2E2EA

Tpr domain of nrfg mediates the complex formation between heme lyase and formate-dependent nitrite reductase in escherichia coli o157:h7
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
171
Chain Sequence
KWQAVRAEYQRQRDPLHQFAEAQLQALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQASQHMTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELWQKVMDLNSPRINRTQLVESINMAKLLQRRSDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Formate-dependent nitrite reductase complex nrfG subunit
publication title TPR domain of NrfG mediates complex formation between heme lyase and formate-dependent nitrite reductase in Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
total genus 56
structure length 171
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2e2eA01
1NA3A 2LSUA 4ME2A 3S7JA 2HO1A 5FZRA 5KJNA 4U04A 4J8DA 3S7DA 3ASDA 4A1SA 1W3BA 4GYWA 5KJLA 4XIFA 3IEGA 3CK9A 5C1DA 4YVOA 4F3VA 2XGOA 3S7FA 3GZ1A 3RKVA 3MV2B 5EX0A 4GYOA 3KAEA 1ELWA 3HYMB 5BNWA 3LYAA 4WNEA 4W9RA 4BT9A 5D0OD 5DBKA 4G1TA 2VGXB 4N3CA 4UQXA 3GW4A 4UI9J 2KCLA 4I17A 3SZ7A 5G05J 3VTYA 2V5FA 3Q5MA 2Y4TA 3N71A 2GW1A 5FZSA 1A17A 3AS5A 4XI0A 3ULQA 3AS8A 4XI9A 3ZFWA 4IN3B 2UWJG 1ELRA 3U4TA 1HZ4A 3CKCA 4G23A 3E4BA 3K9IA 3CKBA 2KCVA 3CVLA 3LY7A 5G04C 5JJ7A 3CK8A 1QZ2A 4EQFA 3VTXA 2IFUA 2KC7A 5CHEE 2HYZA 4I2ZA 4N5CA 3JYSA 4UI9K 1FCHA 3GZ2A 5EX3A 2QFCA 4I9EA 2VGXA 3QOUA 2PQNA 5HI7A 3QKYA 4BTAA 5JJ6A 3ASGA 3RU0A 4HOUA 3U3WA 4B94A 4HOQA 3FFLA 3PDNA 3LPZA 4GZ3A 3GYZA 3NF1A 4H7YA 2FO7A 4JA9A 2XCBA 3KD7A 4JL0A 4J8FA 4YVQC 4UQYA 2FBNA 5KJKA 1NA0A 2FI7A 5FTPA 2AVPA 3ASHA 2XGMA 4JHRA 5D0QD 3SF4A 4GZ5A 4KXKB 3ZPJA 2MHKA 2VYIA 4N3AA 5M72A 3QDNA 2XCCA 5FZQA 4H7XA 1B89A 3URZA 3CVQA 3ESKA 3R9AB 3RIBA 1NZNA 1ZU2A 5BW8C 4BTBA 4J8EA 5BT1A 3LY9A 4GPKA 4N39A 2HR2A 1KLXA 5A6CA 3LCAA 4G2VA 5FT9A 2E2EA 3LKUA 3UQ3A 3WXXA 4O6FA 5KJMA 4WNFA 3UPVA 1PC2A 4N2QA 4G26A 3MV3B 3S7BA 3ZN3A 4N2SA 3Q49B 3Q4AB 2XEVA 3ASFA 3MKRA 3Q47B 4BWRA 4KYOB 5ARFA 2YQ8A 4HOTA 5LCWC 3Q15A 3TG5A 4NQ0A 3MEKA 5FJYA 2WPVA 1Y8MA 3ZGQA 3PE3A 3OXGA 4HOSA 1KT1A 4GA2A 2VQ2A 2WQHA 1TJCA 4AM9A 5CCMA 3TG4A 2LSVA 4UQZA 2NC9A 5EKQD 2Q7FA 3OXFA 4I9CA 1HH8A 1WM5A 3TAXA 5CCLA 3FP3A 2P58C 1KT0A 2VGYA 3O48A 3FWVA 2I6HA 5JJTA 2PL2A 2BUGA 3OXLA 2OOEA 2JLBA 4G24A 2UY1B 2FEZA 3EDTB 4G25A 3BEEA 3PE4A 3TGOA 5DIZA 3CV0A 1XNFA 4Y6CA 3MA5A 3QWPA 4U0SA 3CEQA 5ARGA 4RG9A 1WAO1 2C2LA 5LCWJ 3CVPA 4WNDA 1OUVA 5G04J 3RO2A 4ABNA 3LY8A 2VSNA 2L6JA 2PZIA 1HXIA 4AY6A 1QQEA 2DBAA 3RJVA 4GA0A 5HQ8A 4CGWA 4U07A 4APOA 4I1AA 2IF4A 4I2WA 1ZBPA 3RO3A 3CK7A 3ZHEB 2UY1A 4WUYA 2R5SA 4GCNA 3KS2A 4RG6A 4CGVA 4YNDA 4JA7A 4Y6WA 4J0UA 4WNGA 2FF4A 1IYGA 1YA0A 4AIFA 2XPIA 3AS4A 2KCKA 4NRHB 2LNIA 1P5QA 1IHGA 4UI9C 2VSYA 4LEUA 5G05C 3CVNA 4AY5A 4N3BA 3UUXA 2KATA 4GA1A 2C0LA 3QWVA 2PQRA 3ZHEA 4CDRA 4U0UA 4HORA 4GYYA 4GCOA 2XGSA 4KBQA 2ONDA 4GZ6A 1E96B 5A7DB 2C0MA 2YHCA 4BT8A 4U0ZA 5AYWD 3QWWA 2J9QA 2Y4UA
chains in the Genus database with same CATH superfamily
3ZIMA 5FQ7A 3FTYA 4ME2A 4E6HA 4GTTA 3FUJA 3PZ1A 5T3RA 1OT8A 5KJNA 1N4RA 2OEVA 4U04A 5LP0A 3ASDA 4YVOA 2P2CP 3G2SA 4DJAA 4JPSA 5A23A 1OWOA 2LXLA 5JHAA 4JVSA 4R7LA 1ELWA 3ZU7B 2XEHA 3ONKA 5B3SE 4WNEA 2AXVA 2P9SG 3HXDA 4W9RA 4LG6A 1K3ZD 3ZUVB 2A5UA 3APDA 3LXUX 3LJ3A 3B7TA 3RRUA 5AQ9A 3SZ7A 4JEHA 2Y1LE 3CVXA 5AIJA 4TUUA 2CG2A 2DYSE 3FU5A 1DNPA 2AWIA 4WWPA 3ULQA 4L2LA 4GTPA 3JCKC 2WB2A 2J4BA 3U4TA 1IQRA 1HZ4A 3CR3A 3E4BA 2B6CA 3CKBA 5G04C 2ZIRA 3CK8A 1QZ2A 4AVXA 3VTXA 2IFUA 3IHYA 4QFVA 1EF1C 3AAAC 5LFAA 3SBTB 2QFCA 1HS6A 4MKTA 5AENA 4IRUA 4HVBA 5JJ6A 1N0RA 2V8SE 4MBGA 4D10C 3EJNA 3QJZA 3IHVA 3ASGA 4O60A 3RU0A 2QYUA 3LS8A 4B94A 4M3OA 3AG4E 3KEZA 3LVRE 3GYZA 3DXMG 2FO7A 1E90A 1E8XA 4UQYA 2ZXWE 2WXFA 2FI7A 2FULA 5FTPA 4A63B 3PNTB 4JHRA 5D0QD 2OVFA 3FUIA 3SFXA 4HLLA 2WXNA 2VYIA 3DRAA 1U3DA 2Y69E 5ENSD 2XCCA 5IY5E 1BI7B 1B89A 3URZA 3G2UA 2BEDA 4CZ2D 3SBSA 5BW8C 3PZ3A 1DC2A 3EHMA 4GPKA 5A6CA 3B7RL 5JA4D 5FT9A 5BXOA 2WXKA 3DBSA 2CHWA 2WXRA 1S0PA 4L23A 1HU3A 2A4ZA 4JD2G 2BTDA 2NYJA 2R2LA 4M7CA 3TWWA 4GTQA 4F1PA 4LERA 3MGBA 1XGWA 3Q49B 3QARA 1LD7A 1MYOA 2DIWA 1DVPA 3C3OA 4G11A 5ARFA 4HOTA 1HX8A 3Q15A 3FU6A 2F0YA 3SGHA 2AJAA 2WXQA 1ELKA 1AWCB 5ENRD 2CFUA 1Y8MA 3E33A 4A3TA 4YDWA 4HOSA 3CQCB 1OCZE 3L6AA 3C3RA 1TJCA 3DSUA 1S64A 4PUCA 4A3VA 1SVXA 4AM9A 1TN8A 2LSVA 2AXZA 3LJNA 3DSSA 1TYQG 3OXFA 3D9PA 3U66A 2CFZA 1N0QA 3TAXA 5CCLA 2WXIA 3O48A 1N9AA 4PS3A 5JJTA 1FT1A 4HRMB 1N94A 1E8WA 4G25A 3R7RA 3IV0A 3BEEA 1YMPA 4ILHB 3CV0A 2RD0A 1MX6A 3PZ4A 4U0SA 2ZISA 4B0ZA 3HIZA 3VLEA 4BY6A 5LCWJ 5T4YA 4WNDA 2H6FA 3FH8A 4I6JA 1HFAA 4I6EA 4EHMA 1K1BA 4ANXA 2PZIA 3TWSA 5KCMA 3ABLE 4B93B 4JC8A 3RJVA 2OEWA 5HQ8A 4CGWA 4TV3A 4RVBA 4BFRA 1MHQA 3ZYQA 2EINE 2IF4A 4AXHA 3S2AA 5ANRA 1QYMA 2UY1A 4WUYA 3FY4A 1ZB1A 3CGHA 3KS2A 4GMRA 4EBAA 4L9PA 2AXUA 2WXJA 1UN9A 3HHMA 4J0UA 3I4RB 2OCCE 3DXKG 4KVOA 2CHXA 5FIOA 1UOHA 3EU5A 1YA0A 3RRMB 3QNKA 2XPIA 4CDNA 3AS4A 3ZKJA 4I43A 3FDHA 4NRHB 2WMOA 1KZPA 2LNIA 4U8YD 3CHQA 4BX8A 4LEUA 3FUNA 2J4DA 4ATGA 3L22A 4HI9A 3DWLG 4FJZA 1TN6A 4XKCA 2H6GA 2YINA 3ZYLA 4ATZD 2PM7A 2KATA 3B7UX 4JHKA 4GA1A 2C0LA 3ZHEA 4AP2A 5BV1A 3CHRA 2DWZA 4C48B 4GCOA 3Q78A 4EECA 1UG3A 5BV0A 1NL4A 4GZ6A 2Y0BG 1E96B 2C0MA 3FULA 3Q79A 4U0ZA 3CSFA 1NA3A 2LSUA 2LAHA 3S7JA 2E0IA 2X6HA 1W3BA 4GYWA 4F7AA 5KJLA 4NACA 3IEGA 5C1DA 4F3VA 1QBQA 2XGOA 3IXEA 3MV2B 4DI4A 2X38A 2L0IA 3QC1A 4NURA 3HYMB 1E8ZA 3HVEA 1BD8A 1RZ4A 5DBKA 3AG1E 1IXVA 4BEPA 3TWVA 2ZGDA 3JQ0A 2GRQB 4UQXA 3AU5A 1YYHA 3ASOE 1FVHA 3GW4A 3FEXA 2IY0C 5G05J 1LF8A 4B8AA 5BUZA 3ZYKA 2GW1A 4FADA 3UX4A 3AS5A 3UM0A 3ONLA 3MX3A 3MKQB 4EPZA 4BSZB 4XI9A 4WAFA 4MRUA 1HG5A 4JHJA 1D8EA 4LCTA 3J5PA 3NQPA 4EBAG 4GMLA 1S70B 3CVWA 5CECB 3HDXA 3CVLA 4DLQA 3ASNE 3PZDA 5AJDA 4GZDA 2KC7A 1PY1A 2XS8A 4I2ZA 3NAWA 3JYSA 5HRYA 3R9MA 2VGXA 1D9SA 2IU1A 4K5BA 5ITZF 2JABA 1JCQA 3L08A 1DCEA 4V3IA 2ILRA 4ANUA 3KSQA 3U3WA 3EU9A 4HOQA 3OTNA 3MJWA 3D9HA 3B7BA 3PDNA 4I1OB 4HRNA 2L6BA 4TXPA 4U95D 4H7YA 4L1BA 5EDSA 4I6GA 3FUHA 4JL0A 4J8FA 4YVQC 1JPLA 5D2MC 2FBNA 5BXUA 5KJKA 1NA0A 2XHEA 3AJIA 3ASHA 5CEDB 2XGMA 4U63A 4GZ5A 4KXKB 2VGEA 1DCQA 3TWQA 4N3AA 5M72A 3FTZA 3PUJA 4DX7D 3CVQA 2XRYA 3ESKA 3R9AB 1PAQA 1H0AA 4PS8A 3W9GA 3B13A 4G2VA 3E32A 4ACLA 3L16A 3LKUA 5KJMA 3PZ2A 1JWFA 1UJJA 1PC2A 4CDMA 4N2QA 4G26A 2GRRB 3MZLB 1A5EA 1AP7A 3Q4AB 3NOGD 3UT7A 3MKRA 3Q47B 4KYOB 2J09A 1H2VC 1X81A 3V2OA 4AJWA 3Q9NC 1H6PA 2WXLA 2FO1E 4G8LA 4F1SA 1VDYA 1BPOA 5AQAA 2ZGGA 5FJYA 2WPVA 2XEEA 3ZGQA 1EPUA 3OXGA 3SO8A 4F6RD 2P9LG 4QQIA 4U7EB 1N95A 4XEIG 3D9JA 4HQDA 2IEJA 5HKPA 4LNBA 3TG4A 3CHOA 3ZYMA 4UQZA 3ZXSA 5EKQD 3TWTA 2EIME 3ABME 2P9PG 3UT8A 2HM8A 3FP3A 2P58C 2NXPA 1KT0A 5AN8A 2VGYA 3VLFA 1INZA 2PL2A 2JEKA 3OXLA 3UXGA 2OOEA 2BF0X 2IOLA 4RQIA 4HS2A 4ANVA 1N4SA 3D9MA 3PE4A 3TGOA 1XNFA 1FPPA 5KWDA 2OV8A 2VSOE 4BSXA 3OAWA 1WAO1 4CYMD 2C2LA 1BI8B 3J5QB 3T8KA 2XENA 5JMND 5FQ8A 3TWUA 3NZUA 4DX1A 2L0TB 3Q75A 3APCA 4FA6A 4BERA 5E75A 2DYRE 2F37A 3G2WA 1H2TC 2LUHA 2RKKA 4FHJA 4GA0A 2V4LA 4IYPA 3T8MA 3T5XA 4CEMA 4APOA 2X6FA 3TL5A 3TXNA 4FC8A 4CT4A 3BQOA 3PUKA 2R5SA 4DI3A 4HB5A 2KM4A 2XRZA 2J07A 4Y6WA 2WVIA 3ENEA 4UWKA 1TNUA 2MYOA 3IKOB 4WWNA 4JB8P 3D9NA 3EHQA 4EZJA 1OWMA 4U8VD 5CRUA 3D9LA 1S63A 1P5QA 4ZHBA 1IHGA 4UI9C 1SZ9A 1NFIE 4TRQA 2IJGX 2X6IA 3ZVVA 3NOCD 4AY5A 4N3BA 1N11A 4IULA 3G2VA 5LOZA 2PQRA 3RSEG 5ANLA 3AG3E 4KZ0A 3HXBA 2X6JA 2WXGA 5AQBA 4GYYA 1WY6A 4C0EA 4A1GA 2XGSA 2RFAA 3UM1A 2VTBA 4KBQA 2ONDA 3V30A 3TJPA 4MLPA 3BUAA 4LUNU 1LTXA 4FJYA 3TWRA 1K8KG 1OCOE 2KZTA 2AW6A 2RG8A 4HI8A 1H19A 3EUVA 2P9IG 2WMNA 3C98A 4J8DA 5FINA 1MX4A 1TNBA 1HO8A 3S7DA 1O5MA 4A1SA 3UM3A 2DCPA 4XIFA 3CK9A 4BETA 3HXCA 3S7FA 3MCXA 3SNXA 5EX0A 1KZOA 3FUDA 4GYOA 3UKRG 3SD5A 4FULA 3FU0A 1WDYA 3L9TA 4OVUA 3DSVA 5D0OD 3SI5A 4G1TA 3D9IA 4K03A 4FP7A 3F6QA 4N3CA 3V31A 3RK6A 1OCRE 3UMVA 4I17A 3VLDA 4GTSA 5G2NA 3N71A 3E34A 1A17A 4XI0A 4GTOA 2F8YA 3AS8A 2KXPC 3ZFWA 4IN3B 5ENNA 4HXIA 3FEYA 2DVWA 3CKCA 3HXFA 4G23A 1TNOA 3ZXPA 1O1SA 2KCVA 4UWGA 5CBOA 5KBAA 3LY7A 3L13A 4GZCA 5CMYA 3G2TA 3KSLA 1G3NB 5CHEE 2BKKB 4N5CA 1FCHA 3GZ2A 4I9EA 3CVUA 2PQNA 3QKYA 2XPYA 2QY7A 5E76A 3ZRHA 2R02A 3ZNGA 4Q94A 2EIKE 1MQSA 1TR4A 2J49A 3FFLA 3DPDA 3CVYA 3Q7AA 2BKGA 4GZ3A 3FTSA 3UM2A 3NF1A 4JA9A 1SZAA 2M63A 2QYJA 1JWGA 3SF4A 5FWQA 3ZPJA 1YCSB 3EIJA 1BU9A 5AQ7A 5ENOD 3QDNA 1H2UA 3RRNB 5FZQA 3ZW3A 4H7XA 4LNUD 3RIBA 1NZNA 1ZU2A 4GAAA 4J8EA 3I3NA 4Z68A 4X8QA 3ESLA 3JQ1A 3V79K 1N4PA 2E2EA 4UWHA 3ULEG 3PS6A 1X5BA 3UPVA 2F8XK 3SY2A 1GW6A 4YDYA 2QZAA 3MV3B 3TWXA 4GU5A 3S7BA 2GRNB 5EYPF 4L2YA 1U3CA 3ASFA 3JXIA 1OWNA 4CT0A 4LNGA 1L5JA 2YQ8A 2YHEA 2R17C 2I1JA 5D66A 3Q73A 1OWPA 3TG5A 2RFMA 4NQ0A 3UIOC 3APFA 2P9UG 3PEUB 3MEKA 4AOFA 4NIKA 1FT2A 3ZEFA 4YDEA 3PNLB 3DEOA 2WXOA 1E7VA 3HRAA 3P1UA 3PE3A 4GMJA 2WQ6A 3CHSA 3LDZA 4XE0A 4E85A 4OYSA 2NSZA 3DPYA 2R59A 1KT1A 5C2YA 3Q7FA 2VQ2A 3SFYA 3CIAA 2WQHA 3UKUG 3QAQA 1Q2ZA 4HRLA 1NI1A 3ULYA 2NC9A 3U9WA 4RLYA 4I9CA 1SA5A 4URKA 3FWVA 3IBEA 2I6HA 4J8SA 1IQUA 2BUGA 3P2BA 4OVVA 1HE8A 4XKBA 3L82A 4G24A 2UY1B 3UINC 3EDTB 5AAOA 4TUMA 1FVFA 1KPSB 4Y6CA 3QWPA 3CEQA 5ARGA 3I5PA 2LO6A 4JZYA 4K5CA 4FLHA 1MZCA 1V55E 2WXPA 5G04J 4BESA 3SFZA 3RO2A 1Z3XA 5ENTD 3LY8A 3V2XA 3FUFA 3FUMA 4OAVB 2DBAA 1O1TA 3BG1B 3FTWA 3B7SA 4U07A 3UIPC 4I1AA 4TXRA 5B1BE 3ZHEB 4YDOA 3HG0D 2J8SD 4CGVA 4XZ4A 5JHBA 1N54A 3FH5A 4AEZC 4JA7A 4WNGA 2B0OE 3CSTA 4J8YA 1Z6TA 3X2QE 1IYGA 4F53A 4DX6D 2MRIA 2ETAA 4J7WA 2KCKA 2R05A 1EDUA 3JUEA 2LXMA 4K5AB 3B95A 3R7QA 2QC9A 2P9KG 1MJ0A 5AARA 4JEUA 3HVEB 4DK5A 4DX2A 3ML9A 3QWVA 1WG0A 4CDRA 4U0UA 1K1AA 4HORA 1OY3D 5LX8A 4AV7A 2H6IA 2YHCA 4BT8A 2WXHA 5AYWD 2J9QA 3PH0C 2V5QC 3QK0A 2ETCA 2HO1A 5FZRA 3CLJA 2I9CA 2XS1A 3CHPA 3MYVA 4CRWA 4PDXA 1NP7A 2LAIA 1SW6A 3GZ1A 3RKVA 3NBNB 3KAEA 2KBXA 3GZSA 5BNWA 3LYAA 1N4QA 4B89A 5B1AE 3DSTA 4BT9A 4EZLA 3HXEA 1HG2A 2VGXB 3DEPA 1U2VG 1HF8A 2MOWA 3L54A 4UI9J 2KCLA 4APFA 3VTYA 2V5FA 5ENPD 3Q5MA 4ACKA 2Y4TA 3D3MA 4HNAD 5FZSA 3LVQE 3C5RA 4GPMA 1JUQA 3EIQC 2UWJG 1ELRA 2J08A 4LRZA 3K9IA 3RAUA 2OVBA 5KNGA 1O1RA 4DX5D 2X6KA 2XZDG 4EQFA 5JJ7A 2V4HC 3JXJA 4N5QA 2HYZA 3CQGB 2WXMA 2XZTG 4UI9K 4ANWA 3FTUA 5EX3A 3E37A 3QOUA 3Q9UC 4L7TA 5HI7A 2DZNA 4FLBA 5FQ6A 4BTAA 2CHZA 4HOUA 1H6OA 4ZFHA 1SQMA 4A55A 3E30A 3MKQA 3LPZA 4DUIA 1H6KA 2XPZA 2WM9A 2IO2C 2XCBA 3KD7A 4U8HA 3C3QA 3L17A 4C9BB 3CHMA 2AVPA 2I1KA 3SQVA 2MHKA 1Y6IA 5J90A 2VSXE 3D9OA 3U64A 3PVLA 2GRMA 4BX9A 3CVVA 1JCSA 4OAUC 2PNNA 2IQCA 4EZKA 3UT4A 4RSYA 4BTBA 5BT1A 1JCRA 1OXJA 4U96D 3LY9A 3DSWA 4N39A 2Y3AA 2HR2A 4HFGA 1KLXA 3LCAA 3UQ3A 2I2OA 3WXXA 2GROB 4O6FA 4WNFA 2VJ8A 2GRLA 4C0MA 1E8YA 1OCCE 4UWLA 1OWLA 5EILA 4FU3A 2PM6A 3ZN3A 4N2SA 3FH7A 2XEVA 5EIDA 1UW4B 3AG2E 4K0RA 3TXMA 4BWRA 1EYHA 4CCAA 5LCWC 5ENQD 3FUKA 4ILIA 4XX5A 2XQ0A 4O1OA 4KVMA 2EIJE 2EQXA 2DZOA 4B8CB 1D8DA 4GA2A 4ILGA 3PRZA 1RW2A 5FQ4A 5CCMA 4UUCA 2P9NG 4LSZE 5BPPA 3FU3A 4TXQA 5G55A 1TNZA 1UN8A 5HS0A 4MS6A 2Q7FA 4GTVA 1HH8A 1WM5A 3BU8A 3JUIA 2GRPB 3LEWA 4GB9A 3PREA 3ABKE 2V0PA 4FHKA 4JXTA 2HE0A 1TJFA 2R03A 1E7UA 1Z5SC 5EN5D 4KZCA 2JLBA 2FEZA 4GTRA 3DSXA 2EILE 5DIZA 2YNQA 2IONA 3FTXA 2IO3C 3AU4A 3MA5A 4KMOA 5AJLA 4RG9A 4HBDA 5EIBE 2CG3A 3T5VA 3CVPA 1LD8A 4P29A 3FTVA 4Q96A 1OUVA 1Z3YA 5CEAA 5CBNA 1UJKA 4PH4B 4ABNA 2VSNA 1QNFA 2L6JA 4WWOA 3SHFA 1HXIA 3NZSA 3PEVB 4AY6A 1QQEA 3KEAA 1SA4A 2A5EA 1TEZA 1TNYA 4JW1A 2WQ7A 3QB2A 4I2WA 1ZBPA 3FHEA 3RO3A 3CK7A 3ISMC 3NB2A 3EHRA 3O4ZA 3BG0B 3D9KA 4GCNA 2VTBB 4PS7A 3W9FA 4RG6A 1TN7A 4YNDA 5EYLA 3I4GA 4J6IA 3C72A 5H7PA 2FF4A 2KZTB 4Q69A 2ZU6B 3T9KA 4G8KA 4O1PA 4AIFA 3ML8A 1N52A 4DRXE 2GGFA 1MX2A 5KNHD 1IKND 3UI2A 1BLXB 4DPRA 3WG7E 2VSYA 5G05C 2ETBA 2L9BA 3CVNA 4I1MA 5CMWA 5J08A 3UUXA 4KT6B 3EHNA 4GTMA 4UWFA 1IHBA 4DLOA 1V54E 5CRVA 2X3MA 2IOSA 2H6HA 4HLEA 3FUEA 5A7DB 5T8IA 3UTMA 3QWWA 5CERB 2Y4UA
chains in the Genus database with same CATH topology
1NA3A 2KZTA 3QK0A 2LSUA 2LAHA 2AW6A 2RG8A 3ZIMA 5FQ7A 3FTYA 4ME2A 4E6HA 3FUJA 3S7JA 2HO1A 5T3RA 2E0IA 5FZRA 1H19A 3CLJA 2I9CA 5KJNA 3CHPA 2WMNA 2X6HA 3C98A 4U04A 4J8DA 5LP0A 1HO8A 3S7DA 3ASDA 4A1SA 1W3BA 4GYWA 3MYVA 4F7AA 5KJLA 4NACA 2DCPA 3IEGA 4PDXA 4XIFA 3CK9A 4CRWA 5C1DA 4YVOA 4F3VA 1NP7A 2LAIA 2XGOA 3S7FA 3GZ1A 3RKVA 3MCXA 3MV2B 5EX0A 3SNXA 3G2SA 4DI4A 4DJAA 4JPSA 3FUDA 5A23A 1OWOA 2X38A 4GYOA 5JHAA 4JVSA 3KAEA 1ELWA 4R7LA 3SD5A 2L0IA 3QC1A 3ONKA 4NURA 4FULA 3HYMB 1E8ZA 3FU0A 3HVEA 3GZSA 5BNWA 3LYAA 4WNEA 2AXVA 4B89A 4OVUA 4W9RA 4BT9A 4EZLA 5D0OD 3SI5A 5DBKA 4G1TA 3D9IA 4K03A 4FP7A 1HG2A 2A5UA 2VGXB 3APDA 3LXUX 3JQ0A 4N3CA 3LJ3A 3RK6A 4UQXA 3AU5A 3B7TA 1HF8A 3RRUA 1FVHA 2MOWA 3GW4A 3UMVA 3L54A 3FEXA 4UI9J 2KCLA 4I17A 3SZ7A 4JEHA 3VLDA 5G05J 4APFA 1LF8A 4B8AA 5G2NA 3VTYA 2V5FA 3Q5MA 4ACKA 3CVXA 5AIJA 2Y4TA 3N71A 3ZYKA 5BUZA 2GW1A 3D3MA 4FADA 4TUUA 3UX4A 2CG2A 5FZSA 3LVQE 3FU5A 1A17A 3AS5A 1DNPA 4XI0A 2AWIA 4WWPA 3ULQA 3ONLA 3MX3A 3MKQB 4EPZA 3AS8A 4L2LA 4XI9A 4WAFA 1JUQA 3EIQC 3ZFWA 4IN3B 5ENNA 4MRUA 2UWJG 3JCKC 1HG5A 4JHJA 2WB2A 1ELRA 4HXIA 4LCTA 2J4BA 3FEYA 3U4TA 1IQRA 2J08A 1HZ4A 3CKCA 3CR3A 3NQPA 4G23A 4LRZA 3E4BA 3K9IA 2OVBA 4EBAG 3CKBA 4GMLA 2KCVA 4UWGA 3CVWA 3HDXA 3CVLA 4DLQA 3LY7A 3L13A 5G04C 4GZCA 3PZDA 2X6KA 5JJ7A 3CK8A 1QZ2A 4AVXA 5CMYA 5AJDA 4GZDA 3VTXA 3G2TA 2IFUA 4EQFA 2KC7A 3IHYA 5CHEE 1PY1A 4QFVA 2HYZA 3CQGB 2WXMA 4I2ZA 4N5CA 3JYSA 1EF1C 4UI9K 4ANWA 5LFAA 3SBTB 1FCHA 3FTUA 3GZ2A 5EX3A 2QFCA 1HS6A 4MKTA 5AENA 2VGXA 4I9EA 3CVUA 2PQNA 3QOUA 4L7TA 4IRUA 4HVBA 2IU1A 5HI7A 3QKYA 4FLBA 5FQ6A 2XPYA 4BTAA 2QY7A 5E76A 5JJ6A 3L08A 4V3IA 2V8SE 3ZRHA 2CHZA 2ILRA 4Q94A 4D10C 3EJNA 3QJZA 3IHVA 3ASGA 3RU0A 4ANUA 1MQSA 4HOUA 3U3WA 3LS8A 2J49A 4B94A 4HOQA 3FFLA 1SQMA 3DPDA 3MJWA 3OTNA 3PDNA 4M3OA 4A55A 3KEZA 3CVYA 4I1OB 3LVRE 3MKQA 3LPZA 4GZ3A 3FTSA 3GYZA 3NF1A 1H6KA 4H7YA 2FO7A 2XPZA 4L1BA 2WM9A 5EDSA 1E90A 4JA9A 4I6GA 2XCBA 3FUHA 3KD7A 4JL0A 4J8FA 4YVQC 1SZAA 1E8XA 1JPLA 4UQYA 4U8HA 2FBNA 2M63A 3L17A 5KJKA 2WXFA 1NA0A 2FI7A 4C9BB 3CHMA 2FULA 1JWGA 5FTPA 2AVPA 2XHEA 3ASHA 2XGMA 3PNTB 4JHRA 2OVFA 4U63A 5D0QD 3SF4A 4GZ5A 2I1KA 3FUIA 4KXKB 5FWQA 3ZPJA 2MHKA 1Y6IA 2WXNA 2VYIA 3EIJA 5J90A 4N3AA 5M72A 3FTZA 2VSXE 1U3DA 3D9OA 3PUJA 3U64A 3PVLA 2GRMA 3QDNA 2XCCA 1H2UA 3RRNB 5FZQA 3ZW3A 4BX9A 4H7XA 3CVVA 1B89A 3URZA 3CVQA 3G2UA 2XRYA 3ESKA 3R9AB 3RIBA 1NZNA 2IQCA 4EZKA 1ZU2A 4GAAA 3SBSA 1PAQA 1H0AA 4PS8A 4RSYA 4J8EA 5BW8C 3UT4A 4BTBA 5BT1A 3LY9A 3EHMA 3I3NA 4GPKA 4N39A 2Y3AA 2HR2A 4HFGA 1KLXA 3ESLA 3JQ1A 5A6CA 3B13A 3LCAA 4G2VA 3B7RL 4ACLA 5FT9A 3L16A 2E2EA 3LKUA 3UQ3A 2I2OA 3WXXA 4UWHA 2WXKA 3DBSA 3PS6A 4O6FA 5KJMA 4WNFA 1X5BA 2CHWA 2WXRA 3UPVA 2VJ8A 1JWFA 1UJJA 1S0PA 2GRLA 1GW6A 4L23A 1PC2A 4C0MA 4CDMA 1HU3A 2A4ZA 4N2QA 4G26A 1E8YA 2BTDA 4UWLA 1OWLA 3MZLB 3MV3B 4FU3A 4GU5A 3S7BA 2PM6A 4LERA 3MGBA 3ZN3A 1XGWA 4N2SA 3FH7A 3Q49B 3Q4AB 3QARA 2XEVA 4L2YA 2DIWA 1U3CA 1UW4B 1DVPA 3UT7A 3ASFA 4K0RA 3TXMA 1OWNA 3MKRA 3Q47B 4BWRA 1EYHA 4CT0A 4G11A 4KYOB 2J09A 1H2VC 1L5JA 2YHEA 1HX8A 2YQ8A 5ARFA 4HOTA 4AJWA 3Q15A 2R17C 4CCAA 2I1JA 5LCWC 3FU6A 1OWPA 3TG5A 3FUKA 2WXLA 4NQ0A 3APFA 4ILIA 4XX5A 4F1SA 2XQ0A 3SGHA 1VDYA 1BPOA 2WXQA 3PEUB 3MEKA 4AOFA 1ELKA 5FJYA 2WPVA 4KVMA 2CFUA 3ZEFA 1Y8MA 3PNLB 3ZGQA 2EQXA 2WXOA 1EPUA 1E7VA 4A3TA 3P1UA 3PE3A 4GMJA 2WQ6A 3CHSA 3OXGA 4HOSA 3LDZA 4XE0A 4E85A 4OYSA 2NSZA 2R59A 4B8CB 3CQCB 1KT1A 4GA2A 5C2YA 4ILGA 2VQ2A 3L6AA 3D9JA 3CIAA 2WQHA 1TJCA 4PUCA 4A3VA 3QAQA 3PRZA 4AM9A 5FQ4A 5CCMA 3TG4A 3CHOA 2LSVA 5BPPA 2AXZA 3FU3A 3ZYMA 4UQZA 5G55A 2NC9A 1UN8A 3ZXSA 3U9WA 4MS6A 5EKQD 2Q7FA 3OXFA 4I9CA 3D9PA 3U66A 2CFZA 1HH8A 1WM5A 3TAXA 3UT8A 2HM8A 3JUIA 5CCLA 3FP3A 2P58C 2NXPA 2WXIA 4URKA 3LEWA 4GB9A 1KT0A 3PREA 2VGYA 3VLFA 3O48A 3FWVA 3IBEA 4PS3A 1INZA 2I6HA 2V0PA 4J8SA 5JJTA 2PL2A 4FHKA 4JXTA 1IQUA 2BUGA 2JEKA 2OOEA 3OXLA 1TJFA 2BF0X 2IOLA 1E7UA 3P2BA 4OVVA 1HE8A 4KZCA 4XKBA 2JLBA 4G24A 2UY1B 2FEZA 1E8WA 4HS2A 3EDTB 4G25A 4ANVA 3R7RA 3IV0A 3BEEA 3D9MA 3PE4A 1FVFA 4ILHB 5DIZA 3TGOA 2YNQA 2IONA 3CV0A 1XNFA 2RD0A 3FTXA 4Y6CA 3AU4A 3MA5A 3QWPA 4KMOA 2OV8A 2VSOE 3CEQA 4U0SA 5ARGA 5AJLA 4RG9A 3I5PA 2LO6A 4BSXA 4JZYA 3OAWA 4Y6WA 1WAO1 2CG3A 4B0ZA 3HIZA 4FLHA 3T5VA 3VLEA 4BY6A 2C2LA 5LCWJ 2WXPA 3CVPA 5T4YA 4WNDA 4P29A 3FTVA 5FQ8A 4Q96A 1OUVA 5G04J 3FH8A 3NZUA 4I6JA 1Z3YA 1HFAA 3SFZA 2L0TB 3RO2A 4I6EA 1UJKA 1Z3XA 4PH4B 3APCA 4ABNA 3LY8A 4ANXA 4FA6A 2VSNA 1QNFA 5E75A 2L6JA 3FUFA 4WWOA 2PZIA 3SHFA 1HXIA 3FUMA 3NZSA 3PEVB 4AY6A 1QQEA 2DBAA 5KCMA 3G2WA 1H2TC 4FHJA 4GA0A 4JC8A 3RJVA 2V4LA 4IYPA 5HQ8A 4CGWA 3BG1B 4TV3A 3T8MA 3FTWA 3B7SA 4RVBA 4BFRA 3T5XA 1TEZA 4CEMA 1MHQA 4JW1A 4U07A 3ZYQA 4APOA 4I1AA 2X6FA 2IF4A 2WQ7A 3QB2A 4I2WA 3TL5A 4AXHA 1ZBPA 3FHEA 3S2AA 3RO3A 5ANRA 3CK7A 3ZHEB 2UY1A 3TXNA 3O4ZA 4WUYA 4FC8A 3BG0B 4CT4A 3D9KA 3PUKA 2R5SA 4GCNA 4DI3A 2VTBB 3FY4A 4PS7A 3CGHA 3KS2A 2KM4A 4RG6A 4CGVA 4XZ4A 5JHBA 4YNDA 2XRZA 4EBAA 1N54A 3I4GA 4J6IA 3FH5A 2J07A 4AEZC 4JA7A 2WXJA 2AXUA 2WVIA 1UN9A 3ENEA 3I4RB 3HHMA 4J0UA 2FF4A 2KZTB 4WNGA 4Q69A 4UWKA 3CSTA 2ZU6B 4KVOA 1Z6TA 2CHXA 1IYGA 1YA0A 3RRMB 3QNKA 2XPIA 3ML8A 3AS4A 1N52A 4AIFA 4CDNA 3IKOB 4WWNA 4F53A 2MRIA 2KCKA 3D9NA 2GGFA 1EDUA 4EZJA 1OWMA 3FDHA 4I43A 4NRHB 2WMOA 3D9LA 2LNIA 1P5QA 4DPRA 1IHGA 4UI9C 2VSYA 1SZ9A 3CHQA 4BX8A 4LEUA 3FUNA 4FJYA 5G05C 2J4DA 2IJGX 2X6IA 3L22A 4TRQA 4ATGA 2L9BA 3R7QA 3ZVVA 4FJZA 3CVNA 4XKCA 4I1MA 4AY5A 4N3BA 5CMWA 2YINA 4IULA 3ZYLA 3G2VA 5J08A 3UUXA 2PM7A 2KATA 4JEUA 5LOZA 3B7UX 3HVEB 4JHKA 4DK5A 4GA1A 4KT6B 2C0LA 3ML9A 2PQRA 3QWVA 3ZHEA 4CDRA 4U0UA 3EHNA 4AP2A 5ANLA 5BV1A 4KZ0A 3CHRA 4UWFA 2X6JA 2WXGA 4HORA 4GYYA 1WY6A 4GCOA 4C0EA 4DLOA 4EECA 4A1GA 1UG3A 2XGSA 5BV0A 2VTBA 4KBQA 2ONDA 4GZ6A 3TJPA 2X3MA 1E96B 4MLPA 2IOSA 4HLEA 5LX8A 3FUEA 2C0MA 4LUNU 3FULA 5A7DB 4AV7A 5T8IA 2YHCA 4BT8A 2WXHA 4U0ZA 5AYWD 3QWWA 2J9QA 2Y4UA 3PH0C 3CSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NA3 A;  2LSU A;  4ME2 A;  3S7J A;  2HO1 A;  5FZR A;  5KJN A;  4U04 A;  4J8D A;  3S7D A;  3ASD A;  4A1S A;  1W3B A;  4GYW A;  5KJL A;  4XIF A;  3IEG A;  3CK9 A;  5C1D A;  4YVO A;  4F3V A;  2XGO A;  3S7F A;  3GZ1 A;  3RKV A;  3MV2 B;  5EX0 A;  4GYO A;  3KAE A;  1ELW A;  3HYM B;  5BNW A;  3LYA A;  4WNE A;  4W9R A;  4BT9 A;  5D0O D;  5DBK A;  4G1T A;  2VGX B;  4N3C A;  4UQX A;  3GW4 A;  4UI9 J;  2KCL A;  4I17 A;  3SZ7 A;  5G05 J;  3VTY A;  2V5F A;  3Q5M A;  2Y4T A;  3N71 A;  2GW1 A;  5FZS A;  1A17 A;  3AS5 A;  4XI0 A;  3ULQ A;  3AS8 A;  4XI9 A;  3ZFW A;  4IN3 B;  2UWJ G;  1ELR A;  3U4T A;  1HZ4 A;  3CKC A;  4G23 A;  3E4B A;  3K9I A;  3CKB A;  2KCV A;  3CVL A;  3LY7 A;  5G04 C;  5JJ7 A;  3CK8 A;  1QZ2 A;  4EQF A;  3VTX A;  2IFU A;  2KC7 A;  5CHE E;  2HYZ A;  4I2Z A;  4N5C A;  3JYS A;  4UI9 K;  1FCH A;  3GZ2 A;  5EX3 A;  2QFC A;  4I9E A;  2VGX A;  3QOU A;  2PQN A;  5HI7 A;  3QKY A;  4BTA A;  5JJ6 A;  3ASG A;  3RU0 A;  4HOU A;  3U3W A;  4B94 A;  4HOQ A;  3FFL A;  3PDN A;  3LPZ A;  4GZ3 A;  3GYZ A;  3NF1 A;  4H7Y A;  2FO7 A;  4JA9 A;  2XCB A;  3KD7 A;  4JL0 A;  4J8F A;  4YVQ C;  4UQY A;  2FBN A;  5KJK A;  1NA0 A;  2FI7 A;  5FTP A;  2AVP A;  3ASH A;  2XGM A;  4JHR A;  5D0Q D;  3SF4 A;  4GZ5 A;  4KXK B;  3ZPJ A;  2MHK A;  2VYI A;  4N3A A;  5M72 A;  3QDN A;  2XCC A;  5FZQ A;  4H7X A;  1B89 A;  3URZ A;  3CVQ A;  3ESK A;  3R9A B;  3RIB A;  1NZN A;  1ZU2 A;  5BW8 C;  4BTB A;  4J8E A;  5BT1 A;  3LY9 A;  4GPK A;  4N39 A;  2HR2 A;  1KLX A;  5A6C A;  3LCA A;  4G2V A;  5FT9 A;  2E2E A;  3LKU A;  3UQ3 A;  3WXX A;  4O6F A;  5KJM A;  4WNF A;  3UPV A;  1PC2 A;  4N2Q A;  4G26 A;  3MV3 B;  3S7B A;  3ZN3 A;  4N2S A;  3Q49 B;  3Q4A B;  2XEV A;  3ASF A;  3MKR A;  3Q47 B;  4BWR A;  4KYO B;  5ARF A;  2YQ8 A;  4HOT A;  5LCW C;  3Q15 A;  3TG5 A;  4NQ0 A;  3MEK A;  5FJY A;  2WPV A;  1Y8M A;  3ZGQ A;  3PE3 A;  3OXG A;  4HOS A;  1KT1 A;  4GA2 A;  2VQ2 A;  2WQH A;  1TJC A;  4AM9 A;  5CCM A;  3TG4 A;  2LSV A;  4UQZ A;  2NC9 A;  5EKQ D;  2Q7F A;  3OXF A;  4I9C A;  1HH8 A;  1WM5 A;  3TAX A;  5CCL A;  3FP3 A;  2P58 C;  1KT0 A;  2VGY A;  3O48 A;  3FWV A;  2I6H A;  5JJT A;  2PL2 A;  2BUG A;  3OXL A;  2OOE A;  2JLB A;  4G24 A;  2UY1 B;  2FEZ A;  3EDT B;  4G25 A;  3BEE A;  3PE4 A;  3TGO A;  5DIZ A;  3CV0 A;  1XNF A;  4Y6C A;  3MA5 A;  3QWP A;  4U0S A;  3CEQ A;  5ARG A;  4RG9 A;  1WAO 1;  2C2L A;  5LCW J;  3CVP A;  4WND A;  1OUV A;  5G04 J;  3RO2 A;  4ABN A;  3LY8 A;  2VSN A;  2L6J A;  2PZI A;  1HXI A;  4AY6 A;  1QQE A;  2DBA A;  3RJV A;  4GA0 A;  5HQ8 A;  4CGW A;  4U07 A;  4APO A;  4I1A A;  2IF4 A;  4I2W A;  1ZBP A;  3RO3 A;  3CK7 A;  3ZHE B;  2UY1 A;  4WUY A;  2R5S A;  4GCN A;  3KS2 A;  4RG6 A;  4CGV A;  4YND A;  4JA7 A;  4Y6W A;  4J0U A;  4WNG A;  2FF4 A;  1IYG A;  1YA0 A;  4AIF A;  2XPI A;  3AS4 A;  2KCK A;  4NRH B;  2LNI A;  1P5Q A;  1IHG A;  4UI9 C;  2VSY A;  4LEU A;  5G05 C;  3CVN A;  4AY5 A;  4N3B A;  3UUX A;  2KAT A;  4GA1 A;  2C0L A;  3QWV A;  2PQR A;  3ZHE A;  4CDR A;  4U0U A;  4HOR A;  4GYY A;  4GCO A;  2XGS A;  4KBQ A;  2OND A;  4GZ6 A;  1E96 B;  5A7D B;  2C0M A;  2YHC A;  4BT8 A;  4U0Z A;  5AYW D;  3QWW A;  2J9Q A;  2Y4U A; 
#chains in the Genus database with same CATH topology
 3ZIM A;  5FQ7 A;  3FTY A;  4ME2 A;  4E6H A;  4GTT A;  3FUJ A;  3PZ1 A;  5T3R A;  1OT8 A;  5KJN A;  1N4R A;  2OEV A;  4U04 A;  5LP0 A;  3ASD A;  4YVO A;  2P2C P;  3G2S A;  4DJA A;  4JPS A;  5A23 A;  1OWO A;  2LXL A;  5JHA A;  4JVS A;  4R7L A;  1ELW A;  3ZU7 B;  2XEH A;  3ONK A;  5B3S E;  4WNE A;  2AXV A;  2P9S G;  3HXD A;  4W9R A;  4LG6 A;  1K3Z D;  3ZUV B;  2A5U A;  3APD A;  3LXU X;  3LJ3 A;  3B7T A;  3RRU A;  5AQ9 A;  3SZ7 A;  4JEH A;  2Y1L E;  3CVX A;  5AIJ A;  4TUU A;  2CG2 A;  2DYS E;  3FU5 A;  1DNP A;  2AWI A;  4WWP A;  3ULQ A;  4L2L A;  4GTP A;  3JCK C;  2WB2 A;  2J4B A;  3U4T A;  1IQR A;  1HZ4 A;  3CR3 A;  3E4B A;  2B6C A;  3CKB A;  5G04 C;  2ZIR A;  3CK8 A;  1QZ2 A;  4AVX A;  3VTX A;  2IFU A;  3IHY A;  4QFV A;  1EF1 C;  3AAA C;  5LFA A;  3SBT B;  2QFC A;  1HS6 A;  4MKT A;  5AEN A;  4IRU A;  4HVB A;  5JJ6 A;  1N0R A;  2V8S E;  4MBG A;  4D10 C;  3EJN A;  3QJZ A;  3IHV A;  3ASG A;  4O60 A;  3RU0 A;  2QYU A;  3LS8 A;  4B94 A;  4M3O A;  3AG4 E;  3KEZ A;  3LVR E;  3GYZ A;  3DXM G;  2FO7 A;  1E90 A;  1E8X A;  4UQY A;  2ZXW E;  2WXF A;  2FI7 A;  2FUL A;  5FTP A;  4A63 B;  3PNT B;  4JHR A;  5D0Q D;  2OVF A;  3FUI A;  3SFX A;  4HLL A;  2WXN A;  2VYI A;  3DRA A;  1U3D A;  2Y69 E;  5ENS D;  2XCC A;  5IY5 E;  1BI7 B;  1B89 A;  3URZ A;  3G2U A;  2BED A;  4CZ2 D;  3SBS A;  5BW8 C;  3PZ3 A;  1DC2 A;  3EHM A;  4GPK A;  5A6C A;  3B7R L;  5JA4 D;  5FT9 A;  5BXO A;  2WXK A;  3DBS A;  2CHW A;  2WXR A;  1S0P A;  4L23 A;  1HU3 A;  2A4Z A;  4JD2 G;  2BTD A;  2NYJ A;  2R2L A;  4M7C A;  3TWW A;  4GTQ A;  4F1P A;  4LER A;  3MGB A;  1XGW A;  3Q49 B;  3QAR A;  1LD7 A;  1MYO A;  2DIW A;  1DVP A;  3C3O A;  4G11 A;  5ARF A;  4HOT A;  1HX8 A;  3Q15 A;  3FU6 A;  2F0Y A;  3SGH A;  2AJA A;  2WXQ A;  1ELK A;  1AWC B;  5ENR D;  2CFU A;  1Y8M A;  3E33 A;  4A3T A;  4YDW A;  4HOS A;  3CQC B;  1OCZ E;  3L6A A;  3C3R A;  1TJC A;  3DSU A;  1S64 A;  4PUC A;  4A3V A;  1SVX A;  4AM9 A;  1TN8 A;  2LSV A;  2AXZ A;  3LJN A;  3DSS A;  1TYQ G;  3OXF A;  3D9P A;  3U66 A;  2CFZ A;  1N0Q A;  3TAX A;  5CCL A;  2WXI A;  3O48 A;  1N9A A;  4PS3 A;  5JJT A;  1FT1 A;  4HRM B;  1N94 A;  1E8W A;  4G25 A;  3R7R A;  3IV0 A;  3BEE A;  1YMP A;  4ILH B;  3CV0 A;  2RD0 A;  1MX6 A;  3PZ4 A;  4U0S A;  2ZIS A;  4B0Z A;  3HIZ A;  3VLE A;  4BY6 A;  5LCW J;  5T4Y A;  4WND A;  2H6F A;  3FH8 A;  4I6J A;  1HFA A;  4I6E A;  4EHM A;  1K1B A;  4ANX A;  2PZI A;  3TWS A;  5KCM A;  3ABL E;  4B93 B;  4JC8 A;  3RJV A;  2OEW A;  5HQ8 A;  4CGW A;  4TV3 A;  4RVB A;  4BFR A;  1MHQ A;  3ZYQ A;  2EIN E;  2IF4 A;  4AXH A;  3S2A A;  5ANR A;  1QYM A;  2UY1 A;  4WUY A;  3FY4 A;  1ZB1 A;  3CGH A;  3KS2 A;  4GMR A;  4EBA A;  4L9P A;  2AXU A;  2WXJ A;  1UN9 A;  3HHM A;  4J0U A;  3I4R B;  2OCC E;  3DXK G;  4KVO A;  2CHX A;  5FIO A;  1UOH A;  3EU5 A;  1YA0 A;  3RRM B;  3QNK A;  2XPI A;  4CDN A;  3AS4 A;  3ZKJ A;  4I43 A;  3FDH A;  4NRH B;  2WMO A;  1KZP A;  2LNI A;  4U8Y D;  3CHQ A;  4BX8 A;  4LEU A;  3FUN A;  2J4D A;  4ATG A;  3L22 A;  4HI9 A;  3DWL G;  4FJZ A;  1TN6 A;  4XKC A;  2H6G A;  2YIN A;  3ZYL A;  4ATZ D;  2PM7 A;  2KAT A;  3B7U X;  4JHK A;  4GA1 A;  2C0L A;  3ZHE A;  4AP2 A;  5BV1 A;  3CHR A;  2DWZ A;  4C48 B;  4GCO A;  3Q78 A;  4EEC A;  1UG3 A;  5BV0 A;  1NL4 A;  4GZ6 A;  2Y0B G;  1E96 B;  2C0M A;  3FUL A;  3Q79 A;  4U0Z A;  3CSF A;  1NA3 A;  2LSU A;  2LAH A;  3S7J A;  2E0I A;  2X6H A;  1W3B A;  4GYW A;  4F7A A;  5KJL A;  4NAC A;  3IEG A;  5C1D A;  4F3V A;  1QBQ A;  2XGO A;  3IXE A;  3MV2 B;  4DI4 A;  2X38 A;  2L0I A;  3QC1 A;  4NUR A;  3HYM B;  1E8Z A;  3HVE A;  1BD8 A;  1RZ4 A;  5DBK A;  3AG1 E;  1IXV A;  4BEP A;  3TWV A;  2ZGD A;  3JQ0 A;  2GRQ B;  4UQX A;  3AU5 A;  1YYH A;  3ASO E;  1FVH A;  3GW4 A;  3FEX A;  2IY0 C;  5G05 J;  1LF8 A;  4B8A A;  5BUZ A;  3ZYK A;  2GW1 A;  4FAD A;  3UX4 A;  3AS5 A;  3UM0 A;  3ONL A;  3MX3 A;  3MKQ B;  4EPZ A;  4BSZ B;  4XI9 A;  4WAF A;  4MRU A;  1HG5 A;  4JHJ A;  1D8E A;  4LCT A;  3J5P A;  3NQP A;  4EBA G;  4GML A;  1S70 B;  3CVW A;  5CEC B;  3HDX A;  3CVL A;  4DLQ A;  3ASN E;  3PZD A;  5AJD A;  4GZD A;  2KC7 A;  1PY1 A;  2XS8 A;  4I2Z A;  3NAW A;  3JYS A;  5HRY A;  3R9M A;  2VGX A;  1D9S A;  2IU1 A;  4K5B A;  5ITZ F;  2JAB A;  1JCQ A;  3L08 A;  1DCE A;  4V3I A;  2ILR A;  4ANU A;  3KSQ A;  3U3W A;  3EU9 A;  4HOQ A;  3OTN A;  3MJW A;  3D9H A;  3B7B A;  3PDN A;  4I1O B;  4HRN A;  2L6B A;  4TXP A;  4U95 D;  4H7Y A;  4L1B A;  5EDS A;  4I6G A;  3FUH A;  4JL0 A;  4J8F A;  4YVQ C;  1JPL A;  5D2M C;  2FBN A;  5BXU A;  5KJK A;  1NA0 A;  2XHE A;  3AJI A;  3ASH A;  5CED B;  2XGM A;  4U63 A;  4GZ5 A;  4KXK B;  2VGE A;  1DCQ A;  3TWQ A;  4N3A A;  5M72 A;  3FTZ A;  3PUJ A;  4DX7 D;  3CVQ A;  2XRY A;  3ESK A;  3R9A B;  1PAQ A;  1H0A A;  4PS8 A;  3W9G A;  3B13 A;  4G2V A;  3E32 A;  4ACL A;  3L16 A;  3LKU A;  5KJM A;  3PZ2 A;  1JWF A;  1UJJ A;  1PC2 A;  4CDM A;  4N2Q A;  4G26 A;  2GRR B;  3MZL B;  1A5E A;  1AP7 A;  3Q4A B;  3NOG D;  3UT7 A;  3MKR A;  3Q47 B;  4KYO B;  2J09 A;  1H2V C;  1X81 A;  3V2O A;  4AJW A;  3Q9N C;  1H6P A;  2WXL A;  2FO1 E;  4G8L A;  4F1S A;  1VDY A;  1BPO A;  5AQA A;  2ZGG A;  5FJY A;  2WPV A;  2XEE A;  3ZGQ A;  1EPU A;  3OXG A;  3SO8 A;  4F6R D;  2P9L G;  4QQI A;  4U7E B;  1N95 A;  4XEI G;  3D9J A;  4HQD A;  2IEJ A;  5HKP A;  4LNB A;  3TG4 A;  3CHO A;  3ZYM A;  4UQZ A;  3ZXS A;  5EKQ D;  3TWT A;  2EIM E;  3ABM E;  2P9P G;  3UT8 A;  2HM8 A;  3FP3 A;  2P58 C;  2NXP A;  1KT0 A;  5AN8 A;  2VGY A;  3VLF A;  1INZ A;  2PL2 A;  2JEK A;  3OXL A;  3UXG A;  2OOE A;  2BF0 X;  2IOL A;  4RQI A;  4HS2 A;  4ANV A;  1N4S A;  3D9M A;  3PE4 A;  3TGO A;  1XNF A;  1FPP A;  5KWD A;  2OV8 A;  2VSO E;  4BSX A;  3OAW A;  1WAO 1;  4CYM D;  2C2L A;  1BI8 B;  3J5Q B;  3T8K A;  2XEN A;  5JMN D;  5FQ8 A;  3TWU A;  3NZU A;  4DX1 A;  2L0T B;  3Q75 A;  3APC A;  4FA6 A;  4BER A;  5E75 A;  2DYR E;  2F37 A;  3G2W A;  1H2T C;  2LUH A;  2RKK A;  4FHJ A;  4GA0 A;  2V4L A;  4IYP A;  3T8M A;  3T5X A;  4CEM A;  4APO A;  2X6F A;  3TL5 A;  3TXN A;  4FC8 A;  4CT4 A;  3BQO A;  3PUK A;  2R5S A;  4DI3 A;  4HB5 A;  2KM4 A;  2XRZ A;  2J07 A;  4Y6W A;  2WVI A;  3ENE A;  4UWK A;  1TNU A;  2MYO A;  3IKO B;  4WWN A;  4JB8 P;  3D9N A;  3EHQ A;  4EZJ A;  1OWM A;  4U8V D;  5CRU A;  3D9L A;  1S63 A;  1P5Q A;  4ZHB A;  1IHG A;  4UI9 C;  1SZ9 A;  1NFI E;  4TRQ A;  2IJG X;  2X6I A;  3ZVV A;  3NOC D;  4AY5 A;  4N3B A;  1N11 A;  4IUL A;  3G2V A;  5LOZ A;  2PQR A;  3RSE G;  5ANL A;  3AG3 E;  4KZ0 A;  3HXB A;  2X6J A;  2WXG A;  5AQB A;  4GYY A;  1WY6 A;  4C0E A;  4A1G A;  2XGS A;  2RFA A;  3UM1 A;  2VTB A;  4KBQ A;  2OND A;  3V30 A;  3TJP A;  4MLP A;  3BUA A;  4LUN U;  1LTX A;  4FJY A;  3TWR A;  1K8K G;  1OCO E;  2KZT A;  2AW6 A;  2RG8 A;  4HI8 A;  1H19 A;  3EUV A;  2P9I G;  2WMN A;  3C98 A;  4J8D A;  5FIN A;  1MX4 A;  1TNB A;  1HO8 A;  3S7D A;  1O5M A;  4A1S A;  3UM3 A;  2DCP A;  4XIF A;  3CK9 A;  4BET A;  3HXC A;  3S7F A;  3MCX A;  3SNX A;  5EX0 A;  1KZO A;  3FUD A;  4GYO A;  3UKR G;  3SD5 A;  4FUL A;  3FU0 A;  1WDY A;  3L9T A;  4OVU A;  3DSV A;  5D0O D;  3SI5 A;  4G1T A;  3D9I A;  4K03 A;  4FP7 A;  3F6Q A;  4N3C A;  3V31 A;  3RK6 A;  1OCR E;  3UMV A;  4I17 A;  3VLD A;  4GTS A;  5G2N A;  3N71 A;  3E34 A;  1A17 A;  4XI0 A;  4GTO A;  2F8Y A;  3AS8 A;  2KXP C;  3ZFW A;  4IN3 B;  5ENN A;  4HXI A;  3FEY A;  2DVW A;  3CKC A;  3HXF A;  4G23 A;  1TNO A;  3ZXP A;  1O1S A;  2KCV A;  4UWG A;  5CBO A;  5KBA A;  3LY7 A;  3L13 A;  4GZC A;  5CMY A;  3G2T A;  3KSL A;  1G3N B;  5CHE E;  2BKK B;  4N5C A;  1FCH A;  3GZ2 A;  4I9E A;  3CVU A;  2PQN A;  3QKY A;  2XPY A;  2QY7 A;  5E76 A;  3ZRH A;  2R02 A;  3ZNG A;  4Q94 A;  2EIK E;  1MQS A;  1TR4 A;  2J49 A;  3FFL A;  3DPD A;  3CVY A;  3Q7A A;  2BKG A;  4GZ3 A;  3FTS A;  3UM2 A;  3NF1 A;  4JA9 A;  1SZA A;  2M63 A;  2QYJ A;  1JWG A;  3SF4 A;  5FWQ A;  3ZPJ A;  1YCS B;  3EIJ A;  1BU9 A;  5AQ7 A;  5ENO D;  3QDN A;  1H2U A;  3RRN B;  5FZQ A;  3ZW3 A;  4H7X A;  4LNU D;  3RIB A;  1NZN A;  1ZU2 A;  4GAA A;  4J8E A;  3I3N A;  4Z68 A;  4X8Q A;  3ESL A;  3JQ1 A;  3V79 K;  1N4P A;  2E2E A;  4UWH A;  3ULE G;  3PS6 A;  1X5B A;  3UPV A;  2F8X K;  3SY2 A;  1GW6 A;  4YDY A;  2QZA A;  3MV3 B;  3TWX A;  4GU5 A;  3S7B A;  2GRN B;  5EYP F;  4L2Y A;  1U3C A;  3ASF A;  3JXI A;  1OWN A;  4CT0 A;  4LNG A;  1L5J A;  2YQ8 A;  2YHE A;  2R17 C;  2I1J A;  5D66 A;  3Q73 A;  1OWP A;  3TG5 A;  2RFM A;  4NQ0 A;  3UIO C;  3APF A;  2P9U G;  3PEU B;  3MEK A;  4AOF A;  4NIK A;  1FT2 A;  3ZEF A;  4YDE A;  3PNL B;  3DEO A;  2WXO A;  1E7V A;  3HRA A;  3P1U A;  3PE3 A;  4GMJ A;  2WQ6 A;  3CHS A;  3LDZ A;  4XE0 A;  4E85 A;  4OYS A;  2NSZ A;  3DPY A;  2R59 A;  1KT1 A;  5C2Y A;  3Q7F A;  2VQ2 A;  3SFY A;  3CIA A;  2WQH A;  3UKU G;  3QAQ A;  1Q2Z A;  4HRL A;  1NI1 A;  3ULY A;  2NC9 A;  3U9W A;  4RLY A;  4I9C A;  1SA5 A;  4URK A;  3FWV A;  3IBE A;  2I6H A;  4J8S A;  1IQU A;  2BUG A;  3P2B A;  4OVV A;  1HE8 A;  4XKB A;  3L82 A;  4G24 A;  2UY1 B;  3UIN C;  3EDT B;  5AAO A;  4TUM A;  1FVF A;  1KPS B;  4Y6C A;  3QWP A;  3CEQ A;  5ARG A;  3I5P A;  2LO6 A;  4JZY A;  4K5C A;  4FLH A;  1MZC A;  1V55 E;  2WXP A;  5G04 J;  4BES A;  3SFZ A;  3RO2 A;  1Z3X A;  5ENT D;  3LY8 A;  3V2X A;  3FUF A;  3FUM A;  4OAV B;  2DBA A;  1O1T A;  3BG1 B;  3FTW A;  3B7S A;  4U07 A;  3UIP C;  4I1A A;  4TXR A;  5B1B E;  3ZHE B;  4YDO A;  3HG0 D;  2J8S D;  4CGV A;  4XZ4 A;  5JHB A;  1N54 A;  3FH5 A;  4AEZ C;  4JA7 A;  4WNG A;  2B0O E;  3CST A;  4J8Y A;  1Z6T A;  3X2Q E;  1IYG A;  4F53 A;  4DX6 D;  2MRI A;  2ETA A;  4J7W A;  2KCK A;  2R05 A;  1EDU A;  3JUE A;  2LXM A;  4K5A B;  3B95 A;  3R7Q A;  2QC9 A;  2P9K G;  1MJ0 A;  5AAR A;  4JEU A;  3HVE B;  4DK5 A;  4DX2 A;  3ML9 A;  3QWV A;  1WG0 A;  4CDR A;  4U0U A;  1K1A A;  4HOR A;  1OY3 D;  5LX8 A;  4AV7 A;  2H6I A;  2YHC A;  4BT8 A;  2WXH A;  5AYW D;  2J9Q A;  3PH0 C;  2V5Q C;  3QK0 A;  2ETC A;  2HO1 A;  5FZR A;  3CLJ A;  2I9C A;  2XS1 A;  3CHP A;  3MYV A;  4CRW A;  4PDX A;  1NP7 A;  2LAI A;  1SW6 A;  3GZ1 A;  3RKV A;  3NBN B;  3KAE A;  2KBX A;  3GZS A;  5BNW A;  3LYA A;  1N4Q A;  4B89 A;  5B1A E;  3DST A;  4BT9 A;  4EZL A;  3HXE A;  1HG2 A;  2VGX B;  3DEP A;  1U2V G;  1HF8 A;  2MOW A;  3L54 A;  4UI9 J;  2KCL A;  4APF A;  3VTY A;  2V5F A;  5ENP D;  3Q5M A;  4ACK A;  2Y4T A;  3D3M A;  4HNA D;  5FZS A;  3LVQ E;  3C5R A;  4GPM A;  1JUQ A;  3EIQ C;  2UWJ G;  1ELR A;  2J08 A;  4LRZ A;  3K9I A;  3RAU A;  2OVB A;  5KNG A;  1O1R A;  4DX5 D;  2X6K A;  2XZD G;  4EQF A;  5JJ7 A;  2V4H C;  3JXJ A;  4N5Q A;  2HYZ A;  3CQG B;  2WXM A;  2XZT G;  4UI9 K;  4ANW A;  3FTU A;  5EX3 A;  3E37 A;  3QOU A;  3Q9U C;  4L7T A;  5HI7 A;  2DZN A;  4FLB A;  5FQ6 A;  4BTA A;  2CHZ A;  4HOU A;  1H6O A;  4ZFH A;  1SQM A;  4A55 A;  3E30 A;  3MKQ A;  3LPZ A;  4DUI A;  1H6K A;  2XPZ A;  2WM9 A;  2IO2 C;  2XCB A;  3KD7 A;  4U8H A;  3C3Q A;  3L17 A;  4C9B B;  3CHM A;  2AVP A;  2I1K A;  3SQV A;  2MHK A;  1Y6I A;  5J90 A;  2VSX E;  3D9O A;  3U64 A;  3PVL A;  2GRM A;  4BX9 A;  3CVV A;  1JCS A;  4OAU C;  2PNN A;  2IQC A;  4EZK A;  3UT4 A;  4RSY A;  4BTB A;  5BT1 A;  1JCR A;  1OXJ A;  4U96 D;  3LY9 A;  3DSW A;  4N39 A;  2Y3A A;  2HR2 A;  4HFG A;  1KLX A;  3LCA A;  3UQ3 A;  2I2O A;  3WXX A;  2GRO B;  4O6F A;  4WNF A;  2VJ8 A;  2GRL A;  4C0M A;  1E8Y A;  1OCC E;  4UWL A;  1OWL A;  5EIL A;  4FU3 A;  2PM6 A;  3ZN3 A;  4N2S A;  3FH7 A;  2XEV A;  5EID A;  1UW4 B;  3AG2 E;  4K0R A;  3TXM A;  4BWR A;  1EYH A;  4CCA A;  5LCW C;  5ENQ D;  3FUK A;  4ILI A;  4XX5 A;  2XQ0 A;  4O1O A;  4KVM A;  2EIJ E;  2EQX A;  2DZO A;  4B8C B;  1D8D A;  4GA2 A;  4ILG A;  3PRZ A;  1RW2 A;  5FQ4 A;  5CCM A;  4UUC A;  2P9N G;  4LSZ E;  5BPP A;  3FU3 A;  4TXQ A;  5G55 A;  1TNZ A;  1UN8 A;  5HS0 A;  4MS6 A;  2Q7F A;  4GTV A;  1HH8 A;  1WM5 A;  3BU8 A;  3JUI A;  2GRP B;  3LEW A;  4GB9 A;  3PRE A;  3ABK E;  2V0P A;  4FHK A;  4JXT A;  2HE0 A;  1TJF A;  2R03 A;  1E7U A;  1Z5S C;  5EN5 D;  4KZC A;  2JLB A;  2FEZ A;  4GTR A;  3DSX A;  2EIL E;  5DIZ A;  2YNQ A;  2ION A;  3FTX A;  2IO3 C;  3AU4 A;  3MA5 A;  4KMO A;  5AJL A;  4RG9 A;  4HBD A;  5EIB E;  2CG3 A;  3T5V A;  3CVP A;  1LD8 A;  4P29 A;  3FTV A;  4Q96 A;  1OUV A;  1Z3Y A;  5CEA A;  5CBN A;  1UJK A;  4PH4 B;  4ABN A;  2VSN A;  1QNF A;  2L6J A;  4WWO A;  3SHF A;  1HXI A;  3NZS A;  3PEV B;  4AY6 A;  1QQE A;  3KEA A;  1SA4 A;  2A5E A;  1TEZ A;  1TNY A;  4JW1 A;  2WQ7 A;  3QB2 A;  4I2W A;  1ZBP A;  3FHE A;  3RO3 A;  3CK7 A;  3ISM C;  3NB2 A;  3EHR A;  3O4Z A;  3BG0 B;  3D9K A;  4GCN A;  2VTB B;  4PS7 A;  3W9F A;  4RG6 A;  1TN7 A;  4YND A;  5EYL A;  3I4G A;  4J6I A;  3C72 A;  5H7P A;  2FF4 A;  2KZT B;  4Q69 A;  2ZU6 B;  3T9K A;  4G8K A;  4O1P A;  4AIF A;  3ML8 A;  1N52 A;  4DRX E;  2GGF A;  1MX2 A;  5KNH D;  1IKN D;  3UI2 A;  1BLX B;  4DPR A;  3WG7 E;  2VSY A;  5G05 C;  2ETB A;  2L9B A;  3CVN A;  4I1M A;  5CMW A;  5J08 A;  3UUX A;  4KT6 B;  3EHN A;  4GTM A;  4UWF A;  1IHB A;  4DLO A;  1V54 E;  5CRV A;  2X3M A;  2IOS A;  2H6H A;  4HLE A;  3FUE A;  5A7D B;  5T8I A;  3UTM A;  3QWW A;  5CER B;  2Y4U A; 
#chains in the Genus database with same CATH homology
 1NA3 A;  2KZT A;  3QK0 A;  2LSU A;  2LAH A;  2AW6 A;  2RG8 A;  3ZIM A;  5FQ7 A;  3FTY A;  4ME2 A;  4E6H A;  3FUJ A;  3S7J A;  2HO1 A;  5T3R A;  2E0I A;  5FZR A;  1H19 A;  3CLJ A;  2I9C A;  5KJN A;  3CHP A;  2WMN A;  2X6H A;  3C98 A;  4U04 A;  4J8D A;  5LP0 A;  1HO8 A;  3S7D A;  3ASD A;  4A1S A;  1W3B A;  4GYW A;  3MYV A;  4F7A A;  5KJL A;  4NAC A;  2DCP A;  3IEG A;  4PDX A;  4XIF A;  3CK9 A;  4CRW A;  5C1D A;  4YVO A;  4F3V A;  1NP7 A;  2LAI A;  2XGO A;  3S7F A;  3GZ1 A;  3RKV A;  3MCX A;  3MV2 B;  5EX0 A;  3SNX A;  3G2S A;  4DI4 A;  4DJA A;  4JPS A;  3FUD A;  5A23 A;  1OWO A;  2X38 A;  4GYO A;  5JHA A;  4JVS A;  3KAE A;  1ELW A;  4R7L A;  3SD5 A;  2L0I A;  3QC1 A;  3ONK A;  4NUR A;  4FUL A;  3HYM B;  1E8Z A;  3FU0 A;  3HVE A;  3GZS A;  5BNW A;  3LYA A;  4WNE A;  2AXV A;  4B89 A;  4OVU A;  4W9R A;  4BT9 A;  4EZL A;  5D0O D;  3SI5 A;  5DBK A;  4G1T A;  3D9I A;  4K03 A;  4FP7 A;  1HG2 A;  2A5U A;  2VGX B;  3APD A;  3LXU X;  3JQ0 A;  4N3C A;  3LJ3 A;  3RK6 A;  4UQX A;  3AU5 A;  3B7T A;  1HF8 A;  3RRU A;  1FVH A;  2MOW A;  3GW4 A;  3UMV A;  3L54 A;  3FEX A;  4UI9 J;  2KCL A;  4I17 A;  3SZ7 A;  4JEH A;  3VLD A;  5G05 J;  4APF A;  1LF8 A;  4B8A A;  5G2N A;  3VTY A;  2V5F A;  3Q5M A;  4ACK A;  3CVX A;  5AIJ A;  2Y4T A;  3N71 A;  3ZYK A;  5BUZ A;  2GW1 A;  3D3M A;  4FAD A;  4TUU A;  3UX4 A;  2CG2 A;  5FZS A;  3LVQ E;  3FU5 A;  1A17 A;  3AS5 A;  1DNP A;  4XI0 A;  2AWI A;  4WWP A;  3ULQ A;  3ONL A;  3MX3 A;  3MKQ B;  4EPZ A;  3AS8 A;  4L2L A;  4XI9 A;  4WAF A;  1JUQ A;  3EIQ C;  3ZFW A;  4IN3 B;  5ENN A;  4MRU A;  2UWJ G;  3JCK C;  1HG5 A;  4JHJ A;  2WB2 A;  1ELR A;  4HXI A;  4LCT A;  2J4B A;  3FEY A;  3U4T A;  1IQR A;  2J08 A;  1HZ4 A;  3CKC A;  3CR3 A;  3NQP A;  4G23 A;  4LRZ A;  3E4B A;  3K9I A;  2OVB A;  4EBA G;  3CKB A;  4GML A;  2KCV A;  4UWG A;  3CVW A;  3HDX A;  3CVL A;  4DLQ A;  3LY7 A;  3L13 A;  5G04 C;  4GZC A;  3PZD A;  2X6K A;  5JJ7 A;  3CK8 A;  1QZ2 A;  4AVX A;  5CMY A;  5AJD A;  4GZD A;  3VTX A;  3G2T A;  2IFU A;  4EQF A;  2KC7 A;  3IHY A;  5CHE E;  1PY1 A;  4QFV A;  2HYZ A;  3CQG B;  2WXM A;  4I2Z A;  4N5C A;  3JYS A;  1EF1 C;  4UI9 K;  4ANW A;  5LFA A;  3SBT B;  1FCH A;  3FTU A;  3GZ2 A;  5EX3 A;  2QFC A;  1HS6 A;  4MKT A;  5AEN A;  2VGX A;  4I9E A;  3CVU A;  2PQN A;  3QOU A;  4L7T A;  4IRU A;  4HVB A;  2IU1 A;  5HI7 A;  3QKY A;  4FLB A;  5FQ6 A;  2XPY A;  4BTA A;  2QY7 A;  5E76 A;  5JJ6 A;  3L08 A;  4V3I A;  2V8S E;  3ZRH A;  2CHZ A;  2ILR A;  4Q94 A;  4D10 C;  3EJN A;  3QJZ A;  3IHV A;  3ASG A;  3RU0 A;  4ANU A;  1MQS A;  4HOU A;  3U3W A;  3LS8 A;  2J49 A;  4B94 A;  4HOQ A;  3FFL A;  1SQM A;  3DPD A;  3MJW A;  3OTN A;  3PDN A;  4M3O A;  4A55 A;  3KEZ A;  3CVY A;  4I1O B;  3LVR E;  3MKQ A;  3LPZ A;  4GZ3 A;  3FTS A;  3GYZ A;  3NF1 A;  1H6K A;  4H7Y A;  2FO7 A;  2XPZ A;  4L1B A;  2WM9 A;  5EDS A;  1E90 A;  4JA9 A;  4I6G A;  2XCB A;  3FUH A;  3KD7 A;  4JL0 A;  4J8F A;  4YVQ C;  1SZA A;  1E8X A;  1JPL A;  4UQY A;  4U8H A;  2FBN A;  2M63 A;  3L17 A;  5KJK A;  2WXF A;  1NA0 A;  2FI7 A;  4C9B B;  3CHM A;  2FUL A;  1JWG A;  5FTP A;  2AVP A;  2XHE A;  3ASH A;  2XGM A;  3PNT B;  4JHR A;  2OVF A;  4U63 A;  5D0Q D;  3SF4 A;  4GZ5 A;  2I1K A;  3FUI A;  4KXK B;  5FWQ A;  3ZPJ A;  2MHK A;  1Y6I A;  2WXN A;  2VYI A;  3EIJ A;  5J90 A;  4N3A A;  5M72 A;  3FTZ A;  2VSX E;  1U3D A;  3D9O A;  3PUJ A;  3U64 A;  3PVL A;  2GRM A;  3QDN A;  2XCC A;  1H2U A;  3RRN B;  5FZQ A;  3ZW3 A;  4BX9 A;  4H7X A;  3CVV A;  1B89 A;  3URZ A;  3CVQ A;  3G2U A;  2XRY A;  3ESK A;  3R9A B;  3RIB A;  1NZN A;  2IQC A;  4EZK A;  1ZU2 A;  4GAA A;  3SBS A;  1PAQ A;  1H0A A;  4PS8 A;  4RSY A;  4J8E A;  5BW8 C;  3UT4 A;  4BTB A;  5BT1 A;  3LY9 A;  3EHM A;  3I3N A;  4GPK A;  4N39 A;  2Y3A A;  2HR2 A;  4HFG A;  1KLX A;  3ESL A;  3JQ1 A;  5A6C A;  3B13 A;  3LCA A;  4G2V A;  3B7R L;  4ACL A;  5FT9 A;  3L16 A;  2E2E A;  3LKU A;  3UQ3 A;  2I2O A;  3WXX A;  4UWH A;  2WXK A;  3DBS A;  3PS6 A;  4O6F A;  5KJM A;  4WNF A;  1X5B A;  2CHW A;  2WXR A;  3UPV A;  2VJ8 A;  1JWF A;  1UJJ A;  1S0P A;  2GRL A;  1GW6 A;  4L23 A;  1PC2 A;  4C0M A;  4CDM A;  1HU3 A;  2A4Z A;  4N2Q A;  4G26 A;  1E8Y A;  2BTD A;  4UWL A;  1OWL A;  3MZL B;  3MV3 B;  4FU3 A;  4GU5 A;  3S7B A;  2PM6 A;  4LER A;  3MGB A;  3ZN3 A;  1XGW A;  4N2S A;  3FH7 A;  3Q49 B;  3Q4A B;  3QAR A;  2XEV A;  4L2Y A;  2DIW A;  1U3C A;  1UW4 B;  1DVP A;  3UT7 A;  3ASF A;  4K0R A;  3TXM A;  1OWN A;  3MKR A;  3Q47 B;  4BWR A;  1EYH A;  4CT0 A;  4G11 A;  4KYO B;  2J09 A;  1H2V C;  1L5J A;  2YHE A;  1HX8 A;  2YQ8 A;  5ARF A;  4HOT A;  4AJW A;  3Q15 A;  2R17 C;  4CCA A;  2I1J A;  5LCW C;  3FU6 A;  1OWP A;  3TG5 A;  3FUK A;  2WXL A;  4NQ0 A;  3APF A;  4ILI A;  4XX5 A;  4F1S A;  2XQ0 A;  3SGH A;  1VDY A;  1BPO A;  2WXQ A;  3PEU B;  3MEK A;  4AOF A;  1ELK A;  5FJY A;  2WPV A;  4KVM A;  2CFU A;  3ZEF A;  1Y8M A;  3PNL B;  3ZGQ A;  2EQX A;  2WXO A;  1EPU A;  1E7V A;  4A3T A;  3P1U A;  3PE3 A;  4GMJ A;  2WQ6 A;  3CHS A;  3OXG A;  4HOS A;  3LDZ A;  4XE0 A;  4E85 A;  4OYS A;  2NSZ A;  2R59 A;  4B8C B;  3CQC B;  1KT1 A;  4GA2 A;  5C2Y A;  4ILG A;  2VQ2 A;  3L6A A;  3D9J A;  3CIA A;  2WQH A;  1TJC A;  4PUC A;  4A3V A;  3QAQ A;  3PRZ A;  4AM9 A;  5FQ4 A;  5CCM A;  3TG4 A;  3CHO A;  2LSV A;  5BPP A;  2AXZ A;  3FU3 A;  3ZYM A;  4UQZ A;  5G55 A;  2NC9 A;  1UN8 A;  3ZXS A;  3U9W A;  4MS6 A;  5EKQ D;  2Q7F A;  3OXF A;  4I9C A;  3D9P A;  3U66 A;  2CFZ A;  1HH8 A;  1WM5 A;  3TAX A;  3UT8 A;  2HM8 A;  3JUI A;  5CCL A;  3FP3 A;  2P58 C;  2NXP A;  2WXI A;  4URK A;  3LEW A;  4GB9 A;  1KT0 A;  3PRE A;  2VGY A;  3VLF A;  3O48 A;  3FWV A;  3IBE A;  4PS3 A;  1INZ A;  2I6H A;  2V0P A;  4J8S A;  5JJT A;  2PL2 A;  4FHK A;  4JXT A;  1IQU A;  2BUG A;  2JEK A;  2OOE A;  3OXL A;  1TJF A;  2BF0 X;  2IOL A;  1E7U A;  3P2B A;  4OVV A;  1HE8 A;  4KZC A;  4XKB A;  2JLB A;  4G24 A;  2UY1 B;  2FEZ A;  1E8W A;  4HS2 A;  3EDT B;  4G25 A;  4ANV A;  3R7R A;  3IV0 A;  3BEE A;  3D9M A;  3PE4 A;  1FVF A;  4ILH B;  5DIZ A;  3TGO A;  2YNQ A;  2ION A;  3CV0 A;  1XNF A;  2RD0 A;  3FTX A;  4Y6C A;  3AU4 A;  3MA5 A;  3QWP A;  4KMO A;  2OV8 A;  2VSO E;  3CEQ A;  4U0S A;  5ARG A;  5AJL A;  4RG9 A;  3I5P A;  2LO6 A;  4BSX A;  4JZY A;  3OAW A;  4Y6W A;  1WAO 1;  2CG3 A;  4B0Z A;  3HIZ A;  4FLH A;  3T5V A;  3VLE A;  4BY6 A;  2C2L A;  5LCW J;  2WXP A;  3CVP A;  5T4Y A;  4WND A;  4P29 A;  3FTV A;  5FQ8 A;  4Q96 A;  1OUV A;  5G04 J;  3FH8 A;  3NZU A;  4I6J A;  1Z3Y A;  1HFA A;  3SFZ A;  2L0T B;  3RO2 A;  4I6E A;  1UJK A;  1Z3X A;  4PH4 B;  3APC A;  4ABN A;  3LY8 A;  4ANX A;  4FA6 A;  2VSN A;  1QNF A;  5E75 A;  2L6J A;  3FUF A;  4WWO A;  2PZI A;  3SHF A;  1HXI A;  3FUM A;  3NZS A;  3PEV B;  4AY6 A;  1QQE A;  2DBA A;  5KCM A;  3G2W A;  1H2T C;  4FHJ A;  4GA0 A;  4JC8 A;  3RJV A;  2V4L A;  4IYP A;  5HQ8 A;  4CGW A;  3BG1 B;  4TV3 A;  3T8M A;  3FTW A;  3B7S A;  4RVB A;  4BFR A;  3T5X A;  1TEZ A;  4CEM A;  1MHQ A;  4JW1 A;  4U07 A;  3ZYQ A;  4APO A;  4I1A A;  2X6F A;  2IF4 A;  2WQ7 A;  3QB2 A;  4I2W A;  3TL5 A;  4AXH A;  1ZBP A;  3FHE A;  3S2A A;  3RO3 A;  5ANR A;  3CK7 A;  3ZHE B;  2UY1 A;  3TXN A;  3O4Z A;  4WUY A;  4FC8 A;  3BG0 B;  4CT4 A;  3D9K A;  3PUK A;  2R5S A;  4GCN A;  4DI3 A;  2VTB B;  3FY4 A;  4PS7 A;  3CGH A;  3KS2 A;  2KM4 A;  4RG6 A;  4CGV A;  4XZ4 A;  5JHB A;  4YND A;  2XRZ A;  4EBA A;  1N54 A;  3I4G A;  4J6I A;  3FH5 A;  2J07 A;  4AEZ C;  4JA7 A;  2WXJ A;  2AXU A;  2WVI A;  1UN9 A;  3ENE A;  3I4R B;  3HHM A;  4J0U A;  2FF4 A;  2KZT B;  4WNG A;  4Q69 A;  4UWK A;  3CST A;  2ZU6 B;  4KVO A;  1Z6T A;  2CHX A;  1IYG A;  1YA0 A;  3RRM B;  3QNK A;  2XPI A;  3ML8 A;  3AS4 A;  1N52 A;  4AIF A;  4CDN A;  3IKO B;  4WWN A;  4F53 A;  2MRI A;  2KCK A;  3D9N A;  2GGF A;  1EDU A;  4EZJ A;  1OWM A;  3FDH A;  4I43 A;  4NRH B;  2WMO A;  3D9L A;  2LNI A;  1P5Q A;  4DPR A;  1IHG A;  4UI9 C;  2VSY A;  1SZ9 A;  3CHQ A;  4BX8 A;  4LEU A;  3FUN A;  4FJY A;  5G05 C;  2J4D A;  2IJG X;  2X6I A;  3L22 A;  4TRQ A;  4ATG A;  2L9B A;  3R7Q A;  3ZVV A;  4FJZ A;  3CVN A;  4XKC A;  4I1M A;  4AY5 A;  4N3B A;  5CMW A;  2YIN A;  4IUL A;  3ZYL A;  3G2V A;  5J08 A;  3UUX A;  2PM7 A;  2KAT A;  4JEU A;  5LOZ A;  3B7U X;  3HVE B;  4JHK A;  4DK5 A;  4GA1 A;  4KT6 B;  2C0L A;  3ML9 A;  2PQR A;  3QWV A;  3ZHE A;  4CDR A;  4U0U A;  3EHN A;  4AP2 A;  5ANL A;  5BV1 A;  4KZ0 A;  3CHR A;  4UWF A;  2X6J A;  2WXG A;  4HOR A;  4GYY A;  1WY6 A;  4GCO A;  4C0E A;  4DLO A;  4EEC A;  4A1G A;  1UG3 A;  2XGS A;  5BV0 A;  2VTB A;  4KBQ A;  2OND A;  4GZ6 A;  3TJP A;  2X3M A;  1E96 B;  4MLP A;  2IOS A;  4HLE A;  5LX8 A;  3FUE A;  2C0M A;  4LUN U;  3FUL A;  5A7D B;  4AV7 A;  5T8I A;  2YHC A;  4BT8 A;  2WXH A;  4U0Z A;  5AYW D;  3QWW A;  2J9Q A;  2Y4U A;  3PH0 C;  3CSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...