 5DBKA 3NB2A 4NACA 2R5SA 4JB8P 1V55E 2IO3C 3ABKE 3HXCA 1TEZA 1S70B 5G05C 5LFAA 2V4LA 1NA0A 3LXUX 3PVLA 4HVBA 2XS1A 4EZLA 2E2EA 2YHCA 2ETCA 3B7UX 3SZ7A 3U4TA 3T8MA 4I1OB 4XIFA 3FTWA 2C2LA 4HRNA 3NBNB 4DI4A 1E8XA 4MLPA 5BUZA 3QJZA 3ULEG 3BEEA 5KJLA 3B7TA 3LPZA 3Q49B 4EPZA 1TN7A 2VSNA 4UWLA 4HLEA 2WVIA 1KT1A 4N2QA 4GTVA 3G2SA 2KC7A 3ZYLA 2EIJE 3D9LA 5G05J 1N4QA 2KCVA 1ZB1A 3AG1E 1FT2A 3QDNA 5AQAA 2J4DA 4GA1A 4IRUA 2WQ6A 2F8YA 1SZ9A 3DWLG 3ZU7B 1E7VA 3Q79A 2LAHA 4J8YA 1SW6A 3UM1A 4YNDA 3ASNE 3ZXPA 4AY6A 5AJLA 5E75A 3CVWA 4URKA 3TL5A 4YVOA 3CGHA 1IKND 4GTSA 4WUYA 3D9IA 4UQZA 5BXUA 2CG3A 4L7TA 3QWWA 4CRWA 5BXOA 3UXGA 5ARGA 1MX4A 1IQRA 5EX3A 1BU9A 4PUCA 4P29A 2J08A 3L54A 3JQ0A 3HVEA 1UW4B 3CHQA 2BUGA 3GZSA 4MS6A 2FI7A 2H6IA 3CVQA 1O1RA 1Y6IA 5FINA 2ONDA 3L17A 3SD5A 5AAOA 4ZFHA 4J7WA 4U8YD 4GZCA 3LJ3A 3EDTB 4CGWA 1EDUA 3FUHA 4BT9A 3AG4E 3OAWA 4JZYA 1FVHA 2V8SE 4JL0A 4XKBA 2A5EA 1TNUA 3S7JA 2P9SG 4ME2A 3ZPJA 1D8EA 3UTMA 1E96B 4BEPA 4U04A 2WMNA 1X81A 4EECA 1TNZA 4RG9A 4BWRA 3TG4A 5FQ7A 3ASGA 4HBDA 2H6HA 3JQ1A 2WPVA 2KATA 3I3NA 1KPSB 1IHGA 4XZ4A 1NL4A 5C1DA 3CHSA 3ZUVB 2DVWA 2P9LG 3SBSA 3MV2B 3E4BA 1W3BA 3B7SA 3FH5A 3J5QB 3ZHEA 2V5QC 1K1AA 4K5AB 2WQ7A 3G2VA 4J6IA 4JA7A 2PL2A 4CDRA 3Q7AA 4M7CA 3R7RA 4F7AA 1IYGA 3K9IA 4ILHB 5AIJA 3C5RA 2LO6A 4L2YA 4BX9A 5FT9A 3UI2A 2QYUA 4PS7A 2GW1A 1ELRA 5BPPA 5CRVA 4H7XA 3ZFWA 3EHQA 3E32A 2VSXE 2OCCE 2XEEA 3LVQE 4TXRA 4I17A 3PZ4A 5ENSD 4F1PA 3HXBA 3FEYA 5KBAA 4AY5A 2YINA 5EKQD 1WG0A 3Q47B 3RRUA 3UX4A 3LJNA 2P9IG 4A3VA 3I5PA 5KNGA 3APDA 2DZOA 3W9FA 1YA0A 2RG8A 2DZNA 3R9MA 3HIZA 5ARFA 5KJMA 3D9KA 5G2NA 5JHBA 3CV0A 3Q9UC 2PNNA 4R7LA 5A6CA 2DBAA 2BF0X 2HE0A 4KBQA 5CEAA 2V5FA 4JW1A 4I1AA 3FU3A 3PNTB 4DLOA 1MZCA 1WM5A 5FQ8A 4G11A 3BQOA 3R9AB 4LG6A 1HS6A 1P5QA 3ML9A 4Y6CA 3FWVA 4FLHA 3EHMA 3D9HA 4E85A 4N5CA 1Q2ZA 5CEDB 2HO1A 1HG5A 4U95D 4I9EA 3MZLB 5JJTA 1JCQA 5FQ4A 2XEVA 4UWFA 4CEMA 3BG0B 1EPUA 1JCSA 4NIKA 4GMLA 5LCWC 2PQRA 5ENOD 5EIBE 3ZYQA 2H6GA 4RLYA 2IO2C 1UN9A 3UQ3A 3ZKJA 1OCOE 3TWUA 3CVNA 4UUCA 4HNAD 3FUDA 4JPSA 5CRUA 1L5JA 2R03A 4PS8A 2XRYA 3VLDA 1N95A 4LEUA 3LEWA 4PS3A 3QWVA 1NFIE 1LTXA 5CHEE 3B7BA 1NZNA 4OAUC 3VLFA 4B93B 1RW2A 1TNOA 2J09A 3ZYMA 3D9OA 3GYZA 4G1TA 2ZGDA 5FWQA 4B94A 5B1BE 4JD2G 4HRLA 4KVOA 3D9PA 3FEXA 1XGWA 2VSYA 4TXPA 2YNQA 1SA5A 2NC9A 2A4ZA 2GRRB 3RRNB 4JHKA 3VLEA 4Z68A 3CVVA 2P9NG 3L22A 1N94A 4TXQA 4DK5A 3DSVA 2WXFA 1EF1C 3FU6A 3LDZA 1V54E 4LUNU 2LAIA 3S7DA 1INZA 3ABME 4ZHBA 3AS4A 3IV0A 3FTYA 5D0OD 3HDXA 2OV8A 5FQ6A 1OWPA 3DSTA 1E90A 4GTRA 4A1GA 2IONA 2MYOA 4TUMA 3NZUA 4L23A 2Y1LE 2LSVA 3UIPC 4G8KA 2LNIA 5ITZF 4HQDA 1UJKA 2MHKA 3UPVA 1O1TA 2B6CA 2OVFA 1BLXB 3FUJA 4EBAG 2ZXWE 3CQGB 4HOSA 3JXJA 2OOEA 4HRMB 4F3VA 1DCQA 5AARA 4K5BA 2P9KG 1FT1A 5B1AE 4GZ6A 2F37A 3GZ1A 2XEHA 3BG1B 3L16A 4XX5A 3MGBA 4XI9A 4BERA 4NRHB 3FU5A 4HXIA 4UI9K 2I1KA 4Y6WA 3PH0C 4HFGA 3URZA 2IU1A 3L9TA 2CFZA 5A23A 2V0PA 1YCSB 5BT1A 3UUXA 3B7RL 3LY7A 2KBXA 5ENTD 5E76A 4U0SA 1QYMA 2LXLA 2UWJG 1HZ4A 3V2OA 4XKCA 4O1OA 2HM8A 5LOZA 3AJIA 1UOHA 3CQCB 4HOUA 2QFCA 3UMVA 5DIZA 1B89A 1TN6A 5ANRA 4U96D 3B95A 3Q7FA 4H7YA 3ONKA 3SHFA 2ZISA 3AS8A 3AG3E 4UWHA 1IXVA 5FZRA 1HO8A 3DBSA 4WNEA 3QARA 1PAQA 4EBAA 2C0MA 4I6EA 4XI0A 4FU3A 2FO1E 4OVUA 3APCA 2XPIA 4F1SA 4B89A 1PC2A 2X6KA 4LNUD 3MV3B 2WQHA 1LF8A 4OYSA 3QC1A 2NXPA 1N9AA 5ANLA 3WXXA 4HI8A 3ENEA 1BI7B 3FU0A 4EHMA 2WXKA 3CK8A 3CLJA 3DSWA 4GPMA 3GW4A 3PE4A 3FTSA 5LP0A 5HI7A 3HYMB 3L82A 1E8ZA 3D9JA 3IBEA 3VTYA 1S0PA 4BETA 5EX0A 5BNWA 2LXMA 3HVEB 4FHKA 5EILA 2WXGA 1JUQA 3T5VA 1TNBA 3RJVA 4GZDA 4F6RD 3ZW3A 4HS2A 3PE3A 2WM9A 5KJKA 2WXNA 2FEZA 4UI9C 1U3DA 2UY1A 3TJPA 3JXIA 2P9UG 4N5QA 4AVXA 1QNFA 2MOWA 4G8LA 5FIOA 4WNGA 3B13A 3C3RA 2XGOA 4RVBA 3ZIMA 5AYWD 2ZGGA 1H6KA 3DSUA 3PS6A 2Y3AA 1WY6A 4GCOA 3E30A 3U3WA 1OXJA 5J08A 1BPOA 4QQIA 3TWRA 3NAWA 5EIDA 2BKGA 2ZU6B 3AG2E 4MKTA 4GMRA 1H2UA 3OXFA 4KZCA 2I9CA 2VYIA 3JUIA 1KT0A 4DI3A 2AXZA 2L0TB 1NI1A 4G2VA 3T9KA 1OUVA 1G3NB 1JPLA 3PREA 3DSXA 3ASHA 2X6FA 2XRZA 4X8QA 3FULA 1E7UA 2XGMA 2VGEA 5AENA 4CCAA 5EYLA 2GROB 2IJGX 3DRAA 3TWVA 4YDWA 3CIAA 3FHEA 2FBNA 2XCCA 5EYPF 3DEPA 4N39A 4MRUA 3CKCA 3FUKA 4APOA 1MHQA 3Q5MA 3WG7E 5EN5D 1Z3YA 3SFYA 3PZ3A 3FY4A 4M3OA 3W9GA 3SY2A 4BESA 4HOTA 2C0LA 3CR3A 2AXVA 4ATZD 3KAEA 3R7QA 4AV7A 4AIFA 2PZIA 4KXKB 4A55A 3U66A 3ISMC 1N4SA 1YMPA 2KZTA 5ENNA 1IHBA 2KXPC 4J8DA 2F0YA 4DUIA 1KZPA 3C3OA 1ZBPA 4L9PA 1O5MA 4FC8A 3V2XA 1Z3XA 5CECB 4HORA 3P1UA 4KYOB 2VGXA 3SQVA 5LX8A 3KEZA 3FH8A 4GTOA 2WXPA 3TWSA 4AJWA 3ASOE 4KVMA 2EILE 2QC9A 4CGVA 3ULYA 4IULA 3FUEA 4V3IA 4FADA 3CHMA 3APFA 1KLXA 4A63B 5AN8A 4GPKA 1X5BA 2MRIA 3DPYA 3TXNA 3D9NA 2WB2A 3MA5A 2LUHA 4GA2A 4LCTA 2I1JA 5KCMA 4GTQA 5BW8C 3IHYA 1H19A 4DX5D 3HXEA 4DX2A 1AP7A 4ILIA 2FF4A 5KNHD 3J5PA 4I43A 4IN3B 4CDMA 4GAAA 3BU8A 3SFZA 2J4BA 4PDXA 3IEGA 3PUKA 3ZYKA 3L08A 3HG0D 4RSYA 4JXTA 4U0UA 2FO7A 2I2OA 1N54A 5D66A 2IEJA 4RQIA 1WDYA 4U63A 2JABA 2VJ8A 1N52A 4EZJA 3FDHA 3PZDA 3ESKA 1TYQG 3T5XA 5AQ7A 1MX6A 3ZXSA 5G55A 4A3TA 2XPYA 1JWFA 3ASFA 1YYHA 3V79K 3MKQA 2R05A 4DJAA 3S7FA 4OVVA 3MJWA 3IKOB 4TUUA 1N11A 5CBNA 3ZN3A 3HXDA 3O48A 3UM0A 2HR2A 3TWXA 4FJYA 3TAXA 4WAFA 3RKVA 1KZOA 1HX8A 3CEQA 2X3MA 4ILGA 4J8SA 3LYAA 2V4HC 2VQ2A 2GRQB 1MYOA 2WXQA 3RK6A 3L13A 5LCWJ 3CK7A 1N4PA 2XZDG 3FTVA 2A5UA 2DYRE 3T8KA 3HRAA 3QWPA 3PEUB 4GA0A 4TV3A 3ASDA 3CK9A 3SNXA 5JJ6A 1U3CA 2RD0A 3ZGQA 5C2YA 2VSOE 3LY8A 4WWNA 3UINC 3FTXA 2VTBA 1K8KG 3IHVA 5KWDA 3C72A 3S2AA 4K03A 2LSUA 4B0ZA 4W9RA 4GTPA 4I6JA 3FTZA 5ENRD 2EIME 4ATGA 4BY6A 4G23A 2Y4UA 3EIJA 3AS5A 3E33A 2I6HA 4XE0A 2CHXA 4APFA 4B8CB 2L6BA 3NOCD 5FJYA 3FH7A 2AVPA 5FZQA 3OXGA 4J8EA 3D3MA 3CHRA 2GRNB 4C9BB 2KM4A 4GYWA 4JA9A 2Y4TA 2WMOA 2X6HA 3ESLA 1Z5SC 4G25A 4JHJA 2WXMA 4HB5A 1UN8A 4DX1A 4I2WA 2ETBA 4CT4A
chains in the Genus database with same CATH topology
3ASNE 5B1AE 2Y69E 2EIJE 2DYSE 3WG7E 3ABME 2OCCE 3AG1E 1OCCE 2DYRE 1OCRE 1OCOE 3X2QE 2ZXWE 2EIKE 5IY5E 1OCZE 3ASOE 2EILE 2EINE 1V55E 3ABKE 3ABLE 5B3SE 3AG3E 5B1BE 3AG4E 3AG2E 1V54E 2EIME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASN E;  5B1A E;  2Y69 E;  2EIJ E;  2DYS E;  3WG7 E;  3ABM E;  2OCC E;  3AG1 E;  1OCC E;  2DYR E;  1OCR E;  1OCO E;  3X2Q E;  2ZXW E;  2EIK E;  5IY5 E;  1OCZ E;  3ASO E;  2EIL E;  2EIN E;  1V55 E;  3ABK E;  3ABL E;  5B3S E;  3AG3 E;  5B1B E;  3AG4 E;  3AG2 E;  1V54 E;  2EIM E; 
#chains in the Genus database with same CATH topology
 4AEZ C;  3DPD A;  2IFU A;  1DNP A;  3QB2 A;  1QBQ A;  1S63 A;  4L2L A;  3G2W A;  1SA4 A;  3MYV A;  3PZ1 A;  4I1M A;  1MJ0 A;  1TN8 A;  1EYH A;  1UG3 A;  4DRX E;  4L1B A;  5IY5 E;  4KT6 B;  1N4R A;  2ZIR A;  2EIN E;  3FP3 A;  2RKK A;  1O1S A;  4N3B A;  1E8W A;  3RIB A;  4WWP A;  4ABN A;  4FUL A;  4WWO A;  3RAU A;  1MX2 A;  1N0Q A;  3FFL A;  4LSZ E;  2F8X K;  4CYM D;  2J9Q A;  2XGS A;  3PNL B;  1OWL A;  3DSS A;  1D8D A;  1NP7 A;  3IXE A;  3SGH A;  4HI9 A;  1SVX A;  3CHP A;  3EHR A;  2WXR A;  2ETA A;  3EJN A;  1TJC A;  2WXO A;  3Q75 A;  4N2S A;  3PEV B;  3EU9 A;  3KSL A;  3ZRH A;  4UWG A;  1ELW A;  2X6J A;  3AU5 A;  3F6Q A;  3LS8 A;  2R02 A;  3FUI A;  4GTM A;  1HXI A;  3CKB A;  2QZA A;  3O4Z A;  1OCC E;  3RRM B;  4O1P A;  3ZNG A;  2Q7F A;  3C3Q A;  3X2Q E;  3QAQ A;  2PM6 A;  5FZS A;  4K5C A;  3QKY A;  2DCP A;  3V30 A;  3QK0 A;  5H7P A;  1BD8 A;  4AP2 A;  4DLQ A;  1FCH A;  1H0A A;  2AJA A;  4G24 A;  1HG2 A;  1XNF A;  2XQ0 A;  2L6J A;  1OWM A;  3E37 A;  3ZEF A;  3V31 A;  3KSQ A;  3TWT A;  4ANU A;  4JVS A;  3Q4A B;  3HXF A;  4N3C A;  2QY7 A;  5ENQ D;  2HYZ A;  5JA4 D;  3CVX A;  3GZ2 A;  3CVL A;  1LD7 A;  3FUF A;  4PH4 B;  3SI5 A;  4LNB A;  3G2U A;  2XEN A;  2WXL A;  4DX6 D;  2KCL A;  3DXM G;  3JUE A;  2UY1 B;  4GYY A;  2J8S D;  5T3R A;  5AQB A;  3DEO A;  4D10 C;  4FLB A;  1HF8 A;  4WNF A;  4AXH A;  2WXI A;  5BV1 A;  3ML8 A;  4AOF A;  3EUV A;  3OXL A;  4C0E A;  4BX8 A;  2XHE A;  1TR4 A;  3TWQ A;  1A17 A;  2X38 A;  3LY9 A;  5JJ7 A;  2OEW A;  4BT8 A;  1K3Z D;  3DXK G;  1TJF A;  3QOU A;  4J0U A;  2L0I A;  4KZ0 A;  3EU5 A;  3BUA A;  3SBT B;  2X6I A;  4BTA A;  4Q94 A;  3L6A A;  4UI9 J;  3KEA A;  4GZ3 A;  4GB9 A;  5D2M C;  1DC2 A;  2AXU A;  3N71 A;  3LKU A;  2DIW A;  2KCK A;  3I4G A;  5ENP D;  2WXJ A;  3ULQ A;  4ACL A;  5FTP A;  2H6F A;  2E0I A;  3E34 A;  3TWW A;  1JCR A;  1NA3 A;  5HQ8 A;  3ZHE B;  2JEK A;  4ANX A;  4BSZ B;  2Y69 E;  4XEI G;  2NYJ A;  1JWG A;  2PM7 A;  2OVB A;  2L9B A;  5AJD A;  4HOQ A;  3OTN A;  1U2V G;  3Q73 A;  3TGO A;  3Q15 A;  4GU5 A;  4E6H A;  1N0R A;  4I6G A;  5CCL A;  3PZ2 A;  4U8V D;  5JHA A;  2YQ8 A;  4F53 A;  4YVQ C;  4GYO A;  1RZ4 A;  4AM9 A;  3RU0 A;  3UT7 A;  3UIO C;  1OY3 D;  2B0O E;  1Z6T A;  3RSE G;  3U64 A;  5CBO A;  1PY1 A;  4Q69 A;  2XS8 A;  4ACK A;  5JMN D;  2DWZ A;  1QQE A;  4O6F A;  4B8A A;  1ZU2 A;  4U07 A;  2KZT B;  4YDE A;  2PQN A;  1GW6 A;  3FUM A;  5AQ9 A;  1K1B A;  3MX3 A;  4CZ2 D;  1S64 A;  2NSZ A;  5CER B;  2J49 A;  3CVU A;  2VGX B;  2XCB A;  1DCE A;  2RFM A;  4JEH A;  3QNK A;  4O60 A;  1Y8M A;  4ANV A;  3NZS A;  4ANW A;  4G26 A;  1WAO 1;  2GGF A;  2GRP B;  1HU3 A;  3LCA A;  1D9S A;  4HLL A;  2ILR A;  5G04 C;  4QFV A;  4N3A A;  2FUL A;  4FHJ A;  4UQY A;  5EDS A;  1TNY A;  3I4R B;  5M72 A;  3RO2 A;  2BTD A;  3KS2 A;  1E8Y A;  4RG6 A;  1H2T C;  2QYJ A;  1SQM A;  2IF4 A;  4UWK A;  2XPZ A;  4U7E B;  5T8I A;  1DVP A;  3C98 A;  4GMJ A;  1AWC B;  4LRZ A;  2CHW A;  1OCZ E;  3UM3 A;  2AWI A;  2CHZ A;  3PRZ A;  5HRY A;  3UT8 A;  4UQX A;  3LVR E;  4BSX A;  5J90 A;  4C48 B;  1OWN A;  3EHN A;  5KJN A;  2JLB A;  3D9M A;  3EIQ C;  4DX7 D;  1A5E A;  5D0Q D;  4JEU A;  4Q96 A;  4I9C A;  2EIK E;  4K0R A;  4JC8 A;  1OT8 A;  2R2L A;  1LD8 A;  5G04 J;  3FUN A;  2BKK B;  1FVF A;  4A1S A;  3RO3 A;  5HKP A;  3NF1 A;  4LNG A;  3FTU A;  2YHE A;  4LER A;  2DYS E;  4NUR A;  1H6O A;  4FP7 A;  2Y0B G;  3MKQ B;  3CVP A;  3MCX A;  2RFA A;  3ONL A;  3NOG D;  3MEK A;  2M63 A;  2WXH A;  2R59 A;  5B3S E;  4GZ5 A;  4BFR A;  3CVY A;  3PUJ A;  5CCM A;  1SZA A;  3UKR G;  5BV0 A;  4TRQ A;  4EQF A;  4NQ0 A;  2J07 A;  4J8F A;  5A7D B;  3JYS A;  2P58 C;  3PDN A;  5CMY A;  2AW6 A;  4U0Z A;  4DPR A;  4BTB A;  3ABL E;  1BI8 B;  2IY0 C;  1HE8 A;  1VDY A;  4FJZ A;  4U8H A;  3UT4 A;  4C0M A;  3TG5 A;  1UJJ A;  3HHM A;  2GRM A;  2IOS A;  3G2T A;  3VTX A;  1QZ2 A;  1H2V C;  4OAV B;  3AU4 A;  3MKR A;  2XZT G;  3TXM A;  3SF4 A;  4CDN A;  2R17 C;  4KMO A;  3SO8 A;  2IOL A;  5T4Y A;  1MQS A;  2GRL A;  3S7B A;  2VGY A;  2P9P G;  2VTB B;  1OCR E;  3P2B A;  4GCN A;  3Q9N C;  4MBG A;  3SFX A;  3NQP A;  1H6P A;  3UKU G;  1HFA A;  3CSF A;  4YDY A;  2OEV A;  1OWO A;  1ELK A;  5CMW A;  4FA6 A;  2CFU A;  4I2Z A;  1FPP A;  4EZK A;  2EQX A;  3KD7 A;  3CHO A;  5HS0 A;  4YDO A;  3JCK C;  3AAA C;  3ZVV A;  1IQU A;  2P2C P;  1HH8 A;  4JHR A;  2IQC A;  2CG2 A;  3U9W A;  4CT0 A;  4GTT A;  3CST A;  2BED A;  3Q78 A;  4IYP A;  4WND A;  3UM2 A;  5DBK A;  3NB2 A;  4NAC A;  2R5S A;  4JB8 P;  1V55 E;  2IO3 C;  3ABK E;  3HXC A;  1TEZ A;  1S70 B;  5G05 C;  5LFA A;  2V4L A;  1NA0 A;  3LXU X;  3PVL A;  4HVB A;  2XS1 A;  4EZL A;  2E2E A;  2YHC A;  2ETC A;  3B7U X;  3SZ7 A;  3U4T A;  3T8M A;  4I1O B;  4XIF A;  3FTW A;  2C2L A;  4HRN A;  3NBN B;  4DI4 A;  1E8X A;  4MLP A;  5BUZ A;  3QJZ A;  3ULE G;  3BEE A;  5KJL A;  3B7T A;  3LPZ A;  3Q49 B;  4EPZ A;  1TN7 A;  2VSN A;  4UWL A;  4HLE A;  2WVI A;  1KT1 A;  4N2Q A;  4GTV A;  3G2S A;  2KC7 A;  3ZYL A;  2EIJ E;  3D9L A;  5G05 J;  1N4Q A;  2KCV A;  1ZB1 A;  3AG1 E;  1FT2 A;  3QDN A;  5AQA A;  2J4D A;  4GA1 A;  4IRU A;  2WQ6 A;  2F8Y A;  1SZ9 A;  3DWL G;  3ZU7 B;  1E7V A;  3Q79 A;  2LAH A;  4J8Y A;  1SW6 A;  3UM1 A;  4YND A;  3ASN E;  3ZXP A;  4AY6 A;  5AJL A;  5E75 A;  3CVW A;  4URK A;  3TL5 A;  4YVO A;  3CGH A;  1IKN D;  4GTS A;  4WUY A;  3D9I A;  4UQZ A;  5BXU A;  2CG3 A;  4L7T A;  3QWW A;  4CRW A;  5BXO A;  3UXG A;  5ARG A;  1MX4 A;  1IQR A;  5EX3 A;  1BU9 A;  4PUC A;  4P29 A;  2J08 A;  3L54 A;  3JQ0 A;  3HVE A;  1UW4 B;  3CHQ A;  2BUG A;  3GZS A;  4MS6 A;  2FI7 A;  2H6I A;  3CVQ A;  1O1R A;  1Y6I A;  5FIN A;  2OND A;  3L17 A;  3SD5 A;  5AAO A;  4ZFH A;  4J7W A;  4U8Y D;  4GZC A;  3LJ3 A;  3EDT B;  4CGW A;  1EDU A;  3FUH A;  4BT9 A;  3AG4 E;  3OAW A;  4JZY A;  1FVH A;  2V8S E;  4JL0 A;  4XKB A;  2A5E A;  1TNU A;  3S7J A;  2P9S G;  4ME2 A;  3ZPJ A;  1D8E A;  3UTM A;  1E96 B;  4BEP A;  4U04 A;  2WMN A;  1X81 A;  4EEC A;  1TNZ A;  4RG9 A;  4BWR A;  3TG4 A;  5FQ7 A;  3ASG A;  4HBD A;  2H6H A;  3JQ1 A;  2WPV A;  2KAT A;  3I3N A;  1KPS B;  1IHG A;  4XZ4 A;  1NL4 A;  5C1D A;  3CHS A;  3ZUV B;  2DVW A;  2P9L G;  3SBS A;  3MV2 B;  3E4B A;  1W3B A;  3B7S A;  3FH5 A;  3J5Q B;  3ZHE A;  2V5Q C;  1K1A A;  4K5A B;  2WQ7 A;  3G2V A;  4J6I A;  4JA7 A;  2PL2 A;  4CDR A;  3Q7A A;  4M7C A;  3R7R A;  4F7A A;  1IYG A;  3K9I A;  4ILH B;  5AIJ A;  3C5R A;  2LO6 A;  4L2Y A;  4BX9 A;  5FT9 A;  3UI2 A;  2QYU A;  4PS7 A;  2GW1 A;  1ELR A;  5BPP A;  5CRV A;  4H7X A;  3ZFW A;  3EHQ A;  3E32 A;  2VSX E;  2OCC E;  2XEE A;  3LVQ E;  4TXR A;  4I17 A;  3PZ4 A;  5ENS D;  4F1P A;  3HXB A;  3FEY A;  5KBA A;  4AY5 A;  2YIN A;  5EKQ D;  1WG0 A;  3Q47 B;  3RRU A;  3UX4 A;  3LJN A;  2P9I G;  4A3V A;  3I5P A;  5KNG A;  3APD A;  2DZO A;  3W9F A;  1YA0 A;  2RG8 A;  2DZN A;  3R9M A;  3HIZ A;  5ARF A;  5KJM A;  3D9K A;  5G2N A;  5JHB A;  3CV0 A;  3Q9U C;  2PNN A;  4R7L A;  5A6C A;  2DBA A;  2BF0 X;  2HE0 A;  4KBQ A;  5CEA A;  2V5F A;  4JW1 A;  4I1A A;  3FU3 A;  3PNT B;  4DLO A;  1MZC A;  1WM5 A;  5FQ8 A;  4G11 A;  3BQO A;  3R9A B;  4LG6 A;  1HS6 A;  1P5Q A;  3ML9 A;  4Y6C A;  3FWV A;  4FLH A;  3EHM A;  3D9H A;  4E85 A;  4N5C A;  1Q2Z A;  5CED B;  2HO1 A;  1HG5 A;  4U95 D;  4I9E A;  3MZL B;  5JJT A;  1JCQ A;  5FQ4 A;  2XEV A;  4UWF A;  4CEM A;  3BG0 B;  1EPU A;  1JCS A;  4NIK A;  4GML A;  5LCW C;  2PQR A;  5ENO D;  5EIB E;  3ZYQ A;  2H6G A;  4RLY A;  2IO2 C;  1UN9 A;  3UQ3 A;  3ZKJ A;  1OCO E;  3TWU A;  3CVN A;  4UUC A;  4HNA D;  3FUD A;  4JPS A;  5CRU A;  1L5J A;  2R03 A;  4PS8 A;  2XRY A;  3VLD A;  1N95 A;  4LEU A;  3LEW A;  4PS3 A;  3QWV A;  1NFI E;  1LTX A;  5CHE E;  3B7B A;  1NZN A;  4OAU C;  3VLF A;  4B93 B;  1RW2 A;  1TNO A;  2J09 A;  3ZYM A;  3D9O A;  3GYZ A;  4G1T A;  2ZGD A;  5FWQ A;  4B94 A;  5B1B E;  4JD2 G;  4HRL A;  4KVO A;  3D9P A;  3FEX A;  1XGW A;  2VSY A;  4TXP A;  2YNQ A;  1SA5 A;  2NC9 A;  2A4Z A;  2GRR B;  3RRN B;  4JHK A;  3VLE A;  4Z68 A;  3CVV A;  2P9N G;  3L22 A;  1N94 A;  4TXQ A;  4DK5 A;  3DSV A;  2WXF A;  1EF1 C;  3FU6 A;  3LDZ A;  1V54 E;  4LUN U;  2LAI A;  3S7D A;  1INZ A;  3ABM E;  4ZHB A;  3AS4 A;  3IV0 A;  3FTY A;  5D0O D;  3HDX A;  2OV8 A;  5FQ6 A;  1OWP A;  3DST A;  1E90 A;  4GTR A;  4A1G A;  2ION A;  2MYO A;  4TUM A;  3NZU A;  4L23 A;  2Y1L E;  2LSV A;  3UIP C;  4G8K A;  2LNI A;  5ITZ F;  4HQD A;  1UJK A;  2MHK A;  3UPV A;  1O1T A;  2B6C A;  2OVF A;  1BLX B;  3FUJ A;  4EBA G;  2ZXW E;  3CQG B;  4HOS A;  3JXJ A;  2OOE A;  4HRM B;  4F3V A;  1DCQ A;  5AAR A;  4K5B A;  2P9K G;  1FT1 A;  5B1A E;  4GZ6 A;  2F37 A;  3GZ1 A;  2XEH A;  3BG1 B;  3L16 A;  4XX5 A;  3MGB A;  4XI9 A;  4BER A;  4NRH B;  3FU5 A;  4HXI A;  4UI9 K;  2I1K A;  4Y6W A;  3PH0 C;  4HFG A;  3URZ A;  2IU1 A;  3L9T A;  2CFZ A;  5A23 A;  2V0P A;  1YCS B;  5BT1 A;  3UUX A;  3B7R L;  3LY7 A;  2KBX A;  5ENT D;  5E76 A;  4U0S A;  1QYM A;  2LXL A;  2UWJ G;  1HZ4 A;  3V2O A;  4XKC A;  4O1O A;  2HM8 A;  5LOZ A;  3AJI A;  1UOH A;  3CQC B;  4HOU A;  2QFC A;  3UMV A;  5DIZ A;  1B89 A;  1TN6 A;  5ANR A;  4U96 D;  3B95 A;  3Q7F A;  4H7Y A;  3ONK A;  3SHF A;  2ZIS A;  3AS8 A;  3AG3 E;  4UWH A;  1IXV A;  5FZR A;  1HO8 A;  3DBS A;  4WNE A;  3QAR A;  1PAQ A;  4EBA A;  2C0M A;  4I6E A;  4XI0 A;  4FU3 A;  2FO1 E;  4OVU A;  3APC A;  2XPI A;  4F1S A;  4B89 A;  1PC2 A;  2X6K A;  4LNU D;  3MV3 B;  2WQH A;  1LF8 A;  4OYS A;  3QC1 A;  2NXP A;  1N9A A;  5ANL A;  3WXX A;  4HI8 A;  3ENE A;  1BI7 B;  3FU0 A;  4EHM A;  2WXK A;  3CK8 A;  3CLJ A;  3DSW A;  4GPM A;  3GW4 A;  3PE4 A;  3FTS A;  5LP0 A;  5HI7 A;  3HYM B;  3L82 A;  1E8Z A;  3D9J A;  3IBE A;  3VTY A;  1S0P A;  4BET A;  5EX0 A;  5BNW A;  2LXM A;  3HVE B;  4FHK A;  5EIL A;  2WXG A;  1JUQ A;  3T5V A;  1TNB A;  3RJV A;  4GZD A;  4F6R D;  3ZW3 A;  4HS2 A;  3PE3 A;  2WM9 A;  5KJK A;  2WXN A;  2FEZ A;  4UI9 C;  1U3D A;  2UY1 A;  3TJP A;  3JXI A;  2P9U G;  4N5Q A;  4AVX A;  1QNF A;  2MOW A;  4G8L A;  5FIO A;  4WNG A;  3B13 A;  3C3R A;  2XGO A;  4RVB A;  3ZIM A;  5AYW D;  2ZGG A;  1H6K A;  3DSU A;  3PS6 A;  2Y3A A;  1WY6 A;  4GCO A;  3E30 A;  3U3W A;  1OXJ A;  5J08 A;  1BPO A;  4QQI A;  3TWR A;  3NAW A;  5EID A;  2BKG A;  2ZU6 B;  3AG2 E;  4MKT A;  4GMR A;  1H2U A;  3OXF A;  4KZC A;  2I9C A;  2VYI A;  3JUI A;  1KT0 A;  4DI3 A;  2AXZ A;  2L0T B;  1NI1 A;  4G2V A;  3T9K A;  1OUV A;  1G3N B;  1JPL A;  3PRE A;  3DSX A;  3ASH A;  2X6F A;  2XRZ A;  4X8Q A;  3FUL A;  1E7U A;  2XGM A;  2VGE A;  5AEN A;  4CCA A;  5EYL A;  2GRO B;  2IJG X;  3DRA A;  3TWV A;  4YDW A;  3CIA A;  3FHE A;  2FBN A;  2XCC A;  5EYP F;  3DEP A;  4N39 A;  4MRU A;  3CKC A;  3FUK A;  4APO A;  1MHQ A;  3Q5M A;  3WG7 E;  5EN5 D;  1Z3Y A;  3SFY A;  3PZ3 A;  3FY4 A;  4M3O A;  3W9G A;  3SY2 A;  4BES A;  4HOT A;  2C0L A;  3CR3 A;  2AXV A;  4ATZ D;  3KAE A;  3R7Q A;  4AV7 A;  4AIF A;  2PZI A;  4KXK B;  4A55 A;  3U66 A;  3ISM C;  1N4S A;  1YMP A;  2KZT A;  5ENN A;  1IHB A;  2KXP C;  4J8D A;  2F0Y A;  4DUI A;  1KZP A;  3C3O A;  1ZBP A;  4L9P A;  1O5M A;  4FC8 A;  3V2X A;  1Z3X A;  5CEC B;  4HOR A;  3P1U A;  4KYO B;  2VGX A;  3SQV A;  5LX8 A;  3KEZ A;  3FH8 A;  4GTO A;  2WXP A;  3TWS A;  4AJW A;  3ASO E;  4KVM A;  2EIL E;  2QC9 A;  4CGV A;  3ULY A;  4IUL A;  3FUE A;  4V3I A;  4FAD A;  3CHM A;  3APF A;  1KLX A;  4A63 B;  5AN8 A;  4GPK A;  1X5B A;  2MRI A;  3DPY A;  3TXN A;  3D9N A;  2WB2 A;  3MA5 A;  2LUH A;  4GA2 A;  4LCT A;  2I1J A;  5KCM A;  4GTQ A;  5BW8 C;  3IHY A;  1H19 A;  4DX5 D;  3HXE A;  4DX2 A;  1AP7 A;  4ILI A;  2FF4 A;  5KNH D;  3J5P A;  4I43 A;  4IN3 B;  4CDM A;  4GAA A;  3BU8 A;  3SFZ A;  2J4B A;  4PDX A;  3IEG A;  3PUK A;  3ZYK A;  3L08 A;  3HG0 D;  4RSY A;  4JXT A;  4U0U A;  2FO7 A;  2I2O A;  1N54 A;  5D66 A;  2IEJ A;  4RQI A;  1WDY A;  4U63 A;  2JAB A;  2VJ8 A;  1N52 A;  4EZJ A;  3FDH A;  3PZD A;  3ESK A;  1TYQ G;  3T5X A;  5AQ7 A;  1MX6 A;  3ZXS A;  5G55 A;  4A3T A;  2XPY A;  1JWF A;  3ASF A;  1YYH A;  3V79 K;  3MKQ A;  2R05 A;  4DJA A;  3S7F A;  4OVV A;  3MJW A;  3IKO B;  4TUU A;  1N11 A;  5CBN A;  3ZN3 A;  3HXD A;  3O48 A;  3UM0 A;  2HR2 A;  3TWX A;  4FJY A;  3TAX A;  4WAF A;  3RKV A;  1KZO A;  1HX8 A;  3CEQ A;  2X3M A;  4ILG A;  4J8S A;  3LYA A;  2V4H C;  2VQ2 A;  2GRQ B;  1MYO A;  2WXQ A;  3RK6 A;  3L13 A;  5LCW J;  3CK7 A;  1N4P A;  2XZD G;  3FTV A;  2A5U A;  2DYR E;  3T8K A;  3HRA A;  3QWP A;  3PEU B;  4GA0 A;  4TV3 A;  3ASD A;  3CK9 A;  3SNX A;  5JJ6 A;  1U3C A;  2RD0 A;  3ZGQ A;  5C2Y A;  2VSO E;  3LY8 A;  4WWN A;  3UIN C;  3FTX A;  2VTB A;  1K8K G;  3IHV A;  5KWD A;  3C72 A;  3S2A A;  4K03 A;  2LSU A;  4B0Z A;  4W9R A;  4GTP A;  4I6J A;  3FTZ A;  5ENR D;  2EIM E;  4ATG A;  4BY6 A;  4G23 A;  2Y4U A;  3EIJ A;  3AS5 A;  3E33 A;  2I6H A;  4XE0 A;  2CHX A;  4APF A;  4B8C B;  2L6B A;  3NOC D;  5FJY A;  3FH7 A;  2AVP A;  5FZQ A;  3OXG A;  4J8E A;  3D3M A;  3CHR A;  2GRN B;  4C9B B;  2KM4 A;  4GYW A;  4JA9 A;  2Y4T A;  2WMO A;  2X6H A;  3ESL A;  1Z5S C;  4G25 A;  4JHJ A;  2WXM A;  4HB5 A;  1UN8 A;  4DX1 A;  4I2W A;  2ETB A;  4CT4 A; 
#chains in the Genus database with same CATH homology
 3ASN E;  5B1A E;  2Y69 E;  2EIJ E;  2DYS E;  3WG7 E;  3ABM E;  2OCC E;  3AG1 E;  1OCC E;  2DYR E;  1OCR E;  1OCO E;  3X2Q E;  2ZXW E;  2EIK E;  5IY5 E;  1OCZ E;  3ASO E;  2EIL E;  2EIN E;  1V55 E;  3ABK E;  3ABL E;  5B3S E;  3AG3 E;  5B1B E;  3AG4 E;  3AG2 E;  1V54 E;  2EIM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...