2JEKA

Crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
140
structure length
140
Chain Sequence
DPFDLKRFVYAQAPVYRSVVEELRAGRKRGHWMWFVFPQLRGLGSSPLAVRYGISSLEEAQAYLQHDLLGPRLHECTGLVNQVQGRSIEEIFGPPDDLKLCSSMTLFARATDANQDFVALLAKYYGGGEDRRTVALLAVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords RV1873
publication title The Molecular Structure of Rv1873, a Conserved Hypothetical Protein from Mycobacterium Tuberculosis, at 1.38A Resolution
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 54
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2007-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08837 DUF1810 Protein of unknown function (DUF1810)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.380 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2jekA00
2JEKA
chains in the Genus database with same CATH superfamily
1X5BA 4FULA 2P9SG 1D8EA 2MOWA 3BQOA 5KNGA 4TXPA 1H2UA 4I6EA 3RSEG 4N3BA 1E96B 2FO7A 5HKPA 4FHKA 4Q94A 5CMYA 2IOLA 1TNYA 4KZCA 1UJJA 3RKVA 1E8ZA 1KPSB 2DVWA 3UXGA 3SF4A 3CQCB 2JLBA 4L1BA 2VSNA 3L22A 4HOQA 3T8MA 2VTBA 4WUYA 2P9NG 2B0OE 4CGWA 3D9IA 5AQ7A 4GTMA 2EQXA 5CBNA 3ZXSA 1DVPA 5E76A 2XPIA 3PEVB 4EECA 5HRYA 4HLLA 1S64A 2XEHA 4LERA 3PZ2A 3HVEB 2L9BA 3CK9A 1NA3A 3ONKA 3LY9A 5HS0A 3ASDA 3PE3A 3FTUA 3R9MA 1OUVA 5AQ9A 3IV0A 4TRQA 4U07A 3APDA 2PNNA 4FLBA 4KBQA 4A63B 2EIKE 4FJZA 2V4HC 3FY4A 1DCEA 3UI2A 1INZA 4GTSA 2XZDG 3CQGB 3FTWA 4MKTA 2X6FA 4ILIA 3B95A 2ZGDA 2IO3C 2XPYA 4JEUA 1UW4B 2C0LA 1EPUA 2F8XK 4I17A 2I2OA 4LRZA 5D0OD 3AG3E 2R17C 3L08A 4XI9A 2RFAA 1QZ2A 4ATGA 4GA2A 4L23A 4YDWA 3Q5MA 1HO8A 2GGFA 4LCTA 2E0IA 4XZ4A 4C9BB 1N4QA 3LCAA 3NZSA 4W9RA 1IHGA 1EF1C 3O4ZA 3J5QB 2EILE 2WVIA 4BEPA 2XS1A 4XI0A 3MKQB 3SO8A 1Z6TA 3BG0B 4OVVA 4GA0A 4RSYA 5JHAA 3KEZA 2ZU6B 1U2VG 2GRLA 3DXKG 2V0PA 3GW4A 4WNGA 2AWIA 4EQFA 5B3SE 2QYUA 3UT7A 5D0QD 2BUGA 1LD8A 3PDNA 3ZGQA 4HQDA 3TWSA 4YDYA 3KSLA 3ABKE 4J8EA 4N2SA 1HE8A 4GTRA 1ZB1A 2UY1A 1U3CA 5BPPA 5ARGA 2LXMA 5T4YA 1SQMA 1JWGA 4NQ0A 2EIME 3ZYLA 2Y4UA 4B93B 3D9NA 2WXOA 3D9HA 3J5PA 4IN3B 3I5PA 1UJKA 2IJGX 4U8YD 1SZAA 1N0QA 2NC9A 3UPVA 5D2MC 3TL5A 1N4PA 1L5JA 2J9QA 4F1PA 2L0IA 2CG2A 2MHKA 3ZIMA 2XCCA 5BXUA 4KYOB 4CGVA 3IHYA 2DWZA 4TXRA 4J7WA 2A5EA 2M63A 2CG3A 2ETCA 2OOEA 2WXQA 2XEVA 3FU3A 3QARA 2KZTB 4I1OB 1YYHA 2Y0BG 4HXIA 1N52A 3I4RB 2P58C 2H6HA 3PUKA 4GTVA 3ULQA 4NIKA 3HXCA 3R7RA 4GMRA 4GYOA 3QDNA 3PREA 3BG1B 1O1RA 2DCPA 2CFUA 3FHEA 3V79K 4V3IA 4JC8A 3AG4E 1DCQA 4L2LA 2Y4TA 4JB8P 1KT0A 1DNPA 2H6IA 2P9IG 4J8DA 1DC2A 3TJPA 5G2NA 1IQUA 3ABLE 5LP0A 4DK5A 4ANUA 3NZUA 1ZBPA 3QWWA 3ZW3A 1K1BA 5ENQD 3D9KA 5G05J 4RVBA 3FTXA 1ZU2A 4UWHA 4AOFA 2A5UA 3LXUX 3ZHEA 2NXPA 4G8KA 3SY2A 4GU5A 1GW6A 3L6AA 2XGSA 4KZ0A 3ZKJA 5AAOA 3LKUA 1IYGA 3CEQA 3CK7A 3D9PA 3FU6A 5IY5E 3CVYA 2H6FA 2H6GA 3DWLG 5LCWJ 4Q96A 1QNFA 4G25A 5H7PA 3LS8A 1OWLA 3D9MA 2QYJA 4YNDA 1Z3YA 2ONDA 3Q9NC 4I2ZA 4ANXA 3JUIA 3ASFA 1G3NB 2HM8A 4G8LA 5ENPD 3EHQA 3CVWA 5C2YA 2L6JA 4U8VD 3RO3A 4XKBA 3UM0A 4KMOA 3KD7A 2OCCE 3FUDA 2LNIA 2GRMA 3F6QA 4RG9A 5ENRD 4DI3A 3CK8A 5CCMA 2DYRE 4GZDA 1QQEA 3Q4AB 3G2UA 4AEZC 5B1AE 3RU0A 1OWMA 4EZJA 5CEDB 3CHQA 3AAAC 4BX8A 4J8YA 2J8SD 2P2CP 4Q69A 1W3BA 3SBSA 4PS7A 2CFZA 3ZYKA 4K5BA 2KATA 4JA9A 3MYVA 5JMND 4TUMA 2R03A 4HVBA 5ENNA 3OXLA 3I3NA 4N3AA 4ACLA 4GB9A 2X6HA 4U04A 2YHEA 3FTSA 3V31A 1NA0A 2EIJE 3S2AA 1H2VC 5BV0A 4WNDA 2XPZA 1BI7B 4BX9A 3FTYA 4U63A 5B1BE 3UKRG 3JYSA 2QFCA 2VGXA 3EHRA 3C5RA 4XE0A 2P9LG 3MX3A 2F37A 3VLFA 3S7DA 3EIJA 3DSTA 3L17A 5KWDA 4XIFA 3U4TA 4WWOA 2F0YA 3AU5A 3ZVVA 1N11A 1Z3XA 2R02A 3G2VA 3PUJA 3ISMC 3KSQA 4JEHA 4KVMA 4U0SA 5JHBA 3CVUA 2V5QC 1E7UA 2BTDA 1K3ZD 1LD7A 4A1SA 4O1PA 4HRLA 3SFZA 4QFVA 2Q7FA 2VQ2A 4ATZD 5ITZF 4YDEA 2FBNA 1TR4A 4BY6A 4R7LA 2X38A 2IY0C 4G23A 2WXLA 3JXJA 3ML9A 1HS6A 2WXRA 4YDOA 2HR2A 3MV3B 3TAXA 5EYPF 1MYOA 1YMPA 2XS8A 4A1GA 3MCXA 3FU0A 1WM5A 4I6JA 1O1TA 3QC1A 2PZIA 5FZRA 2AVPA 4I1AA 4O60A 3ENEA 1BD8A 4JW1A 5FWQA 4UI9C 3U64A 1TNZA 2WXFA 2ZXWE 3TWXA 4FLHA 3CHMA 5KJKA 1N94A 1JWFA 2KCKA 4NRHB 3UQ3A 3B7SA 3ABME 2OEVA 2V4LA 3OAWA 1FT2A 5E75A 3CHSA 4JL0A 3ASOE 5BUZA 5ANRA 3AG1E 3R7QA 2IQCA 2J4BA 1NI1A 2X3MA 5T8IA 3ZRHA 1Y6IA 3DSUA 1A5EA 3EIQC 1FVFA 3MGBA 4AY6A 3Q73A 3RIBA 3LY7A 4WWNA 1HG5A 2Y1LE 1RZ4A 4JHKA 3HYMB 3OTNA 5FTPA 3SFYA 5EIDA 1SA4A 3Q7AA 4FJYA 3B7UX 2V8SE 3CSTA 5EDSA 3LDZA 4I1MA 3Q9UC 4BTAA 5KBAA 2CHZA 4OVUA 3PZ1A 1BI8B 3MJWA 4WAFA 4H7YA 3G2SA 4I9EA 2EINE 5FQ7A 5EX3A 4HOUA 3C98A 3E34A 4JZYA 5KNHD 5KJLA 5T3RA 1FPPA 4PDXA 3CR3A 1H2TC 2X6KA 3LY8A 2WB2A 5M72A 4TUUA 3ONLA 1SZ9A 3CV0A 3VLEA 4UUCA 4HRNA 3PRZA 3DBSA 4XX5A 3ZFWA 3PEUB 3U66A 1HH8A 2WXHA 3HVEA 1JUQA 1S70B 1OCCE 4AVXA 1Z5SC 2IF4A 3V2OA 3FH5A 3UUXA 3SI5A 2ETBA 3Q15A 4DI4A 3CVNA 1TN8A 2VYIA 4DLQA 1TJFA 5ENOD 3CHRA 1MQSA 1QYMA 4BFRA 2J4DA 3RAUA 1N54A 4AP2A 4B89A 2P9UG 3C72A 3L13A 4WNFA 1OCZE 1MX6A 4DPRA 1LF8A 1TNUA 3TGOA 2WXKA 4F3VA 3Q78A 2WXNA 5BXOA 5J90A 3CSFA 1OCRE 1UN9A 3FDHA 2BKKB 2LXLA 4LEUA 3FTVA 5EX0A 5ANLA 3QB2A 1E7VA 3RK6A 3HXEA 3PZ3A 3SQVA 2NYJA 1WDYA 2GROB 2A4ZA 1YA0A 3FUFA 5JJTA 4MS6A 3CKBA 1KT1A 5ARFA 1KZPA 1WG0A 3FEYA 3DPDA 4XKCA 1EDUA 3MKQA 5DBKA 4UWFA 1KLXA 4PS8A 1RW2A 2MYOA 2OEWA 3E32A 5ENSD 2XRYA 3TWTA 2I6HA 3FUHA 1TEZA 1IHBA 2QY7A 3NAWA 4LSZE 5EILA 1OY3D 2WQ7A 3UX4A 5HQ8A 1UN8A 1ELRA 4N5QA 1OT8A 3DPYA 4ZHBA 4MLPA 4K0RA 1NL4A 4G24A 5C1DA 2WXGA 4LUNU 4GCOA 4ACKA 3CVLA 4ZFHA 3JCKC 3PNLB 5AQBA 3SHFA 4KXKB 3LVRE 5AN8A 1B89A 5G55A 3ZUVB 2L0TB 3UM1A 3HXBA 4U0UA 4CEMA 2AW6A 3TG4A 2VSYA 1N9AA 2XGMA 5LFAA 3PE4A 2PM6A 2FF4A 2RKKA 4KT6B 4U95D 3MV2B 3DSWA 3WXXA 1LTXA 4GTOA 2OV8A 3C3QA 2KZTA 2GRPB 1N95A 1HF8A 1H0AA 3CVPA 4PS3A 4J6IA 1OCOE 3E33A 4Z68A 4DX6D 1N0RA 3JXIA 2VSOE 2L6BA 1HX8A 3IHVA 4LG6A 4HB5A 2Y3AA 4U96D 4UQYA 1TJCA 2VSXE 3AG2E 2XGOA 4B8AA 1MZCA 3C3RA 3NOCD 4UWGA 4BESA 4GZ6A 5EN5D 2LUHA 2ZGGA 3Q7FA 3HG0D 2C0MA 5CECB 2FO1E 3BUAA 2RD0A 4AJWA 4RG6A 4X8QA 4DX5D 4C0EA 4K5AB 3RO2A 3I4GA 3TXMA 1D8DA 3DXMG 2DBAA 4N39A 3JQ0A 2JEKA 3SGHA 4JA7A 2WXMA 2IFUA 2WQ6A 4HOTA 3FUMA 3ZYQA 3TWWA 3UKUG 3HXDA 3TG5A 3EUVA 3EJNA 4F53A 3PZDA 5J08A 4BERA 3UIOC 3FUIA 5FQ8A 4J8SA 1IKND 4ANWA 4FU3A 3DSSA 1V54E 3AS4A 3ZNGA 3O48A 2P9PG 3P1UA 4N5CA 2WMNA 3B7TA 2YQ8A 3CIAA 4FA6A 2XZTG 3G2WA 3FWVA 2BKGA 3CKCA 4I9CA 3EDTB 3HIZA 3LVQE 2DYSE 1UG3A 2XEEA 2VTBB 3UINC 2PQRA 1ELWA 4IRUA 4DX7D 3LJNA 3ZPJA 4UI9J 4ILGA 2XENA 4PUCA 4DUIA 4B0ZA 4I43A 3GZSA 5JJ7A 3URZA 2YHCA 2RG8A 1AP7A 1OWNA 1Y8MA 4JPSA 3Q47B 4UI9K 4U7EB 5KJNA 3W9FA 3S7FA 5CRUA 1FT1A 3FUJA 2LSVA 4GTTA 4GTQA 4GCNA 2PQNA 3E4BA 3LPZA 4APOA 4BSXA 1MJ0A 3SBTB 4F1SA 3BEEA 3LEWA 4YVOA 4N2QA 2WXJA 3EU5A 3TWUA 3QWPA 4JVSA 3CVVA 4Y6WA 3HHMA 4P29A 5FT9A 3P2BA 2F8YA 2VGEA 5AJDA 2GW1A 1OWPA 1BLXB 2QZAA 5BW8C 3KS2A 2MRIA 5BV1A 3X2QE 4MRUA 3GYZA 4FC8A 3MEKA 3ASGA 4EHMA 4EBAA 4IYPA 3RRNB 3ULYA 2DIWA 1P5QA 2R5SA 4J0UA 3UT4A 4O6FA 1XGWA 4HI9A 3ZEFA 4AV7A 4RLYA 1BU9A 2OVFA 4QQIA 4UQXA 1EYHA 1SA5A 5ENTD 3LYAA 4AY5A 3DEOA 2FULA 3DSXA 4AXHA 5FIOA 3ESKA 3Q75A 2R59A 2HYZA 4BWRA 5JJ6A 5CERB 2PL2A 2ZIRA 2LSUA 3UTMA 2X6IA 3L9TA 4K03A 4OYSA 4JHRA 2IU1A 2KCVA 3D9JA 5JA4D 1N4RA 3PNTB 3ULEG 5CCLA 1OXJA 2UWJG 4GAAA 5FZSA 4ABNA 3ZXPA 3IKOB 4OAVB 3W9GA 3QJZA 4B8CB 3S7JA 5CMWA 4UQZA 3FEXA 2RFMA 4BT9A 1FVHA 3L16A 1IXVA 2HO1A 2UY1B 4ME2A 2P9KG 4JHJA 5FINA 3EHNA 4BTBA 5KJMA 4Y6CA 1TN7A 2R05A 1PY1A 5BNWA 4GYWA 4HLEA 2CHWA 2WXPA 2WMOA 1E90A 3DRAA 3GZ2A 1UOHA 3KEAA 2KBXA 3U3WA 3D3MA 4WNEA 3GZ1A 2J49A 2IO2C 3ASHA 3MKRA 4J8FA 3UIPC 3ML8A 4NACA 3QWVA 4TXQA 3VLDA 3SD5A 3BU8A 5AARA 2FEZA 3OXFA 4HORA 3VTXA 4A3TA 1X81A 3T8KA 1XNFA 4BT8A 5CHEE 3CVXA 3APFA 4LNBA 2ETAA 3QK0A 1TYQG 3NBNB 3FH7A 1TNOA 3IBEA 3HXFA 1O5MA 3HRAA 4C48B 3D9OA 2E2EA 5FQ6A 1HZ4A 3APCA 2XHEA 1E8XA 3SZ7A 2LO6A 3ZU7B 2XQ0A 3OXGA 1MHQA 3EHMA 2J07A 4FADA 3CLJA 1O1SA 4HOSA 3D9LA 1Q2ZA 3T9KA 1VDYA 3JQ1A 4JD2G 3TWVA 4KVOA 3PH0C 2IEJA 3V30A 4I6GA 4M7CA 3QOUA 2WPVA 2WQHA 1N4SA 3B13A 1OWOA 4A3VA 1HFAA 1MX4A 3RRMB 2YINA 2J09A 2I1KA 3FUKA 1NFIE 5HI7A 2GRRB 1KZOA 2GRQB 3PZ4A 3L54A 4HRMB 4ANVA 2DZNA 4BETA 4CT0A 3ZHEB 4E85A 2I1JA 5G04J 3LJ3A 1WAO1 3E30A 4YVQC 4GZ5A 5FZQA 5EKQD 5A7DB 5D66A 3T5VA 2LAHA 3WG7E 2XRZA 4CDMA 2WM9A 3CHPA 2KM4A 4AIFA 3EU9A 5DIZA 4RQIA 5AIJA 1HXIA 3T5XA 4HS2A 4O1OA 4F7AA 3AJIA 2KCLA 4L9PA 4GTPA 2IOSA 4D10C 4DLOA 5CBOA 3CVQA 4OAUC 4A55A 2HE0A 3MZLB 2BEDA 4CCAA 4K5CA 4AM9A 3KAEA 4XEIG 3L82A 3IEGA 4G1TA 3FTZA 1SW6A 3ZN3A 2X6JA 3FULA 4L7TA 2XCBA 1E8YA 4EZLA 3NQPA 4IULA 2V5FA 2AJAA 3UM2A 3V2XA 5A6CA 3AU4A 3UMVA 3QNKA 3FH8A 4LNGA 3NOGD 4TV3A 5G04C 5A23A 4GPMA 4U0ZA 1NP7A 3UT8A 1JPLA 3N71A 1WY6A 3SFXA 4DRXE 1JCSA 4UWKA 4CDRA 2YNQA 3FFLA 3IXEA 4GZ3A 1D9SA 5CEAA 1MX2A 4B94A 3FP3A 4E6HA 4MBGA 4PH4B 2DZOA 4H7XA 4HFGA 4N3CA 4GPKA 3SNXA 1QBQA 3TXNA 4LNUD 4NURA 3HDXA 3B7RL 1ELKA 4CT4A 5LOZA 3Q49B 2BF0X 1IQRA 1H6OA 4G26A 3S7BA 3CGHA 3ESLA 4FHJA 4G11A 4F6RD 3RRUA 4EZKA 3E37A 3JUEA 4C0MA 4DX2A 3FU5A 4M3OA 5AYWD 4URKA 4APFA 3FUEA 2C2LA 1PAQA 4L2YA 2VGXB 3UM3A 1PC2A 5AJLA 3DSVA 2IONA 3C3OA 3B7BA 1TNBA 3FUNA 3RJVA 3Q79A 5AQAA 4GA1A 5G05C 2AXZA 3QAQA 2ILRA 1H6PA 5EYLA 3U9WA 1K1AA 2JABA 1A17A 3PVLA 3TWQA 1TN6A 3QKYA 2VJ8A 2NSZA 4I2WA 1S63A 4GZCA 5LX8A 5LCWC 2OVBA 2GRNB 1YCSB 2I9CA 4GMLA 5FJYA 5AENA 4G2VA 5BT1A 3AS5A 2FI7A 4BSZB 3CHOA 1H19A 4CRWA 3MA5A 2AXVA 5CRVA 2R2LA 1H6KA 4DJAA 3ZYMA 3K9IA 5KCMA 1E8WA 3NB2A 1JCQA 1NZNA 2KXPC 3PS6A 4ILHB 1AWCB 2QC9A 2J08A 1U3DA 3G2TA 3VTYA 4WWPA 2Y69E 2VGYA 4FP7A 4JXTA 2PM7A 1V55E 3AS8A 3DEPA 1BPOA 5EIBE 4CYMD 2KC7A 4U8HA 4EPZA 4CZ2D 1JCRA 3ASNE 1HG2A 4GYYA 2LAIA 4GMJA 4DX1A 5FQ4A 2CHXA 4HBDA 2ZISA 2WXIA 3NF1A 1HU3A 2B6CA 1S0PA 3TWRA 1SVXA 4HNAD 4HI8A 1K8KG 1FCHA 4CDNA 4EBAG 4UWLA 2AXUA 3R9AB
chains in the Genus database with same CATH topology
4KMOA 1X5BA 3GZ2A 4FULA 3KD7A 3FUDA 2LNIA 2GRMA 2MOWA 2XRYA 4RG9A 3U3WA 3D3MA 4WNEA 3GZ1A 2J49A 4DI3A 1H2UA 4I6EA 3ASHA 3CK8A 5CCMA 3MKRA 4GZDA 4J8FA 4N3BA 3ML8A 4NACA 3QWVA 1E96B 2FO7A 2I6HA 1QQEA 3FUHA 3SD5A 3VLDA 1TEZA 3Q4AB 2QY7A 4FHKA 3G2UA 4AEZC 2FEZA 4Q94A 3OXFA 1OWMA 5CMYA 3RU0A 4EZJA 4HORA 3CHQA 3VTXA 2IOLA 4KZCA 4A3TA 4BX8A 1XNFA 4BT8A 2WQ7A 1UJJA 3UX4A 4Q69A 3RKVA 5CHEE 1W3BA 5HQ8A 1E8ZA 1UN8A 3SBSA 4PS7A 3CVXA 2CFZA 3ZYKA 3SF4A 1ELRA 3APFA 3CQCB 2JLBA 4L1BA 2VSNA 2KATA 4JA9A 3MYVA 3L22A 4HOQA 3T8MA 3QK0A 2VTBA 4WUYA 4MLPA 4K0RA 3FH7A 4CGWA 4HVBA 5ENNA 4G24A 3IBEA 3OXLA 3I3NA 3D9IA 5C1DA 3D9OA 2E2EA 4N3AA 5FQ6A 2WXGA 4LUNU 1HZ4A 4ACLA 4GCOA 3APCA 2XHEA 1E8XA 4GB9A 2X6HA 3SZ7A 2LO6A 2EQXA 2YHEA 3FTSA 4U04A 4ACKA 3CVLA 2XQ0A 3OXGA 1MHQA 3ZXSA 1NA0A 3JCKC 3EHMA 3PNLB 3S2AA 1DVPA 3SHFA 4KXKB 3LVRE 1H2VC 5E76A 5BV0A 2J07A 1B89A 4WNDA 2XPZA 3CLJA 2XPIA 3PEVB 5G55A 4FADA 2L0TB 4BX9A 4EECA 4HOSA 3D9LA 4U0UA 1VDYA 3FTYA 3JQ1A 4CEMA 4LERA 2AW6A 3HVEB 3TG4A 2VSYA 2L9BA 4U63A 2XGMA 3CK9A 5LFAA 1NA3A 3PE4A 4KVOA 3PH0C 2PM6A 3JYSA 2FF4A 3ONKA 2QFCA 3LY9A 2VGXA 4I6GA 4KT6B 3MV2B 3ASDA 3QOUA 2WPVA 2WQHA 3PE3A 3WXXA 3FTUA 3B13A 1OWOA 4A3VA 1HFAA 3RRMB 2OV8A 1OUVA 4XE0A 2KZTA 2YINA 3MX3A 3VLFA 3S7DA 1HF8A 3IV0A 2J09A 2I1KA 3FUKA 4TRQA 4U07A 1H0AA 3EIJA 3APDA 3L17A 4FLBA 4KBQA 3CVPA 4PS3A 5HI7A 4J6IA 4XIFA 3U4TA 4FJZA 4WWOA 3FY4A 1INZA 2VSOE 3AU5A 3L54A 3ZVVA 1HX8A 3CQGB 3FTWA 1Z3XA 3IHVA 3G2VA 4MKTA 3PUJA 4ANVA 4CT0A 3ZHEB 2Y3AA 4JEHA 2X6FA 4KVMA 4ILIA 4U0SA 4UQYA 1TJCA 2VSXE 4E85A 5JHBA 2I1JA 3CVUA 5G04J 3LJ3A 1WAO1 1E7UA 2XPYA 1UW4B 2BTDA 4JEUA 2XGOA 4YVQC 2C0LA 1EPUA 4A1SA 4B8AA 4GZ5A 5FZQA 4UWGA 5EKQD 4QFVA 4GZ6A 3SFZA 2Q7FA 4I17A 5A7DB 2I2OA 2VQ2A 3T5VA 4LRZA 2LAHA 5D0OD 2XRZA 2FBNA 4CDMA 2R17C 3L08A 4XI9A 2WM9A 4BY6A 4R7LA 2X38A 3CHPA 4G23A 2WXLA 2KM4A 1QZ2A 4AIFA 2C0MA 4ATGA 5DIZA 4GA2A 3ML9A 1HS6A 2WXRA 4L23A 2RD0A 2HR2A 4AJWA 5AIJA 4RG6A 3Q5MA 1HXIA 1HO8A 3T5XA 4C0EA 4HS2A 2GGFA 3MV3B 3RO2A 3I4GA 3TXMA 4LCTA 2E0IA 3TAXA 4XZ4A 2DBAA 4N39A 4C9BB 4F7AA 3JQ0A 3LCAA 3NZSA 4W9RA 1IHGA 2KCLA 2JEKA 4A1GA 3MCXA 3SGHA 2IOSA 1EF1C 4D10C 4DLOA 4JA7A 2WXMA 3CVQA 1WM5A 3FU0A 4I6JA 4A55A 2IFUA 3O4ZA 2WQ6A 4HOTA 3QC1A 2PZIA 3MZLB 5FZRA 2AVPA 4CCAA 2WVIA 4I1AA 3FUMA 3ZYQA 4AM9A 3ENEA 3KAEA 4XI0A 3MKQB 3IEGA 4JW1A 4G1TA 1Z6TA 3FTZA 5FWQA 3ZN3A 3TG5A 2X6JA 3BG0B 3EJNA 4UI9C 3U64A 4OVVA 4F53A 4GA0A 3FULA 3PZDA 4RSYA 5J08A 2WXFA 5JHAA 4FLHA 4L7TA 2XCBA 1E8YA 3CHMA 3KEZA 3NQPA 4IULA 4EZLA 2ZU6B 3FUIA 2V5FA 5FQ8A 4J8SA 5KJKA 2GRLA 4ANWA 2V0PA 1JWFA 4FU3A 2KCKA 3GW4A 4NRHB 3UQ3A 5A6CA 4WNGA 3AU4A 3B7SA 3UMVA 2AWIA 4EQFA 3QNKA 3AS4A 3FH8A 2V4LA 3OAWA 3UT7A 3O48A 4TV3A 5D0QD 2BUGA 3PDNA 5E75A 5G04C 5A23A 3ZGQA 3CHSA 4JL0A 3P1UA 4U0ZA 4N5CA 1NP7A 5BUZA 5ANRA 3UT8A 2WMNA 1JPLA 3N71A 3B7TA 3R7QA 2YQ8A 4J8EA 1WY6A 4N2SA 2IQCA 2J4BA 4UWKA 1HE8A 3CIAA 4FA6A 4CDRA 2X3MA 5T8IA 3G2WA 3FWVA 2UY1A 3CKCA 2YNQA 3FFLA 4GZ3A 4I9CA 1U3CA 5BPPA 5ARGA 3EDTB 3HIZA 3ZRHA 1Y6IA 3LVQE 4B94A 1UG3A 3FP3A 5T4YA 4E6HA 1SQMA 3EIQC 1JWGA 2VTBB 4NQ0A 1FVFA 3MGBA 4AY6A 4PH4B 4H7XA 4HFGA 2PQRA 4N3CA 3ZYLA 4GPKA 2Y4UA 1ELWA 3RIBA 3LY7A 3SNXA 4IRUA 3D9NA 2WXOA 4WWNA 4NURA 1HG5A 3TXNA 3HDXA 3ZPJA 4JHKA 3HYMB 4IN3B 3OTNA 4UI9J 4ILGA 5FTPA 3I5PA 1UJKA 4PUCA 3B7RL 1ELKA 4CT4A 4B0ZA 2IJGX 4FJYA 4I43A 5LOZA 1SZAA 2NC9A 2BF0X 3B7UX 3Q49B 3UPVA 2V8SE 3CSTA 1IQRA 3TL5A 5EDSA 3LDZA 4G26A 4I1MA 1L5JA 3GZSA 2J9QA 4BTAA 3S7BA 2L0IA 2CG2A 3CGHA 2MHKA 5JJ7A 3ESLA 4FHJA 3URZA 2XCCA 2YHCA 4G11A 2RG8A 3ZIMA 2CHZA 4OVUA 3RRUA 3R9AB 4KYOB 4EZKA 1OWNA 1Y8MA 4CGVA 4JPSA 4C0MA 3IHYA 3MJWA 3Q47B 3FU5A 4WAFA 4H7YA 4M3OA 4UI9K 5AYWD 4URKA 4APFA 3G2SA 4I9EA 5KJNA 3FUEA 2C2LA 1PAQA 5FQ7A 5EX3A 4L2YA 2VGXB 4HOUA 3S7FA 1PC2A 5AJLA 3C98A 2M63A 3FUJA 2LSVA 2IONA 2CG3A 4GCNA 2OOEA 2WXQA 3FUNA 2XEVA 3FU3A 3RJVA 2PQNA 3E4BA 3QARA 4JZYA 5KJLA 2KZTB 3LPZA 5T3RA 4APOA 4I1OB 4BSXA 4PDXA 3SBTB 4F1SA 3BEEA 3LEWA 3CR3A 1H2TC 2X6KA 3LY8A 4GA1A 2WXJA 4YVOA 5G05C 4HXIA 4N2QA 1N52A 2AXZA 3I4RB 3QWPA 4JVSA 2WB2A 3CVVA 4Y6WA 3HHMA 4P29A 5M72A 3QAQA 5FT9A 4TUUA 2ILRA 3P2BA 2P58C 5AJDA 3ONLA 3PUKA 1SZ9A 3ULQA 2GW1A 1OWPA 3CV0A 3VLEA 3R7RA 3PRZA 3DBSA 4XX5A 3U9WA 4GYOA 3QDNA 3PREA 5BW8C 3BG1B 3KS2A 2MRIA 1A17A 3PVLA 3PEUB 3ZFWA 5BV1A 3U66A 1HH8A 2DCPA 2WXHA 4MRUA 2CFUA 3FHEA 3GYZA 4FC8A 3MEKA 3ASGA 3HVEA 4V3IA 1JUQA 4JC8A 3QKYA 2VJ8A 2NSZA 4I2WA 4GZCA 4AVXA 5LX8A 4EBAA 4L2LA 5LCWC 2Y4TA 4IYPA 2IF4A 3RRNB 1KT0A 2DIWA 2OVBA 1DNPA 3FH5A 1P5QA 2R5SA 2I9CA 4J0UA 4J8DA 3UT4A 3TJPA 4GMLA 5G2NA 3UUXA 1IQUA 5FJYA 4O6FA 5LP0A 5AENA 4DK5A 4ANUA 1XGWA 3SI5A 4G2VA 3NZUA 3ZEFA 1ZBPA 4AV7A 3QWWA 3Q15A 2OVFA 3AS5A 4DI4A 5BT1A 3ZW3A 2FI7A 3CVNA 4UQXA 1EYHA 2VYIA 4DLQA 1TJFA 3CHRA 3CHOA 3LYAA 3D9KA 1H19A 4AY5A 5G05J 4RVBA 4CRWA 2FULA 3MA5A 2AXVA 3FTXA 1MQSA 4AXHA 1ZU2A 3ESKA 2J4DA 4BFRA 4UWHA 1H6KA 2R59A 4AOFA 4DJAA 2HYZA 2A5UA 3K9IA 1N54A 5KCMA 3ZYMA 1E8WA 5JJ6A 4BWRA 3LXUX 3ZHEA 2NXPA 1NZNA 4ILHB 3PS6A 4AP2A 4B89A 2PL2A 2LSUA 4GU5A 2J08A 1U3DA 3L13A 2X6IA 3G2TA 3VTYA 1GW6A 4WWPA 4WNFA 4K03A 4OYSA 3L6AA 2XGSA 4KZ0A 1IYGA 3LKUA 3CEQA 4JHRA 2VGYA 2IU1A 3CK7A 2KCVA 2PM7A 3D9PA 4FP7A 4JXTA 4DPRA 1LF8A 3D9JA 3FU6A 3TGOA 2WXKA 3AS8A 4F3VA 3CVYA 1BPOA 2WXNA 5J90A 5LCWJ 2KC7A 3PNTB 3CSFA 5CCLA 4Q96A 2UWJG 1QNFA 4G25A 4U8HA 1UN9A 4EPZA 4GAAA 5FZSA 3LS8A 1OWLA 3FDHA 3D9MA 1HG2A 4LEUA 4YNDA 4GYYA 2LAIA 4ABNA 4GMJA 3FTVA 5EX0A 3IKOB 1Z3YA 3QB2A 1E7VA 5ANLA 2ONDA 3RK6A 3QJZA 4B8CB 4I2ZA 3S7JA 5FQ4A 2CHXA 4ANXA 5CMWA 4UQZA 2WXIA 2A4ZA 1YA0A 3FEXA 3FUFA 3NF1A 3JUIA 1HU3A 4BT9A 5JJTA 3ASFA 1S0PA 4MS6A 1FVHA 3CKBA 2HO1A 2UY1B 3L16A 4ME2A 1KT1A 5ARFA 4JHJA 2HM8A 3EHNA 3FEYA 3DPDA 4XKCA 1FCHA 4Y6CA 4BTBA 1EDUA 4CDNA 5KJMA 1PY1A 3CVWA 3MKQA 5DBKA 4UWFA 1KLXA 5C2YA 4UWLA 4EBAG 5BNWA 2L6JA 2AXUA 4GYWA 4HLEA 2CHWA 2WXPA 2WMOA 4PS8A 3RO3A 1E90A 4XKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEK A; 
#chains in the Genus database with same CATH topology
 1X5B A;  4FUL A;  2P9S G;  1D8E A;  2MOW A;  3BQO A;  5KNG A;  4TXP A;  1H2U A;  4I6E A;  3RSE G;  4N3B A;  1E96 B;  2FO7 A;  5HKP A;  4FHK A;  4Q94 A;  5CMY A;  2IOL A;  1TNY A;  4KZC A;  1UJJ A;  3RKV A;  1E8Z A;  1KPS B;  2DVW A;  3UXG A;  3SF4 A;  3CQC B;  2JLB A;  4L1B A;  2VSN A;  3L22 A;  4HOQ A;  3T8M A;  2VTB A;  4WUY A;  2P9N G;  2B0O E;  4CGW A;  3D9I A;  5AQ7 A;  4GTM A;  2EQX A;  5CBN A;  3ZXS A;  1DVP A;  5E76 A;  2XPI A;  3PEV B;  4EEC A;  5HRY A;  4HLL A;  1S64 A;  2XEH A;  4LER A;  3PZ2 A;  3HVE B;  2L9B A;  3CK9 A;  1NA3 A;  3ONK A;  3LY9 A;  5HS0 A;  3ASD A;  3PE3 A;  3FTU A;  3R9M A;  1OUV A;  5AQ9 A;  3IV0 A;  4TRQ A;  4U07 A;  3APD A;  2PNN A;  4FLB A;  4KBQ A;  4A63 B;  2EIK E;  4FJZ A;  2V4H C;  3FY4 A;  1DCE A;  3UI2 A;  1INZ A;  4GTS A;  2XZD G;  3CQG B;  3FTW A;  4MKT A;  2X6F A;  4ILI A;  3B95 A;  2ZGD A;  2IO3 C;  2XPY A;  4JEU A;  1UW4 B;  2C0L A;  1EPU A;  2F8X K;  4I17 A;  2I2O A;  4LRZ A;  5D0O D;  3AG3 E;  2R17 C;  3L08 A;  4XI9 A;  2RFA A;  1QZ2 A;  4ATG A;  4GA2 A;  4L23 A;  4YDW A;  3Q5M A;  1HO8 A;  2GGF A;  4LCT A;  2E0I A;  4XZ4 A;  4C9B B;  1N4Q A;  3LCA A;  3NZS A;  4W9R A;  1IHG A;  1EF1 C;  3O4Z A;  3J5Q B;  2EIL E;  2WVI A;  4BEP A;  2XS1 A;  4XI0 A;  3MKQ B;  3SO8 A;  1Z6T A;  3BG0 B;  4OVV A;  4GA0 A;  4RSY A;  5JHA A;  3KEZ A;  2ZU6 B;  1U2V G;  2GRL A;  3DXK G;  2V0P A;  3GW4 A;  4WNG A;  2AWI A;  4EQF A;  5B3S E;  2QYU A;  3UT7 A;  5D0Q D;  2BUG A;  1LD8 A;  3PDN A;  3ZGQ A;  4HQD A;  3TWS A;  4YDY A;  3KSL A;  3ABK E;  4J8E A;  4N2S A;  1HE8 A;  4GTR A;  1ZB1 A;  2UY1 A;  1U3C A;  5BPP A;  5ARG A;  2LXM A;  5T4Y A;  1SQM A;  1JWG A;  4NQ0 A;  2EIM E;  3ZYL A;  2Y4U A;  4B93 B;  3D9N A;  2WXO A;  3D9H A;  3J5P A;  4IN3 B;  3I5P A;  1UJK A;  2IJG X;  4U8Y D;  1SZA A;  1N0Q A;  2NC9 A;  3UPV A;  5D2M C;  3TL5 A;  1N4P A;  1L5J A;  2J9Q A;  4F1P A;  2L0I A;  2CG2 A;  2MHK A;  3ZIM A;  2XCC A;  5BXU A;  4KYO B;  4CGV A;  3IHY A;  2DWZ A;  4TXR A;  4J7W A;  2A5E A;  2M63 A;  2CG3 A;  2ETC A;  2OOE A;  2WXQ A;  2XEV A;  3FU3 A;  3QAR A;  2KZT B;  4I1O B;  1YYH A;  2Y0B G;  4HXI A;  1N52 A;  3I4R B;  2P58 C;  2H6H A;  3PUK A;  4GTV A;  3ULQ A;  4NIK A;  3HXC A;  3R7R A;  4GMR A;  4GYO A;  3QDN A;  3PRE A;  3BG1 B;  1O1R A;  2DCP A;  2CFU A;  3FHE A;  3V79 K;  4V3I A;  4JC8 A;  3AG4 E;  1DCQ A;  4L2L A;  2Y4T A;  4JB8 P;  1KT0 A;  1DNP A;  2H6I A;  2P9I G;  4J8D A;  1DC2 A;  3TJP A;  5G2N A;  1IQU A;  3ABL E;  5LP0 A;  4DK5 A;  4ANU A;  3NZU A;  1ZBP A;  3QWW A;  3ZW3 A;  1K1B A;  5ENQ D;  3D9K A;  5G05 J;  4RVB A;  3FTX A;  1ZU2 A;  4UWH A;  4AOF A;  2A5U A;  3LXU X;  3ZHE A;  2NXP A;  4G8K A;  3SY2 A;  4GU5 A;  1GW6 A;  3L6A A;  2XGS A;  4KZ0 A;  3ZKJ A;  5AAO A;  3LKU A;  1IYG A;  3CEQ A;  3CK7 A;  3D9P A;  3FU6 A;  5IY5 E;  3CVY A;  2H6F A;  2H6G A;  3DWL G;  5LCW J;  4Q96 A;  1QNF A;  4G25 A;  5H7P A;  3LS8 A;  1OWL A;  3D9M A;  2QYJ A;  4YND A;  1Z3Y A;  2OND A;  3Q9N C;  4I2Z A;  4ANX A;  3JUI A;  3ASF A;  1G3N B;  2HM8 A;  4G8L A;  5ENP D;  3EHQ A;  3CVW A;  5C2Y A;  2L6J A;  4U8V D;  3RO3 A;  4XKB A;  3UM0 A;  4KMO A;  3KD7 A;  2OCC E;  3FUD A;  2LNI A;  2GRM A;  3F6Q A;  4RG9 A;  5ENR D;  4DI3 A;  3CK8 A;  5CCM A;  2DYR E;  4GZD A;  1QQE A;  3Q4A B;  3G2U A;  4AEZ C;  5B1A E;  3RU0 A;  1OWM A;  4EZJ A;  5CED B;  3CHQ A;  3AAA C;  4BX8 A;  4J8Y A;  2J8S D;  2P2C P;  4Q69 A;  1W3B A;  3SBS A;  4PS7 A;  2CFZ A;  3ZYK A;  4K5B A;  2KAT A;  4JA9 A;  3MYV A;  5JMN D;  4TUM A;  2R03 A;  4HVB A;  5ENN A;  3OXL A;  3I3N A;  4N3A A;  4ACL A;  4GB9 A;  2X6H A;  4U04 A;  2YHE A;  3FTS A;  3V31 A;  1NA0 A;  2EIJ E;  3S2A A;  1H2V C;  5BV0 A;  4WND A;  2XPZ A;  1BI7 B;  4BX9 A;  3FTY A;  4U63 A;  5B1B E;  3UKR G;  3JYS A;  2QFC A;  2VGX A;  3EHR A;  3C5R A;  4XE0 A;  2P9L G;  3MX3 A;  2F37 A;  3VLF A;  3S7D A;  3EIJ A;  3DST A;  3L17 A;  5KWD A;  4XIF A;  3U4T A;  4WWO A;  2F0Y A;  3AU5 A;  3ZVV A;  1N11 A;  1Z3X A;  2R02 A;  3G2V A;  3PUJ A;  3ISM C;  3KSQ A;  4JEH A;  4KVM A;  4U0S A;  5JHB A;  3CVU A;  2V5Q C;  1E7U A;  2BTD A;  1K3Z D;  1LD7 A;  4A1S A;  4O1P A;  4HRL A;  3SFZ A;  4QFV A;  2Q7F A;  2VQ2 A;  4ATZ D;  5ITZ F;  4YDE A;  2FBN A;  1TR4 A;  4BY6 A;  4R7L A;  2X38 A;  2IY0 C;  4G23 A;  2WXL A;  3JXJ A;  3ML9 A;  1HS6 A;  2WXR A;  4YDO A;  2HR2 A;  3MV3 B;  3TAX A;  5EYP F;  1MYO A;  1YMP A;  2XS8 A;  4A1G A;  3MCX A;  3FU0 A;  1WM5 A;  4I6J A;  1O1T A;  3QC1 A;  2PZI A;  5FZR A;  2AVP A;  4I1A A;  4O60 A;  3ENE A;  1BD8 A;  4JW1 A;  5FWQ A;  4UI9 C;  3U64 A;  1TNZ A;  2WXF A;  2ZXW E;  3TWX A;  4FLH A;  3CHM A;  5KJK A;  1N94 A;  1JWF A;  2KCK A;  4NRH B;  3UQ3 A;  3B7S A;  3ABM E;  2OEV A;  2V4L A;  3OAW A;  1FT2 A;  5E75 A;  3CHS A;  4JL0 A;  3ASO E;  5BUZ A;  5ANR A;  3AG1 E;  3R7Q A;  2IQC A;  2J4B A;  1NI1 A;  2X3M A;  5T8I A;  3ZRH A;  1Y6I A;  3DSU A;  1A5E A;  3EIQ C;  1FVF A;  3MGB A;  4AY6 A;  3Q73 A;  3RIB A;  3LY7 A;  4WWN A;  1HG5 A;  2Y1L E;  1RZ4 A;  4JHK A;  3HYM B;  3OTN A;  5FTP A;  3SFY A;  5EID A;  1SA4 A;  3Q7A A;  4FJY A;  3B7U X;  2V8S E;  3CST A;  5EDS A;  3LDZ A;  4I1M A;  3Q9U C;  4BTA A;  5KBA A;  2CHZ A;  4OVU A;  3PZ1 A;  1BI8 B;  3MJW A;  4WAF A;  4H7Y A;  3G2S A;  4I9E A;  2EIN E;  5FQ7 A;  5EX3 A;  4HOU A;  3C98 A;  3E34 A;  4JZY A;  5KNH D;  5KJL A;  5T3R A;  1FPP A;  4PDX A;  3CR3 A;  1H2T C;  2X6K A;  3LY8 A;  2WB2 A;  5M72 A;  4TUU A;  3ONL A;  1SZ9 A;  3CV0 A;  3VLE A;  4UUC A;  4HRN A;  3PRZ A;  3DBS A;  4XX5 A;  3ZFW A;  3PEU B;  3U66 A;  1HH8 A;  2WXH A;  3HVE A;  1JUQ A;  1S70 B;  1OCC E;  4AVX A;  1Z5S C;  2IF4 A;  3V2O A;  3FH5 A;  3UUX A;  3SI5 A;  2ETB A;  3Q15 A;  4DI4 A;  3CVN A;  1TN8 A;  2VYI A;  4DLQ A;  1TJF A;  5ENO D;  3CHR A;  1MQS A;  1QYM A;  4BFR A;  2J4D A;  3RAU A;  1N54 A;  4AP2 A;  4B89 A;  2P9U G;  3C72 A;  3L13 A;  4WNF A;  1OCZ E;  1MX6 A;  4DPR A;  1LF8 A;  1TNU A;  3TGO A;  2WXK A;  4F3V A;  3Q78 A;  2WXN A;  5BXO A;  5J90 A;  3CSF A;  1OCR E;  1UN9 A;  3FDH A;  2BKK B;  2LXL A;  4LEU A;  3FTV A;  5EX0 A;  5ANL A;  3QB2 A;  1E7V A;  3RK6 A;  3HXE A;  3PZ3 A;  3SQV A;  2NYJ A;  1WDY A;  2GRO B;  2A4Z A;  1YA0 A;  3FUF A;  5JJT A;  4MS6 A;  3CKB A;  1KT1 A;  5ARF A;  1KZP A;  1WG0 A;  3FEY A;  3DPD A;  4XKC A;  1EDU A;  3MKQ A;  5DBK A;  4UWF A;  1KLX A;  4PS8 A;  1RW2 A;  2MYO A;  2OEW A;  3E32 A;  5ENS D;  2XRY A;  3TWT A;  2I6H A;  3FUH A;  1TEZ A;  1IHB A;  2QY7 A;  3NAW A;  4LSZ E;  5EIL A;  1OY3 D;  2WQ7 A;  3UX4 A;  5HQ8 A;  1UN8 A;  1ELR A;  4N5Q A;  1OT8 A;  3DPY A;  4ZHB A;  4MLP A;  4K0R A;  1NL4 A;  4G24 A;  5C1D A;  2WXG A;  4LUN U;  4GCO A;  4ACK A;  3CVL A;  4ZFH A;  3JCK C;  3PNL B;  5AQB A;  3SHF A;  4KXK B;  3LVR E;  5AN8 A;  1B89 A;  5G55 A;  3ZUV B;  2L0T B;  3UM1 A;  3HXB A;  4U0U A;  4CEM A;  2AW6 A;  3TG4 A;  2VSY A;  1N9A A;  2XGM A;  5LFA A;  3PE4 A;  2PM6 A;  2FF4 A;  2RKK A;  4KT6 B;  4U95 D;  3MV2 B;  3DSW A;  3WXX A;  1LTX A;  4GTO A;  2OV8 A;  3C3Q A;  2KZT A;  2GRP B;  1N95 A;  1HF8 A;  1H0A A;  3CVP A;  4PS3 A;  4J6I A;  1OCO E;  3E33 A;  4Z68 A;  4DX6 D;  1N0R A;  3JXI A;  2VSO E;  2L6B A;  1HX8 A;  3IHV A;  4LG6 A;  4HB5 A;  2Y3A A;  4U96 D;  4UQY A;  1TJC A;  2VSX E;  3AG2 E;  2XGO A;  4B8A A;  1MZC A;  3C3R A;  3NOC D;  4UWG A;  4BES A;  4GZ6 A;  5EN5 D;  2LUH A;  2ZGG A;  3Q7F A;  3HG0 D;  2C0M A;  5CEC B;  2FO1 E;  3BUA A;  2RD0 A;  4AJW A;  4RG6 A;  4X8Q A;  4DX5 D;  4C0E A;  4K5A B;  3RO2 A;  3I4G A;  3TXM A;  1D8D A;  3DXM G;  2DBA A;  4N39 A;  3JQ0 A;  2JEK A;  3SGH A;  4JA7 A;  2WXM A;  2IFU A;  2WQ6 A;  4HOT A;  3FUM A;  3ZYQ A;  3TWW A;  3UKU G;  3HXD A;  3TG5 A;  3EUV A;  3EJN A;  4F53 A;  3PZD A;  5J08 A;  4BER A;  3UIO C;  3FUI A;  5FQ8 A;  4J8S A;  1IKN D;  4ANW A;  4FU3 A;  3DSS A;  1V54 E;  3AS4 A;  3ZNG A;  3O48 A;  2P9P G;  3P1U A;  4N5C A;  2WMN A;  3B7T A;  2YQ8 A;  3CIA A;  4FA6 A;  2XZT G;  3G2W A;  3FWV A;  2BKG A;  3CKC A;  4I9C A;  3EDT B;  3HIZ A;  3LVQ E;  2DYS E;  1UG3 A;  2XEE A;  2VTB B;  3UIN C;  2PQR A;  1ELW A;  4IRU A;  4DX7 D;  3LJN A;  3ZPJ A;  4UI9 J;  4ILG A;  2XEN A;  4PUC A;  4DUI A;  4B0Z A;  4I43 A;  3GZS A;  5JJ7 A;  3URZ A;  2YHC A;  2RG8 A;  1AP7 A;  1OWN A;  1Y8M A;  4JPS A;  3Q47 B;  4UI9 K;  4U7E B;  5KJN A;  3W9F A;  3S7F A;  5CRU A;  1FT1 A;  3FUJ A;  2LSV A;  4GTT A;  4GTQ A;  4GCN A;  2PQN A;  3E4B A;  3LPZ A;  4APO A;  4BSX A;  1MJ0 A;  3SBT B;  4F1S A;  3BEE A;  3LEW A;  4YVO A;  4N2Q A;  2WXJ A;  3EU5 A;  3TWU A;  3QWP A;  4JVS A;  3CVV A;  4Y6W A;  3HHM A;  4P29 A;  5FT9 A;  3P2B A;  2F8Y A;  2VGE A;  5AJD A;  2GW1 A;  1OWP A;  1BLX B;  2QZA A;  5BW8 C;  3KS2 A;  2MRI A;  5BV1 A;  3X2Q E;  4MRU A;  3GYZ A;  4FC8 A;  3MEK A;  3ASG A;  4EHM A;  4EBA A;  4IYP A;  3RRN B;  3ULY A;  2DIW A;  1P5Q A;  2R5S A;  4J0U A;  3UT4 A;  4O6F A;  1XGW A;  4HI9 A;  3ZEF A;  4AV7 A;  4RLY A;  1BU9 A;  2OVF A;  4QQI A;  4UQX A;  1EYH A;  1SA5 A;  5ENT D;  3LYA A;  4AY5 A;  3DEO A;  2FUL A;  3DSX A;  4AXH A;  5FIO A;  3ESK A;  3Q75 A;  2R59 A;  2HYZ A;  4BWR A;  5JJ6 A;  5CER B;  2PL2 A;  2ZIR A;  2LSU A;  3UTM A;  2X6I A;  3L9T A;  4K03 A;  4OYS A;  4JHR A;  2IU1 A;  2KCV A;  3D9J A;  5JA4 D;  1N4R A;  3PNT B;  3ULE G;  5CCL A;  1OXJ A;  2UWJ G;  4GAA A;  5FZS A;  4ABN A;  3ZXP A;  3IKO B;  4OAV B;  3W9G A;  3QJZ A;  4B8C B;  3S7J A;  5CMW A;  4UQZ A;  3FEX A;  2RFM A;  4BT9 A;  1FVH A;  3L16 A;  1IXV A;  2HO1 A;  2UY1 B;  4ME2 A;  2P9K G;  4JHJ A;  5FIN A;  3EHN A;  4BTB A;  5KJM A;  4Y6C A;  1TN7 A;  2R05 A;  1PY1 A;  5BNW A;  4GYW A;  4HLE A;  2CHW A;  2WXP A;  2WMO A;  1E90 A;  3DRA A;  3GZ2 A;  1UOH A;  3KEA A;  2KBX A;  3U3W A;  3D3M A;  4WNE A;  3GZ1 A;  2J49 A;  2IO2 C;  3ASH A;  3MKR A;  4J8F A;  3UIP C;  3ML8 A;  4NAC A;  3QWV A;  4TXQ A;  3VLD A;  3SD5 A;  3BU8 A;  5AAR A;  2FEZ A;  3OXF A;  4HOR A;  3VTX A;  4A3T A;  1X81 A;  3T8K A;  1XNF A;  4BT8 A;  5CHE E;  3CVX A;  3APF A;  4LNB A;  2ETA A;  3QK0 A;  1TYQ G;  3NBN B;  3FH7 A;  1TNO A;  3IBE A;  3HXF A;  1O5M A;  3HRA A;  4C48 B;  3D9O A;  2E2E A;  5FQ6 A;  1HZ4 A;  3APC A;  2XHE A;  1E8X A;  3SZ7 A;  2LO6 A;  3ZU7 B;  2XQ0 A;  3OXG A;  1MHQ A;  3EHM A;  2J07 A;  4FAD A;  3CLJ A;  1O1S A;  4HOS A;  3D9L A;  1Q2Z A;  3T9K A;  1VDY A;  3JQ1 A;  4JD2 G;  3TWV A;  4KVO A;  3PH0 C;  2IEJ A;  3V30 A;  4I6G A;  4M7C A;  3QOU A;  2WPV A;  2WQH A;  1N4S A;  3B13 A;  1OWO A;  4A3V A;  1HFA A;  1MX4 A;  3RRM B;  2YIN A;  2J09 A;  2I1K A;  3FUK A;  1NFI E;  5HI7 A;  2GRR B;  1KZO A;  2GRQ B;  3PZ4 A;  3L54 A;  4HRM B;  4ANV A;  2DZN A;  4BET A;  4CT0 A;  3ZHE B;  4E85 A;  2I1J A;  5G04 J;  3LJ3 A;  1WAO 1;  3E30 A;  4YVQ C;  4GZ5 A;  5FZQ A;  5EKQ D;  5A7D B;  5D66 A;  3T5V A;  2LAH A;  3WG7 E;  2XRZ A;  4CDM A;  2WM9 A;  3CHP A;  2KM4 A;  4AIF A;  3EU9 A;  5DIZ A;  4RQI A;  5AIJ A;  1HXI A;  3T5X A;  4HS2 A;  4O1O A;  4F7A A;  3AJI A;  2KCL A;  4L9P A;  4GTP A;  2IOS A;  4D10 C;  4DLO A;  5CBO A;  3CVQ A;  4OAU C;  4A55 A;  2HE0 A;  3MZL B;  2BED A;  4CCA A;  4K5C A;  4AM9 A;  3KAE A;  4XEI G;  3L82 A;  3IEG A;  4G1T A;  3FTZ A;  1SW6 A;  3ZN3 A;  2X6J A;  3FUL A;  4L7T A;  2XCB A;  1E8Y A;  4EZL A;  3NQP A;  4IUL A;  2V5F A;  2AJA A;  3UM2 A;  3V2X A;  5A6C A;  3AU4 A;  3UMV A;  3QNK A;  3FH8 A;  4LNG A;  3NOG D;  4TV3 A;  5G04 C;  5A23 A;  4GPM A;  4U0Z A;  1NP7 A;  3UT8 A;  1JPL A;  3N71 A;  1WY6 A;  3SFX A;  4DRX E;  1JCS A;  4UWK A;  4CDR A;  2YNQ A;  3FFL A;  3IXE A;  4GZ3 A;  1D9S A;  5CEA A;  1MX2 A;  4B94 A;  3FP3 A;  4E6H A;  4MBG A;  4PH4 B;  2DZO A;  4H7X A;  4HFG A;  4N3C A;  4GPK A;  3SNX A;  1QBQ A;  3TXN A;  4LNU D;  4NUR A;  3HDX A;  3B7R L;  1ELK A;  4CT4 A;  5LOZ A;  3Q49 B;  2BF0 X;  1IQR A;  1H6O A;  4G26 A;  3S7B A;  3CGH A;  3ESL A;  4FHJ A;  4G11 A;  4F6R D;  3RRU A;  4EZK A;  3E37 A;  3JUE A;  4C0M A;  4DX2 A;  3FU5 A;  4M3O A;  5AYW D;  4URK A;  4APF A;  3FUE A;  2C2L A;  1PAQ A;  4L2Y A;  2VGX B;  3UM3 A;  1PC2 A;  5AJL A;  3DSV A;  2ION A;  3C3O A;  3B7B A;  1TNB A;  3FUN A;  3RJV A;  3Q79 A;  5AQA A;  4GA1 A;  5G05 C;  2AXZ A;  3QAQ A;  2ILR A;  1H6P A;  5EYL A;  3U9W A;  1K1A A;  2JAB A;  1A17 A;  3PVL A;  3TWQ A;  1TN6 A;  3QKY A;  2VJ8 A;  2NSZ A;  4I2W A;  1S63 A;  4GZC A;  5LX8 A;  5LCW C;  2OVB A;  2GRN B;  1YCS B;  2I9C A;  4GML A;  5FJY A;  5AEN A;  4G2V A;  5BT1 A;  3AS5 A;  2FI7 A;  4BSZ B;  3CHO A;  1H19 A;  4CRW A;  3MA5 A;  2AXV A;  5CRV A;  2R2L A;  1H6K A;  4DJA A;  3ZYM A;  3K9I A;  5KCM A;  1E8W A;  3NB2 A;  1JCQ A;  1NZN A;  2KXP C;  3PS6 A;  4ILH B;  1AWC B;  2QC9 A;  2J08 A;  1U3D A;  3G2T A;  3VTY A;  4WWP A;  2Y69 E;  2VGY A;  4FP7 A;  4JXT A;  2PM7 A;  1V55 E;  3AS8 A;  3DEP A;  1BPO A;  5EIB E;  4CYM D;  2KC7 A;  4U8H A;  4EPZ A;  4CZ2 D;  1JCR A;  3ASN E;  1HG2 A;  4GYY A;  2LAI A;  4GMJ A;  4DX1 A;  5FQ4 A;  2CHX A;  4HBD A;  2ZIS A;  2WXI A;  3NF1 A;  1HU3 A;  2B6C A;  1S0P A;  3TWR A;  1SVX A;  4HNA D;  4HI8 A;  1K8K G;  1FCH A;  4CDN A;  4EBA G;  4UWL A;  2AXU A;  3R9A B; 
#chains in the Genus database with same CATH homology
 4KMO A;  1X5B A;  3GZ2 A;  4FUL A;  3KD7 A;  3FUD A;  2LNI A;  2GRM A;  2MOW A;  2XRY A;  4RG9 A;  3U3W A;  3D3M A;  4WNE A;  3GZ1 A;  2J49 A;  4DI3 A;  1H2U A;  4I6E A;  3ASH A;  3CK8 A;  5CCM A;  3MKR A;  4GZD A;  4J8F A;  4N3B A;  3ML8 A;  4NAC A;  3QWV A;  1E96 B;  2FO7 A;  2I6H A;  1QQE A;  3FUH A;  3SD5 A;  3VLD A;  1TEZ A;  3Q4A B;  2QY7 A;  4FHK A;  3G2U A;  4AEZ C;  2FEZ A;  4Q94 A;  3OXF A;  1OWM A;  5CMY A;  3RU0 A;  4EZJ A;  4HOR A;  3CHQ A;  3VTX A;  2IOL A;  4KZC A;  4A3T A;  4BX8 A;  1XNF A;  4BT8 A;  2WQ7 A;  1UJJ A;  3UX4 A;  4Q69 A;  3RKV A;  5CHE E;  1W3B A;  5HQ8 A;  1E8Z A;  1UN8 A;  3SBS A;  4PS7 A;  3CVX A;  2CFZ A;  3ZYK A;  3SF4 A;  1ELR A;  3APF A;  3CQC B;  2JLB A;  4L1B A;  2VSN A;  2KAT A;  4JA9 A;  3MYV A;  3L22 A;  4HOQ A;  3T8M A;  3QK0 A;  2VTB A;  4WUY A;  4MLP A;  4K0R A;  3FH7 A;  4CGW A;  4HVB A;  5ENN A;  4G24 A;  3IBE A;  3OXL A;  3I3N A;  3D9I A;  5C1D A;  3D9O A;  2E2E A;  4N3A A;  5FQ6 A;  2WXG A;  4LUN U;  1HZ4 A;  4ACL A;  4GCO A;  3APC A;  2XHE A;  1E8X A;  4GB9 A;  2X6H A;  3SZ7 A;  2LO6 A;  2EQX A;  2YHE A;  3FTS A;  4U04 A;  4ACK A;  3CVL A;  2XQ0 A;  3OXG A;  1MHQ A;  3ZXS A;  1NA0 A;  3JCK C;  3EHM A;  3PNL B;  3S2A A;  1DVP A;  3SHF A;  4KXK B;  3LVR E;  1H2V C;  5E76 A;  5BV0 A;  2J07 A;  1B89 A;  4WND A;  2XPZ A;  3CLJ A;  2XPI A;  3PEV B;  5G55 A;  4FAD A;  2L0T B;  4BX9 A;  4EEC A;  4HOS A;  3D9L A;  4U0U A;  1VDY A;  3FTY A;  3JQ1 A;  4CEM A;  4LER A;  2AW6 A;  3HVE B;  3TG4 A;  2VSY A;  2L9B A;  4U63 A;  2XGM A;  3CK9 A;  5LFA A;  1NA3 A;  3PE4 A;  4KVO A;  3PH0 C;  2PM6 A;  3JYS A;  2FF4 A;  3ONK A;  2QFC A;  3LY9 A;  2VGX A;  4I6G A;  4KT6 B;  3MV2 B;  3ASD A;  3QOU A;  2WPV A;  2WQH A;  3PE3 A;  3WXX A;  3FTU A;  3B13 A;  1OWO A;  4A3V A;  1HFA A;  3RRM B;  2OV8 A;  1OUV A;  4XE0 A;  2KZT A;  2YIN A;  3MX3 A;  3VLF A;  3S7D A;  1HF8 A;  3IV0 A;  2J09 A;  2I1K A;  3FUK A;  4TRQ A;  4U07 A;  1H0A A;  3EIJ A;  3APD A;  3L17 A;  4FLB A;  4KBQ A;  3CVP A;  4PS3 A;  5HI7 A;  4J6I A;  4XIF A;  3U4T A;  4FJZ A;  4WWO A;  3FY4 A;  1INZ A;  2VSO E;  3AU5 A;  3L54 A;  3ZVV A;  1HX8 A;  3CQG B;  3FTW A;  1Z3X A;  3IHV A;  3G2V A;  4MKT A;  3PUJ A;  4ANV A;  4CT0 A;  3ZHE B;  2Y3A A;  4JEH A;  2X6F A;  4KVM A;  4ILI A;  4U0S A;  4UQY A;  1TJC A;  2VSX E;  4E85 A;  5JHB A;  2I1J A;  3CVU A;  5G04 J;  3LJ3 A;  1WAO 1;  1E7U A;  2XPY A;  1UW4 B;  2BTD A;  4JEU A;  2XGO A;  4YVQ C;  2C0L A;  1EPU A;  4A1S A;  4B8A A;  4GZ5 A;  5FZQ A;  4UWG A;  5EKQ D;  4QFV A;  4GZ6 A;  3SFZ A;  2Q7F A;  4I17 A;  5A7D B;  2I2O A;  2VQ2 A;  3T5V A;  4LRZ A;  2LAH A;  5D0O D;  2XRZ A;  2FBN A;  4CDM A;  2R17 C;  3L08 A;  4XI9 A;  2WM9 A;  4BY6 A;  4R7L A;  2X38 A;  3CHP A;  4G23 A;  2WXL A;  2KM4 A;  1QZ2 A;  4AIF A;  2C0M A;  4ATG A;  5DIZ A;  4GA2 A;  3ML9 A;  1HS6 A;  2WXR A;  4L23 A;  2RD0 A;  2HR2 A;  4AJW A;  5AIJ A;  4RG6 A;  3Q5M A;  1HXI A;  1HO8 A;  3T5X A;  4C0E A;  4HS2 A;  2GGF A;  3MV3 B;  3RO2 A;  3I4G A;  3TXM A;  4LCT A;  2E0I A;  3TAX A;  4XZ4 A;  2DBA A;  4N39 A;  4C9B B;  4F7A A;  3JQ0 A;  3LCA A;  3NZS A;  4W9R A;  1IHG A;  2KCL A;  2JEK A;  4A1G A;  3MCX A;  3SGH A;  2IOS A;  1EF1 C;  4D10 C;  4DLO A;  4JA7 A;  2WXM A;  3CVQ A;  1WM5 A;  3FU0 A;  4I6J A;  4A55 A;  2IFU A;  3O4Z A;  2WQ6 A;  4HOT A;  3QC1 A;  2PZI A;  3MZL B;  5FZR A;  2AVP A;  4CCA A;  2WVI A;  4I1A A;  3FUM A;  3ZYQ A;  4AM9 A;  3ENE A;  3KAE A;  4XI0 A;  3MKQ B;  3IEG A;  4JW1 A;  4G1T A;  1Z6T A;  3FTZ A;  5FWQ A;  3ZN3 A;  3TG5 A;  2X6J A;  3BG0 B;  3EJN A;  4UI9 C;  3U64 A;  4OVV A;  4F53 A;  4GA0 A;  3FUL A;  3PZD A;  4RSY A;  5J08 A;  2WXF A;  5JHA A;  4FLH A;  4L7T A;  2XCB A;  1E8Y A;  3CHM A;  3KEZ A;  3NQP A;  4IUL A;  4EZL A;  2ZU6 B;  3FUI A;  2V5F A;  5FQ8 A;  4J8S A;  5KJK A;  2GRL A;  4ANW A;  2V0P A;  1JWF A;  4FU3 A;  2KCK A;  3GW4 A;  4NRH B;  3UQ3 A;  5A6C A;  4WNG A;  3AU4 A;  3B7S A;  3UMV A;  2AWI A;  4EQF A;  3QNK A;  3AS4 A;  3FH8 A;  2V4L A;  3OAW A;  3UT7 A;  3O48 A;  4TV3 A;  5D0Q D;  2BUG A;  3PDN A;  5E75 A;  5G04 C;  5A23 A;  3ZGQ A;  3CHS A;  4JL0 A;  3P1U A;  4U0Z A;  4N5C A;  1NP7 A;  5BUZ A;  5ANR A;  3UT8 A;  2WMN A;  1JPL A;  3N71 A;  3B7T A;  3R7Q A;  2YQ8 A;  4J8E A;  1WY6 A;  4N2S A;  2IQC A;  2J4B A;  4UWK A;  1HE8 A;  3CIA A;  4FA6 A;  4CDR A;  2X3M A;  5T8I A;  3G2W A;  3FWV A;  2UY1 A;  3CKC A;  2YNQ A;  3FFL A;  4GZ3 A;  4I9C A;  1U3C A;  5BPP A;  5ARG A;  3EDT B;  3HIZ A;  3ZRH A;  1Y6I A;  3LVQ E;  4B94 A;  1UG3 A;  3FP3 A;  5T4Y A;  4E6H A;  1SQM A;  3EIQ C;  1JWG A;  2VTB B;  4NQ0 A;  1FVF A;  3MGB A;  4AY6 A;  4PH4 B;  4H7X A;  4HFG A;  2PQR A;  4N3C A;  3ZYL A;  4GPK A;  2Y4U A;  1ELW A;  3RIB A;  3LY7 A;  3SNX A;  4IRU A;  3D9N A;  2WXO A;  4WWN A;  4NUR A;  1HG5 A;  3TXN A;  3HDX A;  3ZPJ A;  4JHK A;  3HYM B;  4IN3 B;  3OTN A;  4UI9 J;  4ILG A;  5FTP A;  3I5P A;  1UJK A;  4PUC A;  3B7R L;  1ELK A;  4CT4 A;  4B0Z A;  2IJG X;  4FJY A;  4I43 A;  5LOZ A;  1SZA A;  2NC9 A;  2BF0 X;  3B7U X;  3Q49 B;  3UPV A;  2V8S E;  3CST A;  1IQR A;  3TL5 A;  5EDS A;  3LDZ A;  4G26 A;  4I1M A;  1L5J A;  3GZS A;  2J9Q A;  4BTA A;  3S7B A;  2L0I A;  2CG2 A;  3CGH A;  2MHK A;  5JJ7 A;  3ESL A;  4FHJ A;  3URZ A;  2XCC A;  2YHC A;  4G11 A;  2RG8 A;  3ZIM A;  2CHZ A;  4OVU A;  3RRU A;  3R9A B;  4KYO B;  4EZK A;  1OWN A;  1Y8M A;  4CGV A;  4JPS A;  4C0M A;  3IHY A;  3MJW A;  3Q47 B;  3FU5 A;  4WAF A;  4H7Y A;  4M3O A;  4UI9 K;  5AYW D;  4URK A;  4APF A;  3G2S A;  4I9E A;  5KJN A;  3FUE A;  2C2L A;  1PAQ A;  5FQ7 A;  5EX3 A;  4L2Y A;  2VGX B;  4HOU A;  3S7F A;  1PC2 A;  5AJL A;  3C98 A;  2M63 A;  3FUJ A;  2LSV A;  2ION A;  2CG3 A;  4GCN A;  2OOE A;  2WXQ A;  3FUN A;  2XEV A;  3FU3 A;  3RJV A;  2PQN A;  3E4B A;  3QAR A;  4JZY A;  5KJL A;  2KZT B;  3LPZ A;  5T3R A;  4APO A;  4I1O B;  4BSX A;  4PDX A;  3SBT B;  4F1S A;  3BEE A;  3LEW A;  3CR3 A;  1H2T C;  2X6K A;  3LY8 A;  4GA1 A;  2WXJ A;  4YVO A;  5G05 C;  4HXI A;  4N2Q A;  1N52 A;  2AXZ A;  3I4R B;  3QWP A;  4JVS A;  2WB2 A;  3CVV A;  4Y6W A;  3HHM A;  4P29 A;  5M72 A;  3QAQ A;  5FT9 A;  4TUU A;  2ILR A;  3P2B A;  2P58 C;  5AJD A;  3ONL A;  3PUK A;  1SZ9 A;  3ULQ A;  2GW1 A;  1OWP A;  3CV0 A;  3VLE A;  3R7R A;  3PRZ A;  3DBS A;  4XX5 A;  3U9W A;  4GYO A;  3QDN A;  3PRE A;  5BW8 C;  3BG1 B;  3KS2 A;  2MRI A;  1A17 A;  3PVL A;  3PEU B;  3ZFW A;  5BV1 A;  3U66 A;  1HH8 A;  2DCP A;  2WXH A;  4MRU A;  2CFU A;  3FHE A;  3GYZ A;  4FC8 A;  3MEK A;  3ASG A;  3HVE A;  4V3I A;  1JUQ A;  4JC8 A;  3QKY A;  2VJ8 A;  2NSZ A;  4I2W A;  4GZC A;  4AVX A;  5LX8 A;  4EBA A;  4L2L A;  5LCW C;  2Y4T A;  4IYP A;  2IF4 A;  3RRN B;  1KT0 A;  2DIW A;  2OVB A;  1DNP A;  3FH5 A;  1P5Q A;  2R5S A;  2I9C A;  4J0U A;  4J8D A;  3UT4 A;  3TJP A;  4GML A;  5G2N A;  3UUX A;  1IQU A;  5FJY A;  4O6F A;  5LP0 A;  5AEN A;  4DK5 A;  4ANU A;  1XGW A;  3SI5 A;  4G2V A;  3NZU A;  3ZEF A;  1ZBP A;  4AV7 A;  3QWW A;  3Q15 A;  2OVF A;  3AS5 A;  4DI4 A;  5BT1 A;  3ZW3 A;  2FI7 A;  3CVN A;  4UQX A;  1EYH A;  2VYI A;  4DLQ A;  1TJF A;  3CHR A;  3CHO A;  3LYA A;  3D9K A;  1H19 A;  4AY5 A;  5G05 J;  4RVB A;  4CRW A;  2FUL A;  3MA5 A;  2AXV A;  3FTX A;  1MQS A;  4AXH A;  1ZU2 A;  3ESK A;  2J4D A;  4BFR A;  4UWH A;  1H6K A;  2R59 A;  4AOF A;  4DJA A;  2HYZ A;  2A5U A;  3K9I A;  1N54 A;  5KCM A;  3ZYM A;  1E8W A;  5JJ6 A;  4BWR A;  3LXU X;  3ZHE A;  2NXP A;  1NZN A;  4ILH B;  3PS6 A;  4AP2 A;  4B89 A;  2PL2 A;  2LSU A;  4GU5 A;  2J08 A;  1U3D A;  3L13 A;  2X6I A;  3G2T A;  3VTY A;  1GW6 A;  4WWP A;  4WNF A;  4K03 A;  4OYS A;  3L6A A;  2XGS A;  4KZ0 A;  1IYG A;  3LKU A;  3CEQ A;  4JHR A;  2VGY A;  2IU1 A;  3CK7 A;  2KCV A;  2PM7 A;  3D9P A;  4FP7 A;  4JXT A;  4DPR A;  1LF8 A;  3D9J A;  3FU6 A;  3TGO A;  2WXK A;  3AS8 A;  4F3V A;  3CVY A;  1BPO A;  2WXN A;  5J90 A;  5LCW J;  2KC7 A;  3PNT B;  3CSF A;  5CCL A;  4Q96 A;  2UWJ G;  1QNF A;  4G25 A;  4U8H A;  1UN9 A;  4EPZ A;  4GAA A;  5FZS A;  3LS8 A;  1OWL A;  3FDH A;  3D9M A;  1HG2 A;  4LEU A;  4YND A;  4GYY A;  2LAI A;  4ABN A;  4GMJ A;  3FTV A;  5EX0 A;  3IKO B;  1Z3Y A;  3QB2 A;  1E7V A;  5ANL A;  2OND A;  3RK6 A;  3QJZ A;  4B8C B;  4I2Z A;  3S7J A;  5FQ4 A;  2CHX A;  4ANX A;  5CMW A;  4UQZ A;  2WXI A;  2A4Z A;  1YA0 A;  3FEX A;  3FUF A;  3NF1 A;  3JUI A;  1HU3 A;  4BT9 A;  5JJT A;  3ASF A;  1S0P A;  4MS6 A;  1FVH A;  3CKB A;  2HO1 A;  2UY1 B;  3L16 A;  4ME2 A;  1KT1 A;  5ARF A;  4JHJ A;  2HM8 A;  3EHN A;  3FEY A;  3DPD A;  4XKC A;  1FCH A;  4Y6C A;  4BTB A;  1EDU A;  4CDN A;  5KJM A;  1PY1 A;  3CVW A;  3MKQ A;  5DBK A;  4UWF A;  1KLX A;  5C2Y A;  4UWL A;  4EBA G;  5BNW A;  2L6J A;  2AXU A;  4GYW A;  4HLE A;  2CHW A;  2WXP A;  2WMO A;  4PS8 A;  3RO3 A;  1E90 A;  4XKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...