4NRHB

Copn-scc3 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
170
structure length
170
Chain Sequence
b'MSHLNYLLEKIAASSKEDFPFPDDLESYLEGYVPDKNIALDTYQKIFKISSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CopN
publication title A gatekeeper chaperone complex directs translocator secretion during type three secretion.
pubmed doi rcsb
source organism Chlamydia pneumoniae
molecule tags Chaperone/protein binding
total genus 60
structure length 170
sequence length 170
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4nrhB00
4I2WA 3ASFA 1Y8MA 3QKYA 2HO1A 4GA0A 1QZ2A 3RJVA 1WAO1 3UQ3A 2VGYA 2XEVA 3CKBA 1TJCA 1QQEA 2KCKA 2ONDA 4BT8A 2C0MA 4XIFA 2OOEA 3MV3B 3ZHEB 2XCBA 3CVQA 2NC9A 1HH8A 4G2VA 2IFUA 3AS8A 1ZBPA 3HYMB 2BUGA 2WPVA 3KAEA 4GYYA 4I2ZA 5DIZA 2VSYA 4GA1A 3Q15A 3MA5A 2V5FA 2VQ2A 2KCLA 1IHGA 2FO7A 2QFCA 3CVNA 3OXFA 4BTAA 4I9EA 5BNWA 3QOUA 2IF4A 3LCAA 4KYOB 2PQRA 3ZPJA 1HXIA 5FT9A 4WNDA 4ABNA 4G23A 3CKCA 5EX3A 2GW1A 5CCLA 3LY9A 5KJNA 4N3CA 2E2EA 4KXKB 5A6CA 4YNDA 3PE4A 3ASGA 4WNGA 4J8DA 2Y4TA 5FJYA 5G05C 1IYGA 4AY6A 3ULQA 3LY8A 4I9CA 3SZ7A 4NRHB 3CVPA 4CGWA 4RG9A 4W9RA 3N71A 2FEZA 1YA0A 4H7XA 3BEEA 3FFLA 3LYAA 3OXGA 1ELWA 5ARGA 5EX0A 3EDTB 4N5CA 4UQXA 4UQYA 5D0QD 5M72A 5D0OD 2MHKA 3Q4AB 5BW8C 1OUVA 5KJLA 1NA0A 4GZ5A 4JHRA 1ZU2A 2HR2A 3TAXA 5FZQA 4GCNA 4GCOA 4LEUA 3K9IA 2FF4A 4UI9C 3UPVA 4GZ6A 4GZ3A 3S7JA 2XGSA 5EKQD 3GW4A 5DBKA 4J8EA 1HZ4A 2JLBA 4GYWA 4U0UA 4N2QA 2VGXB 4WNEA 2Y4UA 5G04J 2LSVA 5FZSA 3FP3A 1A17A 3Q49B 4UQZA 3R9AB 3VTXA 3CVLA 4GYOA 3FWVA 3CK9A 3QWPA 4NQ0A 2FI7A 1FCHA 4N3BA 2J9QA 4Y6WA 3LKUA 3RO2A 2I6HA 2C2LA 5FTPA 1KT0A 2XCCA 3ZGQA 4JA7A 5G04C 3Q5MA 3ZHEA 4IN3B 4O6FA 4A1SA 3WXXA 3TG5A 3KD7A 3QWWA 5AYWD 3SF4A 1E96B 3KS2A 5LCWJ 1KT1A 4B94A 5FZRA 3QDNA 4RG6A 3S7BA 5JJ7A 5JJTA 2UWJG 4U07A 4JA9A 4H7YA 4U0SA 4CDRA 3RIBA 5JJ6A 2LSUA 5A7DB 5C1DA 3GZ2A 4KBQA 4WUYA 3CK8A 2XGOA 4I1AA 4G26A 1P5QA 2PL2A 2KCVA 5HQ8A 3S7FA 3IEGA 2P58C 2UY1A 4HOQA 4N3AA 3TG4A 2VSNA 2Q7FA 2DBAA 2LNIA 4GA2A 3UUXA 4U04A 3TGOA 3ASHA 2FBNA 5BT1A 4BTBA 4EQFA 2YHCA 3JYSA 4GPKA 3CK7A 4G24A 4YVQC 2WQHA 3GYZA 2PQNA 4Y6CA 3CEQA 3MV2B 4WNFA 1B89A 3OXLA 4N2SA 4HOUA 2C0LA 3MKRA 4APOA 3U4TA 1W3BA 3O48A 3URZA 3RKVA 5CCMA 2R5SA 2KATA 4CGVA 3MEKA 4UI9K 2HYZA 4XI9A 4AIFA 5KJMA 2XPIA 2KC7A 4YVOA 1WM5A 4G1TA 4XI0A 3ESKA 2L6JA 2VYIA 3QWVA 4N39A 5G05J 4HOSA 4JL0A 1ELRA 4BT9A 1NA3A 3RO3A 2VGXA 3PDNA 1XNFA 5ARFA 2UY1B 4J0UA 4AY5A 3CV0A 4I17A 5KJKA 5CHEE 3VTYA 3GZ1A 4ME2A 3Q47B 4HOTA 4BWRA 3RU0A 3LY7A 5LCWC 3E4BA 5HI7A 4HORA 2AVPA 3AS5A 4F3VA 3ASDA 3U3WA 3AS4A 1NZNA 3S7DA 3NF1A 2XGMA 4G25A 2YQ8A 3ZFWA 4J8FA 3LPZA 4AM9A 2PZIA 3ZN3A 4UI9J 1PC2A 1KLXA 3PE3A 4U0ZA
chains in the Genus database with same CATH superfamily
1HS6A 1Q2ZA 1PAQA 1Y8MA 3RJVA 2GRPB 3DWLG 3CQGB 3AAAC 5CEAA 2XQ0A 3FDHA 3EUVA 4XIFA 2I1KA 2OOEA 4CT0A 4LNGA 2YHEA 3RRUA 4HLEA 5H7PA 3DSXA 4DX7D 1PY1A 4MRUA 2J4DA 4YDOA 3SQVA 4G2VA 2DVWA 3LS8A 3HYMB 3T5VA 2BUGA 1UN9A 3D9NA 4GYYA 4PS3A 5DIZA 3D9KA 4ANVA 2X38A 4Q94A 4G11A 2V5FA 2KCLA 1N11A 5ENQD 3RAUA 2FO7A 4BFRA 3ZNGA 4I9EA 3B7RL 5T3RA 3D3MA 4KYOB 4B8CB 3L08A 1HXIA 4ABNA 3FH7A 2CG2A 1K1BA 4X8QA 1H2VC 2NSZA 4WWOA 4TXPA 2BF0X 2E2EA 3B7SA 4KXKB 4YNDA 5FQ7A 3ASGA 3D9OA 3UKRG 3R7QA 1OWNA 4DPRA 4J8DA 4EZKA 3FUMA 4C0MA 2L9BA 3D9PA 3EU9A 4I9CA 4GTRA 2GROB 2DCPA 1EDUA 4AP2A 4OVUA 3CVPA 3HXEA 1NL4A 1TNBA 5JHAA 3DSWA 4RG9A 3SFZA 4B93B 3FH5A 3QK0A 3QB2A 3FFLA 1DNPA 3LYAA 5ITZF 3DSSA 3EDTB 2R2LA 4B0ZA 3MGBA 1KZPA 1IHBA 3FTXA 1Y6IA 3FU5A 4HB5A 3ZVVA 5D0QD 1QYMA 2I1JA 4CRWA 2ILRA 4UWLA 4I6JA 2HR2A 3LVQE 4GCNA 5AQ7A 3TWRA 3UPVA 4GZ6A 2XZDG 4GZ3A 3KEAA 1LD7A 4RVBA 4J8EA 3UI2A 3JXJA 3DXMG 3P1UA 4DLQA 1KPSB 3LEWA 2R59A 3UINC 2LSVA 2J09A 3RRMB 3FP3A 1A17A 1SZAA 3R9AB 4PS8A 4GTOA 4GYOA 4A63B 3QC1A 3TL5A 5J08A 3QWPA 3MYVA 1LTXA 1TYQG 4GMRA 2KBXA 3SFYA 3UT7A 4XKCA 4TUMA 3OAWA 4ACLA 3TJPA 3Q5MA 2AJAA 3ZHEA 3HHMA 4IN3B 3WXXA 4A1SA 3KD7A 4L23A 1FT1A 2VTBB 4UWGA 1EPUA 3KS2A 1HU3A 1KT1A 1TN6A 5FZRA 2CHWA 2J8SD 3NZUA 1DCQA 4LG6A 3FTZA 4XKBA 1N0QA 2UWJG 4U07A 4HRNA 4WWNA 3ZYMA 4YDEA 4FJZA 3CVYA 4DI4A 2M63A 4JB8P 4CDRA 2BKGA 2RD0A 2LSUA 5B1BE 2OCCE 1OWPA 5A7DB 4U7EB 2IOSA 3GZ2A 4KBQA 3ABLE 5CECB 1WG0A 4PDXA 5AQAA 3C3OA 2P9NG 4G26A 2KCVA 2V4HC 3S7FA 1XGWA 2P58C 4K5AB 3ULYA 3QNKA 4N3AA 4LUNU 2H6GA 4KMOA 4A3TA 4U04A 4LERA 4TRQA 4AOFA 3HVEB 2WXIA 2GRQB 1OCZE 1TNOA 3EHNA 1S63A 2WM9A 3O4ZA 3ASOE 3KEZA 3U9WA 4GPKA 2BTDA 3PZ2A 2WXPA 3HXCA 3CHRA 2F0YA 4JXTA 3E30A 3MX3A 1B89A 3RRNB 2CG3A 3ZW3A 4N2SA 3G2UA 3ASNE 3MKRA 4FLHA 3PVLA 3U4TA 3G2SA 2WXMA 4GTPA 5CCMA 3U66A 2WXGA 3UKUG 2KATA 3JUEA 3NZSA 3EJNA 2X3MA 2HYZA 4M3OA 3FTVA 1SA5A 2F37A 1O1RA 1ZB1A 3PUJA 4J8SA 3E37A 2WQ6A 4U96D 3AG1E 3Q79A 2RFAA 3Q9UC 2J4BA 3HXDA 3E33A 1SZ9A 4JL0A 2AXZA 3SHFA 3HXFA 1E8WA 3FUHA 2IO3C 1L5JA 2VGXA 5FWQA 5CERB 3JXIA 4AY5A 1OWLA 2JABA 5CHEE 5CBOA 4RSYA 4HOTA 1SVXA 3RU0A 5C2YA 2WQ7A 3FTSA 1EF1C 2GRLA 3T8KA 3AS4A 4F6RD 3S7DA 4IYPA 3PZ3A 5AQ9A 3PREA 3FU6A 3LPZA 2WMOA 4AM9A 3ZN3A 1N54A 1AWCB 4HI9A 1Z6TA 2P9UG 3ONLA 4HLLA 2L0TB 3QKYA 4I6EA 1D8DA 3L22A 1WAO1 2XEVA 3VLFA 1H6OA 3T8MA 2ONDA 1QNFA 2A5EA 2P2CP 4F1SA 4AVXA 4U8YD 3ZHEB 3V31A 3CVQA 2DYSE 3CVXA 1BU9A 1HH8A 4I1OB 3AS8A 5AAOA 4JVSA 1TJFA 1HG2A 3MZLB 3L6AA 3IKOB 3W9GA 2VQ2A 1D9SA 5BV1A 1IQUA 3U64A 4FU3A 4IRUA 3QOUA 2QC9A 4TXRA 5LX8A 5FT9A 1A5EA 4LNBA 2GW1A 4U95D 5KWDA 1RW2A 3FEXA 1Z5SC 4N3CA 4FADA 3ULEG 1OT8A 3FULA 3CHMA 3Q7AA 2J07A 3JCKC 3DEPA 1DC2A 4GU5A 2Y4TA 5BPPA 1IYGA 4AY6A 4RLYA 2IJGX 4HS2A 5JA4D 4O1OA 4A3VA 3D9MA 4BSXA 3VLEA 2KXPC 3PEVB 3F6QA 3N71A 1YA0A 2ZGDA 1TN7A 5ARGA 2WVIA 3PNTB 3R7RA 2LAHA 5JHBA 2QZAA 5IY5E 3CHPA 3Q73A 4Q96A 2GRNB 5M72A 2IU1A 3IHYA 3TXNA 2MHKA 3Q4AB 2FO1E 5BW8C 2IO2C 4TUUA 1K3ZD 5KJLA 2QYUA 4J7WA 3FTUA 1S0PA 5FZQA 5JMND 3PZ4A 4GCOA 2ETCA 4URKA 1INZA 1BI7B 5LFAA 3J5QB 5G55A 1HF8A 5DBKA 5A23A 4GYWA 2RFMA 4EBAA 4GB9A 2VGXB 2R05A 1S64A 5G04J 4CCAA 5ANLA 1Z3YA 1MX4A 4UQZA 3CHOA 3I5PA 3AJIA 4B89A 5ENOD 3HVEA 4BY6A 2XPZA 3FUIA 3FU3A 4ILHB 2J9QA 3LKUA 2I6HA 1N95A 3FTYA 1KT0A 2DWZA 2OV8A 3G2WA 4XZ4A 3TG5A 5ANRA 3LXUX 1DCEA 2J08A 1U3CA 3ZRHA 4UUCA 4GTTA 4ZHBA 4GTMA 3QDNA 2R03A 2A4ZA 2V8SE 3S7BA 4GAAA 5JJTA 3L13A 1TNYA 3W9FA 2JEKA 4JA9A 1UG3A 1E8XA 4HVBA 3HG0D 4JEUA 4U0SA 1TEZA 2P9SG 3RIBA 2H6FA 1EYHA 4DX5D 1HG5A 5BV0A 4LRZA 3D9HA 4OVVA 4Q69A 4DRXE 3Q7FA 5EILA 3HIZA 1H6KA 5CEDB 1UOHA 3Q78A 4HOQA 5EYLA 2VSNA 5FIOA 4BERA 2Q7FA 2DBAA 5BXOA 3TWVA 3APDA 2IY0C 2WXHA 2FBNA 2VJ8A 3LJ3A 1YCSB 4EQFA 3IBEA 3EHMA 2OVFA 5EN5D 3JYSA 5LOZA 3CK7A 3MKQA 1DVPA 4G8KA 2PQNA 3CEQA 1UJKA 3CIAA 1IQRA 4LSZE 4C0EA 3EHRA 3JUIA 2H6IA 3MV2B 1JCRA 2EINE 3OXLA 2PNNA 4XE0A 1E8ZA 4JHJA 2DZOA 3B13A 3ZYQA 1U2VG 3RKVA 3ZUVB 1Z3XA 3G2VA 1N9AA 4AIFA 5KJMA 1OCRE 4YVOA 2E0IA 1WM5A 3CGHA 1YYHA 4G1TA 3DBSA 3ISMC 4L7TA 4FP7A 4HRLA 5HS0A 2XEEA 3ESKA 3EU5A 4EHMA 4N39A 2AW6A 4ATZD 1ELRA 5FINA 1E7VA 1U3DA 3RO3A 4DX6D 1YMPA 3Q75A 2V5QC 4K5CA 5B3SE 3VTYA 3GZ1A 4ME2A 4O60A 3UM0A 3Q47B 2DIWA 2MOWA 1QBQA 4L2LA 4BWRA 3APFA 4F7AA 5LCWC 2EIME 5FQ4A 3E4BA 5HI7A 2L6BA 4J8YA 4P29A 1SA4A 4HORA 2AVPA 3PUKA 2Y3AA 3ASDA 4DJAA 2ZGGA 4KVMA 4G25A 1NFIE 2A5UA 1JCQA 3ML8A 5E76A 1PC2A 2YNQA 1KLXA 4CT4A 3TWWA 3WG7E 4MBGA 4I2WA 2X6FA 4L2YA 2Y69E 1TJCA 2WB2A 2YINA 4BT8A 4BETA 1N4RA 2WXQA 3QARA 4AEZC 2NC9A 1NI1A 1TN8A 4JD2G 1D8EA 1N4QA 4C48B 1H2TC 3G2TA 1VDYA 2KZTA 1UJJA 3UT4A 3CVUA 4GA1A 3Q15A 1TNZA 3PS6A 3MA5A 2ETBA 5AIJA 1N52A 1IHGA 3ABKE 1JCSA 5B1AE 1OCOE 3CVNA 3ABME 4BTAA 5BNWA 2IF4A 1OCCE 4WWPA 3TWQA 4CDMA 4HQDA 4G23A 3HXBA 5EX3A 3TWUA 5KNGA 2WXNA 5KJNA 3BG1B 2B6CA 2LO6A 3L16A 3PE4A 3OTNA 3D9IA 4A55A 3VLDA 5FJYA 3NBNB 5G05C 1UW4B 3IHVA 3GZSA 3MKQB 2PM6A 4I43A 2XRYA 4ILGA 4FLBA 4CGWA 1S70B 4W9RA 4OAUC 4H7XA 5EIDA 1HFAA 3OXGA 1ELWA 2XHEA 4R7LA 5AJLA 4DX1A 2VSXE 5EX0A 3CHSA 4FHKA 4UQXA 4BEPA 3TWTA 4UQYA 3SGHA 5D0OD 1LF8A 3PNLB 2I2OA 3CVWA 1OUVA 1MYOA 5BUZA 2L0IA 1N4SA 1NA0A 4GZ5A 4E6HA 4JHRA 5CMWA 1ZU2A 1V55E 2GGFA 3TAXA 3DRAA 3K9IA 4M7CA 2LXLA 1RZ4A 1H6PA 1NP7A 3B7BA 3S7JA 1H19A 2XGSA 4KVOA 5T8IA 4K0RA 1HZ4A 4BESA 5EYPF 3SBSA 4CZ2D 4N2QA 1IXVA 4JHKA 3SNXA 5FZSA 4GTSA 5LP0A 3BUAA 3BG0B 3NB2A 3FWVA 2I9CA 3UX4A 4V3IA 2XRZA 2EQXA 2V4LA 4LCTA 1N4PA 4NQ0A 2F8YA 3B7UX 1OY3D 1FCHA 3JQ0A 2VGEA 2IQCA 4A1GA 3TXMA 4IULA 2IEJA 4ATGA 5FTPA 2XCCA 3APCA 3ZGQA 4DLOA 1FPPA 2CHZA 1E90A 4O6FA 4YDYA 3QWWA 5AYWD 4MS6A 4CDNA 4KT6B 5LCWJ 3HRAA 5CRUA 5FQ8A 4B94A 2GRMA 2WMNA 3L9TA 3ZU7B 3PZDA 5JJ7A 3UT8A 3QJZA 3B7TA 4XX5A 3FUJA 1O1TA 2P9KG 3KSLA 4ANUA 3AG4E 4ACKA 3AU5A 3DSTA 2BKKB 5JJ6A 3FUDA 4TV3A 5C1DA 3ONKA 2OEVA 4WUYA 2J49A 5AARA 2XGOA 4I1AA 2XZTG 5T4YA 2PL2A 1OXJA 3C3RA 5HQ8A 4PUCA 5HKPA 3IEGA 2KZTB 1MX2A 4I6GA 3MCXA 4ZFHA 1TR4A 1MHQA 3UTMA 2ZU6B 2CHXA 2LNIA 3UUXA 5ENSD 4MKTA 3TGOA 2OEWA 5BT1A 4BTBA 2YHCA 4G24A 4YVQC 3GYZA 1UN8A 4TXQA 2GRRB 2DZNA 3IXEA 3RSEG 4WNFA 4KZCA 2C0LA 5G2NA 4FA6A 2WXKA 1W3BA 3UM3A 4CGVA 1KZOA 1O1SA 3NAWA 2CFZA 3FUEA 4UI9K 4XI9A 4BX9A 3AG2E 4G8LA 4EPZA 3LDZA 3PH0C 4UWHA 1HO8A 2P9PG 1G3NB 2AWIA 3UMVA 2ZIRA 5G05J 3ZYLA 4HOSA 3R9MA 3NOGD 3EIQC 1NA3A 3DXKG 3T5XA 4FJYA 2LXMA 5ARFA 2UY1B 4J0UA 4O1PA 5KJKA 2WXFA 3TWSA 3B95A 2LAIA 4FULA 5ENTD 4Z68A 1AP7A 4HRMB 3V30A 3SD5A 3AS5A 4UWFA 2CFUA 3UIPC 4HBDA 3BU8A 4F3VA 3L17A 2X6JA 2X6IA 3U3WA 1NZNA 2Y0BG 1K8KG 3DEOA 3S2AA 2YQ8A 3SFXA 3C98A 4EZJA 2PZIA 4BSZB 2R02A 3PE3A 4U0ZA 3SBTB 2ZISA 3ASFA 2HO1A 4GA0A 5AENA 4GZDA 1QZ2A 4MLPA 3UQ3A 2VGYA 3CKBA 4D10C 1V54E 3FEYA 2XS1A 3IV0A 1BPOA 1QQEA 2KCKA 2RG8A 2C0MA 3FU0A 4APFA 1OWOA 2KM4A 3MV3B 2XCBA 2PM7A 4CYMD 3DSVA 4GTVA 3AU4A 5CRVA 1TNUA 4NACA 4OYSA 4GTQA 4JW1A 2B0OE 2IFUA 4K03A 1ZBPA 1MQSA 2IONA 2AXUA 2WPVA 3KAEA 3I4GA 1MJ0A 4AV7A 4I2ZA 2XPYA 2VSYA 3UM2A 2AXVA 3CSFA 3ZEFA 3ZXPA 4PS7A 3QAQA 5FQ6A 3T9KA 3ML9A 2XENA 2Y1LE 4PH4B 2QFCA 4JC8A 1SQMA 2FULA 3OXFA 4JPSA 3LCAA 3BQOA 3CVVA 2PQRA 1N0RA 3ZPJA 1SW6A 4WNDA 3SO8A 3UM1A 3PEUB 3L54A 2F8XK 3CKCA 3V79K 4AJWA 5CCLA 3LY9A 4GPMA 2QYJA 3D9LA 3EHQA 5A6CA 4HFGA 4K5BA 5AQBA 5E75A 4WNGA 3ZYKA 3DSUA 3MJWA 5CBNA 1FT2A 3CR3A 3C3QA 3ULQA 3LY8A 4GMJA 3ZIMA 3SZ7A 4UWKA 4NRHB 4C9BB 4AXHA 4J6IA 3PRZA 1E8YA 2ZXWE 2FEZA 2QY7A 5CMYA 1HX8A 1BI8B 3NQPA 3BEEA 3NOCD 3CLJA 5AJDA 3UIOC 4ILIA 4N5CA 2HE0A 2WXOA 1K1AA 4DI3A 4EBAG 2MYOA 4QFVA 4DUIA 1BD8A 3SI5A 5EIBE 4YDWA 3E32A 1MX6A 4NURA 1JPLA 3C72A 1E7UA 5EDSA 1JWGA 4LEUA 4EECA 1JWFA 2FF4A 2WXJA 4UI9C 5BXUA 4L9PA 4DK5A 2ETAA 3Q9NC 5EKQD 3GW4A 1IKND 3UXGA 2JLBA 2WXRA 4U0UA 4WNEA 2P9IG 2Y4UA 2P9LG 5HRYA 2IOLA 3Q49B 3VTXA 3CVLA 3P2BA 3CK9A 4F1PA 4HI8A 4N5QA 2FI7A 5D66A 2XEHA 4N3BA 4Y6WA 3KSQA 3RO2A 3I4RB 4JEHA 2OVBA 2C2LA 2H6HA 3PZ1A 4JA7A 2HM8A 5G04C 5J90A 3FTWA 3V2OA 2MRIA 2X6HA 4JZYA 3ZXSA 4HNAD 3I3NA 3SF4A 1E96B 4NIKA 1N94A 4DX2A 4RG6A 3FHEA 1FVFA 1X5BA 3ENEA 3C5RA 3CSTA 2V0PA 4FHJA 4H7YA 4F53A 4EZLA 3FY4A 3CQCB 4CEMA 1MZCA 4QQIA 3CK8A 1JUQA 3EIJA 1P5QA 3ESLA 5ENPD 2UY1A 3E34A 3TG4A 3RK6A 2R17C 2XS8A 2LUHA 4LNUD 4GA2A 4GZCA 3ASHA 5D2MC 5AN8A 4HXIA 2DYRE 2WQHA 1WDYA 4Y6CA 3FUFA 3X2QE 1GW6A 2X6KA 2BEDA 3J5PA 1O5MA 4U8HA 4E85A 3CHQA 1HE8A 1WY6A 4OAVB 4HOUA 5KCMA 2EIJE 4APOA 3V2XA 3FUKA 2RKKA 3HDXA 3O48A 3URZA 3ZKJA 2NXPA 1ELKA 2R5SA 3AG3E 1X81A 3MEKA 2VSOE 4L1BA 4BX8A 2XPIA 2EIKE 3SY2A 2KC7A 1BLXB 3DPDA 4GMLA 5ENRD 4B8AA 4U63A 2NYJA 4XI0A 2EILE 2WXLA 1FVHA 4RQIA 2L6JA 2VYIA 3QWVA 3FH8A 4BT9A 1H0AA 4KZ0A 3PDNA 1XNFA 4XEIG 3CV0A 4I17A 3DPYA 4FC8A 4I1MA 3TWXA 4ANXA 3FUNA 4ANWA 4U8VD 5ENNA 3LY7A 3LJNA 5KBAA 4WAFA 3NF1A 2XGMA 3JQ1A 1LD8A 1OWMA 1H2UA 3ZFWA 3L82A 4J8FA 2VTBA 4UI9J 5KNHD 3LVRE 3D9JA
chains in the Genus database with same CATH topology
1HS6A 2L0TB 1PAQA 4I2WA 3SBTB 3ASFA 1Y8MA 2X6FA 3QKYA 2HO1A 4GA0A 4I6EA 5AENA 4GZDA 1QZ2A 3L22A 4MLPA 1WAO1 3RJVA 2VGYA 2XEVA 3CKBA 4L2YA 3UQ3A 4D10C 3VLFA 3FEYA 1TJCA 1BPOA 3IV0A 3T8MA 1QQEA 2KCKA 2ONDA 3CQGB 2RG8A 2WB2A 2YINA 4BT8A 2XQ0A 3FDHA 1QNFA 2C0MA 3FU0A 4APFA 4XIFA 2I1KA 2OOEA 4F1SA 1OWOA 2KM4A 3MV3B 4CT0A 4AVXA 3ZHEB 2WXQA 3QARA 2XCBA 3CVQA 2PM7A 4AEZC 2YHEA 3RRUA 4HLEA 1PY1A 2NC9A 3CVXA 3AU4A 4MRUA 1HH8A 4I1OB 2J4DA 4NACA 4OYSA 4JW1A 4G2VA 2IFUA 3AS8A 4K03A 3LS8A 4JVSA 1TJFA 1ZBPA 1MQSA 3HYMB 3T5VA 2IONA 2AXUA 2BUGA 2WPVA 1H2TC 3G2TA 3KAEA 1HG2A 1VDYA 1UN9A 2KZTA 3D9NA 1UJJA 3I4GA 4GYYA 4PS3A 3UT4A 3MZLB 4AV7A 4I2ZA 2XPYA 5DIZA 2VSYA 3L6AA 2AXVA 3CSFA 3ZEFA 4GA1A 3Q15A 3CVUA 3D9KA 3PS6A 4ANVA 2X38A 3IKOB 3MA5A 4Q94A 4G11A 2V5FA 4PS7A 5AIJA 3QAQA 5FQ6A 1N52A 2KCLA 2VQ2A 3ML9A 5BV1A 1IHGA 2FO7A 4BFRA 4PH4B 2QFCA 4JC8A 1IQUA 3U64A 3CVNA 1SQMA 2FULA 3OXFA 4FU3A 4I9EA 4IRUA 4BTAA 3B7RL 5BNWA 3QOUA 4JPSA 2IF4A 5T3RA 3D3MA 3LCAA 4KYOB 4WWPA 2PQRA 4B8CB 3CVVA 3L08A 3ZPJA 1HXIA 4CDMA 5LX8A 5FT9A 4WNDA 4ABNA 3PEUB 3FH7A 2CG2A 3L54A 4G23A 3CKCA 1H2VC 5EX3A 2GW1A 4AJWA 2NSZA 5CCLA 3FEXA 2WXNA 3LY9A 4WWOA 3D9LA 5KJNA 3BG1B 4N3CA 4FADA 2BF0X 2E2EA 3B7SA 4KXKB 5A6CA 3FULA 4YNDA 5FQ7A 2LO6A 3L16A 4HFGA 3CHMA 5E75A 3PE4A 3ASGA 4WNGA 3ZYKA 3D9OA 2J07A 3OTNA 3D9IA 3R7QA 4A55A 3JCKC 3VLDA 1OWNA 4DPRA 3MJWA 4GU5A 2Y4TA 4J8DA 5FJYA 4EZKA 3FUMA 4C0MA 5BPPA 5G05C 3CR3A 1IYGA 4AY6A 2L9BA 3D9PA 3ULQA 3LY8A 4I9CA 2DCPA 1EDUA 1UW4B 3IHVA 3GZSA 3MKQB 2PM6A 4GMJA 4I43A 2XRYA 4AP2A 4ILGA 3ZIMA 4OVUA 2IJGX 3SZ7A 4HS2A 4UWKA 4FLBA 4NRHB 3D9MA 4A3VA 4C9BB 3CVPA 4CGWA 4AXHA 4J6IA 4BSXA 5JHAA 3PRZA 1E8YA 3VLEA 4RG9A 3SFZA 3PEVB 4W9RA 3N71A 2FEZA 1YA0A 2QY7A 5CMYA 3FH5A 1HX8A 3NQPA 3QB2A 3QK0A 3BEEA 4H7XA 1HFAA 3CLJA 1DNPA 3FFLA 3LYAA 3OXGA 1ELWA 2XHEA 5ARGA 4R7LA 2WVIA 3PNTB 5AJDA 5AJLA 2VSXE 4ILIA 5EX0A 3EDTB 4N5CA 3CHSA 2LAHA 3R7RA 5JHBA 4FHKA 4UQXA 4B0ZA 3MGBA 3CHPA 2WXOA 4Q96A 4DI3A 3FTXA 1Y6IA 3FU5A 4UQYA 3ZVVA 5D0QD 4EBAG 4QFVA 3SGHA 5M72A 5D0OD 3SI5A 1LF8A 2IU1A 3PNLB 2I1JA 3IHYA 3TXNA 2MHKA 2I2OA 3Q4AB 3CVWA 4NURA 1OUVA 5BW8C 4CRWA 4TUUA 5KJLA 2ILRA 4UWLA 5BUZA 2L0IA 3FTUA 1NA0A 4GZ5A 1JPLA 4JHRA 4E6HA 5CMWA 4I6JA 1S0PA 1ZU2A 2HR2A 5BT1A 2GGFA 3TAXA 1E7UA 5FZQA 3LVQE 5EDSA 4GCNA 1JWGA 4GCOA 4LEUA 4EECA 1JWFA 3K9IA 4URKA 2FF4A 2WXJA 1INZA 4UI9C 5LFAA 3UPVA 4GZ6A 4DK5A 1NP7A 4GZ3A 5G55A 3S7JA 1H19A 1HF8A 2XGSA 4KVOA 3GW4A 5DBKA 4RVBA 5EKQD 5T8IA 4J8EA 1HZ4A 4K0RA 2JLBA 5A23A 4GYWA 3SBSA 3P1UA 4DLQA 2WXRA 4EBAA 4U0UA 4GB9A 4N2QA 2VGXB 4WNEA 2Y4UA 3LEWA 2R59A 4JHKA 5G04J 4CCAA 2LSVA 2J09A 3RRMB 3SNXA 5FZSA 3FP3A 1A17A 1SZAA 5LP0A 5ANLA 2IOLA 1Z3YA 3Q49B 4UQZA 3R9AB 4PS8A 3VTXA 3BG0B 3CVLA 3CHOA 3I5PA 4GYOA 3P2BA 3QC1A 3TL5A 3FWVA 2I9CA 4B89A 5J08A 3CK9A 3UX4A 4V3IA 3QWPA 2XRZA 3MYVA 2EQXA 3HVEA 4BY6A 2V4LA 2XPZA 2FI7A 4LCTA 4NQ0A 3B7UX 3FUIA 1FCHA 3JQ0A 2IQCA 3FU3A 4N3BA 4ILHB 2J9QA 4Y6WA 3TXMA 4A1GA 4IULA 3LKUA 3UT7A 3RO2A 4XKCA 3I4RB 2I6HA 4JEHA 2OVBA 2C2LA 5FTPA 3FTYA 4ATGA 1KT0A 2XCCA 3APCA 3ZGQA 4DLOA 3OAWA 4JA7A 4ACLA 2HM8A 5G04C 3TJPA 5J90A 3FTWA 3Q5MA 2MRIA 2CHZA 3ZHEA 1E90A 2OV8A 3HHMA 4IN3B 4O6FA 3G2WA 2X6HA 3WXXA 4A1SA 4XZ4A 3TG5A 3KD7A 3QWWA 4JZYA 4L23A 5AYWD 3ZXSA 5ANRA 3LXUX 2VTBB 2J08A 1U3CA 3I3NA 1E96B 4MS6A 4UWGA 1EPUA 3KS2A 4KT6B 3SF4A 4CDNA 5LCWJ 3ZRHA 1HU3A 1KT1A 5FQ8A 5FZRA 4B94A 2CHWA 3QDNA 2A4ZA 2GRMA 2WMNA 3NZUA 4RG6A 2V8SE 3S7BA 3FTZA 4GAAA 3PZDA 3FHEA 5JJ7A 5JJTA 1FVFA 1X5BA 3UT8A 3QJZA 3ENEA 3B7TA 4XKBA 3L13A 3FUJA 4XX5A 4ANUA 2UWJG 4U07A 4WWNA 2JEKA 3CSTA 2V0PA 4FHJA 4JA9A 4H7YA 1UG3A 3ZYMA 4ACKA 4F53A 1E8XA 4FJZA 4HVBA 3CVYA 4JEUA 4EZLA 3AU5A 4U0SA 4DI4A 2M63A 1TEZA 4CDRA 3RIBA 3FY4A 3CQCB 5JJ6A 2RD0A 2LSUA 1EYHA 3FUDA 4TV3A 1OWPA 5A7DB 1HG5A 5C1DA 3ONKA 4CEMA 5BV0A 2IOSA 4LRZA 3GZ2A 4KBQA 2J49A 4OVVA 4WUYA 4PDXA 3CK8A 2XGOA 4I1AA 1JUQA 3EIJA 4G26A 5T4YA 1P5QA 4Q69A 2PL2A 2KCVA 5HQ8A 3ESLA 4PUCA 3HIZA 3S7FA 1XGWA 3IEGA 2P58C 1H6KA 2UY1A 2KZTB 4I6GA 3QNKA 4HOQA 3MCXA 4N3AA 3TG4A 1MHQA 4LUNU 2VSNA 3RK6A 2ZU6B 2R17C 2Q7FA 2DBAA 3APDA 2CHXA 4KMOA 2LNIA 4GA2A 3UUXA 4A3TA 4U04A 4GZCA 4LERA 4MKTA 4TRQA 3TGOA 4AOFA 3ASHA 2WXHA 2FBNA 2VJ8A 3LJ3A 3HVEB 2WXIA 3EHNA 2WM9A 3O4ZA 4HXIA 3KEZA 3IBEA 4BTBA 4EQFA 3EHMA 2OVFA 2YHCA 3U9WA 3JYSA 4GPKA 5LOZA 3CK7A 3MKQA 1DVPA 4G24A 4YVQC 2BTDA 2WQHA 1UN8A 2PQNA 3GYZA 4Y6CA 3CEQA 3FUFA 1UJKA 3CIAA 1IQRA 1GW6A 2X6KA 4C0EA 3JUIA 2WXPA 3MV2B 3CHRA 4JXTA 3MX3A 4WNFA 4KZCA 4U8HA 1B89A 3OXLA 3RRNB 4E85A 3CHQA 2CG3A 3ZW3A 4N2SA 1HE8A 3G2UA 4XE0A 1WY6A 4HOUA 1E8ZA 2C0LA 5G2NA 4FA6A 4JHJA 3MKRA 4FLHA 3B13A 2WXKA 3PVLA 5KCMA 4APOA 3U4TA 3G2SA 3FUKA 1W3BA 3ZYQA 3HDXA 3O48A 2WXMA 3URZA 2NXPA 3RKVA 5CCMA 3U66A 1ELKA 2WXGA 2R5SA 2KATA 4CGVA 3NZSA 1Z3XA 2CFZA 3FUEA 3MEKA 3EJNA 2X3MA 4UI9K 2HYZA 2VSOE 3G2VA 4M3OA 4L1BA 3FTVA 4XI9A 4AIFA 4BX8A 5KJMA 2XPIA 4BX9A 2KC7A 4YVOA 2E0IA 3DPDA 1WM5A 3CGHA 4GMLA 4B8AA 3PUJA 4G1TA 4J8SA 4EPZA 3DBSA 3LDZA 4L7TA 4U63A 4FP7A 4XI0A 2WQ6A 3PH0C 2WXLA 4UWHA 1FVHA 1HO8A 3ESKA 2AWIA 3UMVA 2L6JA 2J4BA 2VYIA 3QWVA 3FH8A 4N39A 5G05J 3ZYLA 4HOSA 1SZ9A 4JL0A 2AW6A 3EIQC 1ELRA 4BT9A 2AXZA 3SHFA 1NA3A 1E8WA 3T5XA 3FUHA 1E7VA 1H0AA 1U3DA 1L5JA 2VGXA 4KZ0A 3RO3A 5FWQA 3PDNA 1XNFA 4FJYA 5ARFA 2UY1B 4J0UA 4AY5A 3CV0A 4I17A 1OWLA 5KJKA 5CHEE 2WXFA 4FC8A 3VTYA 3GZ1A 4I1MA 4ME2A 3Q47B 2LAIA 3FUNA 4RSYA 4ANWA 2DIWA 4ANXA 4HOTA 2MOWA 4L2LA 4BWRA 3RU0A 4FULA 3APFA 5C2YA 2WQ7A 5ENNA 4F7AA 3LY7A 5LCWC 5FQ4A 3E4BA 5HI7A 3FTSA 1EF1C 3SD5A 2GRLA 4P29A 4HORA 2AVPA 3AS5A 4UWFA 2CFUA 3PUKA 4F3VA 2Y3AA 3ASDA 3L17A 4DJAA 2X6JA 2X6IA 3U3WA 3AS4A 1NZNA 4WAFA 3NF1A 3S7DA 4IYPA 2XGMA 4KVMA 4G25A 3JQ1A 3S2AA 2YQ8A 1OWMA 1H2UA 3ZFWA 4J8FA 3PREA 3C98A 3FU6A 3LPZA 2WMOA 4EZJA 4AM9A 2A5UA 2VTBA 2PZIA 3ZN3A 1N54A 3ML8A 3LVRE 4UI9J 5E76A 1PC2A 2YNQA 1Z6TA 1KLXA 4CT4A 3D9JA 3PE3A 4U0ZA 3ONLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2W A;  3ASF A;  1Y8M A;  3QKY A;  2HO1 A;  4GA0 A;  1QZ2 A;  3RJV A;  1WAO 1;  3UQ3 A;  2VGY A;  2XEV A;  3CKB A;  1TJC A;  1QQE A;  2KCK A;  2OND A;  4BT8 A;  2C0M A;  4XIF A;  2OOE A;  3MV3 B;  3ZHE B;  2XCB A;  3CVQ A;  2NC9 A;  1HH8 A;  4G2V A;  2IFU A;  3AS8 A;  1ZBP A;  3HYM B;  2BUG A;  2WPV A;  3KAE A;  4GYY A;  4I2Z A;  5DIZ A;  2VSY A;  4GA1 A;  3Q15 A;  3MA5 A;  2V5F A;  2VQ2 A;  2KCL A;  1IHG A;  2FO7 A;  2QFC A;  3CVN A;  3OXF A;  4BTA A;  4I9E A;  5BNW A;  3QOU A;  2IF4 A;  3LCA A;  4KYO B;  2PQR A;  3ZPJ A;  1HXI A;  5FT9 A;  4WND A;  4ABN A;  4G23 A;  3CKC A;  5EX3 A;  2GW1 A;  5CCL A;  3LY9 A;  5KJN A;  4N3C A;  2E2E A;  4KXK B;  5A6C A;  4YND A;  3PE4 A;  3ASG A;  4WNG A;  4J8D A;  2Y4T A;  5FJY A;  5G05 C;  1IYG A;  4AY6 A;  3ULQ A;  3LY8 A;  4I9C A;  3SZ7 A;  4NRH B;  3CVP A;  4CGW A;  4RG9 A;  4W9R A;  3N71 A;  2FEZ A;  1YA0 A;  4H7X A;  3BEE A;  3FFL A;  3LYA A;  3OXG A;  1ELW A;  5ARG A;  5EX0 A;  3EDT B;  4N5C A;  4UQX A;  4UQY A;  5D0Q D;  5M72 A;  5D0O D;  2MHK A;  3Q4A B;  5BW8 C;  1OUV A;  5KJL A;  1NA0 A;  4GZ5 A;  4JHR A;  1ZU2 A;  2HR2 A;  3TAX A;  5FZQ A;  4GCN A;  4GCO A;  4LEU A;  3K9I A;  2FF4 A;  4UI9 C;  3UPV A;  4GZ6 A;  4GZ3 A;  3S7J A;  2XGS A;  5EKQ D;  3GW4 A;  5DBK A;  4J8E A;  1HZ4 A;  2JLB A;  4GYW A;  4U0U A;  4N2Q A;  2VGX B;  4WNE A;  2Y4U A;  5G04 J;  2LSV A;  5FZS A;  3FP3 A;  1A17 A;  3Q49 B;  4UQZ A;  3R9A B;  3VTX A;  3CVL A;  4GYO A;  3FWV A;  3CK9 A;  3QWP A;  4NQ0 A;  2FI7 A;  1FCH A;  4N3B A;  2J9Q A;  4Y6W A;  3LKU A;  3RO2 A;  2I6H A;  2C2L A;  5FTP A;  1KT0 A;  2XCC A;  3ZGQ A;  4JA7 A;  5G04 C;  3Q5M A;  3ZHE A;  4IN3 B;  4O6F A;  4A1S A;  3WXX A;  3TG5 A;  3KD7 A;  3QWW A;  5AYW D;  3SF4 A;  1E96 B;  3KS2 A;  5LCW J;  1KT1 A;  4B94 A;  5FZR A;  3QDN A;  4RG6 A;  3S7B A;  5JJ7 A;  5JJT A;  2UWJ G;  4U07 A;  4JA9 A;  4H7Y A;  4U0S A;  4CDR A;  3RIB A;  5JJ6 A;  2LSU A;  5A7D B;  5C1D A;  3GZ2 A;  4KBQ A;  4WUY A;  3CK8 A;  2XGO A;  4I1A A;  4G26 A;  1P5Q A;  2PL2 A;  2KCV A;  5HQ8 A;  3S7F A;  3IEG A;  2P58 C;  2UY1 A;  4HOQ A;  4N3A A;  3TG4 A;  2VSN A;  2Q7F A;  2DBA A;  2LNI A;  4GA2 A;  3UUX A;  4U04 A;  3TGO A;  3ASH A;  2FBN A;  5BT1 A;  4BTB A;  4EQF A;  2YHC A;  3JYS A;  4GPK A;  3CK7 A;  4G24 A;  4YVQ C;  2WQH A;  3GYZ A;  2PQN A;  4Y6C A;  3CEQ A;  3MV2 B;  4WNF A;  1B89 A;  3OXL A;  4N2S A;  4HOU A;  2C0L A;  3MKR A;  4APO A;  3U4T A;  1W3B A;  3O48 A;  3URZ A;  3RKV A;  5CCM A;  2R5S A;  2KAT A;  4CGV A;  3MEK A;  4UI9 K;  2HYZ A;  4XI9 A;  4AIF A;  5KJM A;  2XPI A;  2KC7 A;  4YVO A;  1WM5 A;  4G1T A;  4XI0 A;  3ESK A;  2L6J A;  2VYI A;  3QWV A;  4N39 A;  5G05 J;  4HOS A;  4JL0 A;  1ELR A;  4BT9 A;  1NA3 A;  3RO3 A;  2VGX A;  3PDN A;  1XNF A;  5ARF A;  2UY1 B;  4J0U A;  4AY5 A;  3CV0 A;  4I17 A;  5KJK A;  5CHE E;  3VTY A;  3GZ1 A;  4ME2 A;  3Q47 B;  4HOT A;  4BWR A;  3RU0 A;  3LY7 A;  5LCW C;  3E4B A;  5HI7 A;  4HOR A;  2AVP A;  3AS5 A;  4F3V A;  3ASD A;  3U3W A;  3AS4 A;  1NZN A;  3S7D A;  3NF1 A;  2XGM A;  4G25 A;  2YQ8 A;  3ZFW A;  4J8F A;  3LPZ A;  4AM9 A;  2PZI A;  3ZN3 A;  4UI9 J;  1PC2 A;  1KLX A;  3PE3 A;  4U0Z A; 
#chains in the Genus database with same CATH topology
 1HS6 A;  1Q2Z A;  1PAQ A;  1Y8M A;  3RJV A;  2GRP B;  3DWL G;  3CQG B;  3AAA C;  5CEA A;  2XQ0 A;  3FDH A;  3EUV A;  4XIF A;  2I1K A;  2OOE A;  4CT0 A;  4LNG A;  2YHE A;  3RRU A;  4HLE A;  5H7P A;  3DSX A;  4DX7 D;  1PY1 A;  4MRU A;  2J4D A;  4YDO A;  3SQV A;  4G2V A;  2DVW A;  3LS8 A;  3HYM B;  3T5V A;  2BUG A;  1UN9 A;  3D9N A;  4GYY A;  4PS3 A;  5DIZ A;  3D9K A;  4ANV A;  2X38 A;  4Q94 A;  4G11 A;  2V5F A;  2KCL A;  1N11 A;  5ENQ D;  3RAU A;  2FO7 A;  4BFR A;  3ZNG A;  4I9E A;  3B7R L;  5T3R A;  3D3M A;  4KYO B;  4B8C B;  3L08 A;  1HXI A;  4ABN A;  3FH7 A;  2CG2 A;  1K1B A;  4X8Q A;  1H2V C;  2NSZ A;  4WWO A;  4TXP A;  2BF0 X;  2E2E A;  3B7S A;  4KXK B;  4YND A;  5FQ7 A;  3ASG A;  3D9O A;  3UKR G;  3R7Q A;  1OWN A;  4DPR A;  4J8D A;  4EZK A;  3FUM A;  4C0M A;  2L9B A;  3D9P A;  3EU9 A;  4I9C A;  4GTR A;  2GRO B;  2DCP A;  1EDU A;  4AP2 A;  4OVU A;  3CVP A;  3HXE A;  1NL4 A;  1TNB A;  5JHA A;  3DSW A;  4RG9 A;  3SFZ A;  4B93 B;  3FH5 A;  3QK0 A;  3QB2 A;  3FFL A;  1DNP A;  3LYA A;  5ITZ F;  3DSS A;  3EDT B;  2R2L A;  4B0Z A;  3MGB A;  1KZP A;  1IHB A;  3FTX A;  1Y6I A;  3FU5 A;  4HB5 A;  3ZVV A;  5D0Q D;  1QYM A;  2I1J A;  4CRW A;  2ILR A;  4UWL A;  4I6J A;  2HR2 A;  3LVQ E;  4GCN A;  5AQ7 A;  3TWR A;  3UPV A;  4GZ6 A;  2XZD G;  4GZ3 A;  3KEA A;  1LD7 A;  4RVB A;  4J8E A;  3UI2 A;  3JXJ A;  3DXM G;  3P1U A;  4DLQ A;  1KPS B;  3LEW A;  2R59 A;  3UIN C;  2LSV A;  2J09 A;  3RRM B;  3FP3 A;  1A17 A;  1SZA A;  3R9A B;  4PS8 A;  4GTO A;  4GYO A;  4A63 B;  3QC1 A;  3TL5 A;  5J08 A;  3QWP A;  3MYV A;  1LTX A;  1TYQ G;  4GMR A;  2KBX A;  3SFY A;  3UT7 A;  4XKC A;  4TUM A;  3OAW A;  4ACL A;  3TJP A;  3Q5M A;  2AJA A;  3ZHE A;  3HHM A;  4IN3 B;  3WXX A;  4A1S A;  3KD7 A;  4L23 A;  1FT1 A;  2VTB B;  4UWG A;  1EPU A;  3KS2 A;  1HU3 A;  1KT1 A;  1TN6 A;  5FZR A;  2CHW A;  2J8S D;  3NZU A;  1DCQ A;  4LG6 A;  3FTZ A;  4XKB A;  1N0Q A;  2UWJ G;  4U07 A;  4HRN A;  4WWN A;  3ZYM A;  4YDE A;  4FJZ A;  3CVY A;  4DI4 A;  2M63 A;  4JB8 P;  4CDR A;  2BKG A;  2RD0 A;  2LSU A;  5B1B E;  2OCC E;  1OWP A;  5A7D B;  4U7E B;  2IOS A;  3GZ2 A;  4KBQ A;  3ABL E;  5CEC B;  1WG0 A;  4PDX A;  5AQA A;  3C3O A;  2P9N G;  4G26 A;  2KCV A;  2V4H C;  3S7F A;  1XGW A;  2P58 C;  4K5A B;  3ULY A;  3QNK A;  4N3A A;  4LUN U;  2H6G A;  4KMO A;  4A3T A;  4U04 A;  4LER A;  4TRQ A;  4AOF A;  3HVE B;  2WXI A;  2GRQ B;  1OCZ E;  1TNO A;  3EHN A;  1S63 A;  2WM9 A;  3O4Z A;  3ASO E;  3KEZ A;  3U9W A;  4GPK A;  2BTD A;  3PZ2 A;  2WXP A;  3HXC A;  3CHR A;  2F0Y A;  4JXT A;  3E30 A;  3MX3 A;  1B89 A;  3RRN B;  2CG3 A;  3ZW3 A;  4N2S A;  3G2U A;  3ASN E;  3MKR A;  4FLH A;  3PVL A;  3U4T A;  3G2S A;  2WXM A;  4GTP A;  5CCM A;  3U66 A;  2WXG A;  3UKU G;  2KAT A;  3JUE A;  3NZS A;  3EJN A;  2X3M A;  2HYZ A;  4M3O A;  3FTV A;  1SA5 A;  2F37 A;  1O1R A;  1ZB1 A;  3PUJ A;  4J8S A;  3E37 A;  2WQ6 A;  4U96 D;  3AG1 E;  3Q79 A;  2RFA A;  3Q9U C;  2J4B A;  3HXD A;  3E33 A;  1SZ9 A;  4JL0 A;  2AXZ A;  3SHF A;  3HXF A;  1E8W A;  3FUH A;  2IO3 C;  1L5J A;  2VGX A;  5FWQ A;  5CER B;  3JXI A;  4AY5 A;  1OWL A;  2JAB A;  5CHE E;  5CBO A;  4RSY A;  4HOT A;  1SVX A;  3RU0 A;  5C2Y A;  2WQ7 A;  3FTS A;  1EF1 C;  2GRL A;  3T8K A;  3AS4 A;  4F6R D;  3S7D A;  4IYP A;  3PZ3 A;  5AQ9 A;  3PRE A;  3FU6 A;  3LPZ A;  2WMO A;  4AM9 A;  3ZN3 A;  1N54 A;  1AWC B;  4HI9 A;  1Z6T A;  2P9U G;  3ONL A;  4HLL A;  2L0T B;  3QKY A;  4I6E A;  1D8D A;  3L22 A;  1WAO 1;  2XEV A;  3VLF A;  1H6O A;  3T8M A;  2OND A;  1QNF A;  2A5E A;  2P2C P;  4F1S A;  4AVX A;  4U8Y D;  3ZHE B;  3V31 A;  3CVQ A;  2DYS E;  3CVX A;  1BU9 A;  1HH8 A;  4I1O B;  3AS8 A;  5AAO A;  4JVS A;  1TJF A;  1HG2 A;  3MZL B;  3L6A A;  3IKO B;  3W9G A;  2VQ2 A;  1D9S A;  5BV1 A;  1IQU A;  3U64 A;  4FU3 A;  4IRU A;  3QOU A;  2QC9 A;  4TXR A;  5LX8 A;  5FT9 A;  1A5E A;  4LNB A;  2GW1 A;  4U95 D;  5KWD A;  1RW2 A;  3FEX A;  1Z5S C;  4N3C A;  4FAD A;  3ULE G;  1OT8 A;  3FUL A;  3CHM A;  3Q7A A;  2J07 A;  3JCK C;  3DEP A;  1DC2 A;  4GU5 A;  2Y4T A;  5BPP A;  1IYG A;  4AY6 A;  4RLY A;  2IJG X;  4HS2 A;  5JA4 D;  4O1O A;  4A3V A;  3D9M A;  4BSX A;  3VLE A;  2KXP C;  3PEV B;  3F6Q A;  3N71 A;  1YA0 A;  2ZGD A;  1TN7 A;  5ARG A;  2WVI A;  3PNT B;  3R7R A;  2LAH A;  5JHB A;  2QZA A;  5IY5 E;  3CHP A;  3Q73 A;  4Q96 A;  2GRN B;  5M72 A;  2IU1 A;  3IHY A;  3TXN A;  2MHK A;  3Q4A B;  2FO1 E;  5BW8 C;  2IO2 C;  4TUU A;  1K3Z D;  5KJL A;  2QYU A;  4J7W A;  3FTU A;  1S0P A;  5FZQ A;  5JMN D;  3PZ4 A;  4GCO A;  2ETC A;  4URK A;  1INZ A;  1BI7 B;  5LFA A;  3J5Q B;  5G55 A;  1HF8 A;  5DBK A;  5A23 A;  4GYW A;  2RFM A;  4EBA A;  4GB9 A;  2VGX B;  2R05 A;  1S64 A;  5G04 J;  4CCA A;  5ANL A;  1Z3Y A;  1MX4 A;  4UQZ A;  3CHO A;  3I5P A;  3AJI A;  4B89 A;  5ENO D;  3HVE A;  4BY6 A;  2XPZ A;  3FUI A;  3FU3 A;  4ILH B;  2J9Q A;  3LKU A;  2I6H A;  1N95 A;  3FTY A;  1KT0 A;  2DWZ A;  2OV8 A;  3G2W A;  4XZ4 A;  3TG5 A;  5ANR A;  3LXU X;  1DCE A;  2J08 A;  1U3C A;  3ZRH A;  4UUC A;  4GTT A;  4ZHB A;  4GTM A;  3QDN A;  2R03 A;  2A4Z A;  2V8S E;  3S7B A;  4GAA A;  5JJT A;  3L13 A;  1TNY A;  3W9F A;  2JEK A;  4JA9 A;  1UG3 A;  1E8X A;  4HVB A;  3HG0 D;  4JEU A;  4U0S A;  1TEZ A;  2P9S G;  3RIB A;  2H6F A;  1EYH A;  4DX5 D;  1HG5 A;  5BV0 A;  4LRZ A;  3D9H A;  4OVV A;  4Q69 A;  4DRX E;  3Q7F A;  5EIL A;  3HIZ A;  1H6K A;  5CED B;  1UOH A;  3Q78 A;  4HOQ A;  5EYL A;  2VSN A;  5FIO A;  4BER A;  2Q7F A;  2DBA A;  5BXO A;  3TWV A;  3APD A;  2IY0 C;  2WXH A;  2FBN A;  2VJ8 A;  3LJ3 A;  1YCS B;  4EQF A;  3IBE A;  3EHM A;  2OVF A;  5EN5 D;  3JYS A;  5LOZ A;  3CK7 A;  3MKQ A;  1DVP A;  4G8K A;  2PQN A;  3CEQ A;  1UJK A;  3CIA A;  1IQR A;  4LSZ E;  4C0E A;  3EHR A;  3JUI A;  2H6I A;  3MV2 B;  1JCR A;  2EIN E;  3OXL A;  2PNN A;  4XE0 A;  1E8Z A;  4JHJ A;  2DZO A;  3B13 A;  3ZYQ A;  1U2V G;  3RKV A;  3ZUV B;  1Z3X A;  3G2V A;  1N9A A;  4AIF A;  5KJM A;  1OCR E;  4YVO A;  2E0I A;  1WM5 A;  3CGH A;  1YYH A;  4G1T A;  3DBS A;  3ISM C;  4L7T A;  4FP7 A;  4HRL A;  5HS0 A;  2XEE A;  3ESK A;  3EU5 A;  4EHM A;  4N39 A;  2AW6 A;  4ATZ D;  1ELR A;  5FIN A;  1E7V A;  1U3D A;  3RO3 A;  4DX6 D;  1YMP A;  3Q75 A;  2V5Q C;  4K5C A;  5B3S E;  3VTY A;  3GZ1 A;  4ME2 A;  4O60 A;  3UM0 A;  3Q47 B;  2DIW A;  2MOW A;  1QBQ A;  4L2L A;  4BWR A;  3APF A;  4F7A A;  5LCW C;  2EIM E;  5FQ4 A;  3E4B A;  5HI7 A;  2L6B A;  4J8Y A;  4P29 A;  1SA4 A;  4HOR A;  2AVP A;  3PUK A;  2Y3A A;  3ASD A;  4DJA A;  2ZGG A;  4KVM A;  4G25 A;  1NFI E;  2A5U A;  1JCQ A;  3ML8 A;  5E76 A;  1PC2 A;  2YNQ A;  1KLX A;  4CT4 A;  3TWW A;  3WG7 E;  4MBG A;  4I2W A;  2X6F A;  4L2Y A;  2Y69 E;  1TJC A;  2WB2 A;  2YIN A;  4BT8 A;  4BET A;  1N4R A;  2WXQ A;  3QAR A;  4AEZ C;  2NC9 A;  1NI1 A;  1TN8 A;  4JD2 G;  1D8E A;  1N4Q A;  4C48 B;  1H2T C;  3G2T A;  1VDY A;  2KZT A;  1UJJ A;  3UT4 A;  3CVU A;  4GA1 A;  3Q15 A;  1TNZ A;  3PS6 A;  3MA5 A;  2ETB A;  5AIJ A;  1N52 A;  1IHG A;  3ABK E;  1JCS A;  5B1A E;  1OCO E;  3CVN A;  3ABM E;  4BTA A;  5BNW A;  2IF4 A;  1OCC E;  4WWP A;  3TWQ A;  4CDM A;  4HQD A;  4G23 A;  3HXB A;  5EX3 A;  3TWU A;  5KNG A;  2WXN A;  5KJN A;  3BG1 B;  2B6C A;  2LO6 A;  3L16 A;  3PE4 A;  3OTN A;  3D9I A;  4A55 A;  3VLD A;  5FJY A;  3NBN B;  5G05 C;  1UW4 B;  3IHV A;  3GZS A;  3MKQ B;  2PM6 A;  4I43 A;  2XRY A;  4ILG A;  4FLB A;  4CGW A;  1S70 B;  4W9R A;  4OAU C;  4H7X A;  5EID A;  1HFA A;  3OXG A;  1ELW A;  2XHE A;  4R7L A;  5AJL A;  4DX1 A;  2VSX E;  5EX0 A;  3CHS A;  4FHK A;  4UQX A;  4BEP A;  3TWT A;  4UQY A;  3SGH A;  5D0O D;  1LF8 A;  3PNL B;  2I2O A;  3CVW A;  1OUV A;  1MYO A;  5BUZ A;  2L0I A;  1N4S A;  1NA0 A;  4GZ5 A;  4E6H A;  4JHR A;  5CMW A;  1ZU2 A;  1V55 E;  2GGF A;  3TAX A;  3DRA A;  3K9I A;  4M7C A;  2LXL A;  1RZ4 A;  1H6P A;  1NP7 A;  3B7B A;  3S7J A;  1H19 A;  2XGS A;  4KVO A;  5T8I A;  4K0R A;  1HZ4 A;  4BES A;  5EYP F;  3SBS A;  4CZ2 D;  4N2Q A;  1IXV A;  4JHK A;  3SNX A;  5FZS A;  4GTS A;  5LP0 A;  3BUA A;  3BG0 B;  3NB2 A;  3FWV A;  2I9C A;  3UX4 A;  4V3I A;  2XRZ A;  2EQX A;  2V4L A;  4LCT A;  1N4P A;  4NQ0 A;  2F8Y A;  3B7U X;  1OY3 D;  1FCH A;  3JQ0 A;  2VGE A;  2IQC A;  4A1G A;  3TXM A;  4IUL A;  2IEJ A;  4ATG A;  5FTP A;  2XCC A;  3APC A;  3ZGQ A;  4DLO A;  1FPP A;  2CHZ A;  1E90 A;  4O6F A;  4YDY A;  3QWW A;  5AYW D;  4MS6 A;  4CDN A;  4KT6 B;  5LCW J;  3HRA A;  5CRU A;  5FQ8 A;  4B94 A;  2GRM A;  2WMN A;  3L9T A;  3ZU7 B;  3PZD A;  5JJ7 A;  3UT8 A;  3QJZ A;  3B7T A;  4XX5 A;  3FUJ A;  1O1T A;  2P9K G;  3KSL A;  4ANU A;  3AG4 E;  4ACK A;  3AU5 A;  3DST A;  2BKK B;  5JJ6 A;  3FUD A;  4TV3 A;  5C1D A;  3ONK A;  2OEV A;  4WUY A;  2J49 A;  5AAR A;  2XGO A;  4I1A A;  2XZT G;  5T4Y A;  2PL2 A;  1OXJ A;  3C3R A;  5HQ8 A;  4PUC A;  5HKP A;  3IEG A;  2KZT B;  1MX2 A;  4I6G A;  3MCX A;  4ZFH A;  1TR4 A;  1MHQ A;  3UTM A;  2ZU6 B;  2CHX A;  2LNI A;  3UUX A;  5ENS D;  4MKT A;  3TGO A;  2OEW A;  5BT1 A;  4BTB A;  2YHC A;  4G24 A;  4YVQ C;  3GYZ A;  1UN8 A;  4TXQ A;  2GRR B;  2DZN A;  3IXE A;  3RSE G;  4WNF A;  4KZC A;  2C0L A;  5G2N A;  4FA6 A;  2WXK A;  1W3B A;  3UM3 A;  4CGV A;  1KZO A;  1O1S A;  3NAW A;  2CFZ A;  3FUE A;  4UI9 K;  4XI9 A;  4BX9 A;  3AG2 E;  4G8L A;  4EPZ A;  3LDZ A;  3PH0 C;  4UWH A;  1HO8 A;  2P9P G;  1G3N B;  2AWI A;  3UMV A;  2ZIR A;  5G05 J;  3ZYL A;  4HOS A;  3R9M A;  3NOG D;  3EIQ C;  1NA3 A;  3DXK G;  3T5X A;  4FJY A;  2LXM A;  5ARF A;  2UY1 B;  4J0U A;  4O1P A;  5KJK A;  2WXF A;  3TWS A;  3B95 A;  2LAI A;  4FUL A;  5ENT D;  4Z68 A;  1AP7 A;  4HRM B;  3V30 A;  3SD5 A;  3AS5 A;  4UWF A;  2CFU A;  3UIP C;  4HBD A;  3BU8 A;  4F3V A;  3L17 A;  2X6J A;  2X6I A;  3U3W A;  1NZN A;  2Y0B G;  1K8K G;  3DEO A;  3S2A A;  2YQ8 A;  3SFX A;  3C98 A;  4EZJ A;  2PZI A;  4BSZ B;  2R02 A;  3PE3 A;  4U0Z A;  3SBT B;  2ZIS A;  3ASF A;  2HO1 A;  4GA0 A;  5AEN A;  4GZD A;  1QZ2 A;  4MLP A;  3UQ3 A;  2VGY A;  3CKB A;  4D10 C;  1V54 E;  3FEY A;  2XS1 A;  3IV0 A;  1BPO A;  1QQE A;  2KCK A;  2RG8 A;  2C0M A;  3FU0 A;  4APF A;  1OWO A;  2KM4 A;  3MV3 B;  2XCB A;  2PM7 A;  4CYM D;  3DSV A;  4GTV A;  3AU4 A;  5CRV A;  1TNU A;  4NAC A;  4OYS A;  4GTQ A;  4JW1 A;  2B0O E;  2IFU A;  4K03 A;  1ZBP A;  1MQS A;  2ION A;  2AXU A;  2WPV A;  3KAE A;  3I4G A;  1MJ0 A;  4AV7 A;  4I2Z A;  2XPY A;  2VSY A;  3UM2 A;  2AXV A;  3CSF A;  3ZEF A;  3ZXP A;  4PS7 A;  3QAQ A;  5FQ6 A;  3T9K A;  3ML9 A;  2XEN A;  2Y1L E;  4PH4 B;  2QFC A;  4JC8 A;  1SQM A;  2FUL A;  3OXF A;  4JPS A;  3LCA A;  3BQO A;  3CVV A;  2PQR A;  1N0R A;  3ZPJ A;  1SW6 A;  4WND A;  3SO8 A;  3UM1 A;  3PEU B;  3L54 A;  2F8X K;  3CKC A;  3V79 K;  4AJW A;  5CCL A;  3LY9 A;  4GPM A;  2QYJ A;  3D9L A;  3EHQ A;  5A6C A;  4HFG A;  4K5B A;  5AQB A;  5E75 A;  4WNG A;  3ZYK A;  3DSU A;  3MJW A;  5CBN A;  1FT2 A;  3CR3 A;  3C3Q A;  3ULQ A;  3LY8 A;  4GMJ A;  3ZIM A;  3SZ7 A;  4UWK A;  4NRH B;  4C9B B;  4AXH A;  4J6I A;  3PRZ A;  1E8Y A;  2ZXW E;  2FEZ A;  2QY7 A;  5CMY A;  1HX8 A;  1BI8 B;  3NQP A;  3BEE A;  3NOC D;  3CLJ A;  5AJD A;  3UIO C;  4ILI A;  4N5C A;  2HE0 A;  2WXO A;  1K1A A;  4DI3 A;  4EBA G;  2MYO A;  4QFV A;  4DUI A;  1BD8 A;  3SI5 A;  5EIB E;  4YDW A;  3E32 A;  1MX6 A;  4NUR A;  1JPL A;  3C72 A;  1E7U A;  5EDS A;  1JWG A;  4LEU A;  4EEC A;  1JWF A;  2FF4 A;  2WXJ A;  4UI9 C;  5BXU A;  4L9P A;  4DK5 A;  2ETA A;  3Q9N C;  5EKQ D;  3GW4 A;  1IKN D;  3UXG A;  2JLB A;  2WXR A;  4U0U A;  4WNE A;  2P9I G;  2Y4U A;  2P9L G;  5HRY A;  2IOL A;  3Q49 B;  3VTX A;  3CVL A;  3P2B A;  3CK9 A;  4F1P A;  4HI8 A;  4N5Q A;  2FI7 A;  5D66 A;  2XEH A;  4N3B A;  4Y6W A;  3KSQ A;  3RO2 A;  3I4R B;  4JEH A;  2OVB A;  2C2L A;  2H6H A;  3PZ1 A;  4JA7 A;  2HM8 A;  5G04 C;  5J90 A;  3FTW A;  3V2O A;  2MRI A;  2X6H A;  4JZY A;  3ZXS A;  4HNA D;  3I3N A;  3SF4 A;  1E96 B;  4NIK A;  1N94 A;  4DX2 A;  4RG6 A;  3FHE A;  1FVF A;  1X5B A;  3ENE A;  3C5R A;  3CST A;  2V0P A;  4FHJ A;  4H7Y A;  4F53 A;  4EZL A;  3FY4 A;  3CQC B;  4CEM A;  1MZC A;  4QQI A;  3CK8 A;  1JUQ A;  3EIJ A;  1P5Q A;  3ESL A;  5ENP D;  2UY1 A;  3E34 A;  3TG4 A;  3RK6 A;  2R17 C;  2XS8 A;  2LUH A;  4LNU D;  4GA2 A;  4GZC A;  3ASH A;  5D2M C;  5AN8 A;  4HXI A;  2DYR E;  2WQH A;  1WDY A;  4Y6C A;  3FUF A;  3X2Q E;  1GW6 A;  2X6K A;  2BED A;  3J5P A;  1O5M A;  4U8H A;  4E85 A;  3CHQ A;  1HE8 A;  1WY6 A;  4OAV B;  4HOU A;  5KCM A;  2EIJ E;  4APO A;  3V2X A;  3FUK A;  2RKK A;  3HDX A;  3O48 A;  3URZ A;  3ZKJ A;  2NXP A;  1ELK A;  2R5S A;  3AG3 E;  1X81 A;  3MEK A;  2VSO E;  4L1B A;  4BX8 A;  2XPI A;  2EIK E;  3SY2 A;  2KC7 A;  1BLX B;  3DPD A;  4GML A;  5ENR D;  4B8A A;  4U63 A;  2NYJ A;  4XI0 A;  2EIL E;  2WXL A;  1FVH A;  4RQI A;  2L6J A;  2VYI A;  3QWV A;  3FH8 A;  4BT9 A;  1H0A A;  4KZ0 A;  3PDN A;  1XNF A;  4XEI G;  3CV0 A;  4I17 A;  3DPY A;  4FC8 A;  4I1M A;  3TWX A;  4ANX A;  3FUN A;  4ANW A;  4U8V D;  5ENN A;  3LY7 A;  3LJN A;  5KBA A;  4WAF A;  3NF1 A;  2XGM A;  3JQ1 A;  1LD8 A;  1OWM A;  1H2U A;  3ZFW A;  3L82 A;  4J8F A;  2VTB A;  4UI9 J;  5KNH D;  3LVR E;  3D9J A; 
#chains in the Genus database with same CATH homology
 1HS6 A;  2L0T B;  1PAQ A;  4I2W A;  3SBT B;  3ASF A;  1Y8M A;  2X6F A;  3QKY A;  2HO1 A;  4GA0 A;  4I6E A;  5AEN A;  4GZD A;  1QZ2 A;  3L22 A;  4MLP A;  1WAO 1;  3RJV A;  2VGY A;  2XEV A;  3CKB A;  4L2Y A;  3UQ3 A;  4D10 C;  3VLF A;  3FEY A;  1TJC A;  1BPO A;  3IV0 A;  3T8M A;  1QQE A;  2KCK A;  2OND A;  3CQG B;  2RG8 A;  2WB2 A;  2YIN A;  4BT8 A;  2XQ0 A;  3FDH A;  1QNF A;  2C0M A;  3FU0 A;  4APF A;  4XIF A;  2I1K A;  2OOE A;  4F1S A;  1OWO A;  2KM4 A;  3MV3 B;  4CT0 A;  4AVX A;  3ZHE B;  2WXQ A;  3QAR A;  2XCB A;  3CVQ A;  2PM7 A;  4AEZ C;  2YHE A;  3RRU A;  4HLE A;  1PY1 A;  2NC9 A;  3CVX A;  3AU4 A;  4MRU A;  1HH8 A;  4I1O B;  2J4D A;  4NAC A;  4OYS A;  4JW1 A;  4G2V A;  2IFU A;  3AS8 A;  4K03 A;  3LS8 A;  4JVS A;  1TJF A;  1ZBP A;  1MQS A;  3HYM B;  3T5V A;  2ION A;  2AXU A;  2BUG A;  2WPV A;  1H2T C;  3G2T A;  3KAE A;  1HG2 A;  1VDY A;  1UN9 A;  2KZT A;  3D9N A;  1UJJ A;  3I4G A;  4GYY A;  4PS3 A;  3UT4 A;  3MZL B;  4AV7 A;  4I2Z A;  2XPY A;  5DIZ A;  2VSY A;  3L6A A;  2AXV A;  3CSF A;  3ZEF A;  4GA1 A;  3Q15 A;  3CVU A;  3D9K A;  3PS6 A;  4ANV A;  2X38 A;  3IKO B;  3MA5 A;  4Q94 A;  4G11 A;  2V5F A;  4PS7 A;  5AIJ A;  3QAQ A;  5FQ6 A;  1N52 A;  2KCL A;  2VQ2 A;  3ML9 A;  5BV1 A;  1IHG A;  2FO7 A;  4BFR A;  4PH4 B;  2QFC A;  4JC8 A;  1IQU A;  3U64 A;  3CVN A;  1SQM A;  2FUL A;  3OXF A;  4FU3 A;  4I9E A;  4IRU A;  4BTA A;  3B7R L;  5BNW A;  3QOU A;  4JPS A;  2IF4 A;  5T3R A;  3D3M A;  3LCA A;  4KYO B;  4WWP A;  2PQR A;  4B8C B;  3CVV A;  3L08 A;  3ZPJ A;  1HXI A;  4CDM A;  5LX8 A;  5FT9 A;  4WND A;  4ABN A;  3PEU B;  3FH7 A;  2CG2 A;  3L54 A;  4G23 A;  3CKC A;  1H2V C;  5EX3 A;  2GW1 A;  4AJW A;  2NSZ A;  5CCL A;  3FEX A;  2WXN A;  3LY9 A;  4WWO A;  3D9L A;  5KJN A;  3BG1 B;  4N3C A;  4FAD A;  2BF0 X;  2E2E A;  3B7S A;  4KXK B;  5A6C A;  3FUL A;  4YND A;  5FQ7 A;  2LO6 A;  3L16 A;  4HFG A;  3CHM A;  5E75 A;  3PE4 A;  3ASG A;  4WNG A;  3ZYK A;  3D9O A;  2J07 A;  3OTN A;  3D9I A;  3R7Q A;  4A55 A;  3JCK C;  3VLD A;  1OWN A;  4DPR A;  3MJW A;  4GU5 A;  2Y4T A;  4J8D A;  5FJY A;  4EZK A;  3FUM A;  4C0M A;  5BPP A;  5G05 C;  3CR3 A;  1IYG A;  4AY6 A;  2L9B A;  3D9P A;  3ULQ A;  3LY8 A;  4I9C A;  2DCP A;  1EDU A;  1UW4 B;  3IHV A;  3GZS A;  3MKQ B;  2PM6 A;  4GMJ A;  4I43 A;  2XRY A;  4AP2 A;  4ILG A;  3ZIM A;  4OVU A;  2IJG X;  3SZ7 A;  4HS2 A;  4UWK A;  4FLB A;  4NRH B;  3D9M A;  4A3V A;  4C9B B;  3CVP A;  4CGW A;  4AXH A;  4J6I A;  4BSX A;  5JHA A;  3PRZ A;  1E8Y A;  3VLE A;  4RG9 A;  3SFZ A;  3PEV B;  4W9R A;  3N71 A;  2FEZ A;  1YA0 A;  2QY7 A;  5CMY A;  3FH5 A;  1HX8 A;  3NQP A;  3QB2 A;  3QK0 A;  3BEE A;  4H7X A;  1HFA A;  3CLJ A;  1DNP A;  3FFL A;  3LYA A;  3OXG A;  1ELW A;  2XHE A;  5ARG A;  4R7L A;  2WVI A;  3PNT B;  5AJD A;  5AJL A;  2VSX E;  4ILI A;  5EX0 A;  3EDT B;  4N5C A;  3CHS A;  2LAH A;  3R7R A;  5JHB A;  4FHK A;  4UQX A;  4B0Z A;  3MGB A;  3CHP A;  2WXO A;  4Q96 A;  4DI3 A;  3FTX A;  1Y6I A;  3FU5 A;  4UQY A;  3ZVV A;  5D0Q D;  4EBA G;  4QFV A;  3SGH A;  5M72 A;  5D0O D;  3SI5 A;  1LF8 A;  2IU1 A;  3PNL B;  2I1J A;  3IHY A;  3TXN A;  2MHK A;  2I2O A;  3Q4A B;  3CVW A;  4NUR A;  1OUV A;  5BW8 C;  4CRW A;  4TUU A;  5KJL A;  2ILR A;  4UWL A;  5BUZ A;  2L0I A;  3FTU A;  1NA0 A;  4GZ5 A;  1JPL A;  4JHR A;  4E6H A;  5CMW A;  4I6J A;  1S0P A;  1ZU2 A;  2HR2 A;  5BT1 A;  2GGF A;  3TAX A;  1E7U A;  5FZQ A;  3LVQ E;  5EDS A;  4GCN A;  1JWG A;  4GCO A;  4LEU A;  4EEC A;  1JWF A;  3K9I A;  4URK A;  2FF4 A;  2WXJ A;  1INZ A;  4UI9 C;  5LFA A;  3UPV A;  4GZ6 A;  4DK5 A;  1NP7 A;  4GZ3 A;  5G55 A;  3S7J A;  1H19 A;  1HF8 A;  2XGS A;  4KVO A;  3GW4 A;  5DBK A;  4RVB A;  5EKQ D;  5T8I A;  4J8E A;  1HZ4 A;  4K0R A;  2JLB A;  5A23 A;  4GYW A;  3SBS A;  3P1U A;  4DLQ A;  2WXR A;  4EBA A;  4U0U A;  4GB9 A;  4N2Q A;  2VGX B;  4WNE A;  2Y4U A;  3LEW A;  2R59 A;  4JHK A;  5G04 J;  4CCA A;  2LSV A;  2J09 A;  3RRM B;  3SNX A;  5FZS A;  3FP3 A;  1A17 A;  1SZA A;  5LP0 A;  5ANL A;  2IOL A;  1Z3Y A;  3Q49 B;  4UQZ A;  3R9A B;  4PS8 A;  3VTX A;  3BG0 B;  3CVL A;  3CHO A;  3I5P A;  4GYO A;  3P2B A;  3QC1 A;  3TL5 A;  3FWV A;  2I9C A;  4B89 A;  5J08 A;  3CK9 A;  3UX4 A;  4V3I A;  3QWP A;  2XRZ A;  3MYV A;  2EQX A;  3HVE A;  4BY6 A;  2V4L A;  2XPZ A;  2FI7 A;  4LCT A;  4NQ0 A;  3B7U X;  3FUI A;  1FCH A;  3JQ0 A;  2IQC A;  3FU3 A;  4N3B A;  4ILH B;  2J9Q A;  4Y6W A;  3TXM A;  4A1G A;  4IUL A;  3LKU A;  3UT7 A;  3RO2 A;  4XKC A;  3I4R B;  2I6H A;  4JEH A;  2OVB A;  2C2L A;  5FTP A;  3FTY A;  4ATG A;  1KT0 A;  2XCC A;  3APC A;  3ZGQ A;  4DLO A;  3OAW A;  4JA7 A;  4ACL A;  2HM8 A;  5G04 C;  3TJP A;  5J90 A;  3FTW A;  3Q5M A;  2MRI A;  2CHZ A;  3ZHE A;  1E90 A;  2OV8 A;  3HHM A;  4IN3 B;  4O6F A;  3G2W A;  2X6H A;  3WXX A;  4A1S A;  4XZ4 A;  3TG5 A;  3KD7 A;  3QWW A;  4JZY A;  4L23 A;  5AYW D;  3ZXS A;  5ANR A;  3LXU X;  2VTB B;  2J08 A;  1U3C A;  3I3N A;  1E96 B;  4MS6 A;  4UWG A;  1EPU A;  3KS2 A;  4KT6 B;  3SF4 A;  4CDN A;  5LCW J;  3ZRH A;  1HU3 A;  1KT1 A;  5FQ8 A;  5FZR A;  4B94 A;  2CHW A;  3QDN A;  2A4Z A;  2GRM A;  2WMN A;  3NZU A;  4RG6 A;  2V8S E;  3S7B A;  3FTZ A;  4GAA A;  3PZD A;  3FHE A;  5JJ7 A;  5JJT A;  1FVF A;  1X5B A;  3UT8 A;  3QJZ A;  3ENE A;  3B7T A;  4XKB A;  3L13 A;  3FUJ A;  4XX5 A;  4ANU A;  2UWJ G;  4U07 A;  4WWN A;  2JEK A;  3CST A;  2V0P A;  4FHJ A;  4JA9 A;  4H7Y A;  1UG3 A;  3ZYM A;  4ACK A;  4F53 A;  1E8X A;  4FJZ A;  4HVB A;  3CVY A;  4JEU A;  4EZL A;  3AU5 A;  4U0S A;  4DI4 A;  2M63 A;  1TEZ A;  4CDR A;  3RIB A;  3FY4 A;  3CQC B;  5JJ6 A;  2RD0 A;  2LSU A;  1EYH A;  3FUD A;  4TV3 A;  1OWP A;  5A7D B;  1HG5 A;  5C1D A;  3ONK A;  4CEM A;  5BV0 A;  2IOS A;  4LRZ A;  3GZ2 A;  4KBQ A;  2J49 A;  4OVV A;  4WUY A;  4PDX A;  3CK8 A;  2XGO A;  4I1A A;  1JUQ A;  3EIJ A;  4G26 A;  5T4Y A;  1P5Q A;  4Q69 A;  2PL2 A;  2KCV A;  5HQ8 A;  3ESL A;  4PUC A;  3HIZ A;  3S7F A;  1XGW A;  3IEG A;  2P58 C;  1H6K A;  2UY1 A;  2KZT B;  4I6G A;  3QNK A;  4HOQ A;  3MCX A;  4N3A A;  3TG4 A;  1MHQ A;  4LUN U;  2VSN A;  3RK6 A;  2ZU6 B;  2R17 C;  2Q7F A;  2DBA A;  3APD A;  2CHX A;  4KMO A;  2LNI A;  4GA2 A;  3UUX A;  4A3T A;  4U04 A;  4GZC A;  4LER A;  4MKT A;  4TRQ A;  3TGO A;  4AOF A;  3ASH A;  2WXH A;  2FBN A;  2VJ8 A;  3LJ3 A;  3HVE B;  2WXI A;  3EHN A;  2WM9 A;  3O4Z A;  4HXI A;  3KEZ A;  3IBE A;  4BTB A;  4EQF A;  3EHM A;  2OVF A;  2YHC A;  3U9W A;  3JYS A;  4GPK A;  5LOZ A;  3CK7 A;  3MKQ A;  1DVP A;  4G24 A;  4YVQ C;  2BTD A;  2WQH A;  1UN8 A;  2PQN A;  3GYZ A;  4Y6C A;  3CEQ A;  3FUF A;  1UJK A;  3CIA A;  1IQR A;  1GW6 A;  2X6K A;  4C0E A;  3JUI A;  2WXP A;  3MV2 B;  3CHR A;  4JXT A;  3MX3 A;  4WNF A;  4KZC A;  4U8H A;  1B89 A;  3OXL A;  3RRN B;  4E85 A;  3CHQ A;  2CG3 A;  3ZW3 A;  4N2S A;  1HE8 A;  3G2U A;  4XE0 A;  1WY6 A;  4HOU A;  1E8Z A;  2C0L A;  5G2N A;  4FA6 A;  4JHJ A;  3MKR A;  4FLH A;  3B13 A;  2WXK A;  3PVL A;  5KCM A;  4APO A;  3U4T A;  3G2S A;  3FUK A;  1W3B A;  3ZYQ A;  3HDX A;  3O48 A;  2WXM A;  3URZ A;  2NXP A;  3RKV A;  5CCM A;  3U66 A;  1ELK A;  2WXG A;  2R5S A;  2KAT A;  4CGV A;  3NZS A;  1Z3X A;  2CFZ A;  3FUE A;  3MEK A;  3EJN A;  2X3M A;  4UI9 K;  2HYZ A;  2VSO E;  3G2V A;  4M3O A;  4L1B A;  3FTV A;  4XI9 A;  4AIF A;  4BX8 A;  5KJM A;  2XPI A;  4BX9 A;  2KC7 A;  4YVO A;  2E0I A;  3DPD A;  1WM5 A;  3CGH A;  4GML A;  4B8A A;  3PUJ A;  4G1T A;  4J8S A;  4EPZ A;  3DBS A;  3LDZ A;  4L7T A;  4U63 A;  4FP7 A;  4XI0 A;  2WQ6 A;  3PH0 C;  2WXL A;  4UWH A;  1FVH A;  1HO8 A;  3ESK A;  2AWI A;  3UMV A;  2L6J A;  2J4B A;  2VYI A;  3QWV A;  3FH8 A;  4N39 A;  5G05 J;  3ZYL A;  4HOS A;  1SZ9 A;  4JL0 A;  2AW6 A;  3EIQ C;  1ELR A;  4BT9 A;  2AXZ A;  3SHF A;  1NA3 A;  1E8W A;  3T5X A;  3FUH A;  1E7V A;  1H0A A;  1U3D A;  1L5J A;  2VGX A;  4KZ0 A;  3RO3 A;  5FWQ A;  3PDN A;  1XNF A;  4FJY A;  5ARF A;  2UY1 B;  4J0U A;  4AY5 A;  3CV0 A;  4I17 A;  1OWL A;  5KJK A;  5CHE E;  2WXF A;  4FC8 A;  3VTY A;  3GZ1 A;  4I1M A;  4ME2 A;  3Q47 B;  2LAI A;  3FUN A;  4RSY A;  4ANW A;  2DIW A;  4ANX A;  4HOT A;  2MOW A;  4L2L A;  4BWR A;  3RU0 A;  4FUL A;  3APF A;  5C2Y A;  2WQ7 A;  5ENN A;  4F7A A;  3LY7 A;  5LCW C;  5FQ4 A;  3E4B A;  5HI7 A;  3FTS A;  1EF1 C;  3SD5 A;  2GRL A;  4P29 A;  4HOR A;  2AVP A;  3AS5 A;  4UWF A;  2CFU A;  3PUK A;  4F3V A;  2Y3A A;  3ASD A;  3L17 A;  4DJA A;  2X6J A;  2X6I A;  3U3W A;  3AS4 A;  1NZN A;  4WAF A;  3NF1 A;  3S7D A;  4IYP A;  2XGM A;  4KVM A;  4G25 A;  3JQ1 A;  3S2A A;  2YQ8 A;  1OWM A;  1H2U A;  3ZFW A;  4J8F A;  3PRE A;  3C98 A;  3FU6 A;  3LPZ A;  2WMO A;  4EZJ A;  4AM9 A;  2A5U A;  2VTB A;  2PZI A;  3ZN3 A;  1N54 A;  3ML8 A;  3LVR E;  4UI9 J;  5E76 A;  1PC2 A;  2YNQ A;  1Z6T A;  1KLX A;  4CT4 A;  3D9J A;  3PE3 A;  4U0Z A;  3ONL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...