4NRHB

Copn-scc3 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
170
structure length
170
Chain Sequence
MSHLNYLLEKIAASSKEDFPFPDDLESYLEGYVPDKNIALDTYQKIFKISSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CopN
publication title A gatekeeper chaperone complex directs translocator secretion during type three secretion.
pubmed doi rcsb
source organism Chlamydia pneumoniae
molecule tags Chaperone/protein binding
total genus 60
structure length 170
sequence length 170
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4nrhB00
4B94A 5ARFA 5LCWJ 3VTXA 4LEUA 4GPKA 3Q5MA 4Y6WA 4I9CA 4ME2A 3KS2A 5FT9A 4HOTA 4HOUA 4ABNA 4XI0A 3EDTB 5D0OD 3ASHA 4N3CA 2UWJG 3LY8A 5C1DA 3RKVA 4U04A 3ZHEB 2XGOA 3RU0A 3CKBA 4U0SA 2VQ2A 4KBQA 3PDNA 5G05J 3S7BA 1ELWA 3S7JA 1A17A 2KCLA 1E96B 4G25A 4XI9A 3KD7A 4UI9J 4WNFA 4N2QA 3TGOA 1QQEA 3FFLA 3VTYA 2JLBA 2IFUA 2VYIA 2C0LA 3JYSA 4UQYA 2OOEA 5G04C 4BWRA 3RIBA 4BT8A 3CEQA 4NQ0A 3S7DA 1HXIA 4I2WA 2VGXA 2LNIA 3OXGA 3CVQA 4J0UA 3ULQA 1WM5A 2KC7A 4UQXA 1ZBPA 3LCAA 4WUYA 3ZFWA 1OUVA 2C0MA 4N2SA 3RJVA 3URZA 4JL0A 2Y4TA 3NF1A 4N39A 2UY1A 3FWVA 2P58C 2I6HA 4GZ5A 3ZGQA 4H7YA 1PC2A 4Y6CA 1HZ4A 4JA9A 2PZIA 3GZ2A 3GW4A 3MKRA 3TG4A 4EQFA 2VSNA 4GCOA 3IEGA 5CHEE 5G04J 5BT1A 1YA0A 3O48A 1FCHA 4GA1A 3TAXA 3MV2B 2FF4A 1WAO1 5M72A 2ONDA 5JJ6A 2MHKA 3ESKA 4G1TA 3QWVA 2WPVA 2LSVA 3K9IA 2GW1A 2VSYA 5KJKA 4HOQA 2DBAA 4AM9A 3Q15A 3Q4AB 1P5QA 3U4TA 4I2ZA 5D0QD 1ZU2A 3FP3A 2XCCA 2HR2A 3UPVA 4UQZA 4CGVA 1NZNA 4I17A 2XCBA 2HYZA 3CVLA 3KAEA 3BEEA 5FZSA 2FI7A 3QOUA 1KT0A 5KJMA 2NC9A 2BUGA 4O6FA 3CVPA 4YVOA 2R5SA 4I1AA 3R9AB 1XNFA 3CK8A 4AY6A 2KCKA 3LY7A 4G26A 4U07A 1TJCA 4YNDA 4GYWA 2LSUA 3CV0A 3ZHEA 4AIFA 1W3BA 3ASGA 3RO3A 4N3BA 3CK7A 2XGMA 4BTBA 4WNEA 3LKUA 3UUXA 1Y8MA 3MV3B 2FO7A 3UQ3A 5DIZA 3AS8A 3SZ7A 3QDNA 4GZ6A 2E2EA 5FZQA 5HQ8A 5G05C 4J8FA 2PQNA 4IN3B 3RO2A 1KT1A 3PE4A 3QKYA 2AVPA 2Y4UA 3E4BA 3AS4A 1QZ2A 4WNGA 3TG5A 4G2VA 2YQ8A 4GA2A 4G24A 3SF4A 5CCMA 4BTAA 3LY9A 2FBNA 4UI9K 4J8EA 5DBKA 4J8DA 4XIFA 3Q49B 2IF4A 3AS5A 5KJLA 5FZRA 2XPIA 3N71A 2VGXB 1B89A 4CDRA 2J9QA 4RG9A 2FEZA 5ARGA 3ZN3A 3ZPJA 3GYZA 2KCVA 3LPZA 3OXLA 4KYOB 1KLXA 4GA0A 1ELRA 3U3WA 3ASFA 4GYOA 4BT9A 2UY1B 2PL2A 3QWPA 5BW8C 4KXKB 2KATA 5JJ7A 4CGWA 4YVQC 4U0ZA 2VGYA 5A7DB 2WQHA 5EKQD 3WXXA 4JHRA 5LCWC 2QFCA 2XEVA 3OXFA 2XGSA 4GYYA 5EX3A 1IHGA 5CCLA 1NA0A 1HH8A 5EX0A 4JA7A 5AYWD 5KJNA 3LYAA 4I9EA 4HORA 4WNDA 1IYGA 4H7XA 3ASDA 4N3AA 4GZ3A 3MEKA 4GCNA 2HO1A 5JJTA 3MA5A 3Q47B 5A6CA 3PE3A 4W9RA 2PQRA 3S7FA 4UI9C 3HYMB 4AY5A 4RG6A 4F3VA 3GZ1A 2L6JA 3QWWA 4N5CA 5HI7A 3CVNA 5FJYA 4A1SA 4HOSA 2V5FA 3CKCA 4APOA 2C2LA 2Q7FA 4G23A 4NRHB 1NA3A 5BNWA 3CK9A 2YHCA 4U0UA 5FTPA
chains in the Genus database with same CATH superfamily
5ARFA 4GMJA 5LCWJ 2XRZA 4PS8A 5KBAA 4TXRA 2OVFA 4BX8A 5FT9A 3QJZA 1E7VA 3ZRHA 3APFA 3ULYA 5D0OD 2OEVA 3PREA 2UWJG 5AIJA 3RKVA 5JMND 1N9AA 3ESLA 3CKBA 3LVRE 5D2MC 2VQ2A 1UN8A 3LJ3A 3ZXSA 1OWOA 5G05J 3S7BA 3DBSA 2KCLA 4GU5A 2XZDG 1D8DA 3SBTB 4HRNA 2IOLA 4ANVA 1MQSA 1BPOA 4DX6D 4KT6B 3CSTA 4O60A 1ZB1A 2ZXWE 3FTXA 4O1PA 3HXFA 4NQ0A 1LD8A 2X3MA 2Y1LE 3UIPC 1YCSB 5HKPA 3CVQA 2RD0A 4J7WA 2XHEA 5CEDB 4YDOA 1H2UA 4UQXA 3LCAA 1HU3A 5KNGA 3ZFWA 4ANWA 1OUVA 2YNQA 3PRZA 3APDA 4B89A 1V55E 4I1MA 3CSFA 4DX1A 1WG0A 2VTBB 1DCQA 4C48B 2CG3A 2H6IA 3FWVA 4KZCA 4GMLA 2WXKA 1OCOE 2I6HA 2IU1A 1HZ4A 1MYOA 3HXEA 3CHPA 3KEZA 2BTDA 1DVPA 3DXKG 1TNBA 2IONA 3MKRA 3TG4A 3NBNB 2XEEA 2VSNA 3R9MA 2RKKA 3SY2A 4OAVB 2XS8A 1TNUA 1IQUA 3EHNA 3TAXA 2ZIRA 4ACKA 4HS2A 3L9TA 1N11A 4FP7A 3FUEA 3B7TA 2J8SD 2X6IA 1EYHA 1OWPA 3K9IA 5ANLA 1DCEA 2GW1A 3ZYLA 3IV0A 5KJKA 5ENRD 4F6RD 4V3IA 5CERB 2I2OA 1AP7A 3FU0A 4BSXA 3ZEFA 1QYMA 3Q4AB 4I2ZA 1JUQA 1PAQA 3CHRA 5T8IA 2XCCA 3UINC 2A4ZA 4B8AA 4CGVA 5E76A 1IKND 1LTXA 3CVLA 3PVLA 3KAEA 2VJ8A 2X6FA 2WXPA 4GB9A 3BEEA 5G2NA 2R59A 4ILGA 2AXZA 3FY4A 3ZUVB 2AJAA 2NC9A 2GRLA 3TWVA 1JWFA 5J90A 2KCKA 3LY7A 2A5EA 4G26A 1O1RA 3D3MA 5JHBA 2X38A 4AIFA 1HG2A 2M63A 3FTZA 1E8WA 4N3BA 4FU3A 4BTBA 2DZOA 4GTVA 2F8XK 1HO8A 3UT7A 2HE0A 3MV3B 5CEAA 2I1JA 4FHKA 3FUHA 5FZQA 2WXJA 4UWLA 2EQXA 4EHMA 1UW4B 5AJLA 1O1TA 2F37A 2DYSE 2KM4A 3MJWA 2AXVA 1U3DA 1OT8A 3SFYA 3J5QB 3HXCA 3PE4A 2WQ7A 4HVBA 2J08A 4G2VA 3L82A 1UJJA 3IBEA 4U7EB 2YQ8A 4GA2A 3SD5A 3SF4A 3FUMA 4XKBA 3UM2A 4YDEA 3L13A 3PZ2A 3ZXPA 4J8EA 3AS5A 4Q96A 5FZRA 3TWRA 4U8VD 2P9SG 4CDRA 2J9QA 3AU4A 2FEZA 3HXDA 3ZYMA 4DK5A 3ZN3A 3ZPJA 3OXLA 4A55A 1KLXA 2R17C 5AQAA 3IKOB 3D9JA 1TYQG 1ELRA 5CMWA 2CHXA 1EF1C 4AP2A 4BT9A 4BETA 2PL2A 5D66A 1HS6A 3MGBA 2KATA 1OWMA 5JJ7A 1UN9A 1X5BA 2V8SE 2VGYA 3FTSA 3E34A 3UT8A 2FO1E 5A7DB 2WMNA 2WQHA 5EKQD 1L5JA 1TN6A 4OVUA 1N95A 4FC8A 2XEVA 4AXHA 4KMOA 4CEMA 4U95D 2WM9A 5EX0A 3LEWA 3NB2A 3QNKA 5AYWD 4XKCA 5KJNA 3DSUA 2BKGA 3ASDA 4ANXA 1N4PA 1HE8A 4GCNA 2HO1A 3UMVA 2GRPB 3DEOA 1KZOA 2F0YA 4DX5D 3D9OA 3CVUA 5AN8A 1O5MA 4C0EA 4N5CA 4U63A 3CR3A 3CVNA 5HI7A 2RFAA 5FJYA 4G8KA 5BXUA 3G2TA 4HOSA 3AJIA 3P1UA 4K5BA 5B3SE 3ENEA 4HRLA 2Q7FA 2A5UA 4G23A 1S63A 4MKTA 4OVVA 4K0RA 2ZGDA 1QZ2A 4B94A 4U8YD 2E0IA 3R7RA 1MZCA 1JCQA 2OV8A 1SA4A 1LD7A 4HOUA 4XI0A 4NURA 3EDTB 3FDHA 2WVIA 4U04A 4BX9A 3SNXA 3RU0A 2PM7A 3HXBA 3E32A 2RFMA 4TRQA 3PDNA 5EDSA 2ZGGA 1LF8A 4G25A 2LAHA 2XPYA 4APFA 3KD7A 3C98A 3VTYA 3MCXA 4IYPA 2IFUA 4AOFA 2OOEA 1EPUA 3RIBA 4BT8A 4KVOA 3JXIA 4I1OB 3S7DA 5B1BE 1FVHA 1INZA 1TN8A 5EILA 2GRRB 4O1OA 2XS1A 3HG0D 3URZA 2WXGA 3SGHA 3C3RA 1SW6A 4MRUA 4YDWA 3RSEG 3JXJA 4Q94A 3NZUA 3AG1E 3MKQA 2QY7A 4MS6A 4GZ5A 4K5CA 3E30A 1TR4A 4Y6CA 1N52A 1EDUA 4QFVA 2XPZA 4JW1A 4OAUC 1GW6A 4GCOA 1QNFA 4JHKA 5ENNA 3IEGA 5FQ4A 1WY6A 2L9BA 5BT1A 3QAQA 2R2LA 4HLLA 3SHFA 1X81A 3GZSA 4EZLA 4BEPA 2JEKA 4A63B 5M72A 3FULA 2R05A 2QZAA 3ZW3A 2QC9A 3ABKE 4L2YA 2ETBA 3FH5A 5CRVA 4WWPA 4DPRA 4EBAA 3SFXA 2DYRE 4HOQA 2DBAA 3B95A 3UT4A 3Q15A 2XEHA 4PUCA 4E6HA 3APCA 3FP3A 3I4GA 2HR2A 1IXVA 4UQZA 3B7UX 4NACA 1NP7A 3V31A 3AG4E 4I17A 1MJ0A 3TWSA 3TJPA 2DVWA 2WXQA 3FU5A 5FZSA 5LX8A 4GTRA 3CHOA 4GZDA 4NIKA 3FU6A 4DLOA 3DXMG 4FLHA 3T9KA 1JPLA 2VGEA 2R5SA 4I1AA 4RLYA 4AY6A 4U07A 4YNDA 4JHJA 4M3OA 3HVEA 4UWKA 1UG3A 3RO3A 3DRAA 4XX5A 2P9PG 5DIZA 4BFRA 2ETCA 2Y3AA 3QDNA 3D9MA 4L7TA 1HG5A 5HQ8A 1G3NB 4ANUA 5G05C 4IN3B 1N4QA 2RG8A 1KT1A 5EYPF 4WWNA 3UI2A 1S0PA 1D8EA 2AWIA 4WNGA 4FA6A 1FT2A 3DSWA 3CHMA 1HF8A 4G11A 5CCMA 4FHJA 3LY9A 3KSLA 4CT0A 4GMRA 4LSZE 3FU3A 4XIFA 3NAWA 2XPIA 3EHMA 4B8CB 1NL4A 4DX2A 3DSSA 1TEZA 4RG9A 5ARGA 1N54A 4PS7A 4JD2G 2EINE 3L22A 1XGWA 5JHAA 3VLDA 4GYOA 4ILIA 3Q9UC 5KWDA 1OCRE 3CVWA 5HS0A 4HI8A 3QWPA 4B93B 3JUIA 4LRZA 4KXKB 3MKQB 1Q2ZA 4QQIA 3SQVA 4CGWA 4YVQC 4U0ZA 1TN7A 1HX8A 3RRNB 2NSZA 2GGFA 3D9IA 5ENQD 3JCKC 4AVXA 1MX4A 2IY0C 2XGSA 4GYYA 5EX3A 3FUKA 1IHGA 1TNZA 3JQ0A 4G8LA 4GTOA 4L9PA 4JA7A 4I9EA 3ZYKA 4F53A 4H7XA 2V4HC 3MEKA 4J8SA 2CG2A 2DZNA 3UIOC 3Q47B 3TWXA 3PE3A 1KPSB 3ULEG 3MZLB 5A23A 2PQRA 2X6KA 4UI9C 3HYMB 2KBXA 3F6QA 4AY5A 4F3VA 5CBNA 3PUKA 2CFZA 2V5FA 2C2LA 1MHQA 4FADA 3RAUA 1HFAA 1RW2A 3CK9A 2YHCA 5BXOA 1OWLA 5FTPA 3VTXA 4LEUA 2WXHA 4Q69A 4I9CA 5T4YA 2J07A 2P9IG 3KS2A 1BI7B 2CHWA 3B7BA 3SFZA 5KNHD 4ABNA 3Q79A 3TWWA 1K3ZD 3PZDA 1N4RA 3BUAA 4JXTA 2X6HA 3AAAC 1IQRA 2OVBA 3HVEB 2XGOA 2WQ6A 5AQ7A 3G2SA 5J08A 4K5AB 2WB2A 1TNYA 4EECA 3HRAA 3DSXA 1ELWA 3HDXA 1A17A 1E96B 4PDXA 4XI9A 3CVYA 4WNFA 3ASOE 1QQEA 3D9NA 1AWCB 3TL5A 1OWNA 3EHQA 5C2YA 3Q73A 2VYIA 4DI3A 2C0LA 4LNUD 3ZYQA 3IHVA 4HRMB 4UQYA 5G04C 4MLPA 4Z68A 1E90A 3IXEA 3O4ZA 1HXIA 4IULA 2VGXA 3D9LA 3BG1B 4J0UA 3ULQA 4RVBA 3T8KA 2KC7A 1ZBPA 1E8XA 3PNLB 3C72A 2C0MA 1OCCE 3RJVA 1H19A 1JCSA 4JL0A 4N39A 2UY1A 3FUIA 3C5RA 4I6EA 1N0QA 5FQ6A 4JZYA 3ZGQA 4H7YA 1PC2A 1K1AA 4EZKA 4DRXE 2OCCE 2EILE 5EIDA 3CGHA 3Q7FA 3BU8A 3I5PA 1YA0A 2WXIA 3O48A 5BPPA 3FEXA 2IQCA 4LERA 2FF4A 1WAO1 4GAAA 3FH7A 5ENPD 2CHZA 2WMOA 4GZCA 5KCMA 3FH8A 3Q9NC 2AXUA 2MHKA 5BUZA 4G1TA 5EN5D 2GRMA 3QWVA 1SVXA 2X6JA 4JVSA 2P9KG 4HI9A 2WXMA 3V2XA 2VTBA 1K8KG 1P5QA 2PNNA 1ZU2A 3C3QA 2L0IA 3QC1A 4FJZA 4JC8A 4DI4A 2Y69E 2L0TB 1TNOA 1NZNA 2NXPA 4I43A 2J4BA 3CVVA 5LFAA 2P2CP 5ANRA 4WWOA 3FUFA 2FI7A 1A5EA 1KT0A 5ITZF 4DUIA 2I1KA 3DPYA 2MRIA 1Z3XA 2IJGX 3CVPA 4BESA 2V4LA 1JCRA 2KXPC 4ZFHA 3Q78A 4B0ZA 3R9AB 1XNFA 3V30A 3CK8A 1TJCA 1SZAA 4LUNU 4GYWA 2LSUA 3ZHEA 4D10C 4K03A 4GTMA 3B7SA 3UUXA 2FO7A 5LP0A 3UQ3A 3AS8A 4BSZB 1O1SA 3UM3A 2LXLA 4PH4B 3V79K 3LVQE 3FTWA 1K1BA 3NZSA 4HBDA 2E2EA 3LJNA 2IO3C 4J8FA 3CQCB 2XRYA 2MOWA 3EU5A 3RO2A 4C9BB 3EUVA 2WXRA 5CRUA 2B6CA 3E4BA 3EHRA 3AS4A 1WDYA 3MX3A 3TG5A 4G24A 3TWQA 3DSVA 3PS6A 2WXLA 3ASNE 5FIOA 1UJKA 3HHMA 3CHSA 4CDMA 2L6BA 5DBKA 4J8DA 2GROB 3L6AA 1OXJA 2VGXB 2BF0X 1SZ9A 3L17A 1RZ4A 4L23A 3ZU7B 4F1PA 4EZJA 3LPZA 4KYOB 2LUHA 2ZU6B 5BV0A 4HQDA 4TXQA 1U3CA 4GA0A 3FUNA 3U3WA 3T5XA 3BG0B 1D9SA 1UOHA 2QYUA 3PEVB 1DC2A 1H6KA 2UY1B 1H6PA 3ISMC 3PZ3A 5CMYA 1ELKA 4ATZD 3X2QE 4E85A 5BV1A 5BW8C 4JEUA 3LXUX 3ONKA 2WXOA 3E33A 3UXGA 3UX4A 3VLFA 4PS3A 3L08A 2DCPA 2NYJA 4U96D 3WXXA 4JHRA 5LCWC 1NI1A 2P9UG 3OXFA 3D9PA 3U9WA 3J5PA 1PY1A 4DX7D 4RQIA 1NA0A 3FTUA 4UWHA 2H6FA 3ZKJA 4HORA 4GTTA 1IYGA 3TXNA 4N3AA 2V0PA 4GZ3A 3V2OA 3OTNA 2IO2C 4HLEA 3I3NA 2J09A 5HRYA 5A6CA 3ABLE 5ENOD 1OCZE 3B13A 2ILRA 3S7FA 4F1SA 1S64A 3FTYA 4RG6A 2BEDA 4UWGA 4F7AA 4FLBA 3UKUG 3CQGB 5ENTD 3ONLA 4A1SA 3CKCA 4APOA 4LNGA 4NRHB 1YYHA 1BLXB 5FQ7A 1SA5A 5BNWA 3U64A 2BKKB 4XZ4A 4ACLA 4GTQA 5AJDA 2LXMA 4GPKA 3Q5MA 3WG7E 5T3RA 3NOGD 4Y6WA 4ME2A 2OEWA 5ENSD 1E7UA 4HOTA 4DLQA 2EIJE 2B0OE 2EIKE 2JABA 4A3TA 2QYJA 3UM0A 3PEUB 5JA4D 4XEIG 3ASHA 4N3CA 3LY8A 4MBGA 5C1DA 4J8YA 3ZHEB 1TJFA 4U0SA 4KVMA 4KBQA 2J4DA 3AG2E 3W9GA 1VDYA 3S7JA 1DNPA 5FWQA 3G2UA 4UI9J 5AENA 2IEJA 4N2QA 3TGOA 3CIAA 4RSYA 3FFLA 1KZPA 2EIME 2JLBA 4BERA 4GTSA 2P9LG 2VSOE 2J49A 3JYSA 4AV7A 2CFUA 4OYSA 4BWRA 4DJAA 2WXFA 4CDNA 4ATGA 4LCTA 2IOSA 3CEQA 3T8MA 1H6OA 2XZTG 4R7LA 4L1BA 4I2WA 3ZVVA 2LNIA 1E8ZA 1N4SA 3OXGA 1WM5A 2R03A 1FPPA 4WUYA 3B7RL 4N2SA 1NFIE 2Y0BG 5AQBA 4AEZC 5CECB 4EPZA 4CYMD 3LS8A 2Y4TA 4CZ2D 3NF1A 5IY5E 4I6JA 1FVFA 3P2BA 3W9FA 2H6HA 1V54E 3DWLG 1U2VG 2P58C 2H6GA 5H7PA 4TXPA 1Z3YA 4URKA 3KEAA 4JA9A 4ILHB 2PZIA 3GZ2A 3GW4A 2KZTA 3FTVA 4HB5A 3RRUA 3ZIMA 4EQFA 3DSTA 3G2VA 5CHEE 5G04J 3AG3E 1FCHA 3EIJA 5FQ8A 2GRNB 4GA1A 2ZISA 3MV2B 2ONDA 3EIQC 5JJ6A 5EYLA 3ESKA 4GPMA 2WPVA 2LSVA 3BQOA 2VSYA 2MYOA 4TUUA 4IRUA 4AM9A 4TUMA 4JB8P 3I4RB 2V5QC 3UKRG 4XE0A 3U4TA 3ABME 1H2VC 3JQ1A 5D0QD 3TXMA 3E37A 4CT4A 4FULA 3UPVA 4HNAD 2DIWA 4CCAA 2XCBA 2HYZA 1N0RA 3VLEA 4JEHA 1N94A 4UUCA 5CBOA 3D9KA 1Z5SC 4CRWA 1FT1A 3QOUA 2YINA 3HIZA 5KJMA 2BUGA 4O6FA 5FINA 3DPDA 3SI5A 4YVOA 3QB2A 4FJYA 4I6GA 3S2AA 4U8HA 3CV0A 1Y6IA 3U66A 1W3BA 3EJNA 3PUJA 3ASGA 4C0MA 1MX2A 3UM1A 1H2TC 3L54A 5EIBE 3CK7A 2XGMA 4KZ0A 4WNEA 5G55A 2ETAA 2GRQB 3LKUA 3SBSA 1JWGA 3QARA 3TWTA 2R02A 1Y8MA 4EBAG 3AU5A 3T5VA 3ML8A 3SZ7A 2PM6A 4WAFA 4GZ6A 3Q7AA 3OAWA 3JUEA 2PQNA 5E75A 1S70B 3PZ4A 4TV3A 2HM8A 1BU9A 2XQ0A 3EU9A 5B1AE 3QKYA 3FUJA 3NOCD 2AVPA 2Y4UA 3G2WA 5LOZA 4HXIA 3ZNGA 4LNBA 4AJWA 5AARA 4GTPA 4BTAA 4YDYA 4LG6A 2WXNA 3CHQA 2FBNA 4UI9K 2VSXE 4J6IA 3Q49B 2IF4A 5KJLA 1YMPA 3N71A 3L16A 3IHYA 1B89A 3TWUA 1Z6TA 4L2LA 3GYZA 2KCVA 3FHEA 2LO6A 3PZ1A 3ASFA 4JPSA 3NQPA 1MX6A 3UTMA 4ZHBA 3CLJA 2P9NG 1BD8A 2XENA 4X8QA 3FEYA 3PH0C 2AW6A 3FUDA 2LAIA 1SQMA 4UWFA 3C3OA 2KZTB 3QK0A 1BI8B 2QFCA 3KSQA 5CCLA 2F8YA 1HH8A 3RRMB 3LYAA 3Q75A 1IHBA 4WNDA 2YHEA 3PNTB 5JJTA 3MA5A 4P29A 5AQ9A 2FULA 4N5QA 3R7QA 1OY3D 4W9RA 4M7CA 3DEPA 3CVXA 3ML9A 3D9HA 4A3VA 1QBQA 5AAOA 4HFGA 3GZ1A 2L6JA 1E8YA 3QWWA 4BY6A 2DWZA 3MYVA 3SO8A 3LDZA 1NA3A 4U0UA 3RK6A 1H0AA 2I9CA 4A1GA
chains in the Genus database with same CATH topology
4B94A 5ARFA 4GMJA 2E0IA 5LCWJ 3VTXA 3R7RA 2XRZA 4LEUA 4GPKA 3Q5MA 4PS8A 2OV8A 5T3RA 2WXHA 4Q69A 4Y6WA 4I9CA 5T4YA 2OVFA 4ME2A 2J07A 4BX8A 3KS2A 1E7UA 5FT9A 4HOTA 3QJZA 2CHWA 4DLQA 3SFZA 1E7VA 3ZRHA 4HOUA 4ABNA 4XI0A 3APFA 4NURA 4A3TA 3EDTB 3PEUB 5D0OD 3FDHA 3PZDA 3ASHA 3PREA 4JXTA 4N3CA 2UWJG 3LY8A 2WVIA 2X6HA 3RKVA 5AIJA 5C1DA 4U04A 1IQRA 4BX9A 2OVBA 3ZHEB 3ESLA 3HVEB 3SNXA 2XGOA 2PM7A 3RU0A 1TJFA 2WQ6A 3CKBA 3LVRE 3G2SA 5J08A 4U0SA 2VQ2A 4KVMA 1UN8A 3LJ3A 4KBQA 2WB2A 2J4DA 4TRQA 3ZXSA 1OWOA 4EECA 3PDNA 5G05J 3S7BA 1ELWA 3HDXA 1VDYA 3S7JA 5EDSA 3DBSA 1DNPA 5FWQA 1A17A 2KCLA 1LF8A 1E96B 4G25A 4GU5A 4PDXA 4XI9A 2LAHA 2XPYA 3G2UA 3KD7A 4APFA 3CVYA 4UI9J 3SBTB 5AENA 4WNFA 2IOLA 4N2QA 4ANVA 3TGOA 1MQSA 1BPOA 1QQEA 3C98A 3D9NA 3CIAA 3TL5A 4RSYA 1OWNA 3FFLA 3VTYA 4KT6B 5C2YA 3CSTA 3MCXA 4IYPA 2IFUA 2JLBA 2VYIA 4DI3A 2C0LA 2VSOE 3FTXA 2J49A 3IHVA 3JYSA 3ZYQA 4AOFA 4UQYA 4AV7A 2CFUA 2OOEA 5G04C 1EPUA 4OYSA 4BWRA 4DJAA 2WXFA 4MLPA 4CDNA 3RIBA 4ATGA 4LCTA 1E90A 4BT8A 2IOSA 3CEQA 4KVOA 3T8MA 4I1OB 4NQ0A 4R7LA 3S7DA 3O4ZA 1HXIA 2X3MA 4IULA 1FVHA 4L1BA 4I2WA 3ZVVA 2VGXA 3D9LA 3BG1B 1INZA 2LNIA 1E8ZA 3OXGA 3CVQA 2RD0A 4J0UA 3ULQA 2XHEA 4RVBA 1WM5A 2KC7A 1H2UA 4UQXA 1ZBPA 1E8XA 3LCAA 1HU3A 4WUYA 3ZFWA 4ANWA 1OUVA 2YNQA 3B7RL 3PNLB 2C0MA 4N2SA 3RJVA 3PRZA 3APDA 1H19A 4B89A 3URZA 4AEZC 2WXGA 4I1MA 3SGHA 3CSFA 4EPZA 4JL0A 3LS8A 2Y4TA 4MRUA 3NF1A 4N39A 2UY1A 4I6JA 1FVFA 3P2BA 2VTBB 3FUIA 2CG3A 3FWVA 4Q94A 3NZUA 4KZCA 4I6EA 2P58C 4GMLA 2WXKA 3MKQA 2QY7A 2I6HA 4MS6A 5FQ6A 4GZ5A 4JZYA 3ZGQA 1Z3YA 4H7YA 4URKA 1PC2A 4Y6CA 2IU1A 1HZ4A 4JA9A 1N52A 1EDUA 4ILHB 2PZIA 3CHPA 3KEZA 4EZKA 3GZ2A 4QFVA 2XPZA 3GW4A 2BTDA 1DVPA 2KZTA 3FTVA 3RRUA 4JW1A 2IONA 3CGHA 3MKRA 3TG4A 3ZIMA 1GW6A 4EQFA 2VSNA 3G2VA 4GCOA 1QNFA 4JHKA 5ENNA 3IEGA 5CHEE 5G04J 3I5PA 5FQ4A 1WY6A 2L9BA 1YA0A 5BT1A 3QAQA 2WXIA 1FCHA 3O48A 3EIJA 5BPPA 5FQ8A 3FEXA 3SHFA 1IQUA 2IQCA 3GZSA 4EZLA 4LERA 4GA1A 3EHNA 3TAXA 2JEKA 2FF4A 3MV2B 1WAO1 4GAAA 3FH7A 5M72A 3FULA 4ACKA 4HS2A 2CHZA 2WMOA 3ZW3A 2ONDA 4GZCA 4FP7A 4L2YA 3FUEA 3EIQC 3B7TA 3FH8A 5KCMA 5JJ6A 2X6IA 1EYHA 2AXUA 1OWPA 2MHKA 3ESKA 5BUZA 4G1TA 2GRMA 3FH5A 2WPVA 2LSVA 3QWVA 3K9IA 2X6JA 4JVSA 5ANLA 2GW1A 3ZYLA 2VSYA 4WWPA 3IV0A 4TUUA 2WXMA 4IRUA 5KJKA 4DPRA 4EBAA 4V3IA 2VTBA 2I2OA 4HOQA 2DBAA 4AM9A 3FU0A 3UT4A 4BSXA 3Q15A 3ZEFA 3Q4AB 3I4RB 4PUCA 1P5QA 4E6HA 4XE0A 3U4TA 1H2VC 4I2ZA 1JUQA 3JQ1A 1ZU2A 5D0QD 1PAQA 3APCA 3CHRA 3FP3A 5T8IA 3TXMA 3I4GA 2L0IA 2XCCA 3QC1A 4CT4A 2A4ZA 4FULA 4B8AA 2HR2A 4FJZA 4JC8A 4UQZA 4DI4A 4CGVA 3B7UX 3UPVA 5E76A 2DIWA 4NACA 1NP7A 2L0TB 4CCAA 1NZNA 2NXPA 4I43A 4I17A 2XCBA 2HYZA 2J4BA 3CVLA 3VLEA 3PVLA 3KAEA 4JEHA 3TJPA 3CVVA 2VJ8A 2X6FA 2WXPA 5LFAA 4GB9A 5ANRA 3D9KA 4WWOA 3BEEA 2WXQA 5G2NA 3FU5A 5FZSA 3FUFA 4CRWA 2FI7A 5LX8A 3QOUA 1KT0A 2R59A 2YINA 2AXZA 3HIZA 4ILGA 3CHOA 3FY4A 4GZDA 5KJMA 2NC9A 2I1KA 2BUGA 2MRIA 1Z3XA 3FU6A 4DLOA 4O6FA 2IJGX 2GRLA 3CVPA 3DPDA 4FLHA 2V4LA 4YVOA 3SI5A 1JPLA 3QB2A 2R5SA 4B0ZA 1JWFA 4FJYA 4I1AA 1XNFA 3R9AB 5J90A 3CK8A 4AY6A 2KCKA 4I6GA 3S2AA 3LY7A 4G26A 4U07A 1TJCA 3D3MA 1SZAA 4LUNU 2X38A 5JHBA 4YNDA 4GYWA 4U8HA 2LSUA 3CV0A 1Y6IA 4JHJA 4M3OA 3HVEA 3ZHEA 4UWKA 4AIFA 3U66A 1W3BA 4D10C 4K03A 1HG2A 2M63A 3EJNA 3PUJA 3ASGA 4C0MA 3FTZA 1E8WA 1H2TC 1UG3A 3RO3A 4N3BA 3L54A 3B7SA 3CK7A 2XGMA 4FU3A 4KZ0A 4BTBA 4WNEA 5G55A 3SBSA 3LKUA 3UUXA 1JWGA 3QARA 1HO8A 5FTPA 3UT7A 4XX5A 1Y8MA 3MV3B 2FO7A 4EBAG 5LP0A 3UQ3A 5DIZA 4BFRA 3AU5A 3T5VA 3ML8A 3AS8A 2I1JA 4FHKA 2Y3AA 3QDNA 3SZ7A 4PH4B 2PM6A 3D9MA 4WAFA 3LVQE 3FUHA 1HG5A 3FTWA 4L7TA 4GZ6A 3NZSA 2E2EA 5FZQA 5HQ8A 2WXJA 3OAWA 4UWLA 2EQXA 4ANUA 5G05C 4J8FA 3CQCB 2XRYA 2MOWA 1UW4B 5AJLA 2KM4A 2PQNA 4IN3B 3MJWA 5E75A 2AXVA 3RO2A 4TV3A 2HM8A 1U3DA 2RG8A 2XQ0A 1KT1A 4WWNA 4C9BB 3PE4A 3QKYA 1S0PA 3FUJA 2AVPA 2Y4UA 3G2WA 2WXRA 5LOZA 2WQ7A 3E4BA 3AS4A 4HXIA 2AWIA 4HVBA 4WNGA 3MX3A 4FA6A 2J08A 3TG5A 4G2VA 3CHMA 1UJJA 3IBEA 4AJWA 2YQ8A 1HF8A 4GA2A 4G24A 3SD5A 4G11A 3SF4A 3PS6A 5CCMA 4FHJA 2WXLA 3FUMA 4BTAA 3LY9A 4XKBA 4CT0A 1UJKA 2WXNA 3CHQA 2FBNA 3CHSA 3HHMA 2VSXE 3L13A 4UI9K 4J6IA 4J8EA 3FU3A 4CDMA 5DBKA 4J8DA 4XIFA 3Q49B 2IF4A 3AS5A 5KJLA 4Q96A 5FZRA 2XPIA 3EHMA 4B8CB 3L6AA 2VGXB 3N71A 3L16A 3IHYA 2BF0X 1SZ9A 1TEZA 1B89A 3L17A 4CDRA 2J9QA 3AU4A 4RG9A 2FEZA 3ZYMA 4DK5A 5ARGA 1Z6TA 4L23A 1N54A 4L2LA 4PS7A 3ZN3A 3ZPJA 3GYZA 2KCVA 4EZJA 3LPZA 3OXLA 3FHEA 4KYOB 2LO6A 4A55A 2ZU6B 5BV0A 1KLXA 2R17C 3L22A 1XGWA 3IKOB 1U3CA 4GA0A 3D9JA 5JHAA 3FUNA 1ELRA 5CMWA 3VLDA 3ASFA 4JPSA 3U3WA 3NQPA 4GYOA 3BG0B 3T5XA 2CHXA 1EF1C 3PEVB 4ILIA 1H6KA 4AP2A 4BT9A 2UY1B 3CLJA 5CMYA 1ELKA 2PL2A 3CVWA 3QWPA 4E85A 5BV1A 4LRZA 3JUIA 1HS6A 5BW8C 3MGBA 4KXKB 2KATA 1OWMA 4JEUA 3MKQB 5JJ7A 1UN9A 4CGWA 4YVQC 3LXUX 3ONKA 2WXOA 1X5BA 3FEYA 4U0ZA 2V8SE 2VGYA 3FTSA 3PH0C 3UT8A 1HX8A 3UX4A 3RRNB 2AW6A 3FUDA 2LAIA 2NSZA 2GGFA 3D9IA 1SQMA 5A7DB 3VLFA 4PS3A 2WMNA 2WQHA 3JCKC 3L08A 2DCPA 4UWFA 5EKQD 2KZTB 1L5JA 3WXXA 4JHRA 4AVXA 5LCWC 3QK0A 4OVUA 4FC8A 2QFCA 2XEVA 3OXFA 2XGSA 4GYYA 4AXHA 3D9PA 5EX3A 3FUKA 1IHGA 3U9WA 4KMOA 4CEMA 1PY1A 2WM9A 3JQ0A 5CCLA 1NA0A 3FTUA 1HH8A 3LEWA 5EX0A 4JA7A 3QNKA 5AYWD 4XKCA 4UWHA 3LYAA 4I9EA 3RRMB 3ZYKA 5KJNA 4F53A 4HORA 4WNDA 2YHEA 3PNTB 1IYGA 4H7XA 3TXNA 3ASDA 4N3AA 2V0PA 4GZ3A 4ANXA 1HE8A 3MEKA 3OTNA 4GCNA 2HO1A 5JJTA 3MA5A 3UMVA 4J8SA 2CG2A 4P29A 4HLEA 2FULA 3I3NA 3Q47B 2J09A 3R7QA 5A6CA 3PE3A 4W9RA 3D9OA 3CVUA 3B13A 2ILRA 3MZLB 5A23A 3CVXA 3ML9A 2PQRA 3S7FA 2X6KA 4F1SA 4UI9C 3HYMB 4A3VA 3FTYA 4C0EA 4AY5A 4RG6A 4HFGA 4UWGA 4F7AA 4F3VA 4FLBA 3GZ1A 2L6JA 3PUKA 1E8YA 2CFZA 3QWWA 4N5CA 4BY6A 3CQGB 3CR3A 3CVNA 4U63A 5HI7A 5FJYA 3ONLA 4A1SA 3G2TA 4HOSA 2V5FA 3CKCA 3MYVA 4APOA 2C2LA 3P1UA 1MHQA 4FADA 3ENEA 2Q7FA 2A5UA 4G23A 3LDZA 4NRHB 5FQ7A 1HFAA 1NA3A 4MKTA 5BNWA 3U64A 3CK9A 2YHCA 4OVVA 4U0UA 3RK6A 4K0RA 1H0AA 4XZ4A 1OWLA 2I9CA 4A1GA 4ACLA 1QZ2A 5AJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B94 A;  5ARF A;  5LCW J;  3VTX A;  4LEU A;  4GPK A;  3Q5M A;  4Y6W A;  4I9C A;  4ME2 A;  3KS2 A;  5FT9 A;  4HOT A;  4HOU A;  4ABN A;  4XI0 A;  3EDT B;  5D0O D;  3ASH A;  4N3C A;  2UWJ G;  3LY8 A;  5C1D A;  3RKV A;  4U04 A;  3ZHE B;  2XGO A;  3RU0 A;  3CKB A;  4U0S A;  2VQ2 A;  4KBQ A;  3PDN A;  5G05 J;  3S7B A;  1ELW A;  3S7J A;  1A17 A;  2KCL A;  1E96 B;  4G25 A;  4XI9 A;  3KD7 A;  4UI9 J;  4WNF A;  4N2Q A;  3TGO A;  1QQE A;  3FFL A;  3VTY A;  2JLB A;  2IFU A;  2VYI A;  2C0L A;  3JYS A;  4UQY A;  2OOE A;  5G04 C;  4BWR A;  3RIB A;  4BT8 A;  3CEQ A;  4NQ0 A;  3S7D A;  1HXI A;  4I2W A;  2VGX A;  2LNI A;  3OXG A;  3CVQ A;  4J0U A;  3ULQ A;  1WM5 A;  2KC7 A;  4UQX A;  1ZBP A;  3LCA A;  4WUY A;  3ZFW A;  1OUV A;  2C0M A;  4N2S A;  3RJV A;  3URZ A;  4JL0 A;  2Y4T A;  3NF1 A;  4N39 A;  2UY1 A;  3FWV A;  2P58 C;  2I6H A;  4GZ5 A;  3ZGQ A;  4H7Y A;  1PC2 A;  4Y6C A;  1HZ4 A;  4JA9 A;  2PZI A;  3GZ2 A;  3GW4 A;  3MKR A;  3TG4 A;  4EQF A;  2VSN A;  4GCO A;  3IEG A;  5CHE E;  5G04 J;  5BT1 A;  1YA0 A;  3O48 A;  1FCH A;  4GA1 A;  3TAX A;  3MV2 B;  2FF4 A;  1WAO 1;  5M72 A;  2OND A;  5JJ6 A;  2MHK A;  3ESK A;  4G1T A;  3QWV A;  2WPV A;  2LSV A;  3K9I A;  2GW1 A;  2VSY A;  5KJK A;  4HOQ A;  2DBA A;  4AM9 A;  3Q15 A;  3Q4A B;  1P5Q A;  3U4T A;  4I2Z A;  5D0Q D;  1ZU2 A;  3FP3 A;  2XCC A;  2HR2 A;  3UPV A;  4UQZ A;  4CGV A;  1NZN A;  4I17 A;  2XCB A;  2HYZ A;  3CVL A;  3KAE A;  3BEE A;  5FZS A;  2FI7 A;  3QOU A;  1KT0 A;  5KJM A;  2NC9 A;  2BUG A;  4O6F A;  3CVP A;  4YVO A;  2R5S A;  4I1A A;  3R9A B;  1XNF A;  3CK8 A;  4AY6 A;  2KCK A;  3LY7 A;  4G26 A;  4U07 A;  1TJC A;  4YND A;  4GYW A;  2LSU A;  3CV0 A;  3ZHE A;  4AIF A;  1W3B A;  3ASG A;  3RO3 A;  4N3B A;  3CK7 A;  2XGM A;  4BTB A;  4WNE A;  3LKU A;  3UUX A;  1Y8M A;  3MV3 B;  2FO7 A;  3UQ3 A;  5DIZ A;  3AS8 A;  3SZ7 A;  3QDN A;  4GZ6 A;  2E2E A;  5FZQ A;  5HQ8 A;  5G05 C;  4J8F A;  2PQN A;  4IN3 B;  3RO2 A;  1KT1 A;  3PE4 A;  3QKY A;  2AVP A;  2Y4U A;  3E4B A;  3AS4 A;  1QZ2 A;  4WNG A;  3TG5 A;  4G2V A;  2YQ8 A;  4GA2 A;  4G24 A;  3SF4 A;  5CCM A;  4BTA A;  3LY9 A;  2FBN A;  4UI9 K;  4J8E A;  5DBK A;  4J8D A;  4XIF A;  3Q49 B;  2IF4 A;  3AS5 A;  5KJL A;  5FZR A;  2XPI A;  3N71 A;  2VGX B;  1B89 A;  4CDR A;  2J9Q A;  4RG9 A;  2FEZ A;  5ARG A;  3ZN3 A;  3ZPJ A;  3GYZ A;  2KCV A;  3LPZ A;  3OXL A;  4KYO B;  1KLX A;  4GA0 A;  1ELR A;  3U3W A;  3ASF A;  4GYO A;  4BT9 A;  2UY1 B;  2PL2 A;  3QWP A;  5BW8 C;  4KXK B;  2KAT A;  5JJ7 A;  4CGW A;  4YVQ C;  4U0Z A;  2VGY A;  5A7D B;  2WQH A;  5EKQ D;  3WXX A;  4JHR A;  5LCW C;  2QFC A;  2XEV A;  3OXF A;  2XGS A;  4GYY A;  5EX3 A;  1IHG A;  5CCL A;  1NA0 A;  1HH8 A;  5EX0 A;  4JA7 A;  5AYW D;  5KJN A;  3LYA A;  4I9E A;  4HOR A;  4WND A;  1IYG A;  4H7X A;  3ASD A;  4N3A A;  4GZ3 A;  3MEK A;  4GCN A;  2HO1 A;  5JJT A;  3MA5 A;  3Q47 B;  5A6C A;  3PE3 A;  4W9R A;  2PQR A;  3S7F A;  4UI9 C;  3HYM B;  4AY5 A;  4RG6 A;  4F3V A;  3GZ1 A;  2L6J A;  3QWW A;  4N5C A;  5HI7 A;  3CVN A;  5FJY A;  4A1S A;  4HOS A;  2V5F A;  3CKC A;  4APO A;  2C2L A;  2Q7F A;  4G23 A;  4NRH B;  1NA3 A;  5BNW A;  3CK9 A;  2YHC A;  4U0U A;  5FTP A; 
#chains in the Genus database with same CATH topology
 5ARF A;  4GMJ A;  5LCW J;  2XRZ A;  4PS8 A;  5KBA A;  4TXR A;  2OVF A;  4BX8 A;  5FT9 A;  3QJZ A;  1E7V A;  3ZRH A;  3APF A;  3ULY A;  5D0O D;  2OEV A;  3PRE A;  2UWJ G;  5AIJ A;  3RKV A;  5JMN D;  1N9A A;  3ESL A;  3CKB A;  3LVR E;  5D2M C;  2VQ2 A;  1UN8 A;  3LJ3 A;  3ZXS A;  1OWO A;  5G05 J;  3S7B A;  3DBS A;  2KCL A;  4GU5 A;  2XZD G;  1D8D A;  3SBT B;  4HRN A;  2IOL A;  4ANV A;  1MQS A;  1BPO A;  4DX6 D;  4KT6 B;  3CST A;  4O60 A;  1ZB1 A;  2ZXW E;  3FTX A;  4O1P A;  3HXF A;  4NQ0 A;  1LD8 A;  2X3M A;  2Y1L E;  3UIP C;  1YCS B;  5HKP A;  3CVQ A;  2RD0 A;  4J7W A;  2XHE A;  5CED B;  4YDO A;  1H2U A;  4UQX A;  3LCA A;  1HU3 A;  5KNG A;  3ZFW A;  4ANW A;  1OUV A;  2YNQ A;  3PRZ A;  3APD A;  4B89 A;  1V55 E;  4I1M A;  3CSF A;  4DX1 A;  1WG0 A;  2VTB B;  1DCQ A;  4C48 B;  2CG3 A;  2H6I A;  3FWV A;  4KZC A;  4GML A;  2WXK A;  1OCO E;  2I6H A;  2IU1 A;  1HZ4 A;  1MYO A;  3HXE A;  3CHP A;  3KEZ A;  2BTD A;  1DVP A;  3DXK G;  1TNB A;  2ION A;  3MKR A;  3TG4 A;  3NBN B;  2XEE A;  2VSN A;  3R9M A;  2RKK A;  3SY2 A;  4OAV B;  2XS8 A;  1TNU A;  1IQU A;  3EHN A;  3TAX A;  2ZIR A;  4ACK A;  4HS2 A;  3L9T A;  1N11 A;  4FP7 A;  3FUE A;  3B7T A;  2J8S D;  2X6I A;  1EYH A;  1OWP A;  3K9I A;  5ANL A;  1DCE A;  2GW1 A;  3ZYL A;  3IV0 A;  5KJK A;  5ENR D;  4F6R D;  4V3I A;  5CER B;  2I2O A;  1AP7 A;  3FU0 A;  4BSX A;  3ZEF A;  1QYM A;  3Q4A B;  4I2Z A;  1JUQ A;  1PAQ A;  3CHR A;  5T8I A;  2XCC A;  3UIN C;  2A4Z A;  4B8A A;  4CGV A;  5E76 A;  1IKN D;  1LTX A;  3CVL A;  3PVL A;  3KAE A;  2VJ8 A;  2X6F A;  2WXP A;  4GB9 A;  3BEE A;  5G2N A;  2R59 A;  4ILG A;  2AXZ A;  3FY4 A;  3ZUV B;  2AJA A;  2NC9 A;  2GRL A;  3TWV A;  1JWF A;  5J90 A;  2KCK A;  3LY7 A;  2A5E A;  4G26 A;  1O1R A;  3D3M A;  5JHB A;  2X38 A;  4AIF A;  1HG2 A;  2M63 A;  3FTZ A;  1E8W A;  4N3B A;  4FU3 A;  4BTB A;  2DZO A;  4GTV A;  2F8X K;  1HO8 A;  3UT7 A;  2HE0 A;  3MV3 B;  5CEA A;  2I1J A;  4FHK A;  3FUH A;  5FZQ A;  2WXJ A;  4UWL A;  2EQX A;  4EHM A;  1UW4 B;  5AJL A;  1O1T A;  2F37 A;  2DYS E;  2KM4 A;  3MJW A;  2AXV A;  1U3D A;  1OT8 A;  3SFY A;  3J5Q B;  3HXC A;  3PE4 A;  2WQ7 A;  4HVB A;  2J08 A;  4G2V A;  3L82 A;  1UJJ A;  3IBE A;  4U7E B;  2YQ8 A;  4GA2 A;  3SD5 A;  3SF4 A;  3FUM A;  4XKB A;  3UM2 A;  4YDE A;  3L13 A;  3PZ2 A;  3ZXP A;  4J8E A;  3AS5 A;  4Q96 A;  5FZR A;  3TWR A;  4U8V D;  2P9S G;  4CDR A;  2J9Q A;  3AU4 A;  2FEZ A;  3HXD A;  3ZYM A;  4DK5 A;  3ZN3 A;  3ZPJ A;  3OXL A;  4A55 A;  1KLX A;  2R17 C;  5AQA A;  3IKO B;  3D9J A;  1TYQ G;  1ELR A;  5CMW A;  2CHX A;  1EF1 C;  4AP2 A;  4BT9 A;  4BET A;  2PL2 A;  5D66 A;  1HS6 A;  3MGB A;  2KAT A;  1OWM A;  5JJ7 A;  1UN9 A;  1X5B A;  2V8S E;  2VGY A;  3FTS A;  3E34 A;  3UT8 A;  2FO1 E;  5A7D B;  2WMN A;  2WQH A;  5EKQ D;  1L5J A;  1TN6 A;  4OVU A;  1N95 A;  4FC8 A;  2XEV A;  4AXH A;  4KMO A;  4CEM A;  4U95 D;  2WM9 A;  5EX0 A;  3LEW A;  3NB2 A;  3QNK A;  5AYW D;  4XKC A;  5KJN A;  3DSU A;  2BKG A;  3ASD A;  4ANX A;  1N4P A;  1HE8 A;  4GCN A;  2HO1 A;  3UMV A;  2GRP B;  3DEO A;  1KZO A;  2F0Y A;  4DX5 D;  3D9O A;  3CVU A;  5AN8 A;  1O5M A;  4C0E A;  4N5C A;  4U63 A;  3CR3 A;  3CVN A;  5HI7 A;  2RFA A;  5FJY A;  4G8K A;  5BXU A;  3G2T A;  4HOS A;  3AJI A;  3P1U A;  4K5B A;  5B3S E;  3ENE A;  4HRL A;  2Q7F A;  2A5U A;  4G23 A;  1S63 A;  4MKT A;  4OVV A;  4K0R A;  2ZGD A;  1QZ2 A;  4B94 A;  4U8Y D;  2E0I A;  3R7R A;  1MZC A;  1JCQ A;  2OV8 A;  1SA4 A;  1LD7 A;  4HOU A;  4XI0 A;  4NUR A;  3EDT B;  3FDH A;  2WVI A;  4U04 A;  4BX9 A;  3SNX A;  3RU0 A;  2PM7 A;  3HXB A;  3E32 A;  2RFM A;  4TRQ A;  3PDN A;  5EDS A;  2ZGG A;  1LF8 A;  4G25 A;  2LAH A;  2XPY A;  4APF A;  3KD7 A;  3C98 A;  3VTY A;  3MCX A;  4IYP A;  2IFU A;  4AOF A;  2OOE A;  1EPU A;  3RIB A;  4BT8 A;  4KVO A;  3JXI A;  4I1O B;  3S7D A;  5B1B E;  1FVH A;  1INZ A;  1TN8 A;  5EIL A;  2GRR B;  4O1O A;  2XS1 A;  3HG0 D;  3URZ A;  2WXG A;  3SGH A;  3C3R A;  1SW6 A;  4MRU A;  4YDW A;  3RSE G;  3JXJ A;  4Q94 A;  3NZU A;  3AG1 E;  3MKQ A;  2QY7 A;  4MS6 A;  4GZ5 A;  4K5C A;  3E30 A;  1TR4 A;  4Y6C A;  1N52 A;  1EDU A;  4QFV A;  2XPZ A;  4JW1 A;  4OAU C;  1GW6 A;  4GCO A;  1QNF A;  4JHK A;  5ENN A;  3IEG A;  5FQ4 A;  1WY6 A;  2L9B A;  5BT1 A;  3QAQ A;  2R2L A;  4HLL A;  3SHF A;  1X81 A;  3GZS A;  4EZL A;  4BEP A;  2JEK A;  4A63 B;  5M72 A;  3FUL A;  2R05 A;  2QZA A;  3ZW3 A;  2QC9 A;  3ABK E;  4L2Y A;  2ETB A;  3FH5 A;  5CRV A;  4WWP A;  4DPR A;  4EBA A;  3SFX A;  2DYR E;  4HOQ A;  2DBA A;  3B95 A;  3UT4 A;  3Q15 A;  2XEH A;  4PUC A;  4E6H A;  3APC A;  3FP3 A;  3I4G A;  2HR2 A;  1IXV A;  4UQZ A;  3B7U X;  4NAC A;  1NP7 A;  3V31 A;  3AG4 E;  4I17 A;  1MJ0 A;  3TWS A;  3TJP A;  2DVW A;  2WXQ A;  3FU5 A;  5FZS A;  5LX8 A;  4GTR A;  3CHO A;  4GZD A;  4NIK A;  3FU6 A;  4DLO A;  3DXM G;  4FLH A;  3T9K A;  1JPL A;  2VGE A;  2R5S A;  4I1A A;  4RLY A;  4AY6 A;  4U07 A;  4YND A;  4JHJ A;  4M3O A;  3HVE A;  4UWK A;  1UG3 A;  3RO3 A;  3DRA A;  4XX5 A;  2P9P G;  5DIZ A;  4BFR A;  2ETC A;  2Y3A A;  3QDN A;  3D9M A;  4L7T A;  1HG5 A;  5HQ8 A;  1G3N B;  4ANU A;  5G05 C;  4IN3 B;  1N4Q A;  2RG8 A;  1KT1 A;  5EYP F;  4WWN A;  3UI2 A;  1S0P A;  1D8E A;  2AWI A;  4WNG A;  4FA6 A;  1FT2 A;  3DSW A;  3CHM A;  1HF8 A;  4G11 A;  5CCM A;  4FHJ A;  3LY9 A;  3KSL A;  4CT0 A;  4GMR A;  4LSZ E;  3FU3 A;  4XIF A;  3NAW A;  2XPI A;  3EHM A;  4B8C B;  1NL4 A;  4DX2 A;  3DSS A;  1TEZ A;  4RG9 A;  5ARG A;  1N54 A;  4PS7 A;  4JD2 G;  2EIN E;  3L22 A;  1XGW A;  5JHA A;  3VLD A;  4GYO A;  4ILI A;  3Q9U C;  5KWD A;  1OCR E;  3CVW A;  5HS0 A;  4HI8 A;  3QWP A;  4B93 B;  3JUI A;  4LRZ A;  4KXK B;  3MKQ B;  1Q2Z A;  4QQI A;  3SQV A;  4CGW A;  4YVQ C;  4U0Z A;  1TN7 A;  1HX8 A;  3RRN B;  2NSZ A;  2GGF A;  3D9I A;  5ENQ D;  3JCK C;  4AVX A;  1MX4 A;  2IY0 C;  2XGS A;  4GYY A;  5EX3 A;  3FUK A;  1IHG A;  1TNZ A;  3JQ0 A;  4G8L A;  4GTO A;  4L9P A;  4JA7 A;  4I9E A;  3ZYK A;  4F53 A;  4H7X A;  2V4H C;  3MEK A;  4J8S A;  2CG2 A;  2DZN A;  3UIO C;  3Q47 B;  3TWX A;  3PE3 A;  1KPS B;  3ULE G;  3MZL B;  5A23 A;  2PQR A;  2X6K A;  4UI9 C;  3HYM B;  2KBX A;  3F6Q A;  4AY5 A;  4F3V A;  5CBN A;  3PUK A;  2CFZ A;  2V5F A;  2C2L A;  1MHQ A;  4FAD A;  3RAU A;  1HFA A;  1RW2 A;  3CK9 A;  2YHC A;  5BXO A;  1OWL A;  5FTP A;  3VTX A;  4LEU A;  2WXH A;  4Q69 A;  4I9C A;  5T4Y A;  2J07 A;  2P9I G;  3KS2 A;  1BI7 B;  2CHW A;  3B7B A;  3SFZ A;  5KNH D;  4ABN A;  3Q79 A;  3TWW A;  1K3Z D;  3PZD A;  1N4R A;  3BUA A;  4JXT A;  2X6H A;  3AAA C;  1IQR A;  2OVB A;  3HVE B;  2XGO A;  2WQ6 A;  5AQ7 A;  3G2S A;  5J08 A;  4K5A B;  2WB2 A;  1TNY A;  4EEC A;  3HRA A;  3DSX A;  1ELW A;  3HDX A;  1A17 A;  1E96 B;  4PDX A;  4XI9 A;  3CVY A;  4WNF A;  3ASO E;  1QQE A;  3D9N A;  1AWC B;  3TL5 A;  1OWN A;  3EHQ A;  5C2Y A;  3Q73 A;  2VYI A;  4DI3 A;  2C0L A;  4LNU D;  3ZYQ A;  3IHV A;  4HRM B;  4UQY A;  5G04 C;  4MLP A;  4Z68 A;  1E90 A;  3IXE A;  3O4Z A;  1HXI A;  4IUL A;  2VGX A;  3D9L A;  3BG1 B;  4J0U A;  3ULQ A;  4RVB A;  3T8K A;  2KC7 A;  1ZBP A;  1E8X A;  3PNL B;  3C72 A;  2C0M A;  1OCC E;  3RJV A;  1H19 A;  1JCS A;  4JL0 A;  4N39 A;  2UY1 A;  3FUI A;  3C5R A;  4I6E A;  1N0Q A;  5FQ6 A;  4JZY A;  3ZGQ A;  4H7Y A;  1PC2 A;  1K1A A;  4EZK A;  4DRX E;  2OCC E;  2EIL E;  5EID A;  3CGH A;  3Q7F A;  3BU8 A;  3I5P A;  1YA0 A;  2WXI A;  3O48 A;  5BPP A;  3FEX A;  2IQC A;  4LER A;  2FF4 A;  1WAO 1;  4GAA A;  3FH7 A;  5ENP D;  2CHZ A;  2WMO A;  4GZC A;  5KCM A;  3FH8 A;  3Q9N C;  2AXU A;  2MHK A;  5BUZ A;  4G1T A;  5EN5 D;  2GRM A;  3QWV A;  1SVX A;  2X6J A;  4JVS A;  2P9K G;  4HI9 A;  2WXM A;  3V2X A;  2VTB A;  1K8K G;  1P5Q A;  2PNN A;  1ZU2 A;  3C3Q A;  2L0I A;  3QC1 A;  4FJZ A;  4JC8 A;  4DI4 A;  2Y69 E;  2L0T B;  1TNO A;  1NZN A;  2NXP A;  4I43 A;  2J4B A;  3CVV A;  5LFA A;  2P2C P;  5ANR A;  4WWO A;  3FUF A;  2FI7 A;  1A5E A;  1KT0 A;  5ITZ F;  4DUI A;  2I1K A;  3DPY A;  2MRI A;  1Z3X A;  2IJG X;  3CVP A;  4BES A;  2V4L A;  1JCR A;  2KXP C;  4ZFH A;  3Q78 A;  4B0Z A;  3R9A B;  1XNF A;  3V30 A;  3CK8 A;  1TJC A;  1SZA A;  4LUN U;  4GYW A;  2LSU A;  3ZHE A;  4D10 C;  4K03 A;  4GTM A;  3B7S A;  3UUX A;  2FO7 A;  5LP0 A;  3UQ3 A;  3AS8 A;  4BSZ B;  1O1S A;  3UM3 A;  2LXL A;  4PH4 B;  3V79 K;  3LVQ E;  3FTW A;  1K1B A;  3NZS A;  4HBD A;  2E2E A;  3LJN A;  2IO3 C;  4J8F A;  3CQC B;  2XRY A;  2MOW A;  3EU5 A;  3RO2 A;  4C9B B;  3EUV A;  2WXR A;  5CRU A;  2B6C A;  3E4B A;  3EHR A;  3AS4 A;  1WDY A;  3MX3 A;  3TG5 A;  4G24 A;  3TWQ A;  3DSV A;  3PS6 A;  2WXL A;  3ASN E;  5FIO A;  1UJK A;  3HHM A;  3CHS A;  4CDM A;  2L6B A;  5DBK A;  4J8D A;  2GRO B;  3L6A A;  1OXJ A;  2VGX B;  2BF0 X;  1SZ9 A;  3L17 A;  1RZ4 A;  4L23 A;  3ZU7 B;  4F1P A;  4EZJ A;  3LPZ A;  4KYO B;  2LUH A;  2ZU6 B;  5BV0 A;  4HQD A;  4TXQ A;  1U3C A;  4GA0 A;  3FUN A;  3U3W A;  3T5X A;  3BG0 B;  1D9S A;  1UOH A;  2QYU A;  3PEV B;  1DC2 A;  1H6K A;  2UY1 B;  1H6P A;  3ISM C;  3PZ3 A;  5CMY A;  1ELK A;  4ATZ D;  3X2Q E;  4E85 A;  5BV1 A;  5BW8 C;  4JEU A;  3LXU X;  3ONK A;  2WXO A;  3E33 A;  3UXG A;  3UX4 A;  3VLF A;  4PS3 A;  3L08 A;  2DCP A;  2NYJ A;  4U96 D;  3WXX A;  4JHR A;  5LCW C;  1NI1 A;  2P9U G;  3OXF A;  3D9P A;  3U9W A;  3J5P A;  1PY1 A;  4DX7 D;  4RQI A;  1NA0 A;  3FTU A;  4UWH A;  2H6F A;  3ZKJ A;  4HOR A;  4GTT A;  1IYG A;  3TXN A;  4N3A A;  2V0P A;  4GZ3 A;  3V2O A;  3OTN A;  2IO2 C;  4HLE A;  3I3N A;  2J09 A;  5HRY A;  5A6C A;  3ABL E;  5ENO D;  1OCZ E;  3B13 A;  2ILR A;  3S7F A;  4F1S A;  1S64 A;  3FTY A;  4RG6 A;  2BED A;  4UWG A;  4F7A A;  4FLB A;  3UKU G;  3CQG B;  5ENT D;  3ONL A;  4A1S A;  3CKC A;  4APO A;  4LNG A;  4NRH B;  1YYH A;  1BLX B;  5FQ7 A;  1SA5 A;  5BNW A;  3U64 A;  2BKK B;  4XZ4 A;  4ACL A;  4GTQ A;  5AJD A;  2LXM A;  4GPK A;  3Q5M A;  3WG7 E;  5T3R A;  3NOG D;  4Y6W A;  4ME2 A;  2OEW A;  5ENS D;  1E7U A;  4HOT A;  4DLQ A;  2EIJ E;  2B0O E;  2EIK E;  2JAB A;  4A3T A;  2QYJ A;  3UM0 A;  3PEU B;  5JA4 D;  4XEI G;  3ASH A;  4N3C A;  3LY8 A;  4MBG A;  5C1D A;  4J8Y A;  3ZHE B;  1TJF A;  4U0S A;  4KVM A;  4KBQ A;  2J4D A;  3AG2 E;  3W9G A;  1VDY A;  3S7J A;  1DNP A;  5FWQ A;  3G2U A;  4UI9 J;  5AEN A;  2IEJ A;  4N2Q A;  3TGO A;  3CIA A;  4RSY A;  3FFL A;  1KZP A;  2EIM E;  2JLB A;  4BER A;  4GTS A;  2P9L G;  2VSO E;  2J49 A;  3JYS A;  4AV7 A;  2CFU A;  4OYS A;  4BWR A;  4DJA A;  2WXF A;  4CDN A;  4ATG A;  4LCT A;  2IOS A;  3CEQ A;  3T8M A;  1H6O A;  2XZT G;  4R7L A;  4L1B A;  4I2W A;  3ZVV A;  2LNI A;  1E8Z A;  1N4S A;  3OXG A;  1WM5 A;  2R03 A;  1FPP A;  4WUY A;  3B7R L;  4N2S A;  1NFI E;  2Y0B G;  5AQB A;  4AEZ C;  5CEC B;  4EPZ A;  4CYM D;  3LS8 A;  2Y4T A;  4CZ2 D;  3NF1 A;  5IY5 E;  4I6J A;  1FVF A;  3P2B A;  3W9F A;  2H6H A;  1V54 E;  3DWL G;  1U2V G;  2P58 C;  2H6G A;  5H7P A;  4TXP A;  1Z3Y A;  4URK A;  3KEA A;  4JA9 A;  4ILH B;  2PZI A;  3GZ2 A;  3GW4 A;  2KZT A;  3FTV A;  4HB5 A;  3RRU A;  3ZIM A;  4EQF A;  3DST A;  3G2V A;  5CHE E;  5G04 J;  3AG3 E;  1FCH A;  3EIJ A;  5FQ8 A;  2GRN B;  4GA1 A;  2ZIS A;  3MV2 B;  2OND A;  3EIQ C;  5JJ6 A;  5EYL A;  3ESK A;  4GPM A;  2WPV A;  2LSV A;  3BQO A;  2VSY A;  2MYO A;  4TUU A;  4IRU A;  4AM9 A;  4TUM A;  4JB8 P;  3I4R B;  2V5Q C;  3UKR G;  4XE0 A;  3U4T A;  3ABM E;  1H2V C;  3JQ1 A;  5D0Q D;  3TXM A;  3E37 A;  4CT4 A;  4FUL A;  3UPV A;  4HNA D;  2DIW A;  4CCA A;  2XCB A;  2HYZ A;  1N0R A;  3VLE A;  4JEH A;  1N94 A;  4UUC A;  5CBO A;  3D9K A;  1Z5S C;  4CRW A;  1FT1 A;  3QOU A;  2YIN A;  3HIZ A;  5KJM A;  2BUG A;  4O6F A;  5FIN A;  3DPD A;  3SI5 A;  4YVO A;  3QB2 A;  4FJY A;  4I6G A;  3S2A A;  4U8H A;  3CV0 A;  1Y6I A;  3U66 A;  1W3B A;  3EJN A;  3PUJ A;  3ASG A;  4C0M A;  1MX2 A;  3UM1 A;  1H2T C;  3L54 A;  5EIB E;  3CK7 A;  2XGM A;  4KZ0 A;  4WNE A;  5G55 A;  2ETA A;  2GRQ B;  3LKU A;  3SBS A;  1JWG A;  3QAR A;  3TWT A;  2R02 A;  1Y8M A;  4EBA G;  3AU5 A;  3T5V A;  3ML8 A;  3SZ7 A;  2PM6 A;  4WAF A;  4GZ6 A;  3Q7A A;  3OAW A;  3JUE A;  2PQN A;  5E75 A;  1S70 B;  3PZ4 A;  4TV3 A;  2HM8 A;  1BU9 A;  2XQ0 A;  3EU9 A;  5B1A E;  3QKY A;  3FUJ A;  3NOC D;  2AVP A;  2Y4U A;  3G2W A;  5LOZ A;  4HXI A;  3ZNG A;  4LNB A;  4AJW A;  5AAR A;  4GTP A;  4BTA A;  4YDY A;  4LG6 A;  2WXN A;  3CHQ A;  2FBN A;  4UI9 K;  2VSX E;  4J6I A;  3Q49 B;  2IF4 A;  5KJL A;  1YMP A;  3N71 A;  3L16 A;  3IHY A;  1B89 A;  3TWU A;  1Z6T A;  4L2L A;  3GYZ A;  2KCV A;  3FHE A;  2LO6 A;  3PZ1 A;  3ASF A;  4JPS A;  3NQP A;  1MX6 A;  3UTM A;  4ZHB A;  3CLJ A;  2P9N G;  1BD8 A;  2XEN A;  4X8Q A;  3FEY A;  3PH0 C;  2AW6 A;  3FUD A;  2LAI A;  1SQM A;  4UWF A;  3C3O A;  2KZT B;  3QK0 A;  1BI8 B;  2QFC A;  3KSQ A;  5CCL A;  2F8Y A;  1HH8 A;  3RRM B;  3LYA A;  3Q75 A;  1IHB A;  4WND A;  2YHE A;  3PNT B;  5JJT A;  3MA5 A;  4P29 A;  5AQ9 A;  2FUL A;  4N5Q A;  3R7Q A;  1OY3 D;  4W9R A;  4M7C A;  3DEP A;  3CVX A;  3ML9 A;  3D9H A;  4A3V A;  1QBQ A;  5AAO A;  4HFG A;  3GZ1 A;  2L6J A;  1E8Y A;  3QWW A;  4BY6 A;  2DWZ A;  3MYV A;  3SO8 A;  3LDZ A;  1NA3 A;  4U0U A;  3RK6 A;  1H0A A;  2I9C A;  4A1G A; 
#chains in the Genus database with same CATH homology
 4B94 A;  5ARF A;  4GMJ A;  2E0I A;  5LCW J;  3VTX A;  3R7R A;  2XRZ A;  4LEU A;  4GPK A;  3Q5M A;  4PS8 A;  2OV8 A;  5T3R A;  2WXH A;  4Q69 A;  4Y6W A;  4I9C A;  5T4Y A;  2OVF A;  4ME2 A;  2J07 A;  4BX8 A;  3KS2 A;  1E7U A;  5FT9 A;  4HOT A;  3QJZ A;  2CHW A;  4DLQ A;  3SFZ A;  1E7V A;  3ZRH A;  4HOU A;  4ABN A;  4XI0 A;  3APF A;  4NUR A;  4A3T A;  3EDT B;  3PEU B;  5D0O D;  3FDH A;  3PZD A;  3ASH A;  3PRE A;  4JXT A;  4N3C A;  2UWJ G;  3LY8 A;  2WVI A;  2X6H A;  3RKV A;  5AIJ A;  5C1D A;  4U04 A;  1IQR A;  4BX9 A;  2OVB A;  3ZHE B;  3ESL A;  3HVE B;  3SNX A;  2XGO A;  2PM7 A;  3RU0 A;  1TJF A;  2WQ6 A;  3CKB A;  3LVR E;  3G2S A;  5J08 A;  4U0S A;  2VQ2 A;  4KVM A;  1UN8 A;  3LJ3 A;  4KBQ A;  2WB2 A;  2J4D A;  4TRQ A;  3ZXS A;  1OWO A;  4EEC A;  3PDN A;  5G05 J;  3S7B A;  1ELW A;  3HDX A;  1VDY A;  3S7J A;  5EDS A;  3DBS A;  1DNP A;  5FWQ A;  1A17 A;  2KCL A;  1LF8 A;  1E96 B;  4G25 A;  4GU5 A;  4PDX A;  4XI9 A;  2LAH A;  2XPY A;  3G2U A;  3KD7 A;  4APF A;  3CVY A;  4UI9 J;  3SBT B;  5AEN A;  4WNF A;  2IOL A;  4N2Q A;  4ANV A;  3TGO A;  1MQS A;  1BPO A;  1QQE A;  3C98 A;  3D9N A;  3CIA A;  3TL5 A;  4RSY A;  1OWN A;  3FFL A;  3VTY A;  4KT6 B;  5C2Y A;  3CST A;  3MCX A;  4IYP A;  2IFU A;  2JLB A;  2VYI A;  4DI3 A;  2C0L A;  2VSO E;  3FTX A;  2J49 A;  3IHV A;  3JYS A;  3ZYQ A;  4AOF A;  4UQY A;  4AV7 A;  2CFU A;  2OOE A;  5G04 C;  1EPU A;  4OYS A;  4BWR A;  4DJA A;  2WXF A;  4MLP A;  4CDN A;  3RIB A;  4ATG A;  4LCT A;  1E90 A;  4BT8 A;  2IOS A;  3CEQ A;  4KVO A;  3T8M A;  4I1O B;  4NQ0 A;  4R7L A;  3S7D A;  3O4Z A;  1HXI A;  2X3M A;  4IUL A;  1FVH A;  4L1B A;  4I2W A;  3ZVV A;  2VGX A;  3D9L A;  3BG1 B;  1INZ A;  2LNI A;  1E8Z A;  3OXG A;  3CVQ A;  2RD0 A;  4J0U A;  3ULQ A;  2XHE A;  4RVB A;  1WM5 A;  2KC7 A;  1H2U A;  4UQX A;  1ZBP A;  1E8X A;  3LCA A;  1HU3 A;  4WUY A;  3ZFW A;  4ANW A;  1OUV A;  2YNQ A;  3B7R L;  3PNL B;  2C0M A;  4N2S A;  3RJV A;  3PRZ A;  3APD A;  1H19 A;  4B89 A;  3URZ A;  4AEZ C;  2WXG A;  4I1M A;  3SGH A;  3CSF A;  4EPZ A;  4JL0 A;  3LS8 A;  2Y4T A;  4MRU A;  3NF1 A;  4N39 A;  2UY1 A;  4I6J A;  1FVF A;  3P2B A;  2VTB B;  3FUI A;  2CG3 A;  3FWV A;  4Q94 A;  3NZU A;  4KZC A;  4I6E A;  2P58 C;  4GML A;  2WXK A;  3MKQ A;  2QY7 A;  2I6H A;  4MS6 A;  5FQ6 A;  4GZ5 A;  4JZY A;  3ZGQ A;  1Z3Y A;  4H7Y A;  4URK A;  1PC2 A;  4Y6C A;  2IU1 A;  1HZ4 A;  4JA9 A;  1N52 A;  1EDU A;  4ILH B;  2PZI A;  3CHP A;  3KEZ A;  4EZK A;  3GZ2 A;  4QFV A;  2XPZ A;  3GW4 A;  2BTD A;  1DVP A;  2KZT A;  3FTV A;  3RRU A;  4JW1 A;  2ION A;  3CGH A;  3MKR A;  3TG4 A;  3ZIM A;  1GW6 A;  4EQF A;  2VSN A;  3G2V A;  4GCO A;  1QNF A;  4JHK A;  5ENN A;  3IEG A;  5CHE E;  5G04 J;  3I5P A;  5FQ4 A;  1WY6 A;  2L9B A;  1YA0 A;  5BT1 A;  3QAQ A;  2WXI A;  1FCH A;  3O48 A;  3EIJ A;  5BPP A;  5FQ8 A;  3FEX A;  3SHF A;  1IQU A;  2IQC A;  3GZS A;  4EZL A;  4LER A;  4GA1 A;  3EHN A;  3TAX A;  2JEK A;  2FF4 A;  3MV2 B;  1WAO 1;  4GAA A;  3FH7 A;  5M72 A;  3FUL A;  4ACK A;  4HS2 A;  2CHZ A;  2WMO A;  3ZW3 A;  2OND A;  4GZC A;  4FP7 A;  4L2Y A;  3FUE A;  3EIQ C;  3B7T A;  3FH8 A;  5KCM A;  5JJ6 A;  2X6I A;  1EYH A;  2AXU A;  1OWP A;  2MHK A;  3ESK A;  5BUZ A;  4G1T A;  2GRM A;  3FH5 A;  2WPV A;  2LSV A;  3QWV A;  3K9I A;  2X6J A;  4JVS A;  5ANL A;  2GW1 A;  3ZYL A;  2VSY A;  4WWP A;  3IV0 A;  4TUU A;  2WXM A;  4IRU A;  5KJK A;  4DPR A;  4EBA A;  4V3I A;  2VTB A;  2I2O A;  4HOQ A;  2DBA A;  4AM9 A;  3FU0 A;  3UT4 A;  4BSX A;  3Q15 A;  3ZEF A;  3Q4A B;  3I4R B;  4PUC A;  1P5Q A;  4E6H A;  4XE0 A;  3U4T A;  1H2V C;  4I2Z A;  1JUQ A;  3JQ1 A;  1ZU2 A;  5D0Q D;  1PAQ A;  3APC A;  3CHR A;  3FP3 A;  5T8I A;  3TXM A;  3I4G A;  2L0I A;  2XCC A;  3QC1 A;  4CT4 A;  2A4Z A;  4FUL A;  4B8A A;  2HR2 A;  4FJZ A;  4JC8 A;  4UQZ A;  4DI4 A;  4CGV A;  3B7U X;  3UPV A;  5E76 A;  2DIW A;  4NAC A;  1NP7 A;  2L0T B;  4CCA A;  1NZN A;  2NXP A;  4I43 A;  4I17 A;  2XCB A;  2HYZ A;  2J4B A;  3CVL A;  3VLE A;  3PVL A;  3KAE A;  4JEH A;  3TJP A;  3CVV A;  2VJ8 A;  2X6F A;  2WXP A;  5LFA A;  4GB9 A;  5ANR A;  3D9K A;  4WWO A;  3BEE A;  2WXQ A;  5G2N A;  3FU5 A;  5FZS A;  3FUF A;  4CRW A;  2FI7 A;  5LX8 A;  3QOU A;  1KT0 A;  2R59 A;  2YIN A;  2AXZ A;  3HIZ A;  4ILG A;  3CHO A;  3FY4 A;  4GZD A;  5KJM A;  2NC9 A;  2I1K A;  2BUG A;  2MRI A;  1Z3X A;  3FU6 A;  4DLO A;  4O6F A;  2IJG X;  2GRL A;  3CVP A;  3DPD A;  4FLH A;  2V4L A;  4YVO A;  3SI5 A;  1JPL A;  3QB2 A;  2R5S A;  4B0Z A;  1JWF A;  4FJY A;  4I1A A;  1XNF A;  3R9A B;  5J90 A;  3CK8 A;  4AY6 A;  2KCK A;  4I6G A;  3S2A A;  3LY7 A;  4G26 A;  4U07 A;  1TJC A;  3D3M A;  1SZA A;  4LUN U;  2X38 A;  5JHB A;  4YND A;  4GYW A;  4U8H A;  2LSU A;  3CV0 A;  1Y6I A;  4JHJ A;  4M3O A;  3HVE A;  3ZHE A;  4UWK A;  4AIF A;  3U66 A;  1W3B A;  4D10 C;  4K03 A;  1HG2 A;  2M63 A;  3EJN A;  3PUJ A;  3ASG A;  4C0M A;  3FTZ A;  1E8W A;  1H2T C;  1UG3 A;  3RO3 A;  4N3B A;  3L54 A;  3B7S A;  3CK7 A;  2XGM A;  4FU3 A;  4KZ0 A;  4BTB A;  4WNE A;  5G55 A;  3SBS A;  3LKU A;  3UUX A;  1JWG A;  3QAR A;  1HO8 A;  5FTP A;  3UT7 A;  4XX5 A;  1Y8M A;  3MV3 B;  2FO7 A;  4EBA G;  5LP0 A;  3UQ3 A;  5DIZ A;  4BFR A;  3AU5 A;  3T5V A;  3ML8 A;  3AS8 A;  2I1J A;  4FHK A;  2Y3A A;  3QDN A;  3SZ7 A;  4PH4 B;  2PM6 A;  3D9M A;  4WAF A;  3LVQ E;  3FUH A;  1HG5 A;  3FTW A;  4L7T A;  4GZ6 A;  3NZS A;  2E2E A;  5FZQ A;  5HQ8 A;  2WXJ A;  3OAW A;  4UWL A;  2EQX A;  4ANU A;  5G05 C;  4J8F A;  3CQC B;  2XRY A;  2MOW A;  1UW4 B;  5AJL A;  2KM4 A;  2PQN A;  4IN3 B;  3MJW A;  5E75 A;  2AXV A;  3RO2 A;  4TV3 A;  2HM8 A;  1U3D A;  2RG8 A;  2XQ0 A;  1KT1 A;  4WWN A;  4C9B B;  3PE4 A;  3QKY A;  1S0P A;  3FUJ A;  2AVP A;  2Y4U A;  3G2W A;  2WXR A;  5LOZ A;  2WQ7 A;  3E4B A;  3AS4 A;  4HXI A;  2AWI A;  4HVB A;  4WNG A;  3MX3 A;  4FA6 A;  2J08 A;  3TG5 A;  4G2V A;  3CHM A;  1UJJ A;  3IBE A;  4AJW A;  2YQ8 A;  1HF8 A;  4GA2 A;  4G24 A;  3SD5 A;  4G11 A;  3SF4 A;  3PS6 A;  5CCM A;  4FHJ A;  2WXL A;  3FUM A;  4BTA A;  3LY9 A;  4XKB A;  4CT0 A;  1UJK A;  2WXN A;  3CHQ A;  2FBN A;  3CHS A;  3HHM A;  2VSX E;  3L13 A;  4UI9 K;  4J6I A;  4J8E A;  3FU3 A;  4CDM A;  5DBK A;  4J8D A;  4XIF A;  3Q49 B;  2IF4 A;  3AS5 A;  5KJL A;  4Q96 A;  5FZR A;  2XPI A;  3EHM A;  4B8C B;  3L6A A;  2VGX B;  3N71 A;  3L16 A;  3IHY A;  2BF0 X;  1SZ9 A;  1TEZ A;  1B89 A;  3L17 A;  4CDR A;  2J9Q A;  3AU4 A;  4RG9 A;  2FEZ A;  3ZYM A;  4DK5 A;  5ARG A;  1Z6T A;  4L23 A;  1N54 A;  4L2L A;  4PS7 A;  3ZN3 A;  3ZPJ A;  3GYZ A;  2KCV A;  4EZJ A;  3LPZ A;  3OXL A;  3FHE A;  4KYO B;  2LO6 A;  4A55 A;  2ZU6 B;  5BV0 A;  1KLX A;  2R17 C;  3L22 A;  1XGW A;  3IKO B;  1U3C A;  4GA0 A;  3D9J A;  5JHA A;  3FUN A;  1ELR A;  5CMW A;  3VLD A;  3ASF A;  4JPS A;  3U3W A;  3NQP A;  4GYO A;  3BG0 B;  3T5X A;  2CHX A;  1EF1 C;  3PEV B;  4ILI A;  1H6K A;  4AP2 A;  4BT9 A;  2UY1 B;  3CLJ A;  5CMY A;  1ELK A;  2PL2 A;  3CVW A;  3QWP A;  4E85 A;  5BV1 A;  4LRZ A;  3JUI A;  1HS6 A;  5BW8 C;  3MGB A;  4KXK B;  2KAT A;  1OWM A;  4JEU A;  3MKQ B;  5JJ7 A;  1UN9 A;  4CGW A;  4YVQ C;  3LXU X;  3ONK A;  2WXO A;  1X5B A;  3FEY A;  4U0Z A;  2V8S E;  2VGY A;  3FTS A;  3PH0 C;  3UT8 A;  1HX8 A;  3UX4 A;  3RRN B;  2AW6 A;  3FUD A;  2LAI A;  2NSZ A;  2GGF A;  3D9I A;  1SQM A;  5A7D B;  3VLF A;  4PS3 A;  2WMN A;  2WQH A;  3JCK C;  3L08 A;  2DCP A;  4UWF A;  5EKQ D;  2KZT B;  1L5J A;  3WXX A;  4JHR A;  4AVX A;  5LCW C;  3QK0 A;  4OVU A;  4FC8 A;  2QFC A;  2XEV A;  3OXF A;  2XGS A;  4GYY A;  4AXH A;  3D9P A;  5EX3 A;  3FUK A;  1IHG A;  3U9W A;  4KMO A;  4CEM A;  1PY1 A;  2WM9 A;  3JQ0 A;  5CCL A;  1NA0 A;  3FTU A;  1HH8 A;  3LEW A;  5EX0 A;  4JA7 A;  3QNK A;  5AYW D;  4XKC A;  4UWH A;  3LYA A;  4I9E A;  3RRM B;  3ZYK A;  5KJN A;  4F53 A;  4HOR A;  4WND A;  2YHE A;  3PNT B;  1IYG A;  4H7X A;  3TXN A;  3ASD A;  4N3A A;  2V0P A;  4GZ3 A;  4ANX A;  1HE8 A;  3MEK A;  3OTN A;  4GCN A;  2HO1 A;  5JJT A;  3MA5 A;  3UMV A;  4J8S A;  2CG2 A;  4P29 A;  4HLE A;  2FUL A;  3I3N A;  3Q47 B;  2J09 A;  3R7Q A;  5A6C A;  3PE3 A;  4W9R A;  3D9O A;  3CVU A;  3B13 A;  2ILR A;  3MZL B;  5A23 A;  3CVX A;  3ML9 A;  2PQR A;  3S7F A;  2X6K A;  4F1S A;  4UI9 C;  3HYM B;  4A3V A;  3FTY A;  4C0E A;  4AY5 A;  4RG6 A;  4HFG A;  4UWG A;  4F7A A;  4F3V A;  4FLB A;  3GZ1 A;  2L6J A;  3PUK A;  1E8Y A;  2CFZ A;  3QWW A;  4N5C A;  4BY6 A;  3CQG B;  3CR3 A;  3CVN A;  4U63 A;  5HI7 A;  5FJY A;  3ONL A;  4A1S A;  3G2T A;  4HOS A;  2V5F A;  3CKC A;  3MYV A;  4APO A;  2C2L A;  3P1U A;  1MHQ A;  4FAD A;  3ENE A;  2Q7F A;  2A5U A;  4G23 A;  3LDZ A;  4NRH B;  5FQ7 A;  1HFA A;  1NA3 A;  4MKT A;  5BNW A;  3U64 A;  3CK9 A;  2YHC A;  4OVV A;  4U0U A;  3RK6 A;  4K0R A;  1H0A A;  4XZ4 A;  1OWL A;  2I9C A;  4A1G A;  4ACL A;  1QZ2 A;  5AJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...