1OCOE

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
109
structure length
109
Chain Sequence
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1ocoE00
3ABME 3AG2E 3AG3E 5B1BE 1OCZE 2EIJE 3ABLE 2ZXWE 1V54E 1OCOE 3AG1E 2OCCE 5B1AE 1OCCE 3ASOE 2Y69E 1V55E 2DYRE 3ASNE 5B3SE 3WG7E 2DYSE 1OCRE 2EINE 2EIKE 3AG4E 3ABKE 3X2QE 2EILE 5IY5E 2EIME
chains in the Genus database with same CATH superfamily
4YDWA 5BV0A 4X8QA 3IBEA 3D3MA 3FDHA 3CHQA 1YCSB 3JYSA 2GRLA 1JWFA 3MKRA 2YNQA 5BUZA 2JABA 1H19A 2BEDA 4HLEA 2OV8A 3CVVA 1U3CA 2C0LA 4NRHB 3QWWA 1YA0A 3BG0B 3EUVA 5T3RA 3UM2A 4CT0A 1H6KA 3FFLA 1UJJA 1MYOA 4K5AB 2VGYA 3TWWA 4AY6A 4F53A 5A6CA 4FC8A 4I9EA 5B1BE 1N94A 1N4PA 1SZAA 4HRLA 5ENQD 2NXPA 5KJKA 2DVWA 4GPKA 1ELRA 3VLFA 4ACKA 3UPVA 4DX2A 2A5UA 4L23A 2BF0X 3SBSA 4UWGA 3G2UA 2VTBA 4CGVA 2XHEA 1ZBPA 1S63A 3FUHA 1KZPA 3UT4A 4GTTA 2J49A 3SQVA 2R02A 4OVVA 4ILGA 2I9CA 3I5PA 3G2TA 1JCSA 1ZB1A 1TEZA 4ZFHA 4JL0A 3W9FA 4BX9A 3LJ3A 5T8IA 4HOQA 3NBNB 5EIDA 2KCLA 3PH0C 5FZRA 4NURA 4C9BB 2EINE 3DPDA 3AU5A 2XEHA 3FHEA 4I17A 2XRZA 2J09A 2WQ6A 5AQBA 3CVYA 1HU3A 1B89A 4G23A 2HE0A 3NZSA 5G05J 5JMND 3B7TA 3MKQB 2Y0BG 4P29A 3ZN3A 3J5QB 2ETAA 4GB9A 2DZOA 2DZNA 1TJCA 3TWVA 2B6CA 2VGXA 3Q79A 3DXKG 3OTNA 4J8FA 4CYMD 1HX8A 3JQ1A 4OYSA 2GRQB 3HVEA 1ELWA 4C0EA 1BPOA 3B7UX 4XI9A 3HYMB 4EHMA 2PQRA 2EIME 2WXGA 4LEUA 1HG2A 2EQXA 5EYLA 4UQXA 4J8SA 3PZ4A 3V30A 3FTVA 3I4RB 4N3AA 5EDSA 4GZ5A 5LX8A 1S70B 4UI9K 3K9IA 1EDUA 3PDNA 2ILRA 4DK5A 2I1JA 3T8KA 5AQ9A 1HZ4A 3D9KA 5J90A 4CRWA 3Q9NC 4AVXA 3FU6A 4FU3A 2NSZA 3CVXA 4HI8A 3PE3A 3AAAC 2X6KA 1FCHA 3NQPA 3PZ1A 4E6HA 2VTBB 2LUHA 3E34A 3CQCB 3L16A 3PREA 2ETBA 3FU0A 2HYZA 1E8WA 2R17C 2H6HA 2GROB 4BERA 4YDYA 4L7TA 2LSVA 4GA1A 2RFAA 3Q47B 1SW6A 2FF4A 5CECB 2XS8A 3PNTB 4G25A 4XEIG 2WXOA 2XCCA 2XRYA 4F1PA 2DIWA 4G8KA 3KEZA 3KAEA 2IJGX 3SFZA 3APFA 4RVBA 3ULQA 4TXPA 1D8DA 3ABME 3ABLE 4GTMA 4BSZB 4I43A 5BXUA 2RFMA 4JHRA 2P58C 2VGXB 4A63B 4APFA 1HH8A 3HVEB 3B7SA 3ONLA 5KBAA 1N0RA 4FHJA 4JEHA 3Q78A 4BWRA 2VYIA 5CEDB 4H7XA 3RO3A 1N4QA 4G24A 3CGHA 3LCAA 1S64A 2NYJA 5DBKA 5JA4D 2KATA 3FH7A 5HRYA 3GZ2A 4O6FA 3SBTB 2QZAA 2ZGDA 4GMJA 1H2VC 4GTOA 3FTSA 2X6FA 3E33A 1TN6A 4U95D 4GCNA 3RAUA 4N39A 3JCKC 3GZ1A 3S2AA 4A1SA 4XKCA 2X6HA 2J07A 1BI7B 2IY0C 2FBNA 4FP7A 3I3NA 3Q49B 4UWFA 4J7WA 4LNUD 5ANRA 3D9LA 4IYPA 2J4DA 3RIBA 3HIZA 2XPZA 3TAXA 3ABKE 4U63A 3ZIMA 4K0RA 3U3WA 3WXXA 3UT7A 1ZU2A 5A7DB 4N3CA 1HS6A 1FPPA 3TG4A 4TXRA 3RRNB 3APDA 4K5CA 4HXIA 4JA9A 4TXQA 3UM0A 1YMPA 3LVQE 4AIFA 3MZLB 2L6JA 4K03A 3CVUA 3DSXA 3SZ7A 4Y6WA 3EU5A 3CEQA 3APCA 4LRZA 4K5BA 3QWVA 4PUCA 3T5XA 2DCPA 1SA4A 3OXFA 1TNBA 2XPIA 4HFGA 5LFAA 3LY7A 1PC2A 3S7DA 5KWDA 3FTYA 3CK7A 4WWOA 4LUNU 4UUCA 3ZFWA 1V55E 3Q7AA 2WXRA 2AWIA 3KSQA 3NB2A 5AARA 4QFVA 2JEKA 3CSFA 4BEPA 3QARA 3FH8A 1N11A 3PZ3A 4YDOA 2KC7A 2LSUA 4XKBA 4O1OA 3W9GA 3U66A 1IHBA 3D9NA 1A5EA 2YINA 1QBQA 1HXIA 3MV2B 4BT8A 3CIAA 5BXOA 4N5QA 3TWQA 4ANUA 1FT1A 2LO6A 4J8DA 4YVOA 2DYRE 3L17A 3FUDA 2XPYA 5JHAA 5AQ7A 2L9BA 4EZKA 1SVXA 4JVSA 5EIBE 2KZTA 4GU5A 1WM5A 3QJZA 4F6RD 2WB2A 1BD8A 5FINA 1UW4B 1H2UA 3HXCA 5G04J 3CVWA 1Y6IA 4A55A 1K1BA 3LY9A 3ML9A 2QC9A 3UIOC 1OWLA 3FUMA 4J8EA 1IXVA 4APOA 3L6AA 4IULA 1H6PA 4GTRA 2GRMA 3FULA 4UI9C 4AJWA 2BKGA 3EHRA 4BETA 3B13A 3Q4AB 4AM9A 5ITZF 4KBQA 3V2OA 3Q73A 3T5VA 4LCTA 4W9RA 5BPPA 3MEKA 4YDEA 2MOWA 4U04A 4DLQA 2XGMA 3FTXA 1TN7A 4U8HA 1N4RA 3MCXA 4AV7A 2F8XK 4GMRA 4FLBA 4I6EA 3ESKA 1WDYA 4GYYA 3E4BA 4HRNA 1ELKA 2LNIA 4EBAA 1OCOE 2CG2A 4KYOB 1DC2A 5D0QD 3TXMA 4RLYA 3TWXA 3HG0D 4EZJA 5E75A 3FUNA 1QZ2A 2B0OE 1XNFA 3TWRA 1Z5SC 2VSOE 2L0TB 1VDYA 2L6BA 4RQIA 2WXFA 2ZXWE 5CRUA 1OCCE 3ZNGA 5KCMA 3G2SA 4J0UA 1WAO1 1W3BA 3VLDA 3IV0A 1HFAA 2R59A 4U0UA 3X2QE 4EBAG 1Z3YA 4LNGA 2Q7FA 3Q9UC 2FEZA 5JJ7A 2P9KG 3FUFA 2XZDG 4JB8P 3R9AB 3UUXA 3PE4A 2OVFA 3FEYA 2BTDA 1OY3D 1QYMA 4WNDA 4AOFA 4RG9A 5C2YA 2PQNA 4FADA 2VSYA 3ZVVA 4GTVA 3T9KA 1D8EA 2P9LG 3FEXA 3HRAA 2RKKA 4XIFA 3C5RA 2CHZA 1YYHA 2KZTB 4IRUA 1NA3A 3IHVA 3URZA 5CBOA 3PUKA 4L2LA 2ONDA 4C48B 1QNFA 2YQ8A 3U4TA 1SQMA 5AN8A 5AJDA 2I2OA 4GA0A 2CFUA 1E7VA 4GAAA 4FJYA 4ACLA 2WQHA 3ULYA 1OWNA 1NZNA 3LKUA 1DCEA 5ARFA 4HOSA 5T4YA 4GTSA 3R9MA 5LCWJ 3UI2A 5AYWD 5KJNA 2WXLA 5KNHD 1Z6TA 3CLJA 4NACA 1FT2A 3EHNA 4B93B 5CERB 3HDXA 3ASFA 5ENSD 3D9JA 3TWUA 1NA0A 4I2ZA 2M63A 4U0SA 5JJ6A 4G2VA 4F3VA 3SY2A 4PS7A 4QQIA 3BG1B 1NL4A 4L9PA 5KJMA 3V79K 2XZTG 3MGBA 4GMLA 2KM4A 2VSXE 3NAWA 2BKKB 3ENEA 5JHBA 3EJNA 5E76A 2X6JA 4A3VA 4DUIA 3D9IA 3TL5A 2BUGA 2J8SD 1OUVA 3TGOA 5FQ7A 3MA5A 4DX1A 3D9HA 2GRPB 3F6QA 4C0MA 3B7RL 4CEMA 1OT8A 4N3BA 4OAUC 4MBGA 2GW1A 3Q15A 3UIPC 3O4ZA 1IQUA 3SO8A 2LAHA 3RJVA 3FTUA 1RW2A 1TJFA 3CVNA 4GZ6A 3QNKA 1D9SA 2H6FA 3SNXA 2IF4A 4ANVA 1TNUA 1P5QA 5ANLA 3TWTA 4DJAA 3FUEA 3C3OA 3FH5A 2LXMA 2WXHA 5FQ6A 4BX8A 2GRNB 3ZPJA 2NC9A 4J8YA 3UXGA 2J4BA 5FIOA 4LNBA 3UMVA 4J6IA 3E30A 3E37A 4URKA 2OOEA 3L82A 3HXEA 5FT9A 2FO7A 4B8CB 3EHMA 4I1MA 2OVBA 4JW1A 2XCBA 2A4ZA 4KVOA 5H7PA 4JD2G 4HOTA 2XEEA 3FU3A 5CRVA 3ISMC 2AVPA 4AEZC 4DPRA 4PS3A 4N2QA 3ASDA 3DWLG 4I1OB 4N5CA 5CMYA 2DBAA 3ZEFA 4KZCA 5BT1A 2WXIA 4XX5A 3RU0A 1V54E 3AG1E 1JCQA 1KT1A 2R05A 2VSNA 2ZIRA 3HXBA 4AXHA 4KZ0A 3PS6A 4MS6A 3C72A 5FZQA 4O1PA 2CFZA 2I1KA 5ENTD 3J5PA 4I2WA 3DEOA 2R5SA 3L08A 3BEEA 1QQEA 4CDRA 3C3RA 3VTYA 4B89A 4ZHBA 3R7RA 1HE8A 3EDTB 1LD7A 3RO2A 3SD5A 1X81A 5AENA 4I6JA 4M3OA 5ENOD 5HI7A 5ENNA 1WG0A 3SHFA 3CHPA 3R7QA 3FU5A 1Z3XA 4G11A 4CDNA 1WY6A 3KD7A 3UM1A 5B3SE 1DVPA 4WWNA 2WXPA 2VJ8A 1BLXB 4CZ2D 5FQ4A 5J08A 4KT6B 5FTPA 1EYHA 4I1AA 4JXTA 2RG8A 3S7JA 4ILIA 2AXVA 3ZYQA 2F37A 1H2TC 3S7BA 5C1DA 2WMNA 3QDNA 2AXZA 3EIQC 5BV1A 3ZGQA 5D66A 2IOSA 2EIJE 2QFCA 4B94A 3PVLA 4WWPA 4XI0A 2PNNA 3Q7FA 4YVQC 2Y4TA 2IOLA 1N4SA 3QC1A 3VTXA 2CG3A 3RKVA 5CEAA 3CR3A 4GZDA 2WQ7A 3GYZA 5AIJA 2FI7A 4HQDA 3E32A 1E90A 3D9MA 2FULA 3WG7E 2YHEA 2UWJG 4R7LA 2PZIA 4JEUA 4L2YA 2ZISA 2C0MA 5G04C 2VQ2A 2HO1A 4PS8A 1SA5A 1O1TA 4WNEA 4FULA 3Q5MA 4BESA 3AU4A 5FQ8A 2QYJA 1OXJA 4CGWA 3FTWA 2FO1E 2ZU6B 2QY7A 4A1GA 3QAQA 4OAVB 4UQZA 1KLXA 1TR4A 1TNZA 1H6OA 1GW6A 4HI9A 2Y4UA 5FJYA 4HB5A 3CSTA 1IHGA 2V8SE 2X6IA 3FUJA 1RZ4A 3LPZA 2VGEA 4UWHA 1JWGA 2E2EA 4LSZE 3PUJA 4LERA 4BTAA 3OAWA 4BSXA 4RG6A 5D2MC 5D0OD 4HORA 2ETCA 5HKPA 2P9NG 4FJZA 4GTQA 4H7YA 1UN8A 1SZ9A 1IKND 1INZA 3JUIA 2Y3AA 1U3DA 1EF1C 3NOCD 1AWCB 2OEVA 2WM9A 1KPSB 4DRXE 4GYWA 3CVPA 4HRMB 1N0QA 4JHKA 3DSVA 1K1AA 5CCLA 3RRUA 4XE0A 1O5MA 1N9AA 3GW4A 2WXKA 3UQ3A 1OWOA 3GZSA 4MLPA 1KZOA 3FUIA 2Y1LE 4U07A 4MKTA 3UKRG 2Y69E 2L0IA 5CBNA 2V4HC 4U7EB 4DI3A 4HS2A 3ASGA 4NIKA 3RRMB 2P9IG 5IY5E 5HQ8A 1TN8A 1X5BA 4U8VD 4OVUA 3TG5A 4B8AA 4A3TA 3DSUA 3LXUX 3PZDA 3CV0A 3D9OA 4HLLA 3O48A 4GA2A 3L22A 3CVQA 2YHCA 3EHQA 4JZYA 5AJLA 3ZU7B 4MRUA 3CKBA 4TUUA 3DSWA 4ILHB 4L1BA 5EILA 2GRRB 2IO2C 3FP3A 3KEAA 4DLOA 3LS8A 2IU1A 4EECA 2KBXA 3B7BA 1N52A 5EX0A 4U0ZA 3C3QA 1HF8A 4WNGA 4D10C 5HS0A 2IEJA 1JCRA 2WPVA 2WXMA 3DRAA 3FTZA 5G05C 3P2BA 3ASHA 4HBDA 5LCWC 3HXFA 2GGFA 1MX6A 3DXMG 3BUAA 3I4GA 3L13A 1Y8MA 1NI1A 4JA7A 4U8YD 4EPZA 1KT0A 1S0PA 2IFUA 2R2LA 4BY6A 2AW6A 2PM7A 2CHXA 4WAFA 4EQFA 2WXNA 2HM8A 5FZSA 3ZYLA 2DYSE 3UTMA 4PH4B 3AG4E 1DNPA 3HXDA 3OXLA 3ZRHA 3CHMA 3UKUG 2LAIA 3MJWA 3L54A 3KSLA 1FVHA 4CCAA 2V0PA 2C2LA 2P9UG 1MJ0A 1TYQG 2KXPC 3ZXPA 3CHOA 1MX4A 5ENPD 2F8YA 4BT9A 3CVLA 3PNLB 4HNAD 4GCOA 1U2VG 2PL2A 4ANWA 3SI5A 4DX5D 4I9CA 3NOGD 3JUEA 3AJIA 2AXUA 4ATGA 5JJTA 3LEWA 3CHSA 3UT8A 3DPYA 1HO8A 2V4LA 3CHRA 1E96B 4BFRA 3MYVA 2H6IA 3EU9A 3TJPA 3MX3A 3AG2E 4PDXA 1E8ZA 2KCKA 3V31A 4V3IA 1OWMA 3RSEG 1XGWA 3QK0A 3N71A 5M72A 3QOUA 4Z68A 3SFYA 1Q2ZA 4M7CA 3FUKA 3T8MA 1OCRE 1PY1A 5LOZA 1HG5A 1NP7A 4DX6D 1A17A 1AP7A 2MYOA 4UQYA 3G2VA 4KVMA 4CT4A 1LTXA 4Y6CA 2P9PG 3DBSA 3BQOA 1E7UA 4TUMA 4YNDA 4ABNA 3ZHEA 2J08A 2WXJA 3OXGA 3PEUB 1O1RA 5EYPF 4F7AA 3Q75A 3CK8A 1O1SA 3LVRE 4N2SA 2XENA 3ZKJA 2H6GA 5ENRD 2DWZA 3ZYMA 1TNOA 3U64A 4AY5A 4GYOA 2EIKE 5EN5D 1TNYA 5A23A 3AS4A 1E8XA 5ARGA 4UWLA 3JQ0A 3LJNA 5B1AE 1PAQA 3LDZA 2E0IA 4IN3B 4WUYA 1LF8A 4Q69A 4ATZD 2AJAA 2XS1A 3UM3A 3FWVA 2A5EA 5AQAA 1OCZE 3TWSA 2MRIA 3KS2A 3IXEA 4KXKB 3AS8A 5EKQD 3ASNE 4BTBA 2LXLA 2JLBA 3V2XA 1OWPA 4GPMA 2WXQA 4KMOA 4JHJA 3S7FA 2EILE 3P1UA 3SFXA 3ESLA 3TXNA 4DX7D 3SF4A 3AG3E 3PZ2A 1BU9A 4E85A 1MX2A 1N95A 1N54A 5DIZA 3ZW3A 4TV3A 5BNWA 3C98A 4AP2A 3FY4A 2UY1A 4RSYA 2IQCA 1LD8A 4DI4A 4LG6A 3NZUA 3QKYA 3DSTA 2OCCE 5BW8C 4GZCA 2V5QC 3JXIA 4Q96A 4Q94A 5AAOA 1UN9A 2X38A 3ZHEB 3IEGA 3IKOB 3LY8A 3QWPA 4G1TA 3DEPA 3B95A 5G55A 3ML8A 4WNFA 5CHEE 4TRQA 2KCVA 2XEVA 4O60A 4G26A 3VLEA 4JPSA 3BU8A 1FVFA 3D9PA 1G3NB 3HHMA 4G8LA 3RK6A 2WMOA 1MHQA 2XGOA 2CHWA 3IHYA 5EX3A 5CMWA 4FA6A 4JC8A 1JUQA 3PEVB 4FHKA 3ZXSA 3LYAA 3CQGB 3ASOE 5CCMA 4XZ4A 5G2NA 1DCQA 3ONKA 4FLHA 1K8KG 4NQ0A 3SGHA 2XGSA 2P9SG 2J9QA 4F1SA 2XQ0A 3JXJA 3U9WA 4UWKA 5KNGA 3NF1A 4ME2A 2PM6A 1UJKA 2F0YA 2IO3C 3ZYKA 2WVIA 3QB2A 1UOHA 3G2WA 3UINC 1NFIE 4GZ3A 3MV3B 4EZLA 4CDMA 3AS5A 3L9TA 1MQSA 1H0AA 2IONA 2MHKA 1IYGA 1JPLA 4U96D 2R03A 2V5FA 3EIJA 1EPUA 4ANXA 2OEWA 5LP0A 5FWQA 2RD0A 2X3MA 2UY1B 4I6GA 3CKCA 2HR2A 1BI8B 1E8YA 2ZGGA 2QYUA 4HOUA 3CK9A 4UI9J 3PRZA 1K3ZD 4HVBA 1MZCA 4B0ZA 2I6HA 3ULEG 1L5JA 1UG3A 1IQRA 5KJLA 3DSSA 4GTPA 3MKQA 3UX4A 3ZUVB 2P2CP
chains in the Genus database with same CATH topology
3ABME 3AG2E 3AG3E 5B1BE 1OCZE 2EIJE 3ABLE 2ZXWE 1V54E 1OCOE 3AG1E 2OCCE 5B1AE 1OCCE 3ASOE 2Y69E 1V55E 2DYRE 3ASNE 5B3SE 3WG7E 2DYSE 1OCRE 2EINE 2EIKE 3AG4E 3ABKE 3X2QE 2EILE 5IY5E 2EIME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABM E;  3AG2 E;  3AG3 E;  5B1B E;  1OCZ E;  2EIJ E;  3ABL E;  2ZXW E;  1V54 E;  1OCO E;  3AG1 E;  2OCC E;  5B1A E;  1OCC E;  3ASO E;  2Y69 E;  1V55 E;  2DYR E;  3ASN E;  5B3S E;  3WG7 E;  2DYS E;  1OCR E;  2EIN E;  2EIK E;  3AG4 E;  3ABK E;  3X2Q E;  2EIL E;  5IY5 E;  2EIM E; 
#chains in the Genus database with same CATH topology
 4YDW A;  5BV0 A;  4X8Q A;  3IBE A;  3D3M A;  3FDH A;  3CHQ A;  1YCS B;  3JYS A;  2GRL A;  1JWF A;  3MKR A;  2YNQ A;  5BUZ A;  2JAB A;  1H19 A;  2BED A;  4HLE A;  2OV8 A;  3CVV A;  1U3C A;  2C0L A;  4NRH B;  3QWW A;  1YA0 A;  3BG0 B;  3EUV A;  5T3R A;  3UM2 A;  4CT0 A;  1H6K A;  3FFL A;  1UJJ A;  1MYO A;  4K5A B;  2VGY A;  3TWW A;  4AY6 A;  4F53 A;  5A6C A;  4FC8 A;  4I9E A;  5B1B E;  1N94 A;  1N4P A;  1SZA A;  4HRL A;  5ENQ D;  2NXP A;  5KJK A;  2DVW A;  4GPK A;  1ELR A;  3VLF A;  4ACK A;  3UPV A;  4DX2 A;  2A5U A;  4L23 A;  2BF0 X;  3SBS A;  4UWG A;  3G2U A;  2VTB A;  4CGV A;  2XHE A;  1ZBP A;  1S63 A;  3FUH A;  1KZP A;  3UT4 A;  4GTT A;  2J49 A;  3SQV A;  2R02 A;  4OVV A;  4ILG A;  2I9C A;  3I5P A;  3G2T A;  1JCS A;  1ZB1 A;  1TEZ A;  4ZFH A;  4JL0 A;  3W9F A;  4BX9 A;  3LJ3 A;  5T8I A;  4HOQ A;  3NBN B;  5EID A;  2KCL A;  3PH0 C;  5FZR A;  4NUR A;  4C9B B;  2EIN E;  3DPD A;  3AU5 A;  2XEH A;  3FHE A;  4I17 A;  2XRZ A;  2J09 A;  2WQ6 A;  5AQB A;  3CVY A;  1HU3 A;  1B89 A;  4G23 A;  2HE0 A;  3NZS A;  5G05 J;  5JMN D;  3B7T A;  3MKQ B;  2Y0B G;  4P29 A;  3ZN3 A;  3J5Q B;  2ETA A;  4GB9 A;  2DZO A;  2DZN A;  1TJC A;  3TWV A;  2B6C A;  2VGX A;  3Q79 A;  3DXK G;  3OTN A;  4J8F A;  4CYM D;  1HX8 A;  3JQ1 A;  4OYS A;  2GRQ B;  3HVE A;  1ELW A;  4C0E A;  1BPO A;  3B7U X;  4XI9 A;  3HYM B;  4EHM A;  2PQR A;  2EIM E;  2WXG A;  4LEU A;  1HG2 A;  2EQX A;  5EYL A;  4UQX A;  4J8S A;  3PZ4 A;  3V30 A;  3FTV A;  3I4R B;  4N3A A;  5EDS A;  4GZ5 A;  5LX8 A;  1S70 B;  4UI9 K;  3K9I A;  1EDU A;  3PDN A;  2ILR A;  4DK5 A;  2I1J A;  3T8K A;  5AQ9 A;  1HZ4 A;  3D9K A;  5J90 A;  4CRW A;  3Q9N C;  4AVX A;  3FU6 A;  4FU3 A;  2NSZ A;  3CVX A;  4HI8 A;  3PE3 A;  3AAA C;  2X6K A;  1FCH A;  3NQP A;  3PZ1 A;  4E6H A;  2VTB B;  2LUH A;  3E34 A;  3CQC B;  3L16 A;  3PRE A;  2ETB A;  3FU0 A;  2HYZ A;  1E8W A;  2R17 C;  2H6H A;  2GRO B;  4BER A;  4YDY A;  4L7T A;  2LSV A;  4GA1 A;  2RFA A;  3Q47 B;  1SW6 A;  2FF4 A;  5CEC B;  2XS8 A;  3PNT B;  4G25 A;  4XEI G;  2WXO A;  2XCC A;  2XRY A;  4F1P A;  2DIW A;  4G8K A;  3KEZ A;  3KAE A;  2IJG X;  3SFZ A;  3APF A;  4RVB A;  3ULQ A;  4TXP A;  1D8D A;  3ABM E;  3ABL E;  4GTM A;  4BSZ B;  4I43 A;  5BXU A;  2RFM A;  4JHR A;  2P58 C;  2VGX B;  4A63 B;  4APF A;  1HH8 A;  3HVE B;  3B7S A;  3ONL A;  5KBA A;  1N0R A;  4FHJ A;  4JEH A;  3Q78 A;  4BWR A;  2VYI A;  5CED B;  4H7X A;  3RO3 A;  1N4Q A;  4G24 A;  3CGH A;  3LCA A;  1S64 A;  2NYJ A;  5DBK A;  5JA4 D;  2KAT A;  3FH7 A;  5HRY A;  3GZ2 A;  4O6F A;  3SBT B;  2QZA A;  2ZGD A;  4GMJ A;  1H2V C;  4GTO A;  3FTS A;  2X6F A;  3E33 A;  1TN6 A;  4U95 D;  4GCN A;  3RAU A;  4N39 A;  3JCK C;  3GZ1 A;  3S2A A;  4A1S A;  4XKC A;  2X6H A;  2J07 A;  1BI7 B;  2IY0 C;  2FBN A;  4FP7 A;  3I3N A;  3Q49 B;  4UWF A;  4J7W A;  4LNU D;  5ANR A;  3D9L A;  4IYP A;  2J4D A;  3RIB A;  3HIZ A;  2XPZ A;  3TAX A;  3ABK E;  4U63 A;  3ZIM A;  4K0R A;  3U3W A;  3WXX A;  3UT7 A;  1ZU2 A;  5A7D B;  4N3C A;  1HS6 A;  1FPP A;  3TG4 A;  4TXR A;  3RRN B;  3APD A;  4K5C A;  4HXI A;  4JA9 A;  4TXQ A;  3UM0 A;  1YMP A;  3LVQ E;  4AIF A;  3MZL B;  2L6J A;  4K03 A;  3CVU A;  3DSX A;  3SZ7 A;  4Y6W A;  3EU5 A;  3CEQ A;  3APC A;  4LRZ A;  4K5B A;  3QWV A;  4PUC A;  3T5X A;  2DCP A;  1SA4 A;  3OXF A;  1TNB A;  2XPI A;  4HFG A;  5LFA A;  3LY7 A;  1PC2 A;  3S7D A;  5KWD A;  3FTY A;  3CK7 A;  4WWO A;  4LUN U;  4UUC A;  3ZFW A;  1V55 E;  3Q7A A;  2WXR A;  2AWI A;  3KSQ A;  3NB2 A;  5AAR A;  4QFV A;  2JEK A;  3CSF A;  4BEP A;  3QAR A;  3FH8 A;  1N11 A;  3PZ3 A;  4YDO A;  2KC7 A;  2LSU A;  4XKB A;  4O1O A;  3W9G A;  3U66 A;  1IHB A;  3D9N A;  1A5E A;  2YIN A;  1QBQ A;  1HXI A;  3MV2 B;  4BT8 A;  3CIA A;  5BXO A;  4N5Q A;  3TWQ A;  4ANU A;  1FT1 A;  2LO6 A;  4J8D A;  4YVO A;  2DYR E;  3L17 A;  3FUD A;  2XPY A;  5JHA A;  5AQ7 A;  2L9B A;  4EZK A;  1SVX A;  4JVS A;  5EIB E;  2KZT A;  4GU5 A;  1WM5 A;  3QJZ A;  4F6R D;  2WB2 A;  1BD8 A;  5FIN A;  1UW4 B;  1H2U A;  3HXC A;  5G04 J;  3CVW A;  1Y6I A;  4A55 A;  1K1B A;  3LY9 A;  3ML9 A;  2QC9 A;  3UIO C;  1OWL A;  3FUM A;  4J8E A;  1IXV A;  4APO A;  3L6A A;  4IUL A;  1H6P A;  4GTR A;  2GRM A;  3FUL A;  4UI9 C;  4AJW A;  2BKG A;  3EHR A;  4BET A;  3B13 A;  3Q4A B;  4AM9 A;  5ITZ F;  4KBQ A;  3V2O A;  3Q73 A;  3T5V A;  4LCT A;  4W9R A;  5BPP A;  3MEK A;  4YDE A;  2MOW A;  4U04 A;  4DLQ A;  2XGM A;  3FTX A;  1TN7 A;  4U8H A;  1N4R A;  3MCX A;  4AV7 A;  2F8X K;  4GMR A;  4FLB A;  4I6E A;  3ESK A;  1WDY A;  4GYY A;  3E4B A;  4HRN A;  1ELK A;  2LNI A;  4EBA A;  1OCO E;  2CG2 A;  4KYO B;  1DC2 A;  5D0Q D;  3TXM A;  4RLY A;  3TWX A;  3HG0 D;  4EZJ A;  5E75 A;  3FUN A;  1QZ2 A;  2B0O E;  1XNF A;  3TWR A;  1Z5S C;  2VSO E;  2L0T B;  1VDY A;  2L6B A;  4RQI A;  2WXF A;  2ZXW E;  5CRU A;  1OCC E;  3ZNG A;  5KCM A;  3G2S A;  4J0U A;  1WAO 1;  1W3B A;  3VLD A;  3IV0 A;  1HFA A;  2R59 A;  4U0U A;  3X2Q E;  4EBA G;  1Z3Y A;  4LNG A;  2Q7F A;  3Q9U C;  2FEZ A;  5JJ7 A;  2P9K G;  3FUF A;  2XZD G;  4JB8 P;  3R9A B;  3UUX A;  3PE4 A;  2OVF A;  3FEY A;  2BTD A;  1OY3 D;  1QYM A;  4WND A;  4AOF A;  4RG9 A;  5C2Y A;  2PQN A;  4FAD A;  2VSY A;  3ZVV A;  4GTV A;  3T9K A;  1D8E A;  2P9L G;  3FEX A;  3HRA A;  2RKK A;  4XIF A;  3C5R A;  2CHZ A;  1YYH A;  2KZT B;  4IRU A;  1NA3 A;  3IHV A;  3URZ A;  5CBO A;  3PUK A;  4L2L A;  2OND A;  4C48 B;  1QNF A;  2YQ8 A;  3U4T A;  1SQM A;  5AN8 A;  5AJD A;  2I2O A;  4GA0 A;  2CFU A;  1E7V A;  4GAA A;  4FJY A;  4ACL A;  2WQH A;  3ULY A;  1OWN A;  1NZN A;  3LKU A;  1DCE A;  5ARF A;  4HOS A;  5T4Y A;  4GTS A;  3R9M A;  5LCW J;  3UI2 A;  5AYW D;  5KJN A;  2WXL A;  5KNH D;  1Z6T A;  3CLJ A;  4NAC A;  1FT2 A;  3EHN A;  4B93 B;  5CER B;  3HDX A;  3ASF A;  5ENS D;  3D9J A;  3TWU A;  1NA0 A;  4I2Z A;  2M63 A;  4U0S A;  5JJ6 A;  4G2V A;  4F3V A;  3SY2 A;  4PS7 A;  4QQI A;  3BG1 B;  1NL4 A;  4L9P A;  5KJM A;  3V79 K;  2XZT G;  3MGB A;  4GML A;  2KM4 A;  2VSX E;  3NAW A;  2BKK B;  3ENE A;  5JHB A;  3EJN A;  5E76 A;  2X6J A;  4A3V A;  4DUI A;  3D9I A;  3TL5 A;  2BUG A;  2J8S D;  1OUV A;  3TGO A;  5FQ7 A;  3MA5 A;  4DX1 A;  3D9H A;  2GRP B;  3F6Q A;  4C0M A;  3B7R L;  4CEM A;  1OT8 A;  4N3B A;  4OAU C;  4MBG A;  2GW1 A;  3Q15 A;  3UIP C;  3O4Z A;  1IQU A;  3SO8 A;  2LAH A;  3RJV A;  3FTU A;  1RW2 A;  1TJF A;  3CVN A;  4GZ6 A;  3QNK A;  1D9S A;  2H6F A;  3SNX A;  2IF4 A;  4ANV A;  1TNU A;  1P5Q A;  5ANL A;  3TWT A;  4DJA A;  3FUE A;  3C3O A;  3FH5 A;  2LXM A;  2WXH A;  5FQ6 A;  4BX8 A;  2GRN B;  3ZPJ A;  2NC9 A;  4J8Y A;  3UXG A;  2J4B A;  5FIO A;  4LNB A;  3UMV A;  4J6I A;  3E30 A;  3E37 A;  4URK A;  2OOE A;  3L82 A;  3HXE A;  5FT9 A;  2FO7 A;  4B8C B;  3EHM A;  4I1M A;  2OVB A;  4JW1 A;  2XCB A;  2A4Z A;  4KVO A;  5H7P A;  4JD2 G;  4HOT A;  2XEE A;  3FU3 A;  5CRV A;  3ISM C;  2AVP A;  4AEZ C;  4DPR A;  4PS3 A;  4N2Q A;  3ASD A;  3DWL G;  4I1O B;  4N5C A;  5CMY A;  2DBA A;  3ZEF A;  4KZC A;  5BT1 A;  2WXI A;  4XX5 A;  3RU0 A;  1V54 E;  3AG1 E;  1JCQ A;  1KT1 A;  2R05 A;  2VSN A;  2ZIR A;  3HXB A;  4AXH A;  4KZ0 A;  3PS6 A;  4MS6 A;  3C72 A;  5FZQ A;  4O1P A;  2CFZ A;  2I1K A;  5ENT D;  3J5P A;  4I2W A;  3DEO A;  2R5S A;  3L08 A;  3BEE A;  1QQE A;  4CDR A;  3C3R A;  3VTY A;  4B89 A;  4ZHB A;  3R7R A;  1HE8 A;  3EDT B;  1LD7 A;  3RO2 A;  3SD5 A;  1X81 A;  5AEN A;  4I6J A;  4M3O A;  5ENO D;  5HI7 A;  5ENN A;  1WG0 A;  3SHF A;  3CHP A;  3R7Q A;  3FU5 A;  1Z3X A;  4G11 A;  4CDN A;  1WY6 A;  3KD7 A;  3UM1 A;  5B3S E;  1DVP A;  4WWN A;  2WXP A;  2VJ8 A;  1BLX B;  4CZ2 D;  5FQ4 A;  5J08 A;  4KT6 B;  5FTP A;  1EYH A;  4I1A A;  4JXT A;  2RG8 A;  3S7J A;  4ILI A;  2AXV A;  3ZYQ A;  2F37 A;  1H2T C;  3S7B A;  5C1D A;  2WMN A;  3QDN A;  2AXZ A;  3EIQ C;  5BV1 A;  3ZGQ A;  5D66 A;  2IOS A;  2EIJ E;  2QFC A;  4B94 A;  3PVL A;  4WWP A;  4XI0 A;  2PNN A;  3Q7F A;  4YVQ C;  2Y4T A;  2IOL A;  1N4S A;  3QC1 A;  3VTX A;  2CG3 A;  3RKV A;  5CEA A;  3CR3 A;  4GZD A;  2WQ7 A;  3GYZ A;  5AIJ A;  2FI7 A;  4HQD A;  3E32 A;  1E90 A;  3D9M A;  2FUL A;  3WG7 E;  2YHE A;  2UWJ G;  4R7L A;  2PZI A;  4JEU A;  4L2Y A;  2ZIS A;  2C0M A;  5G04 C;  2VQ2 A;  2HO1 A;  4PS8 A;  1SA5 A;  1O1T A;  4WNE A;  4FUL A;  3Q5M A;  4BES A;  3AU4 A;  5FQ8 A;  2QYJ A;  1OXJ A;  4CGW A;  3FTW A;  2FO1 E;  2ZU6 B;  2QY7 A;  4A1G A;  3QAQ A;  4OAV B;  4UQZ A;  1KLX A;  1TR4 A;  1TNZ A;  1H6O A;  1GW6 A;  4HI9 A;  2Y4U A;  5FJY A;  4HB5 A;  3CST A;  1IHG A;  2V8S E;  2X6I A;  3FUJ A;  1RZ4 A;  3LPZ A;  2VGE A;  4UWH A;  1JWG A;  2E2E A;  4LSZ E;  3PUJ A;  4LER A;  4BTA A;  3OAW A;  4BSX A;  4RG6 A;  5D2M C;  5D0O D;  4HOR A;  2ETC A;  5HKP A;  2P9N G;  4FJZ A;  4GTQ A;  4H7Y A;  1UN8 A;  1SZ9 A;  1IKN D;  1INZ A;  3JUI A;  2Y3A A;  1U3D A;  1EF1 C;  3NOC D;  1AWC B;  2OEV A;  2WM9 A;  1KPS B;  4DRX E;  4GYW A;  3CVP A;  4HRM B;  1N0Q A;  4JHK A;  3DSV A;  1K1A A;  5CCL A;  3RRU A;  4XE0 A;  1O5M A;  1N9A A;  3GW4 A;  2WXK A;  3UQ3 A;  1OWO A;  3GZS A;  4MLP A;  1KZO A;  3FUI A;  2Y1L E;  4U07 A;  4MKT A;  3UKR G;  2Y69 E;  2L0I A;  5CBN A;  2V4H C;  4U7E B;  4DI3 A;  4HS2 A;  3ASG A;  4NIK A;  3RRM B;  2P9I G;  5IY5 E;  5HQ8 A;  1TN8 A;  1X5B A;  4U8V D;  4OVU A;  3TG5 A;  4B8A A;  4A3T A;  3DSU A;  3LXU X;  3PZD A;  3CV0 A;  3D9O A;  4HLL A;  3O48 A;  4GA2 A;  3L22 A;  3CVQ A;  2YHC A;  3EHQ A;  4JZY A;  5AJL A;  3ZU7 B;  4MRU A;  3CKB A;  4TUU A;  3DSW A;  4ILH B;  4L1B A;  5EIL A;  2GRR B;  2IO2 C;  3FP3 A;  3KEA A;  4DLO A;  3LS8 A;  2IU1 A;  4EEC A;  2KBX A;  3B7B A;  1N52 A;  5EX0 A;  4U0Z A;  3C3Q A;  1HF8 A;  4WNG A;  4D10 C;  5HS0 A;  2IEJ A;  1JCR A;  2WPV A;  2WXM A;  3DRA A;  3FTZ A;  5G05 C;  3P2B A;  3ASH A;  4HBD A;  5LCW C;  3HXF A;  2GGF A;  1MX6 A;  3DXM G;  3BUA A;  3I4G A;  3L13 A;  1Y8M A;  1NI1 A;  4JA7 A;  4U8Y D;  4EPZ A;  1KT0 A;  1S0P A;  2IFU A;  2R2L A;  4BY6 A;  2AW6 A;  2PM7 A;  2CHX A;  4WAF A;  4EQF A;  2WXN A;  2HM8 A;  5FZS A;  3ZYL A;  2DYS E;  3UTM A;  4PH4 B;  3AG4 E;  1DNP A;  3HXD A;  3OXL A;  3ZRH A;  3CHM A;  3UKU G;  2LAI A;  3MJW A;  3L54 A;  3KSL A;  1FVH A;  4CCA A;  2V0P A;  2C2L A;  2P9U G;  1MJ0 A;  1TYQ G;  2KXP C;  3ZXP A;  3CHO A;  1MX4 A;  5ENP D;  2F8Y A;  4BT9 A;  3CVL A;  3PNL B;  4HNA D;  4GCO A;  1U2V G;  2PL2 A;  4ANW A;  3SI5 A;  4DX5 D;  4I9C A;  3NOG D;  3JUE A;  3AJI A;  2AXU A;  4ATG A;  5JJT A;  3LEW A;  3CHS A;  3UT8 A;  3DPY A;  1HO8 A;  2V4L A;  3CHR A;  1E96 B;  4BFR A;  3MYV A;  2H6I A;  3EU9 A;  3TJP A;  3MX3 A;  3AG2 E;  4PDX A;  1E8Z A;  2KCK A;  3V31 A;  4V3I A;  1OWM A;  3RSE G;  1XGW A;  3QK0 A;  3N71 A;  5M72 A;  3QOU A;  4Z68 A;  3SFY A;  1Q2Z A;  4M7C A;  3FUK A;  3T8M A;  1OCR E;  1PY1 A;  5LOZ A;  1HG5 A;  1NP7 A;  4DX6 D;  1A17 A;  1AP7 A;  2MYO A;  4UQY A;  3G2V A;  4KVM A;  4CT4 A;  1LTX A;  4Y6C A;  2P9P G;  3DBS A;  3BQO A;  1E7U A;  4TUM A;  4YND A;  4ABN A;  3ZHE A;  2J08 A;  2WXJ A;  3OXG A;  3PEU B;  1O1R A;  5EYP F;  4F7A A;  3Q75 A;  3CK8 A;  1O1S A;  3LVR E;  4N2S A;  2XEN A;  3ZKJ A;  2H6G A;  5ENR D;  2DWZ A;  3ZYM A;  1TNO A;  3U64 A;  4AY5 A;  4GYO A;  2EIK E;  5EN5 D;  1TNY A;  5A23 A;  3AS4 A;  1E8X A;  5ARG A;  4UWL A;  3JQ0 A;  3LJN A;  5B1A E;  1PAQ A;  3LDZ A;  2E0I A;  4IN3 B;  4WUY A;  1LF8 A;  4Q69 A;  4ATZ D;  2AJA A;  2XS1 A;  3UM3 A;  3FWV A;  2A5E A;  5AQA A;  1OCZ E;  3TWS A;  2MRI A;  3KS2 A;  3IXE A;  4KXK B;  3AS8 A;  5EKQ D;  3ASN E;  4BTB A;  2LXL A;  2JLB A;  3V2X A;  1OWP A;  4GPM A;  2WXQ A;  4KMO A;  4JHJ A;  3S7F A;  2EIL E;  3P1U A;  3SFX A;  3ESL A;  3TXN A;  4DX7 D;  3SF4 A;  3AG3 E;  3PZ2 A;  1BU9 A;  4E85 A;  1MX2 A;  1N95 A;  1N54 A;  5DIZ A;  3ZW3 A;  4TV3 A;  5BNW A;  3C98 A;  4AP2 A;  3FY4 A;  2UY1 A;  4RSY A;  2IQC A;  1LD8 A;  4DI4 A;  4LG6 A;  3NZU A;  3QKY A;  3DST A;  2OCC E;  5BW8 C;  4GZC A;  2V5Q C;  3JXI A;  4Q96 A;  4Q94 A;  5AAO A;  1UN9 A;  2X38 A;  3ZHE B;  3IEG A;  3IKO B;  3LY8 A;  3QWP A;  4G1T A;  3DEP A;  3B95 A;  5G55 A;  3ML8 A;  4WNF A;  5CHE E;  4TRQ A;  2KCV A;  2XEV A;  4O60 A;  4G26 A;  3VLE A;  4JPS A;  3BU8 A;  1FVF A;  3D9P A;  1G3N B;  3HHM A;  4G8L A;  3RK6 A;  2WMO A;  1MHQ A;  2XGO A;  2CHW A;  3IHY A;  5EX3 A;  5CMW A;  4FA6 A;  4JC8 A;  1JUQ A;  3PEV B;  4FHK A;  3ZXS A;  3LYA A;  3CQG B;  3ASO E;  5CCM A;  4XZ4 A;  5G2N A;  1DCQ A;  3ONK A;  4FLH A;  1K8K G;  4NQ0 A;  3SGH A;  2XGS A;  2P9S G;  2J9Q A;  4F1S A;  2XQ0 A;  3JXJ A;  3U9W A;  4UWK A;  5KNG A;  3NF1 A;  4ME2 A;  2PM6 A;  1UJK A;  2F0Y A;  2IO3 C;  3ZYK A;  2WVI A;  3QB2 A;  1UOH A;  3G2W A;  3UIN C;  1NFI E;  4GZ3 A;  3MV3 B;  4EZL A;  4CDM A;  3AS5 A;  3L9T A;  1MQS A;  1H0A A;  2ION A;  2MHK A;  1IYG A;  1JPL A;  4U96 D;  2R03 A;  2V5F A;  3EIJ A;  1EPU A;  4ANX A;  2OEW A;  5LP0 A;  5FWQ A;  2RD0 A;  2X3M A;  2UY1 B;  4I6G A;  3CKC A;  2HR2 A;  1BI8 B;  1E8Y A;  2ZGG A;  2QYU A;  4HOU A;  3CK9 A;  4UI9 J;  3PRZ A;  1K3Z D;  4HVB A;  1MZC A;  4B0Z A;  2I6H A;  3ULE G;  1L5J A;  1UG3 A;  1IQR A;  5KJL A;  3DSS A;  4GTP A;  3MKQ A;  3UX4 A;  3ZUV B;  2P2C P; 
#chains in the Genus database with same CATH homology
 3ABM E;  3AG2 E;  3AG3 E;  5B1B E;  1OCZ E;  2EIJ E;  3ABL E;  2ZXW E;  1V54 E;  1OCO E;  3AG1 E;  2OCC E;  5B1A E;  1OCC E;  3ASO E;  2Y69 E;  1V55 E;  2DYR E;  3ASN E;  5B3S E;  3WG7 E;  2DYS E;  1OCR E;  2EIN E;  2EIK E;  3AG4 E;  3ABK E;  3X2Q E;  2EIL E;  5IY5 E;  2EIM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...