2P9SG

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
141
structure length
135
Chain Sequence
b'FRKVDVDEYDENKFVDEDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 41
structure length 135
sequence length 141
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9sG00
2P9PG 2P9UG 3DXKG 4JD2G 2P9KG 2P9SG 3UKRG 3ULEG 2P9NG 3DWLG 3UKUG 2P9LG 1K8KG 1U2VG 3DXMG 2P9IG 3RSEG 1TYQG 4XEIG
chains in the Genus database with same CATH superfamily
3CKBA 3FHEA 1DC2A 5FJYA 1TNBA 1KT1A 2UY1A 4J8DA 1XNFA 3EUVA 4MS6A 3UM3A 4B8AA 3ASHA 4J0UA 5ENSD 1E96B 4C9BB 3AG1E 1N54A 4R7LA 1N0RA 1Z3YA 5KNGA 3RAUA 3RKVA 5BXUA 3ZFWA 1H6PA 4UI9C 1OY3D 4G26A 1MHQA 1MX6A 1EDUA 2OCCE 1H19A 4G11A 4CT0A 1H0AA 2NXPA 2EILE 4JVSA 4F6RD 3ZYLA 4N2QA 5BNWA 2KZTB 1S70B 3OXGA 1IQUA 4TV3A 3PEVB 3ML9A 2J49A 2CG2A 3L6AA 3EU5A 4DUIA 4GTRA 3SFYA 3ZKJA 1DCEA 3MCXA 1MJ0A 2J4BA 2GRRB 3CHSA 5KJMA 1Z5SC 1IYGA 4U8YD 3ZPJA 1IHGA 4FADA 3FUEA 4XIFA 3ZNGA 4CDMA 1BI7B 3UPVA 1ZB1A 4OVVA 1MX2A 3FUFA 4K5CA 4MLPA 3IBEA 3RO3A 3CSFA 5G04J 4UUCA 4H7XA 5T8IA 3I3NA 3G2TA 2PM6A 1Z3XA 4LRZA 2UY1B 4FLHA 2KATA 1TNZA 3UT7A 3HXFA 5CBNA 2DYSE 4WWNA 4Q96A 3E32A 1TR4A 3HXCA 5HRYA 2B6CA 3ZYMA 1A5EA 3V2XA 2L0IA 4F3VA 1BI8B 1K1AA 3PEUB 2Y4TA 5E76A 3EIQC 1TN8A 1KLXA 3DEOA 3TAXA 2EQXA 3SBSA 2F8XK 4GTMA 4DX5D 2X6IA 4BT8A 2KC7A 2AWIA 4JA9A 3CK8A 3DSXA 5EYLA 2P58C 2V0PA 5JJ6A 2WPVA 3C3OA 4X8QA 4F53A 3KD7A 4XX5A 2Y1LE 2IFUA 3LY7A 5C1DA 2C0MA 5J08A 1AWCB 1ZU2A 2E0IA 3LVQE 1KZOA 1OT8A 1S64A 5EKQD 3SZ7A 3URZA 3FTUA 4IULA 4BSZB 3GZSA 3T8MA 3NBNB 4I6GA 3HDXA 2HYZA 5AENA 4RVBA 2I1JA 4JHRA 4KMOA 1HF8A 4EHMA 3DBSA 2DCPA 5G04C 3OAWA 3NOCD 3ZGQA 1HFAA 4HRMB 4GTQA 1U3DA 4DJAA 1YMPA 5AYWD 4NIKA 2HO1A 2XCCA 3T5XA 3CHQA 3D9MA 1JWFA 4WWPA 1HO8A 3G2VA 1JCRA 2XGSA 5CCMA 1AP7A 3SGHA 1OCRE 1N94A 5ITZF 1QQEA 3UT8A 2VSXE 4DRXE 2IO2C 1INZA 4YVOA 3B7SA 3TWTA 4YDOA 3Q75A 3KSLA 5T4YA 5FINA 4AEZC 3FDHA 3V31A 1OWLA 2FEZA 2IY0C 1SA5A 1FT2A 3UKRG 2X6HA 1MQSA 4GTSA 3S7DA 2IJGX 4GYWA 3Q9UC 2HR2A 4D10C 1O5MA 2WQ7A 3FUHA 2XHEA 3BQOA 4UWGA 3CGHA 3APDA 4B89A 3LY8A 2KCKA 2IQCA 5T3RA 5EIBE 3RRNB 4K5AB 3TJPA 2GRMA 5A6CA 4AV7A 1QZ2A 3OTNA 4M3OA 2I1KA 2F8YA 1NI1A 3LYAA 2EIJE 3ENEA 3FU6A 1E8ZA 3C3QA 3D3MA 2VGYA 1OCCE 4O60A 4URKA 1GW6A 2WM9A 3ASOE 5CRUA 4ILHB 4RLYA 3CVLA 4TXRA 4ABNA 5CBOA 3L82A 5EN5D 3TG4A 3ML8A 4I17A 3PNLB 3LEWA 5AIJA 3SF4A 1G3NB 5ARGA 3ZIMA 2KM4A 5CEAA 4B0ZA 2WXKA 2J07A 1HU3A 4ATZD 3FEXA 3EHMA 3ABKE 2LAHA 2QZAA 3DRAA 5BUZA 3O4ZA 3NZUA 2XZDG 3APFA 4G8KA 1NA0A 1VDYA 3U9WA 3B95A 4GCOA 1KPSB 4QQIA 1DCQA 3NAWA 4JHJA 3CQCB 4MRUA 2ETBA 1EPUA 4I1AA 1HX8A 3HXEA 3TGOA 4GA2A 2OEWA 4I1OB 3CK9A 1HE8A 3IHYA 3TWRA 4HFGA 4A3TA 2NSZA 3FUDA 1K3ZD 4U8VD 4YDYA 3JYSA 4LSZE 3UIOC 5FZSA 4G2VA 3RRUA 1ELRA 3BUAA 1N4SA 2H6FA 3HYMB 3JUIA 4GMJA 5KJKA 4O6FA 3TWWA 3TWVA 2DZOA 3CV0A 4M7CA 5KCMA 5CCLA 2IEJA 4U8HA 4XI9A 4RG9A 5B1AE 3SY2A 2H6IA 2R03A 5JJTA 4U63A 3DEPA 4GA1A 5AJLA 3TXNA 3PUJA 1W3BA 4UWKA 4APOA 3PUKA 4NQ0A 2F37A 3DPYA 4AP2A 4O1OA 2OEVA 2XGOA 1WDYA 2LSVA 4I6JA 2WMOA 3GYZA 3Q9NC 3PS6A 4K0RA 3EHQA 2WXPA 4N2SA 4PS3A 4A55A 3KEAA 4FHKA 2BKGA 2EIME 3U3WA 2JABA 4A63B 4HORA 3F6QA 4HRLA 3HRAA 3OXLA 2P9NG 2OOEA 2V5FA 3I5PA 3UUXA 1JWGA 2QY7A 4N5QA 4BWRA 2ILRA 1SQMA 2FI7A 4HB5A 3FTSA 3ZYQA 4EZKA 4JHKA 1SW6A 1LD7A 4U7EB 4HLEA 3FY4A 3NZSA 4BTBA 1RW2A 2IONA 4Z68A 3FU5A 4K03A 1TJFA 3SBTB 2E2EA 2MYOA 1FVHA 3O48A 3UI2A 1DVPA 4N5CA 4CGVA 3Q73A 1KZPA 3KSQA 1S63A 3UQ3A 4KYOB 1S0PA 4BFRA 1K8KG 5AN8A 3LPZA 5EDSA 2VSNA 5FIOA 2XPZA 4G25A 4LEUA 4DPRA 3HVEA 2R5SA 2WXNA 3Q7FA 5EX3A 2P9SG 3L17A 2WXJA 4J8YA 2P9LG 3CVVA 4AVXA 3JQ0A 3CVWA 1FT1A 3W9GA 2XRYA 1D9SA 1TNOA 1ELWA 4GTPA 4DX6D 4HI9A 3CVQA 1TEZA 4NURA 2LO6A 3MJWA 4HBDA 2DZNA 5IY5E 5B3SE 3CVXA 3G2WA 2PQNA 4L2LA 5G05J 3PNTB 2QFCA 2RFMA 4RG6A 4N3CA 3I4GA 2VGEA 2X6FA 3PZDA 4U0SA 4AY6A 4ILGA 2GRNB 5EILA 4HOSA 5CRVA 5D2MC 1JUQA 3ULEG 3L9TA 4EBAG 2WQHA 3RRMB 2X3MA 2XS1A 4YVQC 4ZHBA 3TWSA 2NYJA 4B94A 3NF1A 3PDNA 3DSTA 5FZRA 5LOZA 1FCHA 2J09A 5ENRD 4GA0A 3FTYA 4BEPA 2VTBB 2MHKA 3UT4A 5C2YA 3UINC 1TN6A 3D9HA 3SD5A 4UQXA 4F7AA 3QJZA 2KBXA 1MX4A 3ESLA 4L9PA 3Q49B 4U95D 3QDNA 5CECB 2XZTG 2AVPA 5ENOD 3FU0A 2JEKA 4JPSA 4G23A 3UKUG 4GCNA 3FH8A 2R05A 4BSXA 2WVIA 2X6JA 2Y4UA 3B7BA 1HH8A 3UM1A 5JHAA 3HVEB 4RQIA 3FH7A 2FBNA 3IV0A 1X81A 3ULQA 3SO8A 2HE0A 3UM2A 3UXGA 3CVPA 4DI3A 1QNFA 2I2OA 2RG8A 3TG5A 5G05C 2P9UG 3Q5MA 1ELKA 1N4PA 4CDNA 1MYOA 5KNHD 2XCBA 2MRIA 4FHJA 2Y69E 2L6BA 3S7FA 4E85A 3ESKA 5HKPA 4I9EA 2WB2A 2Y3AA 2VYIA 3T5VA 3J5PA 3L16A 4BERA 3JCKC 1FVFA 3QARA 4WNFA 1E8YA 2KXPC 1BU9A 1HS6A 4I6EA 1K1BA 4TXPA 1H2TC 5ENQD 2PNNA 4UQYA 2YHCA 3KS2A 3ASFA 3FTWA 3DXMG 3SHFA 1TNYA 2A5EA 3L22A 2XGMA 3EJNA 3AJIA 4CT4A 4FC8A 4Q94A 4GZ3A 2LNIA 2GGFA 3FUIA 1N0QA 1YCSB 3PREA 3SI5A 3FU3A 1IXVA 4WUYA 4C48B 4GTTA 1N11A 4WWOA 2V5QC 4CYMD 4PDXA 1TYQG 5BW8C 3NOGD 1YYHA 4BX9A 3CSTA 4IYPA 2GRPB 3AAAC 2YNQA 3BG0B 4GU5A 1O1SA 4LG6A 1IHBA 4FJYA 4W9RA 4Y6CA 2IO3C 4FP7A 1PC2A 2AXUA 1TNUA 2GW1A 2J8SD 4HLLA 2ZU6B 4FJZA 3B13A 3CQGB 5KJLA 3ASGA 4BETA 4LUNU 2KCVA 1BLXB 5FTPA 3UMVA 3ABLE 2XENA 3MV2B 3DSVA 2WXGA 2ZISA 3QWWA 4OAVB 2YQ8A 1N9AA 5CEDB 3PZ1A 3HHMA 1WY6A 3JUEA 4EQFA 4KT6B 4KZ0A 1EYHA 2X38A 1TJCA 1U2VG 1PAQA 4J8EA 1HG5A 1NA3A 2XEHA 4GTVA 1IKND 3MEKA 2MOWA 3EU9A 3FEYA 3LJ3A 4JEUA 2WQ6A 3PE3A 1NP7A 1UN9A 5D66A 4GPKA 3MX3A 2WXQA 1E8WA 2J08A 1N4QA 1O1TA 1H2VC 3E33A 1L5JA 3LY9A 3FH5A 2WXFA 3QKYA 4I2ZA 1A17A 2JLBA 3LDZA 3CR3A 2RFAA 3PE4A 1KT0A 2NC9A 4WNEA 1X5BA 3HXBA 4ATGA 2YHEA 4ME2A 4TUMA 4XI0A 3ZYKA 2H6HA 3DSUA 3MV3B 1IQRA 3LXUX 1WAO1 4J7WA 2OV8A 5BXOA 2OVBA 3FWVA 5EX0A 3L13A 3HXDA 4GZCA 4AOFA 2AJAA 4PS7A 2IU1A 2P9PG 5ANLA 2GRQB 4BTAA 2DWZA 3B7RL 4DX7D 5ENPD 5FQ6A 1D8EA 3ASNE 3QAQA 4U0UA 4HQDA 4BESA 4AJWA 1DNPA 2P9IG 3PZ3A 4HRNA 3LKUA 1YA0A 2QC9A 3AS8A 2ZXWE 2OVFA 4UI9K 2WXHA 4PH4B 2EIKE 1BPOA 4KVOA 5LX8A 5JJ7A 4HS2A 4FU3A 3Q15A 4EZLA 4N39A 2XPIA 5AQBA 3CKCA 4GPMA 3J5QB 3ZXSA 2LXMA 4WAFA 4H7YA 1UJKA 2A4ZA 2IOLA 4UWFA 2GROB 1XGWA 1E7UA 2B0OE 2PM7A 4MBGA 2WXIA 1MZCA 3AG3E 4XE0A 4XZ4A 3LS8A 4LCTA 4PUCA 5BT1A 2AXVA 3KAEA 3PH0C 3CHPA 3PRZA 4JEHA 3P1UA 3VLDA 4GYYA 2WXLA 3S2AA 3L08A 3C3RA 4YDWA 3ISMC 2RKKA 4JL0A 4APFA 2Q7FA 2GRLA 5CHEE 2ETAA 3SQVA 3FUNA 5CMWA 3U64A 4I43A 3EIJA 4YDEA 4JZYA 4BY6A 2VTBA 5D0OD 2BKKB 4FA6A 5H7PA 4L1BA 4EZJA 1NL4A 5ENTD 3FFLA 1E90A 3Q4AB 4GMRA 1WM5A 1TN7A 3D9OA 3UM0A 3ZUVB 5FQ4A 4B8CB 3N71A 1NFIE 4AXHA 2CG3A 2CHXA 4LERA 4TRQA 2VQ2A 2WMNA 3T8KA 4JW1A 5DIZA 3OXFA 3IEGA 3D9IA 4F1PA 3D9LA 2R02A 5HQ8A 3BU8A 5E75A 2R2LA 5AAOA 3RU0A 1OCOE 5D0QD 4GB9A 4I1MA 4GZ5A 4HNAD 1RZ4A 1H6OA 2F0YA 2V4HC 3G2SA 4LNGA 2AW6A 3DPDA 2X6KA 3IHVA 1U3CA 5DBKA 4EBAA 3UTMA 3DXKG 3R7RA 2LAIA 3AU4A 5FQ8A 2LUHA 3QC1A 1Q2ZA 3Q7AA 4KZCA 3TWQA 1HZ4A 3Q79A 4A1GA 3AG2E 3MZLB 3FULA 3QNKA 2FO1E 2LXLA 5LFAA 4BX8A 3C72A 1H2UA 3ONKA 4BT9A 4DK5A 2C0LA 2M63A 3RIBA 5JHBA 3CLJA 3FTXA 4PS8A 3NB2A 4U96D 4EPZA 3MKQA 3KEZA 3CIAA 4A3VA 3Q47B 5AQAA 2Y0BG 2PQRA 3CHMA 4HXIA 4U04A 4KXKB 1UJJA 2V8SE 2KCLA 3AG4E 4EECA 2L0TB 3FTVA 4UQZA 4ZFHA 2VJ8A 5KJNA 4CCAA 4TUUA 3E4BA 4IN3B 3B7UX 3GZ2A 3T9KA 4JA7A 2C2LA 3U66A 2ZIRA 1P5QA 3ZXPA 4ACLA 3TWUA 3ZVVA 1QYMA 4OVUA 3FTZA 3GW4A 4HOUA 5JMND 4NACA 1SVXA 3ZHEA 5M72A 2IF4A 4GZ6A 3UIPC 2I6HA 3CEQA 3PVLA 3ULYA 5HI7A 1NZNA 4MKTA 3EHRA 5AARA 3CHRA 3Q78A 3FUJA 4LNUD 4DLQA 4HI8A 4RSYA 3JXIA 3VTXA 4I9CA 1JCQA 3PZ4A 3C5RA 1SZ9A 4WNDA 1SZAA 3SNXA 4GMLA 2L9BA 2LSUA 4N3AA 3ONLA 3V79K 1O1RA 1OWMA 1JPLA 5BV0A 3CVNA 4C0MA 1Z6TA 2BUGA 4DX1A 1E8XA 5AQ7A 4I2WA 1FPPA 5CMYA 5JA4D 2ETCA 2PL2A 3GZ1A 4JB8P 4ANWA 1N95A 2HM8A 3ZN3A 4E6HA 4KBQA 3DSWA 3TXMA 4GAAA 4L23A 2CHZA 4FLBA 3MKQB 2PZIA 4P29A 4ILIA 5FZQA 3DSSA 1Y6IA 1LD8A 2XRZA 2DVWA 2P9KG 4N3BA 4ANXA 2XEVA 2VGXA 3R9AB 4CGWA 3FUKA 3VLFA 3R7QA 1HG2A 3VLEA 2BTDA 3APCA 4F1SA 1OUVA 4XKBA 2VSOE 4NRHB 4Y6WA 5LCWJ 4XKCA 3E34A 2XPYA 2R17C 5J90A 4CZ2D 2YINA 3I4RB 2RD0A 4ANVA 3WXXA 3RJVA 3ZHEB 4HOQA 3MGBA 4U0ZA 1QBQA 3LVRE 5A23A 5A7DB 3E37A 3HIZA 4ANUA 1V55E 5B1BE 1OCZE 5AJDA 4C0EA 5KBAA 4DLOA 4G1TA 1OWPA 4AY5A 2WXOA 4ACKA 2CFUA 4XEIG 4IRUA 4JC8A 2ZGDA 1OXJA 4QFVA 1N52A 4LNBA 4L2YA 5CERB 3ZU7B 3QOUA 3BEEA 3RK6A 4V3IA 4O1PA 3L54A 5BPPA 4J8FA 2H6GA 3ZRHA 5FQ7A 3C98A 4HVBA 3VTYA 1UW4B 4GTOA 2J9QA 5ARFA 1LTXA 3X2QE 4J6IA 4L7TA 3QWPA 3E30A 3EHNA 2P2CP 3SFXA 2V4LA 3HG0D 2QYUA 3MA5A 1JCSA 4UWLA 3B7TA 2CFZA 4OYSA 3ASDA 3CVYA 5FT9A 5EIDA 2VGXB 3TL5A 3U4TA 3QB2A 3QWVA 5KWDA 1PY1A 5LCWC 2AXZA 4U07A 1E7VA 1H6KA 2UWJG 5G2NA 3SFZA 4K5BA 3BG1B 3V30A 1N4RA 4GYOA 1SA4A 3LCAA 2FF4A 4TXQA 2XQ0A 2BF0X 5HS0A 3K9IA 3FUMA 4A1SA 5AQ9A 1ZBPA 3CK7A 4YNDA 2QYJA 4FULA 3S7JA 3D9PA 3JXJA 1Y8MA 3D9NA 2A5UA 5LP0A 3R9MA 3RO2A 3DWLG 4OAUC 4Q69A 1UOHA 3LJNA 3IKOB 3TWXA 3RSEG 4KVMA 2CHWA 3CVUA 4UWHA 4HOTA 2I9CA 1UG3A 3WG7E 2ZGGA 2J4DA 3MKRA 5FWQA 4AM9A 5BV1A 3D9JA 2FO7A 4GZDA 3ABME 2XEEA 3UX4A 4UI9J 5G55A 3AS5A 1BD8A 1EF1C 4B93B 3S7BA 2XS8A 2DYRE 2WXMA 4CDRA 1D8DA 1UN8A 3CHOA 2KZTA 3JQ1A 2ONDA 3PZ2A 1OWNA 2IOSA 1LF8A 2VSYA 3QK0A 1V54E 3ZW3A 4JXTA 3ZEFA 4DX2A 3AU5A 4DI4A 3FP3A 4G24A 3D9KA 4J8SA 5ENNA 2DBAA 4AIFA 3EDTB 4G8LA 5EYPF 4CEMA 4CRWA 3NQPA 2L6JA 1B89A 3W9FA 2FULA 1OWOA 4JD2G 5ANRA 1HXIA 3MYVA 3P2BA 1WG0A 3G2UA 3IXEA 2EINE 3V2OA 3AS4A 2WXRA 2DIWA 4WNGA 2R59A 2BEDA
chains in the Genus database with same CATH topology
2P9PG 2P9UG 3DXKG 4JD2G 2P9KG 2P9SG 3UKRG 3ULEG 2P9NG 3DWLG 3UKUG 2P9LG 1K8KG 1U2VG 3DXMG 2P9IG 3RSEG 1TYQG 4XEIG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9P G;  2P9U G;  3DXK G;  4JD2 G;  2P9K G;  2P9S G;  3UKR G;  3ULE G;  2P9N G;  3DWL G;  3UKU G;  2P9L G;  1K8K G;  1U2V G;  3DXM G;  2P9I G;  3RSE G;  1TYQ G;  4XEI G; 
#chains in the Genus database with same CATH topology
 3CKB A;  3FHE A;  1DC2 A;  5FJY A;  1TNB A;  1KT1 A;  2UY1 A;  4J8D A;  1XNF A;  3EUV A;  4MS6 A;  3UM3 A;  4B8A A;  3ASH A;  4J0U A;  5ENS D;  1E96 B;  4C9B B;  3AG1 E;  1N54 A;  4R7L A;  1N0R A;  1Z3Y A;  5KNG A;  3RAU A;  3RKV A;  5BXU A;  3ZFW A;  1H6P A;  4UI9 C;  1OY3 D;  4G26 A;  1MHQ A;  1MX6 A;  1EDU A;  2OCC E;  1H19 A;  4G11 A;  4CT0 A;  1H0A A;  2NXP A;  2EIL E;  4JVS A;  4F6R D;  3ZYL A;  4N2Q A;  5BNW A;  2KZT B;  1S70 B;  3OXG A;  1IQU A;  4TV3 A;  3PEV B;  3ML9 A;  2J49 A;  2CG2 A;  3L6A A;  3EU5 A;  4DUI A;  4GTR A;  3SFY A;  3ZKJ A;  1DCE A;  3MCX A;  1MJ0 A;  2J4B A;  2GRR B;  3CHS A;  5KJM A;  1Z5S C;  1IYG A;  4U8Y D;  3ZPJ A;  1IHG A;  4FAD A;  3FUE A;  4XIF A;  3ZNG A;  4CDM A;  1BI7 B;  3UPV A;  1ZB1 A;  4OVV A;  1MX2 A;  3FUF A;  4K5C A;  4MLP A;  3IBE A;  3RO3 A;  3CSF A;  5G04 J;  4UUC A;  4H7X A;  5T8I A;  3I3N A;  3G2T A;  2PM6 A;  1Z3X A;  4LRZ A;  2UY1 B;  4FLH A;  2KAT A;  1TNZ A;  3UT7 A;  3HXF A;  5CBN A;  2DYS E;  4WWN A;  4Q96 A;  3E32 A;  1TR4 A;  3HXC A;  5HRY A;  2B6C A;  3ZYM A;  1A5E A;  3V2X A;  2L0I A;  4F3V A;  1BI8 B;  1K1A A;  3PEU B;  2Y4T A;  5E76 A;  3EIQ C;  1TN8 A;  1KLX A;  3DEO A;  3TAX A;  2EQX A;  3SBS A;  2F8X K;  4GTM A;  4DX5 D;  2X6I A;  4BT8 A;  2KC7 A;  2AWI A;  4JA9 A;  3CK8 A;  3DSX A;  5EYL A;  2P58 C;  2V0P A;  5JJ6 A;  2WPV A;  3C3O A;  4X8Q A;  4F53 A;  3KD7 A;  4XX5 A;  2Y1L E;  2IFU A;  3LY7 A;  5C1D A;  2C0M A;  5J08 A;  1AWC B;  1ZU2 A;  2E0I A;  3LVQ E;  1KZO A;  1OT8 A;  1S64 A;  5EKQ D;  3SZ7 A;  3URZ A;  3FTU A;  4IUL A;  4BSZ B;  3GZS A;  3T8M A;  3NBN B;  4I6G A;  3HDX A;  2HYZ A;  5AEN A;  4RVB A;  2I1J A;  4JHR A;  4KMO A;  1HF8 A;  4EHM A;  3DBS A;  2DCP A;  5G04 C;  3OAW A;  3NOC D;  3ZGQ A;  1HFA A;  4HRM B;  4GTQ A;  1U3D A;  4DJA A;  1YMP A;  5AYW D;  4NIK A;  2HO1 A;  2XCC A;  3T5X A;  3CHQ A;  3D9M A;  1JWF A;  4WWP A;  1HO8 A;  3G2V A;  1JCR A;  2XGS A;  5CCM A;  1AP7 A;  3SGH A;  1OCR E;  1N94 A;  5ITZ F;  1QQE A;  3UT8 A;  2VSX E;  4DRX E;  2IO2 C;  1INZ A;  4YVO A;  3B7S A;  3TWT A;  4YDO A;  3Q75 A;  3KSL A;  5T4Y A;  5FIN A;  4AEZ C;  3FDH A;  3V31 A;  1OWL A;  2FEZ A;  2IY0 C;  1SA5 A;  1FT2 A;  3UKR G;  2X6H A;  1MQS A;  4GTS A;  3S7D A;  2IJG X;  4GYW A;  3Q9U C;  2HR2 A;  4D10 C;  1O5M A;  2WQ7 A;  3FUH A;  2XHE A;  3BQO A;  4UWG A;  3CGH A;  3APD A;  4B89 A;  3LY8 A;  2KCK A;  2IQC A;  5T3R A;  5EIB E;  3RRN B;  4K5A B;  3TJP A;  2GRM A;  5A6C A;  4AV7 A;  1QZ2 A;  3OTN A;  4M3O A;  2I1K A;  2F8Y A;  1NI1 A;  3LYA A;  2EIJ E;  3ENE A;  3FU6 A;  1E8Z A;  3C3Q A;  3D3M A;  2VGY A;  1OCC E;  4O60 A;  4URK A;  1GW6 A;  2WM9 A;  3ASO E;  5CRU A;  4ILH B;  4RLY A;  3CVL A;  4TXR A;  4ABN A;  5CBO A;  3L82 A;  5EN5 D;  3TG4 A;  3ML8 A;  4I17 A;  3PNL B;  3LEW A;  5AIJ A;  3SF4 A;  1G3N B;  5ARG A;  3ZIM A;  2KM4 A;  5CEA A;  4B0Z A;  2WXK A;  2J07 A;  1HU3 A;  4ATZ D;  3FEX A;  3EHM A;  3ABK E;  2LAH A;  2QZA A;  3DRA A;  5BUZ A;  3O4Z A;  3NZU A;  2XZD G;  3APF A;  4G8K A;  1NA0 A;  1VDY A;  3U9W A;  3B95 A;  4GCO A;  1KPS B;  4QQI A;  1DCQ A;  3NAW A;  4JHJ A;  3CQC B;  4MRU A;  2ETB A;  1EPU A;  4I1A A;  1HX8 A;  3HXE A;  3TGO A;  4GA2 A;  2OEW A;  4I1O B;  3CK9 A;  1HE8 A;  3IHY A;  3TWR A;  4HFG A;  4A3T A;  2NSZ A;  3FUD A;  1K3Z D;  4U8V D;  4YDY A;  3JYS A;  4LSZ E;  3UIO C;  5FZS A;  4G2V A;  3RRU A;  1ELR A;  3BUA A;  1N4S A;  2H6F A;  3HYM B;  3JUI A;  4GMJ A;  5KJK A;  4O6F A;  3TWW A;  3TWV A;  2DZO A;  3CV0 A;  4M7C A;  5KCM A;  5CCL A;  2IEJ A;  4U8H A;  4XI9 A;  4RG9 A;  5B1A E;  3SY2 A;  2H6I A;  2R03 A;  5JJT A;  4U63 A;  3DEP A;  4GA1 A;  5AJL A;  3TXN A;  3PUJ A;  1W3B A;  4UWK A;  4APO A;  3PUK A;  4NQ0 A;  2F37 A;  3DPY A;  4AP2 A;  4O1O A;  2OEV A;  2XGO A;  1WDY A;  2LSV A;  4I6J A;  2WMO A;  3GYZ A;  3Q9N C;  3PS6 A;  4K0R A;  3EHQ A;  2WXP A;  4N2S A;  4PS3 A;  4A55 A;  3KEA A;  4FHK A;  2BKG A;  2EIM E;  3U3W A;  2JAB A;  4A63 B;  4HOR A;  3F6Q A;  4HRL A;  3HRA A;  3OXL A;  2P9N G;  2OOE A;  2V5F A;  3I5P A;  3UUX A;  1JWG A;  2QY7 A;  4N5Q A;  4BWR A;  2ILR A;  1SQM A;  2FI7 A;  4HB5 A;  3FTS A;  3ZYQ A;  4EZK A;  4JHK A;  1SW6 A;  1LD7 A;  4U7E B;  4HLE A;  3FY4 A;  3NZS A;  4BTB A;  1RW2 A;  2ION A;  4Z68 A;  3FU5 A;  4K03 A;  1TJF A;  3SBT B;  2E2E A;  2MYO A;  1FVH A;  3O48 A;  3UI2 A;  1DVP A;  4N5C A;  4CGV A;  3Q73 A;  1KZP A;  3KSQ A;  1S63 A;  3UQ3 A;  4KYO B;  1S0P A;  4BFR A;  1K8K G;  5AN8 A;  3LPZ A;  5EDS A;  2VSN A;  5FIO A;  2XPZ A;  4G25 A;  4LEU A;  4DPR A;  3HVE A;  2R5S A;  2WXN A;  3Q7F A;  5EX3 A;  2P9S G;  3L17 A;  2WXJ A;  4J8Y A;  2P9L G;  3CVV A;  4AVX A;  3JQ0 A;  3CVW A;  1FT1 A;  3W9G A;  2XRY A;  1D9S A;  1TNO A;  1ELW A;  4GTP A;  4DX6 D;  4HI9 A;  3CVQ A;  1TEZ A;  4NUR A;  2LO6 A;  3MJW A;  4HBD A;  2DZN A;  5IY5 E;  5B3S E;  3CVX A;  3G2W A;  2PQN A;  4L2L A;  5G05 J;  3PNT B;  2QFC A;  2RFM A;  4RG6 A;  4N3C A;  3I4G A;  2VGE A;  2X6F A;  3PZD A;  4U0S A;  4AY6 A;  4ILG A;  2GRN B;  5EIL A;  4HOS A;  5CRV A;  5D2M C;  1JUQ A;  3ULE G;  3L9T A;  4EBA G;  2WQH A;  3RRM B;  2X3M A;  2XS1 A;  4YVQ C;  4ZHB A;  3TWS A;  2NYJ A;  4B94 A;  3NF1 A;  3PDN A;  3DST A;  5FZR A;  5LOZ A;  1FCH A;  2J09 A;  5ENR D;  4GA0 A;  3FTY A;  4BEP A;  2VTB B;  2MHK A;  3UT4 A;  5C2Y A;  3UIN C;  1TN6 A;  3D9H A;  3SD5 A;  4UQX A;  4F7A A;  3QJZ A;  2KBX A;  1MX4 A;  3ESL A;  4L9P A;  3Q49 B;  4U95 D;  3QDN A;  5CEC B;  2XZT G;  2AVP A;  5ENO D;  3FU0 A;  2JEK A;  4JPS A;  4G23 A;  3UKU G;  4GCN A;  3FH8 A;  2R05 A;  4BSX A;  2WVI A;  2X6J A;  2Y4U A;  3B7B A;  1HH8 A;  3UM1 A;  5JHA A;  3HVE B;  4RQI A;  3FH7 A;  2FBN A;  3IV0 A;  1X81 A;  3ULQ A;  3SO8 A;  2HE0 A;  3UM2 A;  3UXG A;  3CVP A;  4DI3 A;  1QNF A;  2I2O A;  2RG8 A;  3TG5 A;  5G05 C;  2P9U G;  3Q5M A;  1ELK A;  1N4P A;  4CDN A;  1MYO A;  5KNH D;  2XCB A;  2MRI A;  4FHJ A;  2Y69 E;  2L6B A;  3S7F A;  4E85 A;  3ESK A;  5HKP A;  4I9E A;  2WB2 A;  2Y3A A;  2VYI A;  3T5V A;  3J5P A;  3L16 A;  4BER A;  3JCK C;  1FVF A;  3QAR A;  4WNF A;  1E8Y A;  2KXP C;  1BU9 A;  1HS6 A;  4I6E A;  1K1B A;  4TXP A;  1H2T C;  5ENQ D;  2PNN A;  4UQY A;  2YHC A;  3KS2 A;  3ASF A;  3FTW A;  3DXM G;  3SHF A;  1TNY A;  2A5E A;  3L22 A;  2XGM A;  3EJN A;  3AJI A;  4CT4 A;  4FC8 A;  4Q94 A;  4GZ3 A;  2LNI A;  2GGF A;  3FUI A;  1N0Q A;  1YCS B;  3PRE A;  3SI5 A;  3FU3 A;  1IXV A;  4WUY A;  4C48 B;  4GTT A;  1N11 A;  4WWO A;  2V5Q C;  4CYM D;  4PDX A;  1TYQ G;  5BW8 C;  3NOG D;  1YYH A;  4BX9 A;  3CST A;  4IYP A;  2GRP B;  3AAA C;  2YNQ A;  3BG0 B;  4GU5 A;  1O1S A;  4LG6 A;  1IHB A;  4FJY A;  4W9R A;  4Y6C A;  2IO3 C;  4FP7 A;  1PC2 A;  2AXU A;  1TNU A;  2GW1 A;  2J8S D;  4HLL A;  2ZU6 B;  4FJZ A;  3B13 A;  3CQG B;  5KJL A;  3ASG A;  4BET A;  4LUN U;  2KCV A;  1BLX B;  5FTP A;  3UMV A;  3ABL E;  2XEN A;  3MV2 B;  3DSV A;  2WXG A;  2ZIS A;  3QWW A;  4OAV B;  2YQ8 A;  1N9A A;  5CED B;  3PZ1 A;  3HHM A;  1WY6 A;  3JUE A;  4EQF A;  4KT6 B;  4KZ0 A;  1EYH A;  2X38 A;  1TJC A;  1U2V G;  1PAQ A;  4J8E A;  1HG5 A;  1NA3 A;  2XEH A;  4GTV A;  1IKN D;  3MEK A;  2MOW A;  3EU9 A;  3FEY A;  3LJ3 A;  4JEU A;  2WQ6 A;  3PE3 A;  1NP7 A;  1UN9 A;  5D66 A;  4GPK A;  3MX3 A;  2WXQ A;  1E8W A;  2J08 A;  1N4Q A;  1O1T A;  1H2V C;  3E33 A;  1L5J A;  3LY9 A;  3FH5 A;  2WXF A;  3QKY A;  4I2Z A;  1A17 A;  2JLB A;  3LDZ A;  3CR3 A;  2RFA A;  3PE4 A;  1KT0 A;  2NC9 A;  4WNE A;  1X5B A;  3HXB A;  4ATG A;  2YHE A;  4ME2 A;  4TUM A;  4XI0 A;  3ZYK A;  2H6H A;  3DSU A;  3MV3 B;  1IQR A;  3LXU X;  1WAO 1;  4J7W A;  2OV8 A;  5BXO A;  2OVB A;  3FWV A;  5EX0 A;  3L13 A;  3HXD A;  4GZC A;  4AOF A;  2AJA A;  4PS7 A;  2IU1 A;  2P9P G;  5ANL A;  2GRQ B;  4BTA A;  2DWZ A;  3B7R L;  4DX7 D;  5ENP D;  5FQ6 A;  1D8E A;  3ASN E;  3QAQ A;  4U0U A;  4HQD A;  4BES A;  4AJW A;  1DNP A;  2P9I G;  3PZ3 A;  4HRN A;  3LKU A;  1YA0 A;  2QC9 A;  3AS8 A;  2ZXW E;  2OVF A;  4UI9 K;  2WXH A;  4PH4 B;  2EIK E;  1BPO A;  4KVO A;  5LX8 A;  5JJ7 A;  4HS2 A;  4FU3 A;  3Q15 A;  4EZL A;  4N39 A;  2XPI A;  5AQB A;  3CKC A;  4GPM A;  3J5Q B;  3ZXS A;  2LXM A;  4WAF A;  4H7Y A;  1UJK A;  2A4Z A;  2IOL A;  4UWF A;  2GRO B;  1XGW A;  1E7U A;  2B0O E;  2PM7 A;  4MBG A;  2WXI A;  1MZC A;  3AG3 E;  4XE0 A;  4XZ4 A;  3LS8 A;  4LCT A;  4PUC A;  5BT1 A;  2AXV A;  3KAE A;  3PH0 C;  3CHP A;  3PRZ A;  4JEH A;  3P1U A;  3VLD A;  4GYY A;  2WXL A;  3S2A A;  3L08 A;  3C3R A;  4YDW A;  3ISM C;  2RKK A;  4JL0 A;  4APF A;  2Q7F A;  2GRL A;  5CHE E;  2ETA A;  3SQV A;  3FUN A;  5CMW A;  3U64 A;  4I43 A;  3EIJ A;  4YDE A;  4JZY A;  4BY6 A;  2VTB A;  5D0O D;  2BKK B;  4FA6 A;  5H7P A;  4L1B A;  4EZJ A;  1NL4 A;  5ENT D;  3FFL A;  1E90 A;  3Q4A B;  4GMR A;  1WM5 A;  1TN7 A;  3D9O A;  3UM0 A;  3ZUV B;  5FQ4 A;  4B8C B;  3N71 A;  1NFI E;  4AXH A;  2CG3 A;  2CHX A;  4LER A;  4TRQ A;  2VQ2 A;  2WMN A;  3T8K A;  4JW1 A;  5DIZ A;  3OXF A;  3IEG A;  3D9I A;  4F1P A;  3D9L A;  2R02 A;  5HQ8 A;  3BU8 A;  5E75 A;  2R2L A;  5AAO A;  3RU0 A;  1OCO E;  5D0Q D;  4GB9 A;  4I1M A;  4GZ5 A;  4HNA D;  1RZ4 A;  1H6O A;  2F0Y A;  2V4H C;  3G2S A;  4LNG A;  2AW6 A;  3DPD A;  2X6K A;  3IHV A;  1U3C A;  5DBK A;  4EBA A;  3UTM A;  3DXK G;  3R7R A;  2LAI A;  3AU4 A;  5FQ8 A;  2LUH A;  3QC1 A;  1Q2Z A;  3Q7A A;  4KZC A;  3TWQ A;  1HZ4 A;  3Q79 A;  4A1G A;  3AG2 E;  3MZL B;  3FUL A;  3QNK A;  2FO1 E;  2LXL A;  5LFA A;  4BX8 A;  3C72 A;  1H2U A;  3ONK A;  4BT9 A;  4DK5 A;  2C0L A;  2M63 A;  3RIB A;  5JHB A;  3CLJ A;  3FTX A;  4PS8 A;  3NB2 A;  4U96 D;  4EPZ A;  3MKQ A;  3KEZ A;  3CIA A;  4A3V A;  3Q47 B;  5AQA A;  2Y0B G;  2PQR A;  3CHM A;  4HXI A;  4U04 A;  4KXK B;  1UJJ A;  2V8S E;  2KCL A;  3AG4 E;  4EEC A;  2L0T B;  3FTV A;  4UQZ A;  4ZFH A;  2VJ8 A;  5KJN A;  4CCA A;  4TUU A;  3E4B A;  4IN3 B;  3B7U X;  3GZ2 A;  3T9K A;  4JA7 A;  2C2L A;  3U66 A;  2ZIR A;  1P5Q A;  3ZXP A;  4ACL A;  3TWU A;  3ZVV A;  1QYM A;  4OVU A;  3FTZ A;  3GW4 A;  4HOU A;  5JMN D;  4NAC A;  1SVX A;  3ZHE A;  5M72 A;  2IF4 A;  4GZ6 A;  3UIP C;  2I6H A;  3CEQ A;  3PVL A;  3ULY A;  5HI7 A;  1NZN A;  4MKT A;  3EHR A;  5AAR A;  3CHR A;  3Q78 A;  3FUJ A;  4LNU D;  4DLQ A;  4HI8 A;  4RSY A;  3JXI A;  3VTX A;  4I9C A;  1JCQ A;  3PZ4 A;  3C5R A;  1SZ9 A;  4WND A;  1SZA A;  3SNX A;  4GML A;  2L9B A;  2LSU A;  4N3A A;  3ONL A;  3V79 K;  1O1R A;  1OWM A;  1JPL A;  5BV0 A;  3CVN A;  4C0M A;  1Z6T A;  2BUG A;  4DX1 A;  1E8X A;  5AQ7 A;  4I2W A;  1FPP A;  5CMY A;  5JA4 D;  2ETC A;  2PL2 A;  3GZ1 A;  4JB8 P;  4ANW A;  1N95 A;  2HM8 A;  3ZN3 A;  4E6H A;  4KBQ A;  3DSW A;  3TXM A;  4GAA A;  4L23 A;  2CHZ A;  4FLB A;  3MKQ B;  2PZI A;  4P29 A;  4ILI A;  5FZQ A;  3DSS A;  1Y6I A;  1LD8 A;  2XRZ A;  2DVW A;  2P9K G;  4N3B A;  4ANX A;  2XEV A;  2VGX A;  3R9A B;  4CGW A;  3FUK A;  3VLF A;  3R7Q A;  1HG2 A;  3VLE A;  2BTD A;  3APC A;  4F1S A;  1OUV A;  4XKB A;  2VSO E;  4NRH B;  4Y6W A;  5LCW J;  4XKC A;  3E34 A;  2XPY A;  2R17 C;  5J90 A;  4CZ2 D;  2YIN A;  3I4R B;  2RD0 A;  4ANV A;  3WXX A;  3RJV A;  3ZHE B;  4HOQ A;  3MGB A;  4U0Z A;  1QBQ A;  3LVR E;  5A23 A;  5A7D B;  3E37 A;  3HIZ A;  4ANU A;  1V55 E;  5B1B E;  1OCZ E;  5AJD A;  4C0E A;  5KBA A;  4DLO A;  4G1T A;  1OWP A;  4AY5 A;  2WXO A;  4ACK A;  2CFU A;  4XEI G;  4IRU A;  4JC8 A;  2ZGD A;  1OXJ A;  4QFV A;  1N52 A;  4LNB A;  4L2Y A;  5CER B;  3ZU7 B;  3QOU A;  3BEE A;  3RK6 A;  4V3I A;  4O1P A;  3L54 A;  5BPP A;  4J8F A;  2H6G A;  3ZRH A;  5FQ7 A;  3C98 A;  4HVB A;  3VTY A;  1UW4 B;  4GTO A;  2J9Q A;  5ARF A;  1LTX A;  3X2Q E;  4J6I A;  4L7T A;  3QWP A;  3E30 A;  3EHN A;  2P2C P;  3SFX A;  2V4L A;  3HG0 D;  2QYU A;  3MA5 A;  1JCS A;  4UWL A;  3B7T A;  2CFZ A;  4OYS A;  3ASD A;  3CVY A;  5FT9 A;  5EID A;  2VGX B;  3TL5 A;  3U4T A;  3QB2 A;  3QWV A;  5KWD A;  1PY1 A;  5LCW C;  2AXZ A;  4U07 A;  1E7V A;  1H6K A;  2UWJ G;  5G2N A;  3SFZ A;  4K5B A;  3BG1 B;  3V30 A;  1N4R A;  4GYO A;  1SA4 A;  3LCA A;  2FF4 A;  4TXQ A;  2XQ0 A;  2BF0 X;  5HS0 A;  3K9I A;  3FUM A;  4A1S A;  5AQ9 A;  1ZBP A;  3CK7 A;  4YND A;  2QYJ A;  4FUL A;  3S7J A;  3D9P A;  3JXJ A;  1Y8M A;  3D9N A;  2A5U A;  5LP0 A;  3R9M A;  3RO2 A;  3DWL G;  4OAU C;  4Q69 A;  1UOH A;  3LJN A;  3IKO B;  3TWX A;  3RSE G;  4KVM A;  2CHW A;  3CVU A;  4UWH A;  4HOT A;  2I9C A;  1UG3 A;  3WG7 E;  2ZGG A;  2J4D A;  3MKR A;  5FWQ A;  4AM9 A;  5BV1 A;  3D9J A;  2FO7 A;  4GZD A;  3ABM E;  2XEE A;  3UX4 A;  4UI9 J;  5G55 A;  3AS5 A;  1BD8 A;  1EF1 C;  4B93 B;  3S7B A;  2XS8 A;  2DYR E;  2WXM A;  4CDR A;  1D8D A;  1UN8 A;  3CHO A;  2KZT A;  3JQ1 A;  2OND A;  3PZ2 A;  1OWN A;  2IOS A;  1LF8 A;  2VSY A;  3QK0 A;  1V54 E;  3ZW3 A;  4JXT A;  3ZEF A;  4DX2 A;  3AU5 A;  4DI4 A;  3FP3 A;  4G24 A;  3D9K A;  4J8S A;  5ENN A;  2DBA A;  4AIF A;  3EDT B;  4G8L A;  5EYP F;  4CEM A;  4CRW A;  3NQP A;  2L6J A;  1B89 A;  3W9F A;  2FUL A;  1OWO A;  4JD2 G;  5ANR A;  1HXI A;  3MYV A;  3P2B A;  1WG0 A;  3G2U A;  3IXE A;  2EIN E;  3V2O A;  3AS4 A;  2WXR A;  2DIW A;  4WNG A;  2R59 A;  2BED A; 
#chains in the Genus database with same CATH homology
 2P9P G;  2P9U G;  3DXK G;  4JD2 G;  2P9K G;  2P9S G;  3UKR G;  3ULE G;  2P9N G;  3DWL G;  3UKU G;  2P9L G;  1K8K G;  1U2V G;  3DXM G;  2P9I G;  3RSE G;  1TYQ G;  4XEI G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...