2E2EA

Tpr domain of nrfg mediates the complex formation between heme lyase and formate-dependent nitrite reductase in escherichia coli o157:h7
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
171
Chain Sequence
KWQAVRAEYQRQRDPLHQFAEAQLQALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQASQHMTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELWQKVMDLNSPRINRTQLVESINMAKLLQRRSDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formate-dependent nitrite reductase complex nrfG subunit
publication title TPR domain of NrfG mediates complex formation between heme lyase and formate-dependent nitrite reductase in Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 56
structure length 171
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2e2eA01
4N3BA 5A6CA 2Y4TA 3RU0A 5G05J 3VTYA 5FTPA 3ASFA 5FJYA 4J8DA 2LSUA 3CVPA 4AY6A 4N3AA 1TJCA 1OUVA 2FF4A 2XCCA 5ARGA 3S7BA 2XEVA 1NA3A 2UWJG 3LY8A 2BUGA 4O6FA 1QQEA 2KCLA 3TGOA 4UQZA 4BWRA 3CKBA 5JJTA 4GYOA 3O48A 4W9RA 2FBNA 2Y4UA 2XPIA 3R9AB 3KD7A 4GA0A 2FO7A 4XI9A 3N71A 5JJ6A 5G05C 3S7FA 3CV0A 3PE4A 5FT9A 4GYYA 3ZGQA 2VGYA 3GYZA 1ELRA 1ZBPA 2KATA 4UQYA 2J9QA 2VGXA 2WQHA 4CDRA 4HOTA 3LPZA 3IEGA 4H7XA 3TAXA 2FEZA 3CVLA 4RG9A 5EX0A 3LYAA 4G23A 1A17A 4G2VA 4XIFA 4G24A 3RO3A 2GW1A 2AVPA 4I9CA 4WNFA 4JA7A 3UQ3A 3QWWA 3S7DA 3CEQA 2I6HA 4U04A 5EX3A 3Q4AB 3U3WA 2UY1A 4AM9A 4J8EA 2VYIA 2KC7A 3PDNA 4KBQA 3VTXA 3SF4A 2IFUA 3OXFA 3PE3A 2IF4A 2KCVA 4HORA 3Q5MA 3LCAA 4U0ZA 4G1TA 4A1SA 5HQ8A 5BT1A 4Y6WA 3LY9A 2LNIA 4UI9J 3QWPA 2YQ8A 5C1DA 4GCNA 1IYGA 4GZ3A 3ASDA 2PL2A 3AS8A 3FWVA 4I2ZA 2WPVA 3QWVA 4G25A 2FI7A 4LEUA 2QFCA 5A7DB 3K9IA 2E2EA 2KCKA 3MKRA 3RKVA 3RO2A 2YHCA 3RIBA 3MA5A 4U0UA 5CHEE 2V5FA 3GZ1A 1P5QA 3Q15A 1NA0A 4JL0A 5ARFA 4AIFA 4ABNA 4NQ0A 2PZIA 4CGVA 3S7JA 4RG6A 4BT8A 3ASGA 2ONDA 3QKYA 4GA1A 2XGMA 2VGXB 4HOSA 4N5CA 1NZNA 5FZSA 3URZA 5KJLA 2VSYA 3CK7A 4I2WA 5KJMA 2JLBA 3LY7A 4GZ6A 4AY5A 1WAO1 5AYWD 4WNDA 1B89A 2NC9A 3JYSA 3ESKA 3CVNA 3U4TA 5G04J 3E4BA 4YVOA 2OOEA 3UUXA 4XI0A 5FZRA 2UY1B 1HH8A 4GA2A 3EDTB 2HO1A 4GZ5A 5KJNA 2R5SA 3ZPJA 2XCBA 3CKCA 4U0SA 5DIZA 4WNEA 2XGSA 3SZ7A 3WXXA 3CVQA 4WNGA 4HOUA 3ZHEA 4KXKB 3OXLA 3MV3B 3QOUA 4B94A 4HOQA 5BNWA 3MEKA 3Q47B 5CCMA 4BTAA 2L6JA 4GPKA 4Y6CA 5DBKA 3KAEA 3FP3A 4BT9A 1QZ2A 4I17A 3LKUA 5D0QD 5D0OD 5JJ7A 1Y8MA 1YA0A 4UI9C 3MV2B 5LCWJ 1ELWA 3ZFWA 5HI7A 4JHRA 4G26A 5EKQD 2VSNA 1HXIA 3ZN3A 1KLXA 1PC2A 2LSVA 3GW4A 4I9EA 4EQFA 2HYZA 1HZ4A 2P58C 5M72A 1ZU2A 3ULQA 4YNDA 3UPVA 3RJVA 3ASHA 3CK9A 4CGWA 1IHGA 2C2LA 2C0LA 3BEEA 4UI9K 4NRHB 4YVQC 4H7YA 5LCWC 3AS4A 1FCHA 1W3BA 2DBAA 3FFLA 3TG5A 4N2QA 4N39A 4N3CA 4J8FA 4WUYA 3NF1A 4IN3B 2PQRA 4J0UA 3GZ2A 3HYMB 3OXGA 5BW8C 4ME2A 4KYOB 3CK8A 1KT0A 2XGOA 2C0MA 2Q7FA 5FZQA 4UQXA 4GYWA 4JA9A 3ZHEB 5KJKA 4F3VA 4GCOA 2VQ2A 5G04C 2PQNA 2HR2A 5CCLA 3Q49B 1XNFA 4APOA 3QDNA 4N2SA 1WM5A 2MHKA 3TG4A 3AS5A 4U07A 1KT1A 4BTBA 3KS2A 4I1AA 1E96B
chains in the Genus database with same CATH superfamily
5A6CA 4RVBA 3UT4A 5G05J 4Z68A 3DXMG 3Q78A 4L2YA 4OAVB 4JPSA 3ABKE 5ARGA 3QJZA 3TWQA 3EIJA 4XZ4A 3RAUA 4HRLA 4O6FA 2KCLA 3C3OA 4BWRA 3CKBA 5BV0A 4PS8A 3D9JA 4GYOA 3AG1E 1SZ9A 4B93B 3W9FA 3F6QA 3AG2E 4D10C 2DYSE 1FPPA 1WG0A 3FUHA 3SBTB 1JCQA 2WXOA 4MKTA 3C5RA 3EHQA 3CV0A 3MYVA 2BTDA 5ANRA 5FT9A 5AN8A 1K8KG 2X3MA 2KATA 2LAHA 1LTXA 1OWNA 3I5PA 3PREA 2WQHA 1TNUA 3ZUVB 4DI4A 2F8YA 1IQRA 3CVLA 1DCEA 3FHEA 2IO2C 3DWLG 3DSXA 1AWCB 5KWDA 3CHPA 4I9CA 3SNXA 3ML9A 4U8VD 3CVYA 3BU8A 3AG4E 1FVFA 2QYJA 4U04A 5B1AE 5EX3A 5EYLA 3U3WA 3LVRE 2UY1A 1S70B 4AM9A 4J8EA 4ZHBA 5ANLA 5ENSD 4PH4B 1MX2A 2P2CP 3SF4A 3OXFA 2IF4A 4HORA 4U0ZA 5CBNA 3UX4A 2WXGA 2OEVA 1TR4A 5J08A 3APFA 3QAQA 5BT1A 1TN8A 4Y6WA 3L13A 2LNIA 3UT8A 4UI9J 1OCCE 3VLEA 4OYSA 4XKBA 1O1SA 5HKPA 2R2LA 3IHVA 4NURA 4CRWA 2WPVA 3RRMB 2DIWA 4G25A 4B89A 1TEZA 1N54A 4DI3A 2CHZA 4RSYA 3K9IA 3RRNB 1Q2ZA 3MKRA 3RO2A 3SHFA 4JXTA 4CCAA 4BY6A 3L54A 3Q15A 5HS0A 2NYJA 3CLJA 4KT6B 4ABNA 4F6RD 1YMPA 2PZIA 3R7RA 3X2QE 3T5VA 3FUMA 4KZCA 2R05A 4RG6A 4BT8A 2J4BA 3ASGA 2ONDA 3QKYA 4AVXA 3TWTA 3TXNA 1TNBA 1N0QA 1HS6A 4FU3A 1SVXA 2VSOE 2MRIA 5JMND 5LX8A 5KJLA 3CK7A 4I2WA 5KJMA 2JLBA 4IRUA 1D8DA 4AY5A 2BKGA 1N4PA 5AYWD 4EBAG 3BQOA 5CEAA 3ASOE 4O1PA 5FQ7A 2OOEA 4XI0A 1E8WA 3ONLA 2R02A 1S64A 3UIPC 2UY1B 1H6KA 1OCZE 4EZLA 3C3QA 3ZKJA 5KJNA 2NSZA 2R5SA 3FTSA 2CHWA 4ACLA 3CKCA 3OAWA 4U0SA 3ULYA 3UXGA 2X6KA 2ETAA 1Z5SC 3B7SA 3KEAA 4HI8A 1YYHA 5JHAA 4KXKB 4AV7A 5D2MC 3CVWA 4LNBA 4FHJA 1ELKA 4P29A 2RKKA 3Q47B 4EHMA 4TXPA 3NZUA 2L6JA 4FADA 5AARA 3Q73A 3FUEA 3SD5A 4BT9A 3PRZA 1QZ2A 5D0OD 2JEKA 3NOGD 4HLLA 2L0IA 3MV2B 2QZAA 4CDNA 5EKQD 1HXIA 3S2AA 1PAQA 1FVHA 1N11A 2OV8A 3JXIA 4GZDA 3GW4A 2HYZA 2P9LG 1ZU2A 4GTVA 3UPVA 3ASHA 4TRQA 1GW6A 3KSLA 1RW2A 3ZXSA 1N9AA 3PZ4A 1FCHA 3HVEA 3SY2A 1SA4A 4J6IA 5ENPD 3CSFA 4KMOA 2RFAA 4JEUA 3FFLA 3UKRG 3AG3E 3EJNA 1VDYA 2MOWA 4KZ0A 4N39A 4N2QA 1KPSB 2IY0C 5BUZA 4IN3B 2L9BA 2PQRA 4J0UA 3B7UX 4U63A 2J08A 3EHMA 1KT0A 5FIOA 1OXJA 2XGOA 1HX8A 4HS2A 4JA9A 4GAAA 3DEOA 3IHYA 1KZPA 5AQAA 5CERB 3RRUA 2H6IA 2EILE 4JHKA 3FU0A 5J90A 4TUUA 3QARA 4AEZC 3Q49B 1TN6A 4M3OA 3P1UA 4APOA 3UMVA 1KT1A 4BTBA 4XX5A 1N0RA 1E96B 4ILIA 3E37A 3L16A 4GTQA 3RU0A 1N4SA 3TJPA 2XZDG 4DUIA 1BD8A 4J8DA 2LSUA 3R7QA 4B8AA 4AY6A 1LD8A 3ZYMA 3ZXPA 1OUVA 2XCCA 4DX6D 2ZGDA 1NA3A 4HBDA 2UWJG 3LY8A 3NZSA 4U96D 5ENQD 1HG2A 3I4RB 3FTZA 3DPYA 4JW1A 2JABA 3WG7E 3R9AB 4Q94A 1E8XA 4GTOA 3CHOA 3KD7A 3NOCD 4GMRA 5G05C 5KCMA 2J4DA 4GYYA 3PEVB 3ZGQA 2VGYA 1ELRA 3UT7A 2RD0A 3L08A 2FO1E 4PDXA 2LXLA 3L9TA 4UQYA 4G11A 2WXPA 1E7VA 2J9QA 1NP7A 2B6CA 3HVEB 4YDOA 4HOTA 3LPZA 3Q9UC 3IEGA 4H7XA 1U3CA 4QFVA 2Y0BG 4G23A 5FQ4A 2P9SG 2R59A 2A4ZA 3RO3A 2XRZA 1Z3YA 1NI1A 2KM4A 3PNLB 5JA4D 3UQ3A 4A1GA 3Q4AB 2B0OE 3D9KA 3PS6A 2KC7A 4KBQA 3E32A 4J8SA 3Q7AA 2OVFA 4Q96A 5C2YA 4FLBA 2VTBA 3LCAA 1E90A 5HQ8A 1H2VC 4GTTA 1LF8A 3E30A 2I1JA 3EIQC 3JUIA 2J09A 3HXEA 3LJNA 4ANXA 2YQ8A 3SO8A 5C1DA 1EF1C 3R9MA 5BXOA 4F53A 1OWMA 4PUCA 1IYGA 4GZ3A 2PL2A 3V30A 4I2ZA 3MJWA 2FI7A 2BF0X 2LAIA 1OT8A 2EIME 4UWLA 2KCKA 3V31A 2WQ6A 3RKVA 2YHCA 4FHKA 5LFAA 3RIBA 2PM7A 4U7EB 5CHEE 4X8QA 2YHEA 4U8HA 1WDYA 4XE0A 3LEWA 1MX4A 4UWGA 2GRNB 3W9GA 5D66A 3Q7FA 1MX6A 2LO6A 1LD7A 4HQDA 4NQ0A 3T9KA 4N5QA 4BESA 3S7JA 2EQXA 5CMYA 4GA1A 4HOSA 3Q9NC 1NZNA 1H6PA 1H6OA 2VSYA 4E85A 3PEUB 4LNUD 3T5XA 3MCXA 2VJ8A 1BI7B 4C0EA 4WNDA 4GTRA 2M63A 3CVNA 5LOZA 5G04J 3E4BA 2J8SD 5FZRA 4GTPA 2X6JA 2GRRB 1X5BA 2OEWA 5AIJA 3B7TA 4GZ5A 3CR3A 3VLDA 2AJAA 2XCBA 3ZRHA 4APFA 4G8KA 3T8KA 2XGSA 1S0PA 3SZ7A 4WNGA 3QB2A 5B1BE 3ZHEA 3QK0A 4C9BB 3QOUA 2WXHA 3KSQA 3EU5A 4I6GA 2WXJA 4QQIA 4OVUA 3B95A 5CCMA 4LNGA 1TJFA 2MYOA 4J8YA 5IY5E 5DBKA 4CYMD 3UINC 3CSTA 3OTNA 4RQIA 3FTWA 4ATZD 2GROB 5D0QD 3VLFA 1Y8MA 1YA0A 3DSWA 3BG0B 2H6FA 5AENA 4JVSA 1U3DA 5LCWJ 3ZFWA 5HI7A 1AP7A 4BEPA 2IONA 4BX8A 2WXIA 2ILRA 1KLXA 5G2NA 2CFUA 4HRNA 2X6FA 1HZ4A 3DXKG 1K3ZD 4FP7A 2ZISA 3CHMA 3EU9A 4YNDA 3TWRA 3RJVA 3SFXA 4CGWA 2BEDA 1IHGA 2C2LA 3FTXA 5H7PA 3LS8A 4L23A 2C0LA 2Y3AA 3BEEA 4UI9K 1HG5A 5BPPA 3AS4A 5KBAA 1W3BA 3RSEG 1BPOA 3IV0A 1K1AA 2IO3C 3TG5A 3V2XA 1UN9A 2IU1A 3SGHA 2FULA 2V8SE 3OXGA 1SA5A 5BW8C 2V0PA 4KYOB 1OCOE 3CGHA 3D9OA 2EINE 3ZVVA 2Q7FA 5FZQA 4UQXA 3E33A 2L6BA 2AXZA 3ZHEB 1TNYA 4XEIG 4B0ZA 3PNTB 4FJYA 4LCTA 1ZB1A 2GGFA 4HI9A 3TG4A 5B3SE 3CHQA 3ABLE 3D9PA 3TWVA 3FULA 3FUDA 4I1MA 3ZYLA 3FU5A 1N4RA 2EIJE 3VTYA 4AP2A 1DVPA 5FTPA 3ASFA 4I1OB 1OWLA 2WXQA 3CVPA 5LP0A 1TJCA 4BSXA 2XEVA 4RLYA 1YCSB 2WXKA 3U9WA 2BUGA 3C72A 2DZNA 4UQZA 2P9IG 4EECA 2EIKE 4CEMA 1SW6A 4W9RA 1MQSA 1FT2A 1TNZA 2Y4UA 2XPIA 2L0TB 4Q69A 3ZEFA 1E7UA 5CBOA 1O5MA 5KNHD 5EIBE 5EYPF 3JCKC 3S7FA 2QY7A 3GYZA 3C98A 4GPMA 3BUAA 3SI5A 1NFIE 2DWZA 2VGXA 3L82A 2A5UA 3TAXA 4A3TA 2FEZA 4RG9A 3D9MA 2P9PG 4JEHA 2WM9A 1OCRE 1UJJA 3PZ1A 3TXMA 4G2VA 4XIFA 4G24A 2P9KG 2GW1A 2AVPA 3CVXA 3ZYQA 4A55A 3IXEA 4JA7A 3QWWA 2XEEA 2I6HA 4WAFA 3FU6A 3ZNGA 4MBGA 3ABME 3PDNA 2IFUA 3PE3A 2KCVA 3G2WA 3Q5MA 4DRXE 1QNFA 4L7TA 2XPYA 4G1TA 4UUCA 5ENRD 5AQ7A 4WWOA 3TWSA 1JCRA 1Z6TA 5BV1A 4IULA 1OWOA 4I43A 3TWXA 4BETA 4URKA 4JZYA 4DX7D 1N94A 4GCNA 1HFAA 1TNOA 3ASDA 2KBXA 3QWVA 1RZ4A 4LEUA 2QFCA 5ENOD 5A7DB 2E2EA 4TUMA 4K03A 4ATGA 1BLXB 2GRLA 1JWGA 3MA5A 3FUJA 3CQCB 3DSTA 4YDWA 2V5FA 3G2TA 3PVLA 1V54E 1P5QA 2XENA 5ARFA 3L6AA 2XQ0A 5CRUA 3EUVA 2HM8A 4K5BA 3FUFA 3DBSA 4CGVA 1KZOA 4FA6A 2XGMA 4BX9A 2VGXB 3UM1A 3PH0C 4N5CA 4I6JA 2YNQA 5FZSA 1INZA 3URZA 4LERA 1BI8B 3B7RL 3SFZA 3LY7A 3L22A 4GZ6A 3Q75A 1WAO1 4DLOA 2VGEA 2NC9A 3JYSA 3RK6A 4TXRA 4HB5A 2V5QC 1V55E 3U4TA 3CVVA 1H19A 4YVOA 2V4HC 3ISMC 3LJ3A 2F0YA 4EZKA 1HH8A 5FINA 4MS6A 1NL4A 3UIOC 3EDTB 3PZ2A 2HO1A 1H2TC 4K0RA 2XPZA 4DPRA 3D9IA 1HE8A 3G2UA 4XKCA 3WXXA 4YDEA 4G8LA 3NB2A 4HOUA 3FU3A 3OXLA 3MV3B 4B94A 3AU4A 4KVMA 4HOQA 4O1OA 2IEJA 3MX3A 1A5EA 4BTAA 2WXLA 3JXJA 4Y6CA 3FEXA 1JPLA 3FP3A 1MZCA 1Y6IA 1QYMA 4DJAA 4O60A 3UI2A 5CRVA 2DCPA 5JJ7A 3QNKA 4KVOA 2F8XK 4LSZE 1E8YA 4UI9C 5E75A 3CHSA 1JWFA 3FH5A 3CHRA 2R03A 3ENEA 2VSNA 1Z3XA 3NQPA 4HRMB 3PZDA 4AJWA 2DYRE 4I9EA 1JCSA 1N4QA 2P58C 2J49A 5M72A 5AAOA 3NAWA 4DLQA 3CK9A 2VSXE 3L17A 1OY3D 1SZAA 1DCQA 5LCWC 4GU5A 4CDMA 2ZGGA 3SQVA 1D9SA 2DBAA 3C3RA 3O4ZA 4N3CA 5G55A 4WUYA 3NF1A 3CQGB 3HRAA 3GZ2A 3HYMB 4JHJA 4ME2A 3KEZA 4GMJA 1TN7A 2ETBA 1HU3A 4OAUC 3CK8A 3ESLA 4GTMA 2VTBB 2P9NG 2C0MA 2WB2A 3EHNA 4F3VA 3HDXA 4GZCA 3U66A 3DEPA 4GCOA 2VQ2A 2X38A 3I4GA 3HIZA 2PQNA 2HR2A 5T8IA 1K1BA 1XNFA 4C48B 3HXBA 2MHKA 4PS3A 3V2OA 4C0MA 3KS2A 1MJ0A 2KZTA 4N3BA 2Y4TA 5FJYA 4EPZA 2E0IA 2XEHA 4HFGA 4N3AA 4JB8P 2WMOA 4ZFHA 2FF4A 3S7BA 2H6HA 3ASNE 5FQ8A 3FY4A 1QQEA 4MRUA 3TGOA 3B13A 1MYOA 5JJTA 1FT1A 3O48A 3IBEA 1EPUA 2FBNA 4TXQA 4GA0A 3FH8A 2FO7A 4XI9A 3LVQE 3N71A 4TV3A 5JJ6A 4B8CB 4JD2G 3AAAC 4F1SA 4WWNA 3PE4A 5EILA 4HNAD 1PY1A 3ZIMA 2DZOA 1ZBPA 1HF8A 4F1PA 3EHRA 1OWPA 1L5JA 4YDYA 2RFMA 4ILHB 4CDRA 5KNGA 4FJZA 2XS8A 3HXDA 1DNPA 5EX0A 3DSUA 2IJGX 3JQ0A 3LYAA 3PUKA 1A17A 3T8MA 2AW6A 5E76A 2WMNA 1IHBA 4OVVA 3Q79A 4WNFA 1O1TA 4FLHA 5EIDA 2I1KA 3FTVA 2NXPA 4AOFA 3S7DA 3CEQA 2IOLA 3DSSA 3G2VA 2VYIA 1D8EA 1MHQA 2YINA 3D9NA 3VTXA 4EBAA 2I9CA 4UWHA 1UW4B 4LG6A 4U8YD 2P9UG 4A1SA 5AQ9A 1X81A 4DX2A 4ACKA 2KZTB 4NACA 3AU5A 3LY9A 3FUIA 2OVBA 3ZW3A 3V79K 3QWPA 4ANVA 3HG0D 2AXVA 4K5CA 1HO8A 3D9HA 4IYPA 2V4LA 4V3IA 3FEYA 3FWVA 3AS8A 3ZYKA 2J07A 3UM2A 3CIAA 3GZSA 5A23A 5EDSA 4PS7A 3UKUG 3PZ3A 4U0UA 4HLEA 3GZ1A 2WQ7A 4U95D 1NA0A 4JL0A 2GRMA 3CVUA 1TYQG 2X6IA 5AJDA 3MZLB 4AIFA 4E6HA 2XRYA 4UWKA 2LUHA 2GRQB 2XS1A 2I2OA 1O1RA 1SQMA 4F7AA 3FUNA 5CEDB 1IKND 2WXNA 3TL5A 4BERA 4EZJA 4DX5D 1EDUA 3B7BA 2IQCA 3UTMA 3APDA 3AJIA 3HXCA 3FDHA 3ML8A 1UOHA 2XZTG 3SBSA 2XHEA 1B89A 3LDZA 3ONKA 2ZU6B 2F37A 3ESKA 4L1BA 3HHMA 3UUXA 2ZIRA 3SFYA 4GA2A 2Y1LE 2WXMA 3ZPJA 4I6EA 4FC8A 2Y69E 2WXFA 4LUNU 5DIZA 4GMLA 4WNEA 2LXMA 3CVQA 4ANUA 5FQ6A 1UN8A 5CMWA 3ZU7B 5T4YA 5CECB 1IQUA 3ULEG 3DPDA 3NBNB 1N52A 5BNWA 2H6GA 3JQ1A 4A63B 3JUEA 3MEKA 5BXUA 2A5EA 2KXPC 5HRYA 3D3MA 3J5PA 1H0AA 4GPKA 3MKQA 4GB9A 3DRAA 3KAEA 3DSVA 5AJLA 2CFZA 4JC8A 2PM6A 3QC1A 4I17A 3LKUA 2ETCA 4FULA 2BKKB 4L2LA 4DX1A 3FH7A 4NIKA 4UWFA 1WY6A 2AWIA 2R17C 4BSZB 1ELWA 3P2BA 4JHRA 4G26A 3HXFA 3ZN3A 5ITZF 1EYHA 1PC2A 2LSVA 3U64A 5JHBA 4BFRA 4EQFA 3TWUA 2WXRA 3UM0A 3G2SA 3MGBA 4MLPA 5EN5D 3ULQA 2WVIA 4ANWA 4M7CA 4CT4A 1UJKA 3APCA 2CHXA 4DK5A 2IOSA 2QYUA 4NRHB 4YVQC 5T3RA 1N95A 1QBQA 4H7YA 2PNNA 4K5AB 2RG8A 4HVBA 3LXUX 3TWWA 3FUKA 4L9PA 2CG3A 5FWQA 1E8ZA 4J8FA 4WWPA 3I3NA 3IKOB 4R7LA 2ZXWE 2GRPB 5ENTD 4LRZA 1BU9A 4A3VA 1DC2A 1IXVA 5AQBA 2X6HA 1UG3A 3BG1B 3FTUA 4CT0A 2OCCE 3E34A 2AXUA 4GYWA 1H2UA 1S63A 1G3NB 2DVWA 4ILGA 4HXIA 2CG2A 4CZ2D 5KJKA 2HE0A 5ENNA 3J5QB 3UM3A 3FTYA 5G04C 4J7WA 4AXHA 1U2VG 5CCLA 1XGWA 4GTSA 3PUJA 3QDNA 4N2SA 1WM5A 3AS5A 3MKQB 4U07A 1JUQA 4I1AA 3D9LA 2QC9A
chains in the Genus database with same CATH topology
4N3BA 3L16A 4I1MA 2Y4TA 4RVBA 3ZYLA 3UT4A 5A6CA 3FU5A 3RU0A 5G05J 4AP2A 3VTYA 1DVPA 5FTPA 3ASFA 4I1OB 3TJPA 5FJYA 4J8DA 4L2YA 1OWLA 2LSUA 2WXQA 3CVPA 4JPSA 5LP0A 4EPZA 2E0IA 3R7QA 4B8AA 4HFGA 4AY6A 4N3AA 1TJCA 2WMOA 3ZYMA 1OUVA 4BSXA 2FF4A 2XCCA 5ARGA 3QJZA 2XEVA 3S7BA 1NA3A 3EIJA 5FQ8A 2UWJG 3LY8A 4XZ4A 2WXKA 3NZSA 3U9WA 3FY4A 2BUGA 4O6FA 1QQEA 2KCLA 4MRUA 3TGOA 4UQZA 4BWRA 3CKBA 4EECA 3B13A 1HG2A 5BV0A 5JJTA 4PS8A 3D9JA 3I4RB 4GYOA 4CEMA 3O48A 3FTZA 4W9RA 1SZ9A 1MQSA 3IBEA 4JW1A 1EPUA 2FBNA 2Y4UA 2XPIA 2L0TB 4Q69A 3ZEFA 3R9AB 4Q94A 1E8XA 3CHOA 1E7UA 3KD7A 4D10C 4GA0A 3FH8A 2FO7A 4XI9A 3LVQE 3N71A 3FUHA 4TV3A 5JJ6A 3SBTB 2WXOA 4MKTA 3JCKC 4B8CB 5G05C 5KCMA 3S7FA 4F1SA 5ANRA 2QY7A 3CV0A 2BTDA 2J4DA 3MYVA 3PE4A 4WWNA 5FT9A 4GYYA 3PEVB 3ZGQA 2VGYA 3GYZA 1ELRA 1PY1A 3C98A 3UT7A 2RD0A 3L08A 3ZIMA 2X3MA 3SI5A 1ZBPA 2KATA 1HF8A 4PDXA 2LAHA 4UQYA 4G11A 2WXPA 1E7VA 1OWNA 1OWPA 2J9QA 3I5PA 2VGXA 1L5JA 1NP7A 3PREA 2WQHA 3HVEB 4ILHB 2A5UA 4DI4A 4CDRA 4HOTA 3LPZA 3IEGA 4FJZA 4H7XA 3TAXA 4A3TA 2FEZA 1IQRA 1U3CA 3CVLA 1DNPA 4RG9A 5EX0A 3D9MA 2IJGX 3JQ0A 3LYAA 4QFVA 3PUKA 4JEHA 4G23A 3FHEA 5FQ4A 2WM9A 1A17A 1UJJA 3TXMA 4G2VA 3T8MA 2AW6A 5E76A 2R59A 2A4ZA 4G24A 4XIFA 3CHPA 2GW1A 3RO3A 2AVPA 2WMNA 4I9CA 3SNXA 3ML9A 4OVVA 4WNFA 3CVXA 2XRZA 3ZYQA 1Z3YA 4FLHA 2KM4A 3PNLB 4A55A 2I1KA 3CVYA 3FTVA 2NXPA 4AOFA 4JA7A 3UQ3A 3QWWA 1FVFA 3S7DA 3CEQA 2I6HA 4U04A 4A1GA 5EX3A 3Q4AB 2IOLA 3U3WA 3D9KA 4WAFA 3FU6A 2UY1A 3LVRE 4AM9A 4J8EA 3G2VA 3PS6A 5ANLA 2VYIA 4PH4B 1MHQA 2YINA 2KC7A 3D9NA 3PDNA 4KBQA 3VTXA 4J8SA 2OVFA 3SF4A 4Q96A 5C2YA 4EBAA 2IFUA 4FLBA 2I9CA 3OXFA 3PE3A 1UW4B 2IF4A 2KCVA 3G2WA 3Q5MA 4UWHA 4HORA 2VTBA 3LCAA 4U0ZA 1E90A 3UX4A 1QNFA 4L7TA 2XPYA 2WXGA 4G1TA 4A1SA 5HQ8A 1H2VC 5J08A 3APFA 3QAQA 4ACKA 4WWOA 1LF8A 2KZTB 5BT1A 4NACA 1Z6TA 2I1JA 4Y6WA 3AU5A 3EIQC 5BV1A 3LY9A 3FUIA 4IULA 3JUIA 2OVBA 3L13A 2LNIA 2J09A 3ZW3A 1OWOA 4I43A 3UT8A 4UI9J 4ANXA 3QWPA 4ANVA 2YQ8A 4JZYA 5C1DA 4URKA 2AXVA 1EF1C 3VLEA 4OYSA 4XKBA 1HO8A 4GCNA 4F53A 4IYPA 1OWMA 2V4LA 4V3IA 4PUCA 1HFAA 3FEYA 1IYGA 4GZ3A 3IHVA 3ASDA 4NURA 2PL2A 3AS8A 3FWVA 4CRWA 4I2ZA 2WPVA 3QWVA 3RRMB 2DIWA 4G25A 3MJWA 4B89A 2FI7A 1N54A 4DI3A 1TEZA 4LEUA 2BF0X 2CHZA 2LAIA 2QFCA 3ZYKA 2J07A 4RSYA 5A7DB 3K9IA 3CIAA 2E2EA 3RRNB 3GZSA 4UWLA 2KCKA 2WQ6A 3MKRA 5A23A 4K03A 3RKVA 3RO2A 4ATGA 5EDSA 2YHCA 4PS7A 3SHFA 4FHKA 5LFAA 4JXTA 3RIBA 2PM7A 2GRLA 1JWGA 3MA5A 3FUJA 4U0UA 3CQCB 5CHEE 4HLEA 2YHEA 4CCAA 4U8HA 2V5FA 3G2TA 4BY6A 3L54A 3PVLA 3GZ1A 4XE0A 1P5QA 3Q15A 3LEWA 2WQ7A 4UWGA 1NA0A 4JL0A 2GRMA 5ARFA 3CVUA 3L6AA 2LO6A 3CLJA 4KT6B 2XQ0A 2X6IA 5AJDA 3MZLB 4AIFA 4ABNA 4E6HA 4NQ0A 2HM8A 2XRYA 2PZIA 4UWKA 3FUFA 3R7RA 3T5VA 3FUMA 3DBSA 4KZCA 4CGVA 3S7JA 4RG6A 4BT8A 2J4BA 3ASGA 2EQXA 2ONDA 5CMYA 3QKYA 4GA1A 2XGMA 4FA6A 4AVXA 4BX9A 2VGXB 4HOSA 3PH0C 3TXNA 1HS6A 2I2OA 4N5CA 4I6JA 1NZNA 1SQMA 2YNQA 4FU3A 5FZSA 4F7AA 3FUNA 1INZA 2VSOE 2MRIA 3TL5A 2WXNA 3URZA 4LERA 5LX8A 4EZJA 5KJLA 3B7RL 2VSYA 1EDUA 2IQCA 3CK7A 4I2WA 3SFZA 4E85A 2JLBA 3LY7A 5KJMA 4IRUA 3L22A 3PEUB 4GZ6A 4AY5A 3APDA 3T5XA 3MCXA 2VJ8A 3FDHA 3ML8A 1WAO1 4C0EA 3SBSA 5AYWD 4DLOA 2XHEA 1B89A 2NC9A 3JYSA 2M63A 3LDZA 4WNDA 3RK6A 4EBAG 3ONKA 2ZU6B 3ESKA 3CVNA 4L1BA 5LOZA 5G04J 3U4TA 3HHMA 3E4BA 5FQ7A 3CVVA 1H19A 2OOEA 4YVOA 3UUXA 4XI0A 1E8WA 5FZRA 3ONLA 2X6JA 3LJ3A 2UY1B 1H6KA 4EZKA 1HH8A 4GA2A 1X5BA 4EZLA 5AIJA 2WXMA 3B7TA 4MS6A 3EDTB 2HO1A 4GZ5A 3CR3A 5KJNA 3VLDA 2NSZA 1H2TC 2R5SA 2XCBA 3FTSA 4FC8A 4I6EA 4K0RA 3ZPJA 2CHWA 3ZRHA 2XPZA 4ACLA 3CKCA 3OAWA 4U0SA 4APFA 4DPRA 2WXFA 3D9IA 2X6KA 4LUNU 1HE8A 5DIZA 3G2UA 4GMLA 4WNEA 2XGSA 1S0PA 4XKCA 3SZ7A 3WXXA 3B7SA 3CVQA 4WNGA 4ANUA 5FQ6A 1UN8A 5CMWA 5T4YA 4HOUA 5JHAA 3FU3A 3QB2A 3ZHEA 4KXKB 1IQUA 4AV7A 3OXLA 3CVWA 3QK0A 3MV3B 3QOUA 4FHJA 4C9BB 2WXHA 4B94A 1ELKA 3AU4A 3DPDA 4KVMA 1N52A 4HOQA 4P29A 4I6GA 5BNWA 3JQ1A 2WXJA 3MEKA 4OVUA 3MX3A 3Q47B 5CCMA 4BTAA 3D3MA 1TJFA 3NZUA 1H0AA 2L6JA 4FADA 3MKQA 4GPKA 2WXLA 4GB9A 4Y6CA 3FEXA 5DBKA 3KAEA 3FUEA 3SD5A 5AJLA 2CFZA 1JPLA 3CSTA 3FP3A 4JC8A 3OTNA 4BT9A 2PM6A 1Y6IA 3QC1A 3PRZA 4DJAA 1QZ2A 3FTWA 4I17A 3LKUA 5D0QD 2DCPA 5D0OD 3VLFA 4FULA 5JJ7A 3QNKA 1Y8MA 4L2LA 3FH7A 1YA0A 2JEKA 4UWFA 4KVOA 1WY6A 2AWIA 3BG0B 1E8YA 2L0IA 5AENA 4JVSA 2R17C 1U3DA 3MV2B 4UI9C 5LCWJ 5E75A 1ELWA 3ZFWA 3P2BA 3CHSA 5HI7A 1JWFA 3FH5A 4JHRA 2IONA 3CHRA 4G26A 4CDNA 3ENEA 4BX8A 5EKQD 2VSNA 1HXIA 2WXIA 3S2AA 1PAQA 3ZN3A 2ILRA 1FVHA 1KLXA 1Z3XA 5G2NA 1EYHA 1PC2A 2CFUA 2OV8A 3NQPA 2LSVA 3PZDA 2X6FA 4AJWA 4GZDA 3U64A 5JHBA 4BFRA 3GW4A 4I9EA 4EQFA 2HYZA 1HZ4A 2WXRA 4FP7A 3G2SA 2P58C 2J49A 5M72A 1ZU2A 3MGBA 4MLPA 3CHMA 3ULQA 4YNDA 3UPVA 2WVIA 3RJVA 4ANWA 3ASHA 4DLQA 3CK9A 4TRQA 2VSXE 3L17A 4CGWA 1GW6A 1IHGA 2C2LA 3FTXA 1SZAA 4CT4A 3ZXSA 1UJKA 3APCA 2CHXA 3LS8A 4L23A 2C0LA 2Y3AA 4DK5A 3BEEA 2IOSA 4UI9K 4NRHB 1HG5A 4YVQC 5T3RA 4H7YA 5BPPA 5LCWC 3AS4A 1FCHA 1W3BA 4GU5A 3HVEA 4CDMA 4J6IA 2RG8A 4HVBA 3CSFA 3LXUX 2DBAA 4KMOA 1BPOA 4JEUA 3FFLA 3IV0A 3O4ZA 3FUKA 3EJNA 2CG3A 5FWQA 1VDYA 3TG5A 1E8ZA 2MOWA 4KZ0A 4N39A 4N2QA 4N3CA 5G55A 4J8FA 4WUYA 1UN9A 2IU1A 4WWPA 3NF1A 5BUZA 3SGHA 3I3NA 2FULA 2L9BA 2PQRA 2V8SE 3CQGB 3IKOB 4IN3B 3GZ2A 3HYMB 3OXGA 4JHJA 4J0UA 4R7LA 5BW8C 4ME2A 3B7UX 2V0PA 4LRZA 4A3VA 4KYOB 3KEZA 4GMJA 1HU3A 2X6HA 1UG3A 3CGHA 4U63A 2J08A 3BG1B 3D9OA 3EHMA 3CK8A 3ESLA 3FTUA 3ZVVA 4CT0A 2VTBB 1KT0A 2XGOA 2AXUA 1HX8A 2C0MA 2Q7FA 5FZQA 2WB2A 4UQXA 4GYWA 3EHNA 1H2UA 4HS2A 4JA9A 2AXZA 4GAAA 3ZHEB 4ILGA 4HXIA 3IHYA 2CG2A 5KJKA 4B0ZA 4F3VA 5ENNA 3HDXA 4GZCA 3RRUA 3PNTB 4FJYA 3U66A 4JHKA 4LCTA 3FTYA 4GCOA 3FU0A 2VQ2A 5G04C 2GGFA 2X38A 5J90A 4TUUA 4AXHA 3I4GA 3QARA 4AEZC 3HIZA 2PQNA 2HR2A 5T8IA 5CCLA 1XGWA 3Q49B 4M3OA 1XNFA 3P1UA 4APOA 3PUJA 3QDNA 4N2SA 1WM5A 2MHKA 4PS3A 3TG4A 3CHQA 3AS5A 3MKQB 4U07A 3UMVA 1KT1A 1JUQA 4XX5A 4BTBA 3D9PA 4C0MA 3KS2A 4I1AA 3FULA 1E96B 3FUDA 3D9LA 4ILIA 2KZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3B A;  5A6C A;  2Y4T A;  3RU0 A;  5G05 J;  3VTY A;  5FTP A;  3ASF A;  5FJY A;  4J8D A;  2LSU A;  3CVP A;  4AY6 A;  4N3A A;  1TJC A;  1OUV A;  2FF4 A;  2XCC A;  5ARG A;  3S7B A;  2XEV A;  1NA3 A;  2UWJ G;  3LY8 A;  2BUG A;  4O6F A;  1QQE A;  2KCL A;  3TGO A;  4UQZ A;  4BWR A;  3CKB A;  5JJT A;  4GYO A;  3O48 A;  4W9R A;  2FBN A;  2Y4U A;  2XPI A;  3R9A B;  3KD7 A;  4GA0 A;  2FO7 A;  4XI9 A;  3N71 A;  5JJ6 A;  5G05 C;  3S7F A;  3CV0 A;  3PE4 A;  5FT9 A;  4GYY A;  3ZGQ A;  2VGY A;  3GYZ A;  1ELR A;  1ZBP A;  2KAT A;  4UQY A;  2J9Q A;  2VGX A;  2WQH A;  4CDR A;  4HOT A;  3LPZ A;  3IEG A;  4H7X A;  3TAX A;  2FEZ A;  3CVL A;  4RG9 A;  5EX0 A;  3LYA A;  4G23 A;  1A17 A;  4G2V A;  4XIF A;  4G24 A;  3RO3 A;  2GW1 A;  2AVP A;  4I9C A;  4WNF A;  4JA7 A;  3UQ3 A;  3QWW A;  3S7D A;  3CEQ A;  2I6H A;  4U04 A;  5EX3 A;  3Q4A B;  3U3W A;  2UY1 A;  4AM9 A;  4J8E A;  2VYI A;  2KC7 A;  3PDN A;  4KBQ A;  3VTX A;  3SF4 A;  2IFU A;  3OXF A;  3PE3 A;  2IF4 A;  2KCV A;  4HOR A;  3Q5M A;  3LCA A;  4U0Z A;  4G1T A;  4A1S A;  5HQ8 A;  5BT1 A;  4Y6W A;  3LY9 A;  2LNI A;  4UI9 J;  3QWP A;  2YQ8 A;  5C1D A;  4GCN A;  1IYG A;  4GZ3 A;  3ASD A;  2PL2 A;  3AS8 A;  3FWV A;  4I2Z A;  2WPV A;  3QWV A;  4G25 A;  2FI7 A;  4LEU A;  2QFC A;  5A7D B;  3K9I A;  2E2E A;  2KCK A;  3MKR A;  3RKV A;  3RO2 A;  2YHC A;  3RIB A;  3MA5 A;  4U0U A;  5CHE E;  2V5F A;  3GZ1 A;  1P5Q A;  3Q15 A;  1NA0 A;  4JL0 A;  5ARF A;  4AIF A;  4ABN A;  4NQ0 A;  2PZI A;  4CGV A;  3S7J A;  4RG6 A;  4BT8 A;  3ASG A;  2OND A;  3QKY A;  4GA1 A;  2XGM A;  2VGX B;  4HOS A;  4N5C A;  1NZN A;  5FZS A;  3URZ A;  5KJL A;  2VSY A;  3CK7 A;  4I2W A;  5KJM A;  2JLB A;  3LY7 A;  4GZ6 A;  4AY5 A;  1WAO 1;  5AYW D;  4WND A;  1B89 A;  2NC9 A;  3JYS A;  3ESK A;  3CVN A;  3U4T A;  5G04 J;  3E4B A;  4YVO A;  2OOE A;  3UUX A;  4XI0 A;  5FZR A;  2UY1 B;  1HH8 A;  4GA2 A;  3EDT B;  2HO1 A;  4GZ5 A;  5KJN A;  2R5S A;  3ZPJ A;  2XCB A;  3CKC A;  4U0S A;  5DIZ A;  4WNE A;  2XGS A;  3SZ7 A;  3WXX A;  3CVQ A;  4WNG A;  4HOU A;  3ZHE A;  4KXK B;  3OXL A;  3MV3 B;  3QOU A;  4B94 A;  4HOQ A;  5BNW A;  3MEK A;  3Q47 B;  5CCM A;  4BTA A;  2L6J A;  4GPK A;  4Y6C A;  5DBK A;  3KAE A;  3FP3 A;  4BT9 A;  1QZ2 A;  4I17 A;  3LKU A;  5D0Q D;  5D0O D;  5JJ7 A;  1Y8M A;  1YA0 A;  4UI9 C;  3MV2 B;  5LCW J;  1ELW A;  3ZFW A;  5HI7 A;  4JHR A;  4G26 A;  5EKQ D;  2VSN A;  1HXI A;  3ZN3 A;  1KLX A;  1PC2 A;  2LSV A;  3GW4 A;  4I9E A;  4EQF A;  2HYZ A;  1HZ4 A;  2P58 C;  5M72 A;  1ZU2 A;  3ULQ A;  4YND A;  3UPV A;  3RJV A;  3ASH A;  3CK9 A;  4CGW A;  1IHG A;  2C2L A;  2C0L A;  3BEE A;  4UI9 K;  4NRH B;  4YVQ C;  4H7Y A;  5LCW C;  3AS4 A;  1FCH A;  1W3B A;  2DBA A;  3FFL A;  3TG5 A;  4N2Q A;  4N39 A;  4N3C A;  4J8F A;  4WUY A;  3NF1 A;  4IN3 B;  2PQR A;  4J0U A;  3GZ2 A;  3HYM B;  3OXG A;  5BW8 C;  4ME2 A;  4KYO B;  3CK8 A;  1KT0 A;  2XGO A;  2C0M A;  2Q7F A;  5FZQ A;  4UQX A;  4GYW A;  4JA9 A;  3ZHE B;  5KJK A;  4F3V A;  4GCO A;  2VQ2 A;  5G04 C;  2PQN A;  2HR2 A;  5CCL A;  3Q49 B;  1XNF A;  4APO A;  3QDN A;  4N2S A;  1WM5 A;  2MHK A;  3TG4 A;  3AS5 A;  4U07 A;  1KT1 A;  4BTB A;  3KS2 A;  4I1A A;  1E96 B; 
#chains in the Genus database with same CATH topology
 5A6C A;  4RVB A;  3UT4 A;  5G05 J;  4Z68 A;  3DXM G;  3Q78 A;  4L2Y A;  4OAV B;  4JPS A;  3ABK E;  5ARG A;  3QJZ A;  3TWQ A;  3EIJ A;  4XZ4 A;  3RAU A;  4HRL A;  4O6F A;  2KCL A;  3C3O A;  4BWR A;  3CKB A;  5BV0 A;  4PS8 A;  3D9J A;  4GYO A;  3AG1 E;  1SZ9 A;  4B93 B;  3W9F A;  3F6Q A;  3AG2 E;  4D10 C;  2DYS E;  1FPP A;  1WG0 A;  3FUH A;  3SBT B;  1JCQ A;  2WXO A;  4MKT A;  3C5R A;  3EHQ A;  3CV0 A;  3MYV A;  2BTD A;  5ANR A;  5FT9 A;  5AN8 A;  1K8K G;  2X3M A;  2KAT A;  2LAH A;  1LTX A;  1OWN A;  3I5P A;  3PRE A;  2WQH A;  1TNU A;  3ZUV B;  4DI4 A;  2F8Y A;  1IQR A;  3CVL A;  1DCE A;  3FHE A;  2IO2 C;  3DWL G;  3DSX A;  1AWC B;  5KWD A;  3CHP A;  4I9C A;  3SNX A;  3ML9 A;  4U8V D;  3CVY A;  3BU8 A;  3AG4 E;  1FVF A;  2QYJ A;  4U04 A;  5B1A E;  5EX3 A;  5EYL A;  3U3W A;  3LVR E;  2UY1 A;  1S70 B;  4AM9 A;  4J8E A;  4ZHB A;  5ANL A;  5ENS D;  4PH4 B;  1MX2 A;  2P2C P;  3SF4 A;  3OXF A;  2IF4 A;  4HOR A;  4U0Z A;  5CBN A;  3UX4 A;  2WXG A;  2OEV A;  1TR4 A;  5J08 A;  3APF A;  3QAQ A;  5BT1 A;  1TN8 A;  4Y6W A;  3L13 A;  2LNI A;  3UT8 A;  4UI9 J;  1OCC E;  3VLE A;  4OYS A;  4XKB A;  1O1S A;  5HKP A;  2R2L A;  3IHV A;  4NUR A;  4CRW A;  2WPV A;  3RRM B;  2DIW A;  4G25 A;  4B89 A;  1TEZ A;  1N54 A;  4DI3 A;  2CHZ A;  4RSY A;  3K9I A;  3RRN B;  1Q2Z A;  3MKR A;  3RO2 A;  3SHF A;  4JXT A;  4CCA A;  4BY6 A;  3L54 A;  3Q15 A;  5HS0 A;  2NYJ A;  3CLJ A;  4KT6 B;  4ABN A;  4F6R D;  1YMP A;  2PZI A;  3R7R A;  3X2Q E;  3T5V A;  3FUM A;  4KZC A;  2R05 A;  4RG6 A;  4BT8 A;  2J4B A;  3ASG A;  2OND A;  3QKY A;  4AVX A;  3TWT A;  3TXN A;  1TNB A;  1N0Q A;  1HS6 A;  4FU3 A;  1SVX A;  2VSO E;  2MRI A;  5JMN D;  5LX8 A;  5KJL A;  3CK7 A;  4I2W A;  5KJM A;  2JLB A;  4IRU A;  1D8D A;  4AY5 A;  2BKG A;  1N4P A;  5AYW D;  4EBA G;  3BQO A;  5CEA A;  3ASO E;  4O1P A;  5FQ7 A;  2OOE A;  4XI0 A;  1E8W A;  3ONL A;  2R02 A;  1S64 A;  3UIP C;  2UY1 B;  1H6K A;  1OCZ E;  4EZL A;  3C3Q A;  3ZKJ A;  5KJN A;  2NSZ A;  2R5S A;  3FTS A;  2CHW A;  4ACL A;  3CKC A;  3OAW A;  4U0S A;  3ULY A;  3UXG A;  2X6K A;  2ETA A;  1Z5S C;  3B7S A;  3KEA A;  4HI8 A;  1YYH A;  5JHA A;  4KXK B;  4AV7 A;  5D2M C;  3CVW A;  4LNB A;  4FHJ A;  1ELK A;  4P29 A;  2RKK A;  3Q47 B;  4EHM A;  4TXP A;  3NZU A;  2L6J A;  4FAD A;  5AAR A;  3Q73 A;  3FUE A;  3SD5 A;  4BT9 A;  3PRZ A;  1QZ2 A;  5D0O D;  2JEK A;  3NOG D;  4HLL A;  2L0I A;  3MV2 B;  2QZA A;  4CDN A;  5EKQ D;  1HXI A;  3S2A A;  1PAQ A;  1FVH A;  1N11 A;  2OV8 A;  3JXI A;  4GZD A;  3GW4 A;  2HYZ A;  2P9L G;  1ZU2 A;  4GTV A;  3UPV A;  3ASH A;  4TRQ A;  1GW6 A;  3KSL A;  1RW2 A;  3ZXS A;  1N9A A;  3PZ4 A;  1FCH A;  3HVE A;  3SY2 A;  1SA4 A;  4J6I A;  5ENP D;  3CSF A;  4KMO A;  2RFA A;  4JEU A;  3FFL A;  3UKR G;  3AG3 E;  3EJN A;  1VDY A;  2MOW A;  4KZ0 A;  4N39 A;  4N2Q A;  1KPS B;  2IY0 C;  5BUZ A;  4IN3 B;  2L9B A;  2PQR A;  4J0U A;  3B7U X;  4U63 A;  2J08 A;  3EHM A;  1KT0 A;  5FIO A;  1OXJ A;  2XGO A;  1HX8 A;  4HS2 A;  4JA9 A;  4GAA A;  3DEO A;  3IHY A;  1KZP A;  5AQA A;  5CER B;  3RRU A;  2H6I A;  2EIL E;  4JHK A;  3FU0 A;  5J90 A;  4TUU A;  3QAR A;  4AEZ C;  3Q49 B;  1TN6 A;  4M3O A;  3P1U A;  4APO A;  3UMV A;  1KT1 A;  4BTB A;  4XX5 A;  1N0R A;  1E96 B;  4ILI A;  3E37 A;  3L16 A;  4GTQ A;  3RU0 A;  1N4S A;  3TJP A;  2XZD G;  4DUI A;  1BD8 A;  4J8D A;  2LSU A;  3R7Q A;  4B8A A;  4AY6 A;  1LD8 A;  3ZYM A;  3ZXP A;  1OUV A;  2XCC A;  4DX6 D;  2ZGD A;  1NA3 A;  4HBD A;  2UWJ G;  3LY8 A;  3NZS A;  4U96 D;  5ENQ D;  1HG2 A;  3I4R B;  3FTZ A;  3DPY A;  4JW1 A;  2JAB A;  3WG7 E;  3R9A B;  4Q94 A;  1E8X A;  4GTO A;  3CHO A;  3KD7 A;  3NOC D;  4GMR A;  5G05 C;  5KCM A;  2J4D A;  4GYY A;  3PEV B;  3ZGQ A;  2VGY A;  1ELR A;  3UT7 A;  2RD0 A;  3L08 A;  2FO1 E;  4PDX A;  2LXL A;  3L9T A;  4UQY A;  4G11 A;  2WXP A;  1E7V A;  2J9Q A;  1NP7 A;  2B6C A;  3HVE B;  4YDO A;  4HOT A;  3LPZ A;  3Q9U C;  3IEG A;  4H7X A;  1U3C A;  4QFV A;  2Y0B G;  4G23 A;  5FQ4 A;  2P9S G;  2R59 A;  2A4Z A;  3RO3 A;  2XRZ A;  1Z3Y A;  1NI1 A;  2KM4 A;  3PNL B;  5JA4 D;  3UQ3 A;  4A1G A;  3Q4A B;  2B0O E;  3D9K A;  3PS6 A;  2KC7 A;  4KBQ A;  3E32 A;  4J8S A;  3Q7A A;  2OVF A;  4Q96 A;  5C2Y A;  4FLB A;  2VTB A;  3LCA A;  1E90 A;  5HQ8 A;  1H2V C;  4GTT A;  1LF8 A;  3E30 A;  2I1J A;  3EIQ C;  3JUI A;  2J09 A;  3HXE A;  3LJN A;  4ANX A;  2YQ8 A;  3SO8 A;  5C1D A;  1EF1 C;  3R9M A;  5BXO A;  4F53 A;  1OWM A;  4PUC A;  1IYG A;  4GZ3 A;  2PL2 A;  3V30 A;  4I2Z A;  3MJW A;  2FI7 A;  2BF0 X;  2LAI A;  1OT8 A;  2EIM E;  4UWL A;  2KCK A;  3V31 A;  2WQ6 A;  3RKV A;  2YHC A;  4FHK A;  5LFA A;  3RIB A;  2PM7 A;  4U7E B;  5CHE E;  4X8Q A;  2YHE A;  4U8H A;  1WDY A;  4XE0 A;  3LEW A;  1MX4 A;  4UWG A;  2GRN B;  3W9G A;  5D66 A;  3Q7F A;  1MX6 A;  2LO6 A;  1LD7 A;  4HQD A;  4NQ0 A;  3T9K A;  4N5Q A;  4BES A;  3S7J A;  2EQX A;  5CMY A;  4GA1 A;  4HOS A;  3Q9N C;  1NZN A;  1H6P A;  1H6O A;  2VSY A;  4E85 A;  3PEU B;  4LNU D;  3T5X A;  3MCX A;  2VJ8 A;  1BI7 B;  4C0E A;  4WND A;  4GTR A;  2M63 A;  3CVN A;  5LOZ A;  5G04 J;  3E4B A;  2J8S D;  5FZR A;  4GTP A;  2X6J A;  2GRR B;  1X5B A;  2OEW A;  5AIJ A;  3B7T A;  4GZ5 A;  3CR3 A;  3VLD A;  2AJA A;  2XCB A;  3ZRH A;  4APF A;  4G8K A;  3T8K A;  2XGS A;  1S0P A;  3SZ7 A;  4WNG A;  3QB2 A;  5B1B E;  3ZHE A;  3QK0 A;  4C9B B;  3QOU A;  2WXH A;  3KSQ A;  3EU5 A;  4I6G A;  2WXJ A;  4QQI A;  4OVU A;  3B95 A;  5CCM A;  4LNG A;  1TJF A;  2MYO A;  4J8Y A;  5IY5 E;  5DBK A;  4CYM D;  3UIN C;  3CST A;  3OTN A;  4RQI A;  3FTW A;  4ATZ D;  2GRO B;  5D0Q D;  3VLF A;  1Y8M A;  1YA0 A;  3DSW A;  3BG0 B;  2H6F A;  5AEN A;  4JVS A;  1U3D A;  5LCW J;  3ZFW A;  5HI7 A;  1AP7 A;  4BEP A;  2ION A;  4BX8 A;  2WXI A;  2ILR A;  1KLX A;  5G2N A;  2CFU A;  4HRN A;  2X6F A;  1HZ4 A;  3DXK G;  1K3Z D;  4FP7 A;  2ZIS A;  3CHM A;  3EU9 A;  4YND A;  3TWR A;  3RJV A;  3SFX A;  4CGW A;  2BED A;  1IHG A;  2C2L A;  3FTX A;  5H7P A;  3LS8 A;  4L23 A;  2C0L A;  2Y3A A;  3BEE A;  4UI9 K;  1HG5 A;  5BPP A;  3AS4 A;  5KBA A;  1W3B A;  3RSE G;  1BPO A;  3IV0 A;  1K1A A;  2IO3 C;  3TG5 A;  3V2X A;  1UN9 A;  2IU1 A;  3SGH A;  2FUL A;  2V8S E;  3OXG A;  1SA5 A;  5BW8 C;  2V0P A;  4KYO B;  1OCO E;  3CGH A;  3D9O A;  2EIN E;  3ZVV A;  2Q7F A;  5FZQ A;  4UQX A;  3E33 A;  2L6B A;  2AXZ A;  3ZHE B;  1TNY A;  4XEI G;  4B0Z A;  3PNT B;  4FJY A;  4LCT A;  1ZB1 A;  2GGF A;  4HI9 A;  3TG4 A;  5B3S E;  3CHQ A;  3ABL E;  3D9P A;  3TWV A;  3FUL A;  3FUD A;  4I1M A;  3ZYL A;  3FU5 A;  1N4R A;  2EIJ E;  3VTY A;  4AP2 A;  1DVP A;  5FTP A;  3ASF A;  4I1O B;  1OWL A;  2WXQ A;  3CVP A;  5LP0 A;  1TJC A;  4BSX A;  2XEV A;  4RLY A;  1YCS B;  2WXK A;  3U9W A;  2BUG A;  3C72 A;  2DZN A;  4UQZ A;  2P9I G;  4EEC A;  2EIK E;  4CEM A;  1SW6 A;  4W9R A;  1MQS A;  1FT2 A;  1TNZ A;  2Y4U A;  2XPI A;  2L0T B;  4Q69 A;  3ZEF A;  1E7U A;  5CBO A;  1O5M A;  5KNH D;  5EIB E;  5EYP F;  3JCK C;  3S7F A;  2QY7 A;  3GYZ A;  3C98 A;  4GPM A;  3BUA A;  3SI5 A;  1NFI E;  2DWZ A;  2VGX A;  3L82 A;  2A5U A;  3TAX A;  4A3T A;  2FEZ A;  4RG9 A;  3D9M A;  2P9P G;  4JEH A;  2WM9 A;  1OCR E;  1UJJ A;  3PZ1 A;  3TXM A;  4G2V A;  4XIF A;  4G24 A;  2P9K G;  2GW1 A;  2AVP A;  3CVX A;  3ZYQ A;  4A55 A;  3IXE A;  4JA7 A;  3QWW A;  2XEE A;  2I6H A;  4WAF A;  3FU6 A;  3ZNG A;  4MBG A;  3ABM E;  3PDN A;  2IFU A;  3PE3 A;  2KCV A;  3G2W A;  3Q5M A;  4DRX E;  1QNF A;  4L7T A;  2XPY A;  4G1T A;  4UUC A;  5ENR D;  5AQ7 A;  4WWO A;  3TWS A;  1JCR A;  1Z6T A;  5BV1 A;  4IUL A;  1OWO A;  4I43 A;  3TWX A;  4BET A;  4URK A;  4JZY A;  4DX7 D;  1N94 A;  4GCN A;  1HFA A;  1TNO A;  3ASD A;  2KBX A;  3QWV A;  1RZ4 A;  4LEU A;  2QFC A;  5ENO D;  5A7D B;  2E2E A;  4TUM A;  4K03 A;  4ATG A;  1BLX B;  2GRL A;  1JWG A;  3MA5 A;  3FUJ A;  3CQC B;  3DST A;  4YDW A;  2V5F A;  3G2T A;  3PVL A;  1V54 E;  1P5Q A;  2XEN A;  5ARF A;  3L6A A;  2XQ0 A;  5CRU A;  3EUV A;  2HM8 A;  4K5B A;  3FUF A;  3DBS A;  4CGV A;  1KZO A;  4FA6 A;  2XGM A;  4BX9 A;  2VGX B;  3UM1 A;  3PH0 C;  4N5C A;  4I6J A;  2YNQ A;  5FZS A;  1INZ A;  3URZ A;  4LER A;  1BI8 B;  3B7R L;  3SFZ A;  3LY7 A;  3L22 A;  4GZ6 A;  3Q75 A;  1WAO 1;  4DLO A;  2VGE A;  2NC9 A;  3JYS A;  3RK6 A;  4TXR A;  4HB5 A;  2V5Q C;  1V55 E;  3U4T A;  3CVV A;  1H19 A;  4YVO A;  2V4H C;  3ISM C;  3LJ3 A;  2F0Y A;  4EZK A;  1HH8 A;  5FIN A;  4MS6 A;  1NL4 A;  3UIO C;  3EDT B;  3PZ2 A;  2HO1 A;  1H2T C;  4K0R A;  2XPZ A;  4DPR A;  3D9I A;  1HE8 A;  3G2U A;  4XKC A;  3WXX A;  4YDE A;  4G8L A;  3NB2 A;  4HOU A;  3FU3 A;  3OXL A;  3MV3 B;  4B94 A;  3AU4 A;  4KVM A;  4HOQ A;  4O1O A;  2IEJ A;  3MX3 A;  1A5E A;  4BTA A;  2WXL A;  3JXJ A;  4Y6C A;  3FEX A;  1JPL A;  3FP3 A;  1MZC A;  1Y6I A;  1QYM A;  4DJA A;  4O60 A;  3UI2 A;  5CRV A;  2DCP A;  5JJ7 A;  3QNK A;  4KVO A;  2F8X K;  4LSZ E;  1E8Y A;  4UI9 C;  5E75 A;  3CHS A;  1JWF A;  3FH5 A;  3CHR A;  2R03 A;  3ENE A;  2VSN A;  1Z3X A;  3NQP A;  4HRM B;  3PZD A;  4AJW A;  2DYR E;  4I9E A;  1JCS A;  1N4Q A;  2P58 C;  2J49 A;  5M72 A;  5AAO A;  3NAW A;  4DLQ A;  3CK9 A;  2VSX E;  3L17 A;  1OY3 D;  1SZA A;  1DCQ A;  5LCW C;  4GU5 A;  4CDM A;  2ZGG A;  3SQV A;  1D9S A;  2DBA A;  3C3R A;  3O4Z A;  4N3C A;  5G55 A;  4WUY A;  3NF1 A;  3CQG B;  3HRA A;  3GZ2 A;  3HYM B;  4JHJ A;  4ME2 A;  3KEZ A;  4GMJ A;  1TN7 A;  2ETB A;  1HU3 A;  4OAU C;  3CK8 A;  3ESL A;  4GTM A;  2VTB B;  2P9N G;  2C0M A;  2WB2 A;  3EHN A;  4F3V A;  3HDX A;  4GZC A;  3U66 A;  3DEP A;  4GCO A;  2VQ2 A;  2X38 A;  3I4G A;  3HIZ A;  2PQN A;  2HR2 A;  5T8I A;  1K1B A;  1XNF A;  4C48 B;  3HXB A;  2MHK A;  4PS3 A;  3V2O A;  4C0M A;  3KS2 A;  1MJ0 A;  2KZT A;  4N3B A;  2Y4T A;  5FJY A;  4EPZ A;  2E0I A;  2XEH A;  4HFG A;  4N3A A;  4JB8 P;  2WMO A;  4ZFH A;  2FF4 A;  3S7B A;  2H6H A;  3ASN E;  5FQ8 A;  3FY4 A;  1QQE A;  4MRU A;  3TGO A;  3B13 A;  1MYO A;  5JJT A;  1FT1 A;  3O48 A;  3IBE A;  1EPU A;  2FBN A;  4TXQ A;  4GA0 A;  3FH8 A;  2FO7 A;  4XI9 A;  3LVQ E;  3N71 A;  4TV3 A;  5JJ6 A;  4B8C B;  4JD2 G;  3AAA C;  4F1S A;  4WWN A;  3PE4 A;  5EIL A;  4HNA D;  1PY1 A;  3ZIM A;  2DZO A;  1ZBP A;  1HF8 A;  4F1P A;  3EHR A;  1OWP A;  1L5J A;  4YDY A;  2RFM A;  4ILH B;  4CDR A;  5KNG A;  4FJZ A;  2XS8 A;  3HXD A;  1DNP A;  5EX0 A;  3DSU A;  2IJG X;  3JQ0 A;  3LYA A;  3PUK A;  1A17 A;  3T8M A;  2AW6 A;  5E76 A;  2WMN A;  1IHB A;  4OVV A;  3Q79 A;  4WNF A;  1O1T A;  4FLH A;  5EID A;  2I1K A;  3FTV A;  2NXP A;  4AOF A;  3S7D A;  3CEQ A;  2IOL A;  3DSS A;  3G2V A;  2VYI A;  1D8E A;  1MHQ A;  2YIN A;  3D9N A;  3VTX A;  4EBA A;  2I9C A;  4UWH A;  1UW4 B;  4LG6 A;  4U8Y D;  2P9U G;  4A1S A;  5AQ9 A;  1X81 A;  4DX2 A;  4ACK A;  2KZT B;  4NAC A;  3AU5 A;  3LY9 A;  3FUI A;  2OVB A;  3ZW3 A;  3V79 K;  3QWP A;  4ANV A;  3HG0 D;  2AXV A;  4K5C A;  1HO8 A;  3D9H A;  4IYP A;  2V4L A;  4V3I A;  3FEY A;  3FWV A;  3AS8 A;  3ZYK A;  2J07 A;  3UM2 A;  3CIA A;  3GZS A;  5A23 A;  5EDS A;  4PS7 A;  3UKU G;  3PZ3 A;  4U0U A;  4HLE A;  3GZ1 A;  2WQ7 A;  4U95 D;  1NA0 A;  4JL0 A;  2GRM A;  3CVU A;  1TYQ G;  2X6I A;  5AJD A;  3MZL B;  4AIF A;  4E6H A;  2XRY A;  4UWK A;  2LUH A;  2GRQ B;  2XS1 A;  2I2O A;  1O1R A;  1SQM A;  4F7A A;  3FUN A;  5CED B;  1IKN D;  2WXN A;  3TL5 A;  4BER A;  4EZJ A;  4DX5 D;  1EDU A;  3B7B A;  2IQC A;  3UTM A;  3APD A;  3AJI A;  3HXC A;  3FDH A;  3ML8 A;  1UOH A;  2XZT G;  3SBS A;  2XHE A;  1B89 A;  3LDZ A;  3ONK A;  2ZU6 B;  2F37 A;  3ESK A;  4L1B A;  3HHM A;  3UUX A;  2ZIR A;  3SFY A;  4GA2 A;  2Y1L E;  2WXM A;  3ZPJ A;  4I6E A;  4FC8 A;  2Y69 E;  2WXF A;  4LUN U;  5DIZ A;  4GML A;  4WNE A;  2LXM A;  3CVQ A;  4ANU A;  5FQ6 A;  1UN8 A;  5CMW A;  3ZU7 B;  5T4Y A;  5CEC B;  1IQU A;  3ULE G;  3DPD A;  3NBN B;  1N52 A;  5BNW A;  2H6G A;  3JQ1 A;  4A63 B;  3JUE A;  3MEK A;  5BXU A;  2A5E A;  2KXP C;  5HRY A;  3D3M A;  3J5P A;  1H0A A;  4GPK A;  3MKQ A;  4GB9 A;  3DRA A;  3KAE A;  3DSV A;  5AJL A;  2CFZ A;  4JC8 A;  2PM6 A;  3QC1 A;  4I17 A;  3LKU A;  2ETC A;  4FUL A;  2BKK B;  4L2L A;  4DX1 A;  3FH7 A;  4NIK A;  4UWF A;  1WY6 A;  2AWI A;  2R17 C;  4BSZ B;  1ELW A;  3P2B A;  4JHR A;  4G26 A;  3HXF A;  3ZN3 A;  5ITZ F;  1EYH A;  1PC2 A;  2LSV A;  3U64 A;  5JHB A;  4BFR A;  4EQF A;  3TWU A;  2WXR A;  3UM0 A;  3G2S A;  3MGB A;  4MLP A;  5EN5 D;  3ULQ A;  2WVI A;  4ANW A;  4M7C A;  4CT4 A;  1UJK A;  3APC A;  2CHX A;  4DK5 A;  2IOS A;  2QYU A;  4NRH B;  4YVQ C;  5T3R A;  1N95 A;  1QBQ A;  4H7Y A;  2PNN A;  4K5A B;  2RG8 A;  4HVB A;  3LXU X;  3TWW A;  3FUK A;  4L9P A;  2CG3 A;  5FWQ A;  1E8Z A;  4J8F A;  4WWP A;  3I3N A;  3IKO B;  4R7L A;  2ZXW E;  2GRP B;  5ENT D;  4LRZ A;  1BU9 A;  4A3V A;  1DC2 A;  1IXV A;  5AQB A;  2X6H A;  1UG3 A;  3BG1 B;  3FTU A;  4CT0 A;  2OCC E;  3E34 A;  2AXU A;  4GYW A;  1H2U A;  1S63 A;  1G3N B;  2DVW A;  4ILG A;  4HXI A;  2CG2 A;  4CZ2 D;  5KJK A;  2HE0 A;  5ENN A;  3J5Q B;  3UM3 A;  3FTY A;  5G04 C;  4J7W A;  4AXH A;  1U2V G;  5CCL A;  1XGW A;  4GTS A;  3PUJ A;  3QDN A;  4N2S A;  1WM5 A;  3AS5 A;  3MKQ B;  4U07 A;  1JUQ A;  4I1A A;  3D9L A;  2QC9 A; 
#chains in the Genus database with same CATH homology
 4N3B A;  3L16 A;  4I1M A;  2Y4T A;  4RVB A;  3ZYL A;  3UT4 A;  5A6C A;  3FU5 A;  3RU0 A;  5G05 J;  4AP2 A;  3VTY A;  1DVP A;  5FTP A;  3ASF A;  4I1O B;  3TJP A;  5FJY A;  4J8D A;  4L2Y A;  1OWL A;  2LSU A;  2WXQ A;  3CVP A;  4JPS A;  5LP0 A;  4EPZ A;  2E0I A;  3R7Q A;  4B8A A;  4HFG A;  4AY6 A;  4N3A A;  1TJC A;  2WMO A;  3ZYM A;  1OUV A;  4BSX A;  2FF4 A;  2XCC A;  5ARG A;  3QJZ A;  2XEV A;  3S7B A;  1NA3 A;  3EIJ A;  5FQ8 A;  2UWJ G;  3LY8 A;  4XZ4 A;  2WXK A;  3NZS A;  3U9W A;  3FY4 A;  2BUG A;  4O6F A;  1QQE A;  2KCL A;  4MRU A;  3TGO A;  4UQZ A;  4BWR A;  3CKB A;  4EEC A;  3B13 A;  1HG2 A;  5BV0 A;  5JJT A;  4PS8 A;  3D9J A;  3I4R B;  4GYO A;  4CEM A;  3O48 A;  3FTZ A;  4W9R A;  1SZ9 A;  1MQS A;  3IBE A;  4JW1 A;  1EPU A;  2FBN A;  2Y4U A;  2XPI A;  2L0T B;  4Q69 A;  3ZEF A;  3R9A B;  4Q94 A;  1E8X A;  3CHO A;  1E7U A;  3KD7 A;  4D10 C;  4GA0 A;  3FH8 A;  2FO7 A;  4XI9 A;  3LVQ E;  3N71 A;  3FUH A;  4TV3 A;  5JJ6 A;  3SBT B;  2WXO A;  4MKT A;  3JCK C;  4B8C B;  5G05 C;  5KCM A;  3S7F A;  4F1S A;  5ANR A;  2QY7 A;  3CV0 A;  2BTD A;  2J4D A;  3MYV A;  3PE4 A;  4WWN A;  5FT9 A;  4GYY A;  3PEV B;  3ZGQ A;  2VGY A;  3GYZ A;  1ELR A;  1PY1 A;  3C98 A;  3UT7 A;  2RD0 A;  3L08 A;  3ZIM A;  2X3M A;  3SI5 A;  1ZBP A;  2KAT A;  1HF8 A;  4PDX A;  2LAH A;  4UQY A;  4G11 A;  2WXP A;  1E7V A;  1OWN A;  1OWP A;  2J9Q A;  3I5P A;  2VGX A;  1L5J A;  1NP7 A;  3PRE A;  2WQH A;  3HVE B;  4ILH B;  2A5U A;  4DI4 A;  4CDR A;  4HOT A;  3LPZ A;  3IEG A;  4FJZ A;  4H7X A;  3TAX A;  4A3T A;  2FEZ A;  1IQR A;  1U3C A;  3CVL A;  1DNP A;  4RG9 A;  5EX0 A;  3D9M A;  2IJG X;  3JQ0 A;  3LYA A;  4QFV A;  3PUK A;  4JEH A;  4G23 A;  3FHE A;  5FQ4 A;  2WM9 A;  1A17 A;  1UJJ A;  3TXM A;  4G2V A;  3T8M A;  2AW6 A;  5E76 A;  2R59 A;  2A4Z A;  4G24 A;  4XIF A;  3CHP A;  2GW1 A;  3RO3 A;  2AVP A;  2WMN A;  4I9C A;  3SNX A;  3ML9 A;  4OVV A;  4WNF A;  3CVX A;  2XRZ A;  3ZYQ A;  1Z3Y A;  4FLH A;  2KM4 A;  3PNL B;  4A55 A;  2I1K A;  3CVY A;  3FTV A;  2NXP A;  4AOF A;  4JA7 A;  3UQ3 A;  3QWW A;  1FVF A;  3S7D A;  3CEQ A;  2I6H A;  4U04 A;  4A1G A;  5EX3 A;  3Q4A B;  2IOL A;  3U3W A;  3D9K A;  4WAF A;  3FU6 A;  2UY1 A;  3LVR E;  4AM9 A;  4J8E A;  3G2V A;  3PS6 A;  5ANL A;  2VYI A;  4PH4 B;  1MHQ A;  2YIN A;  2KC7 A;  3D9N A;  3PDN A;  4KBQ A;  3VTX A;  4J8S A;  2OVF A;  3SF4 A;  4Q96 A;  5C2Y A;  4EBA A;  2IFU A;  4FLB A;  2I9C A;  3OXF A;  3PE3 A;  1UW4 B;  2IF4 A;  2KCV A;  3G2W A;  3Q5M A;  4UWH A;  4HOR A;  2VTB A;  3LCA A;  4U0Z A;  1E90 A;  3UX4 A;  1QNF A;  4L7T A;  2XPY A;  2WXG A;  4G1T A;  4A1S A;  5HQ8 A;  1H2V C;  5J08 A;  3APF A;  3QAQ A;  4ACK A;  4WWO A;  1LF8 A;  2KZT B;  5BT1 A;  4NAC A;  1Z6T A;  2I1J A;  4Y6W A;  3AU5 A;  3EIQ C;  5BV1 A;  3LY9 A;  3FUI A;  4IUL A;  3JUI A;  2OVB A;  3L13 A;  2LNI A;  2J09 A;  3ZW3 A;  1OWO A;  4I43 A;  3UT8 A;  4UI9 J;  4ANX A;  3QWP A;  4ANV A;  2YQ8 A;  4JZY A;  5C1D A;  4URK A;  2AXV A;  1EF1 C;  3VLE A;  4OYS A;  4XKB A;  1HO8 A;  4GCN A;  4F53 A;  4IYP A;  1OWM A;  2V4L A;  4V3I A;  4PUC A;  1HFA A;  3FEY A;  1IYG A;  4GZ3 A;  3IHV A;  3ASD A;  4NUR A;  2PL2 A;  3AS8 A;  3FWV A;  4CRW A;  4I2Z A;  2WPV A;  3QWV A;  3RRM B;  2DIW A;  4G25 A;  3MJW A;  4B89 A;  2FI7 A;  1N54 A;  4DI3 A;  1TEZ A;  4LEU A;  2BF0 X;  2CHZ A;  2LAI A;  2QFC A;  3ZYK A;  2J07 A;  4RSY A;  5A7D B;  3K9I A;  3CIA A;  2E2E A;  3RRN B;  3GZS A;  4UWL A;  2KCK A;  2WQ6 A;  3MKR A;  5A23 A;  4K03 A;  3RKV A;  3RO2 A;  4ATG A;  5EDS A;  2YHC A;  4PS7 A;  3SHF A;  4FHK A;  5LFA A;  4JXT A;  3RIB A;  2PM7 A;  2GRL A;  1JWG A;  3MA5 A;  3FUJ A;  4U0U A;  3CQC B;  5CHE E;  4HLE A;  2YHE A;  4CCA A;  4U8H A;  2V5F A;  3G2T A;  4BY6 A;  3L54 A;  3PVL A;  3GZ1 A;  4XE0 A;  1P5Q A;  3Q15 A;  3LEW A;  2WQ7 A;  4UWG A;  1NA0 A;  4JL0 A;  2GRM A;  5ARF A;  3CVU A;  3L6A A;  2LO6 A;  3CLJ A;  4KT6 B;  2XQ0 A;  2X6I A;  5AJD A;  3MZL B;  4AIF A;  4ABN A;  4E6H A;  4NQ0 A;  2HM8 A;  2XRY A;  2PZI A;  4UWK A;  3FUF A;  3R7R A;  3T5V A;  3FUM A;  3DBS A;  4KZC A;  4CGV A;  3S7J A;  4RG6 A;  4BT8 A;  2J4B A;  3ASG A;  2EQX A;  2OND A;  5CMY A;  3QKY A;  4GA1 A;  2XGM A;  4FA6 A;  4AVX A;  4BX9 A;  2VGX B;  4HOS A;  3PH0 C;  3TXN A;  1HS6 A;  2I2O A;  4N5C A;  4I6J A;  1NZN A;  1SQM A;  2YNQ A;  4FU3 A;  5FZS A;  4F7A A;  3FUN A;  1INZ A;  2VSO E;  2MRI A;  3TL5 A;  2WXN A;  3URZ A;  4LER A;  5LX8 A;  4EZJ A;  5KJL A;  3B7R L;  2VSY A;  1EDU A;  2IQC A;  3CK7 A;  4I2W A;  3SFZ A;  4E85 A;  2JLB A;  3LY7 A;  5KJM A;  4IRU A;  3L22 A;  3PEU B;  4GZ6 A;  4AY5 A;  3APD A;  3T5X A;  3MCX A;  2VJ8 A;  3FDH A;  3ML8 A;  1WAO 1;  4C0E A;  3SBS A;  5AYW D;  4DLO A;  2XHE A;  1B89 A;  2NC9 A;  3JYS A;  2M63 A;  3LDZ A;  4WND A;  3RK6 A;  4EBA G;  3ONK A;  2ZU6 B;  3ESK A;  3CVN A;  4L1B A;  5LOZ A;  5G04 J;  3U4T A;  3HHM A;  3E4B A;  5FQ7 A;  3CVV A;  1H19 A;  2OOE A;  4YVO A;  3UUX A;  4XI0 A;  1E8W A;  5FZR A;  3ONL A;  2X6J A;  3LJ3 A;  2UY1 B;  1H6K A;  4EZK A;  1HH8 A;  4GA2 A;  1X5B A;  4EZL A;  5AIJ A;  2WXM A;  3B7T A;  4MS6 A;  3EDT B;  2HO1 A;  4GZ5 A;  3CR3 A;  5KJN A;  3VLD A;  2NSZ A;  1H2T C;  2R5S A;  2XCB A;  3FTS A;  4FC8 A;  4I6E A;  4K0R A;  3ZPJ A;  2CHW A;  3ZRH A;  2XPZ A;  4ACL A;  3CKC A;  3OAW A;  4U0S A;  4APF A;  4DPR A;  2WXF A;  3D9I A;  2X6K A;  4LUN U;  1HE8 A;  5DIZ A;  3G2U A;  4GML A;  4WNE A;  2XGS A;  1S0P A;  4XKC A;  3SZ7 A;  3WXX A;  3B7S A;  3CVQ A;  4WNG A;  4ANU A;  5FQ6 A;  1UN8 A;  5CMW A;  5T4Y A;  4HOU A;  5JHA A;  3FU3 A;  3QB2 A;  3ZHE A;  4KXK B;  1IQU A;  4AV7 A;  3OXL A;  3CVW A;  3QK0 A;  3MV3 B;  3QOU A;  4FHJ A;  4C9B B;  2WXH A;  4B94 A;  1ELK A;  3AU4 A;  3DPD A;  4KVM A;  1N52 A;  4HOQ A;  4P29 A;  4I6G A;  5BNW A;  3JQ1 A;  2WXJ A;  3MEK A;  4OVU A;  3MX3 A;  3Q47 B;  5CCM A;  4BTA A;  3D3M A;  1TJF A;  3NZU A;  1H0A A;  2L6J A;  4FAD A;  3MKQ A;  4GPK A;  2WXL A;  4GB9 A;  4Y6C A;  3FEX A;  5DBK A;  3KAE A;  3FUE A;  3SD5 A;  5AJL A;  2CFZ A;  1JPL A;  3CST A;  3FP3 A;  4JC8 A;  3OTN A;  4BT9 A;  2PM6 A;  1Y6I A;  3QC1 A;  3PRZ A;  4DJA A;  1QZ2 A;  3FTW A;  4I17 A;  3LKU A;  5D0Q D;  2DCP A;  5D0O D;  3VLF A;  4FUL A;  5JJ7 A;  3QNK A;  1Y8M A;  4L2L A;  3FH7 A;  1YA0 A;  2JEK A;  4UWF A;  4KVO A;  1WY6 A;  2AWI A;  3BG0 B;  1E8Y A;  2L0I A;  5AEN A;  4JVS A;  2R17 C;  1U3D A;  3MV2 B;  4UI9 C;  5LCW J;  5E75 A;  1ELW A;  3ZFW A;  3P2B A;  3CHS A;  5HI7 A;  1JWF A;  3FH5 A;  4JHR A;  2ION A;  3CHR A;  4G26 A;  4CDN A;  3ENE A;  4BX8 A;  5EKQ D;  2VSN A;  1HXI A;  2WXI A;  3S2A A;  1PAQ A;  3ZN3 A;  2ILR A;  1FVH A;  1KLX A;  1Z3X A;  5G2N A;  1EYH A;  1PC2 A;  2CFU A;  2OV8 A;  3NQP A;  2LSV A;  3PZD A;  2X6F A;  4AJW A;  4GZD A;  3U64 A;  5JHB A;  4BFR A;  3GW4 A;  4I9E A;  4EQF A;  2HYZ A;  1HZ4 A;  2WXR A;  4FP7 A;  3G2S A;  2P58 C;  2J49 A;  5M72 A;  1ZU2 A;  3MGB A;  4MLP A;  3CHM A;  3ULQ A;  4YND A;  3UPV A;  2WVI A;  3RJV A;  4ANW A;  3ASH A;  4DLQ A;  3CK9 A;  4TRQ A;  2VSX E;  3L17 A;  4CGW A;  1GW6 A;  1IHG A;  2C2L A;  3FTX A;  1SZA A;  4CT4 A;  3ZXS A;  1UJK A;  3APC A;  2CHX A;  3LS8 A;  4L23 A;  2C0L A;  2Y3A A;  4DK5 A;  3BEE A;  2IOS A;  4UI9 K;  4NRH B;  1HG5 A;  4YVQ C;  5T3R A;  4H7Y A;  5BPP A;  5LCW C;  3AS4 A;  1FCH A;  1W3B A;  4GU5 A;  3HVE A;  4CDM A;  4J6I A;  2RG8 A;  4HVB A;  3CSF A;  3LXU X;  2DBA A;  4KMO A;  1BPO A;  4JEU A;  3FFL A;  3IV0 A;  3O4Z A;  3FUK A;  3EJN A;  2CG3 A;  5FWQ A;  1VDY A;  3TG5 A;  1E8Z A;  2MOW A;  4KZ0 A;  4N39 A;  4N2Q A;  4N3C A;  5G55 A;  4J8F A;  4WUY A;  1UN9 A;  2IU1 A;  4WWP A;  3NF1 A;  5BUZ A;  3SGH A;  3I3N A;  2FUL A;  2L9B A;  2PQR A;  2V8S E;  3CQG B;  3IKO B;  4IN3 B;  3GZ2 A;  3HYM B;  3OXG A;  4JHJ A;  4J0U A;  4R7L A;  5BW8 C;  4ME2 A;  3B7U X;  2V0P A;  4LRZ A;  4A3V A;  4KYO B;  3KEZ A;  4GMJ A;  1HU3 A;  2X6H A;  1UG3 A;  3CGH A;  4U63 A;  2J08 A;  3BG1 B;  3D9O A;  3EHM A;  3CK8 A;  3ESL A;  3FTU A;  3ZVV A;  4CT0 A;  2VTB B;  1KT0 A;  2XGO A;  2AXU A;  1HX8 A;  2C0M A;  2Q7F A;  5FZQ A;  2WB2 A;  4UQX A;  4GYW A;  3EHN A;  1H2U A;  4HS2 A;  4JA9 A;  2AXZ A;  4GAA A;  3ZHE B;  4ILG A;  4HXI A;  3IHY A;  2CG2 A;  5KJK A;  4B0Z A;  4F3V A;  5ENN A;  3HDX A;  4GZC A;  3RRU A;  3PNT B;  4FJY A;  3U66 A;  4JHK A;  4LCT A;  3FTY A;  4GCO A;  3FU0 A;  2VQ2 A;  5G04 C;  2GGF A;  2X38 A;  5J90 A;  4TUU A;  4AXH A;  3I4G A;  3QAR A;  4AEZ C;  3HIZ A;  2PQN A;  2HR2 A;  5T8I A;  5CCL A;  1XGW A;  3Q49 B;  4M3O A;  1XNF A;  3P1U A;  4APO A;  3PUJ A;  3QDN A;  4N2S A;  1WM5 A;  2MHK A;  4PS3 A;  3TG4 A;  3CHQ A;  3AS5 A;  3MKQ B;  4U07 A;  3UMV A;  1KT1 A;  1JUQ A;  4XX5 A;  4BTB A;  3D9P A;  4C0M A;  3KS2 A;  4I1A A;  3FUL A;  1E96 B;  3FUD A;  3D9L A;  4ILI A;  2KZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...