4NRHB

Copn-scc3 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
170
structure length
170
Chain Sequence
MSHLNYLLEKIAASSKEDFPFPDDLESYLEGYVPDKNIALDTYQKIFKISSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/protein binding
molecule keywords CopN
publication title A gatekeeper chaperone complex directs translocator secretion during type three secretion.
pubmed doi rcsb
source organism Chlamydia pneumoniae
total genus 60
structure length 170
sequence length 170
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4nrhB00
5HI7A 4UQXA 3OXLA 3FWVA 2IF4A 5JJTA 5EX0A 4RG6A 2PQRA 4GYWA 3ESKA 5BNWA 3ZHEA 3FP3A 3LY7A 4G24A 4I2WA 4AY6A 4Y6CA 3QKYA 1ZBPA 4KXKB 4BTAA 4N2SA 5G04J 4U07A 2AVPA 5KJNA 2ONDA 3LY9A 3AS8A 1ELWA 4BWRA 2QFCA 2KC7A 2E2EA 4WUYA 3CKBA 2LSVA 2HO1A 4I17A 2JLBA 3TGOA 5A6CA 1TJCA 3QDNA 3Q47B 1W3BA 3E4BA 3ZGQA 4I9EA 3OXGA 4H7YA 2VSNA 4N2QA 4GYOA 4GA2A 3O48A 3LPZA 4HOQA 3CV0A 4XI0A 4CGWA 4Y6WA 3ASFA 3UQ3A 4J8DA 4WNDA 2VYIA 3Q49B 1QQEA 3UUXA 3CVNA 3S7JA 2VGXB 4UQYA 4J0UA 3K9IA 3ZN3A 3Q15A 4U04A 3TAXA 3CVLA 3MEKA 3ASGA 2WPVA 4G1TA 5FT9A 2PQNA 2Y4UA 4IN3B 1IYGA 1WAO1 2KATA 5D0OD 4G25A 4HOTA 4WNEA 3GZ2A 3RO2A 5JJ7A 4ABNA 2VGXA 2MHKA 3Q4AB 1ZU2A 4ME2A 4H7XA 3MV3B 3MA5A 2PL2A 4GCNA 3PE4A 5A7DB 3Q5MA 5BW8C 3RJVA 3ZPJA 3RO3A 2FBNA 2KCVA 4HOSA 3MV2B 4GZ6A 2YQ8A 3LYAA 3VTYA 3IEGA 4GA1A 4LEUA 5FZQA 4KBQA 2DBAA 3ASHA 3QWPA 2LSUA 2J9QA 3S7DA 2HYZA 3BEEA 4U0UA 4EQFA 4BTBA 2P58C 3S7FA 2BUGA 5AYWD 4JHRA 3KS2A 5FJYA 5FTPA 3AS4A 4G23A 2FO7A 5DBKA 5LCWJ 4WNGA 2FF4A 4O6FA 3MKRA 5G05J 1NZNA 4RG9A 4HOUA 4GZ5A 5LCWC 5ARFA 3ASDA 5FZRA 5KJLA 4I9CA 5KJKA 3PDNA 5G05C 1KT1A 3LKUA 3CK9A 4WNFA 3SF4A 4JA7A 1KT0A 5KJMA 3S7BA 3FFLA 3RU0A 4XIFA 5HQ8A 1QZ2A 3CEQA 2Q7FA 2GW1A 2XPIA 2UY1B 1OUVA 3N71A 1ELRA 2VSYA 1B89A 4J8FA 2OOEA 5BT1A 2VGYA 4F3VA 2R5SA 3GW4A 3EDTB 5EX3A 1HZ4A 3QWVA 5C1DA 4YVQC 2C2LA 1FCHA 2WQHA 1A17A 5M72A 3UPVA 5DIZA 4UI9C 2FI7A 2HR2A 1XNFA 4YVOA 4NQ0A 2VQ2A 2V5FA 3CVPA 3TG5A 3WXXA 2UY1A 5ARGA 4N39A 5JJ6A 4N3CA 3KD7A 2YHCA 4BT8A 4CDRA 4NRHB 4AM9A 1Y8MA 3RIBA 3QOUA 2C0MA 5CCLA 1WM5A 4GZ3A 4APOA 4GA0A 3LCAA 4G2VA 2XEVA 3GZ1A 1HH8A 4N5CA 1YA0A 2Y4TA 3U4TA 2NC9A 5G04C 4A1SA 3NF1A 3HYMB 2FEZA 4U0ZA 4N3AA 3ZFWA 5D0QD 5CHEE 2XGSA 2UWJG 3JYSA 4GPKA 2XCBA 3CKCA 1IHGA 4CGVA 1NA3A 5FZSA 2XGOA 2IFUA 2LNIA 3AS5A 2XCCA 3GYZA 4G26A 4YNDA 1PC2A 4GYYA 2I6HA 3SZ7A 3R9AB 1NA0A 1HXIA 4GCOA 3OXFA 4KYOB 3LY8A 3VTXA 3TG4A 3U3WA 2KCKA 4AIFA 4B94A 2KCLA 4AY5A 5CCMA 2PZIA 1KLXA 1E96B 4HORA 2C0LA 3ZHEB 4W9RA 4N3BA 3CK7A 3CVQA 3KAEA 3URZA 3RKVA 4U0SA 3ULQA 3CK8A 3QWWA 4I2ZA 4XI9A 4UI9K 4I1AA 2XGMA 4JA9A 4JL0A 4UI9J 1P5QA 3PE3A 5EKQD 4UQZA 4J8EA 4BT9A 2L6JA
chains in the Genus database with same CATH superfamily
2V5QC 4L9PA 4UQXA 3OXLA 3FWVA 3RRUA 3FTSA 3ESKA 3FP3A 3Q75A 1Y6IA 4AY6A 4UWGA 4Y6CA 3NZSA 4GTSA 4B93B 4N2SA 4FHKA 3CQGB 4JD2G 3X2QE 2X6IA 3SQVA 2KC7A 3Q78A 3EHQA 1JWGA 1G3NB 1OWPA 2XHEA 4YDOA 2LSVA 4Q96A 4I17A 3UIOC 2JLBA 3CVWA 1TJCA 3AU5A 2B0OE 3ZYQA 3MX3A 3OXGA 4I9EA 4H7YA 3ZXSA 1SW6A 4GA2A 4HOQA 4XI0A 4CGWA 3I3NA 4J8DA 3UQ3A 3VLEA 2XS1A 3TWSA 4GZCA 4JHJA 3HXBA 3Q49B 2LAHA 2WMNA 3CVNA 3CIAA 3S7JA 4GMJA 4G8LA 1EPUA 4TRQA 4Z68A 2XEHA 4U04A 3SY2A 3CVLA 3JQ0A 1E8XA 5LFAA 4XE0A 2XQ0A 4ANWA 2EIKE 1TN8A 2GRQB 2PQNA 2ZGGA 4IN3B 1FT1A 4OAUC 1QBQA 1IYGA 3T8MA 1IHBA 4U63A 4LRZA 5D0OD 4G25A 4HOTA 3D9LA 1TNUA 2VGEA 5EIDA 1NP7A 1HO8A 5D66A 3MGBA 4MRUA 4AVXA 3ZYMA 2VGXA 2MHKA 3Q4AB 3Q79A 4H7XA 1TNOA 4ATZD 2XENA 4GTVA 1YMPA 2BTDA 1OT8A 5A7DB 3HXCA 3QC1A 5JMND 3E33A 3HHMA 3RJVA 4FP7A 2QY7A 2FBNA 1SQMA 3E37A 2YQ8A 3KEAA 3IEGA 2EILE 1EYHA 2DZNA 2LO6A 3GZSA 4LEUA 5CBOA 2DBAA 2OV8A 2WXLA 3CSTA 5ENNA 1S63A 5BUZA 3HXEA 2J07A 4BTBA 1E8YA 5CECB 4HLLA 2NYJA 3KS2A 1NL4A 3T8KA 2WXMA 1JCSA 2FO7A 1FVFA 3D9IA 1RW2A 4WNGA 2CG2A 3TJPA 5EYPF 2DYSE 5G05J 3E34A 5BPPA 2EIME 4RG9A 3FUEA 3QARA 1K8KG 2IU1A 4HOUA 5ARFA 5T8IA 4DX7D 1DCQA 3ASDA 3AAAC 3L08A 5FZRA 3ML8A 3FTWA 4I9CA 4UUCA 3PDNA 2J8SD 1KT1A 3KSLA 3L13A 3LKUA 3ULYA 4WNFA 4HXIA 3HXFA 3IBEA 3SF4A 3DXMG 4JA7A 5KJMA 4IYPA 4XIFA 1QZ2A 3FUHA 2GW1A 3PEUB 3T9KA 2X6HA 3N71A 5G55A 2VSYA 3G2UA 4HI8A 5KCMA 3AJIA 3FUNA 4F3VA 4ZHBA 2IO3C 1HZ4A 4RVBA 1GW6A 4GMLA 2C2LA 1LTXA 2R17C 4UWLA 1K3ZD 1S0PA 4XEIG 5M72A 1MHQA 3UPVA 4WWNA 5CRVA 4UI9C 1XNFA 3EJNA 4DPRA 2YHEA 3FHEA 1QYMA 1N0QA 3WXXA 2OCCE 5ARGA 1FVHA 3NOCD 4XKBA 4CCAA 4BT8A 4CDRA 1TYQG 3ASNE 4CEMA 4HNAD 3RIBA 5B3SE 4DI4A 5CCLA 2Y0BG 1WM5A 1JWFA 5BXOA 1E7UA 3LCAA 4GA0A 3C72A 3U4TA 1IKND 3FTXA 4JXTA 3NF1A 4UWFA 2X3MA 5B1BE 3TWWA 3ZFWA 3C3OA 5CERB 4U8HA 2JEKA 3TWUA 3CHOA 1IHGA 3HRAA 3EU5A 3U64A 2XGOA 3APCA 4DI3A 2IFUA 2LNIA 1KPSB 3AS5A 1WY6A 3D9MA 5FQ8A 3OTNA 4G26A 1BU9A 2A5EA 5AQBA 3FUKA 3VTXA 4PDXA 2P9UG 3PZ1A 4B94A 3FY4A 4AIFA 2KCLA 1DVPA 3CK7A 3KAEA 4GTOA 4DJAA 3CVXA 4UWHA 3UIPC 3ULQA 1N4PA 4ILIA 3DEOA 3LEWA 2X38A 4JL0A 5FQ6A 4UI9J 1P5QA 3BU8A 3FUJA 2VTBA 2AW6A 3PRZA 3P1UA 3R9MA 4TV3A 1IQRA 5JJTA 4BSXA 1X81A 4DX6D 2WB2A 3ZYKA 4LUNU 4BETA 5BNWA 3ZHEA 1EDUA 3LY7A 4G24A 2ZISA 4D10C 2KZTB 1N95A 5J08A 4CZ2D 2CG3A 4Q94A 3BUAA 5CMWA 5ENSD 1O1TA 3T5XA 3MJWA 5E76A 5T3RA 4U07A 5KJNA 2MRIA 4F1PA 2V0PA 3HIZA 2ONDA 4Q69A 4BWRA 5LX8A 5ITZF 4C0MA 3Q9NC 2P9SG 4JPSA 2GRPB 1Z3YA 4FLBA 4PH4B 4ATGA 5J90A 1H19A 2HO1A 4K5CA 3EIQC 4APFA 3CR3A 3APDA 4PS8A 3CLJA 4DRXE 1D8EA 2R05A 2J08A 3IHVA 4GTMA 1E8WA 3QDNA 1W3BA 3E4BA 3V30A 2VSNA 3TL5A 1OWLA 3RRMB 1K1AA 2WQ7A 4X8QA 1QNFA 3CV0A 4FJZA 4I1MA 3DSSA 4FC8A 4WWOA 3ASFA 4F53A 3PUJA 4WNDA 2VYIA 3UUXA 1H6OA 1TN6A 4FADA 4UQYA 3K9IA 2IOLA 4M7CA 3Q15A 3Q7AA 3L16A 4U8VD 5AJDA 2IO2C 3C98A 3D9NA 3UINC 3G2VA 3FH5A 3ASGA 4JZYA 4KZCA 2MOWA 4DX5D 4FU3A 1L5JA 5FT9A 4TUUA 2Y4UA 5BV1A 2BEDA 1WAO1 3B7RL 2WXPA 2XS8A 2GRMA 3D3MA 3V79K 3FTZA 2V4HC 2IJGX 1LD8A 3DSUA 2FULA 3UX4A 4XZ4A 3AG3E 4ABNA 3DSTA 5AIJA 4QQIA 4TXRA 3UKUG 4BY6A 2PL2A 3MKQA 2R2LA 1E90A 4GTPA 2DZOA 5BW8C 3AG2E 2X6JA 5JHAA 4HRNA 4G8KA 4DLOA 4MLPA 3LVRE 3HXDA 3VTYA 3SFYA 4N5QA 4BERA 5JHBA 4KBQA 3ASHA 4EZKA 4K5BA 3QWPA 3NB2A 3S7DA 4EQFA 4P29A 5KWDA 3DWLG 4WWPA 1N52A 4V3IA 3KSQA 1AP7A 3HVEA 4C9BB 3LXUX 4O60A 1ZB1A 1TNBA 4DUIA 1JPLA 2IOSA 2KM4A 4HVBA 2IQCA 5G05C 5KNHD 1Z5SC 1FPPA 1MJ0A 4GMRA 3ZRHA 3ABME 3RAUA 2IEJA 2LAIA 3S7BA 3RU0A 2QYUA 1UW4B 5HQ8A 4CYMD 2ZU6B 2XPIA 2VSXE 3J5PA 2OOEA 5EILA 5ANRA 2DIWA 1IQUA 3EDTB 5EX3A 2AXUA 4YVQC 5AQ9A 1FCHA 5EN5D 1PY1A 5FQ7A 4DLQA 3C3QA 2BKKB 1A17A 3B13A 1AWCB 4JHKA 4BESA 2NXPA 5AN8A 3PREA 4CDNA 3VLFA 3HDXA 3LVQE 2DCPA 2F8XK 3CSFA 3UT4A 4GZDA 3TG5A 2UY1A 4N39A 3UXGA 5JJ6A 1DCEA 3L22A 2YHCA 2P9KG 3DSVA 2C0MA 3FEXA 2WXFA 4GZ3A 3UMVA 3UM2A 4APOA 2PM6A 2R59A 4RSYA 2QYJA 2XEVA 1HH8A 2LUHA 5BV0A 3TWTA 1YA0A 2IY0C 3QAQA 5G04C 3HYMB 2M63A 4U0ZA 3DRAA 3PS6A 4EZJA 5FIOA 5ENPD 3ZIMA 5D0QD 2XZTG 4GPKA 3HG0D 2AJAA 3QJZA 4K03A 4OYSA 3ZEFA 2P9NG 4J7WA 5FZSA 2QC9A 2ILRA 4J6IA 4LSZE 3WG7E 2J4BA 2H6HA 4LNUD 5AENA 3FUDA 1MYOA 4GYYA 3CQCB 5HRYA 2I6HA 4CT4A 4BFRA 1OCRE 3PEVB 1SVXA 1NA0A 4GCOA 3OXFA 4I6GA 2Y3AA 3ZYLA 4IRUA 3V2XA 3UM0A 5D2MC 3UM1A 4ACKA 3SHFA 4FHJA 4O1PA 2WMOA 1HG2A 4MS6A 4CT0A 1E96B 2EQXA 3ONKA 4N3BA 4NIKA 1N4RA 3FUMA 3ZNGA 3URZA 4CRWA 3CK8A 3QWWA 4I2ZA 4I1AA 3RRNB 1KZPA 4U8YD 3CHMA 4J8EA 4BT9A 3FH7A 4GTRA 2OVBA 5HI7A 2IF4A 4KVMA 5EX0A 3IKOB 1WG0A 5HS0A 1KZOA 1N0RA 1EF1C 3G2WA 1TEZA 4NURA 3ONLA 4I6EA 1S64A 3ABLE 2WXQA 1HG5A 5EYLA 2HM8A 4M3OA 1U3DA 3JCKC 4JB8P 4KXKB 4BTAA 5G04J 2DYRE 1IXVA 2A5UA 2PM7A 1Q2ZA 3LJ3A 4GB9A 5CEAA 4IULA 3AS8A 1ELWA 1UN9A 2HE0A 3SBSA 3C5RA 3ZVVA 2CHWA 3PH0C 4HBDA 1N9AA 3DXKG 3G2TA 3UM3A 3DPYA 2E2EA 1XGWA 3PVLA 1K1BA 4WUYA 3D9JA 3CKBA 3SGHA 4PS3A 4AV7A 3W9GA 4FJYA 1N4QA 3B7UX 5ANLA 4A3VA 3ISMC 1PAQA 3MCXA 2J09A 3TGOA 4ILHB 4BX9A 3ZGQA 2AXZA 1MX6A 3EUVA 3PUKA 4N2QA 1VDYA 3L6AA 5CRUA 3O48A 1INZA 4B89A 4WAFA 4Y6WA 3B7BA 1OXJA 3TWQA 1E8ZA 1H2TC 2WXJA 1QQEA 2CFZA 2WXIA 2VGXB 5AJLA 4J0UA 1H0AA 4FA6A 4MKTA 2AWIA 3FUIA 3FH8A 4DK5A 3ZXPA 2RFAA 4AXHA 5FWQA 4AP2A 4G1TA 1SZ9A 4KVOA 1NFIE 4AEZC 2KATA 2OEVA 2RD0A 3GZ2A 4I1OB 3FUFA 3ZUVB 3Q73A 3RO2A 4HRLA 3LS8A 5JJ7A 3BG0B 2GROB 4EPZA 4EECA 3PZ2A 4QFVA 1SZAA 3ABKE 2J49A 1FT2A 1OY3D 4I6JA 3EU9A 4HB5A 4ME2A 5CBNA 4PUCA 3EHNA 4GCNA 1UN8A 2ZGDA 3Q5MA 3LJNA 3QNKA 3ML9A 1HFAA 3NZUA 3RO3A 3ZPJA 2PNNA 3W9FA 2KCVA 4HOSA 4ANXA 3LYAA 4GA1A 5IY5E 1LF8A 5LOZA 5FZQA 2ZIRA 2LSUA 1YCSB 1N94A 4U0UA 5ENRD 2P58C 3FU0A 5EIBE 3S7FA 4J8YA 5AYWD 4JHRA 2XPZA 5C2YA 2XZDG 1H6KA 4RQIA 5FTPA 1MZCA 4G23A 1MX2A 4E6HA 5LCWJ 4JEUA 2Y69E 1NZNA 2OEWA 3RK6A 3Q9UC 4GAAA 3ASOE 2WXKA 4LNGA 4A3TA 4OVVA 1V54E 3CK9A 2H6FA 3I5PA 2ETBA 1ELKA 3DSWA 3FFLA 3DSXA 3FU5A 2Q7FA 2ETAA 2WVIA 2I9CA 1ELRA 1DC2A 1TJFA 2H6IA 2L0IA 3ZKJA 5BT1A 4YDYA 1UJJA 4LG6A 4EZLA 1BI7B 5C1DA 3IHYA 1HE8A 3CHSA 5AQAA 2V4LA 1E7VA 3T5VA 3V31A 3IXEA 4URKA 1U3CA 2WXNA 2HR2A 3SFXA 4BEPA 3ZW3A 3FEYA 3L82A 2VQ2A 1BD8A 3O4ZA 3U66A 4LERA 4N3CA 4TXQA 1TNZA 3KD7A 3PZ3A 5B1AE 2KBXA 4BX8A 1RZ4A 3FU3A 4AM9A 3PZDA 3UT8A 4HLEA 4JW1A 3C3RA 4UWKA 1MQSA 3SO8A 1D8DA 2CFUA 4G2VA 4EBAG 3GZ1A 1BI8B 3L9TA 1BLXB 4N5CA 2Y4TA 2NC9A 2J4DA 4A1SA 2FEZA 3FDHA 4U96D 1O5MA 3P2BA 3CVYA 4HQDA 3ESLA 2XGSA 2UWJG 4J8SA 4ILGA 4CGVA 2H6GA 4ANUA 3B7TA 1HF8A 1NA3A 4BSZB 5KNGA 2DWZA 2VTBB 2P9PG 3AG1E 1N4SA 1SA5A 3D9KA 3SZ7A 2RKKA 3Q7FA 1HXIA 4KYOB 3TG4A 3U3WA 2MYOA 4L23A 4AY5A 4OAVB 4XX5A 3FTUA 4ANVA 3E32A 1HS6A 1KLXA 3NBNB 3UI2A 2RFMA 3D9HA 3ZHEB 4W9RA 5AQ7A 3APFA 5ENTD 4KZ0A 1D9SA 3SD5A 4U0SA 4XI9A 3B95A 2L6BA 2XGMA 4F6RD 4GTTA 4JA9A 4A55A 3SBTB 5FINA 2BF0X 2Y1LE 3JUEA 4C0EA 1SA4A 4G11A 4RG6A 3LDZA 2PQRA 5EDSA 4GYWA 3TWVA 1WDYA 5CEDB 4I2WA 2XPYA 4LCTA 4EBAA 2KXPC 2X6FA 2L9BA 3QKYA 1N11A 4KMOA 1ZBPA 3IV0A 3UTMA 3TWRA 1UOHA 2I1KA 2AVPA 2F37A 1YYHA 3LY9A 3L54A 4FLHA 4LNBA 2LXMA 4CDMA 4C48B 2QFCA 2WXOA 2CHZA 2XRYA 2R02A 3FULA 3I4RB 1OCZE 1OCCE 3TXNA 3JUIA 3FTVA 3TXMA 1DNPA 3NAWA 2KZTA 4FULA 5A6CA 1JCQA 2BKGA 3Q47B 4L7TA 1JCRA 1HX8A 4GYOA 3R7QA 2XEEA 2L0TB 3LPZA 4ACLA 4L2YA 4L1BA 4U95D 1HU3A 2NSZA 3DEPA 2V8SE 5BXUA 3OAWA 3ZN3A 4A1GA 4R7LA 5LP0A 3MKQB 3TAXA 3MEKA 4ZFHA 2YNQA 1H2VC 1TNYA 2GRNB 5E75A 3QK0A 1TN7A 1A5EA 2WPVA 3JQ1A 2AXVA 3J5QB 3UT7A 3SI5A 3NOGD 4WNEA 2WQ6A 3FU6A 3F6QA 1Z3XA 5FQ4A 4HI9A 1OCOE 4U7EB 4YDEA 3CVUA 1U2VG 1OWMA 2I1JA 3E30A 2EIJE 1ZU2A 4YDWA 3BG1B 2YINA 3MV3B 5T4YA 3MA5A 4F1SA 3PE4A 3PNTB 3ENEA 4HRMB 3VLDA 3HVEB 4B8CB 3ULEG 2P9LG 1OWNA 4JEHA 4GTQA 3MV2B 2GRRB 4GZ6A 1N54A 5A23A 2ETCA 4B8AA 2F8YA 3SNXA 4TXPA 2J9QA 2HYZA 3BEEA 4F7AA 2EINE 3B7SA 5AARA 3RSEG 5JA4D 4GPMA 1JUQA 2BUGA 5ENQD 5FJYA 3AS4A 2ZXWE 5DBKA 3MYVA 3EHMA 3U9WA 4K5AB 2WXRA 2FF4A 4O6FA 4K0RA 3MKRA 5KBAA 3D9OA 2X6KA 3CHPA 4KT6B 4AJWA 4I43A 2XRZA 4GZ5A 5LCWC 3D9PA 1UG3A 5KJLA 2LXLA 5KJKA 3DBSA 3V2OA 5CMYA 5G2NA 1X5BA 1KT0A 2GRLA 2QZAA 4RLYA 3CEQA 4AOFA 2UY1B 1OUVA 4XKCA 5ENOD 1B89A 4J8FA 2I2OA 2WXGA 3JXIA 2VGYA 3CVVA 3AG4E 2R5SA 3GW4A 3TWXA 3ZU7B 3QWVA 2WQHA 1NI1A 5HKPA 5AAOA 1Z6TA 3QB2A 5H7PA 4OVUA 5DIZA 4L2LA 2FI7A 4EHMA 4YVOA 4NQ0A 4HS2A 2V5FA 3PNLB 3UKRG 3CVPA 1V55E 2CHXA 4GU5A 2RG8A 4PS7A 3PZ4A 1O1RA 2A4ZA 1UJKA 3SFZA 3CGHA 4E85A 3CHQA 4NRHB 2IONA 2WXHA 1Y8MA 4TUMA 4DX1A 3L17A 3FTYA 3S2AA 3QOUA 2DVWA 4JVSA 2B6CA 2F0YA 3G2SA 4HFGA 2R03A 2OVFA 1TR4A 2E0IA 4N3AA 3EHRA 2P9IG 5CHEE 3JYSA 1LD7A 1OWOA 4JC8A 1H6PA 1MX4A 2XCBA 3CKCA 3R7RA 2VJ8A 1H2UA 2GGFA 2XCCA 3GYZA 4DX2A 4A63B 4YNDA 1PC2A 3NQPA 1O1SA 4O1OA 2FO1E 3R9AB 3LY8A 2JABA 2KCKA 3BQOA 3MZLB 5CCMA 2PZIA 2WM9A 4B0ZA 4NACA 4HORA 2C0LA 1S70B 2P2CP 1BPOA 3CVQA 4MBGA 3RKVA 4UI9K 3JXJA 3EIJA 2VSOE 3PE3A 5EKQD 3KEZA 4UQZA 3I4GA 3AU4A 3CHRA 3DPDA 2L6JA
chains in the Genus database with same CATH topology
5HI7A 4C0EA 4TV3A 1IQRA 4UQXA 3OXLA 3FWVA 2IF4A 4KVMA 4G11A 5EX0A 3RRUA 5JJTA 3IKOB 4RG6A 4BSXA 3LDZA 2PQRA 5EDSA 3FTSA 4GYWA 2WB2A 3ESKA 3ZYKA 4LUNU 1EF1C 5BNWA 1EDUA 3FP3A 3G2WA 3LY7A 4G24A 4I2WA 1Y6IA 4NURA 3ZHEA 2XPYA 3ONLA 4I6EA 4AY6A 4LCTA 4EBAA 2WXQA 4UWGA 1HG5A 4D10C 4Y6CA 2KZTB 2X6FA 2L9BA 3QKYA 5J08A 3NZSA 2HM8A 2CG3A 4KMOA 4M3OA 1ZBPA 1U3DA 3IV0A 3JCKC 4Q94A 5CMWA 4KXKB 3T5XA 4BTAA 4N2SA 5G04J 2I1KA 3MJWA 5E76A 5T3RA 2A5UA 4U07A 4FHKA 2PM7A 2AVPA 5KJNA 2MRIA 3LJ3A 2V0PA 3CQGB 3HIZA 4GB9A 2ONDA 3LY9A 3L54A 3AS8A 1ELWA 1UN9A 4IULA 4FLHA 3SBSA 4Q69A 4BWRA 5LX8A 3ZVVA 2CHWA 3PH0C 4C0MA 2X6IA 4CDMA 2QFCA 2WXOA 3G2TA 4JPSA 1Z3YA 4FLBA 2CHZA 4PH4B 2KC7A 2E2EA 2XRYA 4ATGA 1XGWA 3FULA 3I4RB 1JWGA 3PVLA 1OWPA 4WUYA 3D9JA 3CKBA 5J90A 2XHEA 3TXNA 2LSVA 3JUIA 4Q96A 3SGHA 3FTVA 1H19A 2HO1A 3EIQC 4APFA 4PS3A 4AV7A 4I17A 3TXMA 3CR3A 1DNPA 3APDA 2JLBA 4FJYA 4PS8A 3B7UX 3CVWA 3CLJA 2KZTA 5ANLA 4A3VA 4FULA 2J08A 1PAQA 3MCXA 2J09A 3TGOA 3IHVA 4ILHB 5A6CA 1E8WA 1TJCA 3AU5A 3QDNA 4BX9A 3Q47B 1W3BA 3E4BA 3ZGQA 3ZYQA 4L7TA 3MX3A 3OXGA 4I9EA 2AXZA 4H7YA 2VSNA 1HX8A 3PUKA 4N2QA 3TL5A 1VDYA 3ZXSA 4GYOA 1OWLA 3L6AA 3R7QA 2L0TB 3RRMB 4GA2A 3O48A 3LPZA 2WQ7A 4ACLA 4HOQA 1QNFA 3CV0A 4L2YA 4L1BA 4FJZA 4I1MA 4FC8A 1HU3A 1INZA 4XI0A 4CGWA 4B89A 3I3NA 4WAFA 4Y6WA 4WWOA 2NSZA 3ASFA 4F53A 4J8DA 3UQ3A 3PUJA 2V8SE 3VLEA 4WNDA 2VYIA 1E8ZA 1H2TC 4GZCA 4JHJA 2WXJA 3Q49B 1QQEA 2LAHA 2WMNA 3UUXA 3CVNA 3CIAA 3S7JA 4GMJA 2CFZA 2WXIA 2VGXB 3OAWA 5AJLA 4FADA 4UQYA 1EPUA 4J0UA 4TRQA 3K9IA 2IOLA 3ZN3A 4A1GA 1H0AA 4FA6A 4MKTA 2AWIA 3Q15A 4R7LA 3L16A 4U04A 3MKQB 3FUIA 5AJDA 3C98A 3D9NA 3FH8A 5LP0A 4DK5A 3TAXA 3CVLA 3MEKA 3G2VA 3FH5A 3JQ0A 2YNQA 1E8XA 4AXHA 3ASGA 1H2VC 4JZYA 4XE0A 5FWQA 5LFAA 2XQ0A 5E75A 4KZCA 3QK0A 4ANWA 4AP2A 2WPVA 3JQ1A 2MOWA 2AXVA 4FU3A 1L5JA 4G1TA 5FT9A 2PQNA 2Y4UA 4TUUA 5BV1A 1SZ9A 4IN3B 4KVOA 1IYGA 3T8MA 3UT7A 1WAO1 4AEZC 2KATA 4U63A 3SI5A 4LRZA 5D0OD 4G25A 4HOTA 3B7RL 2RD0A 2WXPA 4WNEA 3GZ2A 4I1OB 2WQ6A 3FUFA 3FU6A 3D9LA 2GRMA 3RO2A 3D3MA 3FTZA 1Z3XA 5FQ4A 2IJGX 1NP7A 3LS8A 5JJ7A 3BG0B 3DPDA 2FULA 4EPZA 1HO8A 4EECA 4QFVA 1SZAA 4XZ4A 3MGBA 3UX4A 3CVUA 4MRUA 4ABNA 1OWMA 2I1JA 4AVXA 3ZYMA 2J49A 2VGXA 5AIJA 2MHKA 4I6JA 3Q4AB 1ZU2A 3BG1B 4BY6A 4ME2A 4H7XA 2YINA 3MV3B 5T4YA 4PUCA 3MA5A 2PL2A 3MKQA 3EHNA 4GCNA 4F1SA 1UN8A 2BTDA 1E90A 3PE4A 5A7DB 3PNTB 3Q5MA 3ENEA 3QC1A 5BW8C 3VLDA 3HVEB 3ML9A 3QNKA 3HHMA 2X6JA 3RJVA 5JHAA 4B8CB 1HFAA 4FP7A 1OWNA 3NZUA 3RO3A 2QY7A 3ZPJA 4DLOA 4JEHA 2FBNA 4MLPA 3LVRE 2KCVA 4HOSA 1SQMA 3MV2B 4ANXA 4GZ6A 1N54A 2YQ8A 3LYAA 3VTYA 5A23A 3IEGA 4GA1A 1EYHA 5JHBA 2LO6A 3GZSA 4LEUA 1LF8A 5LOZA 5FZQA 4KBQA 2DBAA 3ASHA 4EZKA 4B8AA 2OV8A 3QWPA 2WXLA 3SNXA 2LSUA 3CSTA 5ENNA 2J9QA 3S7DA 5BUZA 2HYZA 3BEEA 4F7AA 3B7SA 4U0UA 4EQFA 2J07A 4BTBA 1JUQA 4P29A 2P58C 3FU0A 3S7FA 2BUGA 1E8YA 4WWPA 5AYWD 4JHRA 1N52A 2XPZA 3KS2A 5C2YA 1H6KA 4V3IA 5FJYA 5FTPA 2WXMA 3AS4A 4G23A 2FO7A 5DBKA 3HVEA 1FVFA 4C9BB 4E6HA 3MYVA 3D9IA 3EHMA 3U9WA 3LXUX 5LCWJ 2WXRA 4WNGA 1TEZA 2CG2A 4JEUA 2FF4A 3TJPA 4O6FA 4K0RA 3MKRA 3D9OA 5G05J 1NZNA 2X6KA 3CHPA 4KT6B 4RG9A 3RK6A 4AJWA 5BPPA 4I43A 3FUEA 3QARA 2XRZA 2IU1A 4HOUA 4GZ5A 5LCWC 1JPLA 4GAAA 5ARFA 2IOSA 5T8IA 2KM4A 3D9PA 2WXKA 3ASDA 1UG3A 3L08A 5FZRA 3ML8A 4HVBA 5KJLA 3FTWA 4I9CA 4A3TA 5KJKA 2IQCA 3DBSA 3PDNA 4OVVA 5G05C 1KT1A 3L13A 3LKUA 3CK9A 4WNFA 3I5PA 4HXIA 5CMYA 5G2NA 3ZRHA 3IBEA 3SF4A 1X5BA 4JA7A 1KT0A 2LAIA 5KJMA 1ELKA 2GRLA 3S7BA 3FFLA 3RU0A 1UW4B 4IYPA 4XIFA 5HQ8A 1QZ2A 3CEQA 3FU5A 3FUHA 2Q7FA 2GW1A 2ZU6B 2XPIA 3PEUB 4AOFA 2UY1B 1OUVA 2VSXE 4XKCA 2WVIA 2X6HA 2I9CA 3N71A 5G55A 1ELRA 2VSYA 1B89A 4J8FA 1TJFA 2I2OA 3G2UA 2L0IA 2OOEA 5KCMA 2WXGA 5BT1A 5ANRA 2DIWA 3FUNA 1UJJA 2VGYA 3CVVA 1IQUA 4F3VA 2R5SA 3GW4A 3EDTB 5EX3A 1HZ4A 4EZLA 3QWVA 4RVBA 1GW6A 5C1DA 3IHYA 2AXUA 4GMLA 1HE8A 3CHSA 4YVQC 2C2LA 1FCHA 2V4LA 2WQHA 1E7VA 2R17C 3T5VA 1PY1A 1Z6TA 4UWLA 3QB2A 5FQ7A 4DLQA 1S0PA 1A17A 3B13A 4OVUA 4JHKA 5M72A 1MHQA 3UPVA 5DIZA 4WWNA 4L2LA 4URKA 4UI9C 2NXPA 1U3CA 2FI7A 2WXNA 3PREA 2HR2A 1XNFA 4CDNA 3ZW3A 4YVOA 3FEYA 4NQ0A 3VLFA 4HS2A 3EJNA 3HDXA 4DPRA 2YHEA 2VQ2A 2V5FA 3FHEA 3LVQE 2DCPA 3O4ZA 3PNLB 3CVPA 3CSFA 3U66A 3UT4A 2CHXA 4GU5A 4GZDA 2RG8A 4PS7A 3TG5A 3WXXA 2UY1A 5ARGA 4N39A 2A4ZA 5JJ6A 1FVHA 4LERA 4N3CA 1UJKA 4XKBA 3L22A 3SFZA 4CCAA 3KD7A 3CGHA 2YHCA 4BT8A 4CDRA 4E85A 3CHQA 4CEMA 4BX8A 4NRHB 2IONA 3FU3A 2WXHA 4AM9A 1Y8MA 3PZDA 3RIBA 3L17A 3FTYA 3S2AA 3QOUA 4DI4A 2C0MA 3FEXA 5CCLA 3UT8A 2WXFA 4HLEA 1WM5A 4GZ3A 4JW1A 3UMVA 4UWKA 1MQSA 4APOA 2PM6A 2R59A 1JWFA 4RSYA 1E7UA 3LCAA 4GA0A 2CFUA 4G2VA 4EBAG 2XEVA 3GZ1A 1HH8A 4JVSA 5BV0A 4N5CA 1YA0A 2Y4TA 3U4TA 4HFGA 3G2SA 2NC9A 3QAQA 2J4DA 5G04C 4A1SA 3FTXA 4JXTA 3NF1A 3HYMB 2FEZA 3FDHA 2M63A 3P2BA 4U0ZA 3PS6A 4UWFA 2OVFA 2X3MA 4EZJA 3CVYA 4N3AA 2E0IA 3ESLA 3ZFWA 3ZIMA 5D0QD 5CHEE 2XGSA 2UWJG 4U8HA 3JYSA 2JEKA 1OWOA 4JC8A 4GPKA 4J8SA 2XCBA 3CKCA 3CHOA 3R7RA 4ILGA 3QJZA 1IHGA 4K03A 4OYSA 4CGVA 4ANUA 3ZEFA 3B7TA 3U64A 1HF8A 1NA3A 5FZSA 2XGOA 3APCA 4DI3A 2IFUA 2ILRA 2LNIA 2VJ8A 4J6IA 1H2UA 3AS5A 1WY6A 2XCCA 2GGFA 2J4BA 3D9MA 3GYZA 2VTBB 5FQ8A 3OTNA 4G26A 5AENA 3FUDA 4YNDA 1PC2A 4GYYA 3CQCB 3NQPA 2I6HA 4CT4A 4BFRA 3D9KA 3PEVB 3SZ7A 3R9AB 1NA0A 1HXIA 4GCOA 3OXFA 3FUKA 4KYOB 3LY8A 3VTXA 4I6GA 4PDXA 3TG4A 3U3WA 2Y3AA 2KCKA 4IRUA 3ZYLA 3FY4A 4AIFA 4L23A 3MZLB 4ACKA 3SHFA 2KCLA 4FHJA 4B94A 4AY5A 4XX5A 5CCMA 2PZIA 2WM9A 3FTUA 4B0ZA 4ANVA 2WMOA 1HG2A 4MS6A 1HS6A 1KLXA 4CT0A 4NACA 1E96B 4HORA 2C0LA 3ZHEB 2EQXA 1DVPA 3ONKA 4W9RA 4N3BA 1BPOA 3CK7A 3APFA 3CVQA 3KAEA 4KZ0A 3FUMA 4DJAA 3CVXA 4UWHA 3SD5A 3URZA 4CRWA 4U0SA 3RKVA 3CK8A 3QWWA 4I2ZA 3ULQA 4XI9A 4UI9K 4I1AA 4ILIA 2XGMA 3LEWA 2X38A 3RRNB 3EIJA 4JA9A 4JL0A 4A55A 3SBTB 5FQ6A 3CHMA 4UI9J 1P5QA 2VSOE 3FUJA 3PE3A 5EKQD 3KEZA 4UQZA 2VTBA 3I4GA 4J8EA 4BT9A 3FH7A 3AU4A 2BF0X 2AW6A 3CHRA 3PRZA 2OVBA 3P1UA 2L6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HI7 A;  4UQX A;  3OXL A;  3FWV A;  2IF4 A;  5JJT A;  5EX0 A;  4RG6 A;  2PQR A;  4GYW A;  3ESK A;  5BNW A;  3ZHE A;  3FP3 A;  3LY7 A;  4G24 A;  4I2W A;  4AY6 A;  4Y6C A;  3QKY A;  1ZBP A;  4KXK B;  4BTA A;  4N2S A;  5G04 J;  4U07 A;  2AVP A;  5KJN A;  2OND A;  3LY9 A;  3AS8 A;  1ELW A;  4BWR A;  2QFC A;  2KC7 A;  2E2E A;  4WUY A;  3CKB A;  2LSV A;  2HO1 A;  4I17 A;  2JLB A;  3TGO A;  5A6C A;  1TJC A;  3QDN A;  3Q47 B;  1W3B A;  3E4B A;  3ZGQ A;  4I9E A;  3OXG A;  4H7Y A;  2VSN A;  4N2Q A;  4GYO A;  4GA2 A;  3O48 A;  3LPZ A;  4HOQ A;  3CV0 A;  4XI0 A;  4CGW A;  4Y6W A;  3ASF A;  3UQ3 A;  4J8D A;  4WND A;  2VYI A;  3Q49 B;  1QQE A;  3UUX A;  3CVN A;  3S7J A;  2VGX B;  4UQY A;  4J0U A;  3K9I A;  3ZN3 A;  3Q15 A;  4U04 A;  3TAX A;  3CVL A;  3MEK A;  3ASG A;  2WPV A;  4G1T A;  5FT9 A;  2PQN A;  2Y4U A;  4IN3 B;  1IYG A;  1WAO 1;  2KAT A;  5D0O D;  4G25 A;  4HOT A;  4WNE A;  3GZ2 A;  3RO2 A;  5JJ7 A;  4ABN A;  2VGX A;  2MHK A;  3Q4A B;  1ZU2 A;  4ME2 A;  4H7X A;  3MV3 B;  3MA5 A;  2PL2 A;  4GCN A;  3PE4 A;  5A7D B;  3Q5M A;  5BW8 C;  3RJV A;  3ZPJ A;  3RO3 A;  2FBN A;  2KCV A;  4HOS A;  3MV2 B;  4GZ6 A;  2YQ8 A;  3LYA A;  3VTY A;  3IEG A;  4GA1 A;  4LEU A;  5FZQ A;  4KBQ A;  2DBA A;  3ASH A;  3QWP A;  2LSU A;  2J9Q A;  3S7D A;  2HYZ A;  3BEE A;  4U0U A;  4EQF A;  4BTB A;  2P58 C;  3S7F A;  2BUG A;  5AYW D;  4JHR A;  3KS2 A;  5FJY A;  5FTP A;  3AS4 A;  4G23 A;  2FO7 A;  5DBK A;  5LCW J;  4WNG A;  2FF4 A;  4O6F A;  3MKR A;  5G05 J;  1NZN A;  4RG9 A;  4HOU A;  4GZ5 A;  5LCW C;  5ARF A;  3ASD A;  5FZR A;  5KJL A;  4I9C A;  5KJK A;  3PDN A;  5G05 C;  1KT1 A;  3LKU A;  3CK9 A;  4WNF A;  3SF4 A;  4JA7 A;  1KT0 A;  5KJM A;  3S7B A;  3FFL A;  3RU0 A;  4XIF A;  5HQ8 A;  1QZ2 A;  3CEQ A;  2Q7F A;  2GW1 A;  2XPI A;  2UY1 B;  1OUV A;  3N71 A;  1ELR A;  2VSY A;  1B89 A;  4J8F A;  2OOE A;  5BT1 A;  2VGY A;  4F3V A;  2R5S A;  3GW4 A;  3EDT B;  5EX3 A;  1HZ4 A;  3QWV A;  5C1D A;  4YVQ C;  2C2L A;  1FCH A;  2WQH A;  1A17 A;  5M72 A;  3UPV A;  5DIZ A;  4UI9 C;  2FI7 A;  2HR2 A;  1XNF A;  4YVO A;  4NQ0 A;  2VQ2 A;  2V5F A;  3CVP A;  3TG5 A;  3WXX A;  2UY1 A;  5ARG A;  4N39 A;  5JJ6 A;  4N3C A;  3KD7 A;  2YHC A;  4BT8 A;  4CDR A;  4NRH B;  4AM9 A;  1Y8M A;  3RIB A;  3QOU A;  2C0M A;  5CCL A;  1WM5 A;  4GZ3 A;  4APO A;  4GA0 A;  3LCA A;  4G2V A;  2XEV A;  3GZ1 A;  1HH8 A;  4N5C A;  1YA0 A;  2Y4T A;  3U4T A;  2NC9 A;  5G04 C;  4A1S A;  3NF1 A;  3HYM B;  2FEZ A;  4U0Z A;  4N3A A;  3ZFW A;  5D0Q D;  5CHE E;  2XGS A;  2UWJ G;  3JYS A;  4GPK A;  2XCB A;  3CKC A;  1IHG A;  4CGV A;  1NA3 A;  5FZS A;  2XGO A;  2IFU A;  2LNI A;  3AS5 A;  2XCC A;  3GYZ A;  4G26 A;  4YND A;  1PC2 A;  4GYY A;  2I6H A;  3SZ7 A;  3R9A B;  1NA0 A;  1HXI A;  4GCO A;  3OXF A;  4KYO B;  3LY8 A;  3VTX A;  3TG4 A;  3U3W A;  2KCK A;  4AIF A;  4B94 A;  2KCL A;  4AY5 A;  5CCM A;  2PZI A;  1KLX A;  1E96 B;  4HOR A;  2C0L A;  3ZHE B;  4W9R A;  4N3B A;  3CK7 A;  3CVQ A;  3KAE A;  3URZ A;  3RKV A;  4U0S A;  3ULQ A;  3CK8 A;  3QWW A;  4I2Z A;  4XI9 A;  4UI9 K;  4I1A A;  2XGM A;  4JA9 A;  4JL0 A;  4UI9 J;  1P5Q A;  3PE3 A;  5EKQ D;  4UQZ A;  4J8E A;  4BT9 A;  2L6J A; 
#chains in the Genus database with same CATH topology
 2V5Q C;  4L9P A;  4UQX A;  3OXL A;  3FWV A;  3RRU A;  3FTS A;  3ESK A;  3FP3 A;  3Q75 A;  1Y6I A;  4AY6 A;  4UWG A;  4Y6C A;  3NZS A;  4GTS A;  4B93 B;  4N2S A;  4FHK A;  3CQG B;  4JD2 G;  3X2Q E;  2X6I A;  3SQV A;  2KC7 A;  3Q78 A;  3EHQ A;  1JWG A;  1G3N B;  1OWP A;  2XHE A;  4YDO A;  2LSV A;  4Q96 A;  4I17 A;  3UIO C;  2JLB A;  3CVW A;  1TJC A;  3AU5 A;  2B0O E;  3ZYQ A;  3MX3 A;  3OXG A;  4I9E A;  4H7Y A;  3ZXS A;  1SW6 A;  4GA2 A;  4HOQ A;  4XI0 A;  4CGW A;  3I3N A;  4J8D A;  3UQ3 A;  3VLE A;  2XS1 A;  3TWS A;  4GZC A;  4JHJ A;  3HXB A;  3Q49 B;  2LAH A;  2WMN A;  3CVN A;  3CIA A;  3S7J A;  4GMJ A;  4G8L A;  1EPU A;  4TRQ A;  4Z68 A;  2XEH A;  4U04 A;  3SY2 A;  3CVL A;  3JQ0 A;  1E8X A;  5LFA A;  4XE0 A;  2XQ0 A;  4ANW A;  2EIK E;  1TN8 A;  2GRQ B;  2PQN A;  2ZGG A;  4IN3 B;  1FT1 A;  4OAU C;  1QBQ A;  1IYG A;  3T8M A;  1IHB A;  4U63 A;  4LRZ A;  5D0O D;  4G25 A;  4HOT A;  3D9L A;  1TNU A;  2VGE A;  5EID A;  1NP7 A;  1HO8 A;  5D66 A;  3MGB A;  4MRU A;  4AVX A;  3ZYM A;  2VGX A;  2MHK A;  3Q4A B;  3Q79 A;  4H7X A;  1TNO A;  4ATZ D;  2XEN A;  4GTV A;  1YMP A;  2BTD A;  1OT8 A;  5A7D B;  3HXC A;  3QC1 A;  5JMN D;  3E33 A;  3HHM A;  3RJV A;  4FP7 A;  2QY7 A;  2FBN A;  1SQM A;  3E37 A;  2YQ8 A;  3KEA A;  3IEG A;  2EIL E;  1EYH A;  2DZN A;  2LO6 A;  3GZS A;  4LEU A;  5CBO A;  2DBA A;  2OV8 A;  2WXL A;  3CST A;  5ENN A;  1S63 A;  5BUZ A;  3HXE A;  2J07 A;  4BTB A;  1E8Y A;  5CEC B;  4HLL A;  2NYJ A;  3KS2 A;  1NL4 A;  3T8K A;  2WXM A;  1JCS A;  2FO7 A;  1FVF A;  3D9I A;  1RW2 A;  4WNG A;  2CG2 A;  3TJP A;  5EYP F;  2DYS E;  5G05 J;  3E34 A;  5BPP A;  2EIM E;  4RG9 A;  3FUE A;  3QAR A;  1K8K G;  2IU1 A;  4HOU A;  5ARF A;  5T8I A;  4DX7 D;  1DCQ A;  3ASD A;  3AAA C;  3L08 A;  5FZR A;  3ML8 A;  3FTW A;  4I9C A;  4UUC A;  3PDN A;  2J8S D;  1KT1 A;  3KSL A;  3L13 A;  3LKU A;  3ULY A;  4WNF A;  4HXI A;  3HXF A;  3IBE A;  3SF4 A;  3DXM G;  4JA7 A;  5KJM A;  4IYP A;  4XIF A;  1QZ2 A;  3FUH A;  2GW1 A;  3PEU B;  3T9K A;  2X6H A;  3N71 A;  5G55 A;  2VSY A;  3G2U A;  4HI8 A;  5KCM A;  3AJI A;  3FUN A;  4F3V A;  4ZHB A;  2IO3 C;  1HZ4 A;  4RVB A;  1GW6 A;  4GML A;  2C2L A;  1LTX A;  2R17 C;  4UWL A;  1K3Z D;  1S0P A;  4XEI G;  5M72 A;  1MHQ A;  3UPV A;  4WWN A;  5CRV A;  4UI9 C;  1XNF A;  3EJN A;  4DPR A;  2YHE A;  3FHE A;  1QYM A;  1N0Q A;  3WXX A;  2OCC E;  5ARG A;  1FVH A;  3NOC D;  4XKB A;  4CCA A;  4BT8 A;  4CDR A;  1TYQ G;  3ASN E;  4CEM A;  4HNA D;  3RIB A;  5B3S E;  4DI4 A;  5CCL A;  2Y0B G;  1WM5 A;  1JWF A;  5BXO A;  1E7U A;  3LCA A;  4GA0 A;  3C72 A;  3U4T A;  1IKN D;  3FTX A;  4JXT A;  3NF1 A;  4UWF A;  2X3M A;  5B1B E;  3TWW A;  3ZFW A;  3C3O A;  5CER B;  4U8H A;  2JEK A;  3TWU A;  3CHO A;  1IHG A;  3HRA A;  3EU5 A;  3U64 A;  2XGO A;  3APC A;  4DI3 A;  2IFU A;  2LNI A;  1KPS B;  3AS5 A;  1WY6 A;  3D9M A;  5FQ8 A;  3OTN A;  4G26 A;  1BU9 A;  2A5E A;  5AQB A;  3FUK A;  3VTX A;  4PDX A;  2P9U G;  3PZ1 A;  4B94 A;  3FY4 A;  4AIF A;  2KCL A;  1DVP A;  3CK7 A;  3KAE A;  4GTO A;  4DJA A;  3CVX A;  4UWH A;  3UIP C;  3ULQ A;  1N4P A;  4ILI A;  3DEO A;  3LEW A;  2X38 A;  4JL0 A;  5FQ6 A;  4UI9 J;  1P5Q A;  3BU8 A;  3FUJ A;  2VTB A;  2AW6 A;  3PRZ A;  3P1U A;  3R9M A;  4TV3 A;  1IQR A;  5JJT A;  4BSX A;  1X81 A;  4DX6 D;  2WB2 A;  3ZYK A;  4LUN U;  4BET A;  5BNW A;  3ZHE A;  1EDU A;  3LY7 A;  4G24 A;  2ZIS A;  4D10 C;  2KZT B;  1N95 A;  5J08 A;  4CZ2 D;  2CG3 A;  4Q94 A;  3BUA A;  5CMW A;  5ENS D;  1O1T A;  3T5X A;  3MJW A;  5E76 A;  5T3R A;  4U07 A;  5KJN A;  2MRI A;  4F1P A;  2V0P A;  3HIZ A;  2OND A;  4Q69 A;  4BWR A;  5LX8 A;  5ITZ F;  4C0M A;  3Q9N C;  2P9S G;  4JPS A;  2GRP B;  1Z3Y A;  4FLB A;  4PH4 B;  4ATG A;  5J90 A;  1H19 A;  2HO1 A;  4K5C A;  3EIQ C;  4APF A;  3CR3 A;  3APD A;  4PS8 A;  3CLJ A;  4DRX E;  1D8E A;  2R05 A;  2J08 A;  3IHV A;  4GTM A;  1E8W A;  3QDN A;  1W3B A;  3E4B A;  3V30 A;  2VSN A;  3TL5 A;  1OWL A;  3RRM B;  1K1A A;  2WQ7 A;  4X8Q A;  1QNF A;  3CV0 A;  4FJZ A;  4I1M A;  3DSS A;  4FC8 A;  4WWO A;  3ASF A;  4F53 A;  3PUJ A;  4WND A;  2VYI A;  3UUX A;  1H6O A;  1TN6 A;  4FAD A;  4UQY A;  3K9I A;  2IOL A;  4M7C A;  3Q15 A;  3Q7A A;  3L16 A;  4U8V D;  5AJD A;  2IO2 C;  3C98 A;  3D9N A;  3UIN C;  3G2V A;  3FH5 A;  3ASG A;  4JZY A;  4KZC A;  2MOW A;  4DX5 D;  4FU3 A;  1L5J A;  5FT9 A;  4TUU A;  2Y4U A;  5BV1 A;  2BED A;  1WAO 1;  3B7R L;  2WXP A;  2XS8 A;  2GRM A;  3D3M A;  3V79 K;  3FTZ A;  2V4H C;  2IJG X;  1LD8 A;  3DSU A;  2FUL A;  3UX4 A;  4XZ4 A;  3AG3 E;  4ABN A;  3DST A;  5AIJ A;  4QQI A;  4TXR A;  3UKU G;  4BY6 A;  2PL2 A;  3MKQ A;  2R2L A;  1E90 A;  4GTP A;  2DZO A;  5BW8 C;  3AG2 E;  2X6J A;  5JHA A;  4HRN A;  4G8K A;  4DLO A;  4MLP A;  3LVR E;  3HXD A;  3VTY A;  3SFY A;  4N5Q A;  4BER A;  5JHB A;  4KBQ A;  3ASH A;  4EZK A;  4K5B A;  3QWP A;  3NB2 A;  3S7D A;  4EQF A;  4P29 A;  5KWD A;  3DWL G;  4WWP A;  1N52 A;  4V3I A;  3KSQ A;  1AP7 A;  3HVE A;  4C9B B;  3LXU X;  4O60 A;  1ZB1 A;  1TNB A;  4DUI A;  1JPL A;  2IOS A;  2KM4 A;  4HVB A;  2IQC A;  5G05 C;  5KNH D;  1Z5S C;  1FPP A;  1MJ0 A;  4GMR A;  3ZRH A;  3ABM E;  3RAU A;  2IEJ A;  2LAI A;  3S7B A;  3RU0 A;  2QYU A;  1UW4 B;  5HQ8 A;  4CYM D;  2ZU6 B;  2XPI A;  2VSX E;  3J5P A;  2OOE A;  5EIL A;  5ANR A;  2DIW A;  1IQU A;  3EDT B;  5EX3 A;  2AXU A;  4YVQ C;  5AQ9 A;  1FCH A;  5EN5 D;  1PY1 A;  5FQ7 A;  4DLQ A;  3C3Q A;  2BKK B;  1A17 A;  3B13 A;  1AWC B;  4JHK A;  4BES A;  2NXP A;  5AN8 A;  3PRE A;  4CDN A;  3VLF A;  3HDX A;  3LVQ E;  2DCP A;  2F8X K;  3CSF A;  3UT4 A;  4GZD A;  3TG5 A;  2UY1 A;  4N39 A;  3UXG A;  5JJ6 A;  1DCE A;  3L22 A;  2YHC A;  2P9K G;  3DSV A;  2C0M A;  3FEX A;  2WXF A;  4GZ3 A;  3UMV A;  3UM2 A;  4APO A;  2PM6 A;  2R59 A;  4RSY A;  2QYJ A;  2XEV A;  1HH8 A;  2LUH A;  5BV0 A;  3TWT A;  1YA0 A;  2IY0 C;  3QAQ A;  5G04 C;  3HYM B;  2M63 A;  4U0Z A;  3DRA A;  3PS6 A;  4EZJ A;  5FIO A;  5ENP D;  3ZIM A;  5D0Q D;  2XZT G;  4GPK A;  3HG0 D;  2AJA A;  3QJZ A;  4K03 A;  4OYS A;  3ZEF A;  2P9N G;  4J7W A;  5FZS A;  2QC9 A;  2ILR A;  4J6I A;  4LSZ E;  3WG7 E;  2J4B A;  2H6H A;  4LNU D;  5AEN A;  3FUD A;  1MYO A;  4GYY A;  3CQC B;  5HRY A;  2I6H A;  4CT4 A;  4BFR A;  1OCR E;  3PEV B;  1SVX A;  1NA0 A;  4GCO A;  3OXF A;  4I6G A;  2Y3A A;  3ZYL A;  4IRU A;  3V2X A;  3UM0 A;  5D2M C;  3UM1 A;  4ACK A;  3SHF A;  4FHJ A;  4O1P A;  2WMO A;  1HG2 A;  4MS6 A;  4CT0 A;  1E96 B;  2EQX A;  3ONK A;  4N3B A;  4NIK A;  1N4R A;  3FUM A;  3ZNG A;  3URZ A;  4CRW A;  3CK8 A;  3QWW A;  4I2Z A;  4I1A A;  3RRN B;  1KZP A;  4U8Y D;  3CHM A;  4J8E A;  4BT9 A;  3FH7 A;  4GTR A;  2OVB A;  5HI7 A;  2IF4 A;  4KVM A;  5EX0 A;  3IKO B;  1WG0 A;  5HS0 A;  1KZO A;  1N0R A;  1EF1 C;  3G2W A;  1TEZ A;  4NUR A;  3ONL A;  4I6E A;  1S64 A;  3ABL E;  2WXQ A;  1HG5 A;  5EYL A;  2HM8 A;  4M3O A;  1U3D A;  3JCK C;  4JB8 P;  4KXK B;  4BTA A;  5G04 J;  2DYR E;  1IXV A;  2A5U A;  2PM7 A;  1Q2Z A;  3LJ3 A;  4GB9 A;  5CEA A;  4IUL A;  3AS8 A;  1ELW A;  1UN9 A;  2HE0 A;  3SBS A;  3C5R A;  3ZVV A;  2CHW A;  3PH0 C;  4HBD A;  1N9A A;  3DXK G;  3G2T A;  3UM3 A;  3DPY A;  2E2E A;  1XGW A;  3PVL A;  1K1B A;  4WUY A;  3D9J A;  3CKB A;  3SGH A;  4PS3 A;  4AV7 A;  3W9G A;  4FJY A;  1N4Q A;  3B7U X;  5ANL A;  4A3V A;  3ISM C;  1PAQ A;  3MCX A;  2J09 A;  3TGO A;  4ILH B;  4BX9 A;  3ZGQ A;  2AXZ A;  1MX6 A;  3EUV A;  3PUK A;  4N2Q A;  1VDY A;  3L6A A;  5CRU A;  3O48 A;  1INZ A;  4B89 A;  4WAF A;  4Y6W A;  3B7B A;  1OXJ A;  3TWQ A;  1E8Z A;  1H2T C;  2WXJ A;  1QQE A;  2CFZ A;  2WXI A;  2VGX B;  5AJL A;  4J0U A;  1H0A A;  4FA6 A;  4MKT A;  2AWI A;  3FUI A;  3FH8 A;  4DK5 A;  3ZXP A;  2RFA A;  4AXH A;  5FWQ A;  4AP2 A;  4G1T A;  1SZ9 A;  4KVO A;  1NFI E;  4AEZ C;  2KAT A;  2OEV A;  2RD0 A;  3GZ2 A;  4I1O B;  3FUF A;  3ZUV B;  3Q73 A;  3RO2 A;  4HRL A;  3LS8 A;  5JJ7 A;  3BG0 B;  2GRO B;  4EPZ A;  4EEC A;  3PZ2 A;  4QFV A;  1SZA A;  3ABK E;  2J49 A;  1FT2 A;  1OY3 D;  4I6J A;  3EU9 A;  4HB5 A;  4ME2 A;  5CBN A;  4PUC A;  3EHN A;  4GCN A;  1UN8 A;  2ZGD A;  3Q5M A;  3LJN A;  3QNK A;  3ML9 A;  1HFA A;  3NZU A;  3RO3 A;  3ZPJ A;  2PNN A;  3W9F A;  2KCV A;  4HOS A;  4ANX A;  3LYA A;  4GA1 A;  5IY5 E;  1LF8 A;  5LOZ A;  5FZQ A;  2ZIR A;  2LSU A;  1YCS B;  1N94 A;  4U0U A;  5ENR D;  2P58 C;  3FU0 A;  5EIB E;  3S7F A;  4J8Y A;  5AYW D;  4JHR A;  2XPZ A;  5C2Y A;  2XZD G;  1H6K A;  4RQI A;  5FTP A;  1MZC A;  4G23 A;  1MX2 A;  4E6H A;  5LCW J;  4JEU A;  2Y69 E;  1NZN A;  2OEW A;  3RK6 A;  3Q9U C;  4GAA A;  3ASO E;  2WXK A;  4LNG A;  4A3T A;  4OVV A;  1V54 E;  3CK9 A;  2H6F A;  3I5P A;  2ETB A;  1ELK A;  3DSW A;  3FFL A;  3DSX A;  3FU5 A;  2Q7F A;  2ETA A;  2WVI A;  2I9C A;  1ELR A;  1DC2 A;  1TJF A;  2H6I A;  2L0I A;  3ZKJ A;  5BT1 A;  4YDY A;  1UJJ A;  4LG6 A;  4EZL A;  1BI7 B;  5C1D A;  3IHY A;  1HE8 A;  3CHS A;  5AQA A;  2V4L A;  1E7V A;  3T5V A;  3V31 A;  3IXE A;  4URK A;  1U3C A;  2WXN A;  2HR2 A;  3SFX A;  4BEP A;  3ZW3 A;  3FEY A;  3L82 A;  2VQ2 A;  1BD8 A;  3O4Z A;  3U66 A;  4LER A;  4N3C A;  4TXQ A;  1TNZ A;  3KD7 A;  3PZ3 A;  5B1A E;  2KBX A;  4BX8 A;  1RZ4 A;  3FU3 A;  4AM9 A;  3PZD A;  3UT8 A;  4HLE A;  4JW1 A;  3C3R A;  4UWK A;  1MQS A;  3SO8 A;  1D8D A;  2CFU A;  4G2V A;  4EBA G;  3GZ1 A;  1BI8 B;  3L9T A;  1BLX B;  4N5C A;  2Y4T A;  2NC9 A;  2J4D A;  4A1S A;  2FEZ A;  3FDH A;  4U96 D;  1O5M A;  3P2B A;  3CVY A;  4HQD A;  3ESL A;  2XGS A;  2UWJ G;  4J8S A;  4ILG A;  4CGV A;  2H6G A;  4ANU A;  3B7T A;  1HF8 A;  1NA3 A;  4BSZ B;  5KNG A;  2DWZ A;  2VTB B;  2P9P G;  3AG1 E;  1N4S A;  1SA5 A;  3D9K A;  3SZ7 A;  2RKK A;  3Q7F A;  1HXI A;  4KYO B;  3TG4 A;  3U3W A;  2MYO A;  4L23 A;  4AY5 A;  4OAV B;  4XX5 A;  3FTU A;  4ANV A;  3E32 A;  1HS6 A;  1KLX A;  3NBN B;  3UI2 A;  2RFM A;  3D9H A;  3ZHE B;  4W9R A;  5AQ7 A;  3APF A;  5ENT D;  4KZ0 A;  1D9S A;  3SD5 A;  4U0S A;  4XI9 A;  3B95 A;  2L6B A;  2XGM A;  4F6R D;  4GTT A;  4JA9 A;  4A55 A;  3SBT B;  5FIN A;  2BF0 X;  2Y1L E;  3JUE A;  4C0E A;  1SA4 A;  4G11 A;  4RG6 A;  3LDZ A;  2PQR A;  5EDS A;  4GYW A;  3TWV A;  1WDY A;  5CED B;  4I2W A;  2XPY A;  4LCT A;  4EBA A;  2KXP C;  2X6F A;  2L9B A;  3QKY A;  1N11 A;  4KMO A;  1ZBP A;  3IV0 A;  3UTM A;  3TWR A;  1UOH A;  2I1K A;  2AVP A;  2F37 A;  1YYH A;  3LY9 A;  3L54 A;  4FLH A;  4LNB A;  2LXM A;  4CDM A;  4C48 B;  2QFC A;  2WXO A;  2CHZ A;  2XRY A;  2R02 A;  3FUL A;  3I4R B;  1OCZ E;  1OCC E;  3TXN A;  3JUI A;  3FTV A;  3TXM A;  1DNP A;  3NAW A;  2KZT A;  4FUL A;  5A6C A;  1JCQ A;  2BKG A;  3Q47 B;  4L7T A;  1JCR A;  1HX8 A;  4GYO A;  3R7Q A;  2XEE A;  2L0T B;  3LPZ A;  4ACL A;  4L2Y A;  4L1B A;  4U95 D;  1HU3 A;  2NSZ A;  3DEP A;  2V8S E;  5BXU A;  3OAW A;  3ZN3 A;  4A1G A;  4R7L A;  5LP0 A;  3MKQ B;  3TAX A;  3MEK A;  4ZFH A;  2YNQ A;  1H2V C;  1TNY A;  2GRN B;  5E75 A;  3QK0 A;  1TN7 A;  1A5E A;  2WPV A;  3JQ1 A;  2AXV A;  3J5Q B;  3UT7 A;  3SI5 A;  3NOG D;  4WNE A;  2WQ6 A;  3FU6 A;  3F6Q A;  1Z3X A;  5FQ4 A;  4HI9 A;  1OCO E;  4U7E B;  4YDE A;  3CVU A;  1U2V G;  1OWM A;  2I1J A;  3E30 A;  2EIJ E;  1ZU2 A;  4YDW A;  3BG1 B;  2YIN A;  3MV3 B;  5T4Y A;  3MA5 A;  4F1S A;  3PE4 A;  3PNT B;  3ENE A;  4HRM B;  3VLD A;  3HVE B;  4B8C B;  3ULE G;  2P9L G;  1OWN A;  4JEH A;  4GTQ A;  3MV2 B;  2GRR B;  4GZ6 A;  1N54 A;  5A23 A;  2ETC A;  4B8A A;  2F8Y A;  3SNX A;  4TXP A;  2J9Q A;  2HYZ A;  3BEE A;  4F7A A;  2EIN E;  3B7S A;  5AAR A;  3RSE G;  5JA4 D;  4GPM A;  1JUQ A;  2BUG A;  5ENQ D;  5FJY A;  3AS4 A;  2ZXW E;  5DBK A;  3MYV A;  3EHM A;  3U9W A;  4K5A B;  2WXR A;  2FF4 A;  4O6F A;  4K0R A;  3MKR A;  5KBA A;  3D9O A;  2X6K A;  3CHP A;  4KT6 B;  4AJW A;  4I43 A;  2XRZ A;  4GZ5 A;  5LCW C;  3D9P A;  1UG3 A;  5KJL A;  2LXL A;  5KJK A;  3DBS A;  3V2O A;  5CMY A;  5G2N A;  1X5B A;  1KT0 A;  2GRL A;  2QZA A;  4RLY A;  3CEQ A;  4AOF A;  2UY1 B;  1OUV A;  4XKC A;  5ENO D;  1B89 A;  4J8F A;  2I2O A;  2WXG A;  3JXI A;  2VGY A;  3CVV A;  3AG4 E;  2R5S A;  3GW4 A;  3TWX A;  3ZU7 B;  3QWV A;  2WQH A;  1NI1 A;  5HKP A;  5AAO A;  1Z6T A;  3QB2 A;  5H7P A;  4OVU A;  5DIZ A;  4L2L A;  2FI7 A;  4EHM A;  4YVO A;  4NQ0 A;  4HS2 A;  2V5F A;  3PNL B;  3UKR G;  3CVP A;  1V55 E;  2CHX A;  4GU5 A;  2RG8 A;  4PS7 A;  3PZ4 A;  1O1R A;  2A4Z A;  1UJK A;  3SFZ A;  3CGH A;  4E85 A;  3CHQ A;  4NRH B;  2ION A;  2WXH A;  1Y8M A;  4TUM A;  4DX1 A;  3L17 A;  3FTY A;  3S2A A;  3QOU A;  2DVW A;  4JVS A;  2B6C A;  2F0Y A;  3G2S A;  4HFG A;  2R03 A;  2OVF A;  1TR4 A;  2E0I A;  4N3A A;  3EHR A;  2P9I G;  5CHE E;  3JYS A;  1LD7 A;  1OWO A;  4JC8 A;  1H6P A;  1MX4 A;  2XCB A;  3CKC A;  3R7R A;  2VJ8 A;  1H2U A;  2GGF A;  2XCC A;  3GYZ A;  4DX2 A;  4A63 B;  4YND A;  1PC2 A;  3NQP A;  1O1S A;  4O1O A;  2FO1 E;  3R9A B;  3LY8 A;  2JAB A;  2KCK A;  3BQO A;  3MZL B;  5CCM A;  2PZI A;  2WM9 A;  4B0Z A;  4NAC A;  4HOR A;  2C0L A;  1S70 B;  2P2C P;  1BPO A;  3CVQ A;  4MBG A;  3RKV A;  4UI9 K;  3JXJ A;  3EIJ A;  2VSO E;  3PE3 A;  5EKQ D;  3KEZ A;  4UQZ A;  3I4G A;  3AU4 A;  3CHR A;  3DPD A;  2L6J A; 
#chains in the Genus database with same CATH homology
 5HI7 A;  4C0E A;  4TV3 A;  1IQR A;  4UQX A;  3OXL A;  3FWV A;  2IF4 A;  4KVM A;  4G11 A;  5EX0 A;  3RRU A;  5JJT A;  3IKO B;  4RG6 A;  4BSX A;  3LDZ A;  2PQR A;  5EDS A;  3FTS A;  4GYW A;  2WB2 A;  3ESK A;  3ZYK A;  4LUN U;  1EF1 C;  5BNW A;  1EDU A;  3FP3 A;  3G2W A;  3LY7 A;  4G24 A;  4I2W A;  1Y6I A;  4NUR A;  3ZHE A;  2XPY A;  3ONL A;  4I6E A;  4AY6 A;  4LCT A;  4EBA A;  2WXQ A;  4UWG A;  1HG5 A;  4D10 C;  4Y6C A;  2KZT B;  2X6F A;  2L9B A;  3QKY A;  5J08 A;  3NZS A;  2HM8 A;  2CG3 A;  4KMO A;  4M3O A;  1ZBP A;  1U3D A;  3IV0 A;  3JCK C;  4Q94 A;  5CMW A;  4KXK B;  3T5X A;  4BTA A;  4N2S A;  5G04 J;  2I1K A;  3MJW A;  5E76 A;  5T3R A;  2A5U A;  4U07 A;  4FHK A;  2PM7 A;  2AVP A;  5KJN A;  2MRI A;  3LJ3 A;  2V0P A;  3CQG B;  3HIZ A;  4GB9 A;  2OND A;  3LY9 A;  3L54 A;  3AS8 A;  1ELW A;  1UN9 A;  4IUL A;  4FLH A;  3SBS A;  4Q69 A;  4BWR A;  5LX8 A;  3ZVV A;  2CHW A;  3PH0 C;  4C0M A;  2X6I A;  4CDM A;  2QFC A;  2WXO A;  3G2T A;  4JPS A;  1Z3Y A;  4FLB A;  2CHZ A;  4PH4 B;  2KC7 A;  2E2E A;  2XRY A;  4ATG A;  1XGW A;  3FUL A;  3I4R B;  1JWG A;  3PVL A;  1OWP A;  4WUY A;  3D9J A;  3CKB A;  5J90 A;  2XHE A;  3TXN A;  2LSV A;  3JUI A;  4Q96 A;  3SGH A;  3FTV A;  1H19 A;  2HO1 A;  3EIQ C;  4APF A;  4PS3 A;  4AV7 A;  4I17 A;  3TXM A;  3CR3 A;  1DNP A;  3APD A;  2JLB A;  4FJY A;  4PS8 A;  3B7U X;  3CVW A;  3CLJ A;  2KZT A;  5ANL A;  4A3V A;  4FUL A;  2J08 A;  1PAQ A;  3MCX A;  2J09 A;  3TGO A;  3IHV A;  4ILH B;  5A6C A;  1E8W A;  1TJC A;  3AU5 A;  3QDN A;  4BX9 A;  3Q47 B;  1W3B A;  3E4B A;  3ZGQ A;  3ZYQ A;  4L7T A;  3MX3 A;  3OXG A;  4I9E A;  2AXZ A;  4H7Y A;  2VSN A;  1HX8 A;  3PUK A;  4N2Q A;  3TL5 A;  1VDY A;  3ZXS A;  4GYO A;  1OWL A;  3L6A A;  3R7Q A;  2L0T B;  3RRM B;  4GA2 A;  3O48 A;  3LPZ A;  2WQ7 A;  4ACL A;  4HOQ A;  1QNF A;  3CV0 A;  4L2Y A;  4L1B A;  4FJZ A;  4I1M A;  4FC8 A;  1HU3 A;  1INZ A;  4XI0 A;  4CGW A;  4B89 A;  3I3N A;  4WAF A;  4Y6W A;  4WWO A;  2NSZ A;  3ASF A;  4F53 A;  4J8D A;  3UQ3 A;  3PUJ A;  2V8S E;  3VLE A;  4WND A;  2VYI A;  1E8Z A;  1H2T C;  4GZC A;  4JHJ A;  2WXJ A;  3Q49 B;  1QQE A;  2LAH A;  2WMN A;  3UUX A;  3CVN A;  3CIA A;  3S7J A;  4GMJ A;  2CFZ A;  2WXI A;  2VGX B;  3OAW A;  5AJL A;  4FAD A;  4UQY A;  1EPU A;  4J0U A;  4TRQ A;  3K9I A;  2IOL A;  3ZN3 A;  4A1G A;  1H0A A;  4FA6 A;  4MKT A;  2AWI A;  3Q15 A;  4R7L A;  3L16 A;  4U04 A;  3MKQ B;  3FUI A;  5AJD A;  3C98 A;  3D9N A;  3FH8 A;  5LP0 A;  4DK5 A;  3TAX A;  3CVL A;  3MEK A;  3G2V A;  3FH5 A;  3JQ0 A;  2YNQ A;  1E8X A;  4AXH A;  3ASG A;  1H2V C;  4JZY A;  4XE0 A;  5FWQ A;  5LFA A;  2XQ0 A;  5E75 A;  4KZC A;  3QK0 A;  4ANW A;  4AP2 A;  2WPV A;  3JQ1 A;  2MOW A;  2AXV A;  4FU3 A;  1L5J A;  4G1T A;  5FT9 A;  2PQN A;  2Y4U A;  4TUU A;  5BV1 A;  1SZ9 A;  4IN3 B;  4KVO A;  1IYG A;  3T8M A;  3UT7 A;  1WAO 1;  4AEZ C;  2KAT A;  4U63 A;  3SI5 A;  4LRZ A;  5D0O D;  4G25 A;  4HOT A;  3B7R L;  2RD0 A;  2WXP A;  4WNE A;  3GZ2 A;  4I1O B;  2WQ6 A;  3FUF A;  3FU6 A;  3D9L A;  2GRM A;  3RO2 A;  3D3M A;  3FTZ A;  1Z3X A;  5FQ4 A;  2IJG X;  1NP7 A;  3LS8 A;  5JJ7 A;  3BG0 B;  3DPD A;  2FUL A;  4EPZ A;  1HO8 A;  4EEC A;  4QFV A;  1SZA A;  4XZ4 A;  3MGB A;  3UX4 A;  3CVU A;  4MRU A;  4ABN A;  1OWM A;  2I1J A;  4AVX A;  3ZYM A;  2J49 A;  2VGX A;  5AIJ A;  2MHK A;  4I6J A;  3Q4A B;  1ZU2 A;  3BG1 B;  4BY6 A;  4ME2 A;  4H7X A;  2YIN A;  3MV3 B;  5T4Y A;  4PUC A;  3MA5 A;  2PL2 A;  3MKQ A;  3EHN A;  4GCN A;  4F1S A;  1UN8 A;  2BTD A;  1E90 A;  3PE4 A;  5A7D B;  3PNT B;  3Q5M A;  3ENE A;  3QC1 A;  5BW8 C;  3VLD A;  3HVE B;  3ML9 A;  3QNK A;  3HHM A;  2X6J A;  3RJV A;  5JHA A;  4B8C B;  1HFA A;  4FP7 A;  1OWN A;  3NZU A;  3RO3 A;  2QY7 A;  3ZPJ A;  4DLO A;  4JEH A;  2FBN A;  4MLP A;  3LVR E;  2KCV A;  4HOS A;  1SQM A;  3MV2 B;  4ANX A;  4GZ6 A;  1N54 A;  2YQ8 A;  3LYA A;  3VTY A;  5A23 A;  3IEG A;  4GA1 A;  1EYH A;  5JHB A;  2LO6 A;  3GZS A;  4LEU A;  1LF8 A;  5LOZ A;  5FZQ A;  4KBQ A;  2DBA A;  3ASH A;  4EZK A;  4B8A A;  2OV8 A;  3QWP A;  2WXL A;  3SNX A;  2LSU A;  3CST A;  5ENN A;  2J9Q A;  3S7D A;  5BUZ A;  2HYZ A;  3BEE A;  4F7A A;  3B7S A;  4U0U A;  4EQF A;  2J07 A;  4BTB A;  1JUQ A;  4P29 A;  2P58 C;  3FU0 A;  3S7F A;  2BUG A;  1E8Y A;  4WWP A;  5AYW D;  4JHR A;  1N52 A;  2XPZ A;  3KS2 A;  5C2Y A;  1H6K A;  4V3I A;  5FJY A;  5FTP A;  2WXM A;  3AS4 A;  4G23 A;  2FO7 A;  5DBK A;  3HVE A;  1FVF A;  4C9B B;  4E6H A;  3MYV A;  3D9I A;  3EHM A;  3U9W A;  3LXU X;  5LCW J;  2WXR A;  4WNG A;  1TEZ A;  2CG2 A;  4JEU A;  2FF4 A;  3TJP A;  4O6F A;  4K0R A;  3MKR A;  3D9O A;  5G05 J;  1NZN A;  2X6K A;  3CHP A;  4KT6 B;  4RG9 A;  3RK6 A;  4AJW A;  5BPP A;  4I43 A;  3FUE A;  3QAR A;  2XRZ A;  2IU1 A;  4HOU A;  4GZ5 A;  5LCW C;  1JPL A;  4GAA A;  5ARF A;  2IOS A;  5T8I A;  2KM4 A;  3D9P A;  2WXK A;  3ASD A;  1UG3 A;  3L08 A;  5FZR A;  3ML8 A;  4HVB A;  5KJL A;  3FTW A;  4I9C A;  4A3T A;  5KJK A;  2IQC A;  3DBS A;  3PDN A;  4OVV A;  5G05 C;  1KT1 A;  3L13 A;  3LKU A;  3CK9 A;  4WNF A;  3I5P A;  4HXI A;  5CMY A;  5G2N A;  3ZRH A;  3IBE A;  3SF4 A;  1X5B A;  4JA7 A;  1KT0 A;  2LAI A;  5KJM A;  1ELK A;  2GRL A;  3S7B A;  3FFL A;  3RU0 A;  1UW4 B;  4IYP A;  4XIF A;  5HQ8 A;  1QZ2 A;  3CEQ A;  3FU5 A;  3FUH A;  2Q7F A;  2GW1 A;  2ZU6 B;  2XPI A;  3PEU B;  4AOF A;  2UY1 B;  1OUV A;  2VSX E;  4XKC A;  2WVI A;  2X6H A;  2I9C A;  3N71 A;  5G55 A;  1ELR A;  2VSY A;  1B89 A;  4J8F A;  1TJF A;  2I2O A;  3G2U A;  2L0I A;  2OOE A;  5KCM A;  2WXG A;  5BT1 A;  5ANR A;  2DIW A;  3FUN A;  1UJJ A;  2VGY A;  3CVV A;  1IQU A;  4F3V A;  2R5S A;  3GW4 A;  3EDT B;  5EX3 A;  1HZ4 A;  4EZL A;  3QWV A;  4RVB A;  1GW6 A;  5C1D A;  3IHY A;  2AXU A;  4GML A;  1HE8 A;  3CHS A;  4YVQ C;  2C2L A;  1FCH A;  2V4L A;  2WQH A;  1E7V A;  2R17 C;  3T5V A;  1PY1 A;  1Z6T A;  4UWL A;  3QB2 A;  5FQ7 A;  4DLQ A;  1S0P A;  1A17 A;  3B13 A;  4OVU A;  4JHK A;  5M72 A;  1MHQ A;  3UPV A;  5DIZ A;  4WWN A;  4L2L A;  4URK A;  4UI9 C;  2NXP A;  1U3C A;  2FI7 A;  2WXN A;  3PRE A;  2HR2 A;  1XNF A;  4CDN A;  3ZW3 A;  4YVO A;  3FEY A;  4NQ0 A;  3VLF A;  4HS2 A;  3EJN A;  3HDX A;  4DPR A;  2YHE A;  2VQ2 A;  2V5F A;  3FHE A;  3LVQ E;  2DCP A;  3O4Z A;  3PNL B;  3CVP A;  3CSF A;  3U66 A;  3UT4 A;  2CHX A;  4GU5 A;  4GZD A;  2RG8 A;  4PS7 A;  3TG5 A;  3WXX A;  2UY1 A;  5ARG A;  4N39 A;  2A4Z A;  5JJ6 A;  1FVH A;  4LER A;  4N3C A;  1UJK A;  4XKB A;  3L22 A;  3SFZ A;  4CCA A;  3KD7 A;  3CGH A;  2YHC A;  4BT8 A;  4CDR A;  4E85 A;  3CHQ A;  4CEM A;  4BX8 A;  4NRH B;  2ION A;  3FU3 A;  2WXH A;  4AM9 A;  1Y8M A;  3PZD A;  3RIB A;  3L17 A;  3FTY A;  3S2A A;  3QOU A;  4DI4 A;  2C0M A;  3FEX A;  5CCL A;  3UT8 A;  2WXF A;  4HLE A;  1WM5 A;  4GZ3 A;  4JW1 A;  3UMV A;  4UWK A;  1MQS A;  4APO A;  2PM6 A;  2R59 A;  1JWF A;  4RSY A;  1E7U A;  3LCA A;  4GA0 A;  2CFU A;  4G2V A;  4EBA G;  2XEV A;  3GZ1 A;  1HH8 A;  4JVS A;  5BV0 A;  4N5C A;  1YA0 A;  2Y4T A;  3U4T A;  4HFG A;  3G2S A;  2NC9 A;  3QAQ A;  2J4D A;  5G04 C;  4A1S A;  3FTX A;  4JXT A;  3NF1 A;  3HYM B;  2FEZ A;  3FDH A;  2M63 A;  3P2B A;  4U0Z A;  3PS6 A;  4UWF A;  2OVF A;  2X3M A;  4EZJ A;  3CVY A;  4N3A A;  2E0I A;  3ESL A;  3ZFW A;  3ZIM A;  5D0Q D;  5CHE E;  2XGS A;  2UWJ G;  4U8H A;  3JYS A;  2JEK A;  1OWO A;  4JC8 A;  4GPK A;  4J8S A;  2XCB A;  3CKC A;  3CHO A;  3R7R A;  4ILG A;  3QJZ A;  1IHG A;  4K03 A;  4OYS A;  4CGV A;  4ANU A;  3ZEF A;  3B7T A;  3U64 A;  1HF8 A;  1NA3 A;  5FZS A;  2XGO A;  3APC A;  4DI3 A;  2IFU A;  2ILR A;  2LNI A;  2VJ8 A;  4J6I A;  1H2U A;  3AS5 A;  1WY6 A;  2XCC A;  2GGF A;  2J4B A;  3D9M A;  3GYZ A;  2VTB B;  5FQ8 A;  3OTN A;  4G26 A;  5AEN A;  3FUD A;  4YND A;  1PC2 A;  4GYY A;  3CQC B;  3NQP A;  2I6H A;  4CT4 A;  4BFR A;  3D9K A;  3PEV B;  3SZ7 A;  3R9A B;  1NA0 A;  1HXI A;  4GCO A;  3OXF A;  3FUK A;  4KYO B;  3LY8 A;  3VTX A;  4I6G A;  4PDX A;  3TG4 A;  3U3W A;  2Y3A A;  2KCK A;  4IRU A;  3ZYL A;  3FY4 A;  4AIF A;  4L23 A;  3MZL B;  4ACK A;  3SHF A;  2KCL A;  4FHJ A;  4B94 A;  4AY5 A;  4XX5 A;  5CCM A;  2PZI A;  2WM9 A;  3FTU A;  4B0Z A;  4ANV A;  2WMO A;  1HG2 A;  4MS6 A;  1HS6 A;  1KLX A;  4CT0 A;  4NAC A;  1E96 B;  4HOR A;  2C0L A;  3ZHE B;  2EQX A;  1DVP A;  3ONK A;  4W9R A;  4N3B A;  1BPO A;  3CK7 A;  3APF A;  3CVQ A;  3KAE A;  4KZ0 A;  3FUM A;  4DJA A;  3CVX A;  4UWH A;  3SD5 A;  3URZ A;  4CRW A;  4U0S A;  3RKV A;  3CK8 A;  3QWW A;  4I2Z A;  3ULQ A;  4XI9 A;  4UI9 K;  4I1A A;  4ILI A;  2XGM A;  3LEW A;  2X38 A;  3RRN B;  3EIJ A;  4JA9 A;  4JL0 A;  4A55 A;  3SBT B;  5FQ6 A;  3CHM A;  4UI9 J;  1P5Q A;  2VSO E;  3FUJ A;  3PE3 A;  5EKQ D;  3KEZ A;  4UQZ A;  2VTB A;  3I4G A;  4J8E A;  4BT9 A;  3FH7 A;  3AU4 A;  2BF0 X;  2AW6 A;  3CHR A;  3PRZ A;  2OVB A;  3P1U A;  2L6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...