2E2EA

Tpr domain of nrfg mediates the complex formation between heme lyase and formate-dependent nitrite reductase in escherichia coli o157:h7
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
171
Chain Sequence
b'KWQAVRAEYQRQRDPLHQFAEAQLQALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQASQHMTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELWQKVMDLNSPRINRTQLVESINMAKLLQRRSDLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formate-dependent nitrite reductase complex nrfG subunit
publication title TPR domain of NrfG mediates complex formation between heme lyase and formate-dependent nitrite reductase in Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 56
structure length 171
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2e2eA01
4YNDA 3ZN3A 2YHCA 4H7XA 1HH8A 1P5QA 3AS8A 1OUVA 4XI9A 1ELRA 2UY1A 2XEVA 2C2LA 2FF4A 5HI7A 3LY7A 5FZSA 2KC7A 5D0OD 3LPZA 5CHEE 1KT0A 1IYGA 3RU0A 3OXFA 5C1DA 4EQFA 3PDNA 4APOA 5CCLA 4UQZA 4GYYA 5EX3A 4ABNA 3FFLA 3E4BA 2ONDA 3QWVA 4I9EA 4UQYA 4WNGA 4J8EA 3BEEA 2QFCA 3PE4A 3OXGA 3LCAA 5KJMA 4B94A 3TGOA 1KT1A 4WUYA 1ZBPA 5G05C 5AYWD 3AS5A 3Q15A 2WQHA 2XGOA 3KD7A 3ASFA 4I2ZA 1HZ4A 2JLBA 4GZ6A 4BTAA 4BT8A 5DIZA 5FT9A 1B89A 2PQRA 4N2QA 5JJ6A 3RIBA 4AIFA 3Q47B 2NC9A 5DBKA 3MEKA 4ME2A 3CEQA 1NZNA 5FJYA 2HO1A 2PQNA 2LSUA 3UPVA 1WAO1 3LY9A 1KLXA 1HXIA 2L6JA 3CK9A 4KXKB 3NF1A 2WPVA 4GA2A 4RG6A 2PZIA 3K9IA 3N71A 2AVPA 1NA3A 2R5SA 3O48A 4U07A 2FBNA 3QKYA 2XGMA 2LSVA 4Y6CA 3RJVA 2HR2A 4GCOA 3KS2A 5KJNA 2Y4UA 3QOUA 4N39A 2IF4A 1FCHA 4U0SA 3LY8A 4Y6WA 4G23A 4G1TA 4F3VA 2KCLA 1IHGA 4G2VA 4G24A 1XNFA 1Y8MA 5FTPA 4BTBA 3U3WA 4CGWA 2MHKA 3S7JA 3TG5A 3KAEA 3CVQA 4JA7A 5CCMA 4I2WA 2I6HA 3TG4A 2C0LA 4N5CA 5G04J 5BW8C 1QZ2A 4U0UA 2Q7FA 2VGXB 4JA9A 3ASHA 2V5FA 4BT9A 4U04A 4RG9A 3TAXA 5D0QD 3CVLA 4UI9J 2E2EA 4KYOB 5HQ8A 4J8FA 4HOUA 2J9QA 4N3BA 3ASGA 2KATA 5G04C 2C0MA 1WM5A 3S7BA 4HOTA 2HYZA 1W3BA 3ZPJA 4YVQC 1ZU2A 2KCKA 4GZ5A 3FWVA 2VSNA 2VSYA 1A17A 3RKVA 3URZA 2DBAA 2XCBA 4AM9A 3QWPA 5A6CA 3ZHEB 3RO3A 4H7YA 4G25A 3S7DA 4NRHB 2Y4TA 3GYZA 4N3CA 4BWRA 4HOQA 4N3AA 3VTXA 4AY5A 3PE3A 5EX0A 3ASDA 3MKRA 5ARFA 2FO7A 3IEGA 5A7DB 4YVOA 2VGXA 4GA0A 2FEZA 2VQ2A 3CVNA 3ESKA 1NA0A 2OOEA 2VGYA 4IN3B 1E96B 3R9AB 2LNIA 4I9CA 5M72A 4J0UA 4WNEA 5JJTA 5LCWJ 2PL2A 3EDTB 3OXLA 3SZ7A 3U4TA 4W9RA 4N2SA 5FZRA 1TJCA 5FZQA 4AY6A 3CVPA 4JL0A 3VTYA 1ELWA 2P58C 3QDNA 3MA5A 4WNDA 4GZ3A 4NQ0A 4G26A 3WXXA 5LCWC 5BT1A 3ZHEA 3CK7A 3ZGQA 5KJLA 4GA1A 1QQEA 4UQXA 5G05J 3FP3A 3CK8A 3CV0A 3HYMB 3RO2A 3JYSA 4LEUA 5EKQD 3GZ2A 5BNWA 3QWWA 4XI0A 1PC2A 2FI7A 3SF4A 2GW1A 2UY1B 4UI9C 5ARGA 4JHRA 4UI9K 3MV2B 4CGVA 5JJ7A 2XGSA 3CKCA 3GZ1A 2UWJG 4GPKA 2XCCA 3GW4A 3CKBA 3LKUA 2BUGA 3Q49B 1YA0A 4GYOA 5KJKA 4WNFA 4A1SA 4HORA 3UUXA 3MV3B 2XPIA 4CDRA 4O6FA 4XIFA 2YQ8A 4HOSA 3ULQA 3AS4A 3Q4AB 4U0ZA 2KCVA 2IFUA 3UQ3A 3S7FA 3Q5MA 4GCNA 4I17A 3ZFWA 4KBQA 2VYIA 4J8DA 4I1AA 3LYAA 4GYWA
chains in the Genus database with same CATH superfamily
4YNDA 3ZN3A 1Q2ZA 4RVBA 5LP0A 5E75A 2CG2A 1JWFA 3B7RL 1YYHA 1P5QA 1JPLA 3O4ZA 3B7BA 3CHSA 3ZYQA 2PM7A 2FF4A 3LY7A 1UJKA 4CT0A 3G2TA 3LPZA 5CRVA 1KT0A 3C98A 5C1DA 2ETAA 4JD2G 3PDNA 2LAHA 2H6HA 4UQZA 4GYYA 2R59A 4K03A 3FFLA 4HI9A 3ULEG 4CDNA 3VLFA 4I9EA 4NACA 2QZAA 4UWHA 1K1AA 2P9IG 3PE4A 2WXKA 3OXGA 4PUCA 3LCAA 1D8EA 3FEXA 1H0AA 3TGOA 4O1OA 3QAQA 1EYHA 5G05C 5AYWD 3ONLA 1WY6A 2LO6A 1HZ4A 3FDHA 5FT9A 4CZ2D 3PH0C 4N2QA 3QJZA 4AIFA 1N4PA 3FUEA 4HRLA 2AWIA 2H6FA 4HLEA 2J08A 5DBKA 4U7EB 4DX2A 4GTSA 4EZJA 4I1MA 2MOWA 4F1SA 5FJYA 2WXNA 3LY9A 2X6HA 1RZ4A 1E8WA 2WXJA 2KBXA 3UT7A 3DSUA 4C9BB 2OEVA 4KXKB 5EN5D 2IQCA 2VSOE 4GMJA 2XEHA 4GB9A 4HVBA 2R5SA 3CHRA 3O48A 3LVRE 1TEZA 2WXMA 4U07A 5B1BE 4D10C 1X81A 2F8XK 3KS2A 4GU5A 4L2YA 3NOGD 4DLOA 4AXHA 1OXJA 3HXDA 4N39A 1FCHA 3ISMC 1TYQG 5T4YA 2I2OA 1TN8A 5FQ8A 1MX2A 4BSZB 3PEUB 3ZUVB 1Y8MA 1G3NB 5KNGA 4CGWA 4EPZA 3TG5A 4ACLA 4AJWA 4JA7A 4I2WA 5EILA 4A63B 3E37A 3TG4A 2C0LA 1UOHA 1FPPA 3FUIA 5BW8C 3EHQA 2Q7FA 2I1KA 4JA9A 3ASHA 3SD5A 4BT9A 4U04A 4RG9A 5D0QD 3FTXA 4V3IA 2E2EA 3EU5A 2VSXE 1MYOA 1RW2A 1H6KA 4N3BA 3ASGA 1XGWA 3ML8A 4WWNA 1MX6A 4M7CA 4ANWA 2GGFA 1H19A 3CHOA 4B8AA 2HYZA 2MRIA 4YVQC 1ZU2A 5JA4D 4DK5A 4GZ5A 2JABA 5CBNA 3RKVA 2XCBA 4AM9A 3MCXA 5A6CA 5JMND 4EECA 4H7YA 4G25A 2B6CA 4LNBA 4F6RD 3D9JA 4FHKA 3GYZA 4N3CA 4E85A 3UTMA 4HRMB 3ASOE 2F8YA 3VTXA 4AY5A 2L0TB 2AXZA 2DWZA 2OCCE 2IJGX 3IEGA 5A7DB 3Q78A 4YVOA 3ZXPA 2FEZA 3ESKA 1NA0A 3LS8A 4GTRA 5ENOD 2OOEA 1BPOA 2V8SE 3DSTA 3LXUX 5M72A 4J0UA 3FU6A 3APCA 3C3OA 3L22A 3ZYKA 3UT4A 2CFZA 5AQ7A 3APFA 4J7WA 2R05A 3TXNA 3D9KA 4BEPA 5ENTD 4AY6A 1HG5A 1QBQA 3G2WA 4AEZC 1N0QA 2R2LA 3DSXA 4MRUA 5BXOA 4G26A 5LCWC 1TNOA 3C3QA 1VDYA 3ZGQA 1SQMA 4LUNU 4GA1A 3Q9NC 1QQEA 4UQXA 2P9KG 1HU3A 1PAQA 3HYMB 3DBSA 3EUVA 4JZYA 5HRYA 3I5PA 1E7VA 4P29A 2WVIA 4I1OB 2VTBB 4Z68A 2UY1B 4UI9C 5CMYA 5KBAA 1U3DA 4CGVA 5JJ7A 3HXEA 2ZIRA 3G2SA 1S63A 4OAVB 2RD0A 3AU4A 3JXJA 4GAAA 2EINE 1OWMA 2XCCA 3VLDA 4KMOA 3R7QA 2J49A 5B1AE 3HXCA 4OYSA 4G8KA 3Q7AA 3ZIMA 4PS3A 1AWCB 1OWOA 3Q7FA 3MV3B 4RSYA 3RSEG 5C2YA 4XIFA 4XEIG 4TRQA 3UM1A 1OCCE 1JUQA 4L9PA 5IY5E 5CEAA 2EIME 4U0ZA 2KCVA 3CLJA 3UQ3A 2CG3A 4BSXA 3Q75A 4LCTA 3CHPA 2IU1A 1OY3D 4AV7A 1V55E 2DZOA 3LVQE 3ZFWA 4YDYA 2VYIA 3J5PA 3FUMA 4BETA 4GYWA 2YHCA 1UW4B 3I4RB 1PY1A 4XI9A 2VTBA 2UY1A 3TWSA 2XEVA 1KZOA 1S64A 3FTUA 5HI7A 2OV8A 5ENQD 2CHWA 4HQDA 1IYGA 3HXBA 1N52A 4GTPA 3U9WA 5CMWA 3TWQA 3T8KA 4APOA 2IONA 2X38A 4TXPA 4C48B 5EX3A 2J09A 2WXLA 3E33A 4O60A 4YDWA 3JCKC 3BG0B 4KT6B 4ACKA 1D8DA 3E32A 2X6KA 4UQYA 3PRZA 4MBGA 2Y1LE 4J8EA 3AG3E 4U8VD 3DSVA 2YINA 3X2QE 4FJYA 5KJMA 4B94A 2NYJA 3AAAC 3LEWA 3TWRA 3DXMG 3U64A 1KT1A 4ZFHA 1ZBPA 3PREA 4BX9A 3Q15A 3FY4A 1K1BA 2WMOA 4GMRA 1MJ0A 2P9LG 3R7RA 1JCQA 3UM0A 3UKUG 4HI8A 3UIPC 3UKRG 4KVMA 3T9KA 1K8KG 1L5JA 3KSLA 3Q47B 2P9UG 3ZU7B 1N11A 4ME2A 1HE8A 1KLXA 3I3NA 3ENEA 3NF1A 2WXIA 3W9FA 1SA4A 3L13A 4Q94A 2AVPA 1NA3A 3C72A 3QKYA 2XGMA 3ML9A 2LSVA 3RJVA 1HX8A 2LXLA 5AJLA 3DEOA 2Y4UA 4ATZD 3QOUA 1EF1C 3OAWA 1UG3A 4U0SA 3LY8A 1OCOE 2J4BA 5ANLA 4PH4B 4G23A 5FQ4A 4F3VA 4JPSA 2L6BA 2KCLA 3D3MA 4G2VA 1XNFA 2A5EA 2A5UA 4FA6A 3QNKA 3S7JA 3ASNE 5AIJA 5CCMA 1N9AA 3VLEA 1BD8A 3TWVA 5G04J 2WM9A 4U0UA 1IXVA 4HXIA 2GRPB 2V4LA 4JVSA 4XKCA 3CVLA 3CVVA 4B8CB 1YMPA 4KYOB 1KPSB 5HQ8A 3RRMB 3W9GA 2J9QA 1TNBA 1NI1A 1O5MA 1LD8A 4ZHBA 4IULA 3SBSA 1NL4A 3PZ4A 4JEHA 2KCKA 1DVPA 3IBEA 4UUCA 3FTYA 5LOZA 2VSNA 1A17A 3HDXA 2DBAA 3FH5A 3NZSA 3QWPA 3UXGA 2R02A 4BX8A 3IHVA 5JHAA 3FUJA 4NRHB 2GROB 2Y4TA 4BWRA 1D9SA 1QYMA 3D9MA 3TJPA 5CECB 4HOQA 3SGHA 5HKPA 4N3AA 2KXPC 4GMLA 3SFZA 2LXMA 2EIJE 3PE3A 4R7LA 5EX0A 3IHYA 4X8QA 5ARFA 2FO7A 3MKQB 1SW6A 4ATGA 2I9CA 2IO2C 4LERA 2VQ2A 5KCMA 3CVNA 2X3MA 3EJNA 4RLYA 1HS6A 2GRQB 2FULA 3R9AB 1AP7A 4XZ4A 4GTQA 5AARA 3E34A 3KEAA 3SHFA 3V30A 3OXLA 1TNYA 2AW6A 4EZLA 1FVFA 4W9RA 3L54A 5D2MC 4OVVA 3ZRHA 3ABKE 4LNUD 2RFMA 4DLQA 2R17C 4A55A 3CSFA 3DEPA 3VTYA 1ELWA 4E6HA 2P58C 5T3RA 1OWPA 3D9PA 3QDNA 5B3SE 3L9TA 4WNDA 3R9MA 4NQ0A 3NQPA 5BXUA 5FINA 1N4RA 3CK7A 2AXUA 5KJLA 2ZGGA 5G05J 3FEYA 3CV0A 4QQIA 2XS1A 4JHJA 3IXEA 3B95A 2GRLA 3GZ2A 2ILRA 4GPMA 2QYUA 5BNWA 4XI0A 2FI7A 1SZAA 3SF4A 2GW1A 3HHMA 1TR4A 4L23A 5AAOA 4AOFA 3EIJA 3I4GA 5J90A 4APFA 3GZ1A 3ZYLA 4C0MA 4LNGA 1TNZA 3D9HA 2BUGA 5BV0A 3JXIA 1YA0A 3SFXA 4B89A 1DNPA 3PVLA 1MQSA 4ILIA 3UUXA 4CDRA 1IQRA 3HIZA 3FTZA 2DYSE 3FTWA 3UINC 4HOSA 2I1JA 3AS4A 3EU9A 4U63A 3ABLE 3S7FA 2WB2A 1BLXB 4GCNA 4ANUA 2B0OE 3CQGB 5EIBE 3BQOA 3CVUA 4KZCA 4FHJA 2X6JA 4KZ0A 2QY7A 3AJIA 5T8IA 1H2UA 1N4QA 3U66A 4I1AA 3LYAA 3FUNA 4DX1A 4H7XA 3Q79A 3TWXA 3L16A 2Y0BG 3AS8A 1OUVA 2MYOA 3ABME 2C2LA 2XENA 3BG1B 4UWKA 5FZSA 4GTMA 2RKKA 3DPDA 5CHEE 3D9OA 2YHEA 3KEZA 4EQFA 3LDZA 5AENA 2BTDA 5CCLA 2L0IA 2AJAA 1S0PA 2IO3C 4JEUA 2CHXA 2ONDA 3UIOC 2KZTB 2QFCA 1QNFA 4DX5D 3PUKA 2ETBA 3T5XA 2L9BA 1SVXA 3DWLG 3CVXA 4WUYA 3CR3A 3GZSA 4CT4A 3FU0A 4CEMA 4FLBA 2F37A 2XGOA 2XZDG 3AU5A 3ZEFA 3ASFA 2JLBA 5AQ9A 3V79K 4JHKA 4AP2A 1B89A 3QC1A 2PQRA 4XKBA 5KWDA 3RIBA 1H6PA 5G2NA 2WQ6A 2NC9A 3HRAA 3MEKA 1E8ZA 3CEQA 1NZNA 2LSUA 3UPVA 5HS0A 2BKGA 1WAO1 3FUDA 4K0RA 1MX4A 1HG2A 5AQAA 4CRWA 2ETCA 2L6JA 3G2VA 1E7UA 4BFRA 2WXGA 2WPVA 3C5RA 4RG6A 3J5QB 3APDA 3NZUA 3K9IA 2J8SD 2XHEA 3N71A 2RG8A 4A3TA 4CCAA 3NAWA 2KZTA 4Y6CA 3JQ0A 4MKTA 2Y3AA 4WAFA 3EHNA 5KJNA 1OT8A 3RK6A 3NB2A 3SFYA 4PDXA 3SO8A 3ULYA 1DCEA 3JUEA 4FADA 1OCZE 4Y6WA 5ENRD 4G1TA 3CVWA 1IHGA 3B7TA 2XRYA 5FTPA 2HM8A 4LG6A 3KAEA 3CVQA 4GTOA 3LJ3A 2I6HA 4A3VA 2H6IA 2NSZA 2YNQA 1YCSB 4MS6A 1QZ2A 2RFAA 3L17A 3JQ1A 3EHMA 2VGXB 3D9NA 1O1RA 4K5CA 1IQUA 4J6IA 2WXRA 4UI9J 1TNUA 4HB5A 2FO1E 4GZDA 3ZYMA 4HRNA 2KATA 5G04C 5AJDA 1WM5A 4EHMA 4HS2A 3JUIA 3Q9UC 4NIKA 3ZPJA 4GTVA 3CQCB 4YDOA 2XQ0A 2EILE 4YDEA 1U2VG 2IEJA 2VSYA 4TXQA 4J8SA 3ZHEB 3RO3A 4L2LA 5J08A 3IKOB 4N5QA 3UM2A 2DCPA 3G2UA 1Z3YA 4OAUC 4J8YA 3MYVA 1EPUA 3Q73A 4GZCA 4U8HA 4HLLA 4UWFA 3ASDA 3MKRA 3PEVB 1ELKA 4RQIA 3UI2A 3BU8A 3P2BA 1IKND 2VGXA 4GA0A 4F1PA 3V31A 2VGYA 4IN3B 4HFGA 4K5AB 3EHRA 1FT2A 5CEDB 5JJTA 2X6IA 3PNLB 2PL2A 3EDTB 3SZ7A 3B7SA 1DCQA 4IYPA 4TUUA 4B93B 2V5QC 2EQXA 1OCRE 3U4TA 4Q69A 2V0PA 1TJCA 5FZQA 2ZISA 3FUFA 1X5BA 4JL0A 3ESLA 5D66A 3MA5A 2A4ZA 4DUIA 4GZ3A 4CYMD 4JXTA 3ZHEA 1H2TC 3CHMA 4A1GA 4WWPA 1UJJA 4BY6A 4FJZA 3RO2A 2P9NG 4LEUA 1O1TA 5EKQD 4UWLA 2P2CP 3TWUA 3QWWA 3DRAA 1OWLA 1HFAA 1WG0A 5ARGA 3QK0A 3PZ1A 1UN9A 3MV2B 4G11A 5FQ7A 2XGSA 2GRMA 3CKCA 3CVYA 3HG0D 2UWJG 4URKA 4BESA 4M3OA 4TV3A 3LKUA 3Q49B 4F53A 3PZDA 5ENPD 1U3CA 1BU9A 5KJKA 4WNFA 4A1SA 4HORA 2XPIA 4U8YD 4O6FA 3SBTB 1INZA 4L1BA 3CSTA 5EYLA 2YQ8A 3AG2E 2WXOA 1HO8A 2CHZA 3ULQA 5CERB 3Q4AB 2E0IA 4U95D 3FUHA 1TJFA 4I17A 4QFVA 3FUKA 4IRUA 2ZGDA 2BEDA 4KBQA 1SA5A 5CBOA 5LFAA 2AXVA 4XX5A 1S70B 4J8DA 4PS8A 4I6JA 2R03A 1E90A 4U96D 3L82A 1HH8A 4JB8P 1JCSA 3SY2A 1ELRA 2QYJA 3QARA 2WXHA 3TWWA 5E76A 2QC9A 4DI4A 3UMVA 3T8MA 2KC7A 3DXKG 4I6EA 5BUZA 1BI7B 4O1PA 5D0OD 3PZ3A 3FU3A 2BF0X 3OTNA 1KZPA 2P9SG 3RU0A 3OXFA 3QB2A 1BI8B 3MJWA 3ONKA 2OVBA 5ITZF 1MZCA 4ABNA 3E4BA 2WXFA 3DSSA 3QWVA 3FH8A 4WNGA 1H6OA 4FULA 3BEEA 2XZTG 3CHQA 4B0ZA 3FTSA 3F6QA 4L7TA 4F7AA 3MKQA 2IOSA 3L6AA 2LAIA 1E8XA 1JCRA 4KVOA 3AS5A 3CGHA 2WQHA 3KD7A 3KSQA 4I2ZA 4I43A 2M63A 4GZ6A 3SI5A 4BTAA 4BT8A 5DIZA 3IV0A 3RRUA 5JJ6A 3SNXA 5EIDA 5JHBA 3FTVA 2IOLA 1LTXA 3MGBA 3ZW3A 1SZ9A 2VGEA 1K3ZD 5FQ6A 2HO1A 2PQNA 1V54E 1HXIA 3HVEB 1Z6TA 3CK9A 2OVFA 5FIOA 1MHQA 4GA2A 2PZIA 4GTTA 2FBNA 3BUAA 2DZNA 2CFUA 2XRZA 2HR2A 4GCOA 3PZ2A 4PS7A 2IF4A 1O1SA 4FC8A 3RRNB 2J07A 4XE0A 4G8LA 1N54A 4DRXE 5KNHD 2BKKB 2KM4A 4C0EA 4G24A 2WMNA 4AVXA 4BERA 4BTBA 3U3WA 5ENSD 2MHKA 3MX3A 2VJ8A 2JEKA 3UT8A 3S2AA 3UX4A 4N5CA 4LSZE 4FP7A 3AG1E 2DIWA 1NP7A 3FH7A 2V5FA 3TAXA 3P1UA 2IY0C 3PS6A 4TUMA 2ZU6B 4J8FA 4HOUA 3EIQC 4EBAG 3L08A 3WG7E 4MLPA 3HVEA 2NXPA 1Z5SC 2C0MA 4DX6D 3S7BA 5LX8A 4HOTA 2X6FA 2XEEA 4ANXA 1W3BA 1EDUA 1UN8A 3ZXSA 4NURA 4DX7D 4EBAA 3FWVA 3LJNA 4ILHB 3NOCD 3URZA 3DSWA 5AQBA 5BPPA 1OWNA 4DJAA 5FWQA 2EIKE 3S7DA 5H7PA 2XPYA 3PUJA 1TN7A 4FU3A 4HBDA 3NBNB 1DC2A 3CIAA 5G55A 1NFIE 4ILGA 3TXMA 4ANVA 3UM3A 2V4HC 4K5BA 2Y69E 2J4DA 4JC8A 3ZKJA 5AN8A 2WXPA 1E96B 3FU5A 2LNIA 2XPZA 4UWGA 4I9CA 4WNEA 1FVHA 3SQVA 2GRRB 3C3RA 3TWTA 2HE0A 5LCWJ 3D9LA 3ZNGA 3FHEA 3HXFA 4FLHA 4N2SA 5FZRA 2DYRE 4LRZA 3CVPA 5EDSA 3DPYA 1N4SA 1IHBA 3D9IA 1LF8A 3WXXA 5BT1A 1JWGA 3PNTB 2LUHA 4DPRA 4Q96A 5EYPF 1Y6IA 3FP3A 3CK8A 1Z3XA 3JYSA 4CDMA 3V2XA 4HNAD 1GW6A 2PNNA 1PC2A 4JW1A 2F0YA 3RAUA 4JHRA 4I6GA 4UI9K 1N0RA 1E8YA 1WDYA 4OVUA 4EZKA 1FT1A 4TXRA 1ZB1A 1HF8A 4GPKA 3E30A 1A5EA 2OEWA 2P9PG 3GW4A 3CKBA 4WWOA 2WQ7A 3ZVVA 4GYOA 2GRNB 1N95A 2XS8A 3V2OA 1TN6A 3B7UX 5A23A 2ZXWE 2WXQA 3AG4E 4DI3A 5ENNA 2DVWA 2IFUA 3Q5MA 1LD7A 5BV1A 3MZLB 3FULA 2PM6A 1N94A 1H2VC 5CRUA 3TL5A 2H6GA 3T5VA 5ANRA 3B13A
chains in the Genus database with same CATH topology
4YNDA 3ZN3A 2YHCA 4RVBA 1UW4B 4H7XA 5LP0A 5E75A 2CG2A 1JWFA 1HH8A 3B7RL 3L16A 1P5QA 3I4RB 3AS8A 1OUVA 1PY1A 4XI9A 2VTBA 1ELRA 2UY1A 1JPLA 3QARA 2WXHA 3O4ZA 2XEVA 5E76A 4DI4A 3CHSA 2C2LA 3UMVA 3ZYQA 2PM7A 3FTUA 3BG1B 2FF4A 4UWKA 5HI7A 3LY7A 1UJKA 5FZSA 3T8MA 2OV8A 2CHWA 2KC7A 4CT0A 4I6EA 5BUZA 3G2TA 5D0OD 3FU3A 2BF0X 3DPDA 3LPZA 3OTNA 1KT0A 5CHEE 1IYGA 3C98A 3D9OA 1N52A 2YHEA 3OXFA 3RU0A 3U9WA 5C1DA 3QB2A 3KEZA 5CMWA 4EQFA 3LDZA 3PDNA 2LAHA 2BTDA 3MJWA 5AENA 4APOA 5CCLA 3ONKA 4UQZA 2IONA 2L0IA 4GYYA 2X38A 2OVBA 2R59A 4K03A 1S0PA 5EX3A 2J09A 3FFLA 4ABNA 3E4BA 4CDNA 3VLFA 4JEUA 2WXLA 2WXFA 2CHXA 2ONDA 3QWVA 4I9EA 3JCKC 4NACA 3BG0B 4KT6B 4ACKA 4UWHA 2KZTB 2X6KA 4UQYA 3FH8A 3PRZA 4WNGA 4FULA 4J8EA 3BEEA 2QFCA 1QNFA 3PE4A 2WXKA 3OXGA 4PUCA 3LCAA 3CHQA 3PUKA 4B0ZA 3FTSA 2YINA 4L7TA 4F7AA 3T5XA 4FJYA 2L9BA 3FEXA 4B94A 3MKQA 5KJMA 2IOSA 1H0AA 3LEWA 3U64A 3TGOA 3L6AA 3CVXA 1KT1A 2LAIA 4WUYA 1E8XA 1ZBPA 3QAQA 1EYHA 3CR3A 3GZSA 3PREA 4KVOA 5G05C 4BX9A 5AYWD 4CT4A 3AS5A 3CGHA 3Q15A 3ONLA 2WQHA 3FU0A 3FY4A 4CEMA 1WY6A 2WMOA 4FLBA 2XGOA 3KD7A 3AU5A 3ZEFA 3ASFA 4I2ZA 2LO6A 4I43A 1HZ4A 3FDHA 2M63A 3R7RA 2JLBA 4GZ6A 3SI5A 4BTAA 4BT8A 5DIZA 5FT9A 4JHKA 4AP2A 3IV0A 1B89A 3PH0C 3QC1A 2PQRA 4N2QA 3RRUA 5JJ6A 4KVMA 4XKBA 3RIBA 3SNXA 3QJZA 4AIFA 5JHBA 3FTVA 1L5JA 5G2NA 3Q47B 3FUEA 2IOLA 2AWIA 4HLEA 2J08A 3MGBA 2WQ6A 2NC9A 1SZ9A 3ZW3A 5DBKA 3MEKA 1E8ZA 4EZJA 4I1MA 4ME2A 3CEQA 2MOWA 5FQ6A 4F1SA 1NZNA 5FJYA 2HO1A 2PQNA 2LSUA 1HE8A 3UPVA 2WXNA 1WAO1 3FUDA 3LY9A 4K0RA 2X6HA 1E8WA 2WXJA 1KLXA 1HXIA 1HG2A 3UT7A 3I3NA 4CRWA 2L6JA 3HVEB 4C9BB 1Z6TA 3G2VA 3CK9A 1E7UA 3ENEA 4BFRA 4KXKB 2OVFA 3NF1A 2WXGA 2IQCA 2VSOE 2WPVA 4GMJA 1MHQA 4GA2A 4RG6A 2WXIA 2PZIA 3APDA 3NZUA 4GB9A 3K9IA 2XHEA 4HVBA 3N71A 3L13A 2RG8A 2AVPA 4Q94A 1NA3A 2R5SA 3CHRA 3LVRE 3O48A 4A3TA 4CCAA 1TEZA 2WXMA 4U07A 2FBNA 3QKYA 2XGMA 3ML9A 4D10C 2LSVA 2KZTA 4Y6CA 3RJVA 2CFUA 3JQ0A 2XRZA 1HX8A 2HR2A 4MKTA 4GCOA 3KS2A 4GU5A 4L2YA 2Y3AA 4WAFA 3EHNA 5AJLA 4DLOA 5KJNA 2Y4UA 4AXHA 4PS7A 3QOUA 1EF1C 3RK6A 3OAWA 2IF4A 1FCHA 4N39A 1UG3A 4FC8A 4PDXA 4U0SA 3LY8A 5ANRA 2J4BA 5T4YA 3RRNB 2J07A 5ANLA 4XE0A 4FADA 4PH4B 4Y6WA 4G23A 2I2OA 5FQ4A 1N54A 4G1TA 4F3VA 5FQ8A 4JPSA 3CVWA 2KCLA 3D3MA 1IHGA 2KM4A 3PEUB 4C0EA 4G2VA 2WMNA 4G24A 1XNFA 1Y8MA 4AVXA 3B7TA 2XRYA 2A5UA 4FA6A 5FTPA 4BTBA 3U3WA 4CGWA 3QNKA 2MHKA 3S7JA 3MX3A 4EPZA 2VJ8A 2HM8A 3TG5A 4ACLA 3KAEA 3CVQA 4AJWA 4JA7A 5AIJA 3LJ3A 5CCMA 4I2WA 2JEKA 2I6HA 3VLEA 3TG4A 4A3VA 2C0LA 3UT8A 3S2AA 3UX4A 2NSZA 2YNQA 4MS6A 4N5CA 3FUIA 5G04J 5BW8C 1QZ2A 2WM9A 4FP7A 4U0UA 3L17A 2Q7FA 3JQ1A 2DIWA 3EHMA 1NP7A 2VGXB 2I1KA 3FH7A 4JA9A 3D9NA 4HXIA 3ASHA 3SD5A 2V5FA 4BT9A 4U04A 2V4LA 4JVSA 4RG9A 3TAXA 1IQUA 3P1UA 4XKCA 5D0QD 4J6IA 3PS6A 3FTXA 3CVLA 4V3IA 2WXRA 4UI9J 3CVVA 2ZU6B 4B8CB 2E2EA 4KYOB 2VSXE 5HQ8A 4J8FA 4HOUA 3RRMB 1H6KA 3EIQC 4GZDA 4EBAG 3ZYMA 3L08A 4MLPA 2J9QA 3HVEA 4N3BA 3ASGA 1XGWA 2NXPA 2KATA 3ML8A 4WWNA 5G04C 2C0MA 4ANWA 2GGFA 1H19A 1WM5A 3CHOA 5AJDA 3S7BA 4HS2A 3JUIA 4IULA 4B8AA 3SBSA 5LX8A 4HOTA 4JEHA 2HYZA 2X6FA 4ANXA 1W3BA 2MRIA 1EDUA 3ZPJA 4YVQC 1ZU2A 2KCKA 1UN8A 3ZXSA 3CQCB 4NURA 4DK5A 1DVPA 2XQ0A 3IBEA 4GZ5A 4EBAA 3FWVA 3FTYA 5LOZA 4ILHB 2VSNA 2VSYA 1A17A 3RKVA 3URZA 3HDXA 2DBAA 2XCBA 3FH5A 3NZSA 4AM9A 3QWPA 5BPPA 3MCXA 1OWNA 5A6CA 4J8SA 4DJAA 5FWQA 3ZHEB 3RO3A 4BX8A 4EECA 4H7YA 4L2LA 4G25A 3IHVA 5J08A 3IKOB 5JHAA 3S7DA 3FUJA 3D9JA 4NRHB 2Y4TA 4FHKA 2XPYA 3GYZA 4N3CA 3PUJA 2DCPA 4BWRA 4E85A 4FU3A 3G2UA 3D9MA 3TJPA 1Z3YA 4HOQA 3MYVA 3CIAA 3SGHA 1EPUA 4N3AA 4GMLA 4GZCA 5G55A 3SFZA 4U8HA 3VTXA 2L0TB 2AXZA 4AY5A 3PE3A 4R7LA 4UWFA 5EX0A 4ILGA 2IJGX 3ASDA 3TXMA 4ANVA 3MKRA 3IHYA 5ARFA 2FO7A 3PEVB 1ELKA 3IEGA 2J4DA 3MKQB 4JC8A 4ATGA 2I9CA 5A7DB 3P2BA 4LERA 4YVOA 2VGXA 4GA0A 2FEZA 2VQ2A 5KCMA 3CVNA 3ESKA 2X3MA 1NA0A 3LS8A 2OOEA 2WXPA 1BPOA 2VGYA 4IN3B 2V8SE 3EJNA 1E96B 1HS6A 3FU5A 4HFGA 2FULA 3R9AB 2LNIA 2XPZA 4UWGA 3LXUX 4I9CA 4XZ4A 5M72A 4J0UA 3FU6A 3APCA 4WNEA 1FVHA 5JJTA 3L22A 3ZYKA 2X6IA 2CFZA 3UT4A 3PNLB 5LCWJ 3SHFA 3D9LA 2PL2A 3EDTB 3OXLA 3SZ7A 3B7SA 3APFA 3FHEA 4IYPA 4FLHA 4TUUA 2AW6A 4EZLA 2EQXA 3U4TA 4Q69A 1FVFA 4W9RA 4N2SA 2V0PA 3TXNA 5FZRA 3D9KA 1TJCA 3L54A 4OVVA 5FZQA 3ZRHA 4AY6A 4LRZA 1HG5A 3CVPA 3FUFA 5EDSA 1X5BA 3G2WA 4JL0A 4DLQA 2R17C 4AEZC 3CSFA 4A55A 3VTYA 1ELWA 4E6HA 2P58C 1OWPA 3D9PA 3D9IA 3ESLA 3QDNA 5T3RA 3MA5A 1LF8A 4MRUA 2A4ZA 4WNDA 4GZ3A 4NQ0A 3NQPA 4G26A 3WXXA 5LCWC 5BT1A 4JXTA 1JWGA 3ZHEA 1H2TC 3CHMA 3CK7A 4A1GA 1VDYA 3PNTB 3ZGQA 4WWPA 1SQMA 2AXUA 4LUNU 4GA1A 5KJLA 1UJJA 4BY6A 1QQEA 4UQXA 4DPRA 4Q96A 4FJZA 1Y6IA 5G05J 3FEYA 3FP3A 3CK8A 1HU3A 3CV0A 1PAQA 3HYMB 3RO2A 1Z3XA 3JYSA 4CDMA 3DBSA 4LEUA 4JZYA 4JHJA 3I5PA 5EKQD 1E7VA 2GRLA 3GZ2A 2ILRA 1GW6A 4UWLA 5BNWA 4P29A 3QWWA 4XI0A 2WVIA 1PC2A 4JW1A 4I1OB 2FI7A 1OWLA 1SZAA 1HFAA 2GW1A 3SF4A 2VTBB 2UY1B 3HHMA 4UI9C 5ARGA 4JHRA 3QK0A 4I6GA 4L23A 4UI9K 1E8YA 1UN9A 3MV2B 4G11A 5CMYA 1U3DA 4CGVA 4OVUA 5FQ7A 4AOFA 2XGSA 5JJ7A 3EIJA 3I4GA 3G2SA 4EZKA 2GRMA 1HF8A 5J90A 3CKCA 4APFA 3GZ1A 3CVYA 2RD0A 2UWJG 3ZYLA 4GPKA 4C0MA 3AU4A 4URKA 4GAAA 1OWMA 2XCCA 4M3OA 3VLDA 4KMOA 3R7QA 4TV3A 3GW4A 3CKBA 4WWOA 3LKUA 2J49A 2BUGA 5BV0A 3Q49B 4F53A 1YA0A 2WQ7A 3PZDA 4OYSA 3ZVVA 3ZIMA 4GYOA 4PS3A 1U3CA 4B89A 1DNPA 3PVLA 5KJKA 1OWOA 4WNFA 1MQSA 4A1SA 4HORA 4ILIA 3UUXA 3MV3B 4RSYA 2XPIA 4CDRA 3B7UX 4O6FA 5A23A 1IQRA 5C2YA 4XIFA 3SBTB 2WXQA 1INZA 3HIZA 3FTZA 4TRQA 4L1BA 3CSTA 2YQ8A 1JUQA 4DI3A 3FTWA 2WXOA 4HOSA 1HO8A 2CHZA 3ULQA 5ENNA 2I1JA 3AS4A 3Q4AB 4U63A 4U0ZA 2KCVA 2E0IA 3CLJA 2IFUA 3UQ3A 2CG3A 3FUHA 3S7FA 4BSXA 2WB2A 3Q5MA 4GCNA 4ANUA 1TJFA 3CQGB 3CVUA 4I17A 4KZCA 4FHJA 5BV1A 4LCTA 3CHPA 2IU1A 4QFVA 3FUKA 2X6JA 4IRUA 3MZLB 4AV7A 4KZ0A 2QY7A 3FULA 2PM6A 1H2UA 5T8IA 3LVQE 1H2VC 3ZFWA 4KBQA 2VYIA 3TL5A 3U66A 5LFAA 2AXVA 4XX5A 4J8DA 3T5VA 4I1AA 3FUMA 3LYAA 4PS8A 4I6JA 1E90A 3FUNA 3B13A 4GYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YND A;  3ZN3 A;  2YHC A;  4H7X A;  1HH8 A;  1P5Q A;  3AS8 A;  1OUV A;  4XI9 A;  1ELR A;  2UY1 A;  2XEV A;  2C2L A;  2FF4 A;  5HI7 A;  3LY7 A;  5FZS A;  2KC7 A;  5D0O D;  3LPZ A;  5CHE E;  1KT0 A;  1IYG A;  3RU0 A;  3OXF A;  5C1D A;  4EQF A;  3PDN A;  4APO A;  5CCL A;  4UQZ A;  4GYY A;  5EX3 A;  4ABN A;  3FFL A;  3E4B A;  2OND A;  3QWV A;  4I9E A;  4UQY A;  4WNG A;  4J8E A;  3BEE A;  2QFC A;  3PE4 A;  3OXG A;  3LCA A;  5KJM A;  4B94 A;  3TGO A;  1KT1 A;  4WUY A;  1ZBP A;  5G05 C;  5AYW D;  3AS5 A;  3Q15 A;  2WQH A;  2XGO A;  3KD7 A;  3ASF A;  4I2Z A;  1HZ4 A;  2JLB A;  4GZ6 A;  4BTA A;  4BT8 A;  5DIZ A;  5FT9 A;  1B89 A;  2PQR A;  4N2Q A;  5JJ6 A;  3RIB A;  4AIF A;  3Q47 B;  2NC9 A;  5DBK A;  3MEK A;  4ME2 A;  3CEQ A;  1NZN A;  5FJY A;  2HO1 A;  2PQN A;  2LSU A;  3UPV A;  1WAO 1;  3LY9 A;  1KLX A;  1HXI A;  2L6J A;  3CK9 A;  4KXK B;  3NF1 A;  2WPV A;  4GA2 A;  4RG6 A;  2PZI A;  3K9I A;  3N71 A;  2AVP A;  1NA3 A;  2R5S A;  3O48 A;  4U07 A;  2FBN A;  3QKY A;  2XGM A;  2LSV A;  4Y6C A;  3RJV A;  2HR2 A;  4GCO A;  3KS2 A;  5KJN A;  2Y4U A;  3QOU A;  4N39 A;  2IF4 A;  1FCH A;  4U0S A;  3LY8 A;  4Y6W A;  4G23 A;  4G1T A;  4F3V A;  2KCL A;  1IHG A;  4G2V A;  4G24 A;  1XNF A;  1Y8M A;  5FTP A;  4BTB A;  3U3W A;  4CGW A;  2MHK A;  3S7J A;  3TG5 A;  3KAE A;  3CVQ A;  4JA7 A;  5CCM A;  4I2W A;  2I6H A;  3TG4 A;  2C0L A;  4N5C A;  5G04 J;  5BW8 C;  1QZ2 A;  4U0U A;  2Q7F A;  2VGX B;  4JA9 A;  3ASH A;  2V5F A;  4BT9 A;  4U04 A;  4RG9 A;  3TAX A;  5D0Q D;  3CVL A;  4UI9 J;  2E2E A;  4KYO B;  5HQ8 A;  4J8F A;  4HOU A;  2J9Q A;  4N3B A;  3ASG A;  2KAT A;  5G04 C;  2C0M A;  1WM5 A;  3S7B A;  4HOT A;  2HYZ A;  1W3B A;  3ZPJ A;  4YVQ C;  1ZU2 A;  2KCK A;  4GZ5 A;  3FWV A;  2VSN A;  2VSY A;  1A17 A;  3RKV A;  3URZ A;  2DBA A;  2XCB A;  4AM9 A;  3QWP A;  5A6C A;  3ZHE B;  3RO3 A;  4H7Y A;  4G25 A;  3S7D A;  4NRH B;  2Y4T A;  3GYZ A;  4N3C A;  4BWR A;  4HOQ A;  4N3A A;  3VTX A;  4AY5 A;  3PE3 A;  5EX0 A;  3ASD A;  3MKR A;  5ARF A;  2FO7 A;  3IEG A;  5A7D B;  4YVO A;  2VGX A;  4GA0 A;  2FEZ A;  2VQ2 A;  3CVN A;  3ESK A;  1NA0 A;  2OOE A;  2VGY A;  4IN3 B;  1E96 B;  3R9A B;  2LNI A;  4I9C A;  5M72 A;  4J0U A;  4WNE A;  5JJT A;  5LCW J;  2PL2 A;  3EDT B;  3OXL A;  3SZ7 A;  3U4T A;  4W9R A;  4N2S A;  5FZR A;  1TJC A;  5FZQ A;  4AY6 A;  3CVP A;  4JL0 A;  3VTY A;  1ELW A;  2P58 C;  3QDN A;  3MA5 A;  4WND A;  4GZ3 A;  4NQ0 A;  4G26 A;  3WXX A;  5LCW C;  5BT1 A;  3ZHE A;  3CK7 A;  3ZGQ A;  5KJL A;  4GA1 A;  1QQE A;  4UQX A;  5G05 J;  3FP3 A;  3CK8 A;  3CV0 A;  3HYM B;  3RO2 A;  3JYS A;  4LEU A;  5EKQ D;  3GZ2 A;  5BNW A;  3QWW A;  4XI0 A;  1PC2 A;  2FI7 A;  3SF4 A;  2GW1 A;  2UY1 B;  4UI9 C;  5ARG A;  4JHR A;  4UI9 K;  3MV2 B;  4CGV A;  5JJ7 A;  2XGS A;  3CKC A;  3GZ1 A;  2UWJ G;  4GPK A;  2XCC A;  3GW4 A;  3CKB A;  3LKU A;  2BUG A;  3Q49 B;  1YA0 A;  4GYO A;  5KJK A;  4WNF A;  4A1S A;  4HOR A;  3UUX A;  3MV3 B;  2XPI A;  4CDR A;  4O6F A;  4XIF A;  2YQ8 A;  4HOS A;  3ULQ A;  3AS4 A;  3Q4A B;  4U0Z A;  2KCV A;  2IFU A;  3UQ3 A;  3S7F A;  3Q5M A;  4GCN A;  4I17 A;  3ZFW A;  4KBQ A;  2VYI A;  4J8D A;  4I1A A;  3LYA A;  4GYW A; 
#chains in the Genus database with same CATH topology
 4YND A;  3ZN3 A;  1Q2Z A;  4RVB A;  5LP0 A;  5E75 A;  2CG2 A;  1JWF A;  3B7R L;  1YYH A;  1P5Q A;  1JPL A;  3O4Z A;  3B7B A;  3CHS A;  3ZYQ A;  2PM7 A;  2FF4 A;  3LY7 A;  1UJK A;  4CT0 A;  3G2T A;  3LPZ A;  5CRV A;  1KT0 A;  3C98 A;  5C1D A;  2ETA A;  4JD2 G;  3PDN A;  2LAH A;  2H6H A;  4UQZ A;  4GYY A;  2R59 A;  4K03 A;  3FFL A;  4HI9 A;  3ULE G;  4CDN A;  3VLF A;  4I9E A;  4NAC A;  2QZA A;  4UWH A;  1K1A A;  2P9I G;  3PE4 A;  2WXK A;  3OXG A;  4PUC A;  3LCA A;  1D8E A;  3FEX A;  1H0A A;  3TGO A;  4O1O A;  3QAQ A;  1EYH A;  5G05 C;  5AYW D;  3ONL A;  1WY6 A;  2LO6 A;  1HZ4 A;  3FDH A;  5FT9 A;  4CZ2 D;  3PH0 C;  4N2Q A;  3QJZ A;  4AIF A;  1N4P A;  3FUE A;  4HRL A;  2AWI A;  2H6F A;  4HLE A;  2J08 A;  5DBK A;  4U7E B;  4DX2 A;  4GTS A;  4EZJ A;  4I1M A;  2MOW A;  4F1S A;  5FJY A;  2WXN A;  3LY9 A;  2X6H A;  1RZ4 A;  1E8W A;  2WXJ A;  2KBX A;  3UT7 A;  3DSU A;  4C9B B;  2OEV A;  4KXK B;  5EN5 D;  2IQC A;  2VSO E;  4GMJ A;  2XEH A;  4GB9 A;  4HVB A;  2R5S A;  3CHR A;  3O48 A;  3LVR E;  1TEZ A;  2WXM A;  4U07 A;  5B1B E;  4D10 C;  1X81 A;  2F8X K;  3KS2 A;  4GU5 A;  4L2Y A;  3NOG D;  4DLO A;  4AXH A;  1OXJ A;  3HXD A;  4N39 A;  1FCH A;  3ISM C;  1TYQ G;  5T4Y A;  2I2O A;  1TN8 A;  5FQ8 A;  1MX2 A;  4BSZ B;  3PEU B;  3ZUV B;  1Y8M A;  1G3N B;  5KNG A;  4CGW A;  4EPZ A;  3TG5 A;  4ACL A;  4AJW A;  4JA7 A;  4I2W A;  5EIL A;  4A63 B;  3E37 A;  3TG4 A;  2C0L A;  1UOH A;  1FPP A;  3FUI A;  5BW8 C;  3EHQ A;  2Q7F A;  2I1K A;  4JA9 A;  3ASH A;  3SD5 A;  4BT9 A;  4U04 A;  4RG9 A;  5D0Q D;  3FTX A;  4V3I A;  2E2E A;  3EU5 A;  2VSX E;  1MYO A;  1RW2 A;  1H6K A;  4N3B A;  3ASG A;  1XGW A;  3ML8 A;  4WWN A;  1MX6 A;  4M7C A;  4ANW A;  2GGF A;  1H19 A;  3CHO A;  4B8A A;  2HYZ A;  2MRI A;  4YVQ C;  1ZU2 A;  5JA4 D;  4DK5 A;  4GZ5 A;  2JAB A;  5CBN A;  3RKV A;  2XCB A;  4AM9 A;  3MCX A;  5A6C A;  5JMN D;  4EEC A;  4H7Y A;  4G25 A;  2B6C A;  4LNB A;  4F6R D;  3D9J A;  4FHK A;  3GYZ A;  4N3C A;  4E85 A;  3UTM A;  4HRM B;  3ASO E;  2F8Y A;  3VTX A;  4AY5 A;  2L0T B;  2AXZ A;  2DWZ A;  2OCC E;  2IJG X;  3IEG A;  5A7D B;  3Q78 A;  4YVO A;  3ZXP A;  2FEZ A;  3ESK A;  1NA0 A;  3LS8 A;  4GTR A;  5ENO D;  2OOE A;  1BPO A;  2V8S E;  3DST A;  3LXU X;  5M72 A;  4J0U A;  3FU6 A;  3APC A;  3C3O A;  3L22 A;  3ZYK A;  3UT4 A;  2CFZ A;  5AQ7 A;  3APF A;  4J7W A;  2R05 A;  3TXN A;  3D9K A;  4BEP A;  5ENT D;  4AY6 A;  1HG5 A;  1QBQ A;  3G2W A;  4AEZ C;  1N0Q A;  2R2L A;  3DSX A;  4MRU A;  5BXO A;  4G26 A;  5LCW C;  1TNO A;  3C3Q A;  1VDY A;  3ZGQ A;  1SQM A;  4LUN U;  4GA1 A;  3Q9N C;  1QQE A;  4UQX A;  2P9K G;  1HU3 A;  1PAQ A;  3HYM B;  3DBS A;  3EUV A;  4JZY A;  5HRY A;  3I5P A;  1E7V A;  4P29 A;  2WVI A;  4I1O B;  2VTB B;  4Z68 A;  2UY1 B;  4UI9 C;  5CMY A;  5KBA A;  1U3D A;  4CGV A;  5JJ7 A;  3HXE A;  2ZIR A;  3G2S A;  1S63 A;  4OAV B;  2RD0 A;  3AU4 A;  3JXJ A;  4GAA A;  2EIN E;  1OWM A;  2XCC A;  3VLD A;  4KMO A;  3R7Q A;  2J49 A;  5B1A E;  3HXC A;  4OYS A;  4G8K A;  3Q7A A;  3ZIM A;  4PS3 A;  1AWC B;  1OWO A;  3Q7F A;  3MV3 B;  4RSY A;  3RSE G;  5C2Y A;  4XIF A;  4XEI G;  4TRQ A;  3UM1 A;  1OCC E;  1JUQ A;  4L9P A;  5IY5 E;  5CEA A;  2EIM E;  4U0Z A;  2KCV A;  3CLJ A;  3UQ3 A;  2CG3 A;  4BSX A;  3Q75 A;  4LCT A;  3CHP A;  2IU1 A;  1OY3 D;  4AV7 A;  1V55 E;  2DZO A;  3LVQ E;  3ZFW A;  4YDY A;  2VYI A;  3J5P A;  3FUM A;  4BET A;  4GYW A;  2YHC A;  1UW4 B;  3I4R B;  1PY1 A;  4XI9 A;  2VTB A;  2UY1 A;  3TWS A;  2XEV A;  1KZO A;  1S64 A;  3FTU A;  5HI7 A;  2OV8 A;  5ENQ D;  2CHW A;  4HQD A;  1IYG A;  3HXB A;  1N52 A;  4GTP A;  3U9W A;  5CMW A;  3TWQ A;  3T8K A;  4APO A;  2ION A;  2X38 A;  4TXP A;  4C48 B;  5EX3 A;  2J09 A;  2WXL A;  3E33 A;  4O60 A;  4YDW A;  3JCK C;  3BG0 B;  4KT6 B;  4ACK A;  1D8D A;  3E32 A;  2X6K A;  4UQY A;  3PRZ A;  4MBG A;  2Y1L E;  4J8E A;  3AG3 E;  4U8V D;  3DSV A;  2YIN A;  3X2Q E;  4FJY A;  5KJM A;  4B94 A;  2NYJ A;  3AAA C;  3LEW A;  3TWR A;  3DXM G;  3U64 A;  1KT1 A;  4ZFH A;  1ZBP A;  3PRE A;  4BX9 A;  3Q15 A;  3FY4 A;  1K1B A;  2WMO A;  4GMR A;  1MJ0 A;  2P9L G;  3R7R A;  1JCQ A;  3UM0 A;  3UKU G;  4HI8 A;  3UIP C;  3UKR G;  4KVM A;  3T9K A;  1K8K G;  1L5J A;  3KSL A;  3Q47 B;  2P9U G;  3ZU7 B;  1N11 A;  4ME2 A;  1HE8 A;  1KLX A;  3I3N A;  3ENE A;  3NF1 A;  2WXI A;  3W9F A;  1SA4 A;  3L13 A;  4Q94 A;  2AVP A;  1NA3 A;  3C72 A;  3QKY A;  2XGM A;  3ML9 A;  2LSV A;  3RJV A;  1HX8 A;  2LXL A;  5AJL A;  3DEO A;  2Y4U A;  4ATZ D;  3QOU A;  1EF1 C;  3OAW A;  1UG3 A;  4U0S A;  3LY8 A;  1OCO E;  2J4B A;  5ANL A;  4PH4 B;  4G23 A;  5FQ4 A;  4F3V A;  4JPS A;  2L6B A;  2KCL A;  3D3M A;  4G2V A;  1XNF A;  2A5E A;  2A5U A;  4FA6 A;  3QNK A;  3S7J A;  3ASN E;  5AIJ A;  5CCM A;  1N9A A;  3VLE A;  1BD8 A;  3TWV A;  5G04 J;  2WM9 A;  4U0U A;  1IXV A;  4HXI A;  2GRP B;  2V4L A;  4JVS A;  4XKC A;  3CVL A;  3CVV A;  4B8C B;  1YMP A;  4KYO B;  1KPS B;  5HQ8 A;  3RRM B;  3W9G A;  2J9Q A;  1TNB A;  1NI1 A;  1O5M A;  1LD8 A;  4ZHB A;  4IUL A;  3SBS A;  1NL4 A;  3PZ4 A;  4JEH A;  2KCK A;  1DVP A;  3IBE A;  4UUC A;  3FTY A;  5LOZ A;  2VSN A;  1A17 A;  3HDX A;  2DBA A;  3FH5 A;  3NZS A;  3QWP A;  3UXG A;  2R02 A;  4BX8 A;  3IHV A;  5JHA A;  3FUJ A;  4NRH B;  2GRO B;  2Y4T A;  4BWR A;  1D9S A;  1QYM A;  3D9M A;  3TJP A;  5CEC B;  4HOQ A;  3SGH A;  5HKP A;  4N3A A;  2KXP C;  4GML A;  3SFZ A;  2LXM A;  2EIJ E;  3PE3 A;  4R7L A;  5EX0 A;  3IHY A;  4X8Q A;  5ARF A;  2FO7 A;  3MKQ B;  1SW6 A;  4ATG A;  2I9C A;  2IO2 C;  4LER A;  2VQ2 A;  5KCM A;  3CVN A;  2X3M A;  3EJN A;  4RLY A;  1HS6 A;  2GRQ B;  2FUL A;  3R9A B;  1AP7 A;  4XZ4 A;  4GTQ A;  5AAR A;  3E34 A;  3KEA A;  3SHF A;  3V30 A;  3OXL A;  1TNY A;  2AW6 A;  4EZL A;  1FVF A;  4W9R A;  3L54 A;  5D2M C;  4OVV A;  3ZRH A;  3ABK E;  4LNU D;  2RFM A;  4DLQ A;  2R17 C;  4A55 A;  3CSF A;  3DEP A;  3VTY A;  1ELW A;  4E6H A;  2P58 C;  5T3R A;  1OWP A;  3D9P A;  3QDN A;  5B3S E;  3L9T A;  4WND A;  3R9M A;  4NQ0 A;  3NQP A;  5BXU A;  5FIN A;  1N4R A;  3CK7 A;  2AXU A;  5KJL A;  2ZGG A;  5G05 J;  3FEY A;  3CV0 A;  4QQI A;  2XS1 A;  4JHJ A;  3IXE A;  3B95 A;  2GRL A;  3GZ2 A;  2ILR A;  4GPM A;  2QYU A;  5BNW A;  4XI0 A;  2FI7 A;  1SZA A;  3SF4 A;  2GW1 A;  3HHM A;  1TR4 A;  4L23 A;  5AAO A;  4AOF A;  3EIJ A;  3I4G A;  5J90 A;  4APF A;  3GZ1 A;  3ZYL A;  4C0M A;  4LNG A;  1TNZ A;  3D9H A;  2BUG A;  5BV0 A;  3JXI A;  1YA0 A;  3SFX A;  4B89 A;  1DNP A;  3PVL A;  1MQS A;  4ILI A;  3UUX A;  4CDR A;  1IQR A;  3HIZ A;  3FTZ A;  2DYS E;  3FTW A;  3UIN C;  4HOS A;  2I1J A;  3AS4 A;  3EU9 A;  4U63 A;  3ABL E;  3S7F A;  2WB2 A;  1BLX B;  4GCN A;  4ANU A;  2B0O E;  3CQG B;  5EIB E;  3BQO A;  3CVU A;  4KZC A;  4FHJ A;  2X6J A;  4KZ0 A;  2QY7 A;  3AJI A;  5T8I A;  1H2U A;  1N4Q A;  3U66 A;  4I1A A;  3LYA A;  3FUN A;  4DX1 A;  4H7X A;  3Q79 A;  3TWX A;  3L16 A;  2Y0B G;  3AS8 A;  1OUV A;  2MYO A;  3ABM E;  2C2L A;  2XEN A;  3BG1 B;  4UWK A;  5FZS A;  4GTM A;  2RKK A;  3DPD A;  5CHE E;  3D9O A;  2YHE A;  3KEZ A;  4EQF A;  3LDZ A;  5AEN A;  2BTD A;  5CCL A;  2L0I A;  2AJA A;  1S0P A;  2IO3 C;  4JEU A;  2CHX A;  2OND A;  3UIO C;  2KZT B;  2QFC A;  1QNF A;  4DX5 D;  3PUK A;  2ETB A;  3T5X A;  2L9B A;  1SVX A;  3DWL G;  3CVX A;  4WUY A;  3CR3 A;  3GZS A;  4CT4 A;  3FU0 A;  4CEM A;  4FLB A;  2F37 A;  2XGO A;  2XZD G;  3AU5 A;  3ZEF A;  3ASF A;  2JLB A;  5AQ9 A;  3V79 K;  4JHK A;  4AP2 A;  1B89 A;  3QC1 A;  2PQR A;  4XKB A;  5KWD A;  3RIB A;  1H6P A;  5G2N A;  2WQ6 A;  2NC9 A;  3HRA A;  3MEK A;  1E8Z A;  3CEQ A;  1NZN A;  2LSU A;  3UPV A;  5HS0 A;  2BKG A;  1WAO 1;  3FUD A;  4K0R A;  1MX4 A;  1HG2 A;  5AQA A;  4CRW A;  2ETC A;  2L6J A;  3G2V A;  1E7U A;  4BFR A;  2WXG A;  2WPV A;  3C5R A;  4RG6 A;  3J5Q B;  3APD A;  3NZU A;  3K9I A;  2J8S D;  2XHE A;  3N71 A;  2RG8 A;  4A3T A;  4CCA A;  3NAW A;  2KZT A;  4Y6C A;  3JQ0 A;  4MKT A;  2Y3A A;  4WAF A;  3EHN A;  5KJN A;  1OT8 A;  3RK6 A;  3NB2 A;  3SFY A;  4PDX A;  3SO8 A;  3ULY A;  1DCE A;  3JUE A;  4FAD A;  1OCZ E;  4Y6W A;  5ENR D;  4G1T A;  3CVW A;  1IHG A;  3B7T A;  2XRY A;  5FTP A;  2HM8 A;  4LG6 A;  3KAE A;  3CVQ A;  4GTO A;  3LJ3 A;  2I6H A;  4A3V A;  2H6I A;  2NSZ A;  2YNQ A;  1YCS B;  4MS6 A;  1QZ2 A;  2RFA A;  3L17 A;  3JQ1 A;  3EHM A;  2VGX B;  3D9N A;  1O1R A;  4K5C A;  1IQU A;  4J6I A;  2WXR A;  4UI9 J;  1TNU A;  4HB5 A;  2FO1 E;  4GZD A;  3ZYM A;  4HRN A;  2KAT A;  5G04 C;  5AJD A;  1WM5 A;  4EHM A;  4HS2 A;  3JUI A;  3Q9U C;  4NIK A;  3ZPJ A;  4GTV A;  3CQC B;  4YDO A;  2XQ0 A;  2EIL E;  4YDE A;  1U2V G;  2IEJ A;  2VSY A;  4TXQ A;  4J8S A;  3ZHE B;  3RO3 A;  4L2L A;  5J08 A;  3IKO B;  4N5Q A;  3UM2 A;  2DCP A;  3G2U A;  1Z3Y A;  4OAU C;  4J8Y A;  3MYV A;  1EPU A;  3Q73 A;  4GZC A;  4U8H A;  4HLL A;  4UWF A;  3ASD A;  3MKR A;  3PEV B;  1ELK A;  4RQI A;  3UI2 A;  3BU8 A;  3P2B A;  1IKN D;  2VGX A;  4GA0 A;  4F1P A;  3V31 A;  2VGY A;  4IN3 B;  4HFG A;  4K5A B;  3EHR A;  1FT2 A;  5CED B;  5JJT A;  2X6I A;  3PNL B;  2PL2 A;  3EDT B;  3SZ7 A;  3B7S A;  1DCQ A;  4IYP A;  4TUU A;  4B93 B;  2V5Q C;  2EQX A;  1OCR E;  3U4T A;  4Q69 A;  2V0P A;  1TJC A;  5FZQ A;  2ZIS A;  3FUF A;  1X5B A;  4JL0 A;  3ESL A;  5D66 A;  3MA5 A;  2A4Z A;  4DUI A;  4GZ3 A;  4CYM D;  4JXT A;  3ZHE A;  1H2T C;  3CHM A;  4A1G A;  4WWP A;  1UJJ A;  4BY6 A;  4FJZ A;  3RO2 A;  2P9N G;  4LEU A;  1O1T A;  5EKQ D;  4UWL A;  2P2C P;  3TWU A;  3QWW A;  3DRA A;  1OWL A;  1HFA A;  1WG0 A;  5ARG A;  3QK0 A;  3PZ1 A;  1UN9 A;  3MV2 B;  4G11 A;  5FQ7 A;  2XGS A;  2GRM A;  3CKC A;  3CVY A;  3HG0 D;  2UWJ G;  4URK A;  4BES A;  4M3O A;  4TV3 A;  3LKU A;  3Q49 B;  4F53 A;  3PZD A;  5ENP D;  1U3C A;  1BU9 A;  5KJK A;  4WNF A;  4A1S A;  4HOR A;  2XPI A;  4U8Y D;  4O6F A;  3SBT B;  1INZ A;  4L1B A;  3CST A;  5EYL A;  2YQ8 A;  3AG2 E;  2WXO A;  1HO8 A;  2CHZ A;  3ULQ A;  5CER B;  3Q4A B;  2E0I A;  4U95 D;  3FUH A;  1TJF A;  4I17 A;  4QFV A;  3FUK A;  4IRU A;  2ZGD A;  2BED A;  4KBQ A;  1SA5 A;  5CBO A;  5LFA A;  2AXV A;  4XX5 A;  1S70 B;  4J8D A;  4PS8 A;  4I6J A;  2R03 A;  1E90 A;  4U96 D;  3L82 A;  1HH8 A;  4JB8 P;  1JCS A;  3SY2 A;  1ELR A;  2QYJ A;  3QAR A;  2WXH A;  3TWW A;  5E76 A;  2QC9 A;  4DI4 A;  3UMV A;  3T8M A;  2KC7 A;  3DXK G;  4I6E A;  5BUZ A;  1BI7 B;  4O1P A;  5D0O D;  3PZ3 A;  3FU3 A;  2BF0 X;  3OTN A;  1KZP A;  2P9S G;  3RU0 A;  3OXF A;  3QB2 A;  1BI8 B;  3MJW A;  3ONK A;  2OVB A;  5ITZ F;  1MZC A;  4ABN A;  3E4B A;  2WXF A;  3DSS A;  3QWV A;  3FH8 A;  4WNG A;  1H6O A;  4FUL A;  3BEE A;  2XZT G;  3CHQ A;  4B0Z A;  3FTS A;  3F6Q A;  4L7T A;  4F7A A;  3MKQ A;  2IOS A;  3L6A A;  2LAI A;  1E8X A;  1JCR A;  4KVO A;  3AS5 A;  3CGH A;  2WQH A;  3KD7 A;  3KSQ A;  4I2Z A;  4I43 A;  2M63 A;  4GZ6 A;  3SI5 A;  4BTA A;  4BT8 A;  5DIZ A;  3IV0 A;  3RRU A;  5JJ6 A;  3SNX A;  5EID A;  5JHB A;  3FTV A;  2IOL A;  1LTX A;  3MGB A;  3ZW3 A;  1SZ9 A;  2VGE A;  1K3Z D;  5FQ6 A;  2HO1 A;  2PQN A;  1V54 E;  1HXI A;  3HVE B;  1Z6T A;  3CK9 A;  2OVF A;  5FIO A;  1MHQ A;  4GA2 A;  2PZI A;  4GTT A;  2FBN A;  3BUA A;  2DZN A;  2CFU A;  2XRZ A;  2HR2 A;  4GCO A;  3PZ2 A;  4PS7 A;  2IF4 A;  1O1S A;  4FC8 A;  3RRN B;  2J07 A;  4XE0 A;  4G8L A;  1N54 A;  4DRX E;  5KNH D;  2BKK B;  2KM4 A;  4C0E A;  4G24 A;  2WMN A;  4AVX A;  4BER A;  4BTB A;  3U3W A;  5ENS D;  2MHK A;  3MX3 A;  2VJ8 A;  2JEK A;  3UT8 A;  3S2A A;  3UX4 A;  4N5C A;  4LSZ E;  4FP7 A;  3AG1 E;  2DIW A;  1NP7 A;  3FH7 A;  2V5F A;  3TAX A;  3P1U A;  2IY0 C;  3PS6 A;  4TUM A;  2ZU6 B;  4J8F A;  4HOU A;  3EIQ C;  4EBA G;  3L08 A;  3WG7 E;  4MLP A;  3HVE A;  2NXP A;  1Z5S C;  2C0M A;  4DX6 D;  3S7B A;  5LX8 A;  4HOT A;  2X6F A;  2XEE A;  4ANX A;  1W3B A;  1EDU A;  1UN8 A;  3ZXS A;  4NUR A;  4DX7 D;  4EBA A;  3FWV A;  3LJN A;  4ILH B;  3NOC D;  3URZ A;  3DSW A;  5AQB A;  5BPP A;  1OWN A;  4DJA A;  5FWQ A;  2EIK E;  3S7D A;  5H7P A;  2XPY A;  3PUJ A;  1TN7 A;  4FU3 A;  4HBD A;  3NBN B;  1DC2 A;  3CIA A;  5G55 A;  1NFI E;  4ILG A;  3TXM A;  4ANV A;  3UM3 A;  2V4H C;  4K5B A;  2Y69 E;  2J4D A;  4JC8 A;  3ZKJ A;  5AN8 A;  2WXP A;  1E96 B;  3FU5 A;  2LNI A;  2XPZ A;  4UWG A;  4I9C A;  4WNE A;  1FVH A;  3SQV A;  2GRR B;  3C3R A;  3TWT A;  2HE0 A;  5LCW J;  3D9L A;  3ZNG A;  3FHE A;  3HXF A;  4FLH A;  4N2S A;  5FZR A;  2DYR E;  4LRZ A;  3CVP A;  5EDS A;  3DPY A;  1N4S A;  1IHB A;  3D9I A;  1LF8 A;  3WXX A;  5BT1 A;  1JWG A;  3PNT B;  2LUH A;  4DPR A;  4Q96 A;  5EYP F;  1Y6I A;  3FP3 A;  3CK8 A;  1Z3X A;  3JYS A;  4CDM A;  3V2X A;  4HNA D;  1GW6 A;  2PNN A;  1PC2 A;  4JW1 A;  2F0Y A;  3RAU A;  4JHR A;  4I6G A;  4UI9 K;  1N0R A;  1E8Y A;  1WDY A;  4OVU A;  4EZK A;  1FT1 A;  4TXR A;  1ZB1 A;  1HF8 A;  4GPK A;  3E30 A;  1A5E A;  2OEW A;  2P9P G;  3GW4 A;  3CKB A;  4WWO A;  2WQ7 A;  3ZVV A;  4GYO A;  2GRN B;  1N95 A;  2XS8 A;  3V2O A;  1TN6 A;  3B7U X;  5A23 A;  2ZXW E;  2WXQ A;  3AG4 E;  4DI3 A;  5ENN A;  2DVW A;  2IFU A;  3Q5M A;  1LD7 A;  5BV1 A;  3MZL B;  3FUL A;  2PM6 A;  1N94 A;  1H2V C;  5CRU A;  3TL5 A;  2H6G A;  3T5V A;  5ANR A;  3B13 A; 
#chains in the Genus database with same CATH homology
 4YND A;  3ZN3 A;  2YHC A;  4RVB A;  1UW4 B;  4H7X A;  5LP0 A;  5E75 A;  2CG2 A;  1JWF A;  1HH8 A;  3B7R L;  3L16 A;  1P5Q A;  3I4R B;  3AS8 A;  1OUV A;  1PY1 A;  4XI9 A;  2VTB A;  1ELR A;  2UY1 A;  1JPL A;  3QAR A;  2WXH A;  3O4Z A;  2XEV A;  5E76 A;  4DI4 A;  3CHS A;  2C2L A;  3UMV A;  3ZYQ A;  2PM7 A;  3FTU A;  3BG1 B;  2FF4 A;  4UWK A;  5HI7 A;  3LY7 A;  1UJK A;  5FZS A;  3T8M A;  2OV8 A;  2CHW A;  2KC7 A;  4CT0 A;  4I6E A;  5BUZ A;  3G2T A;  5D0O D;  3FU3 A;  2BF0 X;  3DPD A;  3LPZ A;  3OTN A;  1KT0 A;  5CHE E;  1IYG A;  3C98 A;  3D9O A;  1N52 A;  2YHE A;  3OXF A;  3RU0 A;  3U9W A;  5C1D A;  3QB2 A;  3KEZ A;  5CMW A;  4EQF A;  3LDZ A;  3PDN A;  2LAH A;  2BTD A;  3MJW A;  5AEN A;  4APO A;  5CCL A;  3ONK A;  4UQZ A;  2ION A;  2L0I A;  4GYY A;  2X38 A;  2OVB A;  2R59 A;  4K03 A;  1S0P A;  5EX3 A;  2J09 A;  3FFL A;  4ABN A;  3E4B A;  4CDN A;  3VLF A;  4JEU A;  2WXL A;  2WXF A;  2CHX A;  2OND A;  3QWV A;  4I9E A;  3JCK C;  4NAC A;  3BG0 B;  4KT6 B;  4ACK A;  4UWH A;  2KZT B;  2X6K A;  4UQY A;  3FH8 A;  3PRZ A;  4WNG A;  4FUL A;  4J8E A;  3BEE A;  2QFC A;  1QNF A;  3PE4 A;  2WXK A;  3OXG A;  4PUC A;  3LCA A;  3CHQ A;  3PUK A;  4B0Z A;  3FTS A;  2YIN A;  4L7T A;  4F7A A;  3T5X A;  4FJY A;  2L9B A;  3FEX A;  4B94 A;  3MKQ A;  5KJM A;  2IOS A;  1H0A A;  3LEW A;  3U64 A;  3TGO A;  3L6A A;  3CVX A;  1KT1 A;  2LAI A;  4WUY A;  1E8X A;  1ZBP A;  3QAQ A;  1EYH A;  3CR3 A;  3GZS A;  3PRE A;  4KVO A;  5G05 C;  4BX9 A;  5AYW D;  4CT4 A;  3AS5 A;  3CGH A;  3Q15 A;  3ONL A;  2WQH A;  3FU0 A;  3FY4 A;  4CEM A;  1WY6 A;  2WMO A;  4FLB A;  2XGO A;  3KD7 A;  3AU5 A;  3ZEF A;  3ASF A;  4I2Z A;  2LO6 A;  4I43 A;  1HZ4 A;  3FDH A;  2M63 A;  3R7R A;  2JLB A;  4GZ6 A;  3SI5 A;  4BTA A;  4BT8 A;  5DIZ A;  5FT9 A;  4JHK A;  4AP2 A;  3IV0 A;  1B89 A;  3PH0 C;  3QC1 A;  2PQR A;  4N2Q A;  3RRU A;  5JJ6 A;  4KVM A;  4XKB A;  3RIB A;  3SNX A;  3QJZ A;  4AIF A;  5JHB A;  3FTV A;  1L5J A;  5G2N A;  3Q47 B;  3FUE A;  2IOL A;  2AWI A;  4HLE A;  2J08 A;  3MGB A;  2WQ6 A;  2NC9 A;  1SZ9 A;  3ZW3 A;  5DBK A;  3MEK A;  1E8Z A;  4EZJ A;  4I1M A;  4ME2 A;  3CEQ A;  2MOW A;  5FQ6 A;  4F1S A;  1NZN A;  5FJY A;  2HO1 A;  2PQN A;  2LSU A;  1HE8 A;  3UPV A;  2WXN A;  1WAO 1;  3FUD A;  3LY9 A;  4K0R A;  2X6H A;  1E8W A;  2WXJ A;  1KLX A;  1HXI A;  1HG2 A;  3UT7 A;  3I3N A;  4CRW A;  2L6J A;  3HVE B;  4C9B B;  1Z6T A;  3G2V A;  3CK9 A;  1E7U A;  3ENE A;  4BFR A;  4KXK B;  2OVF A;  3NF1 A;  2WXG A;  2IQC A;  2VSO E;  2WPV A;  4GMJ A;  1MHQ A;  4GA2 A;  4RG6 A;  2WXI A;  2PZI A;  3APD A;  3NZU A;  4GB9 A;  3K9I A;  2XHE A;  4HVB A;  3N71 A;  3L13 A;  2RG8 A;  2AVP A;  4Q94 A;  1NA3 A;  2R5S A;  3CHR A;  3LVR E;  3O48 A;  4A3T A;  4CCA A;  1TEZ A;  2WXM A;  4U07 A;  2FBN A;  3QKY A;  2XGM A;  3ML9 A;  4D10 C;  2LSV A;  2KZT A;  4Y6C A;  3RJV A;  2CFU A;  3JQ0 A;  2XRZ A;  1HX8 A;  2HR2 A;  4MKT A;  4GCO A;  3KS2 A;  4GU5 A;  4L2Y A;  2Y3A A;  4WAF A;  3EHN A;  5AJL A;  4DLO A;  5KJN A;  2Y4U A;  4AXH A;  4PS7 A;  3QOU A;  1EF1 C;  3RK6 A;  3OAW A;  2IF4 A;  1FCH A;  4N39 A;  1UG3 A;  4FC8 A;  4PDX A;  4U0S A;  3LY8 A;  5ANR A;  2J4B A;  5T4Y A;  3RRN B;  2J07 A;  5ANL A;  4XE0 A;  4FAD A;  4PH4 B;  4Y6W A;  4G23 A;  2I2O A;  5FQ4 A;  1N54 A;  4G1T A;  4F3V A;  5FQ8 A;  4JPS A;  3CVW A;  2KCL A;  3D3M A;  1IHG A;  2KM4 A;  3PEU B;  4C0E A;  4G2V A;  2WMN A;  4G24 A;  1XNF A;  1Y8M A;  4AVX A;  3B7T A;  2XRY A;  2A5U A;  4FA6 A;  5FTP A;  4BTB A;  3U3W A;  4CGW A;  3QNK A;  2MHK A;  3S7J A;  3MX3 A;  4EPZ A;  2VJ8 A;  2HM8 A;  3TG5 A;  4ACL A;  3KAE A;  3CVQ A;  4AJW A;  4JA7 A;  5AIJ A;  3LJ3 A;  5CCM A;  4I2W A;  2JEK A;  2I6H A;  3VLE A;  3TG4 A;  4A3V A;  2C0L A;  3UT8 A;  3S2A A;  3UX4 A;  2NSZ A;  2YNQ A;  4MS6 A;  4N5C A;  3FUI A;  5G04 J;  5BW8 C;  1QZ2 A;  2WM9 A;  4FP7 A;  4U0U A;  3L17 A;  2Q7F A;  3JQ1 A;  2DIW A;  3EHM A;  1NP7 A;  2VGX B;  2I1K A;  3FH7 A;  4JA9 A;  3D9N A;  4HXI A;  3ASH A;  3SD5 A;  2V5F A;  4BT9 A;  4U04 A;  2V4L A;  4JVS A;  4RG9 A;  3TAX A;  1IQU A;  3P1U A;  4XKC A;  5D0Q D;  4J6I A;  3PS6 A;  3FTX A;  3CVL A;  4V3I A;  2WXR A;  4UI9 J;  3CVV A;  2ZU6 B;  4B8C B;  2E2E A;  4KYO B;  2VSX E;  5HQ8 A;  4J8F A;  4HOU A;  3RRM B;  1H6K A;  3EIQ C;  4GZD A;  4EBA G;  3ZYM A;  3L08 A;  4MLP A;  2J9Q A;  3HVE A;  4N3B A;  3ASG A;  1XGW A;  2NXP A;  2KAT A;  3ML8 A;  4WWN A;  5G04 C;  2C0M A;  4ANW A;  2GGF A;  1H19 A;  1WM5 A;  3CHO A;  5AJD A;  3S7B A;  4HS2 A;  3JUI A;  4IUL A;  4B8A A;  3SBS A;  5LX8 A;  4HOT A;  4JEH A;  2HYZ A;  2X6F A;  4ANX A;  1W3B A;  2MRI A;  1EDU A;  3ZPJ A;  4YVQ C;  1ZU2 A;  2KCK A;  1UN8 A;  3ZXS A;  3CQC B;  4NUR A;  4DK5 A;  1DVP A;  2XQ0 A;  3IBE A;  4GZ5 A;  4EBA A;  3FWV A;  3FTY A;  5LOZ A;  4ILH B;  2VSN A;  2VSY A;  1A17 A;  3RKV A;  3URZ A;  3HDX A;  2DBA A;  2XCB A;  3FH5 A;  3NZS A;  4AM9 A;  3QWP A;  5BPP A;  3MCX A;  1OWN A;  5A6C A;  4J8S A;  4DJA A;  5FWQ A;  3ZHE B;  3RO3 A;  4BX8 A;  4EEC A;  4H7Y A;  4L2L A;  4G25 A;  3IHV A;  5J08 A;  3IKO B;  5JHA A;  3S7D A;  3FUJ A;  3D9J A;  4NRH B;  2Y4T A;  4FHK A;  2XPY A;  3GYZ A;  4N3C A;  3PUJ A;  2DCP A;  4BWR A;  4E85 A;  4FU3 A;  3G2U A;  3D9M A;  3TJP A;  1Z3Y A;  4HOQ A;  3MYV A;  3CIA A;  3SGH A;  1EPU A;  4N3A A;  4GML A;  4GZC A;  5G55 A;  3SFZ A;  4U8H A;  3VTX A;  2L0T B;  2AXZ A;  4AY5 A;  3PE3 A;  4R7L A;  4UWF A;  5EX0 A;  4ILG A;  2IJG X;  3ASD A;  3TXM A;  4ANV A;  3MKR A;  3IHY A;  5ARF A;  2FO7 A;  3PEV B;  1ELK A;  3IEG A;  2J4D A;  3MKQ B;  4JC8 A;  4ATG A;  2I9C A;  5A7D B;  3P2B A;  4LER A;  4YVO A;  2VGX A;  4GA0 A;  2FEZ A;  2VQ2 A;  5KCM A;  3CVN A;  3ESK A;  2X3M A;  1NA0 A;  3LS8 A;  2OOE A;  2WXP A;  1BPO A;  2VGY A;  4IN3 B;  2V8S E;  3EJN A;  1E96 B;  1HS6 A;  3FU5 A;  4HFG A;  2FUL A;  3R9A B;  2LNI A;  2XPZ A;  4UWG A;  3LXU X;  4I9C A;  4XZ4 A;  5M72 A;  4J0U A;  3FU6 A;  3APC A;  4WNE A;  1FVH A;  5JJT A;  3L22 A;  3ZYK A;  2X6I A;  2CFZ A;  3UT4 A;  3PNL B;  5LCW J;  3SHF A;  3D9L A;  2PL2 A;  3EDT B;  3OXL A;  3SZ7 A;  3B7S A;  3APF A;  3FHE A;  4IYP A;  4FLH A;  4TUU A;  2AW6 A;  4EZL A;  2EQX A;  3U4T A;  4Q69 A;  1FVF A;  4W9R A;  4N2S A;  2V0P A;  3TXN A;  5FZR A;  3D9K A;  1TJC A;  3L54 A;  4OVV A;  5FZQ A;  3ZRH A;  4AY6 A;  4LRZ A;  1HG5 A;  3CVP A;  3FUF A;  5EDS A;  1X5B A;  3G2W A;  4JL0 A;  4DLQ A;  2R17 C;  4AEZ C;  3CSF A;  4A55 A;  3VTY A;  1ELW A;  4E6H A;  2P58 C;  1OWP A;  3D9P A;  3D9I A;  3ESL A;  3QDN A;  5T3R A;  3MA5 A;  1LF8 A;  4MRU A;  2A4Z A;  4WND A;  4GZ3 A;  4NQ0 A;  3NQP A;  4G26 A;  3WXX A;  5LCW C;  5BT1 A;  4JXT A;  1JWG A;  3ZHE A;  1H2T C;  3CHM A;  3CK7 A;  4A1G A;  1VDY A;  3PNT B;  3ZGQ A;  4WWP A;  1SQM A;  2AXU A;  4LUN U;  4GA1 A;  5KJL A;  1UJJ A;  4BY6 A;  1QQE A;  4UQX A;  4DPR A;  4Q96 A;  4FJZ A;  1Y6I A;  5G05 J;  3FEY A;  3FP3 A;  3CK8 A;  1HU3 A;  3CV0 A;  1PAQ A;  3HYM B;  3RO2 A;  1Z3X A;  3JYS A;  4CDM A;  3DBS A;  4LEU A;  4JZY A;  4JHJ A;  3I5P A;  5EKQ D;  1E7V A;  2GRL A;  3GZ2 A;  2ILR A;  1GW6 A;  4UWL A;  5BNW A;  4P29 A;  3QWW A;  4XI0 A;  2WVI A;  1PC2 A;  4JW1 A;  4I1O B;  2FI7 A;  1OWL A;  1SZA A;  1HFA A;  2GW1 A;  3SF4 A;  2VTB B;  2UY1 B;  3HHM A;  4UI9 C;  5ARG A;  4JHR A;  3QK0 A;  4I6G A;  4L23 A;  4UI9 K;  1E8Y A;  1UN9 A;  3MV2 B;  4G11 A;  5CMY A;  1U3D A;  4CGV A;  4OVU A;  5FQ7 A;  4AOF A;  2XGS A;  5JJ7 A;  3EIJ A;  3I4G A;  3G2S A;  4EZK A;  2GRM A;  1HF8 A;  5J90 A;  3CKC A;  4APF A;  3GZ1 A;  3CVY A;  2RD0 A;  2UWJ G;  3ZYL A;  4GPK A;  4C0M A;  3AU4 A;  4URK A;  4GAA A;  1OWM A;  2XCC A;  4M3O A;  3VLD A;  4KMO A;  3R7Q A;  4TV3 A;  3GW4 A;  3CKB A;  4WWO A;  3LKU A;  2J49 A;  2BUG A;  5BV0 A;  3Q49 B;  4F53 A;  1YA0 A;  2WQ7 A;  3PZD A;  4OYS A;  3ZVV A;  3ZIM A;  4GYO A;  4PS3 A;  1U3C A;  4B89 A;  1DNP A;  3PVL A;  5KJK A;  1OWO A;  4WNF A;  1MQS A;  4A1S A;  4HOR A;  4ILI A;  3UUX A;  3MV3 B;  4RSY A;  2XPI A;  4CDR A;  3B7U X;  4O6F A;  5A23 A;  1IQR A;  5C2Y A;  4XIF A;  3SBT B;  2WXQ A;  1INZ A;  3HIZ A;  3FTZ A;  4TRQ A;  4L1B A;  3CST A;  2YQ8 A;  1JUQ A;  4DI3 A;  3FTW A;  2WXO A;  4HOS A;  1HO8 A;  2CHZ A;  3ULQ A;  5ENN A;  2I1J A;  3AS4 A;  3Q4A B;  4U63 A;  4U0Z A;  2KCV A;  2E0I A;  3CLJ A;  2IFU A;  3UQ3 A;  2CG3 A;  3FUH A;  3S7F A;  4BSX A;  2WB2 A;  3Q5M A;  4GCN A;  4ANU A;  1TJF A;  3CQG B;  3CVU A;  4I17 A;  4KZC A;  4FHJ A;  5BV1 A;  4LCT A;  3CHP A;  2IU1 A;  4QFV A;  3FUK A;  2X6J A;  4IRU A;  3MZL B;  4AV7 A;  4KZ0 A;  2QY7 A;  3FUL A;  2PM6 A;  1H2U A;  5T8I A;  3LVQ E;  1H2V C;  3ZFW A;  4KBQ A;  2VYI A;  3TL5 A;  3U66 A;  5LFA A;  2AXV A;  4XX5 A;  4J8D A;  3T5V A;  4I1A A;  3FUM A;  3LYA A;  4PS8 A;  4I6J A;  1E90 A;  3FUN A;  3B13 A;  4GYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...