4NRHB

Copn-scc3 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
170
structure length
170
Chain Sequence
MSHLNYLLEKIAASSKEDFPFPDDLESYLEGYVPDKNIALDTYQKIFKISSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A gatekeeper chaperone complex directs translocator secretion during type three secretion.
pubmed doi rcsb
source organism Chlamydia pneumoniae
molecule tags Chaperone/protein binding
molecule keywords CopN
total genus 60
structure length 170
sequence length 170
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4nrhB00
3VTYA 5FZQA 1ZU2A 2C0MA 3QKYA 3ASHA 3NF1A 4UQYA 3ZN3A 5A6CA 1OUVA 3KS2A 2XGSA 4N3CA 2KATA 4HOTA 4HOUA 1NA3A 2XCCA 4H7XA 4UQZA 4A1SA 3RO3A 3EDTB 1ELRA 4UQXA 1ELWA 2FF4A 2PQNA 3LYAA 4J0UA 1ZBPA 4WUYA 3LPZA 5FZRA 3QWVA 4KXKB 4U0SA 4H7YA 3ZHEB 1HH8A 2AVPA 4G24A 2WPVA 3KD7A 4GA1A 4F3VA 2Q7FA 1Y8MA 2P58C 2HYZA 3LY9A 2J9QA 2C0LA 1WM5A 4U0ZA 2FO7A 2UWJG 4GYWA 4GYYA 4WNGA 3S7FA 3KAEA 2V5FA 3IEGA 4JA9A 4WNFA 3RJVA 4G2VA 2JLBA 3S7JA 2BUGA 4U07A 1IYGA 2KCKA 4G25A 3OXFA 1KLXA 2FI7A 2KCVA 2PZIA 4J8EA 4N39A 4UI9K 3ESKA 4YVOA 4BT8A 4UI9J 4W9RA 2YHCA 4JL0A 5HI7A 5EX0A 3RIBA 4BTAA 3CEQA 5JJ7A 4NRHB 2YQ8A 5EX3A 2XEVA 4I9CA 3PDNA 4N3AA 2UY1A 1TJCA 1KT0A 1WAO1 2Y4UA 5BNWA 5CHEE 3GYZA 4Y6CA 4GA2A 4LEUA 5KJNA 2LSUA 3BEEA 3CKCA 3MEKA 5CCMA 2VYIA 4J8FA 3OXGA 3Q49B 4Y6WA 1FCHA 3S7BA 3ZHEA 4APOA 1IHGA 3PE4A 3MKRA 4NQ0A 3QWWA 5JJ6A 2XGOA 2L6JA 3MV3B 3TAXA 1NZNA 3TG5A 4AM9A 4O6FA 4CGWA 4KYOB 4U0UA 2I6HA 2GW1A 1YA0A 5FZSA 5KJMA 5KJKA 3ASDA 4HOSA 4BT9A 5G05C 4BTBA 4HOQA 3CVQA 4U04A 4XI9A 4BWRA 5LCWC 5LCWJ 2R5SA 2VGYA 3R9AB 3OXLA 3UUXA 5AYWD 3QOUA 3FFLA 1HXIA 3AS8A 4WNEA 5D0OD 5ARFA 4GZ6A 1PC2A 3TGOA 2HO1A 3Q5MA 3TG4A 5KJLA 3ZGQA 4ME2A 4GPKA 1P5QA 2E2EA 4I9EA 3GW4A 3ZFWA 4G23A 5DIZA 4KBQA 3Q47B 5DBKA 2UY1B 3SZ7A 4I1AA 4G1TA 5CCLA 4N2SA 1NA0A 2IFUA 4G26A 2LSVA 2LNIA 5D0QD 3URZA 3K9IA 3CVLA 2FBNA 2VGXB 5FJYA 3MA5A 1QQEA 3CK9A 3LY7A 3Q4AB 5G04C 4GA0A 3S7DA 3AS4A 5FTPA 4XIFA 1A17A 4AY6A 4IN3B 4XI0A 3QWPA 3WXXA 4CDRA 3CV0A 4EQFA 3JYSA 2KC7A 3ZPJA 3RO2A 3CVPA 3ULQA 3GZ1A 4AIFA 2MHKA 3CK8A 2DBAA 2WQHA 2PL2A 4YNDA 4GCOA 3VTXA 2XGMA 5BW8C 4CGVA 2VQ2A 5M72A 5JJTA 3U4TA 3LY8A 2KCLA 2XCBA 3LCAA 1HZ4A 3QDNA 4GYOA 2ONDA 4J8DA 2FEZA 3N71A 4GZ5A 4N3BA 4I2ZA 5G04J 1E96B 3RKVA 2C2LA 4ABNA 4B94A 4HORA 4N5CA 3AS5A 3UQ3A 4N2QA 1QZ2A 3LKUA 3SF4A 5C1DA 3GZ2A 5EKQD 2XPIA 3FP3A 4I2WA 5ARGA 2NC9A 4GZ3A 3ASGA 4JHRA 3CK7A 3O48A 5BT1A 5FT9A 3U3WA 2QFCA 2PQRA 1B89A 3FWVA 1XNFA 3HYMB 4UI9C 2VSYA 2VSNA 3MV2B 3CKBA 4WNDA 3E4BA 4RG6A 4GCNA 4YVQC 4AY5A 3CVNA 5G05J 3ASFA 5A7DB 4RG9A 2IF4A 1KT1A 1W3BA 3RU0A 5HQ8A 2OOEA 3UPVA 2HR2A 2VGXA 3PE3A 4JA7A 3Q15A 4I17A 2Y4TA
chains in the Genus database with same CATH superfamily
2KXPC 3VTYA 5FZQA 3QKYA 4U8VD 2EIME 3MGBA 2V8SE 1OUVA 4HVBA 4G8LA 5FINA 4JW1A 2VSOE 2H6FA 1N4PA 2ILRA 1DNPA 1FPPA 3LY9A 2Y0BG 5JHAA 1WY6A 4L9PA 4WNFA 4TXRA 2EQXA 3FUDA 3CVWA 2YHCA 5ANRA 1U2VG 4L2YA 5BNWA 2NXPA 5J90A 5LFAA 2GRLA 3ESLA 5BV1A 3SY2A 3MV3B 2BEDA 3AU5A 3Q75A 4ZFHA 4I6GA 1Y6IA 3F6QA 4OVUA 4X8QA 2WXPA 3Q4AB 3L22A 3HXEA 4LRZA 3GZ1A 2A4ZA 2YINA 2ZGDA 4JC8A 1HFAA 1HZ4A 4OAVB 4J8DA 2H6GA 1EF1C 2DCPA 1UOHA 3CVUA 1NFIE 1QYMA 2QFCA 4WNDA 4DLQA 5KNGA 3CHSA 1Z5SC 4YVQC 4AY5A 2AW6A 5A7DB 3UT8A 3E32A 4U96D 1KT1A 3QAQA 4TXQA 4ZHBA 3FUEA 2CHXA 4M7CA 2V5QC 4JB8P 2AXUA 4B89A 3RRUA 3JQ0A 3KEAA 3QWVA 3UM0A 1H6PA 3B7BA 1N52A 2WPVA 3JUEA 2WQ7A 4U0ZA 2A5EA 3IEGA 3RJVA 4U07A 5T4YA 2IQCA 4UI9K 1OCRE 2MYOA 1K1AA 4XE0A 4DRXE 1E8XA 1H0AA 1FVHA 4APFA 3L08A 2L6BA 3FEXA 4GTSA 4HOSA 2A5UA 3PH0C 4HOQA 5G05C 4BWRA 5LCWC 1NI1A 2X6JA 5AYWD 4BFRA 2GRRB 1TEZA 5EN5D 2E2EA 1HG2A 3S2AA 2DVWA 2IFUA 2XPZA 4NACA 3HXCA 1JCSA 3QB2A 1IKND 3NB2A 3ULQA 2B0OE 1HX8A 2XS8A 5EYLA 3L54A 3EHNA 3VTXA 4Q94A 1FT1A 2C2LA 4C0EA 3LKUA 1TNZA 3FTUA 3W9GA 3LEWA 4JHRA 3Q9NC 3EU9A 3QC1A 3R7QA 3UIOC 4HBDA 1W3BA 2Y4TA 1BPOA 3D3MA 3DSWA 1MZCA 4LCTA 5CERB 4UQZA 4UQXA 3OTNA 5EILA 3AJIA 5BXUA 4F3VA 2QYJA 3G2VA 1N11A 2R17C 4HRNA 2JLBA 4J8SA 3HHMA 3CVYA 3EUVA 3D9JA 4J8EA 4RVBA 3MZLB 4JL0A 5HI7A 3D9IA 5EX3A 3EHMA 1WAO1 4AP2A 4PDXA 5CCMA 3TL5A 3ZHEA 3D9OA 3FH8A 4K5AB 3DSUA 3E37A 4E85A 2IU1A 5KJMA 2WXKA 3JUIA 4BTBA 4KVMA 3UUXA 2XEEA 3QOUA 4LNGA 1YYHA 2H6IA 2GRPB 5D0OD 3TG4A 3IHVA 5DBKA 4GMRA 3K9IA 3D9KA 3MA5A 2CHWA 3L9TA 4CYMD 2ZXWE 3J5QB 3ASOE 4N5QA 4GTRA 4ACLA 5HKPA 3DXKG 1ZB1A 3DPDA 3FU0A 3JQ1A 5JJTA 1MX2A 1TN7A 4I2ZA 2X6KA 3D9NA 4EPZA 4I2WA 2DYRE 2IJGX 4MRUA 2ZISA 1OWLA 4JXTA 3ASFA 4WWNA 5ANLA 4JA7A 4I17A 4UWGA 4TRQA 4I1MA 1D9SA 2R59A 3KS2A 3SQVA 1E8WA 3T5XA 2YNQA 3QJZA 4LG6A 3UM1A 3MJWA 3VLFA 1Y8MA 5BUZA 3ZUVB 1WM5A 4GYYA 4AOFA 3UT4A 3UM2A 4FLHA 2PZIA 4MBGA 3C3QA 4W9RA 4BTAA 3RIBA 1OWMA 1FVFA 3PS6A 2J4DA 3DEOA 1JCRA 3OXGA 5AN8A 3ZKJA 2XGOA 2L6JA 2GW1A 2LO6A 3ASDA 1TN8A 4WNEA 3ZXPA 3DSSA 3PZ2A 4FP7A 2GROB 3CK9A 5E76A 3CQGB 3B95A 1UG3A 3CVPA 3CK8A 4DI4A 2KCLA 4KZ0A 4YDYA 2WVIA 1PY1A 4B94A 1O5MA 3FP3A 2V0PA 3C98A 2NC9A 2F8YA 1RZ4A 3BQOA 2RFAA 3PZ1A 4BETA 5ENTD 3ASHA 1KZPA 4DUIA 5EYPF 2CG3A 1BLXB 4QFVA 5G55A 5AIJA 4F6RD 4E6HA 2HE0A 4A55A 2FO7A 2WMNA 1LF8A 3BU8A 3PNLB 3C5RA 2P9UG 1X5BA 3EJNA 4TUUA 5LCWJ 3PZDA 3UX4A 3FFLA 3TWSA 4L2LA 5CRVA 2WB2A 4ME2A 4YDOA 4G26A 4NIKA 4EECA 2P9NG 4UWFA 3HVEA 2E0IA 4AY6A 3CV0A 2WXRA 4FHJA 4DI3A 4YDEA 4EZLA 1Z3XA 3N71A 4GZ5A 4HORA 3SF4A 1O1SA 3GZ2A 2XENA 3Q78A 2PNNA 3FY4A 5FT9A 1JWGA 4CEMA 3G2WA 2OOEA 3UINC 5J08A 3SFZA 2XGSA 1NA3A 4GAAA 1ELRA 1IXVA 4U8YD 2EILE 2CG2A 3KD7A 3C3RA 2LXMA 2YHEA 5HS0A 2I2OA 3ISMC 1D8DA 3D9PA 3S7JA 1IYGA 2L9BA 5AJLA 2FI7A 3B7UX 4YVOA 2ZIRA 4BX9A 2YQ8A 4HQDA 2VJ8A 4LEUA 4Y6CA 4BEPA 5AARA 2EIKE 1VDYA 4APOA 3DWLG 2I1KA 5B1AE 5BXOA 2J4BA 3D9MA 2RG8A 1HG5A 4LERA 4DX7D 3DEPA 3TGOA 3FTWA 1P5QA 2X38A 2J08A 5C2YA 3SZ7A 3UM3A 3CSFA 5FQ7A 3JYSA 2KC7A 2L0IA 3RO2A 3DSVA 2DZOA 3FTYA 4GYOA 2EINE 3UT7A 4UWKA 2XEHA 5EKQD 1OWOA 1L5JA 5LX8A 2PQRA 1SQMA 4LNBA 2PM7A 4AJWA 2IY0C 2R05A 2J49A 3W9FA 2ETAA 4FLBA 4KMOA 4LSZE 2FF4A 2J07A 4J0UA 1N54A 5CMYA 2M63A 3L16A 4H7YA 3RSEG 4GTTA 4EHMA 1H6KA 4F53A 2J9QA 1MJ0A 4M3OA 3EHQA 2Y69E 4CCAA 3TWTA 2P2CP 2RFMA 3EIJA 1NP7A 4I9CA 4R7LA 3D9LA 2Y4UA 2H6HA 3BEEA 4NURA 1JCQA 3QNKA 3HRAA 3T8MA 5CBOA 2QZAA 4Y6WA 4XZ4A 3PE4A 3R9MA 2JABA 4CGWA 2AWIA 2X6HA 5CEAA 4U04A 4AM9A 3BG1B 1QBQA 4I1OB 5KJLA 4K03A 4K5CA 2AXVA 4I9EA 3GW4A 2VTBA 3DPYA 3Q47B 4N2SA 2WMOA 2LSVA 4C9BB 4CDMA 4GZCA 3FUJA 1IQUA 3AS4A 3HXBA 3PEUB 4XI0A 4AV7A 3ZPJA 4U95D 4CGVA 3MKQB 4ILHB 3LY8A 3U4TA 2NSZA 1K3ZD 5ENOD 3UQ3A 5C1DA 4RSYA 1LTXA 2XPIA 2P9IG 4DJAA 3CHRA 3CK7A 3O48A 2OEVA 2VSXE 4J8YA 5EIDA 4UI9C 4WAFA 2AXZA 1S63A 1LD8A 2XQ0A 3VLEA 3X2QE 5FTPA 1WG0A 3ZN3A 4HOTA 4ANXA 4D10C 2PQNA 4U63A 3L17A 3TJPA 4KXKB 2AVPA 3PRZA 3ZXSA 4GTQA 4O60A 4RLYA 4CT4A 3AG3E 2P9PG 3B7TA 4C0MA 1V55E 3PDNA 3RK6A 1AWCB 5KJNA 3TWQA 3MEKA 4BY6A 3VLDA 4J8FA 1FCHA 3R7RA 1UN8A 4NQ0A 2L0TB 4ACKA 1H2TC 4Q96A 3U66A 2F37A 1XGWA 3CVQA 1WDYA 2XZDG 2BF0X 4B8AA 3ONLA 1MX6A 4O1OA 5D0QD 3CVLA 2QC9A 4A63B 5KNHD 1SVXA 4XKBA 5ENSD 1Q2ZA 3V79K 2XCBA 5JMND 3QK0A 2F0YA 2KM4A 5CMWA 2XRYA 3BUAA 4Z68A 1K1BA 3V2OA 3FWVA 1XNFA 4DX6D 3P2BA 2DYSE 1YCSB 3E4BA 3L82A 4B93B 2VTBB 2IF4A 2HR2A 3PE3A 3ABKE 1OWPA 4Q69A 1NL4A 1OY3D 4HOUA 2XCCA 1N4SA 4HI9A 3LYAA 2IO3C 2MRIA 3MYVA 4G24A 5D2MC 4GA1A 2P58C 4GMLA 3FH7A 1TNOA 1IHBA 4JA9A 4ATGA 4LNUD 2BUGA 3NOCD 2IO2C 4ANVA 4TV3A 5EX0A 3V31A 1N0QA 3IHYA 3ML9A 4J6IA 2LSUA 1E8ZA 1H19A 3S7BA 3SFYA 4O6FA 3LJNA 4OAUC 3PNTB 4BT9A 1OT8A 3OXLA 4QQIA 3SFXA 2I9CA 3I5PA 2LNIA 3LXUX 2DIWA 4XIFA 5IY5E 2XRZA 4YDWA 2HM8A 2VQ2A 3LCAA 5CRUA 1HF8A 3PZ4A 2FEZA 3ABLE 3AS5A 1X81A 5ARGA 1G3NB 2P9LG 3FUKA 1DC2A 3FU6A 3U3WA 2X6FA 3SBTB 3DXMG 3Q7FA 3GZSA 5G05J 5HQ8A 2X3MA 4G8KA 4JEHA 5AENA 4HRMB 5A6CA 2GGFA 3E30A 4AEZC 4BESA 3LPZA 1U3DA 2Q7FA 2FO1E 4URKA 4IULA 3UKRG 4GYWA 2EIJE 1EYHA 4AVXA 3TWVA 4G25A 3L6AA 2I1JA 4CZ2D 3BG0B 4UI9J 4GU5A 3CEQA 3ZVVA 1Z6TA 4N3AA 1TJCA 3RRNB 3SBSA 3HDXA 3FTZA 3JXIA 3TG5A 3CHPA 4EZKA 4KYOB 3FHEA 3C3OA 5FZSA 3R9AB 4PS8A 2WXOA 1PC2A 4JZYA 2JEKA 4DX2A 4EBAG 2XZTG 2P9SG 5FIOA 4GA0A 3ZIMA 4DLOA 4CDRA 1D8EA 4GCOA 1IQRA 2XGMA 5BW8C 3T8KA 3UI2A 1MYOA 1E96B 3P1UA 3ENEA 4V3IA 5E75A 5BT1A 3NQPA 4GTMA 3SGHA 3U9WA 4BX8A 1U3CA 5BV0A 5LOZA 3KEZA 3B13A 3Q7AA 4YNDA 2KBXA 5EIBE 3FEYA 3CGHA 2J09A 3KSLA 3CVXA 1ELWA 3V2XA 3JCKC 1HH8A 3FDHA 4HXIA 3U64A 3HIZA 3DSXA 3PZ3A 1EDUA 4HRLA 4CT0A 4EZJA 3ESKA 4MLPA 4U7EB 1KT0A 4MKTA 3FU3A 4XEIG 4P29A 2WXMA 1N0RA 3QWWA 2KZTB 5HRYA 2Y3AA 2OVBA 3JXJA 3NZUA 1INZA 5AQ7A 3ZYLA 3J5PA 2J8SD 4DPRA 4GPKA 3ZRHA 3ZFWA 1O1RA 4KBQA 3FUNA 3SD5A 3URZA 4F1SA 5ENPD 2VGXB 5FJYA 3LY7A 3ZYKA 3DRAA 4DX5D 4MS6A 3WXXA 1TNBA 2OVFA 4AIFA 3PUJA 3ULEG 2PL2A 4LUNU 3SHFA 5M72A 3L13A 1PAQA 1N4QA 4A3VA 4XKCA 1KZOA 4GZDA 4UWHA 4GZ3A 3NAWA 4G11A 1B89A 3EHRA 2WXIA 4GTOA 4RG6A 4JVSA 5AQ9A 3ZW3A 3MCXA 3T9KA 3RU0A 5JHBA 3Q15A 4I6EA 3I4RB 1MQSA 3CHQA 4N3CA 4JD2G 3EDTB 4BT8A 1BI8B 3E34A 4HLLA 1UN9A 2ETBA 4IYPA 2P9KG 3O4ZA 2WM9A 2UWJG 4WNGA 3LDZA 1JPLA 3OXFA 1KLXA 3LVRE 4FC8A 4TUMA 3T5VA 4WWPA 5G2NA 4B0ZA 3V30A 1N9AA 2UY1A 1HO8A 5T3RA 5CHEE 2IOSA 2B6CA 2BKKB 5ENQD 4HB5A 3TAXA 3I3NA 4U0UA 1YA0A 4EBAA 3APDA 3APFA 4L7TA 4PUCA 5A23A 2F8XK 1HXIA 4GZ6A 3Q5MA 3Q9UC 1EPUA 3RRMB 4IRUA 1O1TA 2R2LA 4EQFA 2IEJA 3UTMA 4KZCA 4GPMA 2R03A 3LVQE 1TJFA 5AQBA 5EDSA 4L23A 2KZTA 3G2UA 2BTDA 4HNAD 2WXHA 1UJJA 2V4HC 5FQ4A 1TNYA 4GCNA 3UPVA 2VGXA 3AAAC 3Q79A 2OV8A 1ZU2A 3TWXA 3NF1A 3E33A 2LAIA 3UKUG 3AG4E 1UW4B 1HE8A 3DSTA 1ZBPA 1SZ9A 3ZHEB 1TNUA 3SNXA 3FUFA 5FWQA 4OYSA 1MHQA 2ZU6B 1JUQA 2WXLA 1S64A 4NRHB 2XEVA 4GA2A 2CHZA 5B3SE 1SA5A 3CQCB 3ONKA 1NZNA 4K5BA 3IXEA 3NOGD 2QY7A 1MX4A 2I6HA 4KT6B 5KJKA 3ZYMA 5JA4D 5AJDA 2OEWA 5KCMA 5DIZA 5CCLA 4G1TA 4XX5A 3PVLA 4JHJA 2FBNA 2WXJA 5G04C 1QQEA 4PS3A 3SO8A 1S0PA 4GTVA 3APCA 2WQHA 2XHEA 3TXMA 4U8HA 1OXJA 3CIAA 4JHKA 3QDNA 2WQ6A 4HI8A 1QZ2A 3EU5A 1OWNA 4GTPA 4AXHA 2LUHA 2WXQA 4RQIA 3MV2B 2IOLA 3HG0D 2VGEA 1A5EA 4RG9A 1LD7A 2GRNB 1SA4A 1H2VC 5ENRD 3MKQA 3G2SA 5AQAA 3ZEFA 4H7XA 3RO3A 4CRWA 5FZRA 1K8KG 1N95A 3IV0A 3FUHA 3B7RL 2XPYA 3DBSA 3Q73A 1OCZE 4WWOA 1N94A 2LXLA 4G2VA 4A3TA 2KCKA 2MOWA 4FA6A 2AJAA 3GYZA 4HLEA 3FTXA 4BSXA 1IHGA 2IONA 5ENNA 4HFGA 3CSTA 1HS6A 4XI9A 1AP7A 2HO1A 4ANUA 1BD8A 1OCCE 3WG7E 3TWUA 4I1AA 3AU4A 3FTSA 4FULA 1Z3YA 4FHKA 4ATZD 3IBEA 3UXGA 2OCCE 2RD0A 2CFZA 2DBAA 5H7PA 3ML8A 5ITZF 2GRMA 3RKVA 2LAHA 3D9HA 3ULYA 2BKGA 1V54E 4I43A 1QNFA 3FULA 4ILGA 2RKKA 4PS7A 2QYUA 4UUCA 2C0MA 4ILIA 4GB9A 3ABME 2KATA 4FJZA 1SW6A 3CR3A 1DCEA 3HXFA 4JPSA 4U0SA 5LP0A 3IKOB 2HYZA 2C0LA 2WXFA 3S7FA 2V5FA 1H2UA 1TYQG 2KCVA 3ZU7B 1E7VA 5T8IA 5JJ7A 3HXDA 4A1GA 4F1PA 3HVEB 4OVVA 5FQ6A 3ZYQA 4ANWA 3MKRA 5JJ6A 5BPPA 4J7WA 3I4GA 3FU5A 3QARA 1E8YA 2VGYA 2CFUA 2ZGGA 5ARFA 2DZNA 3FTVA 2R02A 4G23A 3SI5A 1N4RA 3NZSA 2UY1B 3PREA 4GMJA 1NA0A 1SZAA 3S7DA 3QWPA 1YMPA 5KBAA 3G2TA 1TR4A 3FH5A 4FJYA 3CVVA 4I6JA 2ONDA 1GW6A 4N3BA 4N2QA 4N5CA 3CHMA 2GRQB 3ASGA 2NYJA 3LS8A 1S70B 2X6IA 3CKBA 1KPSB 3TXNA 1BU9A 2FULA 3MX3A 3NBNB 3PUKA 1HU3A 3FUMA 2ETCA 1E90A 3B7SA 3TWWA 3KSQA 4UQYA 1TN6A 4BSZB 4A1SA 4WUYA 2V4LA 5KWDA 5B1BE 1BI7B 1UJKA 4HS2A 4DK5A 3OAWA 3UMVA 5AAOA 3KAEA 4F7AA 4JEUA 1OCOE 3UIPC 4N39A 1E7UA 5CEDB 4B8CB 4C48B 2Y1LE 3PEVB 4UWLA 5CECB 3ASNE 3CKCA 2VYIA 1DVPA 4PH4B 3CHOA 3Q49B 4TXPA 3EIQC 1H6OA 3AG1E 4DX1A 2R5SA 1DCQA 4FADA 3AS8A 1RW2A 3ZGQA 3C72A 4L1BA 2PM6A 1JWFA 3CLJA 3FUIA 1A17A 4IN3B 5CBNA 2MHKA 4CDNA 1ELKA 5G04J 4ABNA 2XS1A 4O1PA 3RAUA 3LJ3A 3ZNGA 5D66A 4FU3A 4BERA 2WXGA 4KVOA 3HYMB 3AG2E 2VSYA 2VSNA 3CVNA 5FQ8A 2DWZA 2WXNA 3TWRA 4K0RA 1FT2A
chains in the Genus database with same CATH topology
2OV8A 3VTYA 5FZQA 1ZU2A 1OWPA 3QKYA 3ASHA 4Q69A 3MGBA 3NF1A 2LAIA 2V8SE 1OUVA 5M72A 1UW4B 4HVBA 4HOUA 2XCCA 2CG3A 1HE8A 3LYAA 1ZBPA 2VSOE 4JW1A 4QFVA 5G55A 1SZ9A 3ZHEB 2MRIA 3MYVA 4G24A 5AIJA 4GA1A 4E6HA 2ILRA 1DNPA 2P58C 3SNXA 4A55A 3FUFA 5FWQA 3LY9A 4GMLA 4OYSA 3FH7A 1MHQA 5JHAA 2FO7A 2ZU6B 1WY6A 2WMNA 4JA9A 4WNFA 4ATGA 2BUGA 1JUQA 1LF8A 2WXLA 4TV3A 4ANVA 2EQXA 3FUDA 3CVWA 2YHCA 5EX0A 5ANRA 4NRHB 2XEVA 4L2YA 5BNWA 2NXPA 3PNLB 5J90A 4GA2A 2CHZA 3IHYA 3ML9A 4J6IA 5LFAA 2GRLA 3ESLA 2LSUA 1E8ZA 1H19A 3S7BA 1X5BA 3CQCB 5BV1A 3EJNA 3ONKA 3MV3B 1NZNA 4O6FA 2QY7A 3AU5A 2I6HA 4TUUA 4KT6B 5KJKA 3PNTB 4BT9A 5LCWJ 4I6GA 1Y6IA 3PZDA 3UX4A 3OXLA 3ZYMA 3FFLA 4L2LA 5AJDA 2WB2A 4ME2A 4OVUA 2WXPA 5KCMA 5DIZA 5CCLA 2I9CA 4G1TA 3I5PA 4G26A 4XX5A 2LNIA 3PVLA 4EECA 4JHJA 2FBNA 2WXJA 4UWFA 5G04C 1QQEA 3HVEA 3Q4AB 3L22A 2E0IA 4PS3A 3LXUX 2DIWA 4XIFA 1S0PA 4AY6A 4LRZA 3CV0A 3APCA 3GZ1A 2XRZA 2A4ZA 2YINA 2WQHA 2WXRA 2XHEA 4FHJA 4U8HA 4JC8A 3TXMA 4DI3A 2HM8A 2VQ2A 4EZLA 3CIAA 1HFAA 1Z3XA 3LCAA 1HZ4A 4JHKA 3QDNA 2WQ6A 1HF8A 4J8DA 2FEZA 3N71A 4GZ5A 1EF1C 2DCPA 4HORA 3AS5A 1QZ2A 3SF4A 1OWNA 3GZ2A 5ARGA 3CVUA 3FUKA 3FU6A 4AXHA 3FY4A 5FT9A 3U3WA 2QFCA 2X6FA 2WXQA 3SBTB 4WNDA 3MV2B 1JWGA 2IOLA 4CEMA 4DLQA 3G2WA 3CHSA 3GZSA 4YVQC 4AY5A 5G05J 2AW6A 5A7DB 3UT8A 4RG9A 1KT1A 2X3MA 5HQ8A 2OOEA 3QAQA 1H2VC 3MKQA 4JEHA 5AENA 5J08A 3FUEA 3SFZA 2CHXA 3G2SA 5A6CA 2XGSA 2GGFA 3ZEFA 1NA3A 4GAAA 2AXUA 4H7XA 3RRUA 3RO3A 4B89A 1ELRA 3JQ0A 4CRWA 5FZRA 4AEZC 3LPZA 3QWVA 2CG2A 1U3DA 3IV0A 3FUHA 3B7RL 1N52A 2WPVA 3KD7A 2YHEA 2Q7FA 2XPYA 3DBSA 4URKA 4IULA 2WQ7A 2I2OA 4WWOA 4U0ZA 3D9PA 4GYWA 1EYHA 3S7JA 3IEGA 3RJVA 4AVXA 4G2VA 4U07A 4A3TA 5T4YA 2KCKA 4G25A 2IQCA 2L9BA 2FI7A 3B7UX 3L6AA 2MOWA 2I1JA 4UI9K 4YVOA 3BG0B 5AJLA 4UI9J 4GU5A 4FA6A 4BX9A 3CEQA 3ZVVA 1Z6TA 2YQ8A 4N3AA 1TJCA 3GYZA 4Y6CA 2VJ8A 4LEUA 3RRNB 4XE0A 3SBSA 3HDXA 4HLEA 3FTXA 1E8XA 4BSXA 3FTZA 1VDYA 4APOA 1H0AA 1FVHA 1IHGA 4APFA 3L08A 2I1KA 2IONA 3TG5A 3CHPA 4EZKA 3FEXA 2J4BA 4KYOB 3D9MA 5ENNA 2RG8A 3FHEA 4HFGA 5FZSA 3CSTA 4HOSA 2A5UA 3PH0C 4HOQA 1HS6A 4XI9A 1HG5A 4LERA 5G05C 4BWRA 5LCWC 3R9AB 2X6JA 4PS8A 5AYWD 2WXOA 1PC2A 4JZYA 2HO1A 3FTWA 3TGOA 2JEKA 4ANUA 4BFRA 1TEZA 1P5QA 2E2EA 2X38A 2J08A 1HG2A 5C2YA 3SZ7A 4I1AA 3S2AA 3AU4A 3FTSA 2IFUA 4FULA 4EBAG 1Z3YA 2XPZA 4NACA 4FHKA 3CSFA 3IBEA 4GA0A 3ZIMA 4DLOA 5FQ7A 3QB2A 2RD0A 4CDRA 3JYSA 2KC7A 2L0IA 2CFZA 3RO2A 3ULQA 1HX8A 2DBAA 3L54A 3EHNA 4GCOA 1IQRA 2XGMA 5BW8C 4Q94A 3VTXA 3FTYA 3ML8A 4GYOA 3UT7A 2GRMA 4UWKA 3RKVA 2LAHA 1E96B 3P1UA 2C2LA 4C0EA 3LKUA 3ENEA 3FTUA 4V3IA 5EKQD 5E75A 1OWOA 3LEWA 4JHRA 1L5JA 5BT1A 3NQPA 5LX8A 3SGHA 2PQRA 1SQMA 3U9WA 4BX8A 4I43A 1U3CA 2PM7A 3QC1A 3R7QA 4AJWA 5BV0A 5LOZA 1QNFA 3FULA 3KEZA 1W3BA 4ILGA 3B13A 4PS7A 4YNDA 2Y4TA 1BPOA 3D3MA 2C0MA 3FEYA 2J49A 3CGHA 4ILIA 2J09A 4GB9A 4LCTA 2KATA 4FLBA 4FJZA 4KMOA 3CVXA 4UQZA 3CR3A 4UQXA 1ELWA 2FF4A 2J07A 4J0UA 3OTNA 1N54A 3JCKC 4JPSA 4U0SA 2M63A 3L16A 4H7YA 5CMYA 1HH8A 5LP0A 4F3VA 3FDHA 4HXIA 3U64A 1H6KA 3IKOB 2HYZA 3HIZA 4F53A 2J9QA 2C0LA 4M3OA 3G2VA 2WXFA 3S7FA 2R17C 2V5FA 4CCAA 2JLBA 4J8SA 1H2UA 3HHMA 1EDUA 4CT0A 3CVYA 2KCVA 3D9JA 4J8EA 4EZJA 3EIJA 3ESKA 4RVBA 3MZLB 4JL0A 5HI7A 4MLPA 1NP7A 3D9IA 1E7VA 5T8IA 5JJ7A 5EX3A 3EHMA 4I9CA 4R7LA 1WAO1 1KT0A 3D9LA 2Y4UA 4MKTA 4AP2A 4PDXA 4A1GA 3BEEA 3HVEB 3QNKA 4NURA 3FU3A 3T8MA 3TL5A 5CCMA 4P29A 4OVVA 4Y6WA 5FQ6A 3ZHEA 2WXMA 3ZYQA 4XZ4A 4ANWA 3PE4A 3D9OA 3FH8A 3MKRA 5JJ6A 3QWWA 5BPPA 2KZTB 4CGWA 2Y3AA 2OVBA 2AWIA 4E85A 2IU1A 5KJMA 2WXKA 2X6HA 3JUIA 3NZUA 3I4GA 4BTBA 4KVMA 3FU5A 3QARA 4U04A 1INZA 1E8YA 2VGYA 3UUXA 4AM9A 2CFUA 3ZYLA 3QOUA 3BG1B 5D0OD 5ARFA 4I1OB 3TG4A 5KJLA 4K03A 4DPRA 2AXVA 4GPKA 3FTVA 4I9EA 3ZRHA 3GW4A 3IHVA 4G23A 3SI5A 3ZFWA 3NZSA 4KBQA 3Q47B 5DBKA 2UY1B 3PREA 4GMJA 3FUNA 4N2SA 1NA0A 2WMOA 2LSVA 3SD5A 3URZA 4F1SA 3K9IA 4C9BB 1SZAA 2VGXB 3D9KA 3MA5A 5FJYA 4CDMA 3LY7A 2CHWA 4GZCA 3ZYKA 4MS6A 3FUJA 1IQUA 3S7DA 3AS4A 3PEUB 4XI0A 3QWPA 3WXXA 2OVFA 4AV7A 3ZPJA 4AIFA 3PUJA 4ACLA 2PL2A 3G2TA 4LUNU 3SHFA 3MKQB 3FU0A 3DPDA 4CGVA 3JQ1A 3L13A 4ILHB 3LY8A 3U4TA 2NSZA 3FH5A 5JJTA 4FJYA 1PAQA 3CVVA 4I6JA 2ONDA 1GW6A 4N3BA 4A3VA 4I2ZA 2X6KA 4XKCA 4N2QA 4N5CA 3CHMA 3D9NA 3UQ3A 4EPZA 5C1DA 4RSYA 4GZDA 2XPIA 4I2WA 4UWHA 4DJAA 2IJGX 3ASGA 4GZ3A 3CHRA 3CK7A 3O48A 4MRUA 3LS8A 4G11A 2VSXE 1B89A 1OWLA 4JXTA 4UI9C 2WXIA 2X6IA 3CKBA 4WAFA 3TXNA 2AXZA 2FULA 4RG6A 3MX3A 4JVSA 3ZW3A 3ASFA 4WWNA 3MCXA 2XQ0A 3PUKA 3RU0A 1HU3A 5ANLA 1IYGA 3VLEA 4JA7A 3FUMA 5JHBA 3Q15A 4I17A 5FTPA 4UWGA 4I6EA 4TRQA 4I1MA 1E90A 3I4RB 3B7SA 2R59A 1MQSA 4UQYA 3CHQA 3ZN3A 3KS2A 4N3CA 4HOTA 4A1SA 4ANXA 4D10C 3EDTB 4BT8A 4WUYA 2PQNA 1E8WA 4U63A 3L17A 3T5XA 2YNQA 2V4LA 3TJPA 4KXKB 3QJZA 2AVPA 1UJKA 3PRZA 1UN9A 3MJWA 4IYPA 3VLFA 1Y8MA 5BUZA 3ZXSA 4HS2A 3O4ZA 1WM5A 4DK5A 2WM9A 3OAWA 2UWJG 3UMVA 4GYYA 4WNGA 3KAEA 4CT4A 4F7AA 4AOFA 3UT4A 4JEUA 3B7TA 3LDZA 4C0MA 1JPLA 3OXFA 1KLXA 2PZIA 1E7UA 3LVRE 4FC8A 4FLHA 4N39A 4W9RA 3T5VA 4WWPA 5G2NA 4B0ZA 4BTAA 3RIBA 1OWMA 1FVFA 4B8CB 3PDNA 2UY1A 1HO8A 3RK6A 5T3RA 3PS6A 3PEVB 4UWLA 2IOSA 5CHEE 5KJNA 2J4DA 3CKCA 3MEKA 3VLDA 2VYIA 4BY6A 1DVPA 3OXGA 4J8FA 3CHOA 3Q49B 4PH4B 1FCHA 3EIQC 3R7RA 1UN8A 4NQ0A 2L0TB 2XGOA 2L6JA 3TAXA 4ACKA 3I3NA 4U0UA 1H2TC 4Q96A 2GW1A 1YA0A 4EBAA 3U66A 2LO6A 3APDA 3ASDA 3APFA 1XGWA 3CVQA 4L7TA 2R5SA 4PUCA 5A23A 4WNEA 1HXIA 3AS8A 4FADA 4GZ6A 2BF0X 3Q5MA 3ZGQA 4B8AA 1EPUA 3ONLA 2VTBA 4L1BA 3RRMB 2PM6A 4IRUA 5D0QD 4FP7A 3CVLA 3CK9A 1JWFA 3CLJA 5E76A 3CQGB 3FUIA 1A17A 4IN3B 4EQFA 1UG3A 3CVPA 2MHKA 3CK8A 4XKBA 4KZCA 4DI4A 3LVQE 2KCLA 2XCBA 1TJFA 4KZ0A 4CDNA 5EDSA 4L23A 2WVIA 3QK0A 1ELKA 5G04J 4ABNA 1PY1A 2KZTA 4B94A 3G2UA 2KM4A 2BTDA 5CMWA 2WXHA 2V0PA 3C98A 1UJJA 2XRYA 3FP3A 2NC9A 3LJ3A 4FU3A 2WXGA 4KVOA 3FWVA 3HYMB 1XNFA 2VSYA 2VSNA 5FQ4A 3P2BA 3E4BA 2VTBB 4GCNA 3CVNA 5FQ8A 2IF4A 3UPVA 2WXNA 2HR2A 2VGXA 3PE3A 4K0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTY A;  5FZQ A;  1ZU2 A;  2C0M A;  3QKY A;  3ASH A;  3NF1 A;  4UQY A;  3ZN3 A;  5A6C A;  1OUV A;  3KS2 A;  2XGS A;  4N3C A;  2KAT A;  4HOT A;  4HOU A;  1NA3 A;  2XCC A;  4H7X A;  4UQZ A;  4A1S A;  3RO3 A;  3EDT B;  1ELR A;  4UQX A;  1ELW A;  2FF4 A;  2PQN A;  3LYA A;  4J0U A;  1ZBP A;  4WUY A;  3LPZ A;  5FZR A;  3QWV A;  4KXK B;  4U0S A;  4H7Y A;  3ZHE B;  1HH8 A;  2AVP A;  4G24 A;  2WPV A;  3KD7 A;  4GA1 A;  4F3V A;  2Q7F A;  1Y8M A;  2P58 C;  2HYZ A;  3LY9 A;  2J9Q A;  2C0L A;  1WM5 A;  4U0Z A;  2FO7 A;  2UWJ G;  4GYW A;  4GYY A;  4WNG A;  3S7F A;  3KAE A;  2V5F A;  3IEG A;  4JA9 A;  4WNF A;  3RJV A;  4G2V A;  2JLB A;  3S7J A;  2BUG A;  4U07 A;  1IYG A;  2KCK A;  4G25 A;  3OXF A;  1KLX A;  2FI7 A;  2KCV A;  2PZI A;  4J8E A;  4N39 A;  4UI9 K;  3ESK A;  4YVO A;  4BT8 A;  4UI9 J;  4W9R A;  2YHC A;  4JL0 A;  5HI7 A;  5EX0 A;  3RIB A;  4BTA A;  3CEQ A;  5JJ7 A;  4NRH B;  2YQ8 A;  5EX3 A;  2XEV A;  4I9C A;  3PDN A;  4N3A A;  2UY1 A;  1TJC A;  1KT0 A;  1WAO 1;  2Y4U A;  5BNW A;  5CHE E;  3GYZ A;  4Y6C A;  4GA2 A;  4LEU A;  5KJN A;  2LSU A;  3BEE A;  3CKC A;  3MEK A;  5CCM A;  2VYI A;  4J8F A;  3OXG A;  3Q49 B;  4Y6W A;  1FCH A;  3S7B A;  3ZHE A;  4APO A;  1IHG A;  3PE4 A;  3MKR A;  4NQ0 A;  3QWW A;  5JJ6 A;  2XGO A;  2L6J A;  3MV3 B;  3TAX A;  1NZN A;  3TG5 A;  4AM9 A;  4O6F A;  4CGW A;  4KYO B;  4U0U A;  2I6H A;  2GW1 A;  1YA0 A;  5FZS A;  5KJM A;  5KJK A;  3ASD A;  4HOS A;  4BT9 A;  5G05 C;  4BTB A;  4HOQ A;  3CVQ A;  4U04 A;  4XI9 A;  4BWR A;  5LCW C;  5LCW J;  2R5S A;  2VGY A;  3R9A B;  3OXL A;  3UUX A;  5AYW D;  3QOU A;  3FFL A;  1HXI A;  3AS8 A;  4WNE A;  5D0O D;  5ARF A;  4GZ6 A;  1PC2 A;  3TGO A;  2HO1 A;  3Q5M A;  3TG4 A;  5KJL A;  3ZGQ A;  4ME2 A;  4GPK A;  1P5Q A;  2E2E A;  4I9E A;  3GW4 A;  3ZFW A;  4G23 A;  5DIZ A;  4KBQ A;  3Q47 B;  5DBK A;  2UY1 B;  3SZ7 A;  4I1A A;  4G1T A;  5CCL A;  4N2S A;  1NA0 A;  2IFU A;  4G26 A;  2LSV A;  2LNI A;  5D0Q D;  3URZ A;  3K9I A;  3CVL A;  2FBN A;  2VGX B;  5FJY A;  3MA5 A;  1QQE A;  3CK9 A;  3LY7 A;  3Q4A B;  5G04 C;  4GA0 A;  3S7D A;  3AS4 A;  5FTP A;  4XIF A;  1A17 A;  4AY6 A;  4IN3 B;  4XI0 A;  3QWP A;  3WXX A;  4CDR A;  3CV0 A;  4EQF A;  3JYS A;  2KC7 A;  3ZPJ A;  3RO2 A;  3CVP A;  3ULQ A;  3GZ1 A;  4AIF A;  2MHK A;  3CK8 A;  2DBA A;  2WQH A;  2PL2 A;  4YND A;  4GCO A;  3VTX A;  2XGM A;  5BW8 C;  4CGV A;  2VQ2 A;  5M72 A;  5JJT A;  3U4T A;  3LY8 A;  2KCL A;  2XCB A;  3LCA A;  1HZ4 A;  3QDN A;  4GYO A;  2OND A;  4J8D A;  2FEZ A;  3N71 A;  4GZ5 A;  4N3B A;  4I2Z A;  5G04 J;  1E96 B;  3RKV A;  2C2L A;  4ABN A;  4B94 A;  4HOR A;  4N5C A;  3AS5 A;  3UQ3 A;  4N2Q A;  1QZ2 A;  3LKU A;  3SF4 A;  5C1D A;  3GZ2 A;  5EKQ D;  2XPI A;  3FP3 A;  4I2W A;  5ARG A;  2NC9 A;  4GZ3 A;  3ASG A;  4JHR A;  3CK7 A;  3O48 A;  5BT1 A;  5FT9 A;  3U3W A;  2QFC A;  2PQR A;  1B89 A;  3FWV A;  1XNF A;  3HYM B;  4UI9 C;  2VSY A;  2VSN A;  3MV2 B;  3CKB A;  4WND A;  3E4B A;  4RG6 A;  4GCN A;  4YVQ C;  4AY5 A;  3CVN A;  5G05 J;  3ASF A;  5A7D B;  4RG9 A;  2IF4 A;  1KT1 A;  1W3B A;  3RU0 A;  5HQ8 A;  2OOE A;  3UPV A;  2HR2 A;  2VGX A;  3PE3 A;  4JA7 A;  3Q15 A;  4I17 A;  2Y4T A; 
#chains in the Genus database with same CATH topology
 2KXP C;  3VTY A;  5FZQ A;  3QKY A;  4U8V D;  2EIM E;  3MGB A;  2V8S E;  1OUV A;  4HVB A;  4G8L A;  5FIN A;  4JW1 A;  2VSO E;  2H6F A;  1N4P A;  2ILR A;  1DNP A;  1FPP A;  3LY9 A;  2Y0B G;  5JHA A;  1WY6 A;  4L9P A;  4WNF A;  4TXR A;  2EQX A;  3FUD A;  3CVW A;  2YHC A;  5ANR A;  1U2V G;  4L2Y A;  5BNW A;  2NXP A;  5J90 A;  5LFA A;  2GRL A;  3ESL A;  5BV1 A;  3SY2 A;  3MV3 B;  2BED A;  3AU5 A;  3Q75 A;  4ZFH A;  4I6G A;  1Y6I A;  3F6Q A;  4OVU A;  4X8Q A;  2WXP A;  3Q4A B;  3L22 A;  3HXE A;  4LRZ A;  3GZ1 A;  2A4Z A;  2YIN A;  2ZGD A;  4JC8 A;  1HFA A;  1HZ4 A;  4OAV B;  4J8D A;  2H6G A;  1EF1 C;  2DCP A;  1UOH A;  3CVU A;  1NFI E;  1QYM A;  2QFC A;  4WND A;  4DLQ A;  5KNG A;  3CHS A;  1Z5S C;  4YVQ C;  4AY5 A;  2AW6 A;  5A7D B;  3UT8 A;  3E32 A;  4U96 D;  1KT1 A;  3QAQ A;  4TXQ A;  4ZHB A;  3FUE A;  2CHX A;  4M7C A;  2V5Q C;  4JB8 P;  2AXU A;  4B89 A;  3RRU A;  3JQ0 A;  3KEA A;  3QWV A;  3UM0 A;  1H6P A;  3B7B A;  1N52 A;  2WPV A;  3JUE A;  2WQ7 A;  4U0Z A;  2A5E A;  3IEG A;  3RJV A;  4U07 A;  5T4Y A;  2IQC A;  4UI9 K;  1OCR E;  2MYO A;  1K1A A;  4XE0 A;  4DRX E;  1E8X A;  1H0A A;  1FVH A;  4APF A;  3L08 A;  2L6B A;  3FEX A;  4GTS A;  4HOS A;  2A5U A;  3PH0 C;  4HOQ A;  5G05 C;  4BWR A;  5LCW C;  1NI1 A;  2X6J A;  5AYW D;  4BFR A;  2GRR B;  1TEZ A;  5EN5 D;  2E2E A;  1HG2 A;  3S2A A;  2DVW A;  2IFU A;  2XPZ A;  4NAC A;  3HXC A;  1JCS A;  3QB2 A;  1IKN D;  3NB2 A;  3ULQ A;  2B0O E;  1HX8 A;  2XS8 A;  5EYL A;  3L54 A;  3EHN A;  3VTX A;  4Q94 A;  1FT1 A;  2C2L A;  4C0E A;  3LKU A;  1TNZ A;  3FTU A;  3W9G A;  3LEW A;  4JHR A;  3Q9N C;  3EU9 A;  3QC1 A;  3R7Q A;  3UIO C;  4HBD A;  1W3B A;  2Y4T A;  1BPO A;  3D3M A;  3DSW A;  1MZC A;  4LCT A;  5CER B;  4UQZ A;  4UQX A;  3OTN A;  5EIL A;  3AJI A;  5BXU A;  4F3V A;  2QYJ A;  3G2V A;  1N11 A;  2R17 C;  4HRN A;  2JLB A;  4J8S A;  3HHM A;  3CVY A;  3EUV A;  3D9J A;  4J8E A;  4RVB A;  3MZL B;  4JL0 A;  5HI7 A;  3D9I A;  5EX3 A;  3EHM A;  1WAO 1;  4AP2 A;  4PDX A;  5CCM A;  3TL5 A;  3ZHE A;  3D9O A;  3FH8 A;  4K5A B;  3DSU A;  3E37 A;  4E85 A;  2IU1 A;  5KJM A;  2WXK A;  3JUI A;  4BTB A;  4KVM A;  3UUX A;  2XEE A;  3QOU A;  4LNG A;  1YYH A;  2H6I A;  2GRP B;  5D0O D;  3TG4 A;  3IHV A;  5DBK A;  4GMR A;  3K9I A;  3D9K A;  3MA5 A;  2CHW A;  3L9T A;  4CYM D;  2ZXW E;  3J5Q B;  3ASO E;  4N5Q A;  4GTR A;  4ACL A;  5HKP A;  3DXK G;  1ZB1 A;  3DPD A;  3FU0 A;  3JQ1 A;  5JJT A;  1MX2 A;  1TN7 A;  4I2Z A;  2X6K A;  3D9N A;  4EPZ A;  4I2W A;  2DYR E;  2IJG X;  4MRU A;  2ZIS A;  1OWL A;  4JXT A;  3ASF A;  4WWN A;  5ANL A;  4JA7 A;  4I17 A;  4UWG A;  4TRQ A;  4I1M A;  1D9S A;  2R59 A;  3KS2 A;  3SQV A;  1E8W A;  3T5X A;  2YNQ A;  3QJZ A;  4LG6 A;  3UM1 A;  3MJW A;  3VLF A;  1Y8M A;  5BUZ A;  3ZUV B;  1WM5 A;  4GYY A;  4AOF A;  3UT4 A;  3UM2 A;  4FLH A;  2PZI A;  4MBG A;  3C3Q A;  4W9R A;  4BTA A;  3RIB A;  1OWM A;  1FVF A;  3PS6 A;  2J4D A;  3DEO A;  1JCR A;  3OXG A;  5AN8 A;  3ZKJ A;  2XGO A;  2L6J A;  2GW1 A;  2LO6 A;  3ASD A;  1TN8 A;  4WNE A;  3ZXP A;  3DSS A;  3PZ2 A;  4FP7 A;  2GRO B;  3CK9 A;  5E76 A;  3CQG B;  3B95 A;  1UG3 A;  3CVP A;  3CK8 A;  4DI4 A;  2KCL A;  4KZ0 A;  4YDY A;  2WVI A;  1PY1 A;  4B94 A;  1O5M A;  3FP3 A;  2V0P A;  3C98 A;  2NC9 A;  2F8Y A;  1RZ4 A;  3BQO A;  2RFA A;  3PZ1 A;  4BET A;  5ENT D;  3ASH A;  1KZP A;  4DUI A;  5EYP F;  2CG3 A;  1BLX B;  4QFV A;  5G55 A;  5AIJ A;  4F6R D;  4E6H A;  2HE0 A;  4A55 A;  2FO7 A;  2WMN A;  1LF8 A;  3BU8 A;  3PNL B;  3C5R A;  2P9U G;  1X5B A;  3EJN A;  4TUU A;  5LCW J;  3PZD A;  3UX4 A;  3FFL A;  3TWS A;  4L2L A;  5CRV A;  2WB2 A;  4ME2 A;  4YDO A;  4G26 A;  4NIK A;  4EEC A;  2P9N G;  4UWF A;  3HVE A;  2E0I A;  4AY6 A;  3CV0 A;  2WXR A;  4FHJ A;  4DI3 A;  4YDE A;  4EZL A;  1Z3X A;  3N71 A;  4GZ5 A;  4HOR A;  3SF4 A;  1O1S A;  3GZ2 A;  2XEN A;  3Q78 A;  2PNN A;  3FY4 A;  5FT9 A;  1JWG A;  4CEM A;  3G2W A;  2OOE A;  3UIN C;  5J08 A;  3SFZ A;  2XGS A;  1NA3 A;  4GAA A;  1ELR A;  1IXV A;  4U8Y D;  2EIL E;  2CG2 A;  3KD7 A;  3C3R A;  2LXM A;  2YHE A;  5HS0 A;  2I2O A;  3ISM C;  1D8D A;  3D9P A;  3S7J A;  1IYG A;  2L9B A;  5AJL A;  2FI7 A;  3B7U X;  4YVO A;  2ZIR A;  4BX9 A;  2YQ8 A;  4HQD A;  2VJ8 A;  4LEU A;  4Y6C A;  4BEP A;  5AAR A;  2EIK E;  1VDY A;  4APO A;  3DWL G;  2I1K A;  5B1A E;  5BXO A;  2J4B A;  3D9M A;  2RG8 A;  1HG5 A;  4LER A;  4DX7 D;  3DEP A;  3TGO A;  3FTW A;  1P5Q A;  2X38 A;  2J08 A;  5C2Y A;  3SZ7 A;  3UM3 A;  3CSF A;  5FQ7 A;  3JYS A;  2KC7 A;  2L0I A;  3RO2 A;  3DSV A;  2DZO A;  3FTY A;  4GYO A;  2EIN E;  3UT7 A;  4UWK A;  2XEH A;  5EKQ D;  1OWO A;  1L5J A;  5LX8 A;  2PQR A;  1SQM A;  4LNB A;  2PM7 A;  4AJW A;  2IY0 C;  2R05 A;  2J49 A;  3W9F A;  2ETA A;  4FLB A;  4KMO A;  4LSZ E;  2FF4 A;  2J07 A;  4J0U A;  1N54 A;  5CMY A;  2M63 A;  3L16 A;  4H7Y A;  3RSE G;  4GTT A;  4EHM A;  1H6K A;  4F53 A;  2J9Q A;  1MJ0 A;  4M3O A;  3EHQ A;  2Y69 E;  4CCA A;  3TWT A;  2P2C P;  2RFM A;  3EIJ A;  1NP7 A;  4I9C A;  4R7L A;  3D9L A;  2Y4U A;  2H6H A;  3BEE A;  4NUR A;  1JCQ A;  3QNK A;  3HRA A;  3T8M A;  5CBO A;  2QZA A;  4Y6W A;  4XZ4 A;  3PE4 A;  3R9M A;  2JAB A;  4CGW A;  2AWI A;  2X6H A;  5CEA A;  4U04 A;  4AM9 A;  3BG1 B;  1QBQ A;  4I1O B;  5KJL A;  4K03 A;  4K5C A;  2AXV A;  4I9E A;  3GW4 A;  2VTB A;  3DPY A;  3Q47 B;  4N2S A;  2WMO A;  2LSV A;  4C9B B;  4CDM A;  4GZC A;  3FUJ A;  1IQU A;  3AS4 A;  3HXB A;  3PEU B;  4XI0 A;  4AV7 A;  3ZPJ A;  4U95 D;  4CGV A;  3MKQ B;  4ILH B;  3LY8 A;  3U4T A;  2NSZ A;  1K3Z D;  5ENO D;  3UQ3 A;  5C1D A;  4RSY A;  1LTX A;  2XPI A;  2P9I G;  4DJA A;  3CHR A;  3CK7 A;  3O48 A;  2OEV A;  2VSX E;  4J8Y A;  5EID A;  4UI9 C;  4WAF A;  2AXZ A;  1S63 A;  1LD8 A;  2XQ0 A;  3VLE A;  3X2Q E;  5FTP A;  1WG0 A;  3ZN3 A;  4HOT A;  4ANX A;  4D10 C;  2PQN A;  4U63 A;  3L17 A;  3TJP A;  4KXK B;  2AVP A;  3PRZ A;  3ZXS A;  4GTQ A;  4O60 A;  4RLY A;  4CT4 A;  3AG3 E;  2P9P G;  3B7T A;  4C0M A;  1V55 E;  3PDN A;  3RK6 A;  1AWC B;  5KJN A;  3TWQ A;  3MEK A;  4BY6 A;  3VLD A;  4J8F A;  1FCH A;  3R7R A;  1UN8 A;  4NQ0 A;  2L0T B;  4ACK A;  1H2T C;  4Q96 A;  3U66 A;  2F37 A;  1XGW A;  3CVQ A;  1WDY A;  2XZD G;  2BF0 X;  4B8A A;  3ONL A;  1MX6 A;  4O1O A;  5D0Q D;  3CVL A;  2QC9 A;  4A63 B;  5KNH D;  1SVX A;  4XKB A;  5ENS D;  1Q2Z A;  3V79 K;  2XCB A;  5JMN D;  3QK0 A;  2F0Y A;  2KM4 A;  5CMW A;  2XRY A;  3BUA A;  4Z68 A;  1K1B A;  3V2O A;  3FWV A;  1XNF A;  4DX6 D;  3P2B A;  2DYS E;  1YCS B;  3E4B A;  3L82 A;  4B93 B;  2VTB B;  2IF4 A;  2HR2 A;  3PE3 A;  3ABK E;  1OWP A;  4Q69 A;  1NL4 A;  1OY3 D;  4HOU A;  2XCC A;  1N4S A;  4HI9 A;  3LYA A;  2IO3 C;  2MRI A;  3MYV A;  4G24 A;  5D2M C;  4GA1 A;  2P58 C;  4GML A;  3FH7 A;  1TNO A;  1IHB A;  4JA9 A;  4ATG A;  4LNU D;  2BUG A;  3NOC D;  2IO2 C;  4ANV A;  4TV3 A;  5EX0 A;  3V31 A;  1N0Q A;  3IHY A;  3ML9 A;  4J6I A;  2LSU A;  1E8Z A;  1H19 A;  3S7B A;  3SFY A;  4O6F A;  3LJN A;  4OAU C;  3PNT B;  4BT9 A;  1OT8 A;  3OXL A;  4QQI A;  3SFX A;  2I9C A;  3I5P A;  2LNI A;  3LXU X;  2DIW A;  4XIF A;  5IY5 E;  2XRZ A;  4YDW A;  2HM8 A;  2VQ2 A;  3LCA A;  5CRU A;  1HF8 A;  3PZ4 A;  2FEZ A;  3ABL E;  3AS5 A;  1X81 A;  5ARG A;  1G3N B;  2P9L G;  3FUK A;  1DC2 A;  3FU6 A;  3U3W A;  2X6F A;  3SBT B;  3DXM G;  3Q7F A;  3GZS A;  5G05 J;  5HQ8 A;  2X3M A;  4G8K A;  4JEH A;  5AEN A;  4HRM B;  5A6C A;  2GGF A;  3E30 A;  4AEZ C;  4BES A;  3LPZ A;  1U3D A;  2Q7F A;  2FO1 E;  4URK A;  4IUL A;  3UKR G;  4GYW A;  2EIJ E;  1EYH A;  4AVX A;  3TWV A;  4G25 A;  3L6A A;  2I1J A;  4CZ2 D;  3BG0 B;  4UI9 J;  4GU5 A;  3CEQ A;  3ZVV A;  1Z6T A;  4N3A A;  1TJC A;  3RRN B;  3SBS A;  3HDX A;  3FTZ A;  3JXI A;  3TG5 A;  3CHP A;  4EZK A;  4KYO B;  3FHE A;  3C3O A;  5FZS A;  3R9A B;  4PS8 A;  2WXO A;  1PC2 A;  4JZY A;  2JEK A;  4DX2 A;  4EBA G;  2XZT G;  2P9S G;  5FIO A;  4GA0 A;  3ZIM A;  4DLO A;  4CDR A;  1D8E A;  4GCO A;  1IQR A;  2XGM A;  5BW8 C;  3T8K A;  3UI2 A;  1MYO A;  1E96 B;  3P1U A;  3ENE A;  4V3I A;  5E75 A;  5BT1 A;  3NQP A;  4GTM A;  3SGH A;  3U9W A;  4BX8 A;  1U3C A;  5BV0 A;  5LOZ A;  3KEZ A;  3B13 A;  3Q7A A;  4YND A;  2KBX A;  5EIB E;  3FEY A;  3CGH A;  2J09 A;  3KSL A;  3CVX A;  1ELW A;  3V2X A;  3JCK C;  1HH8 A;  3FDH A;  4HXI A;  3U64 A;  3HIZ A;  3DSX A;  3PZ3 A;  1EDU A;  4HRL A;  4CT0 A;  4EZJ A;  3ESK A;  4MLP A;  4U7E B;  1KT0 A;  4MKT A;  3FU3 A;  4XEI G;  4P29 A;  2WXM A;  1N0R A;  3QWW A;  2KZT B;  5HRY A;  2Y3A A;  2OVB A;  3JXJ A;  3NZU A;  1INZ A;  5AQ7 A;  3ZYL A;  3J5P A;  2J8S D;  4DPR A;  4GPK A;  3ZRH A;  3ZFW A;  1O1R A;  4KBQ A;  3FUN A;  3SD5 A;  3URZ A;  4F1S A;  5ENP D;  2VGX B;  5FJY A;  3LY7 A;  3ZYK A;  3DRA A;  4DX5 D;  4MS6 A;  3WXX A;  1TNB A;  2OVF A;  4AIF A;  3PUJ A;  3ULE G;  2PL2 A;  4LUN U;  3SHF A;  5M72 A;  3L13 A;  1PAQ A;  1N4Q A;  4A3V A;  4XKC A;  1KZO A;  4GZD A;  4UWH A;  4GZ3 A;  3NAW A;  4G11 A;  1B89 A;  3EHR A;  2WXI A;  4GTO A;  4RG6 A;  4JVS A;  5AQ9 A;  3ZW3 A;  3MCX A;  3T9K A;  3RU0 A;  5JHB A;  3Q15 A;  4I6E A;  3I4R B;  1MQS A;  3CHQ A;  4N3C A;  4JD2 G;  3EDT B;  4BT8 A;  1BI8 B;  3E34 A;  4HLL A;  1UN9 A;  2ETB A;  4IYP A;  2P9K G;  3O4Z A;  2WM9 A;  2UWJ G;  4WNG A;  3LDZ A;  1JPL A;  3OXF A;  1KLX A;  3LVR E;  4FC8 A;  4TUM A;  3T5V A;  4WWP A;  5G2N A;  4B0Z A;  3V30 A;  1N9A A;  2UY1 A;  1HO8 A;  5T3R A;  5CHE E;  2IOS A;  2B6C A;  2BKK B;  5ENQ D;  4HB5 A;  3TAX A;  3I3N A;  4U0U A;  1YA0 A;  4EBA A;  3APD A;  3APF A;  4L7T A;  4PUC A;  5A23 A;  2F8X K;  1HXI A;  4GZ6 A;  3Q5M A;  3Q9U C;  1EPU A;  3RRM B;  4IRU A;  1O1T A;  2R2L A;  4EQF A;  2IEJ A;  3UTM A;  4KZC A;  4GPM A;  2R03 A;  3LVQ E;  1TJF A;  5AQB A;  5EDS A;  4L23 A;  2KZT A;  3G2U A;  2BTD A;  4HNA D;  2WXH A;  1UJJ A;  2V4H C;  5FQ4 A;  1TNY A;  4GCN A;  3UPV A;  2VGX A;  3AAA C;  3Q79 A;  2OV8 A;  1ZU2 A;  3TWX A;  3NF1 A;  3E33 A;  2LAI A;  3UKU G;  3AG4 E;  1UW4 B;  1HE8 A;  3DST A;  1ZBP A;  1SZ9 A;  3ZHE B;  1TNU A;  3SNX A;  3FUF A;  5FWQ A;  4OYS A;  1MHQ A;  2ZU6 B;  1JUQ A;  2WXL A;  1S64 A;  4NRH B;  2XEV A;  4GA2 A;  2CHZ A;  5B3S E;  1SA5 A;  3CQC B;  3ONK A;  1NZN A;  4K5B A;  3IXE A;  3NOG D;  2QY7 A;  1MX4 A;  2I6H A;  4KT6 B;  5KJK A;  3ZYM A;  5JA4 D;  5AJD A;  2OEW A;  5KCM A;  5DIZ A;  5CCL A;  4G1T A;  4XX5 A;  3PVL A;  4JHJ A;  2FBN A;  2WXJ A;  5G04 C;  1QQE A;  4PS3 A;  3SO8 A;  1S0P A;  4GTV A;  3APC A;  2WQH A;  2XHE A;  3TXM A;  4U8H A;  1OXJ A;  3CIA A;  4JHK A;  3QDN A;  2WQ6 A;  4HI8 A;  1QZ2 A;  3EU5 A;  1OWN A;  4GTP A;  4AXH A;  2LUH A;  2WXQ A;  4RQI A;  3MV2 B;  2IOL A;  3HG0 D;  2VGE A;  1A5E A;  4RG9 A;  1LD7 A;  2GRN B;  1SA4 A;  1H2V C;  5ENR D;  3MKQ A;  3G2S A;  5AQA A;  3ZEF A;  4H7X A;  3RO3 A;  4CRW A;  5FZR A;  1K8K G;  1N95 A;  3IV0 A;  3FUH A;  3B7R L;  2XPY A;  3DBS A;  3Q73 A;  1OCZ E;  4WWO A;  1N94 A;  2LXL A;  4G2V A;  4A3T A;  2KCK A;  2MOW A;  4FA6 A;  2AJA A;  3GYZ A;  4HLE A;  3FTX A;  4BSX A;  1IHG A;  2ION A;  5ENN A;  4HFG A;  3CST A;  1HS6 A;  4XI9 A;  1AP7 A;  2HO1 A;  4ANU A;  1BD8 A;  1OCC E;  3WG7 E;  3TWU A;  4I1A A;  3AU4 A;  3FTS A;  4FUL A;  1Z3Y A;  4FHK A;  4ATZ D;  3IBE A;  3UXG A;  2OCC E;  2RD0 A;  2CFZ A;  2DBA A;  5H7P A;  3ML8 A;  5ITZ F;  2GRM A;  3RKV A;  2LAH A;  3D9H A;  3ULY A;  2BKG A;  1V54 E;  4I43 A;  1QNF A;  3FUL A;  4ILG A;  2RKK A;  4PS7 A;  2QYU A;  4UUC A;  2C0M A;  4ILI A;  4GB9 A;  3ABM E;  2KAT A;  4FJZ A;  1SW6 A;  3CR3 A;  1DCE A;  3HXF A;  4JPS A;  4U0S A;  5LP0 A;  3IKO B;  2HYZ A;  2C0L A;  2WXF A;  3S7F A;  2V5F A;  1H2U A;  1TYQ G;  2KCV A;  3ZU7 B;  1E7V A;  5T8I A;  5JJ7 A;  3HXD A;  4A1G A;  4F1P A;  3HVE B;  4OVV A;  5FQ6 A;  3ZYQ A;  4ANW A;  3MKR A;  5JJ6 A;  5BPP A;  4J7W A;  3I4G A;  3FU5 A;  3QAR A;  1E8Y A;  2VGY A;  2CFU A;  2ZGG A;  5ARF A;  2DZN A;  3FTV A;  2R02 A;  4G23 A;  3SI5 A;  1N4R A;  3NZS A;  2UY1 B;  3PRE A;  4GMJ A;  1NA0 A;  1SZA A;  3S7D A;  3QWP A;  1YMP A;  5KBA A;  3G2T A;  1TR4 A;  3FH5 A;  4FJY A;  3CVV A;  4I6J A;  2OND A;  1GW6 A;  4N3B A;  4N2Q A;  4N5C A;  3CHM A;  2GRQ B;  3ASG A;  2NYJ A;  3LS8 A;  1S70 B;  2X6I A;  3CKB A;  1KPS B;  3TXN A;  1BU9 A;  2FUL A;  3MX3 A;  3NBN B;  3PUK A;  1HU3 A;  3FUM A;  2ETC A;  1E90 A;  3B7S A;  3TWW A;  3KSQ A;  4UQY A;  1TN6 A;  4BSZ B;  4A1S A;  4WUY A;  2V4L A;  5KWD A;  5B1B E;  1BI7 B;  1UJK A;  4HS2 A;  4DK5 A;  3OAW A;  3UMV A;  5AAO A;  3KAE A;  4F7A A;  4JEU A;  1OCO E;  3UIP C;  4N39 A;  1E7U A;  5CED B;  4B8C B;  4C48 B;  2Y1L E;  3PEV B;  4UWL A;  5CEC B;  3ASN E;  3CKC A;  2VYI A;  1DVP A;  4PH4 B;  3CHO A;  3Q49 B;  4TXP A;  3EIQ C;  1H6O A;  3AG1 E;  4DX1 A;  2R5S A;  1DCQ A;  4FAD A;  3AS8 A;  1RW2 A;  3ZGQ A;  3C72 A;  4L1B A;  2PM6 A;  1JWF A;  3CLJ A;  3FUI A;  1A17 A;  4IN3 B;  5CBN A;  2MHK A;  4CDN A;  1ELK A;  5G04 J;  4ABN A;  2XS1 A;  4O1P A;  3RAU A;  3LJ3 A;  3ZNG A;  5D66 A;  4FU3 A;  4BER A;  2WXG A;  4KVO A;  3HYM B;  3AG2 E;  2VSY A;  2VSN A;  3CVN A;  5FQ8 A;  2DWZ A;  2WXN A;  3TWR A;  4K0R A;  1FT2 A; 
#chains in the Genus database with same CATH homology
 2OV8 A;  3VTY A;  5FZQ A;  1ZU2 A;  1OWP A;  3QKY A;  3ASH A;  4Q69 A;  3MGB A;  3NF1 A;  2LAI A;  2V8S E;  1OUV A;  5M72 A;  1UW4 B;  4HVB A;  4HOU A;  2XCC A;  2CG3 A;  1HE8 A;  3LYA A;  1ZBP A;  2VSO E;  4JW1 A;  4QFV A;  5G55 A;  1SZ9 A;  3ZHE B;  2MRI A;  3MYV A;  4G24 A;  5AIJ A;  4GA1 A;  4E6H A;  2ILR A;  1DNP A;  2P58 C;  3SNX A;  4A55 A;  3FUF A;  5FWQ A;  3LY9 A;  4GML A;  4OYS A;  3FH7 A;  1MHQ A;  5JHA A;  2FO7 A;  2ZU6 B;  1WY6 A;  2WMN A;  4JA9 A;  4WNF A;  4ATG A;  2BUG A;  1JUQ A;  1LF8 A;  2WXL A;  4TV3 A;  4ANV A;  2EQX A;  3FUD A;  3CVW A;  2YHC A;  5EX0 A;  5ANR A;  4NRH B;  2XEV A;  4L2Y A;  5BNW A;  2NXP A;  3PNL B;  5J90 A;  4GA2 A;  2CHZ A;  3IHY A;  3ML9 A;  4J6I A;  5LFA A;  2GRL A;  3ESL A;  2LSU A;  1E8Z A;  1H19 A;  3S7B A;  1X5B A;  3CQC B;  5BV1 A;  3EJN A;  3ONK A;  3MV3 B;  1NZN A;  4O6F A;  2QY7 A;  3AU5 A;  2I6H A;  4TUU A;  4KT6 B;  5KJK A;  3PNT B;  4BT9 A;  5LCW J;  4I6G A;  1Y6I A;  3PZD A;  3UX4 A;  3OXL A;  3ZYM A;  3FFL A;  4L2L A;  5AJD A;  2WB2 A;  4ME2 A;  4OVU A;  2WXP A;  5KCM A;  5DIZ A;  5CCL A;  2I9C A;  4G1T A;  3I5P A;  4G26 A;  4XX5 A;  2LNI A;  3PVL A;  4EEC A;  4JHJ A;  2FBN A;  2WXJ A;  4UWF A;  5G04 C;  1QQE A;  3HVE A;  3Q4A B;  3L22 A;  2E0I A;  4PS3 A;  3LXU X;  2DIW A;  4XIF A;  1S0P A;  4AY6 A;  4LRZ A;  3CV0 A;  3APC A;  3GZ1 A;  2XRZ A;  2A4Z A;  2YIN A;  2WQH A;  2WXR A;  2XHE A;  4FHJ A;  4U8H A;  4JC8 A;  3TXM A;  4DI3 A;  2HM8 A;  2VQ2 A;  4EZL A;  3CIA A;  1HFA A;  1Z3X A;  3LCA A;  1HZ4 A;  4JHK A;  3QDN A;  2WQ6 A;  1HF8 A;  4J8D A;  2FEZ A;  3N71 A;  4GZ5 A;  1EF1 C;  2DCP A;  4HOR A;  3AS5 A;  1QZ2 A;  3SF4 A;  1OWN A;  3GZ2 A;  5ARG A;  3CVU A;  3FUK A;  3FU6 A;  4AXH A;  3FY4 A;  5FT9 A;  3U3W A;  2QFC A;  2X6F A;  2WXQ A;  3SBT B;  4WND A;  3MV2 B;  1JWG A;  2IOL A;  4CEM A;  4DLQ A;  3G2W A;  3CHS A;  3GZS A;  4YVQ C;  4AY5 A;  5G05 J;  2AW6 A;  5A7D B;  3UT8 A;  4RG9 A;  1KT1 A;  2X3M A;  5HQ8 A;  2OOE A;  3QAQ A;  1H2V C;  3MKQ A;  4JEH A;  5AEN A;  5J08 A;  3FUE A;  3SFZ A;  2CHX A;  3G2S A;  5A6C A;  2XGS A;  2GGF A;  3ZEF A;  1NA3 A;  4GAA A;  2AXU A;  4H7X A;  3RRU A;  3RO3 A;  4B89 A;  1ELR A;  3JQ0 A;  4CRW A;  5FZR A;  4AEZ C;  3LPZ A;  3QWV A;  2CG2 A;  1U3D A;  3IV0 A;  3FUH A;  3B7R L;  1N52 A;  2WPV A;  3KD7 A;  2YHE A;  2Q7F A;  2XPY A;  3DBS A;  4URK A;  4IUL A;  2WQ7 A;  2I2O A;  4WWO A;  4U0Z A;  3D9P A;  4GYW A;  1EYH A;  3S7J A;  3IEG A;  3RJV A;  4AVX A;  4G2V A;  4U07 A;  4A3T A;  5T4Y A;  2KCK A;  4G25 A;  2IQC A;  2L9B A;  2FI7 A;  3B7U X;  3L6A A;  2MOW A;  2I1J A;  4UI9 K;  4YVO A;  3BG0 B;  5AJL A;  4UI9 J;  4GU5 A;  4FA6 A;  4BX9 A;  3CEQ A;  3ZVV A;  1Z6T A;  2YQ8 A;  4N3A A;  1TJC A;  3GYZ A;  4Y6C A;  2VJ8 A;  4LEU A;  3RRN B;  4XE0 A;  3SBS A;  3HDX A;  4HLE A;  3FTX A;  1E8X A;  4BSX A;  3FTZ A;  1VDY A;  4APO A;  1H0A A;  1FVH A;  1IHG A;  4APF A;  3L08 A;  2I1K A;  2ION A;  3TG5 A;  3CHP A;  4EZK A;  3FEX A;  2J4B A;  4KYO B;  3D9M A;  5ENN A;  2RG8 A;  3FHE A;  4HFG A;  5FZS A;  3CST A;  4HOS A;  2A5U A;  3PH0 C;  4HOQ A;  1HS6 A;  4XI9 A;  1HG5 A;  4LER A;  5G05 C;  4BWR A;  5LCW C;  3R9A B;  2X6J A;  4PS8 A;  5AYW D;  2WXO A;  1PC2 A;  4JZY A;  2HO1 A;  3FTW A;  3TGO A;  2JEK A;  4ANU A;  4BFR A;  1TEZ A;  1P5Q A;  2E2E A;  2X38 A;  2J08 A;  1HG2 A;  5C2Y A;  3SZ7 A;  4I1A A;  3S2A A;  3AU4 A;  3FTS A;  2IFU A;  4FUL A;  4EBA G;  1Z3Y A;  2XPZ A;  4NAC A;  4FHK A;  3CSF A;  3IBE A;  4GA0 A;  3ZIM A;  4DLO A;  5FQ7 A;  3QB2 A;  2RD0 A;  4CDR A;  3JYS A;  2KC7 A;  2L0I A;  2CFZ A;  3RO2 A;  3ULQ A;  1HX8 A;  2DBA A;  3L54 A;  3EHN A;  4GCO A;  1IQR A;  2XGM A;  5BW8 C;  4Q94 A;  3VTX A;  3FTY A;  3ML8 A;  4GYO A;  3UT7 A;  2GRM A;  4UWK A;  3RKV A;  2LAH A;  1E96 B;  3P1U A;  2C2L A;  4C0E A;  3LKU A;  3ENE A;  3FTU A;  4V3I A;  5EKQ D;  5E75 A;  1OWO A;  3LEW A;  4JHR A;  1L5J A;  5BT1 A;  3NQP A;  5LX8 A;  3SGH A;  2PQR A;  1SQM A;  3U9W A;  4BX8 A;  4I43 A;  1U3C A;  2PM7 A;  3QC1 A;  3R7Q A;  4AJW A;  5BV0 A;  5LOZ A;  1QNF A;  3FUL A;  3KEZ A;  1W3B A;  4ILG A;  3B13 A;  4PS7 A;  4YND A;  2Y4T A;  1BPO A;  3D3M A;  2C0M A;  3FEY A;  2J49 A;  3CGH A;  4ILI A;  2J09 A;  4GB9 A;  4LCT A;  2KAT A;  4FLB A;  4FJZ A;  4KMO A;  3CVX A;  4UQZ A;  3CR3 A;  4UQX A;  1ELW A;  2FF4 A;  2J07 A;  4J0U A;  3OTN A;  1N54 A;  3JCK C;  4JPS A;  4U0S A;  2M63 A;  3L16 A;  4H7Y A;  5CMY A;  1HH8 A;  5LP0 A;  4F3V A;  3FDH A;  4HXI A;  3U64 A;  1H6K A;  3IKO B;  2HYZ A;  3HIZ A;  4F53 A;  2J9Q A;  2C0L A;  4M3O A;  3G2V A;  2WXF A;  3S7F A;  2R17 C;  2V5F A;  4CCA A;  2JLB A;  4J8S A;  1H2U A;  3HHM A;  1EDU A;  4CT0 A;  3CVY A;  2KCV A;  3D9J A;  4J8E A;  4EZJ A;  3EIJ A;  3ESK A;  4RVB A;  3MZL B;  4JL0 A;  5HI7 A;  4MLP A;  1NP7 A;  3D9I A;  1E7V A;  5T8I A;  5JJ7 A;  5EX3 A;  3EHM A;  4I9C A;  4R7L A;  1WAO 1;  1KT0 A;  3D9L A;  2Y4U A;  4MKT A;  4AP2 A;  4PDX A;  4A1G A;  3BEE A;  3HVE B;  3QNK A;  4NUR A;  3FU3 A;  3T8M A;  3TL5 A;  5CCM A;  4P29 A;  4OVV A;  4Y6W A;  5FQ6 A;  3ZHE A;  2WXM A;  3ZYQ A;  4XZ4 A;  4ANW A;  3PE4 A;  3D9O A;  3FH8 A;  3MKR A;  5JJ6 A;  3QWW A;  5BPP A;  2KZT B;  4CGW A;  2Y3A A;  2OVB A;  2AWI A;  4E85 A;  2IU1 A;  5KJM A;  2WXK A;  2X6H A;  3JUI A;  3NZU A;  3I4G A;  4BTB A;  4KVM A;  3FU5 A;  3QAR A;  4U04 A;  1INZ A;  1E8Y A;  2VGY A;  3UUX A;  4AM9 A;  2CFU A;  3ZYL A;  3QOU A;  3BG1 B;  5D0O D;  5ARF A;  4I1O B;  3TG4 A;  5KJL A;  4K03 A;  4DPR A;  2AXV A;  4GPK A;  3FTV A;  4I9E A;  3ZRH A;  3GW4 A;  3IHV A;  4G23 A;  3SI5 A;  3ZFW A;  3NZS A;  4KBQ A;  3Q47 B;  5DBK A;  2UY1 B;  3PRE A;  4GMJ A;  3FUN A;  4N2S A;  1NA0 A;  2WMO A;  2LSV A;  3SD5 A;  3URZ A;  4F1S A;  3K9I A;  4C9B B;  1SZA A;  2VGX B;  3D9K A;  3MA5 A;  5FJY A;  4CDM A;  3LY7 A;  2CHW A;  4GZC A;  3ZYK A;  4MS6 A;  3FUJ A;  1IQU A;  3S7D A;  3AS4 A;  3PEU B;  4XI0 A;  3QWP A;  3WXX A;  2OVF A;  4AV7 A;  3ZPJ A;  4AIF A;  3PUJ A;  4ACL A;  2PL2 A;  3G2T A;  4LUN U;  3SHF A;  3MKQ B;  3FU0 A;  3DPD A;  4CGV A;  3JQ1 A;  3L13 A;  4ILH B;  3LY8 A;  3U4T A;  2NSZ A;  3FH5 A;  5JJT A;  4FJY A;  1PAQ A;  3CVV A;  4I6J A;  2OND A;  1GW6 A;  4N3B A;  4A3V A;  4I2Z A;  2X6K A;  4XKC A;  4N2Q A;  4N5C A;  3CHM A;  3D9N A;  3UQ3 A;  4EPZ A;  5C1D A;  4RSY A;  4GZD A;  2XPI A;  4I2W A;  4UWH A;  4DJA A;  2IJG X;  3ASG A;  4GZ3 A;  3CHR A;  3CK7 A;  3O48 A;  4MRU A;  3LS8 A;  4G11 A;  2VSX E;  1B89 A;  1OWL A;  4JXT A;  4UI9 C;  2WXI A;  2X6I A;  3CKB A;  4WAF A;  3TXN A;  2AXZ A;  2FUL A;  4RG6 A;  3MX3 A;  4JVS A;  3ZW3 A;  3ASF A;  4WWN A;  3MCX A;  2XQ0 A;  3PUK A;  3RU0 A;  1HU3 A;  5ANL A;  1IYG A;  3VLE A;  4JA7 A;  3FUM A;  5JHB A;  3Q15 A;  4I17 A;  5FTP A;  4UWG A;  4I6E A;  4TRQ A;  4I1M A;  1E90 A;  3I4R B;  3B7S A;  2R59 A;  1MQS A;  4UQY A;  3CHQ A;  3ZN3 A;  3KS2 A;  4N3C A;  4HOT A;  4A1S A;  4ANX A;  4D10 C;  3EDT B;  4BT8 A;  4WUY A;  2PQN A;  1E8W A;  4U63 A;  3L17 A;  3T5X A;  2YNQ A;  2V4L A;  3TJP A;  4KXK B;  3QJZ A;  2AVP A;  1UJK A;  3PRZ A;  1UN9 A;  3MJW A;  4IYP A;  3VLF A;  1Y8M A;  5BUZ A;  3ZXS A;  4HS2 A;  3O4Z A;  1WM5 A;  4DK5 A;  2WM9 A;  3OAW A;  2UWJ G;  3UMV A;  4GYY A;  4WNG A;  3KAE A;  4CT4 A;  4F7A A;  4AOF A;  3UT4 A;  4JEU A;  3B7T A;  3LDZ A;  4C0M A;  1JPL A;  3OXF A;  1KLX A;  2PZI A;  1E7U A;  3LVR E;  4FC8 A;  4FLH A;  4N39 A;  4W9R A;  3T5V A;  4WWP A;  5G2N A;  4B0Z A;  4BTA A;  3RIB A;  1OWM A;  1FVF A;  4B8C B;  3PDN A;  2UY1 A;  1HO8 A;  3RK6 A;  5T3R A;  3PS6 A;  3PEV B;  4UWL A;  2IOS A;  5CHE E;  5KJN A;  2J4D A;  3CKC A;  3MEK A;  3VLD A;  2VYI A;  4BY6 A;  1DVP A;  3OXG A;  4J8F A;  3CHO A;  3Q49 B;  4PH4 B;  1FCH A;  3EIQ C;  3R7R A;  1UN8 A;  4NQ0 A;  2L0T B;  2XGO A;  2L6J A;  3TAX A;  4ACK A;  3I3N A;  4U0U A;  1H2T C;  4Q96 A;  2GW1 A;  1YA0 A;  4EBA A;  3U66 A;  2LO6 A;  3APD A;  3ASD A;  3APF A;  1XGW A;  3CVQ A;  4L7T A;  2R5S A;  4PUC A;  5A23 A;  4WNE A;  1HXI A;  3AS8 A;  4FAD A;  4GZ6 A;  2BF0 X;  3Q5M A;  3ZGQ A;  4B8A A;  1EPU A;  3ONL A;  2VTB A;  4L1B A;  3RRM B;  2PM6 A;  4IRU A;  5D0Q D;  4FP7 A;  3CVL A;  3CK9 A;  1JWF A;  3CLJ A;  5E76 A;  3CQG B;  3FUI A;  1A17 A;  4IN3 B;  4EQF A;  1UG3 A;  3CVP A;  2MHK A;  3CK8 A;  4XKB A;  4KZC A;  4DI4 A;  3LVQ E;  2KCL A;  2XCB A;  1TJF A;  4KZ0 A;  4CDN A;  5EDS A;  4L23 A;  2WVI A;  3QK0 A;  1ELK A;  5G04 J;  4ABN A;  1PY1 A;  2KZT A;  4B94 A;  3G2U A;  2KM4 A;  2BTD A;  5CMW A;  2WXH A;  2V0P A;  3C98 A;  1UJJ A;  2XRY A;  3FP3 A;  2NC9 A;  3LJ3 A;  4FU3 A;  2WXG A;  4KVO A;  3FWV A;  3HYM B;  1XNF A;  2VSY A;  2VSN A;  5FQ4 A;  3P2B A;  3E4B A;  2VTB B;  4GCN A;  3CVN A;  5FQ8 A;  2IF4 A;  3UPV A;  2WXN A;  2HR2 A;  2VGX A;  3PE3 A;  4K0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...