4BESA

Crystal structure of the legionella pneumophila fic domain-containing effector ankx protein in complex with cytidine monophosphate and phosphocholine
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
479
structure length
469
Chain Sequence
PNLPGLYFLQAYPSEEIWRLFVDGRFWSKENGWRGYESREPGCLNAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGPGELRTDEPVSFGIPAGRASIKGIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQIYFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNKEIKTAETLDEKLKIIVKHIRMYEVLHPFRDANGRTFVNNLLNIPLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVEIIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPSYEKIKHMDFSDLNPEKLHLKTQKCLSSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISGNMAMLDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKDNHGKTAFHYAAEFGTPELISAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Legionella Effector Ankx Reveals the Mechanism of Phosphocholine Transfer by the Fic Domain.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
molecule tags Transferase
molecule keywords PHOSPHOCHOLINE TRANSFERASE ANKX
total genus 164
structure length 469
sequence length 479
ec nomenclature ec 2.7.1.-:
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4besA02
2AJAA 1YYHA 3DEPA 2ZGDA 3UTMA 3EU9A 5HRYA 3AAAC 4BESA 5KWDA 1TR4A 1WG0A 2DVWA 3IXEA 3TWQA 5CBOA 3C5RA 4CYMD 2XZDG 3EHRA 5AARA 1K3ZD 4QFVA 3T9KA 2XZTG 5AQ9A 4JB8P 3DEOA 4U95D 2J8SD 5KNHD 2PNNA 4HQDA 4NIKA 5BXUA 4OAUC 1UOHA 5CERB 4HRLA 4HRMB 5KNGA 3W9GA 4Z68A 4HRNA 5JA4D 5EIDA 4LG6A 1MX6A 2ETAA 4BERA 2B0OE 1SVXA 1A5EA 2A5EA 2RFMA 5CEAA 2F8YA 4B93B 1OT8A 2Y0BG 1N11A 2HE0A 2RFAA 2ZGGA 4HI8A 5ENSD 3B95A 3TWVA 3TWUA 3TWWA 2VGEA 4U8YD 2V4HC 3NBNB 4F6RD 2XEHA 1N0QA 4G8KA 4YDYA 1MX2A 5AAOA 5HKPA 2MYOA 3D9HA 4K5AB 1IXVA 5EYLA 2BKKB 2DWZA 1YMPA 1N0RA 2KBXA 5ENTD 5AQBA 4DX1A 4F1PA 4BEPA 1AP7A 2DZNA 2V5QC 5FIOA 3ZNGA 1G3NB 3V2XA 3KEAA 1K1AA 3Q9NC 4U96D 3AJIA 4TUMA 2ETCA 5ENOD 4O60A 3TWRA 1BLXB 3TWTA 3V31A 2F8XK 1DC2A 3ZU7B 4DX6D 1K1BA 3HRAA 5AQ7A 3UI2A 4J8YA 1SW6A 3TWXA 5ENPD 2NYJA 1YCSB 3V30A 4DX5D 5EIBE 2JABA 3B7BA 4HLLA 4HB5A 5HS0A 4C48B 3UXGA 2L6BA 2DZOA 4GMRA 4J7WA 4U8VD 3T8KA 4ZHBA 4UUCA 5EILA 3W9FA 3NOCD 3Q9UC 3ZUVB 4DRXE 3NOGD 5AN8A 5ITZF 4ATZD 2P2CP 4G8LA 5KBAA 2XENA 4DUIA 2QYJA 5CECB 1WDYA 3EHQA 1NFIE 5ENRD 5BXOA 1D9SA 3JXJA 5EN5D 5CBNA 2XEEA 4BETA 4HI9A 4A63B 5EYPF 3JUEA 5D66A 5AQAA 4RLYA 4CZ2D 3ZKJA 3J5QB 1OY3D 2KXPC 4O1PA 3V2OA 1QYMA 1MX4A 1S70B 2F37A 2QC9A 4K5BA 4GPMA 3SO8A 1BI7B 4HNAD 4HBDA 3J5PA 4LNUD 4O1OA 4QQIA 3TWSA 1BI8B 3JXIA 1AWCB 1DCQA 4K5CA 4N5QA 4BSZB 4ZFHA 4OAVB 1BU9A 4DX7D 4YDWA 1MYOA 2BKGA 1MJ0A 3F6QA 4LSZE 3V79K 1IKND 1IHBA 2Y1LE 1BD8A 3HG0D 5FINA 5JMND 2FO1E 5ENQD 5CEDB 4DX2A 3LJNA 2ETBA
chains in the Genus database with same CATH superfamily
2HYZA 3CVPA 1N4SA 3Q5MA 4JHKA 3CVWA 2P9IG 3S7JA 3CVUA 2GGFA 4NRHB 5JHBA 3FTYA 4HRNA 5EIDA 3SGHA 3NZSA 1O1TA 2Y0BG 1N11A 1OCRE 1QNFA 3B95A 3CV0A 1N0QA 3NZUA 3OXGA 3P2BA 1MQSA 5ENTD 4GZDA 2P9SG 5FQ6A 3IHVA 3X2QE 4U96D 4DLQA 4U8HA 3TWTA 4TXRA 2ZU6B 5ANRA 3UKUG 5ENPD 1JPLA 3ABME 2L6BA 4DRXE 2P9LG 1TJFA 4GTVA 4JA7A 5FQ8A 3S7FA 1WDYA 2HR2A 4JXTA 3ZVVA 2V0PA 2HO1A 2MRIA 1LD7A 2VYIA 3L82A 4LNUD 2XQ0A 4YDWA 5CEDB 3FFLA 4FADA 1HG5A 3QWVA 1OUVA 1S64A 5CHEE 1QZ2A 1TR4A 3D9NA 4XIFA 5CCLA 3MX3A 1WAO1 2WXGA 3FTSA 3G2TA 3T9KA 2DIWA 3DEOA 5DIZA 3B13A 1D8DA 2B0OE 1S63A 1UJJA 1OWMA 2ZGGA 2HE0A 3DPYA 3PEVB 3DXKG 2XEHA 4U0UA 4G8KA 3ASGA 2MYOA 1L5JA 5FQ4A 2A5UA 4KVOA 3E37A 4DX1A 2P58C 3C3RA 4LNGA 3QDNA 4HVBA 4MKTA 3DXMG 3FTUA 4KMOA 2X38A 5LP0A 2P9NG 5EIBE 4WWOA 3QB2A 4TRQA 4GTRA 4KZ0A 2IJGX 3VLDA 1KLXA 3SY2A 2LO6A 4HOTA 3ENEA 3SD5A 4GZ3A 3ESKA 3R9AB 4ILHB 3FU0A 3B7UX 4UWHA 3FU3A 1NFIE 2LXMA 5EN5D 4JVSA 3EUVA 4A63B 1DVPA 2KATA 2C0MA 3ZHEB 3V2OA 5BV1A 1MX4A 3SO8A 4N3AA 2DYRE 2BKGA 4CDNA 2DYSE 4GTTA 3HG0D 1JWFA 2FBNA 3RK6A 3SFZA 3CVXA 3ZW3A 3UTMA 3EU9A 5HRYA 4LNBA 4X8QA 1K3ZD 2CG3A 1ELWA 1UN9A 2WPVA 4JA9A 2Y4TA 5J90A 2IY0C 2Y4UA 5T3RA 4JHJA 3G2WA 1LD8A 4F6RD 4OVUA 3TXNA 4G1TA 2V4LA 1IXVA 2RKKA 2J08A 3QARA 5C1DA 3CVNA 2XHEA 4AJWA 1H2TC 1QBQA 2P9KG 2IOSA 5BNWA 2VSYA 3IBEA 3RIBA 4GA1A 2IU1A 2EILE 3UM0A 4HB5A 2XCCA 1EF1C 2OEWA 3T8KA 4GMJA 4AM9A 4CT4A 4G2VA 3O4ZA 3DSXA 2P2CP 2HM8A 2PM6A 3I3NA 3UM1A 2WXHA 4CZ2D 4ILGA 5KCMA 2NSZA 4O1PA 3NF1A 5DBKA 1S70B 4N3BA 4I1OB 3VTXA 1FT2A 3JXIA 5KJLA 5G55A 3ZPJA 3UIPC 1HZ4A 4RQIA 3DRAA 3PZ4A 3CIAA 3R9MA 1N4QA 2XPIA 3FH7A 4GTMA 3ZHEA 1LTXA 4UI9K 5G04J 1MHQA 4FC8A 4ABNA 2DVWA 3OAWA 1H2VC 2L0TB 1TNYA 5KNHD 1JCQA 3KEZA 3HYMB 3LDZA 4JPSA 3CEQA 2DBAA 3UPVA 2Y3AA 3EIJA 4U8YD 1E96B 5EYLA 3TXMA 4N39A 1TEZA 5C2YA 4F1PA 5BV0A 3PEUB 1FVHA 2DZNA 3PH0C 2WB2A 3PNLB 4O60A 1BLXB 2A4ZA 2F8XK 2XRYA 2RG8A 4DX6D 3CKBA 4ATGA 4APFA 2UY1B 3GZSA 3HXCA 4GA0A 2JABA 3TG4A 1U3CA 4Q96A 3FULA 5FWQA 1QQEA 4ME2A 2KZTB 3D3MA 5AIJA 5BXOA 3SI5A 1KZPA 2AWIA 4L9PA 3T8MA 5G05J 2CFUA 5IY5E 2J09A 5LX8A 2E0IA 1BU9A 4K5CA 3KD7A 4BWRA 1TYQG 2FEZA 4LSZE 1IKND 3FDHA 4I6GA 3DEPA 1JUQA 5D0OD 5J08A 2JLBA 3TWQA 3PRZA 4JHRA 5FZQA 3FTWA 4C0EA 2WMOA 4NIKA 1N95A 5JJTA 3MKQB 2R17C 2KM4A 2F8YA 4EECA 4HI8A 5ARFA 3PE4A 4AEZC 2IO2C 4YDYA 1MX2A 5AAOA 3Q79A 4WNGA 2DWZA 3Q7FA 5FJYA 2PQNA 5JHAA 4GMLA 1N52A 4BEPA 2EQXA 3UMVA 2V5QC 1G3NB 1K1AA 2R02A 2WXFA 1N4RA 1E8ZA 1K1BA 3HRAA 2UWJG 1TNOA 4IRUA 3CHOA 4C48B 3UXGA 3OXLA 3LPZA 2WVIA 2QZAA 4E6HA 4KT6B 3UT7A 4BY6A 2V5FA 3HXDA 3QOUA 3EHQA 3FUKA 1K8KG 4JD2G 2NXPA 3Q15A 4RLYA 3D9JA 4GYOA 4GPMA 4JEUA 4M7CA 3FY4A 2KCVA 3LY9A 4HBDA 4KYOB 3ZIMA 5HI7A 4FLHA 2FF4A 3L6AA 3L22A 1YYHA 3QAQA 4U7EB 3ZFWA 2LUHA 3MV2B 4XKCA 1OCZE 4UI9C 3L16A 3OXFA 5AARA 1OXJA 3NQPA 2XZTG 4RSYA 4A1GA 1N4PA 3UM2A 3ZYMA 3HIZA 2C2LA 4BX9A 2LNIA 3LVQE 4XX5A 2I1JA 1A5EA 2A5EA 3APFA 4F53A 4G24A 2PQRA 1YMPA 2KCKA 3MGBA 1ZB1A 3UX4A 3HXEA 4DK5A 3MZLB 3ASHA 4JZYA 3DSVA 4AOFA 3AJIA 4IULA 4WAFA 3KSQA 1KT1A 2VTBA 1DC2A 3APCA 1KT0A 1E8WA 1B89A 4C9BB 2FULA 3D9PA 3O48A 4UQYA 3W9FA 1KZOA 3BQOA 2X6JA 4FULA 4WNEA 3FUHA 4GTPA 3FUMA 2XEEA 3GZ1A 1N9AA 3PZDA 4DI4A 4I9CA 5FZRA 1HF8A 4XKBA 3E30A 1SA4A 4ANUA 4O1OA 1H6PA 4ZFHA 3Q78A 3QC1A 3SFXA 4GA2A 3NAWA 3AAAC 4I43A 5FQ7A 4BESA 3CVVA 1RW2A 1LF8A 1MZCA 4TXPA 3ULQA 3RRMB 5G04C 3LCAA 3PS6A 3UQ3A 4N2QA 1MX6A 2ETAA 4G26A 1HG2A 1OT8A 2ZIRA 3TWWA 2VSOE 1OWOA 5HKPA 3AS5A 3TJPA 4UWFA 1N0RA 1RZ4A 4ANWA 1HO8A 4B94A 2IONA 4N2SA 3ZU7B 3RU0A 2BTDA 3TWXA 4FLBA 2YQ8A 3RAUA 3LXUX 1SZ9A 2J4BA 5ITZF 4PUCA 3SHFA 2X6KA 1Z3XA 3MA5A 3QJZA 5AYWD 1NP7A 5B1AE 2IO3C 3PREA 3HVEA 4FA6A 4Y6CA 3T5VA 1HS6A 2QC9A 1PY1A 3LS8A 1BI7B 3AG3E 3CHRA 1AWCB 4BSZB 5JMND 1BD8A 4ILIA 1HXIA 4I6JA 3OTNA 3LJNA 3CR3A 3JQ0A 3G2UA 5T4YA 2WXNA 3IXEA 5BT1A 4UI9J 5AJDA 4CYMD 3EHRA 2ZISA 1VDYA 2PNNA 2WXKA 4AV7A 3UKRG 4Z68A 3CLJA 2WMNA 5CEAA 4WWPA 3DSWA 2KC7A 2VGEA 1NZNA 3E32A 4L1BA 3RKVA 4A3VA 4W9RA 5CMWA 3NB2A 3ZYQA 1OWPA 2PL2A 3KSLA 4IN3B 3ZNGA 3EDTB 5A7DB 1SW6A 3LY7A 3SBTB 3LY8A 3PZ2A 3BUAA 2XGSA 2LXLA 2H6FA 1KPSB 1EYHA 4ATZD 1S0PA 5CECB 1O1RA 4GZCA 2R5SA 1FCHA 2KZTA 3KAEA 5ANLA 3UM3A 3Q7AA 5KJNA 1A17A 5CMYA 1UN8A 4B8CB 2LSUA 2H6HA 3SF4A 2JEKA 3AS8A 3FH8A 3DSTA 1INZA 3CVYA 2IFUA 1U3DA 1BI8B 3LVRE 4MLPA 5EX0A 4GZ5A 3V79K 2VTBB 4XI0A 3CQCB 4LUNU 2WQHA 3RRUA 2AVPA 3JCKC 4PH4B 4HFGA 1ELKA 2L9BA 3S7DA 3L9TA 4KZCA 2MOWA 5M72A 3KS2A 4QFVA 3HVEB 4L23A 4U95D 5BXUA 1TN7A 4EQFA 1IQUA 3FU5A 2IQCA 4GAAA 3S2AA 3ISMC 4DLOA 3D9HA 5EKQD 3FHEA 3RJVA 5G05C 1WM5A 4TXQA 2EIKE 1IHGA 2WXRA 1TNUA 4TUMA 5LOZA 4HORA 2VGYA 4KVMA 2P9PG 5ENNA 1OCCE 4HLLA 3PZ1A 4J7WA 4GU5A 4FJZA 2WXLA 2CHXA 4GCOA 4G8LA 4DUIA 4I6EA 2C0LA 3UIOC 4GB9A 3PDNA 3G2SA 1JCRA 1H6OA 4H7YA 4CGWA 1H6KA 1E8YA 3ZXSA 4JEHA 3CVLA 1QYMA 1TN6A 3DWLG 3AG2E 5LCWJ 4UWLA 3L17A 3C3QA 2FO7A 2XCBA 2XGOA 4GCNA 1TNZA 2CG2A 4E85A 3MV3B 1HE8A 2WXIA 5LFAA 1WG0A 1IYGA 4F3VA 1UG3A 4MRUA 3GW4A 3N71A 3ZYKA 1Y8MA 3MJWA 4WNFA 3MEKA 3CK9A 4KXKB 4HOQA 2Q7FA 3Q4AB 2BEDA 3RO2A 2RFMA 1Z5SC 3ONKA 4PDXA 4NQ0A 3IEGA 3PUJA 4J8SA 3SZ7A 4EBAG 2V4HC 4OYSA 1NI1A 3UT4A 4K5AB 4ACKA 3VTYA 4G11A 4MBGA 3ML9A 5CRUA 2EIME 2GRLA 1Z3YA 5FIOA 5LCWC 3E33A 1SA5A 3ASFA 3I5PA 3HHMA 4BTBA 2ETCA 4PS3A 4CGVA 3MCXA 4DX5D 3TG5A 4YVQC 2L6JA 3EIQC 1XGWA 1D9SA 1TNBA 3JXJA 2XRZA 4DI3A 3Q73A 5EYPF 5D66A 3CSTA 3QWWA 4PS7A 3HXBA 3J5QB 3AU4A 1TN8A 3FTXA 3TWSA 4I2WA 2J9QA 1P5QA 2YNQA 4CT0A 3EHMA 4DX2A 3R7QA 2GRNB 1EDUA 3CHSA 2GROB 3APDA 4OVVA 1JCSA 4C0MA 4G25A 4JW1A 4CDMA 5AENA 3FUEA 5KNGA 4U63A 4O6FA 3LEWA 4LERA 4LG6A 4FJYA 4U0SA 2QY7A 3TWVA 3EHNA 3D9IA 3ABLE 2VSXE 4UQXA 1W3BA 4ACLA 5JJ7A 3EJNA 2AW6A 5FTPA 3UINC 5AJLA 4AY6A 5B3SE 4ANVA 2NYJA 2YHCA 3B7BA 1H2UA 4UUCA 2AXZA 4RG9A 4JL0A 3ZYLA 5KBAA 1V54E 1NA0A 4YVOA 4HLEA 4XE0A 2R03A 3Q49B 2CHWA 2YINA 3K9IA 2YHEA 2KXPC 3D9MA 4GTOA 1NA3A 3ULYA 4HNAD 1UW4B 4EBAA 4BTAA 2IEJA 4EZLA 1O5MA 3P1UA 2H6GA 1MJ0A 3F6QA 4AY5A 5FINA 2PM7A 2ETBA 1E8XA 2RD0A 3D9LA 3TL5A 3VLFA 5KWDA 3FUDA 2I1KA 4YDOA 1PAQA 3HDXA 4OAUC 1HH8A 4HQDA 1UOHA 2P9UG 5CERB 5B1BE 3Q47B 1V55E 2Y69E 4B93B 4K0RA 2OVFA 4BT9A 4J8EA 1FVFA 4XI9A 4BFRA 3S7BA 1N54A 4TV3A 3RSEG 1SQMA 4I9EA 2WQ6A 3I4RB 4I1AA 4HOSA 3CK8A 2GW1A 4YDEA 2WXOA 3CSFA 3FUFA 4N3CA 3D9OA 4FU3A 5E76A 4GZ6A 5EILA 4MS6A 3Q9UC 3ZUVB 2I2OA 4FP7A 3BEEA 3B7RL 3JQ1A 2XENA 2NC9A 1TJCA 3JUIA 4HI9A 4CRWA 2EINE 3I4GA 5EDSA 1DCEA 2I9CA 3SNXA 3L54A 1E7UA 3FUJA 3ZXPA 3EU5A 4DX7D 2FO1E 4Q69A 2AJAA 3ZEFA 4BT8A 5CBOA 2VJ8A 1H19A 2VQ2A 2J8SD 3AG4E 4Q94A 3W9GA 1N94A 1FT1A 1YA0A 2WM9A 3SFYA 4GPKA 3LKUA 4A3TA 4J6IA 2XGMA 3DSSA 4PS8A 5JJ6A 3FTVA 3MYVA 3FH5A 4N5CA 4DJAA 4AVXA 4KBQA 5CRVA 4U0ZA 5T8IA 1HFAA 5FT9A 4LCTA 2FI7A 4GTQA 3CHMA 4J8YA 4URKA 5ARGA 4XZ4A 5HS0A 3E4BA 4UQZA 3U9WA 4UWGA 4CDRA 3PZ3A 3NOGD 1E7VA 4JC8A 4RVBA 3TGOA 5ENRD 1Q2ZA 3D9KA 2QFCA 1JWGA 4EZKA 4HS2A 1OWLA 3GZ2A 4K03A 3G2VA 1OY3D 2VGXB 2XS8A 4AIFA 2F37A 2GRQB 3PE3A 3C72A 4TUUA 3ML8A 3QKYA 3MKRA 4LRZA 4GYWA 2KCLA 2OOEA 4F1SA 4A1SA 1ZBPA 2WXQA 1HU3A 2OVBA 4WUYA 5EX3A 5G2NA 4EHMA 2LSVA 2H6IA 3ZGQA 3QWPA 4HRLA 4HRMB 4ANXA 5KJMA 3IV0A 3ULEG 5D2MC 3AG1E 1IQRA 3BU8A 4EPZA 3ABKE 1H0AA 4APOA 3MKQA 4V3IA 2VSNA 4BX8A 1FPPA 2WXMA 5AQBA 3C98A 1D8EA 4I1MA 3AU5A 3ONLA 1Z6TA 5AQ7A 2J49A 1BPOA 2X3MA 4GMRA 4ZHBA 3ESLA 2CFZA 4J8DA 5E75A 3T5XA 1X81A 4H7XA 5BUZA 2WXPA 5CBNA 3FUIA 4BETA 3JUEA 3BG0B 4I17A 3C3OA 2IOLA 4QQIA 3J5PA 2V8SE 4AXHA 3FTZA 1Y6IA 2PZIA 2LAIA 3L08A 5A23A 2XPZA 2CHZA 4J8FA 4A55A 1AP7A 3FUNA 3ASOE 2UY1A 2GRRB 4B8AA 3U64A 1WY6A 3CGHA 2EIJE 2QYUA 2XZDG 5AQ9A 4HOUA 3FP3A 4YNDA 3PUKA 5JA4D 3LYAA 4U04A 2L0IA 2GRMA 4B0ZA 2RFAA 3IKOB 3ASDA 1OWNA 2ILRA 1E90A 2R2LA 3CKCA 2BKKB 4L7TA 4CEMA 3SQVA 2M63A 1U2VG 4P29A 3IHYA 3V2XA 3PVLA 5ENOD 3V31A 1ZU2A 1ELRA 2J07A 3UI2A 3FWVA 1YCSB 4IYPA 4NURA 4EZJA 1PC2A 3B7SA 4U8VD 2DZOA 5CCMA 1O1SA 4UWKA 5FZSA 5AN8A 2XS1A 4FHJA 3RRNB 2QYJA 2OV8A 1XNFA 2XPYA 1UJKA 4I2ZA 4F7AA 3TAXA 4J0UA 4M3OA 3U66A 2F0YA 3GYZA 3CQGB 2DCPA 4N5QA 5BPPA 4OAVB 4GYYA 4FHKA 5HQ8A 4R7LA 1MYOA 5BW8C 1DNPA 5H7PA 2I6HA 3CHPA 4L2LA 1HX8A 2ZGDA 3E34A 4G23A 3DBSA 4WWNA 3LJ3A 4NACA 3C5RA 4DPRA 4JB8P 4U07A 3CVQA 2AXVA 4CCAA 4L2YA 3QK0A 3U4TA 3BG1B 4BERA 1SVXA 2E2EA 3FU6A 2XEVA 5ENSD 2ONDA 4RG6A 3FEYA 3TWUA 3B7TA 3NBNB 2B6CA 3QNKA 2VGXA 2WXJA 3FEXA 3U3WA 3HXFA 2KBXA 2MHKA 3L13A 3VLEA 2OEVA 4BSXA 1OCOE 2X6IA 2WQ7A 2OCCE 3ZRHA 2X6FA 2R05A 3KEAA 3UT8A 3Q9NC 3CK7A 3TWRA 4AP2A 3WG7E 5D0QD 3Q75A 2AXUA 1X5BA 2GRPB 3PNTB 3V30A 1NL4A 4WNDA 4Y6WA 3NOCD 3ZN3A 3WXXA 1EPUA 4D10C 3SBSA 2ZXWE 3UUXA 4GTSA 4XEIG 1GW6A 3AS4A 3URZA 4B89A 3DPDA 2J4DA 3DSUA 4HXIA 3CHQA 2BUGA 5AQAA 2BF0X 1SZAA 3ZKJA 5A6CA 2X6HA 4K5BA 2R59A 2LAHA 3R7RA 3ASNE 1DCQA 2IF4A 5KJKA 3RO3A 1IHBA 2Y1LE 3JYSA 5ENQD 4LEUA
chains in the Genus database with same CATH topology
2AJAA 1YYHA 3DEPA 2ZGDA 3UTMA 3EU9A 5HRYA 3AAAC 4BESA 5KWDA 1TR4A 1WG0A 2DVWA 3IXEA 3TWQA 5CBOA 3C5RA 4CYMD 2XZDG 3EHRA 5AARA 1K3ZD 4QFVA 3T9KA 2XZTG 5AQ9A 4JB8P 3DEOA 4U95D 2J8SD 5KNHD 2PNNA 4HQDA 4NIKA 5BXUA 4OAUC 1UOHA 5CERB 4HRLA 4HRMB 5KNGA 3W9GA 4Z68A 4HRNA 5JA4D 5EIDA 4LG6A 1MX6A 2ETAA 4BERA 2B0OE 1SVXA 1A5EA 2A5EA 2RFMA 5CEAA 2F8YA 4B93B 1OT8A 2Y0BG 1N11A 2HE0A 2RFAA 2ZGGA 4HI8A 5ENSD 3B95A 3TWVA 3TWUA 3TWWA 2VGEA 4U8YD 2V4HC 3NBNB 4F6RD 2XEHA 1N0QA 4G8KA 4YDYA 1MX2A 5AAOA 5HKPA 2MYOA 3D9HA 4K5AB 1IXVA 5EYLA 2BKKB 2DWZA 1YMPA 1N0RA 2KBXA 5ENTD 5AQBA 4DX1A 4F1PA 4BEPA 1AP7A 2DZNA 2V5QC 5FIOA 3ZNGA 1G3NB 3V2XA 3KEAA 1K1AA 3Q9NC 4U96D 3AJIA 4TUMA 2ETCA 5ENOD 4O60A 3TWRA 1BLXB 3TWTA 3V31A 2F8XK 1DC2A 3ZU7B 4DX6D 1K1BA 3HRAA 5AQ7A 3UI2A 4J8YA 1SW6A 3TWXA 5ENPD 2NYJA 1YCSB 3V30A 4DX5D 5EIBE 2JABA 3B7BA 4HLLA 4HB5A 5HS0A 4C48B 3UXGA 2L6BA 2DZOA 4GMRA 4J7WA 4U8VD 3T8KA 4ZHBA 4UUCA 5EILA 3W9FA 3NOCD 3Q9UC 3ZUVB 4DRXE 3NOGD 5AN8A 5ITZF 4ATZD 2P2CP 4G8LA 5KBAA 2XENA 4DUIA 2QYJA 5CECB 1WDYA 3EHQA 1NFIE 5ENRD 5BXOA 1D9SA 3JXJA 5EN5D 5CBNA 2XEEA 4BETA 4HI9A 4A63B 5EYPF 3JUEA 5D66A 5AQAA 4RLYA 4CZ2D 3ZKJA 3J5QB 1OY3D 2KXPC 4O1PA 3V2OA 1QYMA 1MX4A 1S70B 2F37A 2QC9A 4K5BA 4GPMA 3SO8A 1BI7B 4HNAD 4HBDA 3J5PA 4LNUD 4O1OA 4QQIA 3TWSA 1BI8B 3JXIA 1AWCB 1DCQA 4K5CA 4N5QA 4BSZB 4ZFHA 4OAVB 1BU9A 4DX7D 4YDWA 1MYOA 2BKGA 1MJ0A 3F6QA 4LSZE 3V79K 1IKND 1IHBA 2Y1LE 1BD8A 3HG0D 5FINA 5JMND 2FO1E 5ENQD 5CEDB 4DX2A 3LJNA 2ETBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AJA A;  1YYH A;  3DEP A;  2ZGD A;  3UTM A;  3EU9 A;  5HRY A;  3AAA C;  4BES A;  5KWD A;  1TR4 A;  1WG0 A;  2DVW A;  3IXE A;  3TWQ A;  5CBO A;  3C5R A;  4CYM D;  2XZD G;  3EHR A;  5AAR A;  1K3Z D;  4QFV A;  3T9K A;  2XZT G;  5AQ9 A;  4JB8 P;  3DEO A;  4U95 D;  2J8S D;  5KNH D;  2PNN A;  4HQD A;  4NIK A;  5BXU A;  4OAU C;  1UOH A;  5CER B;  4HRL A;  4HRM B;  5KNG A;  3W9G A;  4Z68 A;  4HRN A;  5JA4 D;  5EID A;  4LG6 A;  1MX6 A;  2ETA A;  4BER A;  2B0O E;  1SVX A;  1A5E A;  2A5E A;  2RFM A;  5CEA A;  2F8Y A;  4B93 B;  1OT8 A;  2Y0B G;  1N11 A;  2HE0 A;  2RFA A;  2ZGG A;  4HI8 A;  5ENS D;  3B95 A;  3TWV A;  3TWU A;  3TWW A;  2VGE A;  4U8Y D;  2V4H C;  3NBN B;  4F6R D;  2XEH A;  1N0Q A;  4G8K A;  4YDY A;  1MX2 A;  5AAO A;  5HKP A;  2MYO A;  3D9H A;  4K5A B;  1IXV A;  5EYL A;  2BKK B;  2DWZ A;  1YMP A;  1N0R A;  2KBX A;  5ENT D;  5AQB A;  4DX1 A;  4F1P A;  4BEP A;  1AP7 A;  2DZN A;  2V5Q C;  5FIO A;  3ZNG A;  1G3N B;  3V2X A;  3KEA A;  1K1A A;  3Q9N C;  4U96 D;  3AJI A;  4TUM A;  2ETC A;  5ENO D;  4O60 A;  3TWR A;  1BLX B;  3TWT A;  3V31 A;  2F8X K;  1DC2 A;  3ZU7 B;  4DX6 D;  1K1B A;  3HRA A;  5AQ7 A;  3UI2 A;  4J8Y A;  1SW6 A;  3TWX A;  5ENP D;  2NYJ A;  1YCS B;  3V30 A;  4DX5 D;  5EIB E;  2JAB A;  3B7B A;  4HLL A;  4HB5 A;  5HS0 A;  4C48 B;  3UXG A;  2L6B A;  2DZO A;  4GMR A;  4J7W A;  4U8V D;  3T8K A;  4ZHB A;  4UUC A;  5EIL A;  3W9F A;  3NOC D;  3Q9U C;  3ZUV B;  4DRX E;  3NOG D;  5AN8 A;  5ITZ F;  4ATZ D;  2P2C P;  4G8L A;  5KBA A;  2XEN A;  4DUI A;  2QYJ A;  5CEC B;  1WDY A;  3EHQ A;  1NFI E;  5ENR D;  5BXO A;  1D9S A;  3JXJ A;  5EN5 D;  5CBN A;  2XEE A;  4BET A;  4HI9 A;  4A63 B;  5EYP F;  3JUE A;  5D66 A;  5AQA A;  4RLY A;  4CZ2 D;  3ZKJ A;  3J5Q B;  1OY3 D;  2KXP C;  4O1P A;  3V2O A;  1QYM A;  1MX4 A;  1S70 B;  2F37 A;  2QC9 A;  4K5B A;  4GPM A;  3SO8 A;  1BI7 B;  4HNA D;  4HBD A;  3J5P A;  4LNU D;  4O1O A;  4QQI A;  3TWS A;  1BI8 B;  3JXI A;  1AWC B;  1DCQ A;  4K5C A;  4N5Q A;  4BSZ B;  4ZFH A;  4OAV B;  1BU9 A;  4DX7 D;  4YDW A;  1MYO A;  2BKG A;  1MJ0 A;  3F6Q A;  4LSZ E;  3V79 K;  1IKN D;  1IHB A;  2Y1L E;  1BD8 A;  3HG0 D;  5FIN A;  5JMN D;  2FO1 E;  5ENQ D;  5CED B;  4DX2 A;  3LJN A;  2ETB A; 
#chains in the Genus database with same CATH topology
 2HYZ A;  3CVP A;  1N4S A;  3Q5M A;  4JHK A;  3CVW A;  2P9I G;  3S7J A;  3CVU A;  2GGF A;  4NRH B;  5JHB A;  3FTY A;  4HRN A;  5EID A;  3SGH A;  3NZS A;  1O1T A;  2Y0B G;  1N11 A;  1OCR E;  1QNF A;  3B95 A;  3CV0 A;  1N0Q A;  3NZU A;  3OXG A;  3P2B A;  1MQS A;  5ENT D;  4GZD A;  2P9S G;  5FQ6 A;  3IHV A;  3X2Q E;  4U96 D;  4DLQ A;  4U8H A;  3TWT A;  4TXR A;  2ZU6 B;  5ANR A;  3UKU G;  5ENP D;  1JPL A;  3ABM E;  2L6B A;  4DRX E;  2P9L G;  1TJF A;  4GTV A;  4JA7 A;  5FQ8 A;  3S7F A;  1WDY A;  2HR2 A;  4JXT A;  3ZVV A;  2V0P A;  2HO1 A;  2MRI A;  1LD7 A;  2VYI A;  3L82 A;  4LNU D;  2XQ0 A;  4YDW A;  5CED B;  3FFL A;  4FAD A;  1HG5 A;  3QWV A;  1OUV A;  1S64 A;  5CHE E;  1QZ2 A;  1TR4 A;  3D9N A;  4XIF A;  5CCL A;  3MX3 A;  1WAO 1;  2WXG A;  3FTS A;  3G2T A;  3T9K A;  2DIW A;  3DEO A;  5DIZ A;  3B13 A;  1D8D A;  2B0O E;  1S63 A;  1UJJ A;  1OWM A;  2ZGG A;  2HE0 A;  3DPY A;  3PEV B;  3DXK G;  2XEH A;  4U0U A;  4G8K A;  3ASG A;  2MYO A;  1L5J A;  5FQ4 A;  2A5U A;  4KVO A;  3E37 A;  4DX1 A;  2P58 C;  3C3R A;  4LNG A;  3QDN A;  4HVB A;  4MKT A;  3DXM G;  3FTU A;  4KMO A;  2X38 A;  5LP0 A;  2P9N G;  5EIB E;  4WWO A;  3QB2 A;  4TRQ A;  4GTR A;  4KZ0 A;  2IJG X;  3VLD A;  1KLX A;  3SY2 A;  2LO6 A;  4HOT A;  3ENE A;  3SD5 A;  4GZ3 A;  3ESK A;  3R9A B;  4ILH B;  3FU0 A;  3B7U X;  4UWH A;  3FU3 A;  1NFI E;  2LXM A;  5EN5 D;  4JVS A;  3EUV A;  4A63 B;  1DVP A;  2KAT A;  2C0M A;  3ZHE B;  3V2O A;  5BV1 A;  1MX4 A;  3SO8 A;  4N3A A;  2DYR E;  2BKG A;  4CDN A;  2DYS E;  4GTT A;  3HG0 D;  1JWF A;  2FBN A;  3RK6 A;  3SFZ A;  3CVX A;  3ZW3 A;  3UTM A;  3EU9 A;  5HRY A;  4LNB A;  4X8Q A;  1K3Z D;  2CG3 A;  1ELW A;  1UN9 A;  2WPV A;  4JA9 A;  2Y4T A;  5J90 A;  2IY0 C;  2Y4U A;  5T3R A;  4JHJ A;  3G2W A;  1LD8 A;  4F6R D;  4OVU A;  3TXN A;  4G1T A;  2V4L A;  1IXV A;  2RKK A;  2J08 A;  3QAR A;  5C1D A;  3CVN A;  2XHE A;  4AJW A;  1H2T C;  1QBQ A;  2P9K G;  2IOS A;  5BNW A;  2VSY A;  3IBE A;  3RIB A;  4GA1 A;  2IU1 A;  2EIL E;  3UM0 A;  4HB5 A;  2XCC A;  1EF1 C;  2OEW A;  3T8K A;  4GMJ A;  4AM9 A;  4CT4 A;  4G2V A;  3O4Z A;  3DSX A;  2P2C P;  2HM8 A;  2PM6 A;  3I3N A;  3UM1 A;  2WXH A;  4CZ2 D;  4ILG A;  5KCM A;  2NSZ A;  4O1P A;  3NF1 A;  5DBK A;  1S70 B;  4N3B A;  4I1O B;  3VTX A;  1FT2 A;  3JXI A;  5KJL A;  5G55 A;  3ZPJ A;  3UIP C;  1HZ4 A;  4RQI A;  3DRA A;  3PZ4 A;  3CIA A;  3R9M A;  1N4Q A;  2XPI A;  3FH7 A;  4GTM A;  3ZHE A;  1LTX A;  4UI9 K;  5G04 J;  1MHQ A;  4FC8 A;  4ABN A;  2DVW A;  3OAW A;  1H2V C;  2L0T B;  1TNY A;  5KNH D;  1JCQ A;  3KEZ A;  3HYM B;  3LDZ A;  4JPS A;  3CEQ A;  2DBA A;  3UPV A;  2Y3A A;  3EIJ A;  4U8Y D;  1E96 B;  5EYL A;  3TXM A;  4N39 A;  1TEZ A;  5C2Y A;  4F1P A;  5BV0 A;  3PEU B;  1FVH A;  2DZN A;  3PH0 C;  2WB2 A;  3PNL B;  4O60 A;  1BLX B;  2A4Z A;  2F8X K;  2XRY A;  2RG8 A;  4DX6 D;  3CKB A;  4ATG A;  4APF A;  2UY1 B;  3GZS A;  3HXC A;  4GA0 A;  2JAB A;  3TG4 A;  1U3C A;  4Q96 A;  3FUL A;  5FWQ A;  1QQE A;  4ME2 A;  2KZT B;  3D3M A;  5AIJ A;  5BXO A;  3SI5 A;  1KZP A;  2AWI A;  4L9P A;  3T8M A;  5G05 J;  2CFU A;  5IY5 E;  2J09 A;  5LX8 A;  2E0I A;  1BU9 A;  4K5C A;  3KD7 A;  4BWR A;  1TYQ G;  2FEZ A;  4LSZ E;  1IKN D;  3FDH A;  4I6G A;  3DEP A;  1JUQ A;  5D0O D;  5J08 A;  2JLB A;  3TWQ A;  3PRZ A;  4JHR A;  5FZQ A;  3FTW A;  4C0E A;  2WMO A;  4NIK A;  1N95 A;  5JJT A;  3MKQ B;  2R17 C;  2KM4 A;  2F8Y A;  4EEC A;  4HI8 A;  5ARF A;  3PE4 A;  4AEZ C;  2IO2 C;  4YDY A;  1MX2 A;  5AAO A;  3Q79 A;  4WNG A;  2DWZ A;  3Q7F A;  5FJY A;  2PQN A;  5JHA A;  4GML A;  1N52 A;  4BEP A;  2EQX A;  3UMV A;  2V5Q C;  1G3N B;  1K1A A;  2R02 A;  2WXF A;  1N4R A;  1E8Z A;  1K1B A;  3HRA A;  2UWJ G;  1TNO A;  4IRU A;  3CHO A;  4C48 B;  3UXG A;  3OXL A;  3LPZ A;  2WVI A;  2QZA A;  4E6H A;  4KT6 B;  3UT7 A;  4BY6 A;  2V5F A;  3HXD A;  3QOU A;  3EHQ A;  3FUK A;  1K8K G;  4JD2 G;  2NXP A;  3Q15 A;  4RLY A;  3D9J A;  4GYO A;  4GPM A;  4JEU A;  4M7C A;  3FY4 A;  2KCV A;  3LY9 A;  4HBD A;  4KYO B;  3ZIM A;  5HI7 A;  4FLH A;  2FF4 A;  3L6A A;  3L22 A;  1YYH A;  3QAQ A;  4U7E B;  3ZFW A;  2LUH A;  3MV2 B;  4XKC A;  1OCZ E;  4UI9 C;  3L16 A;  3OXF A;  5AAR A;  1OXJ A;  3NQP A;  2XZT G;  4RSY A;  4A1G A;  1N4P A;  3UM2 A;  3ZYM A;  3HIZ A;  2C2L A;  4BX9 A;  2LNI A;  3LVQ E;  4XX5 A;  2I1J A;  1A5E A;  2A5E A;  3APF A;  4F53 A;  4G24 A;  2PQR A;  1YMP A;  2KCK A;  3MGB A;  1ZB1 A;  3UX4 A;  3HXE A;  4DK5 A;  3MZL B;  3ASH A;  4JZY A;  3DSV A;  4AOF A;  3AJI A;  4IUL A;  4WAF A;  3KSQ A;  1KT1 A;  2VTB A;  1DC2 A;  3APC A;  1KT0 A;  1E8W A;  1B89 A;  4C9B B;  2FUL A;  3D9P A;  3O48 A;  4UQY A;  3W9F A;  1KZO A;  3BQO A;  2X6J A;  4FUL A;  4WNE A;  3FUH A;  4GTP A;  3FUM A;  2XEE A;  3GZ1 A;  1N9A A;  3PZD A;  4DI4 A;  4I9C A;  5FZR A;  1HF8 A;  4XKB A;  3E30 A;  1SA4 A;  4ANU A;  4O1O A;  1H6P A;  4ZFH A;  3Q78 A;  3QC1 A;  3SFX A;  4GA2 A;  3NAW A;  3AAA C;  4I43 A;  5FQ7 A;  4BES A;  3CVV A;  1RW2 A;  1LF8 A;  1MZC A;  4TXP A;  3ULQ A;  3RRM B;  5G04 C;  3LCA A;  3PS6 A;  3UQ3 A;  4N2Q A;  1MX6 A;  2ETA A;  4G26 A;  1HG2 A;  1OT8 A;  2ZIR A;  3TWW A;  2VSO E;  1OWO A;  5HKP A;  3AS5 A;  3TJP A;  4UWF A;  1N0R A;  1RZ4 A;  4ANW A;  1HO8 A;  4B94 A;  2ION A;  4N2S A;  3ZU7 B;  3RU0 A;  2BTD A;  3TWX A;  4FLB A;  2YQ8 A;  3RAU A;  3LXU X;  1SZ9 A;  2J4B A;  5ITZ F;  4PUC A;  3SHF A;  2X6K A;  1Z3X A;  3MA5 A;  3QJZ A;  5AYW D;  1NP7 A;  5B1A E;  2IO3 C;  3PRE A;  3HVE A;  4FA6 A;  4Y6C A;  3T5V A;  1HS6 A;  2QC9 A;  1PY1 A;  3LS8 A;  1BI7 B;  3AG3 E;  3CHR A;  1AWC B;  4BSZ B;  5JMN D;  1BD8 A;  4ILI A;  1HXI A;  4I6J A;  3OTN A;  3LJN A;  3CR3 A;  3JQ0 A;  3G2U A;  5T4Y A;  2WXN A;  3IXE A;  5BT1 A;  4UI9 J;  5AJD A;  4CYM D;  3EHR A;  2ZIS A;  1VDY A;  2PNN A;  2WXK A;  4AV7 A;  3UKR G;  4Z68 A;  3CLJ A;  2WMN A;  5CEA A;  4WWP A;  3DSW A;  2KC7 A;  2VGE A;  1NZN A;  3E32 A;  4L1B A;  3RKV A;  4A3V A;  4W9R A;  5CMW A;  3NB2 A;  3ZYQ A;  1OWP A;  2PL2 A;  3KSL A;  4IN3 B;  3ZNG A;  3EDT B;  5A7D B;  1SW6 A;  3LY7 A;  3SBT B;  3LY8 A;  3PZ2 A;  3BUA A;  2XGS A;  2LXL A;  2H6F A;  1KPS B;  1EYH A;  4ATZ D;  1S0P A;  5CEC B;  1O1R A;  4GZC A;  2R5S A;  1FCH A;  2KZT A;  3KAE A;  5ANL A;  3UM3 A;  3Q7A A;  5KJN A;  1A17 A;  5CMY A;  1UN8 A;  4B8C B;  2LSU A;  2H6H A;  3SF4 A;  2JEK A;  3AS8 A;  3FH8 A;  3DST A;  1INZ A;  3CVY A;  2IFU A;  1U3D A;  1BI8 B;  3LVR E;  4MLP A;  5EX0 A;  4GZ5 A;  3V79 K;  2VTB B;  4XI0 A;  3CQC B;  4LUN U;  2WQH A;  3RRU A;  2AVP A;  3JCK C;  4PH4 B;  4HFG A;  1ELK A;  2L9B A;  3S7D A;  3L9T A;  4KZC A;  2MOW A;  5M72 A;  3KS2 A;  4QFV A;  3HVE B;  4L23 A;  4U95 D;  5BXU A;  1TN7 A;  4EQF A;  1IQU A;  3FU5 A;  2IQC A;  4GAA A;  3S2A A;  3ISM C;  4DLO A;  3D9H A;  5EKQ D;  3FHE A;  3RJV A;  5G05 C;  1WM5 A;  4TXQ A;  2EIK E;  1IHG A;  2WXR A;  1TNU A;  4TUM A;  5LOZ A;  4HOR A;  2VGY A;  4KVM A;  2P9P G;  5ENN A;  1OCC E;  4HLL A;  3PZ1 A;  4J7W A;  4GU5 A;  4FJZ A;  2WXL A;  2CHX A;  4GCO A;  4G8L A;  4DUI A;  4I6E A;  2C0L A;  3UIO C;  4GB9 A;  3PDN A;  3G2S A;  1JCR A;  1H6O A;  4H7Y A;  4CGW A;  1H6K A;  1E8Y A;  3ZXS A;  4JEH A;  3CVL A;  1QYM A;  1TN6 A;  3DWL G;  3AG2 E;  5LCW J;  4UWL A;  3L17 A;  3C3Q A;  2FO7 A;  2XCB A;  2XGO A;  4GCN A;  1TNZ A;  2CG2 A;  4E85 A;  3MV3 B;  1HE8 A;  2WXI A;  5LFA A;  1WG0 A;  1IYG A;  4F3V A;  1UG3 A;  4MRU A;  3GW4 A;  3N71 A;  3ZYK A;  1Y8M A;  3MJW A;  4WNF A;  3MEK A;  3CK9 A;  4KXK B;  4HOQ A;  2Q7F A;  3Q4A B;  2BED A;  3RO2 A;  2RFM A;  1Z5S C;  3ONK A;  4PDX A;  4NQ0 A;  3IEG A;  3PUJ A;  4J8S A;  3SZ7 A;  4EBA G;  2V4H C;  4OYS A;  1NI1 A;  3UT4 A;  4K5A B;  4ACK A;  3VTY A;  4G11 A;  4MBG A;  3ML9 A;  5CRU A;  2EIM E;  2GRL A;  1Z3Y A;  5FIO A;  5LCW C;  3E33 A;  1SA5 A;  3ASF A;  3I5P A;  3HHM A;  4BTB A;  2ETC A;  4PS3 A;  4CGV A;  3MCX A;  4DX5 D;  3TG5 A;  4YVQ C;  2L6J A;  3EIQ C;  1XGW A;  1D9S A;  1TNB A;  3JXJ A;  2XRZ A;  4DI3 A;  3Q73 A;  5EYP F;  5D66 A;  3CST A;  3QWW A;  4PS7 A;  3HXB A;  3J5Q B;  3AU4 A;  1TN8 A;  3FTX A;  3TWS A;  4I2W A;  2J9Q A;  1P5Q A;  2YNQ A;  4CT0 A;  3EHM A;  4DX2 A;  3R7Q A;  2GRN B;  1EDU A;  3CHS A;  2GRO B;  3APD A;  4OVV A;  1JCS A;  4C0M A;  4G25 A;  4JW1 A;  4CDM A;  5AEN A;  3FUE A;  5KNG A;  4U63 A;  4O6F A;  3LEW A;  4LER A;  4LG6 A;  4FJY A;  4U0S A;  2QY7 A;  3TWV A;  3EHN A;  3D9I A;  3ABL E;  2VSX E;  4UQX A;  1W3B A;  4ACL A;  5JJ7 A;  3EJN A;  2AW6 A;  5FTP A;  3UIN C;  5AJL A;  4AY6 A;  5B3S E;  4ANV A;  2NYJ A;  2YHC A;  3B7B A;  1H2U A;  4UUC A;  2AXZ A;  4RG9 A;  4JL0 A;  3ZYL A;  5KBA A;  1V54 E;  1NA0 A;  4YVO A;  4HLE A;  4XE0 A;  2R03 A;  3Q49 B;  2CHW A;  2YIN A;  3K9I A;  2YHE A;  2KXP C;  3D9M A;  4GTO A;  1NA3 A;  3ULY A;  4HNA D;  1UW4 B;  4EBA A;  4BTA A;  2IEJ A;  4EZL A;  1O5M A;  3P1U A;  2H6G A;  1MJ0 A;  3F6Q A;  4AY5 A;  5FIN A;  2PM7 A;  2ETB A;  1E8X A;  2RD0 A;  3D9L A;  3TL5 A;  3VLF A;  5KWD A;  3FUD A;  2I1K A;  4YDO A;  1PAQ A;  3HDX A;  4OAU C;  1HH8 A;  4HQD A;  1UOH A;  2P9U G;  5CER B;  5B1B E;  3Q47 B;  1V55 E;  2Y69 E;  4B93 B;  4K0R A;  2OVF A;  4BT9 A;  4J8E A;  1FVF A;  4XI9 A;  4BFR A;  3S7B A;  1N54 A;  4TV3 A;  3RSE G;  1SQM A;  4I9E A;  2WQ6 A;  3I4R B;  4I1A A;  4HOS A;  3CK8 A;  2GW1 A;  4YDE A;  2WXO A;  3CSF A;  3FUF A;  4N3C A;  3D9O A;  4FU3 A;  5E76 A;  4GZ6 A;  5EIL A;  4MS6 A;  3Q9U C;  3ZUV B;  2I2O A;  4FP7 A;  3BEE A;  3B7R L;  3JQ1 A;  2XEN A;  2NC9 A;  1TJC A;  3JUI A;  4HI9 A;  4CRW A;  2EIN E;  3I4G A;  5EDS A;  1DCE A;  2I9C A;  3SNX A;  3L54 A;  1E7U A;  3FUJ A;  3ZXP A;  3EU5 A;  4DX7 D;  2FO1 E;  4Q69 A;  2AJA A;  3ZEF A;  4BT8 A;  5CBO A;  2VJ8 A;  1H19 A;  2VQ2 A;  2J8S D;  3AG4 E;  4Q94 A;  3W9G A;  1N94 A;  1FT1 A;  1YA0 A;  2WM9 A;  3SFY A;  4GPK A;  3LKU A;  4A3T A;  4J6I A;  2XGM A;  3DSS A;  4PS8 A;  5JJ6 A;  3FTV A;  3MYV A;  3FH5 A;  4N5C A;  4DJA A;  4AVX A;  4KBQ A;  5CRV A;  4U0Z A;  5T8I A;  1HFA A;  5FT9 A;  4LCT A;  2FI7 A;  4GTQ A;  3CHM A;  4J8Y A;  4URK A;  5ARG A;  4XZ4 A;  5HS0 A;  3E4B A;  4UQZ A;  3U9W A;  4UWG A;  4CDR A;  3PZ3 A;  3NOG D;  1E7V A;  4JC8 A;  4RVB A;  3TGO A;  5ENR D;  1Q2Z A;  3D9K A;  2QFC A;  1JWG A;  4EZK A;  4HS2 A;  1OWL A;  3GZ2 A;  4K03 A;  3G2V A;  1OY3 D;  2VGX B;  2XS8 A;  4AIF A;  2F37 A;  2GRQ B;  3PE3 A;  3C72 A;  4TUU A;  3ML8 A;  3QKY A;  3MKR A;  4LRZ A;  4GYW A;  2KCL A;  2OOE A;  4F1S A;  4A1S A;  1ZBP A;  2WXQ A;  1HU3 A;  2OVB A;  4WUY A;  5EX3 A;  5G2N A;  4EHM A;  2LSV A;  2H6I A;  3ZGQ A;  3QWP A;  4HRL A;  4HRM B;  4ANX A;  5KJM A;  3IV0 A;  3ULE G;  5D2M C;  3AG1 E;  1IQR A;  3BU8 A;  4EPZ A;  3ABK E;  1H0A A;  4APO A;  3MKQ A;  4V3I A;  2VSN A;  4BX8 A;  1FPP A;  2WXM A;  5AQB A;  3C98 A;  1D8E A;  4I1M A;  3AU5 A;  3ONL A;  1Z6T A;  5AQ7 A;  2J49 A;  1BPO A;  2X3M A;  4GMR A;  4ZHB A;  3ESL A;  2CFZ A;  4J8D A;  5E75 A;  3T5X A;  1X81 A;  4H7X A;  5BUZ A;  2WXP A;  5CBN A;  3FUI A;  4BET A;  3JUE A;  3BG0 B;  4I17 A;  3C3O A;  2IOL A;  4QQI A;  3J5P A;  2V8S E;  4AXH A;  3FTZ A;  1Y6I A;  2PZI A;  2LAI A;  3L08 A;  5A23 A;  2XPZ A;  2CHZ A;  4J8F A;  4A55 A;  1AP7 A;  3FUN A;  3ASO E;  2UY1 A;  2GRR B;  4B8A A;  3U64 A;  1WY6 A;  3CGH A;  2EIJ E;  2QYU A;  2XZD G;  5AQ9 A;  4HOU A;  3FP3 A;  4YND A;  3PUK A;  5JA4 D;  3LYA A;  4U04 A;  2L0I A;  2GRM A;  4B0Z A;  2RFA A;  3IKO B;  3ASD A;  1OWN A;  2ILR A;  1E90 A;  2R2L A;  3CKC A;  2BKK B;  4L7T A;  4CEM A;  3SQV A;  2M63 A;  1U2V G;  4P29 A;  3IHY A;  3V2X A;  3PVL A;  5ENO D;  3V31 A;  1ZU2 A;  1ELR A;  2J07 A;  3UI2 A;  3FWV A;  1YCS B;  4IYP A;  4NUR A;  4EZJ A;  1PC2 A;  3B7S A;  4U8V D;  2DZO A;  5CCM A;  1O1S A;  4UWK A;  5FZS A;  5AN8 A;  2XS1 A;  4FHJ A;  3RRN B;  2QYJ A;  2OV8 A;  1XNF A;  2XPY A;  1UJK A;  4I2Z A;  4F7A A;  3TAX A;  4J0U A;  4M3O A;  3U66 A;  2F0Y A;  3GYZ A;  3CQG B;  2DCP A;  4N5Q A;  5BPP A;  4OAV B;  4GYY A;  4FHK A;  5HQ8 A;  4R7L A;  1MYO A;  5BW8 C;  1DNP A;  5H7P A;  2I6H A;  3CHP A;  4L2L A;  1HX8 A;  2ZGD A;  3E34 A;  4G23 A;  3DBS A;  4WWN A;  3LJ3 A;  4NAC A;  3C5R A;  4DPR A;  4JB8 P;  4U07 A;  3CVQ A;  2AXV A;  4CCA A;  4L2Y A;  3QK0 A;  3U4T A;  3BG1 B;  4BER A;  1SVX A;  2E2E A;  3FU6 A;  2XEV A;  5ENS D;  2OND A;  4RG6 A;  3FEY A;  3TWU A;  3B7T A;  3NBN B;  2B6C A;  3QNK A;  2VGX A;  2WXJ A;  3FEX A;  3U3W A;  3HXF A;  2KBX A;  2MHK A;  3L13 A;  3VLE A;  2OEV A;  4BSX A;  1OCO E;  2X6I A;  2WQ7 A;  2OCC E;  3ZRH A;  2X6F A;  2R05 A;  3KEA A;  3UT8 A;  3Q9N C;  3CK7 A;  3TWR A;  4AP2 A;  3WG7 E;  5D0Q D;  3Q75 A;  2AXU A;  1X5B A;  2GRP B;  3PNT B;  3V30 A;  1NL4 A;  4WND A;  4Y6W A;  3NOC D;  3ZN3 A;  3WXX A;  1EPU A;  4D10 C;  3SBS A;  2ZXW E;  3UUX A;  4GTS A;  4XEI G;  1GW6 A;  3AS4 A;  3URZ A;  4B89 A;  3DPD A;  2J4D A;  3DSU A;  4HXI A;  3CHQ A;  2BUG A;  5AQA A;  2BF0 X;  1SZA A;  3ZKJ A;  5A6C A;  2X6H A;  4K5B A;  2R59 A;  2LAH A;  3R7R A;  3ASN E;  1DCQ A;  2IF4 A;  5KJK A;  3RO3 A;  1IHB A;  2Y1L E;  3JYS A;  5ENQ D;  4LEU A; 
#chains in the Genus database with same CATH homology
 2AJA A;  1YYH A;  3DEP A;  2ZGD A;  3UTM A;  3EU9 A;  5HRY A;  3AAA C;  4BES A;  5KWD A;  1TR4 A;  1WG0 A;  2DVW A;  3IXE A;  3TWQ A;  5CBO A;  3C5R A;  4CYM D;  2XZD G;  3EHR A;  5AAR A;  1K3Z D;  4QFV A;  3T9K A;  2XZT G;  5AQ9 A;  4JB8 P;  3DEO A;  4U95 D;  2J8S D;  5KNH D;  2PNN A;  4HQD A;  4NIK A;  5BXU A;  4OAU C;  1UOH A;  5CER B;  4HRL A;  4HRM B;  5KNG A;  3W9G A;  4Z68 A;  4HRN A;  5JA4 D;  5EID A;  4LG6 A;  1MX6 A;  2ETA A;  4BER A;  2B0O E;  1SVX A;  1A5E A;  2A5E A;  2RFM A;  5CEA A;  2F8Y A;  4B93 B;  1OT8 A;  2Y0B G;  1N11 A;  2HE0 A;  2RFA A;  2ZGG A;  4HI8 A;  5ENS D;  3B95 A;  3TWV A;  3TWU A;  3TWW A;  2VGE A;  4U8Y D;  2V4H C;  3NBN B;  4F6R D;  2XEH A;  1N0Q A;  4G8K A;  4YDY A;  1MX2 A;  5AAO A;  5HKP A;  2MYO A;  3D9H A;  4K5A B;  1IXV A;  5EYL A;  2BKK B;  2DWZ A;  1YMP A;  1N0R A;  2KBX A;  5ENT D;  5AQB A;  4DX1 A;  4F1P A;  4BEP A;  1AP7 A;  2DZN A;  2V5Q C;  5FIO A;  3ZNG A;  1G3N B;  3V2X A;  3KEA A;  1K1A A;  3Q9N C;  4U96 D;  3AJI A;  4TUM A;  2ETC A;  5ENO D;  4O60 A;  3TWR A;  1BLX B;  3TWT A;  3V31 A;  2F8X K;  1DC2 A;  3ZU7 B;  4DX6 D;  1K1B A;  3HRA A;  5AQ7 A;  3UI2 A;  4J8Y A;  1SW6 A;  3TWX A;  5ENP D;  2NYJ A;  1YCS B;  3V30 A;  4DX5 D;  5EIB E;  2JAB A;  3B7B A;  4HLL A;  4HB5 A;  5HS0 A;  4C48 B;  3UXG A;  2L6B A;  2DZO A;  4GMR A;  4J7W A;  4U8V D;  3T8K A;  4ZHB A;  4UUC A;  5EIL A;  3W9F A;  3NOC D;  3Q9U C;  3ZUV B;  4DRX E;  3NOG D;  5AN8 A;  5ITZ F;  4ATZ D;  2P2C P;  4G8L A;  5KBA A;  2XEN A;  4DUI A;  2QYJ A;  5CEC B;  1WDY A;  3EHQ A;  1NFI E;  5ENR D;  5BXO A;  1D9S A;  3JXJ A;  5EN5 D;  5CBN A;  2XEE A;  4BET A;  4HI9 A;  4A63 B;  5EYP F;  3JUE A;  5D66 A;  5AQA A;  4RLY A;  4CZ2 D;  3ZKJ A;  3J5Q B;  1OY3 D;  2KXP C;  4O1P A;  3V2O A;  1QYM A;  1MX4 A;  1S70 B;  2F37 A;  2QC9 A;  4K5B A;  4GPM A;  3SO8 A;  1BI7 B;  4HNA D;  4HBD A;  3J5P A;  4LNU D;  4O1O A;  4QQI A;  3TWS A;  1BI8 B;  3JXI A;  1AWC B;  1DCQ A;  4K5C A;  4N5Q A;  4BSZ B;  4ZFH A;  4OAV B;  1BU9 A;  4DX7 D;  4YDW A;  1MYO A;  2BKG A;  1MJ0 A;  3F6Q A;  4LSZ E;  3V79 K;  1IKN D;  1IHB A;  2Y1L E;  1BD8 A;  3HG0 D;  5FIN A;  5JMN D;  2FO1 E;  5ENQ D;  5CED B;  4DX2 A;  3LJN A;  2ETB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...