4BESA

Crystal structure of the legionella pneumophila fic domain-containing effector ankx protein in complex with cytidine monophosphate and phosphocholine
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
479
structure length
469
Chain Sequence
PNLPGLYFLQAYPSEEIWRLFVDGRFWSKENGWRGYESREPGCLNAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGPGELRTDEPVSFGIPAGRASIKGIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQIYFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNKEIKTAETLDEKLKIIVKHIRMYEVLHPFRDANGRTFVNNLLNIPLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVEIIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPSYEKIKHMDFSDLNPEKLHLKTQKCLSSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISGNMAMLDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKDNHGKTAFHYAAEFGTPELISAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PHOSPHOCHOLINE TRANSFERASE ANKX
publication title Structure of the Legionella Effector Ankx Reveals the Mechanism of Phosphocholine Transfer by the Fic Domain.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
total genus 164
structure length 469
sequence length 479
ec nomenclature ec 2.7.1.-:
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4besA02
2BKGA 5JMND 4U95D 2XZTG 3AAAC 3HRAA 4BESA 4OAVB 3EHQA 4DX5D 4A63B 2BKKB 3W9FA 5AQAA 1S70B 2RFMA 3ZU7B 2J8SD 3D9HA 4UUCA 3J5QB 3EU9A 4HBDA 4BETA 3NOCD 1BLXB 3ZUVB 1BI8B 4K5AB 5D66A 3JXJA 3UI2A 3UXGA 2FO1E 3Q9UC 5ENQD 5ITZF 1OT8A 2Y0BG 4DRXE 1MX6A 2KXPC 5EYPF 1BU9A 3ZKJA 3LJNA 1K1AA 2Y1LE 5ENTD 2ETAA 5CBNA 4GMRA 2A5EA 4HLLA 3T8KA 4U96D 4O1PA 2DVWA 3DEPA 2ZGDA 4HI9A 5CERB 2HE0A 4HNAD 4TUMA 4YDYA 4GPMA 3V79K 3JXIA 2VGEA 4DX7D 4G8LA 2ETCA 2F8YA 3NOGD 4ATZD 4HRMB 4ZHBA 4J7WA 4U8VD 5EYLA 4RLYA 4K5CA 4LSZE 3JUEA 4HB5A 4N5QA 5EIDA 5KNGA 3HG0D 4NIKA 1K3ZD 4YDWA 2XENA 2QYJA 5FINA 3AJIA 4CYMD 2DZNA 2B0OE 4HRLA 5EN5D 3TWQA 2L6BA 4BERA 4CZ2D 5CEAA 5AQ7A 5HKPA 4LG6A 5ENRD 1OY3D 5CECB 4DX2A 2NYJA 4HI8A 3F6QA 5EILA 5AARA 3UTMA 4DX1A 2JABA 4QQIA 1DCQA 2P2CP 4ZFHA 3EHRA 3TWVA 1MX4A 3TWWA 1TR4A 5KBAA 4G8KA 1IXVA 1DC2A 4LNUD 1BI7B 2DWZA 1IHBA 4O60A 1G3NB 1YMPA 3B95A 4K5BA 5AN8A 3V31A 2ZGGA 5HRYA 1NFIE 5KWDA 5KNHD 2XEHA 4QFVA 3KEAA 1AWCB 1MYOA 4C48B 5ENOD 3TWUA 4BSZB 2F37A 2V5QC 4HRNA 1AP7A 4HQDA 1WG0A 4O1OA 3V2OA 4F6RD 4U8YD 2XEEA 1K1BA 1QYMA 5JA4D 1D9SA 5ENSD 3V30A 3C5RA 4DX6D 1YYHA 3B7BA 3TWXA 1SW6A 1MX2A 1A5EA 1N0QA 3TWSA 5BXOA 5EIBE 1BD8A 4BEPA 3IXEA 1N11A 1WDYA 1MJ0A 3T9KA 2DZOA 2RFAA 2V4HC 2ETBA 4DUIA 5ENPD 3NBNB 2F8XK 4J8YA 2PNNA 5FIOA 1UOHA 2QC9A 5HS0A 3TWRA 3DEOA 5CEDB 3V2XA 3W9GA 1N0RA 2KBXA 3Q9NC 3SO8A 4OAUC 2MYOA 1IKND 1YCSB 5AQBA 1SVXA 3TWTA 2XZDG 5BXUA 5AQ9A 4JB8P 3J5PA 4B93B 3ZNGA 2AJAA 4Z68A 5AAOA 4F1PA 5CBOA
chains in the Genus database with same CATH superfamily
3SNXA 3EHQA 2WB2A 1E96B 2IFUA 2XGSA 1HX8A 1HXIA 3I4GA 2VSOE 4K03A 4B94A 2HM8A 4GA2A 3C3RA 2XGMA 4TUMA 3DSWA 1H6KA 4G8LA 4GTRA 3FTZA 4J7WA 4U8VD 1QNFA 1TN6A 4HB5A 4AM9A 4KBQA 2P9NG 5AYWD 2J07A 4WNFA 3G2WA 2LSVA 2Y4TA 4LERA 1HS6A 2J9QA 3OAWA 1ZB1A 3NZSA 4CGWA 4PS7A 2DWZA 3Q4AB 2IOLA 5KWDA 1NFIE 3LY8A 1BPOA 4KVOA 2XEEA 1TNZA 5ENSD 3S7DA 3NAWA 1A5EA 2OEWA 4JC8A 4BT9A 3CVVA 4BEPA 1O1RA 3O4ZA 2RFAA 4E85A 5M72A 1TN8A 2QC9A 3ULYA 4EZJA 2KBXA 3SGHA 2J4DA 3D9KA 3PRZA 5FQ6A 4CDMA 5CBOA 3UM0A 2GRNB 3Q78A 4BESA 1IYGA 5AQAA 1S70B 1OCOE 2GRRB 2B6CA 4I17A 3L13A 4UI9C 4A3TA 3IHVA 3PEUB 4BETA 5KJMA 2WQ6A 4WUYA 5D66A 2FO1E 2V0PA 5ITZF 2Y0BG 4DRXE 3Q47B 4R7LA 3ZKJA 3L54A 3SZ7A 4WAFA 2PL2A 2Y1LE 2NXPA 3JXIA 4DX7D 4GAAA 4U0SA 4GTOA 4RLYA 3ZW3A 4UQYA 3FU3A 1OWOA 3TWQA 5CEAA 5ANLA 1JWGA 5ENRD 4JW1A 5LCWC 4AV7A 4JZYA 1PC2A 2VSNA 3PDNA 2R03A 4I9CA 3FTVA 4HOTA 1EYHA 3UT8A 2CFUA 4A1SA 4A55A 3QAQA 2LO6A 3UQ3A 2XEHA 3I5PA 5C2YA 2F37A 3CSTA 5CCMA 4F6RD 3NQPA 3C5RA 1SW6A 2KCKA 2I1JA 3DWLG 2YNQA 4GZ5A 1TYQG 4F3VA 2XRZA 1N95A 3LPZA 3IXEA 2E2EA 5A7DB 4HS2A 3RU0A 3BG0B 4DJAA 3UM2A 3DXMG 3URZA 2IONA 2XEVA 5G04J 1KZOA 3P1UA 2XZTG 1N4SA 3RRNB 4A63B 4MLPA 3KEZA 2UWJG 3QC1A 1E7VA 3CHPA 4V3IA 3DPYA 1S0PA 3UXGA 3D9IA 2CFZA 2KXPC 3APDA 4RG9A 3T5VA 2ETAA 2LSUA 2AWIA 5ANRA 3Q75A 3Q15A 1SZ9A 2VGYA 3HXBA 3RRUA 4D10C 1PY1A 5JHBA 4NIKA 5DIZA 3T5XA 4CYMD 1KT0A 1LD7A 1E8ZA 5HKPA 3PZ4A 2DBAA 3FH5A 4HI8A 1EF1C 4CDNA 3CGHA 3GYZA 4LNUD 3ZN3A 3QK0A 3AG2E 1YMPA 3EIJA 2IU1A 3APCA 3RO3A 5B1BE 4UWHA 1JCQA 4HQDA 4C9BB 3D9MA 2LNIA 2R02A 3ONKA 1JWFA 3FUJA 4APOA 3O48A 2X6FA 3B7RL 5EDSA 1RZ4A 1HG5A 3OTNA 1EPUA 3FP3A 3TWTA 5IY5E 2PQNA 3C98A 3AAAC 5FWQA 3ABME 4OAVB 5BW8C 4NRHB 1OCCE 3ESKA 1LTXA 4K5AB 1FT2A 2AXVA 1E8WA 3MGBA 3RAUA 4N3BA 4GMRA 5B3SE 4Q96A 4M3OA 4BY6A 4N5QA 4L2YA 4YVOA 4AVXA 2XENA 3GZ1A 4TXPA 3ZGQA 3ASDA 4HRLA 2DYRE 3G2UA 5FTPA 3S2AA 4FADA 4AOFA 3PUKA 1TJCA 2JABA 1SA5A 4U7EB 1MX4A 3ZXPA 4Q69A 4ILIA 4GA0A 3ZRHA 1IHBA 3CQGB 2YQ8A 3UUXA 4HORA 3KEAA 3DBSA 1MYOA 5T3RA 3JQ1A 2XS8A 4U0UA 5B1AE 4U8HA 2EIME 3V30A 5AIJA 2LXMA 4AY6A 5JJ7A 2WMNA 3MKQA 4WWOA 3ESLA 5ENPD 1UOHA 3CSFA 4I6EA 4G23A 4JB8P 3TL5A 2IQCA 4ANXA 4Z68A 2AW6A 2MOWA 2WXKA 3ULEG 2CHZA 2H6FA 2BEDA 1HU3A 2J8SD 3D9HA 3FUIA 3BEEA 3QKYA 4ILGA 4L1BA 1FT1A 4XIFA 1WAO1 4I2WA 3KSQA 2X6IA 3G2SA 5EYPF 2F0YA 4I2ZA 4H7XA 4HI9A 1H2UA 3V79K 2VGEA 5FJYA 4CEMA 4F7AA 4GCOA 4NACA 4DPRA 2IEJA 3ZHEA 3Q5MA 3CHQA 3VTYA 4PUCA 3FU6A 3U4TA 5JHAA 4HLEA 5AJLA 1QQEA 1G3NB 3B7UX 4A3VA 2ZU6B 3HXFA 4JHKA 1U2VG 2V5QC 2X6JA 3ZPJA 3V2OA 3KSLA 3L9TA 4U8YD 3MKQB 1E8YA 1D9SA 3B7BA 3MA5A 4HFGA 1N0QA 3L08A 3EHMA 2X6KA 4WWPA 4DUIA 1Y8MA 4GTTA 3ZEFA 2L6JA 3DSSA 5CHEE 1N52A 4XI9A 4PDXA 1H19A 4GTSA 4ILHB 3SO8A 1IKND 1YCSB 2IJGX 2XZDG 1S64A 5AAOA 5JMND 4U95D 5T8IA 3FWVA 4GYYA 1Y6IA 3CK8A 5D0OD 3APFA 2RFMA 5FT9A 1UJKA 2KATA 3ASFA 4G2VA 4ACKA 5LX8A 2R59A 5A6CA 1Z3YA 2CHWA 3MEKA 2L9BA 3QWVA 2NC9A 3U9WA 4LNBA 3E30A 3DSUA 4XKBA 3ZHEB 3PREA 4MKTA 1SZAA 4YDWA 1TNBA 4BX9A 2L6BA 4TV3A 2IY0C 5CECB 3F6QA 3E32A 3MCXA 1TR4A 4G8KA 1IXVA 3RSEG 1IHGA 2P9KG 4I43A 3QWPA 5BT1A 2HO1A 4EZLA 4HRNA 3K9IA 3QB2A 2XS1A 3UKRG 1UJJA 1N94A 1V55E 4L9PA 5CMWA 3SF4A 4BTBA 3LDZA 3PZ1A 3I3NA 1N11A 1HO8A 4GB9A 5T4YA 4N2SA 5J90A 2R5SA 4B8AA 4UI9K 2BF0X 5HI7A 4WWNA 1JCSA 1N9AA 3ZYQA 5AQBA 1SVXA 3PVLA 4FJYA 3LCAA 3VLFA 3EDTB 4RG6A 3SFYA 2R17C 3NF1A 4UUCA 1MZCA 1BLXB 4KVMA 4ACLA 3DXKG 3VLDA 1NA3A 3KD7A 2Y4UA 4JA7A 3QNKA 2OOEA 2LUHA 4C0MA 4PS3A 5ENNA 2WM9A 4FHKA 1S63A 2ETCA 2F8YA 2FF4A 3FU5A 2OEVA 4J8EA 3FH7A 2ZISA 3AJIA 4N5CA 2WXIA 3CVWA 4KT6B 3R7RA 4ME2A 4I6JA 1ELRA 4L2LA 3RJVA 3D9LA 1DCQA 4JA9A 3TWWA 3EIQC 3PZ3A 3TXNA 3EUVA 2V5FA 2KCVA 5ENOD 4KYOB 4I6GA 4RSYA 3RK6A 4E6HA 3FTUA 3ISMC 4XX5A 3LVRE 4GMJA 3AG3E 4JHJA 3FUDA 2CHXA 4GTMA 3BG1B 1D8DA 3FDHA 2IF4A 3CVYA 2X38A 3DEOA 4G25A 3TJPA 5CEDB 2LXLA 3JUIA 4OAUC 3HVEA 5KJNA 4NURA 3TG4A 2WXQA 5JJ6A 2FEZA 2CG2A 4DI4A 2QFCA 3FTWA 1NZNA 3PNLB 3SHFA 1INZA 2WQ7A 1K1AA 3AU5A 1TN7A 4MS6A 2A5EA 4WNDA 2H6IA 3S7JA 2Q7FA 3FHEA 4AP2A 4HOSA 2I1KA 4EBAA 3NOGD 5G05J 5EYLA 5EX3A 2VTBA 4FU3A 1N4QA 2VSYA 4CZ2D 3PH0C 5A23A 3FTYA 1DVPA 3P2BA 4EECA 4LG6A 3UTMA 1LD8A 5FQ4A 2C2LA 3AG4E 3RKVA 2RG8A 2OVFA 3G2TA 1UN9A 4JPSA 2WVIA 3MX3A 4G26A 3UX4A 3QDNA 4OYSA 5KNHD 1IQUA 3WG7E 3IV0A 3TGOA 4RVBA 3TWUA 3FTSA 1WG0A 4O1OA 2PM6A 3S7FA 5JA4D 3IBEA 2EILE 1BD8A 4CGVA 3Q7FA 3FUNA 5FQ8A 4ATGA 4B8CB 4JEHA 3DRAA 1P5QA 3HVEB 3Q79A 1U3DA 5FZRA 5HS0A 4GZ6A 5G55A 3V2XA 4OVUA 3C3OA 2MYOA 2A4ZA 2PZIA 5J08A 4OVVA 5D0QD 3HHMA 2HYZA 2JEKA 2PQRA 4DX5D 3GW4A 2VYIA 4Y6CA 2ZXWE 3DSTA 1BI8B 4XEIG 3LJ3A 4TXRA 4PH4B 2L0TB 3CHOA 4GPKA 4XZ4A 2P9SG 4CT4A 2GGFA 2ZGDA 4NQ0A 4EHMA 3CKBA 4HNAD 4YDYA 2XPIA 2VTBB 4U63A 2XCBA 2DIWA 4YVQC 4BFRA 3CVLA 4K5CA 4DLOA 1K3ZD 3ASGA 3L17A 2B0OE 3AG1E 4K0RA 4GU5A 4DX1A 3ABLE 4QQIA 1TJFA 2V4LA 3TWVA 3D9NA 3FUKA 3E4BA 3B95A 3LVQE 2ZIRA 2J09A 2L0IA 5FQ7A 1AWCB 2C0LA 4C48B 2GRMA 3PS6A 2IOSA 1KPSB 1Q2ZA 3FEXA 4GTQA 3WXXA 1MX2A 2P58C 2M63A 3HDXA 3T8MA 2MHKA 1H6OA 2P9UG 3Q49B 2KCLA 3W9GA 3Q9NC 2IO2C 1H6PA 1OWMA 4CRWA 3ZFWA 1Z3XA 2AVPA 3QWWA 1O1SA 3SQVA 3ML8A 2P9PG 2QY7A 4GZDA 3J5QB 3CQCB 1DNPA 3CVUA 4HXIA 3JXJA 4DK5A 1OT8A 4G11A 1XGWA 3AS4A 2XPYA 4UWFA 1UG3A 2WXRA 3UIOC 2HE0A 3ML9A 1ELWA 3BU8A 2XPZA 3LY7A 3SBTB 2QZAA 4KXKB 3CK9A 5BUZA 2WXJA 5G04C 3JYSA 4URKA 1SA4A 1O5MA 1D8EA 4U04A 4UI9J 1DC2A 2FULA 1L5JA 5G05C 4UQZA 3CIAA 4O60A 5AN8A 2QYUA 2WXHA 3CVPA 2P9LG 3TWXA 1N4RA 3L6AA 2OVBA 3NB2A 1RW2A 3LEWA 3Q73A 4HOUA 1WDYA 4I1AA 3U66A 1MHQA 2J4BA 4LEUA 5BXUA 4F53A 1TNYA 2UY1A 4FC8A 4JD2G 2BKKB 3EHNA 2YHEA 1TNOA 1FVFA 2WMOA 3DSXA 4O6FA 3CR3A 3LJNA 3DEPA 5CRVA 4I1MA 4J8SA 4HRMB 2A5UA 1MQSA 3MZLB 4LSZE 5DBKA 1E90A 3UM1A 2GW1A 3UMVA 4DX2A 4LCTA 3IEGA 2FBNA 4ZFHA 3GZ2A 4HOQA 3FTXA 2ILRA 3JQ0A 4K5BA 3AS8A 3GZSA 4Y6WA 2YINA 1OWNA 3QARA 1GW6A 5FZQA 2I9CA 3E34A 3B7TA 5HQ8A 4X8QA 3EU5A 2F8XK 2MRIA 2PNNA 1X5BA 2LAHA 4Q94A 3R7QA 3CHSA 2UY1B 5BNWA 3RIBA 4N2QA 5EIBE 4UWGA 4F1PA 2BKGA 1KZPA 3NZUA 5LOZA 3OXLA 4IULA 2KM4A 4GYOA 5EKQD 4N3AA 4C0EA 1FVHA 1MX6A 1HH8A 5CBNA 4UWKA 2EIKE 3RO2A 3JCKC 3T8KA 4O1PA 2DVWA 5CERB 3SD5A 4P29A 3TAXA 4ATZD 4LUNU 3EJNA 3SBSA 4U0ZA 1O1TA 5FINA 5C1DA 2OCCE 3MV3B 4XE0A 3MJWA 3L82A 4A1GA 2NYJA 3MKRA 1OWPA 3B7SA 2H6HA 4ABNA 4EBAG 2FI7A 3PZ2A 3V31A 3AU4A 1HE8A 1KLXA 5E76A 4GTPA 4WNGA 2OV8A 3VLEA 1HG2A 1QYMA 3KAEA 3SY2A 1YYHA 4WNEA 3MYVA 3N71A 5BXOA 1NA0A 3ASNE 4MRUA 2WXPA 4GMLA 1MJ0A 2V4HC 4LRZA 4B0ZA 4J6IA 1LF8A 2XGOA 1EDUA 2XRYA 4N39A 4FJZA 3CEQA 2V8SE 3LYAA 1TNUA 5E75A 3BQOA 3IHYA 3ZNGA 2EQXA 3CVXA 4TUUA 3S7BA 1IQRA 2VGXA 5KJKA 3G2VA 3NOCD 3UI2A 4G24A 5ENQD 3D9OA 4EPZA 3OXGA 4IRUA 4W9RA 4J0UA 3TG5A 1SQMA 5BV1A 3CLJA 2Y3AA 3ZIMA 3UPVA 2RKKA 3L22A 4B89A 1H2TC 3ASHA 3PUJA 3JUEA 2R05A 5KNGA 3PNTB 2DZNA 2WQHA 1X81A 3L16A 4G1TA 4AIFA 5ARFA 3MV2B 1Z6TA 5EILA 1HF8A 5BPPA 2RD0A 4J8FA 1BI7B 5CCLA 2J49A 1QBQA 2ONDA 4GTVA 1Z5SC 5JJTA 1AP7A 4GCNA 3CHRA 4ANUA 1OCRE 3E37A 4APFA 4I9EA 3HIZA 3CK7A 4U07A 3PZDA 2WXFA 4DI3A 5FIOA 1WY6A 3B13A 2WXNA 1VDYA 1OXJA 1KT1A 2WXLA 3J5PA 5CRUA 2VGXB 3SI5A 1OUVA 2WPVA 2DYSE 3UT7A 3W9FA 5ARGA 4AXHA 3CKCA 5KJLA 2GRPB 3ZUVB 2X3MA 2XQ0A 5FZSA 3Q9UC 2EINE 4CT0A 3FUMA 3DSVA 1DCEA 3QOUA 3FULA 3FUHA 4GPMA 3UT4A 4JL0A 3HXEA 3UIPC 2NSZA 4JEUA 4FA6A 4F1SA 4BERA 2IO3C 3E33A 2GRLA 5KCMA 3CV0A 5AJDA 2FO7A 1W3BA 4EQFA 3ZYLA 2AXUA 2Y69E 1TEZA 1JPLA 2ZGGA 4FULA 3FEYA 4ANWA 1K1BA 3ZYKA 3KS2A 2R2LA 4EZKA 4KZ0A 5D2MC 5BV0A 4LNGA 5H7PA 2X6HA 4J8YA 3LY9A 3FUFA 3UM3A 1UW4B 3LXUX 2KZTA 3ULQA 1ZBPA 3R9AB 4FP7A 3U64A 1ELKA 3FUEA 3ZU7B 4H7YA 3EU9A 4UWLA 4HBDA 3U3WA 3PEVB 2HR2A 3OXFA 3ENEA 2LAIA 1BU9A 3HXDA 4UQXA 1FCHA 2VJ8A 3PE4A 3TXMA 2C0MA 1U3CA 2I2OA 2CG3A 3IKOB 2GROB 2WXGA 1V54E 3C3QA 4JHRA 2WXOA 5LFAA 1QZ2A 2XHEA 3HYMB 5AQ7A 4HVBA 4GYWA 3LKUA 5AARA 2DCPA 2P2CP 2VSXE 2JLBA 3ASOE 4RQIA 4L23A 5KBAA 3UINC 4M7CA 2WXMA 3ZXSA 3CHMA 5HRYA 2EIJE 4QFVA 2GRQB 5G2NA 4BSZB 1PAQA 4GZ3A 1WM5A 1HFAA 3I4RB 4KMOA 4PS8A 3ZYMA 2I6HA 1K8KG 3TWSA 4AY5A 1JUQA 2J08A 3AS5A 4TXQA 3X2QE 3UKUG 3T9KA 1H2VC 2DZOA 2KZTB 1OCZE 3TWRA 4FLBA 5AENA 4AEZC 4BX8A 3FFLA 4IN3B 4JXTA 5AQ9A 1OWLA 4CDRA 4BTAA 2AJAA 3HRAA 3ZVVA 4XI0A 3FY4A 4DLQA 3PE3A 3HXCA 1ZU2A 4GZCA 2AXZA 4L7TA 1NP7A 4GA1A 4YDOA 4BWRA 2P9IG 1E8XA 1JCRA 1FPPA 5ENTD 1NL4A 3SFZA 5EX0A 4HLLA 5LCWJ 4U96D 3SFXA 3CVNA 4MBGA 1UN8A 3Q7AA 3ABKE 1XNFA 4YDEA 4ZHBA 2BUGA 4J8DA 3FH8A 5EIDA 3HG0D 1E7UA 3R9MA 2QYJA 1B89A 3D9PA 1A17A 4FLHA 1HZ4A 2KC7A 2VQ2A 1OY3D 3D3MA 3EHRA 4N3CA 4CCAA 3D9JA 2YHCA 1NI1A 4JVSA 4BT8A 5CMYA 4BSXA 3ONLA 4XKCA 5LP0A 4I1OB 4FHJA 4DX6D 2E0IA 4KZCA 4ANVA 3BUAA 3FU0A 3RRMB 2H6GA 3LS8A 1YA0A 3CVQA 2ETBA 3NBNB 3C72A 1N54A 4TRQA 1H0AA 1N0RA 3DPDA 4IYPA 2PM7A 1N4PA 2BTDA 4B93B 2XCCA 3QJZA 4AJWA 5EN5D 4YNDA 3VTXA
chains in the Genus database with same CATH topology
2BKGA 5JMND 4U95D 2XZTG 3AAAC 3HRAA 4BESA 4OAVB 3EHQA 4DX5D 4A63B 2BKKB 3W9FA 5AQAA 1S70B 2RFMA 3ZU7B 2J8SD 3D9HA 4UUCA 3J5QB 3EU9A 4HBDA 4BETA 3NOCD 1BLXB 3ZUVB 1BI8B 4K5AB 5D66A 3JXJA 3UI2A 3UXGA 2FO1E 3Q9UC 5ENQD 5ITZF 1OT8A 2Y0BG 4DRXE 1MX6A 2KXPC 5EYPF 1BU9A 3ZKJA 3LJNA 1K1AA 2Y1LE 5ENTD 2ETAA 5CBNA 4GMRA 2A5EA 4HLLA 3T8KA 4U96D 4O1PA 2DVWA 3DEPA 2ZGDA 4HI9A 5CERB 2HE0A 4HNAD 4TUMA 4YDYA 4GPMA 3V79K 3JXIA 2VGEA 4DX7D 4G8LA 2ETCA 2F8YA 3NOGD 4ATZD 4HRMB 4ZHBA 4J7WA 4U8VD 5EYLA 4RLYA 4K5CA 4LSZE 3JUEA 4HB5A 4N5QA 5EIDA 5KNGA 3HG0D 4NIKA 1K3ZD 4YDWA 2XENA 2QYJA 5FINA 3AJIA 4CYMD 2DZNA 2B0OE 4HRLA 5EN5D 3TWQA 2L6BA 4BERA 4CZ2D 5CEAA 5AQ7A 5HKPA 4LG6A 5ENRD 1OY3D 5CECB 4DX2A 2NYJA 4HI8A 3F6QA 5EILA 5AARA 3UTMA 4DX1A 2JABA 4QQIA 1DCQA 2P2CP 4ZFHA 3EHRA 3TWVA 1MX4A 3TWWA 1TR4A 5KBAA 4G8KA 1IXVA 1DC2A 4LNUD 1BI7B 2DWZA 1IHBA 4O60A 1G3NB 1YMPA 3B95A 4K5BA 5AN8A 3V31A 2ZGGA 5HRYA 1NFIE 5KWDA 5KNHD 2XEHA 4QFVA 3KEAA 1AWCB 1MYOA 4C48B 5ENOD 3TWUA 4BSZB 2F37A 2V5QC 4HRNA 1AP7A 4HQDA 1WG0A 4O1OA 3V2OA 4F6RD 4U8YD 2XEEA 1K1BA 1QYMA 5JA4D 1D9SA 5ENSD 3V30A 3C5RA 4DX6D 1YYHA 3B7BA 3TWXA 1SW6A 1MX2A 1A5EA 1N0QA 3TWSA 5BXOA 5EIBE 1BD8A 4BEPA 3IXEA 1N11A 1WDYA 1MJ0A 3T9KA 2DZOA 2RFAA 2V4HC 2ETBA 4DUIA 5ENPD 3NBNB 2F8XK 4J8YA 2PNNA 5FIOA 1UOHA 2QC9A 5HS0A 3TWRA 3DEOA 5CEDB 3V2XA 3W9GA 1N0RA 2KBXA 3Q9NC 3SO8A 4OAUC 2MYOA 1IKND 1YCSB 5AQBA 1SVXA 3TWTA 2XZDG 5BXUA 5AQ9A 4JB8P 3J5PA 4B93B 3ZNGA 2AJAA 4Z68A 5AAOA 4F1PA 5CBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKG A;  5JMN D;  4U95 D;  2XZT G;  3AAA C;  3HRA A;  4BES A;  4OAV B;  3EHQ A;  4DX5 D;  4A63 B;  2BKK B;  3W9F A;  5AQA A;  1S70 B;  2RFM A;  3ZU7 B;  2J8S D;  3D9H A;  4UUC A;  3J5Q B;  3EU9 A;  4HBD A;  4BET A;  3NOC D;  1BLX B;  3ZUV B;  1BI8 B;  4K5A B;  5D66 A;  3JXJ A;  3UI2 A;  3UXG A;  2FO1 E;  3Q9U C;  5ENQ D;  5ITZ F;  1OT8 A;  2Y0B G;  4DRX E;  1MX6 A;  2KXP C;  5EYP F;  1BU9 A;  3ZKJ A;  3LJN A;  1K1A A;  2Y1L E;  5ENT D;  2ETA A;  5CBN A;  4GMR A;  2A5E A;  4HLL A;  3T8K A;  4U96 D;  4O1P A;  2DVW A;  3DEP A;  2ZGD A;  4HI9 A;  5CER B;  2HE0 A;  4HNA D;  4TUM A;  4YDY A;  4GPM A;  3V79 K;  3JXI A;  2VGE A;  4DX7 D;  4G8L A;  2ETC A;  2F8Y A;  3NOG D;  4ATZ D;  4HRM B;  4ZHB A;  4J7W A;  4U8V D;  5EYL A;  4RLY A;  4K5C A;  4LSZ E;  3JUE A;  4HB5 A;  4N5Q A;  5EID A;  5KNG A;  3HG0 D;  4NIK A;  1K3Z D;  4YDW A;  2XEN A;  2QYJ A;  5FIN A;  3AJI A;  4CYM D;  2DZN A;  2B0O E;  4HRL A;  5EN5 D;  3TWQ A;  2L6B A;  4BER A;  4CZ2 D;  5CEA A;  5AQ7 A;  5HKP A;  4LG6 A;  5ENR D;  1OY3 D;  5CEC B;  4DX2 A;  2NYJ A;  4HI8 A;  3F6Q A;  5EIL A;  5AAR A;  3UTM A;  4DX1 A;  2JAB A;  4QQI A;  1DCQ A;  2P2C P;  4ZFH A;  3EHR A;  3TWV A;  1MX4 A;  3TWW A;  1TR4 A;  5KBA A;  4G8K A;  1IXV A;  1DC2 A;  4LNU D;  1BI7 B;  2DWZ A;  1IHB A;  4O60 A;  1G3N B;  1YMP A;  3B95 A;  4K5B A;  5AN8 A;  3V31 A;  2ZGG A;  5HRY A;  1NFI E;  5KWD A;  5KNH D;  2XEH A;  4QFV A;  3KEA A;  1AWC B;  1MYO A;  4C48 B;  5ENO D;  3TWU A;  4BSZ B;  2F37 A;  2V5Q C;  4HRN A;  1AP7 A;  4HQD A;  1WG0 A;  4O1O A;  3V2O A;  4F6R D;  4U8Y D;  2XEE A;  1K1B A;  1QYM A;  5JA4 D;  1D9S A;  5ENS D;  3V30 A;  3C5R A;  4DX6 D;  1YYH A;  3B7B A;  3TWX A;  1SW6 A;  1MX2 A;  1A5E A;  1N0Q A;  3TWS A;  5BXO A;  5EIB E;  1BD8 A;  4BEP A;  3IXE A;  1N11 A;  1WDY A;  1MJ0 A;  3T9K A;  2DZO A;  2RFA A;  2V4H C;  2ETB A;  4DUI A;  5ENP D;  3NBN B;  2F8X K;  4J8Y A;  2PNN A;  5FIO A;  1UOH A;  2QC9 A;  5HS0 A;  3TWR A;  3DEO A;  5CED B;  3V2X A;  3W9G A;  1N0R A;  2KBX A;  3Q9N C;  3SO8 A;  4OAU C;  2MYO A;  1IKN D;  1YCS B;  5AQB A;  1SVX A;  3TWT A;  2XZD G;  5BXU A;  5AQ9 A;  4JB8 P;  3J5P A;  4B93 B;  3ZNG A;  2AJA A;  4Z68 A;  5AAO A;  4F1P A;  5CBO A; 
#chains in the Genus database with same CATH topology
 3SNX A;  3EHQ A;  2WB2 A;  1E96 B;  2IFU A;  2XGS A;  1HX8 A;  1HXI A;  3I4G A;  2VSO E;  4K03 A;  4B94 A;  2HM8 A;  4GA2 A;  3C3R A;  2XGM A;  4TUM A;  3DSW A;  1H6K A;  4G8L A;  4GTR A;  3FTZ A;  4J7W A;  4U8V D;  1QNF A;  1TN6 A;  4HB5 A;  4AM9 A;  4KBQ A;  2P9N G;  5AYW D;  2J07 A;  4WNF A;  3G2W A;  2LSV A;  2Y4T A;  4LER A;  1HS6 A;  2J9Q A;  3OAW A;  1ZB1 A;  3NZS A;  4CGW A;  4PS7 A;  2DWZ A;  3Q4A B;  2IOL A;  5KWD A;  1NFI E;  3LY8 A;  1BPO A;  4KVO A;  2XEE A;  1TNZ A;  5ENS D;  3S7D A;  3NAW A;  1A5E A;  2OEW A;  4JC8 A;  4BT9 A;  3CVV A;  4BEP A;  1O1R A;  3O4Z A;  2RFA A;  4E85 A;  5M72 A;  1TN8 A;  2QC9 A;  3ULY A;  4EZJ A;  2KBX A;  3SGH A;  2J4D A;  3D9K A;  3PRZ A;  5FQ6 A;  4CDM A;  5CBO A;  3UM0 A;  2GRN B;  3Q78 A;  4BES A;  1IYG A;  5AQA A;  1S70 B;  1OCO E;  2GRR B;  2B6C A;  4I17 A;  3L13 A;  4UI9 C;  4A3T A;  3IHV A;  3PEU B;  4BET A;  5KJM A;  2WQ6 A;  4WUY A;  5D66 A;  2FO1 E;  2V0P A;  5ITZ F;  2Y0B G;  4DRX E;  3Q47 B;  4R7L A;  3ZKJ A;  3L54 A;  3SZ7 A;  4WAF A;  2PL2 A;  2Y1L E;  2NXP A;  3JXI A;  4DX7 D;  4GAA A;  4U0S A;  4GTO A;  4RLY A;  3ZW3 A;  4UQY A;  3FU3 A;  1OWO A;  3TWQ A;  5CEA A;  5ANL A;  1JWG A;  5ENR D;  4JW1 A;  5LCW C;  4AV7 A;  4JZY A;  1PC2 A;  2VSN A;  3PDN A;  2R03 A;  4I9C A;  3FTV A;  4HOT A;  1EYH A;  3UT8 A;  2CFU A;  4A1S A;  4A55 A;  3QAQ A;  2LO6 A;  3UQ3 A;  2XEH A;  3I5P A;  5C2Y A;  2F37 A;  3CST A;  5CCM A;  4F6R D;  3NQP A;  3C5R A;  1SW6 A;  2KCK A;  2I1J A;  3DWL G;  2YNQ A;  4GZ5 A;  1TYQ G;  4F3V A;  2XRZ A;  1N95 A;  3LPZ A;  3IXE A;  2E2E A;  5A7D B;  4HS2 A;  3RU0 A;  3BG0 B;  4DJA A;  3UM2 A;  3DXM G;  3URZ A;  2ION A;  2XEV A;  5G04 J;  1KZO A;  3P1U A;  2XZT G;  1N4S A;  3RRN B;  4A63 B;  4MLP A;  3KEZ A;  2UWJ G;  3QC1 A;  1E7V A;  3CHP A;  4V3I A;  3DPY A;  1S0P A;  3UXG A;  3D9I A;  2CFZ A;  2KXP C;  3APD A;  4RG9 A;  3T5V A;  2ETA A;  2LSU A;  2AWI A;  5ANR A;  3Q75 A;  3Q15 A;  1SZ9 A;  2VGY A;  3HXB A;  3RRU A;  4D10 C;  1PY1 A;  5JHB A;  4NIK A;  5DIZ A;  3T5X A;  4CYM D;  1KT0 A;  1LD7 A;  1E8Z A;  5HKP A;  3PZ4 A;  2DBA A;  3FH5 A;  4HI8 A;  1EF1 C;  4CDN A;  3CGH A;  3GYZ A;  4LNU D;  3ZN3 A;  3QK0 A;  3AG2 E;  1YMP A;  3EIJ A;  2IU1 A;  3APC A;  3RO3 A;  5B1B E;  4UWH A;  1JCQ A;  4HQD A;  4C9B B;  3D9M A;  2LNI A;  2R02 A;  3ONK A;  1JWF A;  3FUJ A;  4APO A;  3O48 A;  2X6F A;  3B7R L;  5EDS A;  1RZ4 A;  1HG5 A;  3OTN A;  1EPU A;  3FP3 A;  3TWT A;  5IY5 E;  2PQN A;  3C98 A;  3AAA C;  5FWQ A;  3ABM E;  4OAV B;  5BW8 C;  4NRH B;  1OCC E;  3ESK A;  1LTX A;  4K5A B;  1FT2 A;  2AXV A;  1E8W A;  3MGB A;  3RAU A;  4N3B A;  4GMR A;  5B3S E;  4Q96 A;  4M3O A;  4BY6 A;  4N5Q A;  4L2Y A;  4YVO A;  4AVX A;  2XEN A;  3GZ1 A;  4TXP A;  3ZGQ A;  3ASD A;  4HRL A;  2DYR E;  3G2U A;  5FTP A;  3S2A A;  4FAD A;  4AOF A;  3PUK A;  1TJC A;  2JAB A;  1SA5 A;  4U7E B;  1MX4 A;  3ZXP A;  4Q69 A;  4ILI A;  4GA0 A;  3ZRH A;  1IHB A;  3CQG B;  2YQ8 A;  3UUX A;  4HOR A;  3KEA A;  3DBS A;  1MYO A;  5T3R A;  3JQ1 A;  2XS8 A;  4U0U A;  5B1A E;  4U8H A;  2EIM E;  3V30 A;  5AIJ A;  2LXM A;  4AY6 A;  5JJ7 A;  2WMN A;  3MKQ A;  4WWO A;  3ESL A;  5ENP D;  1UOH A;  3CSF A;  4I6E A;  4G23 A;  4JB8 P;  3TL5 A;  2IQC A;  4ANX A;  4Z68 A;  2AW6 A;  2MOW A;  2WXK A;  3ULE G;  2CHZ A;  2H6F A;  2BED A;  1HU3 A;  2J8S D;  3D9H A;  3FUI A;  3BEE A;  3QKY A;  4ILG A;  4L1B A;  1FT1 A;  4XIF A;  1WAO 1;  4I2W A;  3KSQ A;  2X6I A;  3G2S A;  5EYP F;  2F0Y A;  4I2Z A;  4H7X A;  4HI9 A;  1H2U A;  3V79 K;  2VGE A;  5FJY A;  4CEM A;  4F7A A;  4GCO A;  4NAC A;  4DPR A;  2IEJ A;  3ZHE A;  3Q5M A;  3CHQ A;  3VTY A;  4PUC A;  3FU6 A;  3U4T A;  5JHA A;  4HLE A;  5AJL A;  1QQE A;  1G3N B;  3B7U X;  4A3V A;  2ZU6 B;  3HXF A;  4JHK A;  1U2V G;  2V5Q C;  2X6J A;  3ZPJ A;  3V2O A;  3KSL A;  3L9T A;  4U8Y D;  3MKQ B;  1E8Y A;  1D9S A;  3B7B A;  3MA5 A;  4HFG A;  1N0Q A;  3L08 A;  3EHM A;  2X6K A;  4WWP A;  4DUI A;  1Y8M A;  4GTT A;  3ZEF A;  2L6J A;  3DSS A;  5CHE E;  1N52 A;  4XI9 A;  4PDX A;  1H19 A;  4GTS A;  4ILH B;  3SO8 A;  1IKN D;  1YCS B;  2IJG X;  2XZD G;  1S64 A;  5AAO A;  5JMN D;  4U95 D;  5T8I A;  3FWV A;  4GYY A;  1Y6I A;  3CK8 A;  5D0O D;  3APF A;  2RFM A;  5FT9 A;  1UJK A;  2KAT A;  3ASF A;  4G2V A;  4ACK A;  5LX8 A;  2R59 A;  5A6C A;  1Z3Y A;  2CHW A;  3MEK A;  2L9B A;  3QWV A;  2NC9 A;  3U9W A;  4LNB A;  3E30 A;  3DSU A;  4XKB A;  3ZHE B;  3PRE A;  4MKT A;  1SZA A;  4YDW A;  1TNB A;  4BX9 A;  2L6B A;  4TV3 A;  2IY0 C;  5CEC B;  3F6Q A;  3E32 A;  3MCX A;  1TR4 A;  4G8K A;  1IXV A;  3RSE G;  1IHG A;  2P9K G;  4I43 A;  3QWP A;  5BT1 A;  2HO1 A;  4EZL A;  4HRN A;  3K9I A;  3QB2 A;  2XS1 A;  3UKR G;  1UJJ A;  1N94 A;  1V55 E;  4L9P A;  5CMW A;  3SF4 A;  4BTB A;  3LDZ A;  3PZ1 A;  3I3N A;  1N11 A;  1HO8 A;  4GB9 A;  5T4Y A;  4N2S A;  5J90 A;  2R5S A;  4B8A A;  4UI9 K;  2BF0 X;  5HI7 A;  4WWN A;  1JCS A;  1N9A A;  3ZYQ A;  5AQB A;  1SVX A;  3PVL A;  4FJY A;  3LCA A;  3VLF A;  3EDT B;  4RG6 A;  3SFY A;  2R17 C;  3NF1 A;  4UUC A;  1MZC A;  1BLX B;  4KVM A;  4ACL A;  3DXK G;  3VLD A;  1NA3 A;  3KD7 A;  2Y4U A;  4JA7 A;  3QNK A;  2OOE A;  2LUH A;  4C0M A;  4PS3 A;  5ENN A;  2WM9 A;  4FHK A;  1S63 A;  2ETC A;  2F8Y A;  2FF4 A;  3FU5 A;  2OEV A;  4J8E A;  3FH7 A;  2ZIS A;  3AJI A;  4N5C A;  2WXI A;  3CVW A;  4KT6 B;  3R7R A;  4ME2 A;  4I6J A;  1ELR A;  4L2L A;  3RJV A;  3D9L A;  1DCQ A;  4JA9 A;  3TWW A;  3EIQ C;  3PZ3 A;  3TXN A;  3EUV A;  2V5F A;  2KCV A;  5ENO D;  4KYO B;  4I6G A;  4RSY A;  3RK6 A;  4E6H A;  3FTU A;  3ISM C;  4XX5 A;  3LVR E;  4GMJ A;  3AG3 E;  4JHJ A;  3FUD A;  2CHX A;  4GTM A;  3BG1 B;  1D8D A;  3FDH A;  2IF4 A;  3CVY A;  2X38 A;  3DEO A;  4G25 A;  3TJP A;  5CED B;  2LXL A;  3JUI A;  4OAU C;  3HVE A;  5KJN A;  4NUR A;  3TG4 A;  2WXQ A;  5JJ6 A;  2FEZ A;  2CG2 A;  4DI4 A;  2QFC A;  3FTW A;  1NZN A;  3PNL B;  3SHF A;  1INZ A;  2WQ7 A;  1K1A A;  3AU5 A;  1TN7 A;  4MS6 A;  2A5E A;  4WND A;  2H6I A;  3S7J A;  2Q7F A;  3FHE A;  4AP2 A;  4HOS A;  2I1K A;  4EBA A;  3NOG D;  5G05 J;  5EYL A;  5EX3 A;  2VTB A;  4FU3 A;  1N4Q A;  2VSY A;  4CZ2 D;  3PH0 C;  5A23 A;  3FTY A;  1DVP A;  3P2B A;  4EEC A;  4LG6 A;  3UTM A;  1LD8 A;  5FQ4 A;  2C2L A;  3AG4 E;  3RKV A;  2RG8 A;  2OVF A;  3G2T A;  1UN9 A;  4JPS A;  2WVI A;  3MX3 A;  4G26 A;  3UX4 A;  3QDN A;  4OYS A;  5KNH D;  1IQU A;  3WG7 E;  3IV0 A;  3TGO A;  4RVB A;  3TWU A;  3FTS A;  1WG0 A;  4O1O A;  2PM6 A;  3S7F A;  5JA4 D;  3IBE A;  2EIL E;  1BD8 A;  4CGV A;  3Q7F A;  3FUN A;  5FQ8 A;  4ATG A;  4B8C B;  4JEH A;  3DRA A;  1P5Q A;  3HVE B;  3Q79 A;  1U3D A;  5FZR A;  5HS0 A;  4GZ6 A;  5G55 A;  3V2X A;  4OVU A;  3C3O A;  2MYO A;  2A4Z A;  2PZI A;  5J08 A;  4OVV A;  5D0Q D;  3HHM A;  2HYZ A;  2JEK A;  2PQR A;  4DX5 D;  3GW4 A;  2VYI A;  4Y6C A;  2ZXW E;  3DST A;  1BI8 B;  4XEI G;  3LJ3 A;  4TXR A;  4PH4 B;  2L0T B;  3CHO A;  4GPK A;  4XZ4 A;  2P9S G;  4CT4 A;  2GGF A;  2ZGD A;  4NQ0 A;  4EHM A;  3CKB A;  4HNA D;  4YDY A;  2XPI A;  2VTB B;  4U63 A;  2XCB A;  2DIW A;  4YVQ C;  4BFR A;  3CVL A;  4K5C A;  4DLO A;  1K3Z D;  3ASG A;  3L17 A;  2B0O E;  3AG1 E;  4K0R A;  4GU5 A;  4DX1 A;  3ABL E;  4QQI A;  1TJF A;  2V4L A;  3TWV A;  3D9N A;  3FUK A;  3E4B A;  3B95 A;  3LVQ E;  2ZIR A;  2J09 A;  2L0I A;  5FQ7 A;  1AWC B;  2C0L A;  4C48 B;  2GRM A;  3PS6 A;  2IOS A;  1KPS B;  1Q2Z A;  3FEX A;  4GTQ A;  3WXX A;  1MX2 A;  2P58 C;  2M63 A;  3HDX A;  3T8M A;  2MHK A;  1H6O A;  2P9U G;  3Q49 B;  2KCL A;  3W9G A;  3Q9N C;  2IO2 C;  1H6P A;  1OWM A;  4CRW A;  3ZFW A;  1Z3X A;  2AVP A;  3QWW A;  1O1S A;  3SQV A;  3ML8 A;  2P9P G;  2QY7 A;  4GZD A;  3J5Q B;  3CQC B;  1DNP A;  3CVU A;  4HXI A;  3JXJ A;  4DK5 A;  1OT8 A;  4G11 A;  1XGW A;  3AS4 A;  2XPY A;  4UWF A;  1UG3 A;  2WXR A;  3UIO C;  2HE0 A;  3ML9 A;  1ELW A;  3BU8 A;  2XPZ A;  3LY7 A;  3SBT B;  2QZA A;  4KXK B;  3CK9 A;  5BUZ A;  2WXJ A;  5G04 C;  3JYS A;  4URK A;  1SA4 A;  1O5M A;  1D8E A;  4U04 A;  4UI9 J;  1DC2 A;  2FUL A;  1L5J A;  5G05 C;  4UQZ A;  3CIA A;  4O60 A;  5AN8 A;  2QYU A;  2WXH A;  3CVP A;  2P9L G;  3TWX A;  1N4R A;  3L6A A;  2OVB A;  3NB2 A;  1RW2 A;  3LEW A;  3Q73 A;  4HOU A;  1WDY A;  4I1A A;  3U66 A;  1MHQ A;  2J4B A;  4LEU A;  5BXU A;  4F53 A;  1TNY A;  2UY1 A;  4FC8 A;  4JD2 G;  2BKK B;  3EHN A;  2YHE A;  1TNO A;  1FVF A;  2WMO A;  3DSX A;  4O6F A;  3CR3 A;  3LJN A;  3DEP A;  5CRV A;  4I1M A;  4J8S A;  4HRM B;  2A5U A;  1MQS A;  3MZL B;  4LSZ E;  5DBK A;  1E90 A;  3UM1 A;  2GW1 A;  3UMV A;  4DX2 A;  4LCT A;  3IEG A;  2FBN A;  4ZFH A;  3GZ2 A;  4HOQ A;  3FTX A;  2ILR A;  3JQ0 A;  4K5B A;  3AS8 A;  3GZS A;  4Y6W A;  2YIN A;  1OWN A;  3QAR A;  1GW6 A;  5FZQ A;  2I9C A;  3E34 A;  3B7T A;  5HQ8 A;  4X8Q A;  3EU5 A;  2F8X K;  2MRI A;  2PNN A;  1X5B A;  2LAH A;  4Q94 A;  3R7Q A;  3CHS A;  2UY1 B;  5BNW A;  3RIB A;  4N2Q A;  5EIB E;  4UWG A;  4F1P A;  2BKG A;  1KZP A;  3NZU A;  5LOZ A;  3OXL A;  4IUL A;  2KM4 A;  4GYO A;  5EKQ D;  4N3A A;  4C0E A;  1FVH A;  1MX6 A;  1HH8 A;  5CBN A;  4UWK A;  2EIK E;  3RO2 A;  3JCK C;  3T8K A;  4O1P A;  2DVW A;  5CER B;  3SD5 A;  4P29 A;  3TAX A;  4ATZ D;  4LUN U;  3EJN A;  3SBS A;  4U0Z A;  1O1T A;  5FIN A;  5C1D A;  2OCC E;  3MV3 B;  4XE0 A;  3MJW A;  3L82 A;  4A1G A;  2NYJ A;  3MKR A;  1OWP A;  3B7S A;  2H6H A;  4ABN A;  4EBA G;  2FI7 A;  3PZ2 A;  3V31 A;  3AU4 A;  1HE8 A;  1KLX A;  5E76 A;  4GTP A;  4WNG A;  2OV8 A;  3VLE A;  1HG2 A;  1QYM A;  3KAE A;  3SY2 A;  1YYH A;  4WNE A;  3MYV A;  3N71 A;  5BXO A;  1NA0 A;  3ASN E;  4MRU A;  2WXP A;  4GML A;  1MJ0 A;  2V4H C;  4LRZ A;  4B0Z A;  4J6I A;  1LF8 A;  2XGO A;  1EDU A;  2XRY A;  4N39 A;  4FJZ A;  3CEQ A;  2V8S E;  3LYA A;  1TNU A;  5E75 A;  3BQO A;  3IHY A;  3ZNG A;  2EQX A;  3CVX A;  4TUU A;  3S7B A;  1IQR A;  2VGX A;  5KJK A;  3G2V A;  3NOC D;  3UI2 A;  4G24 A;  5ENQ D;  3D9O A;  4EPZ A;  3OXG A;  4IRU A;  4W9R A;  4J0U A;  3TG5 A;  1SQM A;  5BV1 A;  3CLJ A;  2Y3A A;  3ZIM A;  3UPV A;  2RKK A;  3L22 A;  4B89 A;  1H2T C;  3ASH A;  3PUJ A;  3JUE A;  2R05 A;  5KNG A;  3PNT B;  2DZN A;  2WQH A;  1X81 A;  3L16 A;  4G1T A;  4AIF A;  5ARF A;  3MV2 B;  1Z6T A;  5EIL A;  1HF8 A;  5BPP A;  2RD0 A;  4J8F A;  1BI7 B;  5CCL A;  2J49 A;  1QBQ A;  2OND A;  4GTV A;  1Z5S C;  5JJT A;  1AP7 A;  4GCN A;  3CHR A;  4ANU A;  1OCR E;  3E37 A;  4APF A;  4I9E A;  3HIZ A;  3CK7 A;  4U07 A;  3PZD A;  2WXF A;  4DI3 A;  5FIO A;  1WY6 A;  3B13 A;  2WXN A;  1VDY A;  1OXJ A;  1KT1 A;  2WXL A;  3J5P A;  5CRU A;  2VGX B;  3SI5 A;  1OUV A;  2WPV A;  2DYS E;  3UT7 A;  3W9F A;  5ARG A;  4AXH A;  3CKC A;  5KJL A;  2GRP B;  3ZUV B;  2X3M A;  2XQ0 A;  5FZS A;  3Q9U C;  2EIN E;  4CT0 A;  3FUM A;  3DSV A;  1DCE A;  3QOU A;  3FUL A;  3FUH A;  4GPM A;  3UT4 A;  4JL0 A;  3HXE A;  3UIP C;  2NSZ A;  4JEU A;  4FA6 A;  4F1S A;  4BER A;  2IO3 C;  3E33 A;  2GRL A;  5KCM A;  3CV0 A;  5AJD A;  2FO7 A;  1W3B A;  4EQF A;  3ZYL A;  2AXU A;  2Y69 E;  1TEZ A;  1JPL A;  2ZGG A;  4FUL A;  3FEY A;  4ANW A;  1K1B A;  3ZYK A;  3KS2 A;  2R2L A;  4EZK A;  4KZ0 A;  5D2M C;  5BV0 A;  4LNG A;  5H7P A;  2X6H A;  4J8Y A;  3LY9 A;  3FUF A;  3UM3 A;  1UW4 B;  3LXU X;  2KZT A;  3ULQ A;  1ZBP A;  3R9A B;  4FP7 A;  3U64 A;  1ELK A;  3FUE A;  3ZU7 B;  4H7Y A;  3EU9 A;  4UWL A;  4HBD A;  3U3W A;  3PEV B;  2HR2 A;  3OXF A;  3ENE A;  2LAI A;  1BU9 A;  3HXD A;  4UQX A;  1FCH A;  2VJ8 A;  3PE4 A;  3TXM A;  2C0M A;  1U3C A;  2I2O A;  2CG3 A;  3IKO B;  2GRO B;  2WXG A;  1V54 E;  3C3Q A;  4JHR A;  2WXO A;  5LFA A;  1QZ2 A;  2XHE A;  3HYM B;  5AQ7 A;  4HVB A;  4GYW A;  3LKU A;  5AAR A;  2DCP A;  2P2C P;  2VSX E;  2JLB A;  3ASO E;  4RQI A;  4L23 A;  5KBA A;  3UIN C;  4M7C A;  2WXM A;  3ZXS A;  3CHM A;  5HRY A;  2EIJ E;  4QFV A;  2GRQ B;  5G2N A;  4BSZ B;  1PAQ A;  4GZ3 A;  1WM5 A;  1HFA A;  3I4R B;  4KMO A;  4PS8 A;  3ZYM A;  2I6H A;  1K8K G;  3TWS A;  4AY5 A;  1JUQ A;  2J08 A;  3AS5 A;  4TXQ A;  3X2Q E;  3UKU G;  3T9K A;  1H2V C;  2DZO A;  2KZT B;  1OCZ E;  3TWR A;  4FLB A;  5AEN A;  4AEZ C;  4BX8 A;  3FFL A;  4IN3 B;  4JXT A;  5AQ9 A;  1OWL A;  4CDR A;  4BTA A;  2AJA A;  3HRA A;  3ZVV A;  4XI0 A;  3FY4 A;  4DLQ A;  3PE3 A;  3HXC A;  1ZU2 A;  4GZC A;  2AXZ A;  4L7T A;  1NP7 A;  4GA1 A;  4YDO A;  4BWR A;  2P9I G;  1E8X A;  1JCR A;  1FPP A;  5ENT D;  1NL4 A;  3SFZ A;  5EX0 A;  4HLL A;  5LCW J;  4U96 D;  3SFX A;  3CVN A;  4MBG A;  1UN8 A;  3Q7A A;  3ABK E;  1XNF A;  4YDE A;  4ZHB A;  2BUG A;  4J8D A;  3FH8 A;  5EID A;  3HG0 D;  1E7U A;  3R9M A;  2QYJ A;  1B89 A;  3D9P A;  1A17 A;  4FLH A;  1HZ4 A;  2KC7 A;  2VQ2 A;  1OY3 D;  3D3M A;  3EHR A;  4N3C A;  4CCA A;  3D9J A;  2YHC A;  1NI1 A;  4JVS A;  4BT8 A;  5CMY A;  4BSX A;  3ONL A;  4XKC A;  5LP0 A;  4I1O B;  4FHJ A;  4DX6 D;  2E0I A;  4KZC A;  4ANV A;  3BUA A;  3FU0 A;  3RRM B;  2H6G A;  3LS8 A;  1YA0 A;  3CVQ A;  2ETB A;  3NBN B;  3C72 A;  1N54 A;  4TRQ A;  1H0A A;  1N0R A;  3DPD A;  4IYP A;  2PM7 A;  1N4P A;  2BTD A;  4B93 B;  2XCC A;  3QJZ A;  4AJW A;  5EN5 D;  4YND A;  3VTX A; 
#chains in the Genus database with same CATH homology
 2BKG A;  5JMN D;  4U95 D;  2XZT G;  3AAA C;  3HRA A;  4BES A;  4OAV B;  3EHQ A;  4DX5 D;  4A63 B;  2BKK B;  3W9F A;  5AQA A;  1S70 B;  2RFM A;  3ZU7 B;  2J8S D;  3D9H A;  4UUC A;  3J5Q B;  3EU9 A;  4HBD A;  4BET A;  3NOC D;  1BLX B;  3ZUV B;  1BI8 B;  4K5A B;  5D66 A;  3JXJ A;  3UI2 A;  3UXG A;  2FO1 E;  3Q9U C;  5ENQ D;  5ITZ F;  1OT8 A;  2Y0B G;  4DRX E;  1MX6 A;  2KXP C;  5EYP F;  1BU9 A;  3ZKJ A;  3LJN A;  1K1A A;  2Y1L E;  5ENT D;  2ETA A;  5CBN A;  4GMR A;  2A5E A;  4HLL A;  3T8K A;  4U96 D;  4O1P A;  2DVW A;  3DEP A;  2ZGD A;  4HI9 A;  5CER B;  2HE0 A;  4HNA D;  4TUM A;  4YDY A;  4GPM A;  3V79 K;  3JXI A;  2VGE A;  4DX7 D;  4G8L A;  2ETC A;  2F8Y A;  3NOG D;  4ATZ D;  4HRM B;  4ZHB A;  4J7W A;  4U8V D;  5EYL A;  4RLY A;  4K5C A;  4LSZ E;  3JUE A;  4HB5 A;  4N5Q A;  5EID A;  5KNG A;  3HG0 D;  4NIK A;  1K3Z D;  4YDW A;  2XEN A;  2QYJ A;  5FIN A;  3AJI A;  4CYM D;  2DZN A;  2B0O E;  4HRL A;  5EN5 D;  3TWQ A;  2L6B A;  4BER A;  4CZ2 D;  5CEA A;  5AQ7 A;  5HKP A;  4LG6 A;  5ENR D;  1OY3 D;  5CEC B;  4DX2 A;  2NYJ A;  4HI8 A;  3F6Q A;  5EIL A;  5AAR A;  3UTM A;  4DX1 A;  2JAB A;  4QQI A;  1DCQ A;  2P2C P;  4ZFH A;  3EHR A;  3TWV A;  1MX4 A;  3TWW A;  1TR4 A;  5KBA A;  4G8K A;  1IXV A;  1DC2 A;  4LNU D;  1BI7 B;  2DWZ A;  1IHB A;  4O60 A;  1G3N B;  1YMP A;  3B95 A;  4K5B A;  5AN8 A;  3V31 A;  2ZGG A;  5HRY A;  1NFI E;  5KWD A;  5KNH D;  2XEH A;  4QFV A;  3KEA A;  1AWC B;  1MYO A;  4C48 B;  5ENO D;  3TWU A;  4BSZ B;  2F37 A;  2V5Q C;  4HRN A;  1AP7 A;  4HQD A;  1WG0 A;  4O1O A;  3V2O A;  4F6R D;  4U8Y D;  2XEE A;  1K1B A;  1QYM A;  5JA4 D;  1D9S A;  5ENS D;  3V30 A;  3C5R A;  4DX6 D;  1YYH A;  3B7B A;  3TWX A;  1SW6 A;  1MX2 A;  1A5E A;  1N0Q A;  3TWS A;  5BXO A;  5EIB E;  1BD8 A;  4BEP A;  3IXE A;  1N11 A;  1WDY A;  1MJ0 A;  3T9K A;  2DZO A;  2RFA A;  2V4H C;  2ETB A;  4DUI A;  5ENP D;  3NBN B;  2F8X K;  4J8Y A;  2PNN A;  5FIO A;  1UOH A;  2QC9 A;  5HS0 A;  3TWR A;  3DEO A;  5CED B;  3V2X A;  3W9G A;  1N0R A;  2KBX A;  3Q9N C;  3SO8 A;  4OAU C;  2MYO A;  1IKN D;  1YCS B;  5AQB A;  1SVX A;  3TWT A;  2XZD G;  5BXU A;  5AQ9 A;  4JB8 P;  3J5P A;  4B93 B;  3ZNG A;  2AJA A;  4Z68 A;  5AAO A;  4F1P A;  5CBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...