4NRHB

Copn-scc3 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
170
structure length
170
Chain Sequence
MSHLNYLLEKIAASSKEDFPFPDDLESYLEGYVPDKNIALDTYQKIFKISSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A gatekeeper chaperone complex directs translocator secretion during type three secretion.
pubmed doi rcsb
source organism Chlamydia pneumoniae
molecule tags Chaperone/protein binding
molecule keywords CopN
total genus 60
structure length 170
sequence length 170
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4nrhB00
3JYSA 3FWVA 2UWJG 3GZ2A 2DBAA 2IF4A 1ELRA 2UY1A 4J8EA 5FT9A 4YNDA 4AM9A 3CEQA 4G26A 2KCVA 5JJ6A 1WM5A 4AY6A 1P5QA 1W3BA 2VGXB 3CV0A 4G24A 3QKYA 2OOEA 4YVOA 5AYWD 1A17A 4N2QA 4ABNA 2BUGA 4CDRA 5DIZA 2QFCA 4I9CA 2FI7A 4UQYA 3OXFA 3VTYA 5FTPA 4J8DA 4A1SA 5CCMA 2PQRA 5KJMA 3AS4A 3QWPA 3E4BA 4UI9C 3S7FA 5KJLA 4GA1A 2XPIA 5FZSA 4ME2A 4XI9A 3MEKA 4U0SA 3EDTB 3UUXA 3CVPA 4N3CA 1ZBPA 2I6HA 4RG6A 4XIFA 1KT0A 3SZ7A 4BTAA 4GCNA 1WAO1 4WNEA 4N3BA 5A6CA 2XEVA 5KJKA 5BW8C 3MKRA 3LY9A 4GYOA 1E96B 4WNFA 2PZIA 3KD7A 4WNGA 3TG5A 3RU0A 3K9IA 3ZGQA 4G25A 1QZ2A 4GCOA 4N39A 4N5CA 4RG9A 4UQXA 5D0OD 5FZQA 3ULQA 3RKVA 4U04A 4KBQA 1PC2A 3CK7A 3GYZA 2XCBA 3PE3A 4JA9A 4I2WA 4LEUA 4UI9J 2FBNA 1XNFA 2JLBA 3RO2A 3ASGA 2HYZA 3LCAA 5DBKA 3VTXA 3MV3B 3ASHA 3MV2B 1FCHA 1IHGA 5M72A 3CVQA 1B89A 3OXGA 3TAXA 3Q47B 5G05J 3Q15A 5ARGA 4HOTA 4G2VA 3LYAA 3PDNA 2UY1B 4GPKA 2E2EA 4W9RA 4BT8A 3FFLA 4BT9A 4HORA 4IN3B 3S7JA 3LY8A 1NZNA 3ASDA 3GW4A 3Q4AB 3S7BA 4AY5A 4WNDA 2GW1A 2C0MA 3UPVA 4B94A 2VGXA 2PQNA 4CGWA 2KCLA 4CGVA 4HOUA 3SF4A 5BNWA 2XCCA 4JL0A 4BWRA 1TJCA 1NA3A 3ZFWA 3PE4A 3ZN3A 5HQ8A 1ELWA 1KT1A 2FEZA 2J9QA 2ONDA 1NA0A 2VGYA 1HXIA 4NQ0A 4N3AA 3U3WA 3TGOA 4U07A 5G05C 3LKUA 4APOA 2VSYA 2FF4A 4GZ6A 2C2LA 4GA0A 4G23A 2HR2A 2YHCA 3KS2A 4WUYA 5HI7A 5D0QD 3QWWA 1YA0A 1Y8MA 2XGMA 4I17A 4HOQA 2VQ2A 3ZPJA 3Q49B 2R5SA 4I9EA 4U0UA 2P58C 4I1AA 4Y6WA 5EX3A 5ARFA 3ZHEB 5JJ7A 5G04J 5EX0A 3LY7A 1HZ4A 4GZ5A 4KXKB 2IFUA 4J0UA 5EKQD 2YQ8A 5C1DA 2LSVA 4H7YA 3LPZA 4KYOB 3TG4A 3UQ3A 4XI0A 4GYYA 3IEGA 4AIFA 2WQHA 2AVPA 3CKBA 4O6FA 5KJNA 3NF1A 3Q5MA 4G1TA 4H7XA 2V5FA 3QOUA 3CVNA 5A7DB 4U0ZA 4GYWA 2Y4TA 4GZ3A 3URZA 4JHRA 2KCKA 2LNIA 3CK9A 3ESKA 3GZ1A 4J8FA 3ZHEA 4EQFA 2WPVA 3S7DA 2L6JA 3RIBA 3OXLA 4GA2A 3N71A 5G04C 2MHKA 3U4TA 3R9AB 5LCWC 2PL2A 5JJTA 1HH8A 3AS8A 3HYMB 5LCWJ 3ASFA 2Y4UA 2XGOA 2Q7FA 4Y6CA 3CKCA 3RO3A 3BEEA 4N2SA 3QWVA 1ZU2A 2KC7A 4JA7A 2XGSA 5FJYA 3QDNA 5CCLA 4BTBA 1KLXA 2LSUA 3MA5A 3O48A 4YVQC 2HO1A 2KATA 2VSNA 2NC9A 4UI9K 1OUVA 5BT1A 2FO7A 3KAEA 1QQEA 3CK8A 3CVLA 5CHEE 4HOSA 1IYGA 2VYIA 2C0LA 4I2ZA 4UQZA 5FZRA 4NRHB 3RJVA 3WXXA 3FP3A 4F3VA 3AS5A
chains in the Genus database with same CATH superfamily
3HXDA 4DRXE 5FT9A 5AYWD 5D66A 3G2TA 1DVPA 5DIZA 5AJLA 4I9CA 2FI7A 4J8DA 1KZOA 5KJMA 2LAHA 3WG7E 5AAOA 3JXJA 1K3ZD 4U0SA 2GRLA 2VGEA 3DSWA 3ZYQA 4I6EA 4E85A 2IOSA 3UMVA 4XE0A 5FZQA 4CRWA 3GYZA 1D8DA 4EZJA 3R7QA 4GZDA 2IJGX 5AN8A 4KVMA 1HS6A 3ZYKA 3TAXA 4M7CA 4FHKA 3T5XA 2PM6A 4WWNA 5D2MC 3GW4A 1MJ0A 4CGWA 2WXIA 4YDOA 3BUAA 4JHKA 2HR2A 3FULA 3X2QE 3ZHEB 4D10C 5EX0A 2P2CP 1O5MA 4KYOB 3DSVA 3RRUA 4G1TA 1N0QA 2FO1E 5KBAA 4GZ3A 1QBQA 4AV7A 1A5EA 4PUCA 3SY2A 3AS8A 3HYMB 3L54A 4P29A 3CKCA 3ESLA 3UKRG 5CRUA 3FEYA 2DVWA 3JXIA 4U8YD 4G8KA 2BKKB 3CVLA 1N11A 1U3CA 4HI8A 4U96D 4UQZA 3CR3A 3PEUB 3P1UA 5KNGA 3ULYA 1WM5A 5AJDA 3Q9UC 4TXQA 4GTTA 1WDYA 3VTYA 5CCMA 1OCRE 2XENA 4GPMA 3J5QB 1FVFA 3IV0A 3EDTB 3CVPA 3NQPA 3NAWA 4LNBA 3RU0A 3K9IA 5ENSD 3ZVVA 4BEPA 3APCA 1OWPA 4HLEA 4G11A 3AG1E 3EU9A 3VTXA 1EYHA 5ENNA 2DIWA 3OTNA 3G2VA 1IHGA 1TNYA 2B6CA 4FA6A 4JEHA 2F0YA 2B0OE 5IY5E 3S7JA 1H2TC 1E7VA 3FUHA 4JZYA 4WNDA 4B94A 3TXNA 1IKND 2CHXA 4B89A 1S70B 3JQ1A 3TJPA 1E8YA 2WMOA 2X38A 3ZPJA 4I1AA 1HE8A 4GZ5A 2YQ8A 2V4HC 3W9FA 2EIJE 3Q79A 2WXMA 4F53A 1U3DA 3LJ3A 3KSLA 4JHRA 1S64A 1ZB1A 4LNUD 3B7TA 5KWDA 3DWLG 4KVOA 2PNNA 4AXHA 2NXPA 1KLXA 2CFUA 1OUVA 1N95A 5AIJA 3JUIA 4A3VA 2J09A 2XZTG 4HS2A 5ENPD 5FQ8A 4YVOA 3MYVA 4CDRA 4JPSA 3AG2E 1TNBA 3HHMA 5FZSA 4ME2A 4RSYA 4XIFA 3U64A 4IRUA 2LXMA 3E34A 3UINC 5A6CA 4B8AA 2RFMA 2RG8A 3FH5A 3CGHA 1LTXA 5C2YA 4WWOA 5AQBA 2HYZA 3FUFA 2WM9A 3DSUA 4DX6D 3CVQA 3OXGA 1K1BA 3L6AA 4W9RA 2LO6A 1NZNA 2A5UA 3EHRA 2IQCA 4ILIA 4GMJA 2ETCA 5BNWA 2XCCA 3FEXA 3DBSA 2J49A 3JCKC 2R17C 4NQ0A 3FUDA 4B0ZA 4ZFHA 2ZIRA 4G23A 3T8MA 4I9EA 4U0UA 5JJ7A 5EX3A 4ZHBA 4GTMA 4OAUC 4C48B 4H7YA 5LFAA 2WXGA 3FTYA 3ESKA 4GTSA 2L6BA 2OVFA 1N0RA 1UN8A 1X5BA 3SGHA 2GRPB 3O48A 3TWUA 3SFZA 5ENOD 5JJ6A 2X6FA 3CV0A 2I2OA 1OWLA 3HXCA 1Q2ZA 4UQYA 3AS4A 4U7EB 1MX4A 1AP7A 3CHMA 1U2VG 4GTRA 3UI2A 2QZAA 4GYOA 4GCOA 4UQXA 2NSZA 1PC2A 5A23A 3NBNB 1HX8A 4DI3A 3SI5A 3CVWA 5LP0A 3Q47B 3DPDA 3CVXA 5B3SE 3LYAA 4GPKA 2UY1B 3BQOA 2E2EA 4BT8A 3ISMC 2C0MA 4OAVB 4CGVA 3CQCB 4BWRA 3AG3E 2LAIA 2VGYA 4HRNA 4TV3A 3SQVA 2VTBB 1JCSA 2FF4A 1N52A 3KEZA 4Q96A 2QY7A 5C1DA 5ENRD 1O1SA 2RD0A 2V5FA 4HNAD 4LRZA 1DCEA 2EINE 4IULA 2AXUA 3UTMA 5LOZA 1SZ9A 5CCLA 1BI8B 5AQ9A 5EYLA 3CK8A 1MHQA 3WXXA 3EHNA 3GZ2A 2DBAA 3CVVA 2E0IA 4DX7D 1GW6A 2XPZA 1OWMA 3G2WA 4UI9C 2XPIA 2I6HA 4WNEA 2QYJA 1HO8A 3CIAA 3LY9A 4F1SA 3ZGQA 2VTBA 4HXIA 1QZ2A 3IXEA 3RRNB 3DPYA 1JWGA 1UN9A 2QC9A 3CK7A 5BV0A 4F1PA 4KT6B 2KZTB 4U95D 1X81A 1D8EA 2ETAA 1OY3D 2P9IG 4ACKA 2J8SD 1TJCA 1XGWA 1D9SA 4U07A 3LKUA 2VSYA 3J5PA 4QFVA 3KS2A 4NIKA 3QWWA 4HOQA 3E32A 2IFUA 5HRYA 4HQDA 3TWSA 3PZ4A 3CKBA 5EYPF 1OT8A 2WVIA 2P9SG 2VSOE 4BETA 3KSQA 3TWQA 4XZ4A 4FLBA 3UT7A 2Y4UA 1Z3XA 3UM0A 3HXBA 2DZOA 1Z3YA 3Q75A 4BFRA 4LCTA 3P2BA 1SW6A 4K03A 4GZCA 5AQ7A 1ELRA 4Z68A 1JCRA 3I5PA 2A4ZA 3IHVA 5FTPA 4PDXA 3RK6A 2PQRA 1EPUA 3E4BA 4XI9A 4G8LA 4GAAA 3FU6A 1WAO1 4ATZD 5LCWJ 4WNFA 4WNGA 2QYUA 3MZLB 4HI9A 2YHEA 3FU3A 4JA9A 3HDXA 5EIBE 3FU0A 3ASHA 3SBTB 3Q7FA 2EQXA 4LUNU 3AAAC 5AARA 4UWLA 4BT9A 4V3IA 4AP2A 1RZ4A 5CMWA 2ONDA 4APOA 4FHJA 1OWNA 3UT8A 5CMYA 2P58C 2VJ8A 2WXQA 3SO8A 2L0IA 4PS3A 4EQFA 4J8YA 2AW6A 2X6IA 3NZUA 4UWFA 3EIQC 2WXHA 2OEWA 4OVUA 2HO1A 2FULA 2FO7A 3PZ2A 3RJVA 5FZRA 1MYOA 2GRNB 1E7UA 5BPPA 4IYPA 4TUUA 3GZSA 1O1RA 1ELKA 5B1AE 3SFXA 3UT4A 3FH8A 3BU8A 1N4QA 2XEVA 4G25A 2P9UG 3LXUX 4N39A 2AJAA 2DCPA 3RKVA 4I2WA 2BTDA 3FUJA 1TEZA 3MV3B 5BUZA 3Q15A 1IQRA 3FFLA 1PY1A 3Q4AB 3DEOA 3ZFWA 3KEAA 3L82A 4PS7A 2WXNA 2R03A 3UKUG 1BI7B 2GRRB 1Y8MA 4L23A 3UPVA 4ANWA 2H6GA 4GYYA 1FPPA 3QOUA 4ACLA 3V31A 1V54E 3C3RA 3LDZA 2XEHA 2R02A 4A63B 2H6HA 1OCZE 4J7WA 2KC7A 4A3TA 3ZNGA 1LD7A 4UUCA 2WXLA 3CVYA 4YVQC 2ZU6B 3JUEA 3R7RA 2OV8A 4J8EA 4BESA 3CEQA 2VGXB 4NURA 1A17A 3D9IA 4ABNA 2BUGA 3QJZA 4A1SA 1UJKA 2AXVA 4GA1A 1N4SA 1TNZA 4GCNA 3HXFA 2JEKA 5BW8C 4MRUA 3EHMA 4UI9J 2HE0A 1HU3A 2FBNA 3IHYA 4APFA 1WY6A 2Y1LE 4JC8A 2R59A 1IHBA 2RKKA 2H6IA 4FU3A 4FC8A 4HORA 2XHEA 3BG1B 4AY5A 4TXPA 3EJNA 2WXKA 5HQ8A 2FEZA 1IXVA 4A1GA 4BSXA 4YDEA 4K5BA 1IQUA 1SA4A 4L2YA 2MOWA 5E75A 3TWWA 3FHEA 3DSTA 5G04J 4J0UA 3PUJA 1O1TA 2AXZA 3G2UA 3C72A 4U0ZA 4L2LA 1FVHA 1K8KG 3GZ1A 4K5CA 2P9KG 3ZXPA 4ANUA 4HLLA 5G55A 4Y6CA 2RFAA 3QDNA 2BF0X 2LSUA 3D9KA 3U9WA 3FUNA 3C5RA 4GU5A 3D9NA 4YNDA 3CSFA 2GRQB 1W3BA 4G24A 3ONLA 3TXMA 3OXFA 5CRVA 2XS1A 3CVUA 4O60A 1HG2A 3LVQE 5EN5D 3B95A 1KT0A 5KJKA 2I1JA 3B7SA 4RG9A 4N5CA 4KZ0A 3I3NA 2OCCE 1K1AA 3PEVB 5BXUA 3MV2B 2J4BA 5T8IA 5G05J 4HOTA 1Y6IA 2YNQA 5CEAA 2F8XK 3HRAA 4I1OB 1H2UA 3B7RL 4HOUA 2KM4A 3SF4A 3NZSA 3Q7AA 2V0PA 3PNLB 3UIOC 2ZGGA 3UM1A 3C3OA 3BG0B 3FTVA 1H0AA 4HFGA 2R5SA 4J8SA 3G2SA 3LY7A 5EKQD 3ZUVB 1DCQA 2LUHA 4GTVA 4FJYA 1N9AA 3URZA 3HXEA 1MQSA 3E33A 3HVEA 1N4PA 1PAQA 4WAFA 2IONA 2ZISA 4N2SA 1L5JA 1FT1A 3ASOE 2YINA 5BT1A 1IYGA 3KAEA 1YYHA 2VSXE 2IF4A 5B1BE 3CLJA 2KBXA 3PZDA 4AY6A 1P5QA 4N2QA 2QFCA 1N94A 4L7TA 1YCSB 3SHFA 5CECB 3S7FA 4XX5A 3SFYA 1MZCA 4LERA 1JCQA 3FH7A 4FADA 2PZIA 4F7AA 2X6JA 4KZCA 5CEDB 2XCBA 2EILE 3ASGA 3LCAA 4DJAA 2WXJA 3RAUA 1FCHA 5EILA 3FTXA 3L16A 3EUVA 3LY8A 2CFZA 2WMNA 1BD8A 4FP7A 1OCOE 1NA3A 2X3MA 3ZN3A 1NA0A 3L17A 1UJJA 1BPOA 1SA5A 1YA0A 2Y3AA 2LSVA 4I6JA 4LSZE 5FQ4A 3ZHEA 2EIME 3S7DA 2H6FA 2DYSE 3Q9NC 4Q94A 4C9BB 1TNUA 4UI9K 2PM7A 3FY4A 3I4RB 1EDUA 5E76A 4TUMA 3D9LA 1SQMA 4I1MA 5JA4D 3CSTA 1AWCB 4R7LA 3UUXA 1H6PA 4A55A 3NB2A 5T4YA 4MLPA 4ILGA 2GRMA 2KXPC 4EBAG 4DUIA 1KZPA 1NL4A 5ITZF 3SBSA 1N4RA 1MX2A 4C0MA 3V79K 2AWIA 3IBEA 4XEIG 3VLFA 2CG3A 5G2NA 2PQNA 4WWPA 3ZU7B 1UOHA 3B13A 1ELWA 1KT1A 4TXRA 3Q73A 2C2LA 4GA0A 4HRMB 1OWOA 2I1KA 5D0QD 3QK0A 1SVXA 2HM8A 4CDNA 5FIOA 2AVPA 4J6IA 3D9MA 3CVNA 3FTZA 1H2VC 2WPVA 2L6JA 5EIDA 5AQAA 4HBDA 5G04C 3U66A 2A5EA 4OVVA 4JD2G 4AJWA 5LCWC 1HG5A 2XGOA 3DEPA 3ZRHA 3BEEA 3ML9A 3CHQA 4L1BA 2DZNA 1E8ZA 2ILRA 3TL5A 4GMRA 3TWRA 2VYIA 5ENQD 4AM9A 4G26A 4FULA 5ANLA 2XEEA 2OOEA 4HVBA 4RLYA 3HG0D 3QWPA 2ZXWE 3ZW3A 3CHRA 5LX8A 2OEVA 3ZYLA 4YDWA 1E96B 3HIZA 3EHQA 3D9JA 4DK5A 5DBKA 2WXFA 3V2XA 4UWHA 4BSZB 1B89A 4G2VA 3TWVA 2V8SE 4CT0A 2VGXA 3NOCD 3PNTB 2KCLA 3B7UX 5AENA 3PZ1A 1G3NB 1HXIA 3FUMA 5G05C 3UX4A 2P9NG 2X6HA 3AU5A 3PH0C 4WUYA 5HI7A 4AEZC 3T8KA 5FQ6A 3LEWA 1JPLA 3LPZA 4X8QA 4O6FA 2GGFA 3MX3A 2CHWA 2ZGDA 4GYWA 4RVBA 2KCKA 5HS0A 2R2LA 3OXLA 3QARA 4GA2A 4GTOA 2Q7FA 4PS8A 4JA7A 4JHJA 4MBGA 5CBNA 2ETBA 5CHEE 4CDMA 5ANRA 4I2ZA 3ZKJA 5KCMA 3AS5A 4ANVA 2KCVA 3S2AA 4EECA 1H6KA 3ABKE 5H7PA 1V55E 4EZKA 4Q69A 2WQ7A 3EU5A 4PH4B 3SZ7A 4BY6A 4C0EA 3F6QA 3LS8A 4EZLA 2IOLA 3TG5A 2EIKE 1DC2A 2OVBA 4U63A 3AG4E 4JVSA 3FTSA 4JEUA 5M72A 3SD5A 5JHBA 4UWKA 4U8HA 1LF8A 4IN3B 3ASDA 3QB2A 4AOFA 2GW1A 1TNOA 4FJZA 1BU9A 3ZYMA 3MKQA 4KMOA 3OAWA 3CQGB 3QNKA 2WB2A 3RSEG 3ZIMA 3DXKG 3CHSA 4LNGA 3CHOA 3D9HA 1E90A 2Y69E 2CHZA 2XGMA 2WQ6A 1Z6TA 1NP7A 1TR4A 4DLOA 3Q78A 4BX8A 2LXLA 3Q5MA 4H7XA 1YMPA 5A7DB 4ANXA 1QYMA 2Y0BG 4HB5A 4J8FA 2MYOA 3ASNE 3RIBA 4EBAA 3N71A 3U4TA 4MS6A 3R9AB 1MX6A 1JWFA 1HH8A 3ASFA 5FJYA 2WXPA 4BTBA 3MA5A 3NOGD 2XRYA 4CZ2D 2WXOA 3FP3A 3C3QA 3JYSA 3B7BA 4JW1A 4DX2A 2I9CA 3EIJA 3AU4A 3TWXA 1TN6A 5KNHD 5CBOA 4FLHA 3FUKA 4HRLA 5KJLA 4JB8P 3MKQB 3UM2A 3ONKA 3MKRA 4EPZA 1EF1C 3ULQA 2GROB 5D0OD 4U04A 4KBQA 2V4LA 4LEUA 2J07A 2IU1A 3I4GA 4I43A 4XKCA 1XNFA 3RO2A 1KPSB 3ZEFA 3PZ3A 1H6OA 1TN8A 4U8VD 5CERB 3ML8A 1VDYA 3L22A 3PDNA 4RQIA 3S7BA 2BEDA 3ABLE 5JMND 3CHPA 4UWGA 3VLDA 3PVLA 3PE4A 3APFA 2J9QA 3R9MA 3W9GA 4GZ6A 3LJNA 5T3RA 3E30A 1QNFA 4DX1A 4I17A 4XKBA 2VQ2A 3Q49B 4ATGA 4GTPA 4KXKB 3TG4A 4AIFA 2WQHA 1TJFA 3PRZA 2R05A 5HKPA 4O1PA 3O4ZA 3FUIA 4L9PA 5BV1A 3PS6A 3DRAA 3ENEA 5FQ7A 1E8WA 1ZU2A 2XPYA 5ENTD 2XGSA 1FT2A 2XS8A 2IY0C 3UM3A 4HOSA 5J08A 4QQIA 1OXJA 4F3VA 2CG2A 4NACA 2UWJG 1TYQG 3V2OA 4TRQA 3MJWA 2L9BA 2NYJA 4M3OA 2F8YA 3DSXA 2V5QC 4DX5D 1BLXB 2XRZA 3MEKA 3ZXSA 1DNPA 3L13A 4N3BA 2M63A 2JABA 2J4DA 3T5VA 3PE3A 2IEJA 4K0RA 2JLBA 5EDSA 2MRIA 2J08A 1NI1A 3HVEB 2P9LG 3PREA 3L9TA 5ARGA 4E6HA 3JQ0A 3TGOA 4CCAA 1N54A 3AJIA 1LD8A 4ILHB 4OYSA 3IEGA 5KJNA 3NF1A 2WXRA 1TN7A 4BERA 3MCXA 3TWTA 2MHKA 4F6RD 5JJTA 2IO2C 3DSSA 2P9PG 4MKTA 5J90A 3VLEA 3MGBA 4GB9A 3APDA 5FINA 1JUQA 2NC9A 2XQ0A 1S63A 3DXMG 3QAQA 1Z5SC 4NRHB 3C98A 3ULEG 3FWVA 2UY1A 4B93B 3QKYA 3D9OA 3QC1A 3FDHA 3LVRE 2DWZA 1SZAA 4K5AB 3T9KA 1WG0A 2X6KA 2IO3C 1UW4B 4CYMD 5JHAA 4O1OA 4RG6A 4N3CA 1ZBPA 4BTAA 1NFIE 3D9PA 2F37A 4GTQA 3KD7A 1S0PA 4B8CB 4URKA 4BX9A 4DI4A 5BXOA 3UXGA 4I6GA 4CEMA 1HF8A 4JL0A 1H19A 3V30A 4N3AA 3L08A 4YDYA 3U3WA 3FUEA 4N5QA 3SNXA 4DPRA 2DYRE 2YHCA 2L0TB 3ABME 5ARFA 4Y6WA 1HZ4A 4LG6A 1RW2A 4EHMA 1OCCE 3UQ3A 4XI0A 2Y4TA 2LNIA 3CK9A 4GMLA 4CT4A 3FTUA 2PL2A 3IKOB 4DLQA 3FU5A 4JXTA 3RO3A 3QWVA 3RRMB 2BKGA 1E8XA 4AVXA 1INZA 3PUKA 3D3MA 3E37A 5FWQA 2KATA 2VSNA 3FTWA 2KZTA 1QQEA 2C0LA 3UIPC 1HFAA 2XZDG 1UG3A
chains in the Genus database with same CATH topology
4GU5A 3EHNA 3GZ2A 2DBAA 3D9NA 4ANVA 5FT9A 4YNDA 3CSFA 3CVVA 2KCVA 2E0IA 1W3BA 4G24A 5AYWD 3ONLA 3G2TA 3S2AA 4EECA 1GW6A 1DVPA 1H6KA 2XPZA 5AJLA 1OWMA 5DIZA 4I9CA 2FI7A 3TXMA 3OXFA 4J8DA 5KJMA 2LAHA 3G2WA 3CVUA 4EZKA 4UI9C 1HG2A 3LVQE 2XPIA 4Q69A 4U0SA 2WQ7A 2GRLA 2I6HA 4PH4B 3SZ7A 1KT0A 4BY6A 4WNEA 3ZYQA 4C0EA 5KJKA 2I1JA 3B7SA 1HO8A 3CIAA 3LY9A 2IOSA 3LS8A 2IOLA 4I6EA 3TG5A 3ZGQA 4E85A 4HXIA 4EZLA 2VTBA 3UMVA 1QZ2A 4N5CA 4RG9A 4KZ0A 4XE0A 2OVBA 5FZQA 3RRNB 3I3NA 4U63A 1JWGA 1UN9A 5KCMA 4JVSA 4CRWA 3CK7A 3GYZA 3FTSA 3PEVB 4EZJA 5BV0A 3R7QA 4GZDA 4KT6B 2IJGX 3MV2B 2KZTB 4JEUA 4KVMA 5M72A 1HS6A 2J4BA 3SD5A 5JHBA 3ZYKA 4UWKA 3TAXA 5T8IA 5G05J 4HOTA 1Y6IA 4U8HA 4FHKA 1LF8A 4I1OB 3T5XA 2PM6A 1H2UA 4IN3B 4WWNA 3ASDA 3GW4A 3QB2A 4AOFA 2GW1A 3B7RL 4CGWA 4FJZA 4HOUA 2KM4A 3SF4A 2WXIA 4ACKA 3NZSA 3ZYMA 1TJCA 3MKQA 4KMOA 1XGWA 2V0PA 4JHKA 3OAWA 3CQGB 3PNLB 4U07A 3QNKA 2WB2A 3LKUA 2VSYA 4QFVA 3ZIMA 3CHSA 2HR2A 3CHOA 3FULA 3KS2A 1E90A 3BG0B 3QWWA 2CHZA 2XGMA 3FTVA 4HOQA 1H0AA 4HFGA 2R5SA 2WQ6A 3ZHEB 1Z6TA 1NP7A 4J8SA 4D10C 5EX0A 3G2SA 3LY7A 5EKQD 2IFUA 4DLOA 4KYOB 4BX8A 3CKBA 3RRUA 4G1TA 3Q5MA 4H7XA 5A7DB 4FJYA 2WVIA 2VSOE 4ANXA 4GZ3A 3URZA 4XZ4A 4J8FA 4FLBA 1MQSA 3UT7A 4AV7A 3HVEA 3RIBA 4EBAA 1PAQA 3N71A 3U4TA 4MS6A 3R9AB 4WAFA 1JWFA 4PUCA 1HH8A 3AS8A 3HYMB 3ASFA 2IONA 3L54A 2Y4UA 1Z3XA 4P29A 3CKCA 4N2SA 1L5JA 3ESLA 3FEYA 1Z3YA 5FJYA 2WXPA 2YINA 4BTBA 4BFRA 3MA5A 4LCTA 2XRYA 3P2BA 5BT1A 1IYGA 3KAEA 3CVLA 1U3CA 4UQZA 3CR3A 3PEUB 4K03A 3P1UA 2WXOA 3FP3A 4GZCA 3JYSA 2VSXE 4JW1A 2I9CA 1ELRA 2IF4A 3EIJA 3CLJA 1WM5A 3PZDA 5AJDA 4AY6A 1P5QA 4N2QA 3AU4A 3I5PA 2A4ZA 2QFCA 3IHVA 5FTPA 4PDXA 4FLHA 3VTYA 3RK6A 2PQRA 4L7TA 5CCMA 3FUKA 1EPUA 3SHFA 1FVFA 3E4BA 3S7FA 5KJLA 4XI9A 4XX5A 3IV0A 3EDTB 3CVPA 3MKQB 4GAAA 3NQPA 3FU6A 1WAO1 3ONKA 4LERA 3MKRA 4EPZA 3FH7A 4FADA 4WNFA 5LCWJ 1EF1C 2PZIA 4WNGA 4F7AA 3RU0A 3K9IA 3ULQA 3MZLB 5D0OD 2X6JA 4KZCA 4U04A 4KBQA 2YHEA 3APCA 3ZVVA 1OWPA 4HLEA 2V4LA 3FU3A 2J07A 2IU1A 2XCBA 3I4GA 4G11A 4I43A 4JA9A 3HDXA 1XNFA 4LEUA 4XKCA 3RO2A 3ASGA 1EYHA 3FU0A 3LCAA 3VTXA 3ASHA 3SBTB 3ZEFA 5ENNA 4DJAA 2DIWA 2WXJA 3OTNA 1FCHA 3G2VA 2EQXA 4LUNU 1IHGA 4FA6A 4JEHA 4UWLA 3ML8A 1VDYA 3FTXA 3L22A 3L16A 3PDNA 4BT9A 3S7JA 3LY8A 3S7BA 1H2TC 4V3IA 1E7VA 3FUHA 4JZYA 4WNDA 2CFZA 4AP2A 2WMNA 3TXNA 3CHPA 4UWGA 4B94A 4FP7A 3VLDA 3PVLA 1NA3A 2X3MA 3PE4A 3ZN3A 3APFA 2J9QA 5CMWA 2ONDA 1NA0A 4APOA 2CHXA 3L17A 1OWNA 4FHJA 4GZ6A 5T3RA 1UJJA 1BPOA 4B89A 3JQ1A 3TJPA 1E8YA 1QNFA 1YA0A 2WMOA 2X38A 4I17A 4XKBA 3UT8A 2VQ2A 5CMYA 3ZPJA 3Q49B 4ATGA 2P58C 4I1AA 1HE8A 4GZ5A 4KXKB 2Y3AA 2VJ8A 2YQ8A 2LSVA 3TG4A 2WXQA 4AIFA 2WQHA 4I6JA 2WXMA 4F53A 2L0IA 1U3DA 3LJ3A 1TJFA 3PRZA 4JHRA 4PS3A 5FQ4A 3O4ZA 4F1SA 3FUIA 3ZHEA 4EQFA 3S7DA 5BV1A 2AW6A 3PS6A 2X6IA 3NZUA 4UWFA 3EIQC 3ENEA 3B7TA 5FQ7A 1E8WA 2WXHA 4KVOA 1ZU2A 2XPYA 4Q94A 4AXHA 2XGSA 4OVUA 2NXPA 1KLXA 2CFUA 4C9BB 2HO1A 4UI9K 1OUVA 2FULA 2FO7A 2PM7A 4HOSA 3FY4A 5AIJA 5J08A 3RJVA 1UG3A 3JUIA 3I4RB 2J09A 5FZRA 4A3VA 4F3VA 2CG2A 4NACA 2UWJG 1EDUA 4HS2A 5E76A 4TRQA 3MJWA 1E7UA 3D9LA 1SQMA 4I1MA 5FQ8A 4YVOA 5BPPA 3CSTA 3MYVA 4IYPA 2L9BA 4CDRA 4TUUA 4JPSA 3GZSA 1ELKA 4M3OA 3HHMA 3UT4A 3FH8A 4R7LA 5FZSA 4ME2A 2XRZA 3MEKA 4RSYA 3UUXA 4XIFA 3U64A 3ZXSA 4IRUA 1DNPA 4A55A 3L13A 4N3BA 5A6CA 2XEVA 2M63A 5T4YA 4B8AA 4MLPA 4ILGA 2RG8A 4G25A 2GRMA 3FH5A 3LXUX 4N39A 4EBAG 2DCPA 3CGHA 3RKVA 2J4DA 3T5VA 4I2WA 5C2YA 3PE3A 2BTDA 4WWOA 3FUJA 4K0RA 2JLBA 3SBSA 2HYZA 5EDSA 3FUFA 1TEZA 3MV3B 2MRIA 2J08A 2WM9A 4C0MA 5BUZA 2AWIA 3CVQA 3HVEB 3IBEA 3OXGA 3PREA 3Q15A 5ARGA 3VLFA 1IQRA 2CG3A 3L6AA 4W9RA 3FFLA 2LO6A 5G2NA 1PY1A 1NZNA 3Q4AB 2A5UA 2IQCA 2PQNA 4GMJA 4ILIA 4WWPA 4E6HA 5BNWA 2XCCA 3FEXA 3DBSA 2J49A 3B13A 3ZFWA 3JCKC 1ELWA 2R17C 1KT1A 4NQ0A 4PS7A 2WXNA 3JQ0A 3TGOA 3FUDA 4B0ZA 2C2LA 4GA0A 4G23A 1OWOA 2I1KA 5D0QD 3T8MA 4CCAA 1Y8MA 4L23A 1N54A 3QK0A 4I9EA 4U0UA 5JJ7A 4ILHB 5EX3A 3UPVA 4ANWA 2HM8A 4CDNA 4OYSA 4H7YA 5LFAA 2WXGA 4GYYA 3FTYA 3IEGA 5KJNA 2AVPA 3NF1A 4J6IA 3D9MA 3QOUA 3CVNA 4ACLA 2WXRA 3FTZA 3ESKA 1H2VC 2WPVA 3LDZA 3MCXA 2L6JA 5G04C 3U66A 2MHKA 2OVFA 4OVVA 4AJWA 5LCWC 5JJTA 1HG5A 2XGOA 1UN8A 3ZRHA 1X5BA 3BEEA 3ML9A 3CHQA 3SGHA 2KC7A 4A3TA 4L1BA 2WXLA 4MKTA 5J90A 3CVYA 3MGBA 4GB9A 3VLEA 4YVQC 3APDA 3O48A 1E8ZA 2ILRA 3TL5A 1JUQA 2NC9A 2XQ0A 2ZU6B 3QAQA 2VYIA 4NRHB 3C98A 3R7RA 2OV8A 3FWVA 3SFZA 2UY1A 4J8EA 4AM9A 3CEQA 4G26A 4FULA 5JJ6A 5ANLA 2X6FA 2VGXB 2I2OA 3CV0A 3QKYA 1OWLA 2OOEA 3D9OA 1A17A 3D9IA 3QC1A 4NURA 2BUGA 4ABNA 4HVBA 3FDHA 3QJZA 3LVRE 4UQYA 1SZAA 4A1SA 1UJKA 3AS4A 3QWPA 2AXVA 2X6KA 3CHMA 4GA1A 1UW4B 5JHAA 3ZW3A 4RG6A 4N3CA 1ZBPA 3CHRA 4BTAA 5LX8A 4GCNA 3ZYLA 3D9PA 2JEKA 5BW8C 4GYOA 1E96B 3KD7A 1S0PA 3HIZA 4GCOA 4MRUA 3EHMA 4UQXA 4B8CB 2NSZA 3D9JA 4URKA 1PC2A 4UI9J 5A23A 1HU3A 2FBNA 1HX8A 3IHYA 4BX9A 4DK5A 5DBKA 4DI3A 3SI5A 4APFA 2WXFA 3CVWA 4DI4A 1WY6A 5LP0A 4UWHA 1B89A 4JC8A 2R59A 3Q47B 3DPDA 3CVXA 4FU3A 4G2VA 3LYAA 4FC8A 2UY1B 2V8SE 4GPKA 2E2EA 4BT8A 4HORA 2XHEA 3BG1B 4AY5A 4I6GA 2C0MA 4CT0A 2VGXA 3PNTB 4CEMA 1HF8A 2KCLA 4CGVA 3B7UX 3CQCB 4JL0A 4BWRA 3EJNA 5AENA 1H19A 2WXKA 5HQ8A 2LAIA 2FEZA 3L08A 4N3AA 3U3WA 2VGYA 1HXIA 3FUMA 4A1GA 3FUEA 4TV3A 5G05C 4BSXA 3SNXA 2VTBB 3UX4A 2FF4A 2X6HA 1N52A 4DPRA 2YHCA 3AU5A 2L0TB 3PH0C 4WUYA 1IQUA 5HI7A 4L2YA 3KEZA 4Q96A 2MOWA 4AEZC 5ARFA 4Y6WA 5E75A 3FHEA 5G04J 2QY7A 1HZ4A 5FQ6A 3LEWA 3PUJA 4J0UA 5C1DA 1JPLA 3LPZA 2AXZA 3UQ3A 4XI0A 3G2UA 4O6FA 2RD0A 2GGFA 3MX3A 2V5FA 2CHWA 4U0ZA 4GYWA 2Y4TA 4L2LA 4RVBA 1FVHA 2KCKA 2LNIA 3CK9A 4GMLA 3GZ1A 4CT4A 3FTUA 4LRZA 3OXLA 3QARA 4IULA 4GA2A 4ANUA 5G55A 2PL2A 3IKOB 2AXUA 4DLQA 2Q7FA 4Y6CA 3FU5A 4JXTA 5LOZA 4PS8A 3QWVA 3RO3A 1SZ9A 3RRMB 4JA7A 4JHJA 1E8XA 4AVXA 1INZA 3PUKA 3D3MA 3QDNA 5CCLA 2BF0X 5FWQA 2LSUA 3D9KA 2KATA 2VSNA 3U9WA 3FTWA 3FUNA 2KZTA 5CHEE 1QQEA 3CK8A 4CDMA 1MHQA 5ANRA 2C0LA 4I2ZA 2YNQA 1HFAA 3WXXA 3AS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYS A;  3FWV A;  2UWJ G;  3GZ2 A;  2DBA A;  2IF4 A;  1ELR A;  2UY1 A;  4J8E A;  5FT9 A;  4YND A;  4AM9 A;  3CEQ A;  4G26 A;  2KCV A;  5JJ6 A;  1WM5 A;  4AY6 A;  1P5Q A;  1W3B A;  2VGX B;  3CV0 A;  4G24 A;  3QKY A;  2OOE A;  4YVO A;  5AYW D;  1A17 A;  4N2Q A;  4ABN A;  2BUG A;  4CDR A;  5DIZ A;  2QFC A;  4I9C A;  2FI7 A;  4UQY A;  3OXF A;  3VTY A;  5FTP A;  4J8D A;  4A1S A;  5CCM A;  2PQR A;  5KJM A;  3AS4 A;  3QWP A;  3E4B A;  4UI9 C;  3S7F A;  5KJL A;  4GA1 A;  2XPI A;  5FZS A;  4ME2 A;  4XI9 A;  3MEK A;  4U0S A;  3EDT B;  3UUX A;  3CVP A;  4N3C A;  1ZBP A;  2I6H A;  4RG6 A;  4XIF A;  1KT0 A;  3SZ7 A;  4BTA A;  4GCN A;  1WAO 1;  4WNE A;  4N3B A;  5A6C A;  2XEV A;  5KJK A;  5BW8 C;  3MKR A;  3LY9 A;  4GYO A;  1E96 B;  4WNF A;  2PZI A;  3KD7 A;  4WNG A;  3TG5 A;  3RU0 A;  3K9I A;  3ZGQ A;  4G25 A;  1QZ2 A;  4GCO A;  4N39 A;  4N5C A;  4RG9 A;  4UQX A;  5D0O D;  5FZQ A;  3ULQ A;  3RKV A;  4U04 A;  4KBQ A;  1PC2 A;  3CK7 A;  3GYZ A;  2XCB A;  3PE3 A;  4JA9 A;  4I2W A;  4LEU A;  4UI9 J;  2FBN A;  1XNF A;  2JLB A;  3RO2 A;  3ASG A;  2HYZ A;  3LCA A;  5DBK A;  3VTX A;  3MV3 B;  3ASH A;  3MV2 B;  1FCH A;  1IHG A;  5M72 A;  3CVQ A;  1B89 A;  3OXG A;  3TAX A;  3Q47 B;  5G05 J;  3Q15 A;  5ARG A;  4HOT A;  4G2V A;  3LYA A;  3PDN A;  2UY1 B;  4GPK A;  2E2E A;  4W9R A;  4BT8 A;  3FFL A;  4BT9 A;  4HOR A;  4IN3 B;  3S7J A;  3LY8 A;  1NZN A;  3ASD A;  3GW4 A;  3Q4A B;  3S7B A;  4AY5 A;  4WND A;  2GW1 A;  2C0M A;  3UPV A;  4B94 A;  2VGX A;  2PQN A;  4CGW A;  2KCL A;  4CGV A;  4HOU A;  3SF4 A;  5BNW A;  2XCC A;  4JL0 A;  4BWR A;  1TJC A;  1NA3 A;  3ZFW A;  3PE4 A;  3ZN3 A;  5HQ8 A;  1ELW A;  1KT1 A;  2FEZ A;  2J9Q A;  2OND A;  1NA0 A;  2VGY A;  1HXI A;  4NQ0 A;  4N3A A;  3U3W A;  3TGO A;  4U07 A;  5G05 C;  3LKU A;  4APO A;  2VSY A;  2FF4 A;  4GZ6 A;  2C2L A;  4GA0 A;  4G23 A;  2HR2 A;  2YHC A;  3KS2 A;  4WUY A;  5HI7 A;  5D0Q D;  3QWW A;  1YA0 A;  1Y8M A;  2XGM A;  4I17 A;  4HOQ A;  2VQ2 A;  3ZPJ A;  3Q49 B;  2R5S A;  4I9E A;  4U0U A;  2P58 C;  4I1A A;  4Y6W A;  5EX3 A;  5ARF A;  3ZHE B;  5JJ7 A;  5G04 J;  5EX0 A;  3LY7 A;  1HZ4 A;  4GZ5 A;  4KXK B;  2IFU A;  4J0U A;  5EKQ D;  2YQ8 A;  5C1D A;  2LSV A;  4H7Y A;  3LPZ A;  4KYO B;  3TG4 A;  3UQ3 A;  4XI0 A;  4GYY A;  3IEG A;  4AIF A;  2WQH A;  2AVP A;  3CKB A;  4O6F A;  5KJN A;  3NF1 A;  3Q5M A;  4G1T A;  4H7X A;  2V5F A;  3QOU A;  3CVN A;  5A7D B;  4U0Z A;  4GYW A;  2Y4T A;  4GZ3 A;  3URZ A;  4JHR A;  2KCK A;  2LNI A;  3CK9 A;  3ESK A;  3GZ1 A;  4J8F A;  3ZHE A;  4EQF A;  2WPV A;  3S7D A;  2L6J A;  3RIB A;  3OXL A;  4GA2 A;  3N71 A;  5G04 C;  2MHK A;  3U4T A;  3R9A B;  5LCW C;  2PL2 A;  5JJT A;  1HH8 A;  3AS8 A;  3HYM B;  5LCW J;  3ASF A;  2Y4U A;  2XGO A;  2Q7F A;  4Y6C A;  3CKC A;  3RO3 A;  3BEE A;  4N2S A;  3QWV A;  1ZU2 A;  2KC7 A;  4JA7 A;  2XGS A;  5FJY A;  3QDN A;  5CCL A;  4BTB A;  1KLX A;  2LSU A;  3MA5 A;  3O48 A;  4YVQ C;  2HO1 A;  2KAT A;  2VSN A;  2NC9 A;  4UI9 K;  1OUV A;  5BT1 A;  2FO7 A;  3KAE A;  1QQE A;  3CK8 A;  3CVL A;  5CHE E;  4HOS A;  1IYG A;  2VYI A;  2C0L A;  4I2Z A;  4UQZ A;  5FZR A;  4NRH B;  3RJV A;  3WXX A;  3FP3 A;  4F3V A;  3AS5 A; 
#chains in the Genus database with same CATH topology
 3HXD A;  4DRX E;  5FT9 A;  5AYW D;  5D66 A;  3G2T A;  1DVP A;  5DIZ A;  5AJL A;  4I9C A;  2FI7 A;  4J8D A;  1KZO A;  5KJM A;  2LAH A;  3WG7 E;  5AAO A;  3JXJ A;  1K3Z D;  4U0S A;  2GRL A;  2VGE A;  3DSW A;  3ZYQ A;  4I6E A;  4E85 A;  2IOS A;  3UMV A;  4XE0 A;  5FZQ A;  4CRW A;  3GYZ A;  1D8D A;  4EZJ A;  3R7Q A;  4GZD A;  2IJG X;  5AN8 A;  4KVM A;  1HS6 A;  3ZYK A;  3TAX A;  4M7C A;  4FHK A;  3T5X A;  2PM6 A;  4WWN A;  5D2M C;  3GW4 A;  1MJ0 A;  4CGW A;  2WXI A;  4YDO A;  3BUA A;  4JHK A;  2HR2 A;  3FUL A;  3X2Q E;  3ZHE B;  4D10 C;  5EX0 A;  2P2C P;  1O5M A;  4KYO B;  3DSV A;  3RRU A;  4G1T A;  1N0Q A;  2FO1 E;  5KBA A;  4GZ3 A;  1QBQ A;  4AV7 A;  1A5E A;  4PUC A;  3SY2 A;  3AS8 A;  3HYM B;  3L54 A;  4P29 A;  3CKC A;  3ESL A;  3UKR G;  5CRU A;  3FEY A;  2DVW A;  3JXI A;  4U8Y D;  4G8K A;  2BKK B;  3CVL A;  1N11 A;  1U3C A;  4HI8 A;  4U96 D;  4UQZ A;  3CR3 A;  3PEU B;  3P1U A;  5KNG A;  3ULY A;  1WM5 A;  5AJD A;  3Q9U C;  4TXQ A;  4GTT A;  1WDY A;  3VTY A;  5CCM A;  1OCR E;  2XEN A;  4GPM A;  3J5Q B;  1FVF A;  3IV0 A;  3EDT B;  3CVP A;  3NQP A;  3NAW A;  4LNB A;  3RU0 A;  3K9I A;  5ENS D;  3ZVV A;  4BEP A;  3APC A;  1OWP A;  4HLE A;  4G11 A;  3AG1 E;  3EU9 A;  3VTX A;  1EYH A;  5ENN A;  2DIW A;  3OTN A;  3G2V A;  1IHG A;  1TNY A;  2B6C A;  4FA6 A;  4JEH A;  2F0Y A;  2B0O E;  5IY5 E;  3S7J A;  1H2T C;  1E7V A;  3FUH A;  4JZY A;  4WND A;  4B94 A;  3TXN A;  1IKN D;  2CHX A;  4B89 A;  1S70 B;  3JQ1 A;  3TJP A;  1E8Y A;  2WMO A;  2X38 A;  3ZPJ A;  4I1A A;  1HE8 A;  4GZ5 A;  2YQ8 A;  2V4H C;  3W9F A;  2EIJ E;  3Q79 A;  2WXM A;  4F53 A;  1U3D A;  3LJ3 A;  3KSL A;  4JHR A;  1S64 A;  1ZB1 A;  4LNU D;  3B7T A;  5KWD A;  3DWL G;  4KVO A;  2PNN A;  4AXH A;  2NXP A;  1KLX A;  2CFU A;  1OUV A;  1N95 A;  5AIJ A;  3JUI A;  4A3V A;  2J09 A;  2XZT G;  4HS2 A;  5ENP D;  5FQ8 A;  4YVO A;  3MYV A;  4CDR A;  4JPS A;  3AG2 E;  1TNB A;  3HHM A;  5FZS A;  4ME2 A;  4RSY A;  4XIF A;  3U64 A;  4IRU A;  2LXM A;  3E34 A;  3UIN C;  5A6C A;  4B8A A;  2RFM A;  2RG8 A;  3FH5 A;  3CGH A;  1LTX A;  5C2Y A;  4WWO A;  5AQB A;  2HYZ A;  3FUF A;  2WM9 A;  3DSU A;  4DX6 D;  3CVQ A;  3OXG A;  1K1B A;  3L6A A;  4W9R A;  2LO6 A;  1NZN A;  2A5U A;  3EHR A;  2IQC A;  4ILI A;  4GMJ A;  2ETC A;  5BNW A;  2XCC A;  3FEX A;  3DBS A;  2J49 A;  3JCK C;  2R17 C;  4NQ0 A;  3FUD A;  4B0Z A;  4ZFH A;  2ZIR A;  4G23 A;  3T8M A;  4I9E A;  4U0U A;  5JJ7 A;  5EX3 A;  4ZHB A;  4GTM A;  4OAU C;  4C48 B;  4H7Y A;  5LFA A;  2WXG A;  3FTY A;  3ESK A;  4GTS A;  2L6B A;  2OVF A;  1N0R A;  1UN8 A;  1X5B A;  3SGH A;  2GRP B;  3O48 A;  3TWU A;  3SFZ A;  5ENO D;  5JJ6 A;  2X6F A;  3CV0 A;  2I2O A;  1OWL A;  3HXC A;  1Q2Z A;  4UQY A;  3AS4 A;  4U7E B;  1MX4 A;  1AP7 A;  3CHM A;  1U2V G;  4GTR A;  3UI2 A;  2QZA A;  4GYO A;  4GCO A;  4UQX A;  2NSZ A;  1PC2 A;  5A23 A;  3NBN B;  1HX8 A;  4DI3 A;  3SI5 A;  3CVW A;  5LP0 A;  3Q47 B;  3DPD A;  3CVX A;  5B3S E;  3LYA A;  4GPK A;  2UY1 B;  3BQO A;  2E2E A;  4BT8 A;  3ISM C;  2C0M A;  4OAV B;  4CGV A;  3CQC B;  4BWR A;  3AG3 E;  2LAI A;  2VGY A;  4HRN A;  4TV3 A;  3SQV A;  2VTB B;  1JCS A;  2FF4 A;  1N52 A;  3KEZ A;  4Q96 A;  2QY7 A;  5C1D A;  5ENR D;  1O1S A;  2RD0 A;  2V5F A;  4HNA D;  4LRZ A;  1DCE A;  2EIN E;  4IUL A;  2AXU A;  3UTM A;  5LOZ A;  1SZ9 A;  5CCL A;  1BI8 B;  5AQ9 A;  5EYL A;  3CK8 A;  1MHQ A;  3WXX A;  3EHN A;  3GZ2 A;  2DBA A;  3CVV A;  2E0I A;  4DX7 D;  1GW6 A;  2XPZ A;  1OWM A;  3G2W A;  4UI9 C;  2XPI A;  2I6H A;  4WNE A;  2QYJ A;  1HO8 A;  3CIA A;  3LY9 A;  4F1S A;  3ZGQ A;  2VTB A;  4HXI A;  1QZ2 A;  3IXE A;  3RRN B;  3DPY A;  1JWG A;  1UN9 A;  2QC9 A;  3CK7 A;  5BV0 A;  4F1P A;  4KT6 B;  2KZT B;  4U95 D;  1X81 A;  1D8E A;  2ETA A;  1OY3 D;  2P9I G;  4ACK A;  2J8S D;  1TJC A;  1XGW A;  1D9S A;  4U07 A;  3LKU A;  2VSY A;  3J5P A;  4QFV A;  3KS2 A;  4NIK A;  3QWW A;  4HOQ A;  3E32 A;  2IFU A;  5HRY A;  4HQD A;  3TWS A;  3PZ4 A;  3CKB A;  5EYP F;  1OT8 A;  2WVI A;  2P9S G;  2VSO E;  4BET A;  3KSQ A;  3TWQ A;  4XZ4 A;  4FLB A;  3UT7 A;  2Y4U A;  1Z3X A;  3UM0 A;  3HXB A;  2DZO A;  1Z3Y A;  3Q75 A;  4BFR A;  4LCT A;  3P2B A;  1SW6 A;  4K03 A;  4GZC A;  5AQ7 A;  1ELR A;  4Z68 A;  1JCR A;  3I5P A;  2A4Z A;  3IHV A;  5FTP A;  4PDX A;  3RK6 A;  2PQR A;  1EPU A;  3E4B A;  4XI9 A;  4G8L A;  4GAA A;  3FU6 A;  1WAO 1;  4ATZ D;  5LCW J;  4WNF A;  4WNG A;  2QYU A;  3MZL B;  4HI9 A;  2YHE A;  3FU3 A;  4JA9 A;  3HDX A;  5EIB E;  3FU0 A;  3ASH A;  3SBT B;  3Q7F A;  2EQX A;  4LUN U;  3AAA C;  5AAR A;  4UWL A;  4BT9 A;  4V3I A;  4AP2 A;  1RZ4 A;  5CMW A;  2OND A;  4APO A;  4FHJ A;  1OWN A;  3UT8 A;  5CMY A;  2P58 C;  2VJ8 A;  2WXQ A;  3SO8 A;  2L0I A;  4PS3 A;  4EQF A;  4J8Y A;  2AW6 A;  2X6I A;  3NZU A;  4UWF A;  3EIQ C;  2WXH A;  2OEW A;  4OVU A;  2HO1 A;  2FUL A;  2FO7 A;  3PZ2 A;  3RJV A;  5FZR A;  1MYO A;  2GRN B;  1E7U A;  5BPP A;  4IYP A;  4TUU A;  3GZS A;  1O1R A;  1ELK A;  5B1A E;  3SFX A;  3UT4 A;  3FH8 A;  3BU8 A;  1N4Q A;  2XEV A;  4G25 A;  2P9U G;  3LXU X;  4N39 A;  2AJA A;  2DCP A;  3RKV A;  4I2W A;  2BTD A;  3FUJ A;  1TEZ A;  3MV3 B;  5BUZ A;  3Q15 A;  1IQR A;  3FFL A;  1PY1 A;  3Q4A B;  3DEO A;  3ZFW A;  3KEA A;  3L82 A;  4PS7 A;  2WXN A;  2R03 A;  3UKU G;  1BI7 B;  2GRR B;  1Y8M A;  4L23 A;  3UPV A;  4ANW A;  2H6G A;  4GYY A;  1FPP A;  3QOU A;  4ACL A;  3V31 A;  1V54 E;  3C3R A;  3LDZ A;  2XEH A;  2R02 A;  4A63 B;  2H6H A;  1OCZ E;  4J7W A;  2KC7 A;  4A3T A;  3ZNG A;  1LD7 A;  4UUC A;  2WXL A;  3CVY A;  4YVQ C;  2ZU6 B;  3JUE A;  3R7R A;  2OV8 A;  4J8E A;  4BES A;  3CEQ A;  2VGX B;  4NUR A;  1A17 A;  3D9I A;  4ABN A;  2BUG A;  3QJZ A;  4A1S A;  1UJK A;  2AXV A;  4GA1 A;  1N4S A;  1TNZ A;  4GCN A;  3HXF A;  2JEK A;  5BW8 C;  4MRU A;  3EHM A;  4UI9 J;  2HE0 A;  1HU3 A;  2FBN A;  3IHY A;  4APF A;  1WY6 A;  2Y1L E;  4JC8 A;  2R59 A;  1IHB A;  2RKK A;  2H6I A;  4FU3 A;  4FC8 A;  4HOR A;  2XHE A;  3BG1 B;  4AY5 A;  4TXP A;  3EJN A;  2WXK A;  5HQ8 A;  2FEZ A;  1IXV A;  4A1G A;  4BSX A;  4YDE A;  4K5B A;  1IQU A;  1SA4 A;  4L2Y A;  2MOW A;  5E75 A;  3TWW A;  3FHE A;  3DST A;  5G04 J;  4J0U A;  3PUJ A;  1O1T A;  2AXZ A;  3G2U A;  3C72 A;  4U0Z A;  4L2L A;  1FVH A;  1K8K G;  3GZ1 A;  4K5C A;  2P9K G;  3ZXP A;  4ANU A;  4HLL A;  5G55 A;  4Y6C A;  2RFA A;  3QDN A;  2BF0 X;  2LSU A;  3D9K A;  3U9W A;  3FUN A;  3C5R A;  4GU5 A;  3D9N A;  4YND A;  3CSF A;  2GRQ B;  1W3B A;  4G24 A;  3ONL A;  3TXM A;  3OXF A;  5CRV A;  2XS1 A;  3CVU A;  4O60 A;  1HG2 A;  3LVQ E;  5EN5 D;  3B95 A;  1KT0 A;  5KJK A;  2I1J A;  3B7S A;  4RG9 A;  4N5C A;  4KZ0 A;  3I3N A;  2OCC E;  1K1A A;  3PEV B;  5BXU A;  3MV2 B;  2J4B A;  5T8I A;  5G05 J;  4HOT A;  1Y6I A;  2YNQ A;  5CEA A;  2F8X K;  3HRA A;  4I1O B;  1H2U A;  3B7R L;  4HOU A;  2KM4 A;  3SF4 A;  3NZS A;  3Q7A A;  2V0P A;  3PNL B;  3UIO C;  2ZGG A;  3UM1 A;  3C3O A;  3BG0 B;  3FTV A;  1H0A A;  4HFG A;  2R5S A;  4J8S A;  3G2S A;  3LY7 A;  5EKQ D;  3ZUV B;  1DCQ A;  2LUH A;  4GTV A;  4FJY A;  1N9A A;  3URZ A;  3HXE A;  1MQS A;  3E33 A;  3HVE A;  1N4P A;  1PAQ A;  4WAF A;  2ION A;  2ZIS A;  4N2S A;  1L5J A;  1FT1 A;  3ASO E;  2YIN A;  5BT1 A;  1IYG A;  3KAE A;  1YYH A;  2VSX E;  2IF4 A;  5B1B E;  3CLJ A;  2KBX A;  3PZD A;  4AY6 A;  1P5Q A;  4N2Q A;  2QFC A;  1N94 A;  4L7T A;  1YCS B;  3SHF A;  5CEC B;  3S7F A;  4XX5 A;  3SFY A;  1MZC A;  4LER A;  1JCQ A;  3FH7 A;  4FAD A;  2PZI A;  4F7A A;  2X6J A;  4KZC A;  5CED B;  2XCB A;  2EIL E;  3ASG A;  3LCA A;  4DJA A;  2WXJ A;  3RAU A;  1FCH A;  5EIL A;  3FTX A;  3L16 A;  3EUV A;  3LY8 A;  2CFZ A;  2WMN A;  1BD8 A;  4FP7 A;  1OCO E;  1NA3 A;  2X3M A;  3ZN3 A;  1NA0 A;  3L17 A;  1UJJ A;  1BPO A;  1SA5 A;  1YA0 A;  2Y3A A;  2LSV A;  4I6J A;  4LSZ E;  5FQ4 A;  3ZHE A;  2EIM E;  3S7D A;  2H6F A;  2DYS E;  3Q9N C;  4Q94 A;  4C9B B;  1TNU A;  4UI9 K;  2PM7 A;  3FY4 A;  3I4R B;  1EDU A;  5E76 A;  4TUM A;  3D9L A;  1SQM A;  4I1M A;  5JA4 D;  3CST A;  1AWC B;  4R7L A;  3UUX A;  1H6P A;  4A55 A;  3NB2 A;  5T4Y A;  4MLP A;  4ILG A;  2GRM A;  2KXP C;  4EBA G;  4DUI A;  1KZP A;  1NL4 A;  5ITZ F;  3SBS A;  1N4R A;  1MX2 A;  4C0M A;  3V79 K;  2AWI A;  3IBE A;  4XEI G;  3VLF A;  2CG3 A;  5G2N A;  2PQN A;  4WWP A;  3ZU7 B;  1UOH A;  3B13 A;  1ELW A;  1KT1 A;  4TXR A;  3Q73 A;  2C2L A;  4GA0 A;  4HRM B;  1OWO A;  2I1K A;  5D0Q D;  3QK0 A;  1SVX A;  2HM8 A;  4CDN A;  5FIO A;  2AVP A;  4J6I A;  3D9M A;  3CVN A;  3FTZ A;  1H2V C;  2WPV A;  2L6J A;  5EID A;  5AQA A;  4HBD A;  5G04 C;  3U66 A;  2A5E A;  4OVV A;  4JD2 G;  4AJW A;  5LCW C;  1HG5 A;  2XGO A;  3DEP A;  3ZRH A;  3BEE A;  3ML9 A;  3CHQ A;  4L1B A;  2DZN A;  1E8Z A;  2ILR A;  3TL5 A;  4GMR A;  3TWR A;  2VYI A;  5ENQ D;  4AM9 A;  4G26 A;  4FUL A;  5ANL A;  2XEE A;  2OOE A;  4HVB A;  4RLY A;  3HG0 D;  3QWP A;  2ZXW E;  3ZW3 A;  3CHR A;  5LX8 A;  2OEV A;  3ZYL A;  4YDW A;  1E96 B;  3HIZ A;  3EHQ A;  3D9J A;  4DK5 A;  5DBK A;  2WXF A;  3V2X A;  4UWH A;  4BSZ B;  1B89 A;  4G2V A;  3TWV A;  2V8S E;  4CT0 A;  2VGX A;  3NOC D;  3PNT B;  2KCL A;  3B7U X;  5AEN A;  3PZ1 A;  1G3N B;  1HXI A;  3FUM A;  5G05 C;  3UX4 A;  2P9N G;  2X6H A;  3AU5 A;  3PH0 C;  4WUY A;  5HI7 A;  4AEZ C;  3T8K A;  5FQ6 A;  3LEW A;  1JPL A;  3LPZ A;  4X8Q A;  4O6F A;  2GGF A;  3MX3 A;  2CHW A;  2ZGD A;  4GYW A;  4RVB A;  2KCK A;  5HS0 A;  2R2L A;  3OXL A;  3QAR A;  4GA2 A;  4GTO A;  2Q7F A;  4PS8 A;  4JA7 A;  4JHJ A;  4MBG A;  5CBN A;  2ETB A;  5CHE E;  4CDM A;  5ANR A;  4I2Z A;  3ZKJ A;  5KCM A;  3AS5 A;  4ANV A;  2KCV A;  3S2A A;  4EEC A;  1H6K A;  3ABK E;  5H7P A;  1V55 E;  4EZK A;  4Q69 A;  2WQ7 A;  3EU5 A;  4PH4 B;  3SZ7 A;  4BY6 A;  4C0E A;  3F6Q A;  3LS8 A;  4EZL A;  2IOL A;  3TG5 A;  2EIK E;  1DC2 A;  2OVB A;  4U63 A;  3AG4 E;  4JVS A;  3FTS A;  4JEU A;  5M72 A;  3SD5 A;  5JHB A;  4UWK A;  4U8H A;  1LF8 A;  4IN3 B;  3ASD A;  3QB2 A;  4AOF A;  2GW1 A;  1TNO A;  4FJZ A;  1BU9 A;  3ZYM A;  3MKQ A;  4KMO A;  3OAW A;  3CQG B;  3QNK A;  2WB2 A;  3RSE G;  3ZIM A;  3DXK G;  3CHS A;  4LNG A;  3CHO A;  3D9H A;  1E90 A;  2Y69 E;  2CHZ A;  2XGM A;  2WQ6 A;  1Z6T A;  1NP7 A;  1TR4 A;  4DLO A;  3Q78 A;  4BX8 A;  2LXL A;  3Q5M A;  4H7X A;  1YMP A;  5A7D B;  4ANX A;  1QYM A;  2Y0B G;  4HB5 A;  4J8F A;  2MYO A;  3ASN E;  3RIB A;  4EBA A;  3N71 A;  3U4T A;  4MS6 A;  3R9A B;  1MX6 A;  1JWF A;  1HH8 A;  3ASF A;  5FJY A;  2WXP A;  4BTB A;  3MA5 A;  3NOG D;  2XRY A;  4CZ2 D;  2WXO A;  3FP3 A;  3C3Q A;  3JYS A;  3B7B A;  4JW1 A;  4DX2 A;  2I9C A;  3EIJ A;  3AU4 A;  3TWX A;  1TN6 A;  5KNH D;  5CBO A;  4FLH A;  3FUK A;  4HRL A;  5KJL A;  4JB8 P;  3MKQ B;  3UM2 A;  3ONK A;  3MKR A;  4EPZ A;  1EF1 C;  3ULQ A;  2GRO B;  5D0O D;  4U04 A;  4KBQ A;  2V4L A;  4LEU A;  2J07 A;  2IU1 A;  3I4G A;  4I43 A;  4XKC A;  1XNF A;  3RO2 A;  1KPS B;  3ZEF A;  3PZ3 A;  1H6O A;  1TN8 A;  4U8V D;  5CER B;  3ML8 A;  1VDY A;  3L22 A;  3PDN A;  4RQI A;  3S7B A;  2BED A;  3ABL E;  5JMN D;  3CHP A;  4UWG A;  3VLD A;  3PVL A;  3PE4 A;  3APF A;  2J9Q A;  3R9M A;  3W9G A;  4GZ6 A;  3LJN A;  5T3R A;  3E30 A;  1QNF A;  4DX1 A;  4I17 A;  4XKB A;  2VQ2 A;  3Q49 B;  4ATG A;  4GTP A;  4KXK B;  3TG4 A;  4AIF A;  2WQH A;  1TJF A;  3PRZ A;  2R05 A;  5HKP A;  4O1P A;  3O4Z A;  3FUI A;  4L9P A;  5BV1 A;  3PS6 A;  3DRA A;  3ENE A;  5FQ7 A;  1E8W A;  1ZU2 A;  2XPY A;  5ENT D;  2XGS A;  1FT2 A;  2XS8 A;  2IY0 C;  3UM3 A;  4HOS A;  5J08 A;  4QQI A;  1OXJ A;  4F3V A;  2CG2 A;  4NAC A;  2UWJ G;  1TYQ G;  3V2O A;  4TRQ A;  3MJW A;  2L9B A;  2NYJ A;  4M3O A;  2F8Y A;  3DSX A;  2V5Q C;  4DX5 D;  1BLX B;  2XRZ A;  3MEK A;  3ZXS A;  1DNP A;  3L13 A;  4N3B A;  2M63 A;  2JAB A;  2J4D A;  3T5V A;  3PE3 A;  2IEJ A;  4K0R A;  2JLB A;  5EDS A;  2MRI A;  2J08 A;  1NI1 A;  3HVE B;  2P9L G;  3PRE A;  3L9T A;  5ARG A;  4E6H A;  3JQ0 A;  3TGO A;  4CCA A;  1N54 A;  3AJI A;  1LD8 A;  4ILH B;  4OYS A;  3IEG A;  5KJN A;  3NF1 A;  2WXR A;  1TN7 A;  4BER A;  3MCX A;  3TWT A;  2MHK A;  4F6R D;  5JJT A;  2IO2 C;  3DSS A;  2P9P G;  4MKT A;  5J90 A;  3VLE A;  3MGB A;  4GB9 A;  3APD A;  5FIN A;  1JUQ A;  2NC9 A;  2XQ0 A;  1S63 A;  3DXM G;  3QAQ A;  1Z5S C;  4NRH B;  3C98 A;  3ULE G;  3FWV A;  2UY1 A;  4B93 B;  3QKY A;  3D9O A;  3QC1 A;  3FDH A;  3LVR E;  2DWZ A;  1SZA A;  4K5A B;  3T9K A;  1WG0 A;  2X6K A;  2IO3 C;  1UW4 B;  4CYM D;  5JHA A;  4O1O A;  4RG6 A;  4N3C A;  1ZBP A;  4BTA A;  1NFI E;  3D9P A;  2F37 A;  4GTQ A;  3KD7 A;  1S0P A;  4B8C B;  4URK A;  4BX9 A;  4DI4 A;  5BXO A;  3UXG A;  4I6G A;  4CEM A;  1HF8 A;  4JL0 A;  1H19 A;  3V30 A;  4N3A A;  3L08 A;  4YDY A;  3U3W A;  3FUE A;  4N5Q A;  3SNX A;  4DPR A;  2DYR E;  2YHC A;  2L0T B;  3ABM E;  5ARF A;  4Y6W A;  1HZ4 A;  4LG6 A;  1RW2 A;  4EHM A;  1OCC E;  3UQ3 A;  4XI0 A;  2Y4T A;  2LNI A;  3CK9 A;  4GML A;  4CT4 A;  3FTU A;  2PL2 A;  3IKO B;  4DLQ A;  3FU5 A;  4JXT A;  3RO3 A;  3QWV A;  3RRM B;  2BKG A;  1E8X A;  4AVX A;  1INZ A;  3PUK A;  3D3M A;  3E37 A;  5FWQ A;  2KAT A;  2VSN A;  3FTW A;  2KZT A;  1QQE A;  2C0L A;  3UIP C;  1HFA A;  2XZD G;  1UG3 A; 
#chains in the Genus database with same CATH homology
 4GU5 A;  3EHN A;  3GZ2 A;  2DBA A;  3D9N A;  4ANV A;  5FT9 A;  4YND A;  3CSF A;  3CVV A;  2KCV A;  2E0I A;  1W3B A;  4G24 A;  5AYW D;  3ONL A;  3G2T A;  3S2A A;  4EEC A;  1GW6 A;  1DVP A;  1H6K A;  2XPZ A;  5AJL A;  1OWM A;  5DIZ A;  4I9C A;  2FI7 A;  3TXM A;  3OXF A;  4J8D A;  5KJM A;  2LAH A;  3G2W A;  3CVU A;  4EZK A;  4UI9 C;  1HG2 A;  3LVQ E;  2XPI A;  4Q69 A;  4U0S A;  2WQ7 A;  2GRL A;  2I6H A;  4PH4 B;  3SZ7 A;  1KT0 A;  4BY6 A;  4WNE A;  3ZYQ A;  4C0E A;  5KJK A;  2I1J A;  3B7S A;  1HO8 A;  3CIA A;  3LY9 A;  2IOS A;  3LS8 A;  2IOL A;  4I6E A;  3TG5 A;  3ZGQ A;  4E85 A;  4HXI A;  4EZL A;  2VTB A;  3UMV A;  1QZ2 A;  4N5C A;  4RG9 A;  4KZ0 A;  4XE0 A;  2OVB A;  5FZQ A;  3RRN B;  3I3N A;  4U63 A;  1JWG A;  1UN9 A;  5KCM A;  4JVS A;  4CRW A;  3CK7 A;  3GYZ A;  3FTS A;  3PEV B;  4EZJ A;  5BV0 A;  3R7Q A;  4GZD A;  4KT6 B;  2IJG X;  3MV2 B;  2KZT B;  4JEU A;  4KVM A;  5M72 A;  1HS6 A;  2J4B A;  3SD5 A;  5JHB A;  3ZYK A;  4UWK A;  3TAX A;  5T8I A;  5G05 J;  4HOT A;  1Y6I A;  4U8H A;  4FHK A;  1LF8 A;  4I1O B;  3T5X A;  2PM6 A;  1H2U A;  4IN3 B;  4WWN A;  3ASD A;  3GW4 A;  3QB2 A;  4AOF A;  2GW1 A;  3B7R L;  4CGW A;  4FJZ A;  4HOU A;  2KM4 A;  3SF4 A;  2WXI A;  4ACK A;  3NZS A;  3ZYM A;  1TJC A;  3MKQ A;  4KMO A;  1XGW A;  2V0P A;  4JHK A;  3OAW A;  3CQG B;  3PNL B;  4U07 A;  3QNK A;  2WB2 A;  3LKU A;  2VSY A;  4QFV A;  3ZIM A;  3CHS A;  2HR2 A;  3CHO A;  3FUL A;  3KS2 A;  1E90 A;  3BG0 B;  3QWW A;  2CHZ A;  2XGM A;  3FTV A;  4HOQ A;  1H0A A;  4HFG A;  2R5S A;  2WQ6 A;  3ZHE B;  1Z6T A;  1NP7 A;  4J8S A;  4D10 C;  5EX0 A;  3G2S A;  3LY7 A;  5EKQ D;  2IFU A;  4DLO A;  4KYO B;  4BX8 A;  3CKB A;  3RRU A;  4G1T A;  3Q5M A;  4H7X A;  5A7D B;  4FJY A;  2WVI A;  2VSO E;  4ANX A;  4GZ3 A;  3URZ A;  4XZ4 A;  4J8F A;  4FLB A;  1MQS A;  3UT7 A;  4AV7 A;  3HVE A;  3RIB A;  4EBA A;  1PAQ A;  3N71 A;  3U4T A;  4MS6 A;  3R9A B;  4WAF A;  1JWF A;  4PUC A;  1HH8 A;  3AS8 A;  3HYM B;  3ASF A;  2ION A;  3L54 A;  2Y4U A;  1Z3X A;  4P29 A;  3CKC A;  4N2S A;  1L5J A;  3ESL A;  3FEY A;  1Z3Y A;  5FJY A;  2WXP A;  2YIN A;  4BTB A;  4BFR A;  3MA5 A;  4LCT A;  2XRY A;  3P2B A;  5BT1 A;  1IYG A;  3KAE A;  3CVL A;  1U3C A;  4UQZ A;  3CR3 A;  3PEU B;  4K03 A;  3P1U A;  2WXO A;  3FP3 A;  4GZC A;  3JYS A;  2VSX E;  4JW1 A;  2I9C A;  1ELR A;  2IF4 A;  3EIJ A;  3CLJ A;  1WM5 A;  3PZD A;  5AJD A;  4AY6 A;  1P5Q A;  4N2Q A;  3AU4 A;  3I5P A;  2A4Z A;  2QFC A;  3IHV A;  5FTP A;  4PDX A;  4FLH A;  3VTY A;  3RK6 A;  2PQR A;  4L7T A;  5CCM A;  3FUK A;  1EPU A;  3SHF A;  1FVF A;  3E4B A;  3S7F A;  5KJL A;  4XI9 A;  4XX5 A;  3IV0 A;  3EDT B;  3CVP A;  3MKQ B;  4GAA A;  3NQP A;  3FU6 A;  1WAO 1;  3ONK A;  4LER A;  3MKR A;  4EPZ A;  3FH7 A;  4FAD A;  4WNF A;  5LCW J;  1EF1 C;  2PZI A;  4WNG A;  4F7A A;  3RU0 A;  3K9I A;  3ULQ A;  3MZL B;  5D0O D;  2X6J A;  4KZC A;  4U04 A;  4KBQ A;  2YHE A;  3APC A;  3ZVV A;  1OWP A;  4HLE A;  2V4L A;  3FU3 A;  2J07 A;  2IU1 A;  2XCB A;  3I4G A;  4G11 A;  4I43 A;  4JA9 A;  3HDX A;  1XNF A;  4LEU A;  4XKC A;  3RO2 A;  3ASG A;  1EYH A;  3FU0 A;  3LCA A;  3VTX A;  3ASH A;  3SBT B;  3ZEF A;  5ENN A;  4DJA A;  2DIW A;  2WXJ A;  3OTN A;  1FCH A;  3G2V A;  2EQX A;  4LUN U;  1IHG A;  4FA6 A;  4JEH A;  4UWL A;  3ML8 A;  1VDY A;  3FTX A;  3L22 A;  3L16 A;  3PDN A;  4BT9 A;  3S7J A;  3LY8 A;  3S7B A;  1H2T C;  4V3I A;  1E7V A;  3FUH A;  4JZY A;  4WND A;  2CFZ A;  4AP2 A;  2WMN A;  3TXN A;  3CHP A;  4UWG A;  4B94 A;  4FP7 A;  3VLD A;  3PVL A;  1NA3 A;  2X3M A;  3PE4 A;  3ZN3 A;  3APF A;  2J9Q A;  5CMW A;  2OND A;  1NA0 A;  4APO A;  2CHX A;  3L17 A;  1OWN A;  4FHJ A;  4GZ6 A;  5T3R A;  1UJJ A;  1BPO A;  4B89 A;  3JQ1 A;  3TJP A;  1E8Y A;  1QNF A;  1YA0 A;  2WMO A;  2X38 A;  4I17 A;  4XKB A;  3UT8 A;  2VQ2 A;  5CMY A;  3ZPJ A;  3Q49 B;  4ATG A;  2P58 C;  4I1A A;  1HE8 A;  4GZ5 A;  4KXK B;  2Y3A A;  2VJ8 A;  2YQ8 A;  2LSV A;  3TG4 A;  2WXQ A;  4AIF A;  2WQH A;  4I6J A;  2WXM A;  4F53 A;  2L0I A;  1U3D A;  3LJ3 A;  1TJF A;  3PRZ A;  4JHR A;  4PS3 A;  5FQ4 A;  3O4Z A;  4F1S A;  3FUI A;  3ZHE A;  4EQF A;  3S7D A;  5BV1 A;  2AW6 A;  3PS6 A;  2X6I A;  3NZU A;  4UWF A;  3EIQ C;  3ENE A;  3B7T A;  5FQ7 A;  1E8W A;  2WXH A;  4KVO A;  1ZU2 A;  2XPY A;  4Q94 A;  4AXH A;  2XGS A;  4OVU A;  2NXP A;  1KLX A;  2CFU A;  4C9B B;  2HO1 A;  4UI9 K;  1OUV A;  2FUL A;  2FO7 A;  2PM7 A;  4HOS A;  3FY4 A;  5AIJ A;  5J08 A;  3RJV A;  1UG3 A;  3JUI A;  3I4R B;  2J09 A;  5FZR A;  4A3V A;  4F3V A;  2CG2 A;  4NAC A;  2UWJ G;  1EDU A;  4HS2 A;  5E76 A;  4TRQ A;  3MJW A;  1E7U A;  3D9L A;  1SQM A;  4I1M A;  5FQ8 A;  4YVO A;  5BPP A;  3CST A;  3MYV A;  4IYP A;  2L9B A;  4CDR A;  4TUU A;  4JPS A;  3GZS A;  1ELK A;  4M3O A;  3HHM A;  3UT4 A;  3FH8 A;  4R7L A;  5FZS A;  4ME2 A;  2XRZ A;  3MEK A;  4RSY A;  3UUX A;  4XIF A;  3U64 A;  3ZXS A;  4IRU A;  1DNP A;  4A55 A;  3L13 A;  4N3B A;  5A6C A;  2XEV A;  2M63 A;  5T4Y A;  4B8A A;  4MLP A;  4ILG A;  2RG8 A;  4G25 A;  2GRM A;  3FH5 A;  3LXU X;  4N39 A;  4EBA G;  2DCP A;  3CGH A;  3RKV A;  2J4D A;  3T5V A;  4I2W A;  5C2Y A;  3PE3 A;  2BTD A;  4WWO A;  3FUJ A;  4K0R A;  2JLB A;  3SBS A;  2HYZ A;  5EDS A;  3FUF A;  1TEZ A;  3MV3 B;  2MRI A;  2J08 A;  2WM9 A;  4C0M A;  5BUZ A;  2AWI A;  3CVQ A;  3HVE B;  3IBE A;  3OXG A;  3PRE A;  3Q15 A;  5ARG A;  3VLF A;  1IQR A;  2CG3 A;  3L6A A;  4W9R A;  3FFL A;  2LO6 A;  5G2N A;  1PY1 A;  1NZN A;  3Q4A B;  2A5U A;  2IQC A;  2PQN A;  4GMJ A;  4ILI A;  4WWP A;  4E6H A;  5BNW A;  2XCC A;  3FEX A;  3DBS A;  2J49 A;  3B13 A;  3ZFW A;  3JCK C;  1ELW A;  2R17 C;  1KT1 A;  4NQ0 A;  4PS7 A;  2WXN A;  3JQ0 A;  3TGO A;  3FUD A;  4B0Z A;  2C2L A;  4GA0 A;  4G23 A;  1OWO A;  2I1K A;  5D0Q D;  3T8M A;  4CCA A;  1Y8M A;  4L23 A;  1N54 A;  3QK0 A;  4I9E A;  4U0U A;  5JJ7 A;  4ILH B;  5EX3 A;  3UPV A;  4ANW A;  2HM8 A;  4CDN A;  4OYS A;  4H7Y A;  5LFA A;  2WXG A;  4GYY A;  3FTY A;  3IEG A;  5KJN A;  2AVP A;  3NF1 A;  4J6I A;  3D9M A;  3QOU A;  3CVN A;  4ACL A;  2WXR A;  3FTZ A;  3ESK A;  1H2V C;  2WPV A;  3LDZ A;  3MCX A;  2L6J A;  5G04 C;  3U66 A;  2MHK A;  2OVF A;  4OVV A;  4AJW A;  5LCW C;  5JJT A;  1HG5 A;  2XGO A;  1UN8 A;  3ZRH A;  1X5B A;  3BEE A;  3ML9 A;  3CHQ A;  3SGH A;  2KC7 A;  4A3T A;  4L1B A;  2WXL A;  4MKT A;  5J90 A;  3CVY A;  3MGB A;  4GB9 A;  3VLE A;  4YVQ C;  3APD A;  3O48 A;  1E8Z A;  2ILR A;  3TL5 A;  1JUQ A;  2NC9 A;  2XQ0 A;  2ZU6 B;  3QAQ A;  2VYI A;  4NRH B;  3C98 A;  3R7R A;  2OV8 A;  3FWV A;  3SFZ A;  2UY1 A;  4J8E A;  4AM9 A;  3CEQ A;  4G26 A;  4FUL A;  5JJ6 A;  5ANL A;  2X6F A;  2VGX B;  2I2O A;  3CV0 A;  3QKY A;  1OWL A;  2OOE A;  3D9O A;  1A17 A;  3D9I A;  3QC1 A;  4NUR A;  2BUG A;  4ABN A;  4HVB A;  3FDH A;  3QJZ A;  3LVR E;  4UQY A;  1SZA A;  4A1S A;  1UJK A;  3AS4 A;  3QWP A;  2AXV A;  2X6K A;  3CHM A;  4GA1 A;  1UW4 B;  5JHA A;  3ZW3 A;  4RG6 A;  4N3C A;  1ZBP A;  3CHR A;  4BTA A;  5LX8 A;  4GCN A;  3ZYL A;  3D9P A;  2JEK A;  5BW8 C;  4GYO A;  1E96 B;  3KD7 A;  1S0P A;  3HIZ A;  4GCO A;  4MRU A;  3EHM A;  4UQX A;  4B8C B;  2NSZ A;  3D9J A;  4URK A;  1PC2 A;  4UI9 J;  5A23 A;  1HU3 A;  2FBN A;  1HX8 A;  3IHY A;  4BX9 A;  4DK5 A;  5DBK A;  4DI3 A;  3SI5 A;  4APF A;  2WXF A;  3CVW A;  4DI4 A;  1WY6 A;  5LP0 A;  4UWH A;  1B89 A;  4JC8 A;  2R59 A;  3Q47 B;  3DPD A;  3CVX A;  4FU3 A;  4G2V A;  3LYA A;  4FC8 A;  2UY1 B;  2V8S E;  4GPK A;  2E2E A;  4BT8 A;  4HOR A;  2XHE A;  3BG1 B;  4AY5 A;  4I6G A;  2C0M A;  4CT0 A;  2VGX A;  3PNT B;  4CEM A;  1HF8 A;  2KCL A;  4CGV A;  3B7U X;  3CQC B;  4JL0 A;  4BWR A;  3EJN A;  5AEN A;  1H19 A;  2WXK A;  5HQ8 A;  2LAI A;  2FEZ A;  3L08 A;  4N3A A;  3U3W A;  2VGY A;  1HXI A;  3FUM A;  4A1G A;  3FUE A;  4TV3 A;  5G05 C;  4BSX A;  3SNX A;  2VTB B;  3UX4 A;  2FF4 A;  2X6H A;  1N52 A;  4DPR A;  2YHC A;  3AU5 A;  2L0T B;  3PH0 C;  4WUY A;  1IQU A;  5HI7 A;  4L2Y A;  3KEZ A;  4Q96 A;  2MOW A;  4AEZ C;  5ARF A;  4Y6W A;  5E75 A;  3FHE A;  5G04 J;  2QY7 A;  1HZ4 A;  5FQ6 A;  3LEW A;  3PUJ A;  4J0U A;  5C1D A;  1JPL A;  3LPZ A;  2AXZ A;  3UQ3 A;  4XI0 A;  3G2U A;  4O6F A;  2RD0 A;  2GGF A;  3MX3 A;  2V5F A;  2CHW A;  4U0Z A;  4GYW A;  2Y4T A;  4L2L A;  4RVB A;  1FVH A;  2KCK A;  2LNI A;  3CK9 A;  4GML A;  3GZ1 A;  4CT4 A;  3FTU A;  4LRZ A;  3OXL A;  3QAR A;  4IUL A;  4GA2 A;  4ANU A;  5G55 A;  2PL2 A;  3IKO B;  2AXU A;  4DLQ A;  2Q7F A;  4Y6C A;  3FU5 A;  4JXT A;  5LOZ A;  4PS8 A;  3QWV A;  3RO3 A;  1SZ9 A;  3RRM B;  4JA7 A;  4JHJ A;  1E8X A;  4AVX A;  1INZ A;  3PUK A;  3D3M A;  3QDN A;  5CCL A;  2BF0 X;  5FWQ A;  2LSU A;  3D9K A;  2KAT A;  2VSN A;  3U9W A;  3FTW A;  3FUN A;  2KZT A;  5CHE E;  1QQE A;  3CK8 A;  4CDM A;  1MHQ A;  5ANR A;  2C0L A;  4I2Z A;  2YNQ A;  1HFA A;  3WXX A;  3AS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...