2P9SG

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
141
structure length
135
Chain Sequence
FRKVDVDEYDENKFVDEDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 41
structure length 135
sequence length 141
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9sG00
3UKRG 1K8KG 2P9KG 3DXKG 3RSEG 2P9PG 3DXMG 2P9IG 2P9NG 4JD2G 2P9LG 4XEIG 1U2VG 2P9SG 3DWLG 2P9UG 3UKUG 3ULEG 1TYQG
chains in the Genus database with same CATH superfamily
1V55E 2PNNA 2PZIA 4XKCA 5B1AE 2XS1A 2WQ6A 5D0OD 3SNXA 1OWOA 5HS0A 4AV7A 3N71A 2IQCA 5EIDA 1NA3A 2XHEA 1JUQA 1MX6A 3EIJA 2I1KA 5CHEE 3RO2A 3B7BA 2R03A 4WNGA 3CK7A 3PZDA 2LAHA 4J6IA 4MS6A 4GMRA 4P29A 3OXLA 1RZ4A 4RG9A 3L22A 3Q5MA 4WNDA 5HQ8A 2GRRB 3OTNA 3PZ1A 3RJVA 4RSYA 4GU5A 2PL2A 3CVUA 1MZCA 5G04J 2HM8A 1S70B 3LYAA 2KCVA 2WXGA 3MA5A 4LERA 3UIOC 5T4YA 3FULA 5E76A 1E7UA 3MJWA 3ZKJA 2VSOE 3D9KA 3ONKA 4A1SA 3CGHA 3QOUA 4HOTA 3ZVVA 3Q7FA 3PRZA 3FTXA 4CCAA 1Y6IA 4B93B 1H6PA 2XPYA 4FLBA 4B94A 4AM9A 3QAQA 2HR2A 4I43A 4B8AA 4LNGA 5JA4D 5JHAA 1HZ4A 3UINC 3Q79A 3D3MA 4U04A 4O1PA 3X2QE 3FUMA 4J8DA 4DX5D 2L9BA 3CIAA 1FVHA 2YQ8A 3QARA 4APFA 4XI9A 3ZHEB 2VQ2A 2JEKA 2XZTG 3AS8A 4R7LA 2P9PG 4JPSA 4RLYA 5AARA 3CHSA 1UJJA 2XGSA 2QC9A 3O4ZA 4Q96A 1TJCA 4YVOA 1E8WA 3IEGA 3FEYA 5ANRA 1BI7B 1GW6A 2FF4A 2IJGX 1MJ0A 1IQRA 2R02A 1ELWA 4G26A 3BQOA 3ULEG 4GB9A 4HVBA 5FJYA 3EUVA 4TXQA 4G23A 4ACLA 2OCCE 2X6FA 2XRZA 3E33A 2DZOA 3IXEA 3RAUA 3DPDA 3LS8A 3JXIA 2B6CA 1KT1A 4N2QA 5AQ9A 4FHKA 4XX5A 4B0ZA 3MCXA 2PQRA 3RRMB 3JUIA 2XGOA 4U8VD 3D9OA 2LXMA 3ZFWA 4ABNA 2AXVA 3HYMB 2R2LA 1EYHA 5EYPF 1H2UA 3LXUX 4GTSA 3CVPA 1OWPA 3RRNB 4CEMA 3I5PA 2P9KG 3FWVA 4ZFHA 4BWRA 5CMWA 2NXPA 5CBOA 5G05J 3ESKA 2KXPC 3MX3A 3PVLA 1Z5SC 2WXOA 4PS8A 4F1PA 2WXKA 3E32A 1TNUA 1QBQA 5AN8A 2VSNA 3BUAA 3LKUA 3PZ4A 3RO3A 4RQIA 3W9FA 1JCSA 3GZ1A 3ASFA 1WY6A 4UI9K 4DRXE 3APFA 5ENOD 3DSXA 4HB5A 5JHBA 2WQ7A 4DI3A 1OT8A 1IQUA 1AWCB 3DSSA 4WWNA 3JUEA 2NSZA 1IHGA 2AWIA 2X38A 3ENEA 4J8FA 4N5QA 4UWKA 2VYIA 3LVQE 4HOSA 2XCBA 3SGHA 2CG2A 2VGXA 1QNFA 4W9RA 2J8SD 2E0IA 5B3SE 1BD8A 3ZYKA 5EIBE 4Z68A 4GYOA 1EPUA 5CECB 4AXHA 5ARGA 5BPPA 5ENNA 1V54E 3BG1B 3UM3A 2X6HA 1D9SA 2FO7A 3T8MA 4LSZE 4YDOA 3ASGA 3FY4A 3LJNA 3Q75A 3KSQA 3D9IA 1Q2ZA 3ZIMA 2BTDA 2VJ8A 2VGYA 2V4HC 4WWOA 1BPOA 4FC8A 4EPZA 5CERB 1OY3D 2IEJA 2RFMA 3V2XA 1K8KG 2C0LA 2FEZA 3L16A 5FTPA 3ZPJA 2PM6A 3R9MA 2P9IG 2P9NG 3IV0A 4XZ4A 3R9AB 1NI1A 2YHEA 4GTQA 1KZOA 2V8SE 1SW6A 2X6IA 2GRMA 3UXGA 2EIJE 3BEEA 1U3CA 5ANLA 4F3VA 3U3WA 2LXLA 3TWVA 4EZJA 4JEHA 3NOGD 5LP0A 1TNBA 4BTBA 4ME2A 2MRIA 2KBXA 2LSUA 5CEAA 3UQ3A 1SA4A 1H2VC 5CCMA 3NAWA 4KXKB 1YCSB 5BT1A 4I6GA 4K5BA 4DPRA 2B0OE 3MGBA 4ANVA 3CEQA 3NB2A 1K1AA 5B1BE 1H2TC 4LRZA 3UIPC 4L9PA 2ZGDA 2M63A 3TWUA 2LO6A 4DI4A 2YNQA 4L23A 3S7BA 4UQYA 3AAAC 4U0UA 3PREA 1HXIA 3CVVA 1P5QA 3NZUA 4NQ0A 4O1OA 1OWLA 3C3QA 2CFUA 3D9MA 2J07A 2ETCA 1HX8A 5FQ6A 4BY6A 4N5CA 4JL0A 3V31A 1SZAA 4ATGA 2V5FA 4DLQA 5JJ6A 4CT0A 4ILGA 4K0RA 4WNFA 3OXGA 5G2NA 1Y8MA 4WAFA 4ACKA 3L13A 3LY8A 2P9LG 1Z6TA 4AEZC 2DIWA 5FIOA 1FT2A 3C72A 4CGWA 1TR4A 1N4RA 4MBGA 3EDTB 2ZGGA 2WPVA 3ZGQA 4BT9A 4HOQA 1OWNA 5G55A 2DCPA 2AXUA 5EX0A 5ENQD 1LF8A 2WB2A 3PEUB 4EQFA 4ZHBA 4RG6A 4Y6CA 5ENTD 5C1DA 4GAAA 4DJAA 1HF8A 3I3NA 5EILA 3UTMA 2Y4TA 1UOHA 3B7TA 1NP7A 5ENRD 3TWWA 4L2YA 4HXIA 1E8ZA 3ZRHA 1O5MA 5CCLA 3OAWA 2P9UG 3HDXA 4I1MA 2LAIA 1JWFA 1KPSB 4ANUA 3Q7AA 2Y0BG 4GZDA 5ENPD 3FUNA 3ML8A 3ZXSA 3ULQA 3SO8A 2Y1LE 4LEUA 3LCAA 4B8CB 3IHYA 4J8EA 1ELKA 1O1TA 3AG3E 1HU3A 1N4SA 3EHQA 1WDYA 2YINA 3UPVA 2UWJG 5H7PA 3Q49B 2Y3AA 1TNYA 1Z3YA 1ZBPA 2KCKA 4GTRA 1WAO1 5KWDA 3T5XA 2VGXB 1HG5A 2R17C 1JWGA 2IU1A 3L82A 3SZ7A 4U96D 4GA2A 3FTWA 2XPZA 3ABLE 2KCLA 2A5EA 3C98A 3CVXA 2BEDA 2FBNA 4FU3A 2AXZA 3LPZA 3VTYA 4NACA 4HORA 2H6FA 4L1BA 3TJPA 5LCWC 3QK0A 2VTBA 1SQMA 3JQ1A 3TL5A 2PM7A 3SI5A 4E85A 3MZLB 3CQGB 4HI9A 3UX4A 1HE8A 1XNFA 1S64A 5T8IA 2P2CP 4GMLA 4LNUD 2ZISA 2P58C 1N11A 5T3RA 2LSVA 3HVEB 4JEUA 4ILHB 2EILE 4WWPA 2HE0A 2WXLA 1SVXA 4XI0A 4GPMA 4Y6WA 4PH4B 4LG6A 1TJFA 2PQNA 2Q7FA 4JC8A 3HXCA 2FO1E 2OVFA 1WM5A 3GZSA 3NF1A 2EIKE 1DVPA 3D9NA 4U07A 5A7DB 1UG3A 1FCHA 1UJKA 5FQ4A 1TNOA 1UN9A 4G25A 4YDEA 1HG2A 4CYMD 4UQXA 2LUHA 5AQBA 4U8HA 4B89A 3MKRA 1NL4A 2IFUA 3AG1E 3SQVA 3D9HA 4GCOA 3EU9A 4HRNA 3HHMA 3FHEA 4HOUA 4XEIG 3VTXA 4GTTA 3DEOA 2IOLA 3DEPA 3PUKA 5FQ7A 3CKCA 4GPKA 4BTAA 1H0AA 4PS7A 1PY1A 5BXOA 1N9AA 4LNBA 4KBQA 3DSUA 3ZW3A 1MQSA 4OAUC 3UT7A 2XS8A 2LNIA 4UWGA 4A3VA 4ILIA 3QDNA 2VSXE 2J49A 3EJNA 4G1TA 4FJYA 4AJWA 3E37A 2XGMA 3FUIA 4JHRA 3EHRA 4GTMA 4MKTA 4I1AA 5KBAA 5KJNA 4U8YD 5FZRA 2XQ0A 4MRUA 3NQPA 1KT0A 2HO1A 2WVIA 3KSLA 1YA0A 4C48B 4TV3A 3FTUA 2OOEA 4AY5A 3EU5A 5E75A 2IO2C 2XZDG 1O1RA 5FZSA 4J8YA 2WM9A 1TYQG 1E90A 3P1UA 3Q15A 4X8QA 3U4TA 4UWFA 4CDRA 3PNLB 3S7DA 4XIFA 2MOWA 3TWXA 3SF4A 1A5EA 4GZ5A 3ZUVB 3D9PA 4JW1A 4I2ZA 5BV1A 4M7CA 1S63A 3PDNA 4EZKA 4N3CA 4M3OA 3UM0A 3SBSA 4JB8P 5EN5D 1S0PA 4GZ3A 1EF1C 3CK9A 3FUHA 3CHOA 2R05A 3V79K 2UY1A 4QQIA 3UT8A 3DXMG 1OCZE 1OUVA 3CVWA 2ZXWE 3BG0B 3IKOB 1X81A 5EYLA 1YMPA 3C3OA 3FDHA 2V0PA 4I6EA 1OWMA 5J90A 4IULA 3FP3A 5BV0A 5KNGA 4UI9C 4XKBA 3UM1A 3DPYA 1TEZA 3EHMA 3FU5A 4BFRA 3ULYA 1NA0A 4JHKA 3F6QA 4NRHB 2XENA 3FTSA 1Z3XA 3CHQA 1FT1A 5AYWD 4Q69A 3PS6A 2KZTA 2FI7A 3L54A 4URKA 4G8LA 3UUXA 3K9IA 3QNKA 3HVEA 3C3RA 3FU0A 3ABME 4O6FA 1E8YA 4OVVA 5KJKA 2WMOA 5EDSA 2R5SA 4BSXA 3MV2B 1YYHA 4U95D 1K1BA 3S7FA 2QZAA 3FUFA 2BKKB 2DVWA 2ETAA 3AJIA 3ASOE 5LCWJ 3CVQA 3FUKA 5D66A 4C0EA 4J0UA 3APCA 3WG7E 3ZYQA 3MV3B 3WXXA 1MX4A 1U3DA 3QWPA 2WXRA 2QFCA 2V5QC 5ITZF 2WXHA 2AJAA 4J8SA 3NOCD 2VTBB 4KVOA 2A4ZA 1BU9A 4IYPA 5J08A 4L7TA 2J9QA 3U9WA 4D10C 1K3ZD 1HH8A 2ETBA 1OCRE 4DX6D 3FU3A 1D8EA 1UW4B 2E2EA 3V30A 3LDZA 3JCKC 3TG5A 3CSFA 4NIKA 2OEWA 4GZCA 5CMYA 4GYYA 2XRYA 3HRAA 2QYUA 4DX7D 3CSTA 2WXIA 3ESLA 3AS4A 4CZ2D 3S2AA 4L2LA 3DBSA 4N3AA 2GRPB 1ZU2A 2XEHA 3QWVA 3G2VA 4AP2A 3Q9UC 3W9GA 3PUJA 3Q73A 4U63A 3FH5A 3CR3A 4C9BB 1BLXB 5A6CA 3DWLG 1HS6A 4BSZB 3C5RA 2WQHA 3SFYA 3KD7A 5D0QD 1O1SA 4EZLA 3BU8A 3QC1A 3PE3A 1N52A 4HLEA 2RKKA 1QZ2A 3FUDA 3RU0A 2BUGA 4DX1A 4DK5A 1ELRA 3FUEA 2ZIRA 5AQAA 1NZNA 4G24A 4A1GA 4MLPA 2NC9A 4O60A 3APDA 4CDMA 5G05C 2C0MA 3L6AA 1H6KA 2ONDA 5CBNA 3ONLA 4LCTA 3ZYLA 4HI8A 4BERA 4FP7A 5C2YA 4A3TA 4GMJA 2H6GA 1PAQA 4H7XA 2RD0A 1KZPA 4AY6A 2I9CA 5BUZA 3JXJA 3FUJA 4FJZA 1L5JA 4AVXA 1BI8B 2GROB 3DRAA 4U0SA 1JCQA 2L6BA 3RK6A 3AU4A 4CT4A 1LD7A 4HS2A 5BNWA 3RSEG 3TXNA 3SFXA 4GTVA 4U7EB 3ZEFA 3NZSA 1AP7A 1N54A 2MYOA 2J4DA 4HRMB 2H6HA 5AJLA 2DBAA 2IY0C 2WXFA 3UM2A 1D8DA 5DIZA 1H6OA 4JA7A 2XEVA 3MKQA 3FTZA 5FINA 1U2VG 1MHQA 2F0YA 3B95A 4UI9J 3I4GA 5BW8C 3UKRG 4FLHA 3URZA 4UWHA 3AG2E 1N0RA 4JA9A 1EDUA 3VLDA 3SFZA 3ZNGA 2WXJA 3DXKG 2UY1B 4CGVA 4KVMA 3VLFA 2WXPA 2WXMA 2ZU6B 1XGWA 5AENA 4PDXA 4WNEA 1TN8A 3HXBA 3FTVA 3S7JA 2RFAA 4BEPA 4E6HA 4I17A 3IHVA 3KEZA 4GA1A 3CV0A 2KZTB 5LOZA 3U64A 3O48A 3ZU7B 3B13A 3QJZA 3SHFA 4I9EA 3QKYA 4ANWA 1N94A 5DBKA 2GRQB 2IOSA 2EQXA 2IONA 1E7VA 4IN3B 4IRUA 1G3NB 4ANXA 2H6IA 3B7UX 1WG0A 2I6HA 3DSVA 4ATZD 2GW1A 1UN8A 3MEKA 5FQ8A 2F8XK 3PH0C 4F53A 3TXMA 3AU5A 4K5AB 3EHNA 2EIME 4JD2G 1JCRA 4YDWA 4YDYA 4UUCA 2I1JA 4N2SA 3U66A 3EIQC 5HI7A 3LJ3A 3L17A 3ISMC 2L0TB 4C0MA 3G2SA 3Q47B 4WUYA 4F6RD 2WXNA 5KCMA 4YNDA 3I4RB 1X5BA 4DUIA 2FULA 3FH8A 1MYOA 1DCQA 1OCCE 3E30A 4G2VA 3G2TA 3J5QB 3T8KA 4HFGA 5M72A 3CQCB 2OV8A 5IY5E 1OXJA 2KC7A 4KMOA 3LVRE 1OCOE 2OVBA 3DSWA 5KNHD 2X6JA 3ZXPA 3CK8A 3KS2A 4AIFA 5KJMA 4JVSA 4EECA 2F37A 2CHZA 4TXRA 4BT8A 2CG3A 3B7SA 3ZYMA 4KZ0A 3CHMA 1E8XA 5EX3A 2AVPA 4J7WA 2MHKA 3R7RA 1VDYA 3SBTB 3NBNB 4UWLA 3KEAA 3UKUG 1IYGA 3JQ0A 4U0ZA 4TRQA 2GGFA 4BX8A 4G11A 3HG0D 4XE0A 2L6JA 1FPPA 3G2WA 3TWQA 2L0IA 2HYZA 4CRWA 5AIJA 4BESA 3Q78A 1PC2A 2GRNB 3GZ2A 4JXTA 3SD5A 1TN7A 1N0QA 5FWQA 4PUCA 5CRUA 4AOFA 3HIZA 3AG4E 3LY7A 4I2WA 2DYSE 3G2UA 4N39A 3HXEA 3QB2A 2ILRA 4BETA 4K5CA 3ASDA 1H19A 2Y4UA 2VGEA 4G8KA 4FHJA 5AAOA 3AS5A 3HXDA 3UMVA 3D9LA 1JPLA 2J09A 2QYJA 2R59A 2J08A 4H7YA 3JYSA 3FH7A 1A17A 1LD8A 3PNTB 2DWZA 2OEVA 1RW2A 3GYZA 4GTOA 4I1OB 2WXQA 3SY2A 3T9KA 4KT6B 3TWRA 1HFAA 4APOA 1B89A 2I2OA 4NURA 2KATA 4F1SA 1IHBA 3UI2A 1HO8A 2DYRE 4BX9A 3V2OA 3TWSA 3PZ3A 2GRLA 4TUMA 5CRVA 1SA5A 5G04C 3TWTA 2XCCA 2AW6A 4DX2A 4JZYA 1KLXA 4TXPA 1LTXA 3PE4A 1N95A 4YVQC 3ASHA 4GA0A 3MKQB 4GYWA 2JLBA 3IBEA 2CFZA 4EBAA 2EINE 3OXFA 3CVLA 4EHMA 1ZB1A 5AQ7A 5HKPA 3ZHEA 1MX2A 3FU6A 2IO3C 3B7RL 3ZN3A 2CHXA 4V3IA 1N4PA 4EBAG 4A63B 5JJ7A 5AJDA 3PEVB 2BF0X 5ENSD 4GCNA 4FULA 2WMNA 1NFIE 4JHJA 2A5UA 2QY7A 4K03A 3VLEA 4PS3A 3TG4A 3CHPA 3DSTA 2NYJA 3J5PA 3LY9A 4N3BA 3KAEA 4QFVA 1W3BA 5KJLA 3QWWA 4OAVB 4I6JA 5BXUA 1QQEA 3E34A 4I9CA 2V4LA 2VSYA 2XPIA 5ARFA 3LEWA 1N4QA 3PZ2A 3CHRA 2YHCA 2J4BA 4HQDA 2BKGA 1DCEA 2P9SG 2DZNA 3MYVA 2RG8A 4KYOB 2KM4A 1IKND 4FADA 4F7AA 3R7QA 3RKVA 3FEXA 4HLLA 4KZCA 1TN6A 2X6KA 3CLJA 3UT4A 4GZ6A 4FA6A 5HRYA 1IXVA 1INZA 1DNPA 3FFLA 2C2LA 1TNZA 4A55A 4OVUA 5D2MC 5FZQA 4OYSA 2F8YA 3L9TA 2IF4A 3RRUA 4GTPA 3FTYA 3TGOA 3E4BA 4Q94A 4LUNU 3D9JA 3L08A 2JABA 5FT9A 2XEEA 4HNAD 1QYMA 1DC2A 1FVFA 4UQZA 4TUUA 5JJTA 3CVYA 3CVNA 3P2BA 1SZ9A 2X3MA 5A23A 3T5VA 2CHWA 3GW4A 3RIBA 4CDNA 3ASNE 3HXFA 3Q4AB 4HRLA 3ML9A 5LFAA 4RVBA 3Q9NC 2Y69E 5CEDB 3ABKE 5JMND 3CKBA 3TAXA 4HBDA 5LX8A 4DLOA 5EKQD 1E96B
chains in the Genus database with same CATH topology
3UKRG 1K8KG 2P9KG 3DXKG 3RSEG 2P9PG 3DXMG 2P9IG 2P9NG 4JD2G 2P9LG 4XEIG 1U2VG 2P9SG 3DWLG 2P9UG 3UKUG 3ULEG 1TYQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKR G;  1K8K G;  2P9K G;  3DXK G;  3RSE G;  2P9P G;  3DXM G;  2P9I G;  2P9N G;  4JD2 G;  2P9L G;  4XEI G;  1U2V G;  2P9S G;  3DWL G;  2P9U G;  3UKU G;  3ULE G;  1TYQ G; 
#chains in the Genus database with same CATH topology
 1V55 E;  2PNN A;  2PZI A;  4XKC A;  5B1A E;  2XS1 A;  2WQ6 A;  5D0O D;  3SNX A;  1OWO A;  5HS0 A;  4AV7 A;  3N71 A;  2IQC A;  5EID A;  1NA3 A;  2XHE A;  1JUQ A;  1MX6 A;  3EIJ A;  2I1K A;  5CHE E;  3RO2 A;  3B7B A;  2R03 A;  4WNG A;  3CK7 A;  3PZD A;  2LAH A;  4J6I A;  4MS6 A;  4GMR A;  4P29 A;  3OXL A;  1RZ4 A;  4RG9 A;  3L22 A;  3Q5M A;  4WND A;  5HQ8 A;  2GRR B;  3OTN A;  3PZ1 A;  3RJV A;  4RSY A;  4GU5 A;  2PL2 A;  3CVU A;  1MZC A;  5G04 J;  2HM8 A;  1S70 B;  3LYA A;  2KCV A;  2WXG A;  3MA5 A;  4LER A;  3UIO C;  5T4Y A;  3FUL A;  5E76 A;  1E7U A;  3MJW A;  3ZKJ A;  2VSO E;  3D9K A;  3ONK A;  4A1S A;  3CGH A;  3QOU A;  4HOT A;  3ZVV A;  3Q7F A;  3PRZ A;  3FTX A;  4CCA A;  1Y6I A;  4B93 B;  1H6P A;  2XPY A;  4FLB A;  4B94 A;  4AM9 A;  3QAQ A;  2HR2 A;  4I43 A;  4B8A A;  4LNG A;  5JA4 D;  5JHA A;  1HZ4 A;  3UIN C;  3Q79 A;  3D3M A;  4U04 A;  4O1P A;  3X2Q E;  3FUM A;  4J8D A;  4DX5 D;  2L9B A;  3CIA A;  1FVH A;  2YQ8 A;  3QAR A;  4APF A;  4XI9 A;  3ZHE B;  2VQ2 A;  2JEK A;  2XZT G;  3AS8 A;  4R7L A;  2P9P G;  4JPS A;  4RLY A;  5AAR A;  3CHS A;  1UJJ A;  2XGS A;  2QC9 A;  3O4Z A;  4Q96 A;  1TJC A;  4YVO A;  1E8W A;  3IEG A;  3FEY A;  5ANR A;  1BI7 B;  1GW6 A;  2FF4 A;  2IJG X;  1MJ0 A;  1IQR A;  2R02 A;  1ELW A;  4G26 A;  3BQO A;  3ULE G;  4GB9 A;  4HVB A;  5FJY A;  3EUV A;  4TXQ A;  4G23 A;  4ACL A;  2OCC E;  2X6F A;  2XRZ A;  3E33 A;  2DZO A;  3IXE A;  3RAU A;  3DPD A;  3LS8 A;  3JXI A;  2B6C A;  1KT1 A;  4N2Q A;  5AQ9 A;  4FHK A;  4XX5 A;  4B0Z A;  3MCX A;  2PQR A;  3RRM B;  3JUI A;  2XGO A;  4U8V D;  3D9O A;  2LXM A;  3ZFW A;  4ABN A;  2AXV A;  3HYM B;  2R2L A;  1EYH A;  5EYP F;  1H2U A;  3LXU X;  4GTS A;  3CVP A;  1OWP A;  3RRN B;  4CEM A;  3I5P A;  2P9K G;  3FWV A;  4ZFH A;  4BWR A;  5CMW A;  2NXP A;  5CBO A;  5G05 J;  3ESK A;  2KXP C;  3MX3 A;  3PVL A;  1Z5S C;  2WXO A;  4PS8 A;  4F1P A;  2WXK A;  3E32 A;  1TNU A;  1QBQ A;  5AN8 A;  2VSN A;  3BUA A;  3LKU A;  3PZ4 A;  3RO3 A;  4RQI A;  3W9F A;  1JCS A;  3GZ1 A;  3ASF A;  1WY6 A;  4UI9 K;  4DRX E;  3APF A;  5ENO D;  3DSX A;  4HB5 A;  5JHB A;  2WQ7 A;  4DI3 A;  1OT8 A;  1IQU A;  1AWC B;  3DSS A;  4WWN A;  3JUE A;  2NSZ A;  1IHG A;  2AWI A;  2X38 A;  3ENE A;  4J8F A;  4N5Q A;  4UWK A;  2VYI A;  3LVQ E;  4HOS A;  2XCB A;  3SGH A;  2CG2 A;  2VGX A;  1QNF A;  4W9R A;  2J8S D;  2E0I A;  5B3S E;  1BD8 A;  3ZYK A;  5EIB E;  4Z68 A;  4GYO A;  1EPU A;  5CEC B;  4AXH A;  5ARG A;  5BPP A;  5ENN A;  1V54 E;  3BG1 B;  3UM3 A;  2X6H A;  1D9S A;  2FO7 A;  3T8M A;  4LSZ E;  4YDO A;  3ASG A;  3FY4 A;  3LJN A;  3Q75 A;  3KSQ A;  3D9I A;  1Q2Z A;  3ZIM A;  2BTD A;  2VJ8 A;  2VGY A;  2V4H C;  4WWO A;  1BPO A;  4FC8 A;  4EPZ A;  5CER B;  1OY3 D;  2IEJ A;  2RFM A;  3V2X A;  1K8K G;  2C0L A;  2FEZ A;  3L16 A;  5FTP A;  3ZPJ A;  2PM6 A;  3R9M A;  2P9I G;  2P9N G;  3IV0 A;  4XZ4 A;  3R9A B;  1NI1 A;  2YHE A;  4GTQ A;  1KZO A;  2V8S E;  1SW6 A;  2X6I A;  2GRM A;  3UXG A;  2EIJ E;  3BEE A;  1U3C A;  5ANL A;  4F3V A;  3U3W A;  2LXL A;  3TWV A;  4EZJ A;  4JEH A;  3NOG D;  5LP0 A;  1TNB A;  4BTB A;  4ME2 A;  2MRI A;  2KBX A;  2LSU A;  5CEA A;  3UQ3 A;  1SA4 A;  1H2V C;  5CCM A;  3NAW A;  4KXK B;  1YCS B;  5BT1 A;  4I6G A;  4K5B A;  4DPR A;  2B0O E;  3MGB A;  4ANV A;  3CEQ A;  3NB2 A;  1K1A A;  5B1B E;  1H2T C;  4LRZ A;  3UIP C;  4L9P A;  2ZGD A;  2M63 A;  3TWU A;  2LO6 A;  4DI4 A;  2YNQ A;  4L23 A;  3S7B A;  4UQY A;  3AAA C;  4U0U A;  3PRE A;  1HXI A;  3CVV A;  1P5Q A;  3NZU A;  4NQ0 A;  4O1O A;  1OWL A;  3C3Q A;  2CFU A;  3D9M A;  2J07 A;  2ETC A;  1HX8 A;  5FQ6 A;  4BY6 A;  4N5C A;  4JL0 A;  3V31 A;  1SZA A;  4ATG A;  2V5F A;  4DLQ A;  5JJ6 A;  4CT0 A;  4ILG A;  4K0R A;  4WNF A;  3OXG A;  5G2N A;  1Y8M A;  4WAF A;  4ACK A;  3L13 A;  3LY8 A;  2P9L G;  1Z6T A;  4AEZ C;  2DIW A;  5FIO A;  1FT2 A;  3C72 A;  4CGW A;  1TR4 A;  1N4R A;  4MBG A;  3EDT B;  2ZGG A;  2WPV A;  3ZGQ A;  4BT9 A;  4HOQ A;  1OWN A;  5G55 A;  2DCP A;  2AXU A;  5EX0 A;  5ENQ D;  1LF8 A;  2WB2 A;  3PEU B;  4EQF A;  4ZHB A;  4RG6 A;  4Y6C A;  5ENT D;  5C1D A;  4GAA A;  4DJA A;  1HF8 A;  3I3N A;  5EIL A;  3UTM A;  2Y4T A;  1UOH A;  3B7T A;  1NP7 A;  5ENR D;  3TWW A;  4L2Y A;  4HXI A;  1E8Z A;  3ZRH A;  1O5M A;  5CCL A;  3OAW A;  2P9U G;  3HDX A;  4I1M A;  2LAI A;  1JWF A;  1KPS B;  4ANU A;  3Q7A A;  2Y0B G;  4GZD A;  5ENP D;  3FUN A;  3ML8 A;  3ZXS A;  3ULQ A;  3SO8 A;  2Y1L E;  4LEU A;  3LCA A;  4B8C B;  3IHY A;  4J8E A;  1ELK A;  1O1T A;  3AG3 E;  1HU3 A;  1N4S A;  3EHQ A;  1WDY A;  2YIN A;  3UPV A;  2UWJ G;  5H7P A;  3Q49 B;  2Y3A A;  1TNY A;  1Z3Y A;  1ZBP A;  2KCK A;  4GTR A;  1WAO 1;  5KWD A;  3T5X A;  2VGX B;  1HG5 A;  2R17 C;  1JWG A;  2IU1 A;  3L82 A;  3SZ7 A;  4U96 D;  4GA2 A;  3FTW A;  2XPZ A;  3ABL E;  2KCL A;  2A5E A;  3C98 A;  3CVX A;  2BED A;  2FBN A;  4FU3 A;  2AXZ A;  3LPZ A;  3VTY A;  4NAC A;  4HOR A;  2H6F A;  4L1B A;  3TJP A;  5LCW C;  3QK0 A;  2VTB A;  1SQM A;  3JQ1 A;  3TL5 A;  2PM7 A;  3SI5 A;  4E85 A;  3MZL B;  3CQG B;  4HI9 A;  3UX4 A;  1HE8 A;  1XNF A;  1S64 A;  5T8I A;  2P2C P;  4GML A;  4LNU D;  2ZIS A;  2P58 C;  1N11 A;  5T3R A;  2LSV A;  3HVE B;  4JEU A;  4ILH B;  2EIL E;  4WWP A;  2HE0 A;  2WXL A;  1SVX A;  4XI0 A;  4GPM A;  4Y6W A;  4PH4 B;  4LG6 A;  1TJF A;  2PQN A;  2Q7F A;  4JC8 A;  3HXC A;  2FO1 E;  2OVF A;  1WM5 A;  3GZS A;  3NF1 A;  2EIK E;  1DVP A;  3D9N A;  4U07 A;  5A7D B;  1UG3 A;  1FCH A;  1UJK A;  5FQ4 A;  1TNO A;  1UN9 A;  4G25 A;  4YDE A;  1HG2 A;  4CYM D;  4UQX A;  2LUH A;  5AQB A;  4U8H A;  4B89 A;  3MKR A;  1NL4 A;  2IFU A;  3AG1 E;  3SQV A;  3D9H A;  4GCO A;  3EU9 A;  4HRN A;  3HHM A;  3FHE A;  4HOU A;  4XEI G;  3VTX A;  4GTT A;  3DEO A;  2IOL A;  3DEP A;  3PUK A;  5FQ7 A;  3CKC A;  4GPK A;  4BTA A;  1H0A A;  4PS7 A;  1PY1 A;  5BXO A;  1N9A A;  4LNB A;  4KBQ A;  3DSU A;  3ZW3 A;  1MQS A;  4OAU C;  3UT7 A;  2XS8 A;  2LNI A;  4UWG A;  4A3V A;  4ILI A;  3QDN A;  2VSX E;  2J49 A;  3EJN A;  4G1T A;  4FJY A;  4AJW A;  3E37 A;  2XGM A;  3FUI A;  4JHR A;  3EHR A;  4GTM A;  4MKT A;  4I1A A;  5KBA A;  5KJN A;  4U8Y D;  5FZR A;  2XQ0 A;  4MRU A;  3NQP A;  1KT0 A;  2HO1 A;  2WVI A;  3KSL A;  1YA0 A;  4C48 B;  4TV3 A;  3FTU A;  2OOE A;  4AY5 A;  3EU5 A;  5E75 A;  2IO2 C;  2XZD G;  1O1R A;  5FZS A;  4J8Y A;  2WM9 A;  1TYQ G;  1E90 A;  3P1U A;  3Q15 A;  4X8Q A;  3U4T A;  4UWF A;  4CDR A;  3PNL B;  3S7D A;  4XIF A;  2MOW A;  3TWX A;  3SF4 A;  1A5E A;  4GZ5 A;  3ZUV B;  3D9P A;  4JW1 A;  4I2Z A;  5BV1 A;  4M7C A;  1S63 A;  3PDN A;  4EZK A;  4N3C A;  4M3O A;  3UM0 A;  3SBS A;  4JB8 P;  5EN5 D;  1S0P A;  4GZ3 A;  1EF1 C;  3CK9 A;  3FUH A;  3CHO A;  2R05 A;  3V79 K;  2UY1 A;  4QQI A;  3UT8 A;  3DXM G;  1OCZ E;  1OUV A;  3CVW A;  2ZXW E;  3BG0 B;  3IKO B;  1X81 A;  5EYL A;  1YMP A;  3C3O A;  3FDH A;  2V0P A;  4I6E A;  1OWM A;  5J90 A;  4IUL A;  3FP3 A;  5BV0 A;  5KNG A;  4UI9 C;  4XKB A;  3UM1 A;  3DPY A;  1TEZ A;  3EHM A;  3FU5 A;  4BFR A;  3ULY A;  1NA0 A;  4JHK A;  3F6Q A;  4NRH B;  2XEN A;  3FTS A;  1Z3X A;  3CHQ A;  1FT1 A;  5AYW D;  4Q69 A;  3PS6 A;  2KZT A;  2FI7 A;  3L54 A;  4URK A;  4G8L A;  3UUX A;  3K9I A;  3QNK A;  3HVE A;  3C3R A;  3FU0 A;  3ABM E;  4O6F A;  1E8Y A;  4OVV A;  5KJK A;  2WMO A;  5EDS A;  2R5S A;  4BSX A;  3MV2 B;  1YYH A;  4U95 D;  1K1B A;  3S7F A;  2QZA A;  3FUF A;  2BKK B;  2DVW A;  2ETA A;  3AJI A;  3ASO E;  5LCW J;  3CVQ A;  3FUK A;  5D66 A;  4C0E A;  4J0U A;  3APC A;  3WG7 E;  3ZYQ A;  3MV3 B;  3WXX A;  1MX4 A;  1U3D A;  3QWP A;  2WXR A;  2QFC A;  2V5Q C;  5ITZ F;  2WXH A;  2AJA A;  4J8S A;  3NOC D;  2VTB B;  4KVO A;  2A4Z A;  1BU9 A;  4IYP A;  5J08 A;  4L7T A;  2J9Q A;  3U9W A;  4D10 C;  1K3Z D;  1HH8 A;  2ETB A;  1OCR E;  4DX6 D;  3FU3 A;  1D8E A;  1UW4 B;  2E2E A;  3V30 A;  3LDZ A;  3JCK C;  3TG5 A;  3CSF A;  4NIK A;  2OEW A;  4GZC A;  5CMY A;  4GYY A;  2XRY A;  3HRA A;  2QYU A;  4DX7 D;  3CST A;  2WXI A;  3ESL A;  3AS4 A;  4CZ2 D;  3S2A A;  4L2L A;  3DBS A;  4N3A A;  2GRP B;  1ZU2 A;  2XEH A;  3QWV A;  3G2V A;  4AP2 A;  3Q9U C;  3W9G A;  3PUJ A;  3Q73 A;  4U63 A;  3FH5 A;  3CR3 A;  4C9B B;  1BLX B;  5A6C A;  3DWL G;  1HS6 A;  4BSZ B;  3C5R A;  2WQH A;  3SFY A;  3KD7 A;  5D0Q D;  1O1S A;  4EZL A;  3BU8 A;  3QC1 A;  3PE3 A;  1N52 A;  4HLE A;  2RKK A;  1QZ2 A;  3FUD A;  3RU0 A;  2BUG A;  4DX1 A;  4DK5 A;  1ELR A;  3FUE A;  2ZIR A;  5AQA A;  1NZN A;  4G24 A;  4A1G A;  4MLP A;  2NC9 A;  4O60 A;  3APD A;  4CDM A;  5G05 C;  2C0M A;  3L6A A;  1H6K A;  2OND A;  5CBN A;  3ONL A;  4LCT A;  3ZYL A;  4HI8 A;  4BER A;  4FP7 A;  5C2Y A;  4A3T A;  4GMJ A;  2H6G A;  1PAQ A;  4H7X A;  2RD0 A;  1KZP A;  4AY6 A;  2I9C A;  5BUZ A;  3JXJ A;  3FUJ A;  4FJZ A;  1L5J A;  4AVX A;  1BI8 B;  2GRO B;  3DRA A;  4U0S A;  1JCQ A;  2L6B A;  3RK6 A;  3AU4 A;  4CT4 A;  1LD7 A;  4HS2 A;  5BNW A;  3RSE G;  3TXN A;  3SFX A;  4GTV A;  4U7E B;  3ZEF A;  3NZS A;  1AP7 A;  1N54 A;  2MYO A;  2J4D A;  4HRM B;  2H6H A;  5AJL A;  2DBA A;  2IY0 C;  2WXF A;  3UM2 A;  1D8D A;  5DIZ A;  1H6O A;  4JA7 A;  2XEV A;  3MKQ A;  3FTZ A;  5FIN A;  1U2V G;  1MHQ A;  2F0Y A;  3B95 A;  4UI9 J;  3I4G A;  5BW8 C;  3UKR G;  4FLH A;  3URZ A;  4UWH A;  3AG2 E;  1N0R A;  4JA9 A;  1EDU A;  3VLD A;  3SFZ A;  3ZNG A;  2WXJ A;  3DXK G;  2UY1 B;  4CGV A;  4KVM A;  3VLF A;  2WXP A;  2WXM A;  2ZU6 B;  1XGW A;  5AEN A;  4PDX A;  4WNE A;  1TN8 A;  3HXB A;  3FTV A;  3S7J A;  2RFA A;  4BEP A;  4E6H A;  4I17 A;  3IHV A;  3KEZ A;  4GA1 A;  3CV0 A;  2KZT B;  5LOZ A;  3U64 A;  3O48 A;  3ZU7 B;  3B13 A;  3QJZ A;  3SHF A;  4I9E A;  3QKY A;  4ANW A;  1N94 A;  5DBK A;  2GRQ B;  2IOS A;  2EQX A;  2ION A;  1E7V A;  4IN3 B;  4IRU A;  1G3N B;  4ANX A;  2H6I A;  3B7U X;  1WG0 A;  2I6H A;  3DSV A;  4ATZ D;  2GW1 A;  1UN8 A;  3MEK A;  5FQ8 A;  2F8X K;  3PH0 C;  4F53 A;  3TXM A;  3AU5 A;  4K5A B;  3EHN A;  2EIM E;  4JD2 G;  1JCR A;  4YDW A;  4YDY A;  4UUC A;  2I1J A;  4N2S A;  3U66 A;  3EIQ C;  5HI7 A;  3LJ3 A;  3L17 A;  3ISM C;  2L0T B;  4C0M A;  3G2S A;  3Q47 B;  4WUY A;  4F6R D;  2WXN A;  5KCM A;  4YND A;  3I4R B;  1X5B A;  4DUI A;  2FUL A;  3FH8 A;  1MYO A;  1DCQ A;  1OCC E;  3E30 A;  4G2V A;  3G2T A;  3J5Q B;  3T8K A;  4HFG A;  5M72 A;  3CQC B;  2OV8 A;  5IY5 E;  1OXJ A;  2KC7 A;  4KMO A;  3LVR E;  1OCO E;  2OVB A;  3DSW A;  5KNH D;  2X6J A;  3ZXP A;  3CK8 A;  3KS2 A;  4AIF A;  5KJM A;  4JVS A;  4EEC A;  2F37 A;  2CHZ A;  4TXR A;  4BT8 A;  2CG3 A;  3B7S A;  3ZYM A;  4KZ0 A;  3CHM A;  1E8X A;  5EX3 A;  2AVP A;  4J7W A;  2MHK A;  3R7R A;  1VDY A;  3SBT B;  3NBN B;  4UWL A;  3KEA A;  3UKU G;  1IYG A;  3JQ0 A;  4U0Z A;  4TRQ A;  2GGF A;  4BX8 A;  4G11 A;  3HG0 D;  4XE0 A;  2L6J A;  1FPP A;  3G2W A;  3TWQ A;  2L0I A;  2HYZ A;  4CRW A;  5AIJ A;  4BES A;  3Q78 A;  1PC2 A;  2GRN B;  3GZ2 A;  4JXT A;  3SD5 A;  1TN7 A;  1N0Q A;  5FWQ A;  4PUC A;  5CRU A;  4AOF A;  3HIZ A;  3AG4 E;  3LY7 A;  4I2W A;  2DYS E;  3G2U A;  4N39 A;  3HXE A;  3QB2 A;  2ILR A;  4BET A;  4K5C A;  3ASD A;  1H19 A;  2Y4U A;  2VGE A;  4G8K A;  4FHJ A;  5AAO A;  3AS5 A;  3HXD A;  3UMV A;  3D9L A;  1JPL A;  2J09 A;  2QYJ A;  2R59 A;  2J08 A;  4H7Y A;  3JYS A;  3FH7 A;  1A17 A;  1LD8 A;  3PNT B;  2DWZ A;  2OEV A;  1RW2 A;  3GYZ A;  4GTO A;  4I1O B;  2WXQ A;  3SY2 A;  3T9K A;  4KT6 B;  3TWR A;  1HFA A;  4APO A;  1B89 A;  2I2O A;  4NUR A;  2KAT A;  4F1S A;  1IHB A;  3UI2 A;  1HO8 A;  2DYR E;  4BX9 A;  3V2O A;  3TWS A;  3PZ3 A;  2GRL A;  4TUM A;  5CRV A;  1SA5 A;  5G04 C;  3TWT A;  2XCC A;  2AW6 A;  4DX2 A;  4JZY A;  1KLX A;  4TXP A;  1LTX A;  3PE4 A;  1N95 A;  4YVQ C;  3ASH A;  4GA0 A;  3MKQ B;  4GYW A;  2JLB A;  3IBE A;  2CFZ A;  4EBA A;  2EIN E;  3OXF A;  3CVL A;  4EHM A;  1ZB1 A;  5AQ7 A;  5HKP A;  3ZHE A;  1MX2 A;  3FU6 A;  2IO3 C;  3B7R L;  3ZN3 A;  2CHX A;  4V3I A;  1N4P A;  4EBA G;  4A63 B;  5JJ7 A;  5AJD A;  3PEV B;  2BF0 X;  5ENS D;  4GCN A;  4FUL A;  2WMN A;  1NFI E;  4JHJ A;  2A5U A;  2QY7 A;  4K03 A;  3VLE A;  4PS3 A;  3TG4 A;  3CHP A;  3DST A;  2NYJ A;  3J5P A;  3LY9 A;  4N3B A;  3KAE A;  4QFV A;  1W3B A;  5KJL A;  3QWW A;  4OAV B;  4I6J A;  5BXU A;  1QQE A;  3E34 A;  4I9C A;  2V4L A;  2VSY A;  2XPI A;  5ARF A;  3LEW A;  1N4Q A;  3PZ2 A;  3CHR A;  2YHC A;  2J4B A;  4HQD A;  2BKG A;  1DCE A;  2P9S G;  2DZN A;  3MYV A;  2RG8 A;  4KYO B;  2KM4 A;  1IKN D;  4FAD A;  4F7A A;  3R7Q A;  3RKV A;  3FEX A;  4HLL A;  4KZC A;  1TN6 A;  2X6K A;  3CLJ A;  3UT4 A;  4GZ6 A;  4FA6 A;  5HRY A;  1IXV A;  1INZ A;  1DNP A;  3FFL A;  2C2L A;  1TNZ A;  4A55 A;  4OVU A;  5D2M C;  5FZQ A;  4OYS A;  2F8Y A;  3L9T A;  2IF4 A;  3RRU A;  4GTP A;  3FTY A;  3TGO A;  3E4B A;  4Q94 A;  4LUN U;  3D9J A;  3L08 A;  2JAB A;  5FT9 A;  2XEE A;  4HNA D;  1QYM A;  1DC2 A;  1FVF A;  4UQZ A;  4TUU A;  5JJT A;  3CVY A;  3CVN A;  3P2B A;  1SZ9 A;  2X3M A;  5A23 A;  3T5V A;  2CHW A;  3GW4 A;  3RIB A;  4CDN A;  3ASN E;  3HXF A;  3Q4A B;  4HRL A;  3ML9 A;  5LFA A;  4RVB A;  3Q9N C;  2Y69 E;  5CED B;  3ABK E;  5JMN D;  3CKB A;  3TAX A;  4HBD A;  5LX8 A;  4DLO A;  5EKQ D;  1E96 B; 
#chains in the Genus database with same CATH homology
 3UKR G;  1K8K G;  2P9K G;  3DXK G;  3RSE G;  2P9P G;  3DXM G;  2P9I G;  2P9N G;  4JD2 G;  2P9L G;  4XEI G;  1U2V G;  2P9S G;  3DWL G;  2P9U G;  3UKU G;  3ULE G;  1TYQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...