4NRHB

Copn-scc3 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
170
structure length
170
Chain Sequence
MSHLNYLLEKIAASSKEDFPFPDDLESYLEGYVPDKNIALDTYQKIFKISSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CopN
publication title A gatekeeper chaperone complex directs translocator secretion during type three secretion.
pubmed doi rcsb
source organism Chlamydia pneumoniae
molecule tags Chaperone/protein binding
total genus 60
structure length 170
sequence length 170
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4nrhB00
1NA0A 3TG4A 2YHCA 4HOUA 4J8FA 2KATA 2LNIA 5LCWJ 3JYSA 4BWRA 3S7DA 4AM9A 4O6FA 5JJ6A 4KXKB 4GZ5A 3KD7A 2J9QA 2I6HA 2OOEA 3QOUA 3QKYA 4JA7A 4H7YA 5HI7A 3RU0A 1NZNA 2QFCA 4XIFA 4IN3B 3ZHEB 2IF4A 4G24A 2KC7A 2V5FA 3ESKA 2C0LA 2XEVA 3RJVA 3ZN3A 2MHKA 4N5CA 1B89A 5DIZA 3BEEA 3Q4AB 3KS2A 5AYWD 3GW4A 4APOA 5BT1A 5A6CA 2NC9A 3S7FA 4WUYA 3E4BA 4XI9A 3KAEA 3SZ7A 2FI7A 3UPVA 2HR2A 3PE3A 4Y6CA 4Y6WA 1OUVA 1A17A 2VGXB 2XCBA 4WNGA 1HXIA 2UWJG 2JLBA 3Q47B 4GA2A 4GZ3A 1W3BA 4AY5A 4UQZA 3TAXA 4KYOB 3LY7A 3HYMB 2LSVA 2C0MA 3ZFWA 5M72A 3CKCA 3LCAA 5G05C 5FTPA 3MKRA 3NF1A 2XGSA 1Y8MA 3ASHA 3O48A 2HO1A 2VSNA 4LEUA 4U0SA 3K9IA 1P5QA 2FO7A 3CVNA 5CCLA 2PL2A 5D0OD 4UQXA 2L6JA 4I1AA 2XGMA 4GZ6A 1IHGA 3ULQA 3WXXA 4ME2A 3AS5A 3VTYA 3VTXA 5G05J 5FZSA 2VGXA 1FCHA 4N2SA 4N3CA 4YNDA 3RKVA 4J8DA 4AIFA 4JHRA 3QWWA 5DBKA 1WM5A 4XI0A 1E96B 1QQEA 4CGWA 4JA9A 4G23A 3CEQA 5KJNA 4I17A 5EKQD 4G26A 3TG5A 2Y4TA 4HOTA 3LKUA 4BT9A 2VGYA 4F3VA 5KJLA 3LYAA 4U0UA 4A1SA 3FP3A 4J0UA 4HORA 3UUXA 5KJMA 4H7XA 3MA5A 4ABNA 3TGOA 4GCNA 1TJCA 4I2ZA 2XCCA 4I2WA 2VYIA 2VSYA 5HQ8A 3RO2A 4GCOA 2WQHA 4GYWA 3GZ2A 3S7BA 3CK9A 3LY8A 4U04A 5JJ7A 4G25A 4U0ZA 3PDNA 4BTBA 3U4TA 1KLXA 4UQYA 3ZHEA 4I9EA 4N39A 2PZIA 3CK8A 4N3BA 4HOSA 2E2EA 4UI9K 2XPIA 3Q49B 2KCLA 2WPVA 3GZ1A 4NQ0A 3CK7A 3ASDA 2HYZA 2R5SA 5EX3A 3N71A 2YQ8A 2FF4A 3OXLA 2UY1B 4KBQA 4N3AA 3QWPA 2PQNA 4GA1A 2Q7FA 3ZGQA 5FZRA 4GPKA 4J8EA 1NA3A 2LSUA 5CCMA 3R9AB 5D0QD 4HOQA 5CHEE 2AVPA 5A7DB 4UI9C 3RO3A 3OXGA 2FBNA 3FFLA 2XGOA 3IEGA 4EQFA 3ASGA 4CDRA 3AS8A 5FJYA 1YA0A 5ARGA 3PE4A 4B94A 1HZ4A 4CGVA 5G04C 3CV0A 3QWVA 5EX0A 3AS4A 1KT0A 3UQ3A 5FZQA 3MV2B 4BT8A 4G1TA 1ZBPA 5JJTA 4UI9J 3OXFA 1XNFA 2Y4UA 2IFUA 3LY9A 2BUGA 3U3WA 5ARFA 4WNDA 3ZPJA 1ZU2A 1WAO1 1ELWA 1HH8A 2UY1A 5KJKA 5G04J 4WNFA 2GW1A 4RG6A 3EDTB 4YVQC 2ONDA 4JL0A 4RG9A 4U07A 3ASFA 1KT1A 5BW8C 4GA0A 3LPZA 3CVPA 5FT9A 5C1DA 3MV3B 2FEZA 4NRHB 4N2QA 2DBAA 3FWVA 2VQ2A 3QDNA 5BNWA 3CVLA 3RIBA 4G2VA 4WNEA 3URZA 2KCKA 3CVQA 4YVOA 2P58C 4GYOA 2PQRA 2KCVA 4BTAA 3Q5MA 4I9CA 5LCWC 1PC2A 4AY6A 2C2LA 3S7JA 1ELRA 3GYZA 1QZ2A 3Q15A 3SF4A 3CKBA 1IYGA 4GYYA 4W9RA 3MEKA
chains in the Genus database with same CATH superfamily
1TNOA 1N52A 5E76A 3DSWA 1FVHA 4AOFA 4DLOA 2X6KA 2KATA 2ZGGA 3MZLB 3NZSA 2Y0BG 2A5EA 4BWRA 3CHPA 2R02A 3S7DA 4O6FA 5JJ6A 3CSTA 1OT8A 4AXHA 2I6HA 2ILRA 3QOUA 4JA7A 4IN3B 3MKQB 2IF4A 2V5FA 3ISMC 3ZYLA 1JUQA 3F6QA 1N54A 1EYHA 2XEVA 2IU1A 3ZN3A 2KBXA 5BXOA 4F53A 4N5CA 4HFGA 3PZDA 5DIZA 3Q4AB 2GGFA 1IHBA 1HFAA 1SA4A 3D9HA 5CERB 5BT1A 3APDA 5A6CA 3CQGB 2NC9A 3S7FA 2R03A 2BKGA 1UW4B 4XI9A 3KAEA 3SZ7A 3UPVA 2HR2A 4U95D 4F6RD 3T8MA 1E7UA 2ETBA 3LJNA 5EILA 2LUHA 1N0RA 5CEAA 4GA2A 1IQRA 1N95A 1LTXA 1W3BA 3RRUA 3P2BA 3TAXA 3NOGD 4KYOB 3LY7A 3HXCA 2H6GA 4TV3A 4EPZA 1OWPA 1OCZE 2C0MA 3PUJA 5ANLA 3ZFWA 3LCAA 5G05C 5FTPA 3D9LA 4RLYA 3CHOA 1E8XA 3SGHA 4JHKA 5FQ8A 4KT6B 1S0PA 2VSNA 2KXPC 3FTZA 3I3NA 2DYRE 3LDZA 5D0OD 4K5CA 4AJWA 2R17C 2XGMA 4E85A 2GRRB 1SZ9A 4WAFA 3ULQA 4HS2A 3AS5A 3SQVA 3VTYA 3EU5A 2PNNA 4KZCA 4UWKA 4YDEA 3EHRA 3RKVA 4BFRA 3G2UA 1H2VC 3ZEFA 4A3VA 5DBKA 3PS6A 2X6FA 4J8SA 5KBAA 4B0ZA 4JW1A 4XI0A 4EBAG 2DWZA 4O1OA 2HM8A 2P9SG 3FTXA 3CEQA 2P9UG 3UMVA 1E7VA 1FT1A 3B7TA 3Q79A 2P9KG 3FULA 5EKQD 2F37A 5EYPF 5CRUA 4DRXE 5FQ4A 3E37A 4ILHB 2VGYA 3UM3A 3ENEA 2WXOA 4U0UA 4A1SA 3FP3A 5ENOD 3EJNA 5BV0A 3DXMG 4FHKA 3TGOA 3CHSA 1QYMA 2EIME 4U7EB 4MS6A 3EHNA 4WWNA 4GMJA 3U66A 2WQHA 5B1BE 5JJ7A 3ONLA 3PDNA 3U4TA 1UJKA 3IBEA 3LEWA 3RK6A 3NQPA 4GB9A 4UQYA 1H6KA 4I9EA 4P29A 4N39A 5D2MC 3MYVA 2XHEA 4UI9K 3PZ3A 3C98A 3D9PA 3J5PA 4J8YA 3CK7A 4LERA 3I4GA 2R5SA 1PAQA 3C3RA 1MYOA 2P2CP 2FF4A 3OXLA 3CLJA 2DIWA 4GA1A 2Q7FA 3ZGQA 5FZRA 3Q9UC 1TJFA 3NZUA 1TNYA 2B6CA 3ZYMA 1AP7A 1S63A 4ZHBA 2E0IA 4N5QA 3APCA 3JUEA 3FY4A 3RO3A 5AIJA 1MX2A 3OXGA 2XGOA 4XKCA 4CDRA 3AS8A 2ETAA 3PE4A 4DX2A 2AWIA 4FC8A 1KZOA 3NBNB 4KVOA 3L17A 3UINC 3DSSA 2OEVA 2YNQA 2IONA 2RFAA 3SBSA 1HG2A 3UQ3A 3V2XA 1Z3XA 2AJAA 3TWWA 3HXFA 4ZFHA 4TUUA 4I1MA 3OXFA 4LG6A 4EHMA 2L0IA 5AAOA 2IFUA 3BUAA 3B13A 2XRYA 3U64A 2UY1A 5JMND 4C0MA 3FH8A 2DZOA 2J07A 2ONDA 4RG9A 4D10C 1N4PA 2GRQB 4A63B 4DLQA 3ULYA 2F8XK 1KT1A 4GA0A 2R2LA 3LPZA 5CBNA 4ANVA 4JHJA 1E8WA 5AJDA 3MV3B 3BU8A 3MJWA 4MLPA 4NRHB 3ZUVB 3FWVA 3ONKA 4L23A 3PRZA 4UUCA 3CVLA 4B8AA 1V55E 1LD7A 2X6IA 4MRUA 3URZA 2KCKA 4YVOA 2NSZA 4GYOA 4KZ0A 1TR4A 2V0PA 1K1BA 3ULEG 5G55A 1MJ0A 3UT7A 5AQ9A 1QZ2A 3T5VA 3FEXA 2PM6A 4GYYA 3V2OA 2OV8A 1SW6A 3CVUA 1EF1C 3HXBA 3MX3A 2WVIA 1HO8A 2YHCA 2WB2A 3FUJA 4HOUA 4J8FA 4LUNU 4HQDA 2LO6A 5LCWJ 3OAWA 4CT0A 4L2YA 2OVFA 2A5UA 4G8KA 1TEZA 3ABKE 2IQCA 1H6OA 3G2WA 3L54A 3KD7A 3VLFA 4DJAA 3DWLG 3ZHEB 2L9BA 4TRQA 4LCTA 1Z3YA 3ESKA 4GTMA 1N9AA 3B7BA 2X6JA 3RJVA 3BEEA 4K5AB 3GW4A 2XZTG 3LXUX 3E33A 2WXHA 3SD5A 4ATGA 4NURA 4OAVB 4WUYA 3E4BA 2J4BA 4YDOA 3ABLE 5C2YA 2IEJA 3Q73A 1A17A 3R7RA 1DNPA 4NACA 4QQIA 4FP7A 1HG5A 4F1SA 1HXIA 4DX1A 2JLBA 3Q47B 4FJZA 1QBQA 3QC1A 4UQZA 1UG3A 2XPZA 3HG0D 1SA5A 1OWLA 5AN8A 4YDWA 3MKRA 3HVEA 4DI3A 3NF1A 3SI5A 1WDYA 2XGSA 1Y8MA 3FUDA 2HO1A 2WXRA 3L22A 1BLXB 4LEUA 3CHQA 2MYOA 1OCOE 4CCAA 5KNGA 4E6HA 4J7WA 4PH4B 3LS8A 4GZDA 2L6JA 4I1AA 4Q96A 2F0YA 2XZDG 1UOHA 1TN8A 5EYLA 1UJJA 3VTXA 3DXKG 5G05J 1O1SA 5FZSA 3AG2E 2EQXA 1FCHA 3FTUA 2WXNA 3TWRA 4YNDA 2ZIRA 1WY6A 2P9IG 2JABA 3UIPC 3MGBA 4K03A 4J8DA 4AIFA 1LF8A 4DUIA 1AWCB 3MCXA 3W9FA 4NIKA 1QQEA 5EIDA 1MQSA 4M7CA 2L6BA 1NFIE 3FUNA 2OVBA 1NI1A 4HBDA 4FA6A 3D9NA 4I17A 1Z6TA 1SVXA 5CBOA 2WXPA 4CYMD 3IV0A 2WMNA 4I6GA 1G3NB 1H2UA 2J49A 3SFZA 4BT9A 2WM9A 3LVQE 1OCCE 5KJLA 3LYAA 3EUVA 1E8ZA 4HORA 5KJMA 4XEIG 1PY1A 3RRMB 4H7XA 4GCNA 2XCCA 5T3RA 4I2WA 2VYIA 5HQ8A 2DCPA 5HS0A 1HS6A 4RVBA 4BY6A 3AG4E 4X8QA 1FT2A 4GYWA 3JCKC 3S7BA 2IO3C 3TWQA 1NP7A 3E32A 1JCRA 3Q9NC 2VGEA 2NYJA 3FUKA 4K0RA 4A55A 2CG3A 2OEWA 3CGHA 4BX9A 5LOZA 2I1KA 3Q49B 5ENTD 2KCLA 2WPVA 3CVXA 3ZRHA 4NQ0A 4DK5A 3Q7AA 3ASDA 4J6IA 1N94A 5EX3A 4C48B 3HIZA 4JEUA 4EBAA 4QFVA 2J08A 3W9GA 5FQ6A 3DPYA 2VTBA 5CCMA 5ANRA 4F7AA 3EHQA 3QARA 3C3QA 2WXKA 5A7DB 3RAUA 2FBNA 3IEGA 3ASGA 1NL4A 3ZIMA 4AP2A 4R7LA 2I2OA 2XEEA 2YHEA 4AV7A 1OWMA 4BEPA 2H6HA 2XPYA 2EILE 3I5PA 3ASNE 3EHMA 5FZQA 3ZXSA 3PNTB 1RW2A 2WXGA 2I1JA 3FHEA 4HRMB 1Z5SC 1JWGA 3FU5A 3FTYA 4UWFA 5AENA 4OVUA 1TN7A 5CECB 2BUGA 2BEDA 4WNDA 4OAUC 3FH5A 4ANXA 1ELWA 3JUIA 1HH8A 4IRUA 4K5BA 4I43A 3JQ0A 4GTPA 3IKOB 1BI8B 3RSEG 4YVQC 1YYHA 2LAIA 2XS8A 5EDSA 3AG1E 5BW8C 3S2AA 3ESLA 2KZTA 2OCCE 1U3CA 4BERA 5CMWA 2FEZA 4FJYA 4Q69A 1TNUA 3TWXA 4CZ2D 2IO2C 3C5RA 4EECA 1OWNA 4ILIA 1SZAA 2NXPA 3RIBA 2P58C 4BETA 2EINE 4ANUA 3DPDA 1Y6IA 4GTRA 3DSXA 4BTAA 3V31A 4FHJA 3ZKJA 5B3SE 3V30A 3X2QE 4RQIA 4DPRA 1ELRA 3FUFA 3GYZA 4PS7A 3ZYKA 3Q75A 4V3IA 3D9MA 3AAAC 4DX7D 5ENQD 2WXLA 3MEKA 3PEVB 1NA0A 3DEOA 3ASOE 3TG4A 2ZGDA 3LVRE 4MKTA 4B93B 1UN8A 2RFMA 4LRZA 5G2NA 2AXUA 5HKPA 2R05A 3IHYA 4AM9A 1U2VG 4DX5D 1N4SA 3PZ1A 4O1PA 2QYJA 1IXVA 4L1BA 3QKYA 1NZNA 2QFCA 5JHBA 3E34A 2XRZA 2ZXWE 4G24A 2KC7A 3IXEA 4HVBA 1E8YA 2C0LA 4GTQA 4I6EA 4ILGA 3PEUB 4ANWA 3B7RL 1JCSA 3QK0A 4APOA 1HE8A 1BI7B 4HI9A 5AQ7A 3DSTA 2WXQA 3AJIA 3B7UX 4IYPA 2GRNB 5ENRD 5FIOA 3UT8A 1BPOA 4Y6WA 5ITZF 1OUVA 4TXQA 1MX6A 2VGXB 3ZNGA 4WNGA 4A1GA 2FO1E 4XKBA 2IOSA 3HRAA 4GZ3A 3G2TA 4I6JA 5FWQA 2MOWA 4AY5A 3TWSA 1D8EA 4GMLA 2AXVA 1KZPA 3UKRG 1TNZA 3HYMB 2LSVA 4TXRA 2XEHA 5BXUA 5M72A 3CKCA 4LNUD 2WQ7A 3TXMA 1K1AA 3O48A 3D9KA 4U0SA 3K9IA 1A5EA 1IKND 2FO7A 4MBGA 3CVNA 3C72A 3NB2A 2PL2A 5CCLA 4JVSA 4ACKA 2DVWA 2B0OE 3I4RB 5T8IA 4GZ6A 1IHGA 3WXXA 4ME2A 4CT4A 4JZYA 2VSXE 1N4QA 3B95A 2CFUA 1E90A 3PNLB 4GU5A 4N2SA 4N3CA 4RSYA 1BD8A 1YCSB 3NAWA 3E30A 4LNGA 4GAAA 2GROB 3PH0C 2PM7A 3QWWA 1WM5A 2AXZA 3UM2A 1E96B 3FTWA 4CGWA 4XE0A 4G23A 1D9SA 2LXMA 5KJNA 3QB2A 1HX8A 3VLDA 4DX6D 4G26A 3L6AA 2Y4TA 4HOTA 4AEZC 2CFZA 2YINA 3CHMA 3O4ZA 4LSZE 4FADA 5A23A 5AQBA 1QNFA 4FLHA 2BKKB 1JWFA 4IULA 4PS8A 3G2SA 3QNKA 3FUHA 2AW6A 4ABNA 4I2ZA 3RO2A 4GPMA 4XX5A 3GZ2A 1UN9A 4G25A 4U0ZA 3L82A 4BTBA 2H6FA 1KLXA 2ETCA 3MKQA 1DC2A 3CIAA 5LFAA 1LD8A 4XZ4A 4N3BA 5ENSD 3ML9A 2E2EA 5JHAA 1OWOA 4U63A 5KWDA 5FINA 4CEMA 2YQ8A 2GRLA 4BESA 4KBQA 4N3AA 3QWPA 5CMYA 5BPPA 2CHWA 3PZ4A 4Q94A 1H6PA 3WG7E 4GPKA 1IQUA 1OXJA 2M63A 3KSLA 4J8EA 3T8KA 2LSUA 4KVMA 2XS1A 4CDNA 5D0QD 5CHEE 2AVPA 4UI9C 3J5QB 2QY7A 3FFLA 3EIJA 1WG0A 3AU5A 2LAHA 3CR3A 1HZ4A 5T4YA 4A3TA 4DI4A 1H19A 4PDXA 5G04C 2XQ0A 3CVWA 1N0QA 1Q2ZA 4FU3A 3CHRA 3QWVA 2A4ZA 3AS4A 3DEPA 5IY5E 4Z68A 1MHQA 3MV2B 4BT8A 3T9KA 3HVEB 4G1TA 2MRIA 4JPSA 4PS3A 1ZBPA 3TJPA 1XNFA 3PUKA 5ENNA 3LY9A 5ARFA 3ZPJA 3ABME 1ZU2A 4WWPA 4JB8P 3R9MA 2WXFA 2GW1A 3G2VA 3CQCB 4I1OB 4RG6A 3EDTB 4U07A 4URKA 3ASFA 3ZVVA 5B1AE 3CVPA 4C0EA 2DZNA 2XENA 1INZA 3QAQA 4GZCA 3BQOA 1S64A 3QJZA 1D8DA 4BSXA 2QC9A 3RRNB 1FPPA 4KMOA 3D9JA 5AJLA 2RD0A 3B7SA 4G2VA 4F1PA 1X5BA 2PQRA 1KPSB 5J90A 2KCVA 3DRAA 4LNBA 1OY3D 3BG1B 2GRMA 1PC2A 3SY2A 2I9CA 3EIQC 3L08A 5LX8A 3AG3E 3S7JA 3SF4A 3PREA 3UM0A 3CKBA 5AARA 1IYGA 2Y1LE 2L0TB 2HE0A 4W9RA 3ZYQA 4JEHA 3ZW3A 2H6IA 4PUCA 1K3ZD 3APFA 1JCQA 2BF0X 3KSQA 2LNIA 3JYSA 4BX8A 3SFYA 1ZB1A 3SNXA 4KXKB 4GZ5A 3JQ1A 2J9QA 2OOEA 3ZXPA 3FUMA 5HI7A 4H7YA 3RU0A 4TUMA 4XIFA 3TWUA 2F8YA 3JXJA 3HDXA 5LP0A 4FLBA 1GW6A 3UKUG 4HXIA 1X81A 3CSFA 3LJ3A 4GTVA 4EZJA 4GTTA 4HRNA 2MHKA 1BU9A 1B89A 2GRPB 4GTOA 5KNHD 3KS2A 5AYWD 4B8CB 2RG8A 1S70B 3UIOC 4ACLA 2JEKA 4CDMA 2FI7A 1EDUA 1H2TC 3DBSA 2WXIA 3PE3A 4Y6CA 3TXNA 3KEZA 2VTBB 2XCBA 1HF8A 3PVLA 3ZU7B 2UWJG 2QZAA 2FULA 3TWTA 1L5JA 3ML8A 1XGWA 4U8YD 4HLLA 4GTSA 3BG0B 4GMRA 3FEYA 2WMOA 3AU4A 2WXMA 3ASHA 1MX4A 1U3DA 3L16A 3NOCD 4JXTA 3FDHA 5BV1A 1P5QA 2IJGX 3DSUA 3D9OA 3IHVA 5H7PA 4UQXA 1SQMA 1O5MA 3FU3A 3FUIA 4HNAD 1EPUA 4G11A 3D9IA 4M3OA 5KCMA 3UXGA 3T5XA 2ZU6B 3UM1A 3FUEA 2VGXA 4HI8A 5AQAA 1JPLA 5EN5D 4WWOA 3Q7FA 2IY0C 2IOLA 2KZTB 4G8LA 4JC8A 4JHRA 5CRVA 4FULA 2KM4A 4EZKA 3HXDA 2CG2A 3SFXA 4CRWA 3P1UA 4U96D 4JA9A 4L2LA 3UX4A 3FU0A 1O1TA 1RZ4A 4UWHA 2R59A 1V54E 3SHFA 2QYUA 3TG5A 3LKUA 4UWGA 3R7QA 2V8SE 4F3VA 4J0UA 3UUXA 5ENPD 2P9PG 3MA5A 4C9BB 1TJCA 3D3MA 2Y3AA 2VSYA 4GCOA 2J8SD 5D66A 5CEDB 5JA4D 3U9WA 3CK9A 3HXEA 3LY8A 4U04A 5HRYA 1FVFA 3KEAA 3V79K 1OCRE 2VSOE 3ZHEA 2PZIA 2EIJE 3PZ2A 3EU9A 3CK8A 4B89A 4HOSA 1K8KG 2XPIA 1DCQA 3GZ1A 1N4RA 2V4HC 2X6HA 3TL5A 4YDYA 2HYZA 3FTVA 3N71A 4L9PA 5FQ7A 3VLEA 2LXLA 2UY1B 5BUZA 4ATZD 2V4LA 2PQNA 2Y69E 1HU3A 1TN6A 1N11A 1NA3A 3CVVA 3FU6A 4U8VD 3GZSA 3R9AB 4HOQA 1O1RA 4EQFA 5FJYA 1YMPA 1YA0A 5ARGA 4B94A 3UTMA 4CGVA 1ELKA 3CV0A 3FTSA 3HHMA 4JD2G 1DCEA 3SBTB 5EX0A 1KT0A 2X3MA 4UWLA 3UT4A 2X38A 5JJTA 4UI9J 2J09A 2Y4UA 1H0AA 4U8HA 1MZCA 2RKKA 4BSZB 3U3WA 2CHZA 3UI2A 3L9TA 2DYSE 5J08A 1WAO1 4AVXA 5KJKA 3CVYA 5G04J 2VJ8A 4WNFA 3SO8A 4HB5A 4JL0A 3JXIA 2P9LG 3DSVA 5FT9A 5C1DA 3OTNA 4N2QA 2DBAA 5E75A 2VQ2A 2V5QC 3QDNA 2P9NG 5BNWA 4OYSA 2CHXA 3TWVA 4HRLA 4WNEA 3CVQA 4O60A 1TNBA 1TYQG 2BTDA 3FH7A 3Q5MA 2ZISA 2WQ6A 4I9CA 5LCWC 1VDYA 4HLEA 3L13A 4AY6A 2C2LA 2WXJA 4APFA 4EZLA 1DVPA 3Q15A 3C3OA 4L7TA 4TXPA 2EIKE 2J4DA 4OVVA 3Q78A 5EIBE
chains in the Genus database with same CATH topology
4JEHA 3CVUA 3PEVB 1EF1C 1NA0A 3ZW3A 1N52A 5E76A 3MX3A 3TG4A 2WVIA 4PUCA 1HO8A 1FVHA 2YHCA 4AOFA 3FUJA 2WB2A 3APFA 3LVRE 4MKTA 1UN8A 2BF0X 4HOUA 4J8FA 4DLOA 2X6KA 2KATA 3MZLB 4LRZA 4LUNU 2LO6A 3NZSA 2LNIA 5LCWJ 5G2NA 3OAWA 4CT0A 2AXUA 3JYSA 4L2YA 2OVFA 4BX8A 4BWRA 2A5UA 3CHPA 3IHYA 3S7DA 4AM9A 4O6FA 5JJ6A 1TEZA 3CSTA 3SNXA 2IQCA 3G2WA 3L54A 4KXKB 4GZ5A 3JQ1A 3KD7A 2J9QA 4AXHA 2I6HA 2OOEA 2ILRA 4L1BA 3FUMA 3QOUA 3QKYA 4JA7A 4H7YA 5HI7A 3RU0A 1NZNA 2QFCA 4XIFA 3VLFA 4DJAA 4IN3B 3HDXA 5JHBA 3ZHEB 2L9BA 2XRZA 5LP0A 3MKQB 4TRQA 2IF4A 4G24A 4FLBA 1GW6A 2KC7A 2V5FA 4HXIA 4HVBA 1E8YA 4LCTA 1JUQA 3ZYLA 1Z3YA 3CSFA 3ESKA 2C0LA 3LJ3A 1N54A 1EYHA 4EZJA 2X6JA 2XEVA 2IU1A 3RJVA 3ZN3A 4I6EA 2MHKA 4ILGA 4N5CA 4HFGA 4F53A 1B89A 3PEUB 3PZDA 4ANWA 3B7RL 5DIZA 3BEEA 3Q4AB 2GGFA 3KS2A 5AYWD 4B8CB 3GW4A 3LXUX 1HFAA 3QK0A 2RG8A 2WXHA 3SD5A 1HE8A 4APOA 5BT1A 3APDA 5A6CA 4ATGA 3CQGB 2NC9A 4NURA 3S7FA 4WUYA 4ACLA 2JEKA 2WXQA 3E4BA 1UW4B 3B7UX 4CDMA 4XI9A 3KAEA 2J4BA 3SZ7A 4IYPA 2FI7A 1EDUA 3UPVA 3UT8A 1H2TC 5C2YA 3DBSA 2WXIA 2HR2A 3PE3A 4Y6CA 1BPOA 3TXNA 4Y6WA 1OUVA 3KEZA 1A17A 2VTBB 2VGXB 3R7RA 1E7UA 1DNPA 2XCBA 1HF8A 3PVLA 4NACA 4FP7A 3T8MA 4WNGA 4A1GA 1HG5A 4F1SA 1HXIA 2UWJG 4XKBA 2JLBA 3Q47B 2IOSA 4GA2A 4GZ3A 3G2TA 4I6JA 5FWQA 2FULA 1IQRA 2MOWA 4FJZA 1W3BA 3RRUA 3QC1A 4AY5A 4UQZA 3P2BA 3TAXA 1L5JA 3ML8A 4GMLA 2AXVA 1XGWA 1UG3A 2XPZA 4KYOB 3LY7A 4TV3A 4EPZA 3HYMB 1OWPA 2LSVA 3PUJA 2C0MA 5ANLA 3ZFWA 5M72A 3CKCA 3LCAA 1OWLA 5G05C 2WQ7A 5FTPA 3D9LA 3BG0B 3MKRA 3TXMA 3HVEA 3CHOA 4DI3A 3FEYA 3NF1A 3SI5A 1E8XA 2WMOA 3AU4A 2WXMA 2XGSA 1Y8MA 3ASHA 3SGHA 3O48A 3FUDA 4JHKA 1U3DA 4KT6B 5FQ8A 2HO1A 3L16A 1S0PA 2VSNA 2WXRA 3L22A 4JXTA 4LEUA 3CHQA 3D9KA 3FDHA 4CCAA 4E6HA 4U0SA 3K9IA 5BV1A 1P5QA 3FTZA 3I3NA 2FO7A 2IJGX 3CVNA 3D9OA 3IHVA 4PH4B 5CCLA 2PL2A 3LDZA 5D0OD 4JVSA 4ACKA 3LS8A 4UQXA 1SQMA 4AJWA 3I4RB 4GZDA 2L6JA 2R17C 4I1AA 2XGMA 3FU3A 4Q96A 4E85A 5T8IA 4GZ6A 1SZ9A 3FUIA 1EPUA 4G11A 4WAFA 1IHGA 3D9IA 3ULQA 4HS2A 3WXXA 4ME2A 4M3OA 5KCMA 3AS5A 3VTYA 1UJJA 3T5XA 3VTXA 5G05J 4CT4A 2ZU6B 5FZSA 3FUEA 2VGXA 4JZYA 2VSXE 2CFUA 2EQXA 1JPLA 1FCHA 1E90A 3PNLB 4GU5A 4WWOA 4N2SA 4KZCA 2IOLA 2WXNA 3FTUA 4N3CA 4UWKA 2KZTB 4YNDA 1WY6A 4RSYA 3RKVA 4BFRA 4JC8A 3MGBA 4K03A 4GAAA 4J8DA 4AIFA 3G2UA 4JHRA 1LF8A 1H2VC 3PH0C 4FULA 2PM7A 3QWWA 2KM4A 3ZEFA 4A3VA 5DBKA 3PS6A 1WM5A 4EZKA 2X6FA 4J8SA 2AXZA 2CG2A 4B0ZA 4JW1A 4XI0A 4EBAG 1E96B 4CRWA 3P1UA 3MCXA 1QQEA 3FTWA 4CGWA 1MQSA 2HM8A 4JA9A 4XE0A 4G23A 3FTXA 4L2LA 3CEQA 3UMVA 3UX4A 3FU0A 3FUNA 2OVBA 1E7VA 4UWHA 4FA6A 5KJNA 3QB2A 3B7TA 2R59A 3D9NA 1HX8A 4I17A 1Z6TA 3FULA 5EKQD 3SHFA 2WXPA 3VLDA 3IV0A 4G26A 3L6AA 3TG5A 2WMNA 4I6GA 2Y4TA 4HOTA 4AEZC 1H2UA 2CFZA 3LKUA 4UWGA 5FQ4A 2YINA 3CHMA 3O4ZA 4ILHB 4FADA 2J49A 3R7QA 3SFZA 4BT9A 2VGYA 2WM9A 5A23A 2V8SE 3LVQE 4F3VA 3ENEA 5KJLA 1QNFA 4FLHA 2WXOA 3LYAA 4U0UA 1JWFA 4A1SA 3FP3A 4J0UA 1E8ZA 4IULA 3EJNA 4PS8A 3UUXA 5BV0A 5KJMA 4HORA 4FHKA 1PY1A 3G2SA 3RRMB 3QNKA 3FUHA 2AW6A 4H7XA 3MA5A 4ABNA 3CHSA 4GCNA 4C9BB 3TGOA 1TJCA 3D3MA 2XCCA 4I2ZA 4MS6A 5T3RA 2Y3AA 4I2WA 2VYIA 2VSYA 3EHNA 2DCPA 5HQ8A 1HS6A 4RVBA 4WWNA 4BY6A 4GMJA 3RO2A 4GCOA 3U66A 2WQHA 4GYWA 4XX5A 3GZ2A 3JCKC 3S7BA 3CK9A 3LY8A 4U04A 3U9WA 5JJ7A 1FVFA 1UN9A 4G25A 1NP7A 4U0ZA 3ONLA 3PDNA 4BTBA 3U4TA 1UJKA 3IBEA 3LEWA 3RK6A 1KLXA 2VSOE 3NQPA 4GB9A 4UQYA 3ZHEA 1H6KA 4I9EA 3MKQA 4P29A 3CIAA 4N39A 3FUKA 5LFAA 2PZIA 4K0RA 3MYVA 4A55A 4XZ4A 3CK8A 4B89A 4N3BA 2CG3A 3ML9A 3CGHA 2XHEA 4HOSA 4BX9A 2E2EA 4UI9K 5JHAA 5LOZA 2I1KA 2XPIA 3Q49B 2KCLA 1OWOA 2WPVA 3C98A 3D9PA 4U63A 3GZ1A 3CVXA 3ZRHA 2X6HA 3TL5A 4NQ0A 4DK5A 3CK7A 4LERA 3ASDA 3I4GA 2HYZA 4J6IA 2R5SA 5EX3A 3FTVA 3N71A 4CEMA 1PAQA 2YQ8A 5FQ7A 3VLEA 2GRLA 3HIZA 2FF4A 4JEUA 3OXLA 2UY1B 4EBAA 5BUZA 4KBQA 4QFVA 3CLJA 2V4LA 2J08A 2DIWA 2CHWA 3QWPA 2PQNA 4GA1A 4N3AA 4Q94A 5CMYA 5BPPA 2Q7FA 3ZGQA 5FZRA 5FQ6A 1HU3A 1TJFA 1IQUA 4GPKA 3NZUA 2M63A 4J8EA 1NA3A 3ZYMA 2VTBA 2LSUA 3CVVA 5CCMA 4KVMA 5ANRA 2E0IA 3FU6A 4CDNA 4F7AA 3GZSA 3QARA 3R9AB 3APCA 5D0QD 4HOQA 2WXKA 3FY4A 5CHEE 2AVPA 5A7DB 4UI9C 3RO3A 5AIJA 2QY7A 3OXGA 2FBNA 3FFLA 3EIJA 2XGOA 3IEGA 4EQFA 4XKCA 3ASGA 4CDRA 3AS8A 5FJYA 1YA0A 5ARGA 3PE4A 3ZIMA 3AU5A 2LAHA 3CR3A 1HZ4A 2AWIA 5T4YA 4FC8A 4A3TA 4B94A 4DI4A 1H19A 4AP2A 4PDXA 4CGVA 1ELKA 4R7LA 5G04C 4KVOA 2XQ0A 2I2OA 3CVWA 3CV0A 2YHEA 3L17A 3FTSA 4AV7A 3HHMA 4FU3A 1OWMA 3CHRA 3QWVA 3SBTB 5EX0A 2A4ZA 2YNQA 2IONA 3SBSA 1HG2A 3AS4A 2XPYA 1KT0A 3I5PA 2X3MA 3UQ3A 3EHMA 5FZQA 1MHQA 3MV2B 1Z3XA 3ZXSA 3PNTB 2WXGA 2I1JA 4BT8A 3HVEB 3FHEA 4UWLA 4G1TA 3UT4A 2MRIA 4JPSA 4PS3A 4TUUA 4I1MA 2X38A 1ZBPA 5JJTA 4UI9J 2J09A 3OXFA 3TJPA 1XNFA 3PUKA 1JWGA 2L0IA 2Y4UA 1H0AA 3FU5A 3FTYA 4U8HA 4UWFA 5ENNA 5AENA 2IFUA 3LY9A 4OVUA 2BUGA 3B13A 3U3WA 5ARFA 2CHZA 4WNDA 3ZPJA 2XRYA 3FH5A 4ANXA 1ZU2A 5J08A 1ELWA 1WAO1 1HH8A 3JUIA 4IRUA 3U64A 2UY1A 4I43A 3JQ0A 4WWPA 4AVXA 5KJKA 3CVYA 4C0MA 5G04J 2WXFA 3IKOB 2VJ8A 4WNFA 2GW1A 3G2VA 3CQCB 4I1OB 4RG6A 3EDTB 3FH8A 4YVQC 2J07A 2ONDA 4JL0A 2LAIA 4RG9A 4D10C 4U07A 4DLQA 5EDSA 4URKA 3ASFA 3ZVVA 1KT1A 5BW8C 4GA0A 3LPZA 3S2AA 4ANVA 3ESLA 4JHJA 2KZTA 1E8WA 3CVPA 5FT9A 5C1DA 5AJDA 4C0EA 3MV3B 1U3CA 3OTNA 5CMWA 2FEZA 4FJYA 3MJWA 4Q69A 4MLPA 1INZA 4NRHB 4N2QA 3QAQA 2DBAA 3FWVA 5E75A 3ONKA 4L23A 4GZCA 2VQ2A 3PRZA 3QJZA 3QDNA 5BNWA 3CVLA 4OYSA 4EECA 4BSXA 3RRNB 1OWNA 2CHXA 4B8AA 4ILIA 4KMOA 1SZAA 3D9JA 5AJLA 2NXPA 2RD0A 3B7SA 2X6IA 4G2VA 4MRUA 4WNEA 3RIBA 3URZA 2KCKA 3CVQA 4YVOA 2NSZA 1X5BA 2P58C 4GYOA 4ANUA 3DPDA 1Y6IA 2PQRA 5J90A 2KCVA 2BTDA 4KZ0A 2V0PA 4BTAA 3FH7A 3Q5MA 2WQ6A 4FHJA 4I9CA 5LCWC 1VDYA 2GRMA 3BG1B 1PC2A 4HLEA 3L13A 2I9CA 3EIQC 2C2LA 5G55A 4AY6A 3L08A 5LX8A 2WXJA 3UT7A 4DPRA 3S7JA 4APFA 1ELRA 4EZLA 1DVPA 3FUFA 3GYZA 4PS7A 3ZYKA 1QZ2A 3Q15A 3T5VA 4L7TA 3SF4A 4V3IA 3PREA 3D9MA 3FEXA 2J4DA 2PM6A 3CKBA 1IYGA 4OVVA 4GYYA 2L0TB 2WXLA 4W9RA 3MEKA 2OV8A 3ZYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NA0 A;  3TG4 A;  2YHC A;  4HOU A;  4J8F A;  2KAT A;  2LNI A;  5LCW J;  3JYS A;  4BWR A;  3S7D A;  4AM9 A;  4O6F A;  5JJ6 A;  4KXK B;  4GZ5 A;  3KD7 A;  2J9Q A;  2I6H A;  2OOE A;  3QOU A;  3QKY A;  4JA7 A;  4H7Y A;  5HI7 A;  3RU0 A;  1NZN A;  2QFC A;  4XIF A;  4IN3 B;  3ZHE B;  2IF4 A;  4G24 A;  2KC7 A;  2V5F A;  3ESK A;  2C0L A;  2XEV A;  3RJV A;  3ZN3 A;  2MHK A;  4N5C A;  1B89 A;  5DIZ A;  3BEE A;  3Q4A B;  3KS2 A;  5AYW D;  3GW4 A;  4APO A;  5BT1 A;  5A6C A;  2NC9 A;  3S7F A;  4WUY A;  3E4B A;  4XI9 A;  3KAE A;  3SZ7 A;  2FI7 A;  3UPV A;  2HR2 A;  3PE3 A;  4Y6C A;  4Y6W A;  1OUV A;  1A17 A;  2VGX B;  2XCB A;  4WNG A;  1HXI A;  2UWJ G;  2JLB A;  3Q47 B;  4GA2 A;  4GZ3 A;  1W3B A;  4AY5 A;  4UQZ A;  3TAX A;  4KYO B;  3LY7 A;  3HYM B;  2LSV A;  2C0M A;  3ZFW A;  5M72 A;  3CKC A;  3LCA A;  5G05 C;  5FTP A;  3MKR A;  3NF1 A;  2XGS A;  1Y8M A;  3ASH A;  3O48 A;  2HO1 A;  2VSN A;  4LEU A;  4U0S A;  3K9I A;  1P5Q A;  2FO7 A;  3CVN A;  5CCL A;  2PL2 A;  5D0O D;  4UQX A;  2L6J A;  4I1A A;  2XGM A;  4GZ6 A;  1IHG A;  3ULQ A;  3WXX A;  4ME2 A;  3AS5 A;  3VTY A;  3VTX A;  5G05 J;  5FZS A;  2VGX A;  1FCH A;  4N2S A;  4N3C A;  4YND A;  3RKV A;  4J8D A;  4AIF A;  4JHR A;  3QWW A;  5DBK A;  1WM5 A;  4XI0 A;  1E96 B;  1QQE A;  4CGW A;  4JA9 A;  4G23 A;  3CEQ A;  5KJN A;  4I17 A;  5EKQ D;  4G26 A;  3TG5 A;  2Y4T A;  4HOT A;  3LKU A;  4BT9 A;  2VGY A;  4F3V A;  5KJL A;  3LYA A;  4U0U A;  4A1S A;  3FP3 A;  4J0U A;  4HOR A;  3UUX A;  5KJM A;  4H7X A;  3MA5 A;  4ABN A;  3TGO A;  4GCN A;  1TJC A;  4I2Z A;  2XCC A;  4I2W A;  2VYI A;  2VSY A;  5HQ8 A;  3RO2 A;  4GCO A;  2WQH A;  4GYW A;  3GZ2 A;  3S7B A;  3CK9 A;  3LY8 A;  4U04 A;  5JJ7 A;  4G25 A;  4U0Z A;  3PDN A;  4BTB A;  3U4T A;  1KLX A;  4UQY A;  3ZHE A;  4I9E A;  4N39 A;  2PZI A;  3CK8 A;  4N3B A;  4HOS A;  2E2E A;  4UI9 K;  2XPI A;  3Q49 B;  2KCL A;  2WPV A;  3GZ1 A;  4NQ0 A;  3CK7 A;  3ASD A;  2HYZ A;  2R5S A;  5EX3 A;  3N71 A;  2YQ8 A;  2FF4 A;  3OXL A;  2UY1 B;  4KBQ A;  4N3A A;  3QWP A;  2PQN A;  4GA1 A;  2Q7F A;  3ZGQ A;  5FZR A;  4GPK A;  4J8E A;  1NA3 A;  2LSU A;  5CCM A;  3R9A B;  5D0Q D;  4HOQ A;  5CHE E;  2AVP A;  5A7D B;  4UI9 C;  3RO3 A;  3OXG A;  2FBN A;  3FFL A;  2XGO A;  3IEG A;  4EQF A;  3ASG A;  4CDR A;  3AS8 A;  5FJY A;  1YA0 A;  5ARG A;  3PE4 A;  4B94 A;  1HZ4 A;  4CGV A;  5G04 C;  3CV0 A;  3QWV A;  5EX0 A;  3AS4 A;  1KT0 A;  3UQ3 A;  5FZQ A;  3MV2 B;  4BT8 A;  4G1T A;  1ZBP A;  5JJT A;  4UI9 J;  3OXF A;  1XNF A;  2Y4U A;  2IFU A;  3LY9 A;  2BUG A;  3U3W A;  5ARF A;  4WND A;  3ZPJ A;  1ZU2 A;  1WAO 1;  1ELW A;  1HH8 A;  2UY1 A;  5KJK A;  5G04 J;  4WNF A;  2GW1 A;  4RG6 A;  3EDT B;  4YVQ C;  2OND A;  4JL0 A;  4RG9 A;  4U07 A;  3ASF A;  1KT1 A;  5BW8 C;  4GA0 A;  3LPZ A;  3CVP A;  5FT9 A;  5C1D A;  3MV3 B;  2FEZ A;  4NRH B;  4N2Q A;  2DBA A;  3FWV A;  2VQ2 A;  3QDN A;  5BNW A;  3CVL A;  3RIB A;  4G2V A;  4WNE A;  3URZ A;  2KCK A;  3CVQ A;  4YVO A;  2P58 C;  4GYO A;  2PQR A;  2KCV A;  4BTA A;  3Q5M A;  4I9C A;  5LCW C;  1PC2 A;  4AY6 A;  2C2L A;  3S7J A;  1ELR A;  3GYZ A;  1QZ2 A;  3Q15 A;  3SF4 A;  3CKB A;  1IYG A;  4GYY A;  4W9R A;  3MEK A; 
#chains in the Genus database with same CATH topology
 1TNO A;  1N52 A;  5E76 A;  3DSW A;  1FVH A;  4AOF A;  4DLO A;  2X6K A;  2KAT A;  2ZGG A;  3MZL B;  3NZS A;  2Y0B G;  2A5E A;  4BWR A;  3CHP A;  2R02 A;  3S7D A;  4O6F A;  5JJ6 A;  3CST A;  1OT8 A;  4AXH A;  2I6H A;  2ILR A;  3QOU A;  4JA7 A;  4IN3 B;  3MKQ B;  2IF4 A;  2V5F A;  3ISM C;  3ZYL A;  1JUQ A;  3F6Q A;  1N54 A;  1EYH A;  2XEV A;  2IU1 A;  3ZN3 A;  2KBX A;  5BXO A;  4F53 A;  4N5C A;  4HFG A;  3PZD A;  5DIZ A;  3Q4A B;  2GGF A;  1IHB A;  1HFA A;  1SA4 A;  3D9H A;  5CER B;  5BT1 A;  3APD A;  5A6C A;  3CQG B;  2NC9 A;  3S7F A;  2R03 A;  2BKG A;  1UW4 B;  4XI9 A;  3KAE A;  3SZ7 A;  3UPV A;  2HR2 A;  4U95 D;  4F6R D;  3T8M A;  1E7U A;  2ETB A;  3LJN A;  5EIL A;  2LUH A;  1N0R A;  5CEA A;  4GA2 A;  1IQR A;  1N95 A;  1LTX A;  1W3B A;  3RRU A;  3P2B A;  3TAX A;  3NOG D;  4KYO B;  3LY7 A;  3HXC A;  2H6G A;  4TV3 A;  4EPZ A;  1OWP A;  1OCZ E;  2C0M A;  3PUJ A;  5ANL A;  3ZFW A;  3LCA A;  5G05 C;  5FTP A;  3D9L A;  4RLY A;  3CHO A;  1E8X A;  3SGH A;  4JHK A;  5FQ8 A;  4KT6 B;  1S0P A;  2VSN A;  2KXP C;  3FTZ A;  3I3N A;  2DYR E;  3LDZ A;  5D0O D;  4K5C A;  4AJW A;  2R17 C;  2XGM A;  4E85 A;  2GRR B;  1SZ9 A;  4WAF A;  3ULQ A;  4HS2 A;  3AS5 A;  3SQV A;  3VTY A;  3EU5 A;  2PNN A;  4KZC A;  4UWK A;  4YDE A;  3EHR A;  3RKV A;  4BFR A;  3G2U A;  1H2V C;  3ZEF A;  4A3V A;  5DBK A;  3PS6 A;  2X6F A;  4J8S A;  5KBA A;  4B0Z A;  4JW1 A;  4XI0 A;  4EBA G;  2DWZ A;  4O1O A;  2HM8 A;  2P9S G;  3FTX A;  3CEQ A;  2P9U G;  3UMV A;  1E7V A;  1FT1 A;  3B7T A;  3Q79 A;  2P9K G;  3FUL A;  5EKQ D;  2F37 A;  5EYP F;  5CRU A;  4DRX E;  5FQ4 A;  3E37 A;  4ILH B;  2VGY A;  3UM3 A;  3ENE A;  2WXO A;  4U0U A;  4A1S A;  3FP3 A;  5ENO D;  3EJN A;  5BV0 A;  3DXM G;  4FHK A;  3TGO A;  3CHS A;  1QYM A;  2EIM E;  4U7E B;  4MS6 A;  3EHN A;  4WWN A;  4GMJ A;  3U66 A;  2WQH A;  5B1B E;  5JJ7 A;  3ONL A;  3PDN A;  3U4T A;  1UJK A;  3IBE A;  3LEW A;  3RK6 A;  3NQP A;  4GB9 A;  4UQY A;  1H6K A;  4I9E A;  4P29 A;  4N39 A;  5D2M C;  3MYV A;  2XHE A;  4UI9 K;  3PZ3 A;  3C98 A;  3D9P A;  3J5P A;  4J8Y A;  3CK7 A;  4LER A;  3I4G A;  2R5S A;  1PAQ A;  3C3R A;  1MYO A;  2P2C P;  2FF4 A;  3OXL A;  3CLJ A;  2DIW A;  4GA1 A;  2Q7F A;  3ZGQ A;  5FZR A;  3Q9U C;  1TJF A;  3NZU A;  1TNY A;  2B6C A;  3ZYM A;  1AP7 A;  1S63 A;  4ZHB A;  2E0I A;  4N5Q A;  3APC A;  3JUE A;  3FY4 A;  3RO3 A;  5AIJ A;  1MX2 A;  3OXG A;  2XGO A;  4XKC A;  4CDR A;  3AS8 A;  2ETA A;  3PE4 A;  4DX2 A;  2AWI A;  4FC8 A;  1KZO A;  3NBN B;  4KVO A;  3L17 A;  3UIN C;  3DSS A;  2OEV A;  2YNQ A;  2ION A;  2RFA A;  3SBS A;  1HG2 A;  3UQ3 A;  3V2X A;  1Z3X A;  2AJA A;  3TWW A;  3HXF A;  4ZFH A;  4TUU A;  4I1M A;  3OXF A;  4LG6 A;  4EHM A;  2L0I A;  5AAO A;  2IFU A;  3BUA A;  3B13 A;  2XRY A;  3U64 A;  2UY1 A;  5JMN D;  4C0M A;  3FH8 A;  2DZO A;  2J07 A;  2OND A;  4RG9 A;  4D10 C;  1N4P A;  2GRQ B;  4A63 B;  4DLQ A;  3ULY A;  2F8X K;  1KT1 A;  4GA0 A;  2R2L A;  3LPZ A;  5CBN A;  4ANV A;  4JHJ A;  1E8W A;  5AJD A;  3MV3 B;  3BU8 A;  3MJW A;  4MLP A;  4NRH B;  3ZUV B;  3FWV A;  3ONK A;  4L23 A;  3PRZ A;  4UUC A;  3CVL A;  4B8A A;  1V55 E;  1LD7 A;  2X6I A;  4MRU A;  3URZ A;  2KCK A;  4YVO A;  2NSZ A;  4GYO A;  4KZ0 A;  1TR4 A;  2V0P A;  1K1B A;  3ULE G;  5G55 A;  1MJ0 A;  3UT7 A;  5AQ9 A;  1QZ2 A;  3T5V A;  3FEX A;  2PM6 A;  4GYY A;  3V2O A;  2OV8 A;  1SW6 A;  3CVU A;  1EF1 C;  3HXB A;  3MX3 A;  2WVI A;  1HO8 A;  2YHC A;  2WB2 A;  3FUJ A;  4HOU A;  4J8F A;  4LUN U;  4HQD A;  2LO6 A;  5LCW J;  3OAW A;  4CT0 A;  4L2Y A;  2OVF A;  2A5U A;  4G8K A;  1TEZ A;  3ABK E;  2IQC A;  1H6O A;  3G2W A;  3L54 A;  3KD7 A;  3VLF A;  4DJA A;  3DWL G;  3ZHE B;  2L9B A;  4TRQ A;  4LCT A;  1Z3Y A;  3ESK A;  4GTM A;  1N9A A;  3B7B A;  2X6J A;  3RJV A;  3BEE A;  4K5A B;  3GW4 A;  2XZT G;  3LXU X;  3E33 A;  2WXH A;  3SD5 A;  4ATG A;  4NUR A;  4OAV B;  4WUY A;  3E4B A;  2J4B A;  4YDO A;  3ABL E;  5C2Y A;  2IEJ A;  3Q73 A;  1A17 A;  3R7R A;  1DNP A;  4NAC A;  4QQI A;  4FP7 A;  1HG5 A;  4F1S A;  1HXI A;  4DX1 A;  2JLB A;  3Q47 B;  4FJZ A;  1QBQ A;  3QC1 A;  4UQZ A;  1UG3 A;  2XPZ A;  3HG0 D;  1SA5 A;  1OWL A;  5AN8 A;  4YDW A;  3MKR A;  3HVE A;  4DI3 A;  3NF1 A;  3SI5 A;  1WDY A;  2XGS A;  1Y8M A;  3FUD A;  2HO1 A;  2WXR A;  3L22 A;  1BLX B;  4LEU A;  3CHQ A;  2MYO A;  1OCO E;  4CCA A;  5KNG A;  4E6H A;  4J7W A;  4PH4 B;  3LS8 A;  4GZD A;  2L6J A;  4I1A A;  4Q96 A;  2F0Y A;  2XZD G;  1UOH A;  1TN8 A;  5EYL A;  1UJJ A;  3VTX A;  3DXK G;  5G05 J;  1O1S A;  5FZS A;  3AG2 E;  2EQX A;  1FCH A;  3FTU A;  2WXN A;  3TWR A;  4YND A;  2ZIR A;  1WY6 A;  2P9I G;  2JAB A;  3UIP C;  3MGB A;  4K03 A;  4J8D A;  4AIF A;  1LF8 A;  4DUI A;  1AWC B;  3MCX A;  3W9F A;  4NIK A;  1QQE A;  5EID A;  1MQS A;  4M7C A;  2L6B A;  1NFI E;  3FUN A;  2OVB A;  1NI1 A;  4HBD A;  4FA6 A;  3D9N A;  4I17 A;  1Z6T A;  1SVX A;  5CBO A;  2WXP A;  4CYM D;  3IV0 A;  2WMN A;  4I6G A;  1G3N B;  1H2U A;  2J49 A;  3SFZ A;  4BT9 A;  2WM9 A;  3LVQ E;  1OCC E;  5KJL A;  3LYA A;  3EUV A;  1E8Z A;  4HOR A;  5KJM A;  4XEI G;  1PY1 A;  3RRM B;  4H7X A;  4GCN A;  2XCC A;  5T3R A;  4I2W A;  2VYI A;  5HQ8 A;  2DCP A;  5HS0 A;  1HS6 A;  4RVB A;  4BY6 A;  3AG4 E;  4X8Q A;  1FT2 A;  4GYW A;  3JCK C;  3S7B A;  2IO3 C;  3TWQ A;  1NP7 A;  3E32 A;  1JCR A;  3Q9N C;  2VGE A;  2NYJ A;  3FUK A;  4K0R A;  4A55 A;  2CG3 A;  2OEW A;  3CGH A;  4BX9 A;  5LOZ A;  2I1K A;  3Q49 B;  5ENT D;  2KCL A;  2WPV A;  3CVX A;  3ZRH A;  4NQ0 A;  4DK5 A;  3Q7A A;  3ASD A;  4J6I A;  1N94 A;  5EX3 A;  4C48 B;  3HIZ A;  4JEU A;  4EBA A;  4QFV A;  2J08 A;  3W9G A;  5FQ6 A;  3DPY A;  2VTB A;  5CCM A;  5ANR A;  4F7A A;  3EHQ A;  3QAR A;  3C3Q A;  2WXK A;  5A7D B;  3RAU A;  2FBN A;  3IEG A;  3ASG A;  1NL4 A;  3ZIM A;  4AP2 A;  4R7L A;  2I2O A;  2XEE A;  2YHE A;  4AV7 A;  1OWM A;  4BEP A;  2H6H A;  2XPY A;  2EIL E;  3I5P A;  3ASN E;  3EHM A;  5FZQ A;  3ZXS A;  3PNT B;  1RW2 A;  2WXG A;  2I1J A;  3FHE A;  4HRM B;  1Z5S C;  1JWG A;  3FU5 A;  3FTY A;  4UWF A;  5AEN A;  4OVU A;  1TN7 A;  5CEC B;  2BUG A;  2BED A;  4WND A;  4OAU C;  3FH5 A;  4ANX A;  1ELW A;  3JUI A;  1HH8 A;  4IRU A;  4K5B A;  4I43 A;  3JQ0 A;  4GTP A;  3IKO B;  1BI8 B;  3RSE G;  4YVQ C;  1YYH A;  2LAI A;  2XS8 A;  5EDS A;  3AG1 E;  5BW8 C;  3S2A A;  3ESL A;  2KZT A;  2OCC E;  1U3C A;  4BER A;  5CMW A;  2FEZ A;  4FJY A;  4Q69 A;  1TNU A;  3TWX A;  4CZ2 D;  2IO2 C;  3C5R A;  4EEC A;  1OWN A;  4ILI A;  1SZA A;  2NXP A;  3RIB A;  2P58 C;  4BET A;  2EIN E;  4ANU A;  3DPD A;  1Y6I A;  4GTR A;  3DSX A;  4BTA A;  3V31 A;  4FHJ A;  3ZKJ A;  5B3S E;  3V30 A;  3X2Q E;  4RQI A;  4DPR A;  1ELR A;  3FUF A;  3GYZ A;  4PS7 A;  3ZYK A;  3Q75 A;  4V3I A;  3D9M A;  3AAA C;  4DX7 D;  5ENQ D;  2WXL A;  3MEK A;  3PEV B;  1NA0 A;  3DEO A;  3ASO E;  3TG4 A;  2ZGD A;  3LVR E;  4MKT A;  4B93 B;  1UN8 A;  2RFM A;  4LRZ A;  5G2N A;  2AXU A;  5HKP A;  2R05 A;  3IHY A;  4AM9 A;  1U2V G;  4DX5 D;  1N4S A;  3PZ1 A;  4O1P A;  2QYJ A;  1IXV A;  4L1B A;  3QKY A;  1NZN A;  2QFC A;  5JHB A;  3E34 A;  2XRZ A;  2ZXW E;  4G24 A;  2KC7 A;  3IXE A;  4HVB A;  1E8Y A;  2C0L A;  4GTQ A;  4I6E A;  4ILG A;  3PEU B;  4ANW A;  3B7R L;  1JCS A;  3QK0 A;  4APO A;  1HE8 A;  1BI7 B;  4HI9 A;  5AQ7 A;  3DST A;  2WXQ A;  3AJI A;  3B7U X;  4IYP A;  2GRN B;  5ENR D;  5FIO A;  3UT8 A;  1BPO A;  4Y6W A;  5ITZ F;  1OUV A;  4TXQ A;  1MX6 A;  2VGX B;  3ZNG A;  4WNG A;  4A1G A;  2FO1 E;  4XKB A;  2IOS A;  3HRA A;  4GZ3 A;  3G2T A;  4I6J A;  5FWQ A;  2MOW A;  4AY5 A;  3TWS A;  1D8E A;  4GML A;  2AXV A;  1KZP A;  3UKR G;  1TNZ A;  3HYM B;  2LSV A;  4TXR A;  2XEH A;  5BXU A;  5M72 A;  3CKC A;  4LNU D;  2WQ7 A;  3TXM A;  1K1A A;  3O48 A;  3D9K A;  4U0S A;  3K9I A;  1A5E A;  1IKN D;  2FO7 A;  4MBG A;  3CVN A;  3C72 A;  3NB2 A;  2PL2 A;  5CCL A;  4JVS A;  4ACK A;  2DVW A;  2B0O E;  3I4R B;  5T8I A;  4GZ6 A;  1IHG A;  3WXX A;  4ME2 A;  4CT4 A;  4JZY A;  2VSX E;  1N4Q A;  3B95 A;  2CFU A;  1E90 A;  3PNL B;  4GU5 A;  4N2S A;  4N3C A;  4RSY A;  1BD8 A;  1YCS B;  3NAW A;  3E30 A;  4LNG A;  4GAA A;  2GRO B;  3PH0 C;  2PM7 A;  3QWW A;  1WM5 A;  2AXZ A;  3UM2 A;  1E96 B;  3FTW A;  4CGW A;  4XE0 A;  4G23 A;  1D9S A;  2LXM A;  5KJN A;  3QB2 A;  1HX8 A;  3VLD A;  4DX6 D;  4G26 A;  3L6A A;  2Y4T A;  4HOT A;  4AEZ C;  2CFZ A;  2YIN A;  3CHM A;  3O4Z A;  4LSZ E;  4FAD A;  5A23 A;  5AQB A;  1QNF A;  4FLH A;  2BKK B;  1JWF A;  4IUL A;  4PS8 A;  3G2S A;  3QNK A;  3FUH A;  2AW6 A;  4ABN A;  4I2Z A;  3RO2 A;  4GPM A;  4XX5 A;  3GZ2 A;  1UN9 A;  4G25 A;  4U0Z A;  3L82 A;  4BTB A;  2H6F A;  1KLX A;  2ETC A;  3MKQ A;  1DC2 A;  3CIA A;  5LFA A;  1LD8 A;  4XZ4 A;  4N3B A;  5ENS D;  3ML9 A;  2E2E A;  5JHA A;  1OWO A;  4U63 A;  5KWD A;  5FIN A;  4CEM A;  2YQ8 A;  2GRL A;  4BES A;  4KBQ A;  4N3A A;  3QWP A;  5CMY A;  5BPP A;  2CHW A;  3PZ4 A;  4Q94 A;  1H6P A;  3WG7 E;  4GPK A;  1IQU A;  1OXJ A;  2M63 A;  3KSL A;  4J8E A;  3T8K A;  2LSU A;  4KVM A;  2XS1 A;  4CDN A;  5D0Q D;  5CHE E;  2AVP A;  4UI9 C;  3J5Q B;  2QY7 A;  3FFL A;  3EIJ A;  1WG0 A;  3AU5 A;  2LAH A;  3CR3 A;  1HZ4 A;  5T4Y A;  4A3T A;  4DI4 A;  1H19 A;  4PDX A;  5G04 C;  2XQ0 A;  3CVW A;  1N0Q A;  1Q2Z A;  4FU3 A;  3CHR A;  3QWV A;  2A4Z A;  3AS4 A;  3DEP A;  5IY5 E;  4Z68 A;  1MHQ A;  3MV2 B;  4BT8 A;  3T9K A;  3HVE B;  4G1T A;  2MRI A;  4JPS A;  4PS3 A;  1ZBP A;  3TJP A;  1XNF A;  3PUK A;  5ENN A;  3LY9 A;  5ARF A;  3ZPJ A;  3ABM E;  1ZU2 A;  4WWP A;  4JB8 P;  3R9M A;  2WXF A;  2GW1 A;  3G2V A;  3CQC B;  4I1O B;  4RG6 A;  3EDT B;  4U07 A;  4URK A;  3ASF A;  3ZVV A;  5B1A E;  3CVP A;  4C0E A;  2DZN A;  2XEN A;  1INZ A;  3QAQ A;  4GZC A;  3BQO A;  1S64 A;  3QJZ A;  1D8D A;  4BSX A;  2QC9 A;  3RRN B;  1FPP A;  4KMO A;  3D9J A;  5AJL A;  2RD0 A;  3B7S A;  4G2V A;  4F1P A;  1X5B A;  2PQR A;  1KPS B;  5J90 A;  2KCV A;  3DRA A;  4LNB A;  1OY3 D;  3BG1 B;  2GRM A;  1PC2 A;  3SY2 A;  2I9C A;  3EIQ C;  3L08 A;  5LX8 A;  3AG3 E;  3S7J A;  3SF4 A;  3PRE A;  3UM0 A;  3CKB A;  5AAR A;  1IYG A;  2Y1L E;  2L0T B;  2HE0 A;  4W9R A;  3ZYQ A;  4JEH A;  3ZW3 A;  2H6I A;  4PUC A;  1K3Z D;  3APF A;  1JCQ A;  2BF0 X;  3KSQ A;  2LNI A;  3JYS A;  4BX8 A;  3SFY A;  1ZB1 A;  3SNX A;  4KXK B;  4GZ5 A;  3JQ1 A;  2J9Q A;  2OOE A;  3ZXP A;  3FUM A;  5HI7 A;  4H7Y A;  3RU0 A;  4TUM A;  4XIF A;  3TWU A;  2F8Y A;  3JXJ A;  3HDX A;  5LP0 A;  4FLB A;  1GW6 A;  3UKU G;  4HXI A;  1X81 A;  3CSF A;  3LJ3 A;  4GTV A;  4EZJ A;  4GTT A;  4HRN A;  2MHK A;  1BU9 A;  1B89 A;  2GRP B;  4GTO A;  5KNH D;  3KS2 A;  5AYW D;  4B8C B;  2RG8 A;  1S70 B;  3UIO C;  4ACL A;  2JEK A;  4CDM A;  2FI7 A;  1EDU A;  1H2T C;  3DBS A;  2WXI A;  3PE3 A;  4Y6C A;  3TXN A;  3KEZ A;  2VTB B;  2XCB A;  1HF8 A;  3PVL A;  3ZU7 B;  2UWJ G;  2QZA A;  2FUL A;  3TWT A;  1L5J A;  3ML8 A;  1XGW A;  4U8Y D;  4HLL A;  4GTS A;  3BG0 B;  4GMR A;  3FEY A;  2WMO A;  3AU4 A;  2WXM A;  3ASH A;  1MX4 A;  1U3D A;  3L16 A;  3NOC D;  4JXT A;  3FDH A;  5BV1 A;  1P5Q A;  2IJG X;  3DSU A;  3D9O A;  3IHV A;  5H7P A;  4UQX A;  1SQM A;  1O5M A;  3FU3 A;  3FUI A;  4HNA D;  1EPU A;  4G11 A;  3D9I A;  4M3O A;  5KCM A;  3UXG A;  3T5X A;  2ZU6 B;  3UM1 A;  3FUE A;  2VGX A;  4HI8 A;  5AQA A;  1JPL A;  5EN5 D;  4WWO A;  3Q7F A;  2IY0 C;  2IOL A;  2KZT B;  4G8L A;  4JC8 A;  4JHR A;  5CRV A;  4FUL A;  2KM4 A;  4EZK A;  3HXD A;  2CG2 A;  3SFX A;  4CRW A;  3P1U A;  4U96 D;  4JA9 A;  4L2L A;  3UX4 A;  3FU0 A;  1O1T A;  1RZ4 A;  4UWH A;  2R59 A;  1V54 E;  3SHF A;  2QYU A;  3TG5 A;  3LKU A;  4UWG A;  3R7Q A;  2V8S E;  4F3V A;  4J0U A;  3UUX A;  5ENP D;  2P9P G;  3MA5 A;  4C9B B;  1TJC A;  3D3M A;  2Y3A A;  2VSY A;  4GCO A;  2J8S D;  5D66 A;  5CED B;  5JA4 D;  3U9W A;  3CK9 A;  3HXE A;  3LY8 A;  4U04 A;  5HRY A;  1FVF A;  3KEA A;  3V79 K;  1OCR E;  2VSO E;  3ZHE A;  2PZI A;  2EIJ E;  3PZ2 A;  3EU9 A;  3CK8 A;  4B89 A;  4HOS A;  1K8K G;  2XPI A;  1DCQ A;  3GZ1 A;  1N4R A;  2V4H C;  2X6H A;  3TL5 A;  4YDY A;  2HYZ A;  3FTV A;  3N71 A;  4L9P A;  5FQ7 A;  3VLE A;  2LXL A;  2UY1 B;  5BUZ A;  4ATZ D;  2V4L A;  2PQN A;  2Y69 E;  1HU3 A;  1TN6 A;  1N11 A;  1NA3 A;  3CVV A;  3FU6 A;  4U8V D;  3GZS A;  3R9A B;  4HOQ A;  1O1R A;  4EQF A;  5FJY A;  1YMP A;  1YA0 A;  5ARG A;  4B94 A;  3UTM A;  4CGV A;  1ELK A;  3CV0 A;  3FTS A;  3HHM A;  4JD2 G;  1DCE A;  3SBT B;  5EX0 A;  1KT0 A;  2X3M A;  4UWL A;  3UT4 A;  2X38 A;  5JJT A;  4UI9 J;  2J09 A;  2Y4U A;  1H0A A;  4U8H A;  1MZC A;  2RKK A;  4BSZ B;  3U3W A;  2CHZ A;  3UI2 A;  3L9T A;  2DYS E;  5J08 A;  1WAO 1;  4AVX A;  5KJK A;  3CVY A;  5G04 J;  2VJ8 A;  4WNF A;  3SO8 A;  4HB5 A;  4JL0 A;  3JXI A;  2P9L G;  3DSV A;  5FT9 A;  5C1D A;  3OTN A;  4N2Q A;  2DBA A;  5E75 A;  2VQ2 A;  2V5Q C;  3QDN A;  2P9N G;  5BNW A;  4OYS A;  2CHX A;  3TWV A;  4HRL A;  4WNE A;  3CVQ A;  4O60 A;  1TNB A;  1TYQ G;  2BTD A;  3FH7 A;  3Q5M A;  2ZIS A;  2WQ6 A;  4I9C A;  5LCW C;  1VDY A;  4HLE A;  3L13 A;  4AY6 A;  2C2L A;  2WXJ A;  4APF A;  4EZL A;  1DVP A;  3Q15 A;  3C3O A;  4L7T A;  4TXP A;  2EIK E;  2J4D A;  4OVV A;  3Q78 A;  5EIB E; 
#chains in the Genus database with same CATH homology
 4JEH A;  3CVU A;  3PEV B;  1EF1 C;  1NA0 A;  3ZW3 A;  1N52 A;  5E76 A;  3MX3 A;  3TG4 A;  2WVI A;  4PUC A;  1HO8 A;  1FVH A;  2YHC A;  4AOF A;  3FUJ A;  2WB2 A;  3APF A;  3LVR E;  4MKT A;  1UN8 A;  2BF0 X;  4HOU A;  4J8F A;  4DLO A;  2X6K A;  2KAT A;  3MZL B;  4LRZ A;  4LUN U;  2LO6 A;  3NZS A;  2LNI A;  5LCW J;  5G2N A;  3OAW A;  4CT0 A;  2AXU A;  3JYS A;  4L2Y A;  2OVF A;  4BX8 A;  4BWR A;  2A5U A;  3CHP A;  3IHY A;  3S7D A;  4AM9 A;  4O6F A;  5JJ6 A;  1TEZ A;  3CST A;  3SNX A;  2IQC A;  3G2W A;  3L54 A;  4KXK B;  4GZ5 A;  3JQ1 A;  3KD7 A;  2J9Q A;  4AXH A;  2I6H A;  2OOE A;  2ILR A;  4L1B A;  3FUM A;  3QOU A;  3QKY A;  4JA7 A;  4H7Y A;  5HI7 A;  3RU0 A;  1NZN A;  2QFC A;  4XIF A;  3VLF A;  4DJA A;  4IN3 B;  3HDX A;  5JHB A;  3ZHE B;  2L9B A;  2XRZ A;  5LP0 A;  3MKQ B;  4TRQ A;  2IF4 A;  4G24 A;  4FLB A;  1GW6 A;  2KC7 A;  2V5F A;  4HXI A;  4HVB A;  1E8Y A;  4LCT A;  1JUQ A;  3ZYL A;  1Z3Y A;  3CSF A;  3ESK A;  2C0L A;  3LJ3 A;  1N54 A;  1EYH A;  4EZJ A;  2X6J A;  2XEV A;  2IU1 A;  3RJV A;  3ZN3 A;  4I6E A;  2MHK A;  4ILG A;  4N5C A;  4HFG A;  4F53 A;  1B89 A;  3PEU B;  3PZD A;  4ANW A;  3B7R L;  5DIZ A;  3BEE A;  3Q4A B;  2GGF A;  3KS2 A;  5AYW D;  4B8C B;  3GW4 A;  3LXU X;  1HFA A;  3QK0 A;  2RG8 A;  2WXH A;  3SD5 A;  1HE8 A;  4APO A;  5BT1 A;  3APD A;  5A6C A;  4ATG A;  3CQG B;  2NC9 A;  4NUR A;  3S7F A;  4WUY A;  4ACL A;  2JEK A;  2WXQ A;  3E4B A;  1UW4 B;  3B7U X;  4CDM A;  4XI9 A;  3KAE A;  2J4B A;  3SZ7 A;  4IYP A;  2FI7 A;  1EDU A;  3UPV A;  3UT8 A;  1H2T C;  5C2Y A;  3DBS A;  2WXI A;  2HR2 A;  3PE3 A;  4Y6C A;  1BPO A;  3TXN A;  4Y6W A;  1OUV A;  3KEZ A;  1A17 A;  2VTB B;  2VGX B;  3R7R A;  1E7U A;  1DNP A;  2XCB A;  1HF8 A;  3PVL A;  4NAC A;  4FP7 A;  3T8M A;  4WNG A;  4A1G A;  1HG5 A;  4F1S A;  1HXI A;  2UWJ G;  4XKB A;  2JLB A;  3Q47 B;  2IOS A;  4GA2 A;  4GZ3 A;  3G2T A;  4I6J A;  5FWQ A;  2FUL A;  1IQR A;  2MOW A;  4FJZ A;  1W3B A;  3RRU A;  3QC1 A;  4AY5 A;  4UQZ A;  3P2B A;  3TAX A;  1L5J A;  3ML8 A;  4GML A;  2AXV A;  1XGW A;  1UG3 A;  2XPZ A;  4KYO B;  3LY7 A;  4TV3 A;  4EPZ A;  3HYM B;  1OWP A;  2LSV A;  3PUJ A;  2C0M A;  5ANL A;  3ZFW A;  5M72 A;  3CKC A;  3LCA A;  1OWL A;  5G05 C;  2WQ7 A;  5FTP A;  3D9L A;  3BG0 B;  3MKR A;  3TXM A;  3HVE A;  3CHO A;  4DI3 A;  3FEY A;  3NF1 A;  3SI5 A;  1E8X A;  2WMO A;  3AU4 A;  2WXM A;  2XGS A;  1Y8M A;  3ASH A;  3SGH A;  3O48 A;  3FUD A;  4JHK A;  1U3D A;  4KT6 B;  5FQ8 A;  2HO1 A;  3L16 A;  1S0P A;  2VSN A;  2WXR A;  3L22 A;  4JXT A;  4LEU A;  3CHQ A;  3D9K A;  3FDH A;  4CCA A;  4E6H A;  4U0S A;  3K9I A;  5BV1 A;  1P5Q A;  3FTZ A;  3I3N A;  2FO7 A;  2IJG X;  3CVN A;  3D9O A;  3IHV A;  4PH4 B;  5CCL A;  2PL2 A;  3LDZ A;  5D0O D;  4JVS A;  4ACK A;  3LS8 A;  4UQX A;  1SQM A;  4AJW A;  3I4R B;  4GZD A;  2L6J A;  2R17 C;  4I1A A;  2XGM A;  3FU3 A;  4Q96 A;  4E85 A;  5T8I A;  4GZ6 A;  1SZ9 A;  3FUI A;  1EPU A;  4G11 A;  4WAF A;  1IHG A;  3D9I A;  3ULQ A;  4HS2 A;  3WXX A;  4ME2 A;  4M3O A;  5KCM A;  3AS5 A;  3VTY A;  1UJJ A;  3T5X A;  3VTX A;  5G05 J;  4CT4 A;  2ZU6 B;  5FZS A;  3FUE A;  2VGX A;  4JZY A;  2VSX E;  2CFU A;  2EQX A;  1JPL A;  1FCH A;  1E90 A;  3PNL B;  4GU5 A;  4WWO A;  4N2S A;  4KZC A;  2IOL A;  2WXN A;  3FTU A;  4N3C A;  4UWK A;  2KZT B;  4YND A;  1WY6 A;  4RSY A;  3RKV A;  4BFR A;  4JC8 A;  3MGB A;  4K03 A;  4GAA A;  4J8D A;  4AIF A;  3G2U A;  4JHR A;  1LF8 A;  1H2V C;  3PH0 C;  4FUL A;  2PM7 A;  3QWW A;  2KM4 A;  3ZEF A;  4A3V A;  5DBK A;  3PS6 A;  1WM5 A;  4EZK A;  2X6F A;  4J8S A;  2AXZ A;  2CG2 A;  4B0Z A;  4JW1 A;  4XI0 A;  4EBA G;  1E96 B;  4CRW A;  3P1U A;  3MCX A;  1QQE A;  3FTW A;  4CGW A;  1MQS A;  2HM8 A;  4JA9 A;  4XE0 A;  4G23 A;  3FTX A;  4L2L A;  3CEQ A;  3UMV A;  3UX4 A;  3FU0 A;  3FUN A;  2OVB A;  1E7V A;  4UWH A;  4FA6 A;  5KJN A;  3QB2 A;  3B7T A;  2R59 A;  3D9N A;  1HX8 A;  4I17 A;  1Z6T A;  3FUL A;  5EKQ D;  3SHF A;  2WXP A;  3VLD A;  3IV0 A;  4G26 A;  3L6A A;  3TG5 A;  2WMN A;  4I6G A;  2Y4T A;  4HOT A;  4AEZ C;  1H2U A;  2CFZ A;  3LKU A;  4UWG A;  5FQ4 A;  2YIN A;  3CHM A;  3O4Z A;  4ILH B;  4FAD A;  2J49 A;  3R7Q A;  3SFZ A;  4BT9 A;  2VGY A;  2WM9 A;  5A23 A;  2V8S E;  3LVQ E;  4F3V A;  3ENE A;  5KJL A;  1QNF A;  4FLH A;  2WXO A;  3LYA A;  4U0U A;  1JWF A;  4A1S A;  3FP3 A;  4J0U A;  1E8Z A;  4IUL A;  3EJN A;  4PS8 A;  3UUX A;  5BV0 A;  5KJM A;  4HOR A;  4FHK A;  1PY1 A;  3G2S A;  3RRM B;  3QNK A;  3FUH A;  2AW6 A;  4H7X A;  3MA5 A;  4ABN A;  3CHS A;  4GCN A;  4C9B B;  3TGO A;  1TJC A;  3D3M A;  2XCC A;  4I2Z A;  4MS6 A;  5T3R A;  2Y3A A;  4I2W A;  2VYI A;  2VSY A;  3EHN A;  2DCP A;  5HQ8 A;  1HS6 A;  4RVB A;  4WWN A;  4BY6 A;  4GMJ A;  3RO2 A;  4GCO A;  3U66 A;  2WQH A;  4GYW A;  4XX5 A;  3GZ2 A;  3JCK C;  3S7B A;  3CK9 A;  3LY8 A;  4U04 A;  3U9W A;  5JJ7 A;  1FVF A;  1UN9 A;  4G25 A;  1NP7 A;  4U0Z A;  3ONL A;  3PDN A;  4BTB A;  3U4T A;  1UJK A;  3IBE A;  3LEW A;  3RK6 A;  1KLX A;  2VSO E;  3NQP A;  4GB9 A;  4UQY A;  3ZHE A;  1H6K A;  4I9E A;  3MKQ A;  4P29 A;  3CIA A;  4N39 A;  3FUK A;  5LFA A;  2PZI A;  4K0R A;  3MYV A;  4A55 A;  4XZ4 A;  3CK8 A;  4B89 A;  4N3B A;  2CG3 A;  3ML9 A;  3CGH A;  2XHE A;  4HOS A;  4BX9 A;  2E2E A;  4UI9 K;  5JHA A;  5LOZ A;  2I1K A;  2XPI A;  3Q49 B;  2KCL A;  1OWO A;  2WPV A;  3C98 A;  3D9P A;  4U63 A;  3GZ1 A;  3CVX A;  3ZRH A;  2X6H A;  3TL5 A;  4NQ0 A;  4DK5 A;  3CK7 A;  4LER A;  3ASD A;  3I4G A;  2HYZ A;  4J6I A;  2R5S A;  5EX3 A;  3FTV A;  3N71 A;  4CEM A;  1PAQ A;  2YQ8 A;  5FQ7 A;  3VLE A;  2GRL A;  3HIZ A;  2FF4 A;  4JEU A;  3OXL A;  2UY1 B;  4EBA A;  5BUZ A;  4KBQ A;  4QFV A;  3CLJ A;  2V4L A;  2J08 A;  2DIW A;  2CHW A;  3QWP A;  2PQN A;  4GA1 A;  4N3A A;  4Q94 A;  5CMY A;  5BPP A;  2Q7F A;  3ZGQ A;  5FZR A;  5FQ6 A;  1HU3 A;  1TJF A;  1IQU A;  4GPK A;  3NZU A;  2M63 A;  4J8E A;  1NA3 A;  3ZYM A;  2VTB A;  2LSU A;  3CVV A;  5CCM A;  4KVM A;  5ANR A;  2E0I A;  3FU6 A;  4CDN A;  4F7A A;  3GZS A;  3QAR A;  3R9A B;  3APC A;  5D0Q D;  4HOQ A;  2WXK A;  3FY4 A;  5CHE E;  2AVP A;  5A7D B;  4UI9 C;  3RO3 A;  5AIJ A;  2QY7 A;  3OXG A;  2FBN A;  3FFL A;  3EIJ A;  2XGO A;  3IEG A;  4EQF A;  4XKC A;  3ASG A;  4CDR A;  3AS8 A;  5FJY A;  1YA0 A;  5ARG A;  3PE4 A;  3ZIM A;  3AU5 A;  2LAH A;  3CR3 A;  1HZ4 A;  2AWI A;  5T4Y A;  4FC8 A;  4A3T A;  4B94 A;  4DI4 A;  1H19 A;  4AP2 A;  4PDX A;  4CGV A;  1ELK A;  4R7L A;  5G04 C;  4KVO A;  2XQ0 A;  2I2O A;  3CVW A;  3CV0 A;  2YHE A;  3L17 A;  3FTS A;  4AV7 A;  3HHM A;  4FU3 A;  1OWM A;  3CHR A;  3QWV A;  3SBT B;  5EX0 A;  2A4Z A;  2YNQ A;  2ION A;  3SBS A;  1HG2 A;  3AS4 A;  2XPY A;  1KT0 A;  3I5P A;  2X3M A;  3UQ3 A;  3EHM A;  5FZQ A;  1MHQ A;  3MV2 B;  1Z3X A;  3ZXS A;  3PNT B;  2WXG A;  2I1J A;  4BT8 A;  3HVE B;  3FHE A;  4UWL A;  4G1T A;  3UT4 A;  2MRI A;  4JPS A;  4PS3 A;  4TUU A;  4I1M A;  2X38 A;  1ZBP A;  5JJT A;  4UI9 J;  2J09 A;  3OXF A;  3TJP A;  1XNF A;  3PUK A;  1JWG A;  2L0I A;  2Y4U A;  1H0A A;  3FU5 A;  3FTY A;  4U8H A;  4UWF A;  5ENN A;  5AEN A;  2IFU A;  3LY9 A;  4OVU A;  2BUG A;  3B13 A;  3U3W A;  5ARF A;  2CHZ A;  4WND A;  3ZPJ A;  2XRY A;  3FH5 A;  4ANX A;  1ZU2 A;  5J08 A;  1ELW A;  1WAO 1;  1HH8 A;  3JUI A;  4IRU A;  3U64 A;  2UY1 A;  4I43 A;  3JQ0 A;  4WWP A;  4AVX A;  5KJK A;  3CVY A;  4C0M A;  5G04 J;  2WXF A;  3IKO B;  2VJ8 A;  4WNF A;  2GW1 A;  3G2V A;  3CQC B;  4I1O B;  4RG6 A;  3EDT B;  3FH8 A;  4YVQ C;  2J07 A;  2OND A;  4JL0 A;  2LAI A;  4RG9 A;  4D10 C;  4U07 A;  4DLQ A;  5EDS A;  4URK A;  3ASF A;  3ZVV A;  1KT1 A;  5BW8 C;  4GA0 A;  3LPZ A;  3S2A A;  4ANV A;  3ESL A;  4JHJ A;  2KZT A;  1E8W A;  3CVP A;  5FT9 A;  5C1D A;  5AJD A;  4C0E A;  3MV3 B;  1U3C A;  3OTN A;  5CMW A;  2FEZ A;  4FJY A;  3MJW A;  4Q69 A;  4MLP A;  1INZ A;  4NRH B;  4N2Q A;  3QAQ A;  2DBA A;  3FWV A;  5E75 A;  3ONK A;  4L23 A;  4GZC A;  2VQ2 A;  3PRZ A;  3QJZ A;  3QDN A;  5BNW A;  3CVL A;  4OYS A;  4EEC A;  4BSX A;  3RRN B;  1OWN A;  2CHX A;  4B8A A;  4ILI A;  4KMO A;  1SZA A;  3D9J A;  5AJL A;  2NXP A;  2RD0 A;  3B7S A;  2X6I A;  4G2V A;  4MRU A;  4WNE A;  3RIB A;  3URZ A;  2KCK A;  3CVQ A;  4YVO A;  2NSZ A;  1X5B A;  2P58 C;  4GYO A;  4ANU A;  3DPD A;  1Y6I A;  2PQR A;  5J90 A;  2KCV A;  2BTD A;  4KZ0 A;  2V0P A;  4BTA A;  3FH7 A;  3Q5M A;  2WQ6 A;  4FHJ A;  4I9C A;  5LCW C;  1VDY A;  2GRM A;  3BG1 B;  1PC2 A;  4HLE A;  3L13 A;  2I9C A;  3EIQ C;  2C2L A;  5G55 A;  4AY6 A;  3L08 A;  5LX8 A;  2WXJ A;  3UT7 A;  4DPR A;  3S7J A;  4APF A;  1ELR A;  4EZL A;  1DVP A;  3FUF A;  3GYZ A;  4PS7 A;  3ZYK A;  1QZ2 A;  3Q15 A;  3T5V A;  4L7T A;  3SF4 A;  4V3I A;  3PRE A;  3D9M A;  3FEX A;  2J4D A;  2PM6 A;  3CKB A;  1IYG A;  4OVV A;  4GYY A;  2L0T B;  2WXL A;  4W9R A;  3MEK A;  2OV8 A;  3ZYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...