2JEKA

Crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
140
structure length
140
Chain Sequence
b'DPFDLKRFVYAQAPVYRSVVEELRAGRKRGHWMWFVFPQLRGLGSSPLAVRYGISSLEEAQAYLQHDLLGPRLHECTGLVNQVQGRSIEEIFGPPDDLKLCSSMTLFARATDANQDFVALLAKYYGGGEDRRTVALLAVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RV1873
publication title The Molecular Structure of Rv1873, a Conserved Hypothetical Protein from Mycobacterium Tuberculosis, at 1.38A Resolution
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 54
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2007-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08837 DUF1810 Protein of unknown function (DUF1810)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.380 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2jekA00
2JEKA
chains in the Genus database with same CATH superfamily
1HO8A 2XEHA 4HI8A 3DPYA 4ZHBA 4J8FA 3FH7A 3ZNGA 1PC2A 4L9PA 1ELWA 2KBXA 3CKCA 4AP2A 3ZPJA 3ASNE 3U3WA 3CVNA 3HXCA 3Q7FA 1TN8A 2XPYA 4LRZA 3FUMA 4CT0A 4U96D 3G2TA 5HKPA 2X6KA 1S63A 4K03A 2YQ8A 2FI7A 2LUHA 2QC9A 2WVIA 1UJKA 3CHRA 5AQ9A 4N2SA 4EBAG 3TXMA 4DX6D 2DZOA 4IULA 3UQ3A 2H6GA 1N0RA 1QQEA 3HDXA 3LEWA 4PH4B 2FBNA 3ONLA 3QNKA 1ZBPA 4DX7D 5D66A 4JEUA 5EIBE 4JA7A 3F6QA 3GW4A 4AEZC 1JCRA 1KPSB 1MZCA 2J49A 1SZAA 3V30A 2EIKE 3JUIA 3CQGB 2X38A 1JWGA 4ANVA 4BY6A 3FHEA 1QYMA 1D8EA 2GROB 3L82A 3MKRA 4APFA 4YDOA 3D9PA 3ULEG 5KJKA 4BERA 3FH8A 4HLLA 3DEPA 4XI0A 1PAQA 3TG4A 3U4TA 2XHEA 1XGWA 3FU0A 1NZNA 4FC8A 2Y4TA 5FZRA 1TNBA 2ETAA 3JCKC 5AQ7A 5FT9A 2P9SG 2X6HA 4G26A 4GCNA 4X8QA 5D0OD 4HB5A 1IHBA 3AJIA 1Y8MA 1INZA 3ZN3A 4M3OA 4U63A 3ASOE 4U04A 1IYGA 3IHVA 2XGSA 4NRHB 3DXKG 1TYQG 1K1AA 3ABME 3C3QA 4BSZB 1JWFA 3RRMB 3SFXA 2P9NG 5LCWC 4G23A 4DLQA 3PVLA 1N0QA 3PREA 5BT1A 5HRYA 2H6HA 2WPVA 2Y1LE 3I5PA 4JZYA 4XI9A 5G05C 2R03A 4BT9A 1MX6A 4BETA 3ML9A 3MKQA 2V4LA 5ARGA 1HS6A 3AG4E 3L6AA 2R17C 2OOEA 2AXZA 1OY3D 2YNQA 3ABLE 5JHBA 4Q94A 1SW6A 4N5CA 4G8KA 4G8LA 5FWQA 3SNXA 5BPPA 3DWLG 2AXVA 4DPRA 1AP7A 2R59A 2P9KG 2KCVA 1KZPA 4QFVA 4TV3A 4CRWA 1OWPA 3QKYA 2VSXE 2FO1E 4ABNA 1E8ZA 5ENSD 3VTYA 3AU5A 3RAUA 4F6RD 5T4YA 1NL4A 3KD7A 5C1DA 2LXMA 4GPMA 4MS6A 4KVMA 1Z3YA 3V79K 4I2ZA 3UXGA 3CGHA 1KZOA 5B1BE 4XE0A 2PL2A 3UUXA 2KC7A 3UMVA 3E32A 4GZCA 1IHGA 1V55E 5AARA 1W3BA 1GW6A 4YNDA 2FULA 3R7RA 1N4SA 5FJYA 4FULA 3PUJA 5EN5D 4DUIA 1EF1C 3SY2A 2LAIA 4J8YA 1TNUA 3DPDA 4WAFA 3GZ1A 2DYRE 5EILA 1H2UA 3RO3A 4YVOA 4F1PA 2AWIA 3CVWA 4KBQA 3D9HA 2WB2A 1WAO1 3FEXA 4GTSA 2AJAA 3RO2A 5CCMA 3DSXA 4GA2A 3JXJA 2DBAA 1MHQA 5AQBA 3O4ZA 3CHMA 3HYMB 2WXJA 2IOSA 3CIAA 4GMLA 4UUCA 5JJ6A 5KWDA 3ASDA 1Z5SC 2F0YA 2PZIA 4APOA 3LYAA 3SHFA 5LX8A 2ONDA 3TWTA 2BEDA 2KATA 3GZ2A 2OCCE 2VSOE 2UY1B 3IBEA 2KZTB 2WXFA 5BV1A 5JA4D 1D9SA 5EYLA 3TWRA 1LD8A 3DXMG 3FTXA 4LNBA 2VGXB 3JQ0A 4UQYA 3CHPA 3CVQA 3ULYA 2XS8A 4OVUA 2XCBA 3SD5A 3DSVA 3EHQA 1UG3A 1YCSB 4J6IA 3Q15A 3Q7AA 3LKUA 3I3NA 3CVPA 4XIFA 5J90A 2BTDA 4E6HA 1N4PA 1E96B 1FCHA 1VDYA 2NYJA 2J9QA 3B7BA 1OCOE 1HFAA 1RZ4A 4I6GA 4G25A 3QOUA 5B1AE 3T9KA 2EQXA 1E90A 3UIPC 2WXQA 3E34A 1UN9A 2GGFA 4CDNA 2CFZA 2LNIA 5EX3A 3ZYMA 4RLYA 4J7WA 4LG6A 3FU6A 1AWCB 3QJZA 4BWRA 4TUUA 3VLDA 1H0AA 1ZB1A 2RFMA 3B7SA 4H7XA 3TL5A 1NFIE 5KCMA 5FQ6A 1NA0A 2AXUA 3LVQE 3SI5A 3O48A 2BKGA 4NQ0A 1NI1A 2WXKA 3CVXA 3ZRHA 1XNFA 2JEKA 1FVFA 1N52A 3U9WA 3SBSA 5D2MC 5AJLA 3DSUA 2WQHA 1N54A 4AV7A 5BXOA 3FTVA 4MLPA 4UI9J 1WM5A 4I1AA 3PZ2A 3SFZA 3Q47B 5AYWD 3KEAA 4JHJA 3UX4A 4EHMA 4HOQA 5FQ7A 3CHSA 4IRUA 3HG0D 4O6FA 2WM9A 1E8WA 2BF0X 1TJCA 2GW1A 1SVXA 4U07A 4OYSA 3ZEFA 3WG7E 3OTNA 5KBAA 5E76A 2CHZA 2Y0BG 3BU8A 4DRXE 3B7TA 4NURA 3PE4A 2OVBA 1OUVA 5BNWA 3Q75A 3TWQA 4JB8P 4JXTA 2FF4A 1FT1A 3ULQA 3ONKA 4GCOA 1UN8A 4G1TA 4UI9C 1LD7A 4GTTA 4G2VA 1OWNA 5CERB 2LSVA 5G04C 4AY6A 1HG5A 1D8DA 4GTVA 4NACA 4M7CA 3ABKE 3MZLB 2R05A 2L9BA 4HORA 4KZ0A 4FHJA 2H6IA 4HXIA 5AQAA 3FTYA 3S7DA 3Q9UC 4BEPA 4C9BB 4L2LA 4I9CA 4HRLA 2F8YA 4D10C 2LAHA 3UI2A 3HHMA 4GAAA 2ETBA 3UM3A 2P9LG 4BFRA 3NQPA 3NF1A 3CKBA 3DSTA 4WNDA 3B7UX 2CG3A 2XRZA 4P29A 3CVYA 2IU1A 3E33A 3QB2A 2Y3AA 4BT8A 1P5QA 3EIQC 3V31A 3N71A 4AOFA 1NA3A 3RKVA 4ANUA 1BU9A 2QYUA 3CSFA 2WXRA 3LY8A 2DCPA 2WXGA 3EDTB 3ZYKA 4GZ3A 2P58C 1G3NB 4TXPA 4ILGA 1HX8A 4XKBA 5LCWJ 3G2WA 2XCCA 4KMOA 4L1BA 3S7BA 3J5QB 4K5CA 1HU3A 4ILIA 4U0ZA 2VGEA 4JD2G 3TXNA 5G05J 4O1OA 2QYJA 4L23A 3G2VA 4U95D 5G2NA 5EYPF 5LFAA 1H6KA 2HR2A 3EU9A 3UT8A 4PUCA 1OCRE 5ENNA 3GZSA 2DWZA 5EDSA 3KEZA 4BTBA 5ANLA 4GZDA 3UT7A 3AG1E 2ZGGA 4H7YA 5ENTD 2UY1A 2KZTA 4B0ZA 2B6CA 3QK0A 4GTQA 4J8DA 4B93B 2P9UG 2LSUA 4PDXA 1BLXB 3AAAC 3FUEA 2VGXA 5FQ4A 4G11A 4RSYA 1TJFA 2L0TB 3FUIA 4TUMA 4ACLA 4EZLA 4O1PA 3ASFA 2IO3C 3PZ3A 4CCAA 3CK9A 4JVSA 1YA0A 3IEGA 3G2SA 4A3VA 3UKRG 3VLEA 4Q69A 3D9JA 3E30A 2C0MA 1Y6IA 4Y6CA 5BXUA 2I6HA 1N94A 1X5BA 3NB2A 2CFUA 3QC1A 4HBDA 3HRAA 5FTPA 3OXGA 5T3RA 3ZW3A 4UI9K 4ATGA 2XZTG 3APFA 1O1SA 3DSSA 3OXFA 1X81A 5CHEE 3UT4A 2P9PG 1N9AA 3JXIA 2RFAA 4JPSA 4OAUC 4GYYA 4EECA 4PS8A 3KS2A 4RG6A 3FWVA 4JL0A 4BESA 2V5FA 4A55A 2J4DA 4ANXA 2J4BA 2BKKB 3RRUA 1E8YA 3FUNA 1MX4A 3BG0B 4GPKA 2GRRB 3JQ1A 3NBNB 3KAEA 4B89A 5AAOA 2IO2C 3IHYA 5IY5E 2X3MA 1IQUA 3UIOC 5CEAA 4TRQA 3JYSA 1U3DA 3D3MA 3NOCD 4DX1A 2OV8A 2YHCA 3CR3A 4UQZA 4F1SA 3FY4A 3PDNA 2WXOA 2J08A 4O60A 2VJ8A 4UQXA 5FZSA 1LF8A 4A63B 2KM4A 4V3IA 5A6CA 4GTRA 2WQ7A 4LNGA 1EPUA 3CVUA 3UKUG 3QWVA 4EZKA 3UPVA 1FVHA 3AS8A 4K5AB 3FUHA 5C2YA 1EDUA 1MQSA 3PZDA 3FEYA 3B13A 2WQ6A 4JEHA 3EU5A 4PS7A 1SA4A 3C98A 1S70B 4LNUD 3LY7A 5ANRA 3D9NA 2DZNA 4CGWA 5JJ7A 1HXIA 3AG2E 3FDHA 2P9IG 5J08A 4ACKA 3VLFA 4HRNA 1YMPA 1UJJA 3HIZA 2DVWA 2WMOA 2ZIRA 3ZXSA 3LVRE 1H2TC 2F8XK 4EZJA 2XENA 4AM9A 5BV0A 4U0SA 5AIJA 1E8XA 2VSYA 1OCZE 2C0LA 4J0UA 4B94A 4GYOA 4HI9A 4F3VA 1ZU2A 3MEKA 3PS6A 2L6BA 4FJZA 2L0IA 1QZ2A 4E85A 1LTXA 5H7PA 4GMRA 3TWUA 2B0OE 4FLBA 4A3TA 2XPZA 1U2VG 5JJTA 4KT6B 2R2LA 4WNEA 1TNOA 3MV2B 2OVFA 4JW1A 1TR4A 1FT2A 3DBSA 4HQDA 3C3OA 4I17A 3K9IA 3ZHEB 3FTWA 1TN6A 5CRUA 3SBTB 2P2CP 4I1MA 2IOLA 1DC2A 1O1RA 1Z6TA 5EX0A 1IQRA 3S2AA 4HFGA 2WXIA 1B89A 3V2OA 5CECB 3FUDA 4K5BA 4CT4A 4ME2A 5CEDB 4GTPA 4HNAD 2VQ2A 3FULA 1TN7A 3CVVA 3D9MA 1BD8A 5T8IA 2X6JA 4N5QA 2VTBA 3ML8A 1RW2A 1ELRA 3PE3A 1OCCE 3U66A 3D9KA 4N2QA 1N11A 4N3CA 5JHAA 1K8KG 3J5PA 5CMYA 2WXHA 2QFCA 3PEVB 1K1BA 4FJYA 3I4RB 2PNNA 3C5RA 3T8KA 2MRIA 1HH8A 3HXFA 4GU5A 2I2OA 5G04J 2ZGDA 5ENRD 4WNFA 1Z3XA 4KZCA 5ENPD 2LO6A 2NSZA 2RKKA 4BSXA 1H6OA 3AS5A 3FTUA 4RQIA 4DX5D 2E2EA 5AJDA 3SF4A 3HXEA 2V8SE 2WXNA 3Q5MA 3ASGA 4HOSA 2H6FA 4U0UA 3MCXA 5CMWA 5G55A 3QWPA 5DBKA 3ZKJA 5AN8A 2A5EA 2OEWA 4HOTA 3L08A 2CG2A 2ILRA 3QDNA 3ZIMA 2EILE 3Q9NC 4CYMD 4KYOB 1O1TA 2ZISA 4DI4A 3LJNA 3UM0A 4XZ4A 2DIWA 5HS0A 4AY5A 3U64A 3MYVA 5KJNA 2A5UA 1BI8B 4DJAA 4XKCA 3PNLB 4DX2A 4LUNU 2FO7A 3DSWA 4URKA 4N39A 4MKTA 1HG2A 3PZ1A 4FHKA 2JLBA 3CHQA 4GTOA 1V54E 5BUZA 5ARFA 4B8AA 4RG9A 2Y69E 3BQOA 3UINC 4WWPA 4HLEA 3ZUVB 3TWVA 3MGBA 3EHMA 4C0EA 1H19A 1ELKA 3TWXA 1QBQA 2L6JA 2DYSE 3LS8A 4AVXA 3JUEA 1MX2A 1KT0A 1HF8A 4BX9A 3OAWA 2WXPA 3PEUB 4F7AA 5HQ8A 3RRNB 2Y4UA 3HVEA 3EJNA 3BUAA 3SO8A 1HZ4A 4G24A 1KT1A 2GRQB 4LCTA 2QY7A 4HOUA 1SZ9A 5DIZA 3TWWA 3ZYQA 5EKQD 3L9TA 3AU4A 2HM8A 2XGOA 3FU5A 2RG8A 4TXRA 2VTBB 4CZ2D 1SQMA 4LEUA 3LY9A 3NOGD 4LERA 1OT8A 2J07A 4QQIA 2GRNB 2XZDG 1DVPA 3ASHA 4GZ6A 2J8SD 2WXMA 4CDRA 4GMJA 4JC8A 4UWKA 4A1SA 2IEJA 2GRLA 3FP3A 3S7JA 4L2YA 5FZQA 4FADA 3VTXA 3Q79A 3P1UA 4W9RA 3NZSA 1HE8A 3B95A 4FA6A 3SQVA 4U8VD 3ENEA 3LPZA 3UM2A 2HO1A 3IXEA 2AVPA 4GA0A 1OXJA 3APCA 3L54A 1WDYA 4HS2A 3MA5A 3D9LA 4LSZE 2LXLA 5AENA 3EUVA 3R7QA 2PM6A 3B7RL 3Q73A 2V5QC 3NZUA 3HXBA 4A1GA 3E4BA 4DLOA 1TNYA 3R9AB 3L16A 3FUJA 1BI7B 3S7FA 1S64A 2X6IA 4I6JA 2ZU6B 4N3BA 1H6PA 1N95A 4R7LA 3L22A 2PQRA 3LJ3A 5KJLA 3W9GA 3PNTB 3Q78A 5E75A 3GYZA 4J8EA 4PS3A 1OWMA 3SGHA 2JABA 3BEEA 3CK8A 3EHRA 3PH0C 5CBNA 4AJWA 3ZHEA 1NP7A 4KXKB 4U7EB 3LCAA 3CSTA 3CEQA 1WG0A 4Q96A 1PY1A 4TXQA 3PUKA 1KLXA 2WMNA 2OEVA 1E7UA 4I2WA 4Y6WA 4UWGA 3EHNA 5LOZA 5CCLA 4ANWA 4NIKA 1SA5A 4HRMB 2V4HC 4BTAA 4CEMA 3TGOA 1JUQA 4JHRA 3MV3B 2YHEA 2XQ0A 3CQCB 2BUGA 2X6FA 4N3AA 3SFYA 5A23A 1UW4B 3T8MA 2VYIA 3HXDA 4GYWA 4XEIG 4GB9A 2VSNA 2XRYA 1TEZA 1IKND 2CHXA 3UTMA 4MBGA 3TJPA 3HVEB 5ENQD 2IF4A 2IFUA 3G2UA 3LXUX 4WNGA 4WWNA 4FU3A 2RD0A 3FH5A 1N4QA 4IYPA 1E7VA 1Q2ZA 2NC9A 1A17A 1FPPA 3TAXA 4RVBA 3QARA 4YDYA 4CGVA 3CV0A 2I1KA 3ZVVA 3C72A 2KCKA 4WWOA 2IJGX 1DCQA 4B8CB 3RJVA 1JCQA 1IXVA 3Q4AB 3URZA 3CVLA 4KVOA 5BW8C 3RIBA 1MJ0A 3CLJA 3SZ7A 3PRZA 3KSLA 4IN3B 4BX8A 2I9CA 3QWWA 5KJMA 4DK5A 3LDZA 1DCEA 3L13A 4OVVA 3CHOA 2AW6A 3Q49B 5ENOD 2YINA 2FEZA 3R9MA 4GZ5A 1JCSA 4MRUA 3X2QE 4U8HA 3EIJA 5CRVA 5FINA 5LP0A 3RSEG 3P2BA 2EINE 4GA1A 2A4ZA 4JA9A 2VGYA 1QNFA 4ATZD 2PQNA 2NXPA 3FFLA 3L17A 5FQ8A 1WY6A 4OAVB 3FUFA 2HE0A 4AIFA 4L7TA 3MKQB 5HI7A 2WXLA 1BPOA 1L5JA 4JHKA 4EBAA 4EPZA 3ZXPA 3QAQA 2MOWA 5KNGA 3T5XA 3V2XA 3W9FA 4DI3A 2R5SA 1MYOA 2KCLA 3ZFWA 4C48B 1N4RA 1TNZA 1UOHA 3DRAA 2IONA 3RU0A 3FTSA 2EIME 3C3RA 3FUKA 4J8SA 4XX5A 3AG3E 4ILHB 2IQCA 3T5VA 3ISMC 3I4GA 2UWJG 4YDWA 3TG5A 4EQFA 1OWLA 3ESLA 3RK6A 3BG1B 4Z68A 2HYZA 2QZAA 5D0QD 4HVBA 4UWLA 3OXLA 1S0PA 4I1OB 4FLHA 1H2VC 3ZGQA 1OWOA 3IV0A 2ETCA 2R02A 4I43A 3KSQA 4UWFA 1A5EA 1EYHA 4C0MA 4F53A 3MX3A 3WXXA 2J09A 5A7DB 5CBOA 2MHKA 5EIDA 5B3SE 2C2LA 2I1JA 2F37A 4WUYA 5KNHD 3PZ4A 2ZXWE 2GRPB 3D9OA 2V0PA 3E37A 3ZYLA 4GTMA 5M72A 3MJWA 4UWHA 1K3ZD 5FIOA 3AS4A 2KXPC 4AXHA 2E0IA 3IKOB 4I6EA 2CHWA 3D9IA 4YDEA 4YVQC 3ESKA 4U8YD 1O5MA 2PM7A 3TWSA 4I9EA 1DNPA 3CK7A 2XPIA 2IY0C 2Q7FA 3FTZA 1U3CA 1JPLA 3ZU7B 3APDA 4K0RA 3UM1A 1YYHA 2XGMA 2XS1A 2M63A 2EIJE 3FU3A 3NAWA 2XEVA 4ZFHA 3DEOA 4FP7A 5JMND 2XEEA 4CDMA 2GRMA 2MYOA 5ITZF
chains in the Genus database with same CATH topology
1HO8A 3ZYMA 2KM4A 4HS2A 4V3IA 3MA5A 5A6CA 3D9LA 4J8FA 5AENA 3FU6A 2WQ7A 3QJZA 1EPUA 4BWRA 3FH7A 3CVUA 4TUUA 3QWVA 3R7QA 3VLDA 1PC2A 4EZKA 1H0AA 2PM6A 1ELWA 3B7RL 3UPVA 1FVHA 3AS8A 3FUHA 3B7SA 3NZUA 3CKCA 4H7XA 4AP2A 3TL5A 4A1GA 5C2YA 3E4BA 3ZPJA 5KCMA 4DLOA 1EDUA 1MQSA 5FQ6A 3PZDA 1NA0A 2AXUA 3B13A 3CVNA 3FEYA 3L16A 3FUJA 3R9AB 2WQ6A 4JEHA 3LVQE 3S7FA 3SI5A 4PS7A 2XPYA 3C98A 3O48A 4LRZA 3FUMA 3LY7A 4NQ0A 3D9NA 5ANRA 2WXKA 3CVXA 2X6IA 4I6JA 2ZU6B 4CGWA 3ZRHA 1XNFA 4N3BA 5JJ7A 1HXIA 2JEKA 4R7LA 3L22A 2PQRA 3FDHA 1FVFA 1N52A 3LJ3A 3G2TA 3U9WA 4CT0A 2X6KA 3SBSA 3VLFA 4ACKA 5J08A 5KJLA 3PNTB 5AJLA 5E75A 3GYZA 1UJJA 4J8EA 4K03A 3HIZA 4PS3A 1OWMA 3SGHA 2WMOA 2WQHA 2YQ8A 2FI7A 3BEEA 1N54A 3CK8A 4AV7A 2WVIA 3PH0C 4AJWA 1UJKA 3CHRA 3FTVA 3ZHEA 4MLPA 3ZXSA 4N2SA 4EBAG 3TXMA 4UI9J 1NP7A 4KXKB 1WM5A 3LCAA 3LVRE 4I1AA 4IULA 3UQ3A 1QQEA 3CSTA 3SFZA 3Q47B 5AYWD 1H2TC 3CEQA 3HDXA 4EZJA 4AM9A 5BV0A 3LEWA 4PH4B 4Q96A 1PY1A 2FBNA 4U0SA 5AIJA 1E8XA 3ONLA 3QNKA 4JHJA 3UX4A 1ZBPA 2VSYA 4HOQA 2C0LA 4J0UA 5FQ7A 4B94A 4JEUA 3CHSA 4GYOA 4IRUA 4JA7A 4O6FA 2WM9A 1E8WA 3PUKA 4F3VA 3GW4A 2BF0X 1KLXA 1ZU2A 4AEZC 1TJCA 2WMNA 2GW1A 2J49A 1SZAA 1E7UA 4I2WA 3JUIA 3MEKA 4OYSA 4U07A 3CQGB 3EHNA 2X38A 3PS6A 4UWGA 4Y6WA 5LOZA 3ZEFA 3OTNA 5CCLA 4ANWA 1JWGA 4ANVA 4BY6A 4FJZA 3FHEA 2L0IA 5E76A 2CHZA 1QZ2A 4E85A 3B7TA 4NURA 3PE4A 4BTAA 3MKRA 2OVBA 4APFA 4CEMA 3D9PA 1OUVA 5BNWA 3TGOA 1JUQA 4JHRA 4FLBA 3MV3B 2YHEA 4JXTA 4A3TA 2XQ0A 2XPZA 5KJKA 2FF4A 3CQCB 2X6FA 2BUGA 4N3AA 5A23A 1UW4B 3T8MA 5JJTA 2VYIA 3FH8A 4KT6B 4WNEA 4GYWA 4XI0A 3ULQA 1PAQA 3ONKA 4GCOA 3TG4A 1UN8A 4G1TA 3MV2B 2VSNA 2XRYA 4GB9A 2OVFA 4JW1A 4UI9C 3U4TA 2XHEA 1XGWA 3FU0A 1TEZA 1NZNA 3DBSA 2CHXA 4FC8A 4G2VA 2Y4TA 1OWNA 5FZRA 2LSVA 3TJPA 3HVEB 5G04C 4AY6A 3JCKC 1HG5A 4I17A 3K9IA 3ZHEB 3FTWA 5FT9A 4NACA 2X6HA 4G26A 2IF4A 4GCNA 2IFUA 3G2UA 3MZLB 3SBTB 4HORA 2L9BA 3LXUX 4KZ0A 4FHJA 5D0OD 4WNGA 4I1MA 2IOLA 4WWNA 4HXIA 1Y8MA 1INZA 1Z6TA 3ZN3A 4M3OA 4U63A 4FU3A 5EX0A 1IQRA 3FTYA 4U04A 1IYGA 3S2AA 3IHVA 2RD0A 2XGSA 2WXIA 3FH5A 4HFGA 3S7DA 1B89A 4NRHB 4IYPA 4C9BB 3FUDA 4L2LA 4CT4A 4I9CA 1JWFA 4ME2A 3RRMB 5LCWC 2VQ2A 1E7VA 4G23A 4DLQA 3FULA 3CVVA 3PVLA 3D9MA 4D10C 2NC9A 5T8IA 2LAHA 1A17A 3HHMA 3PREA 5BT1A 2X6JA 4GAAA 3TAXA 2VTBA 4RVBA 2WPVA 4BFRA 3ML8A 3NQPA 3QARA 3I5PA 4JZYA 4XI9A 5G05C 3NF1A 4CGVA 3CV0A 4BT9A 3CKBA 1ELRA 3PE3A 2I1KA 3U66A 3ML9A 3D9KA 3B7UX 4WNDA 3MKQA 4N2QA 5JHAA 2V4LA 4N3CA 2CG3A 5ARGA 1HS6A 3ZVVA 2XRZA 2KCKA 4P29A 4WWOA 2IJGX 5CMYA 3CVYA 2WXHA 4B8CB 3L6AA 2R17C 3RJVA 2QFCA 3PEVB 3Q4AB 4FJYA 3I4RB 3URZA 2OOEA 2AXZA 2IU1A 3CVLA 2YNQA 3QB2A 4KVOA 2Y3AA 5BW8C 5JHBA 3RIBA 2MRIA 1HH8A 4GU5A 4BT8A 3CLJA 4Q94A 3SZ7A 1P5QA 3PRZA 2I2OA 5G04J 4IN3B 3EIQC 3N71A 4AOFA 1NA3A 4N5CA 3RKVA 4BX8A 4ANUA 4WNFA 1Z3XA 4KZCA 2LO6A 2I9CA 5FWQA 3CSFA 3QWWA 2WXRA 4DK5A 5KJMA 2NSZA 3LDZA 3SNXA 4BSXA 3LY8A 2DCPA 3L13A 5BPPA 2WXGA 3AS5A 3EDTB 4OVVA 3CHOA 2AXVA 3FTUA 4DPRA 2AW6A 3Q49B 3ZYKA 2R59A 4GZ3A 2E2EA 2KCVA 2YINA 2FEZA 4QFVA 4TV3A 2P58C 4GZ5A 5AJDA 4CRWA 3SF4A 4MRUA 1OWPA 4U8HA 3QKYA 2V8SE 2VSXE 3EIJA 4ILGA 1HX8A 4XKBA 2WXNA 5LCWJ 3G2WA 2XCCA 3Q5MA 4KMOA 4L1BA 1E8ZA 3S7BA 4ABNA 5LP0A 3ASGA 4HOSA 1HU3A 3P2BA 4GA1A 4ILIA 2A4ZA 4JA9A 2VGYA 3VTYA 4U0ZA 4U0UA 1QNFA 2PQNA 3AU5A 2NXPA 3MCXA 3TXNA 3FFLA 3L17A 3QWPA 5FQ8A 1WY6A 5G05J 3FUFA 5DBKA 5G55A 5T4YA 5CMWA 4AIFA 4L23A 3G2VA 3KD7A 4L7TA 5C1DA 3MKQB 5HI7A 5G2NA 4MS6A 5LFAA 1H6KA 2WXLA 2HR2A 1BPOA 1L5JA 1Z3YA 4JHKA 4KVMA 3UT8A 4PUCA 4I2ZA 4EBAA 3L08A 3CGHA 5ENNA 4EPZA 4XE0A 2PL2A 2CG2A 3UUXA 2KC7A 2ILRA 3GZSA 3QDNA 3QAQA 2MOWA 3KEZA 3UMVA 4BTBA 5EDSA 4GZCA 3U3WA 1IHGA 5ANLA 4GZDA 1W3BA 3T5XA 3UT7A 3ZIMA 1GW6A 4YNDA 2FULA 4KYOB 4DI3A 3R7RA 4H7YA 2UY1A 4DI4A 2R5SA 5FJYA 2KZTA 4FULA 2KCLA 4XZ4A 3PUJA 3ZFWA 2DIWA 4B0ZA 4AY5A 3U64A 3QK0A 3MYVA 5KJNA 1EF1C 4J8DA 2A5UA 2LAIA 4DJAA 2IONA 3FTSA 4XKCA 3FUKA 3DPDA 4J8SA 3PNLB 3GZ1A 4WAFA 4XX5A 3RU0A 2LSUA 4PDXA 1H2UA 4LUNU 3RO3A 4YVOA 2AWIA 2FO7A 4ILHB 4KBQA 3CVWA 2IQCA 2WB2A 1WAO1 4URKA 4N39A 4MKTA 3FUEA 3T5VA 2VGXA 5FQ4A 1HG2A 4FHKA 2JLBA 4G11A 3FEXA 3I4GA 1TJFA 3CHQA 2L0TB 4RSYA 2UWJG 3FUIA 3RO2A 5BUZA 5CCMA 4GA2A 3TG5A 5ARFA 2DBAA 4ACLA 4EQFA 1OWLA 3ESLA 4EZLA 4B8AA 4RG9A 1MHQA 3RK6A 4WWPA 4HLEA 3ASFA 3BG1B 3CHMA 3O4ZA 2HYZA 3HYMB 5D0QD 2WXJA 4HVBA 2IOSA 3CIAA 4UWLA 3OXLA 4GMLA 4CCAA 1S0PA 3MGBA 3CK9A 4JVSA 1YA0A 4FLHA 4I1OB 3EHMA 1H2VC 3IEGA 3ZGQA 4C0EA 5JJ6A 3G2SA 3ASDA 1H19A 4A3VA 1ELKA 2PZIA 3VLEA 4APOA 4Q69A 3D9JA 1OWOA 2L6JA 2C0MA 3IV0A 3LYAA 1Y6IA 3SHFA 4Y6CA 5LX8A 4I43A 3LS8A 2ONDA 4UWFA 4AVXA 2I6HA 1EYHA 1X5BA 4C0MA 1KT0A 1HF8A 2KATA 2CFUA 3GZ2A 3QC1A 4F53A 3MX3A 5FTPA 2VSOE 3WXXA 3OXGA 5T3RA 4BX9A 3ZW3A 3OAWA 2J09A 4UI9K 4ATGA 2WXPA 3PEUB 5A7DB 4F7AA 5HQ8A 2MHKA 3RRNB 2UY1B 3IBEA 3APFA 2Y4UA 2KZTB 3HVEA 3EJNA 2WXFA 5BV1A 4HOTA 2C2LA 2I1JA 1HZ4A 4G24A 3OXFA 1KT1A 4WUYA 5CHEE 3UT4A 4LCTA 2QY7A 4HOUA 1SZ9A 4JPSA 3FTXA 3D9OA 4GYYA 2V0PA 5DIZA 4EECA 2VGXB 3ZYQA 3JQ0A 3ZYLA 5EKQD 4UQYA 3CHPA 3CVQA 4PS8A 3AU4A 5M72A 3KS2A 3MJWA 2HM8A 4OVUA 4RG6A 2XCBA 2XGOA 4UWHA 3SD5A 3FWVA 4JL0A 3FU5A 2RG8A 2V5FA 4A55A 2J4DA 3AS4A 4AXHA 2E0IA 4ANXA 2VTBB 2J4BA 3IKOB 1SQMA 4LEUA 3LY9A 3RRUA 1E8YA 4LERA 2J07A 3FUNA 4I6EA 1UG3A 2CHWA 3D9IA 4YVQC 4J6IA 3Q15A 3ESKA 3BG0B 1DVPA 3ASHA 4GZ6A 4GPKA 2WXMA 3JQ1A 4CDRA 3KAEA 4GMJA 4JC8A 2PM7A 4B89A 4I9EA 4UWKA 1DNPA 3IHYA 4A1SA 3LKUA 3I3NA 3CK7A 2GRLA 1IQUA 2X3MA 3CVPA 2XPIA 4XIFA 5J90A 3FP3A 3S7JA 2BTDA 2Q7FA 4L2YA 4TRQA 3JYSA 5FZQA 3FTZA 1U3DA 4E6HA 1U3CA 4FADA 3VTXA 1E96B 3D3MA 1JPLA 1FCHA 1VDYA 3APDA 3P1UA 2OV8A 2YHCA 4W9RA 4K0RA 2J9QA 3NZSA 1HE8A 4FA6A 1HFAA 4I6GA 2XGMA 3CR3A 3ENEA 3LPZA 4UQZA 4G25A 2M63A 4F1SA 3FY4A 3PDNA 3QOUA 2WXOA 2EQXA 2J08A 2HO1A 3FU3A 1E90A 2XEVA 2WXQA 2AVPA 2VJ8A 4UQXA 5FZSA 1UN9A 2GGFA 4FP7A 4CDNA 2CFZA 4GA0A 4CDMA 3APCA 2LNIA 2GRMA 1LF8A 3L54A 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEK A; 
#chains in the Genus database with same CATH topology
 1HO8 A;  2XEH A;  4HI8 A;  3DPY A;  4ZHB A;  4J8F A;  3FH7 A;  3ZNG A;  1PC2 A;  4L9P A;  1ELW A;  2KBX A;  3CKC A;  4AP2 A;  3ZPJ A;  3ASN E;  3U3W A;  3CVN A;  3HXC A;  3Q7F A;  1TN8 A;  2XPY A;  4LRZ A;  3FUM A;  4CT0 A;  4U96 D;  3G2T A;  5HKP A;  2X6K A;  1S63 A;  4K03 A;  2YQ8 A;  2FI7 A;  2LUH A;  2QC9 A;  2WVI A;  1UJK A;  3CHR A;  5AQ9 A;  4N2S A;  4EBA G;  3TXM A;  4DX6 D;  2DZO A;  4IUL A;  3UQ3 A;  2H6G A;  1N0R A;  1QQE A;  3HDX A;  3LEW A;  4PH4 B;  2FBN A;  3ONL A;  3QNK A;  1ZBP A;  4DX7 D;  5D66 A;  4JEU A;  5EIB E;  4JA7 A;  3F6Q A;  3GW4 A;  4AEZ C;  1JCR A;  1KPS B;  1MZC A;  2J49 A;  1SZA A;  3V30 A;  2EIK E;  3JUI A;  3CQG B;  2X38 A;  1JWG A;  4ANV A;  4BY6 A;  3FHE A;  1QYM A;  1D8E A;  2GRO B;  3L82 A;  3MKR A;  4APF A;  4YDO A;  3D9P A;  3ULE G;  5KJK A;  4BER A;  3FH8 A;  4HLL A;  3DEP A;  4XI0 A;  1PAQ A;  3TG4 A;  3U4T A;  2XHE A;  1XGW A;  3FU0 A;  1NZN A;  4FC8 A;  2Y4T A;  5FZR A;  1TNB A;  2ETA A;  3JCK C;  5AQ7 A;  5FT9 A;  2P9S G;  2X6H A;  4G26 A;  4GCN A;  4X8Q A;  5D0O D;  4HB5 A;  1IHB A;  3AJI A;  1Y8M A;  1INZ A;  3ZN3 A;  4M3O A;  4U63 A;  3ASO E;  4U04 A;  1IYG A;  3IHV A;  2XGS A;  4NRH B;  3DXK G;  1TYQ G;  1K1A A;  3ABM E;  3C3Q A;  4BSZ B;  1JWF A;  3RRM B;  3SFX A;  2P9N G;  5LCW C;  4G23 A;  4DLQ A;  3PVL A;  1N0Q A;  3PRE A;  5BT1 A;  5HRY A;  2H6H A;  2WPV A;  2Y1L E;  3I5P A;  4JZY A;  4XI9 A;  5G05 C;  2R03 A;  4BT9 A;  1MX6 A;  4BET A;  3ML9 A;  3MKQ A;  2V4L A;  5ARG A;  1HS6 A;  3AG4 E;  3L6A A;  2R17 C;  2OOE A;  2AXZ A;  1OY3 D;  2YNQ A;  3ABL E;  5JHB A;  4Q94 A;  1SW6 A;  4N5C A;  4G8K A;  4G8L A;  5FWQ A;  3SNX A;  5BPP A;  3DWL G;  2AXV A;  4DPR A;  1AP7 A;  2R59 A;  2P9K G;  2KCV A;  1KZP A;  4QFV A;  4TV3 A;  4CRW A;  1OWP A;  3QKY A;  2VSX E;  2FO1 E;  4ABN A;  1E8Z A;  5ENS D;  3VTY A;  3AU5 A;  3RAU A;  4F6R D;  5T4Y A;  1NL4 A;  3KD7 A;  5C1D A;  2LXM A;  4GPM A;  4MS6 A;  4KVM A;  1Z3Y A;  3V79 K;  4I2Z A;  3UXG A;  3CGH A;  1KZO A;  5B1B E;  4XE0 A;  2PL2 A;  3UUX A;  2KC7 A;  3UMV A;  3E32 A;  4GZC A;  1IHG A;  1V55 E;  5AAR A;  1W3B A;  1GW6 A;  4YND A;  2FUL A;  3R7R A;  1N4S A;  5FJY A;  4FUL A;  3PUJ A;  5EN5 D;  4DUI A;  1EF1 C;  3SY2 A;  2LAI A;  4J8Y A;  1TNU A;  3DPD A;  4WAF A;  3GZ1 A;  2DYR E;  5EIL A;  1H2U A;  3RO3 A;  4YVO A;  4F1P A;  2AWI A;  3CVW A;  4KBQ A;  3D9H A;  2WB2 A;  1WAO 1;  3FEX A;  4GTS A;  2AJA A;  3RO2 A;  5CCM A;  3DSX A;  4GA2 A;  3JXJ A;  2DBA A;  1MHQ A;  5AQB A;  3O4Z A;  3CHM A;  3HYM B;  2WXJ A;  2IOS A;  3CIA A;  4GML A;  4UUC A;  5JJ6 A;  5KWD A;  3ASD A;  1Z5S C;  2F0Y A;  2PZI A;  4APO A;  3LYA A;  3SHF A;  5LX8 A;  2OND A;  3TWT A;  2BED A;  2KAT A;  3GZ2 A;  2OCC E;  2VSO E;  2UY1 B;  3IBE A;  2KZT B;  2WXF A;  5BV1 A;  5JA4 D;  1D9S A;  5EYL A;  3TWR A;  1LD8 A;  3DXM G;  3FTX A;  4LNB A;  2VGX B;  3JQ0 A;  4UQY A;  3CHP A;  3CVQ A;  3ULY A;  2XS8 A;  4OVU A;  2XCB A;  3SD5 A;  3DSV A;  3EHQ A;  1UG3 A;  1YCS B;  4J6I A;  3Q15 A;  3Q7A A;  3LKU A;  3I3N A;  3CVP A;  4XIF A;  5J90 A;  2BTD A;  4E6H A;  1N4P A;  1E96 B;  1FCH A;  1VDY A;  2NYJ A;  2J9Q A;  3B7B A;  1OCO E;  1HFA A;  1RZ4 A;  4I6G A;  4G25 A;  3QOU A;  5B1A E;  3T9K A;  2EQX A;  1E90 A;  3UIP C;  2WXQ A;  3E34 A;  1UN9 A;  2GGF A;  4CDN A;  2CFZ A;  2LNI A;  5EX3 A;  3ZYM A;  4RLY A;  4J7W A;  4LG6 A;  3FU6 A;  1AWC B;  3QJZ A;  4BWR A;  4TUU A;  3VLD A;  1H0A A;  1ZB1 A;  2RFM A;  3B7S A;  4H7X A;  3TL5 A;  1NFI E;  5KCM A;  5FQ6 A;  1NA0 A;  2AXU A;  3LVQ E;  3SI5 A;  3O48 A;  2BKG A;  4NQ0 A;  1NI1 A;  2WXK A;  3CVX A;  3ZRH A;  1XNF A;  2JEK A;  1FVF A;  1N52 A;  3U9W A;  3SBS A;  5D2M C;  5AJL A;  3DSU A;  2WQH A;  1N54 A;  4AV7 A;  5BXO A;  3FTV A;  4MLP A;  4UI9 J;  1WM5 A;  4I1A A;  3PZ2 A;  3SFZ A;  3Q47 B;  5AYW D;  3KEA A;  4JHJ A;  3UX4 A;  4EHM A;  4HOQ A;  5FQ7 A;  3CHS A;  4IRU A;  3HG0 D;  4O6F A;  2WM9 A;  1E8W A;  2BF0 X;  1TJC A;  2GW1 A;  1SVX A;  4U07 A;  4OYS A;  3ZEF A;  3WG7 E;  3OTN A;  5KBA A;  5E76 A;  2CHZ A;  2Y0B G;  3BU8 A;  4DRX E;  3B7T A;  4NUR A;  3PE4 A;  2OVB A;  1OUV A;  5BNW A;  3Q75 A;  3TWQ A;  4JB8 P;  4JXT A;  2FF4 A;  1FT1 A;  3ULQ A;  3ONK A;  4GCO A;  1UN8 A;  4G1T A;  4UI9 C;  1LD7 A;  4GTT A;  4G2V A;  1OWN A;  5CER B;  2LSV A;  5G04 C;  4AY6 A;  1HG5 A;  1D8D A;  4GTV A;  4NAC A;  4M7C A;  3ABK E;  3MZL B;  2R05 A;  2L9B A;  4HOR A;  4KZ0 A;  4FHJ A;  2H6I A;  4HXI A;  5AQA A;  3FTY A;  3S7D A;  3Q9U C;  4BEP A;  4C9B B;  4L2L A;  4I9C A;  4HRL A;  2F8Y A;  4D10 C;  2LAH A;  3UI2 A;  3HHM A;  4GAA A;  2ETB A;  3UM3 A;  2P9L G;  4BFR A;  3NQP A;  3NF1 A;  3CKB A;  3DST A;  4WND A;  3B7U X;  2CG3 A;  2XRZ A;  4P29 A;  3CVY A;  2IU1 A;  3E33 A;  3QB2 A;  2Y3A A;  4BT8 A;  1P5Q A;  3EIQ C;  3V31 A;  3N71 A;  4AOF A;  1NA3 A;  3RKV A;  4ANU A;  1BU9 A;  2QYU A;  3CSF A;  2WXR A;  3LY8 A;  2DCP A;  2WXG A;  3EDT B;  3ZYK A;  4GZ3 A;  2P58 C;  1G3N B;  4TXP A;  4ILG A;  1HX8 A;  4XKB A;  5LCW J;  3G2W A;  2XCC A;  4KMO A;  4L1B A;  3S7B A;  3J5Q B;  4K5C A;  1HU3 A;  4ILI A;  4U0Z A;  2VGE A;  4JD2 G;  3TXN A;  5G05 J;  4O1O A;  2QYJ A;  4L23 A;  3G2V A;  4U95 D;  5G2N A;  5EYP F;  5LFA A;  1H6K A;  2HR2 A;  3EU9 A;  3UT8 A;  4PUC A;  1OCR E;  5ENN A;  3GZS A;  2DWZ A;  5EDS A;  3KEZ A;  4BTB A;  5ANL A;  4GZD A;  3UT7 A;  3AG1 E;  2ZGG A;  4H7Y A;  5ENT D;  2UY1 A;  2KZT A;  4B0Z A;  2B6C A;  3QK0 A;  4GTQ A;  4J8D A;  4B93 B;  2P9U G;  2LSU A;  4PDX A;  1BLX B;  3AAA C;  3FUE A;  2VGX A;  5FQ4 A;  4G11 A;  4RSY A;  1TJF A;  2L0T B;  3FUI A;  4TUM A;  4ACL A;  4EZL A;  4O1P A;  3ASF A;  2IO3 C;  3PZ3 A;  4CCA A;  3CK9 A;  4JVS A;  1YA0 A;  3IEG A;  3G2S A;  4A3V A;  3UKR G;  3VLE A;  4Q69 A;  3D9J A;  3E30 A;  2C0M A;  1Y6I A;  4Y6C A;  5BXU A;  2I6H A;  1N94 A;  1X5B A;  3NB2 A;  2CFU A;  3QC1 A;  4HBD A;  3HRA A;  5FTP A;  3OXG A;  5T3R A;  3ZW3 A;  4UI9 K;  4ATG A;  2XZT G;  3APF A;  1O1S A;  3DSS A;  3OXF A;  1X81 A;  5CHE E;  3UT4 A;  2P9P G;  1N9A A;  3JXI A;  2RFA A;  4JPS A;  4OAU C;  4GYY A;  4EEC A;  4PS8 A;  3KS2 A;  4RG6 A;  3FWV A;  4JL0 A;  4BES A;  2V5F A;  4A55 A;  2J4D A;  4ANX A;  2J4B A;  2BKK B;  3RRU A;  1E8Y A;  3FUN A;  1MX4 A;  3BG0 B;  4GPK A;  2GRR B;  3JQ1 A;  3NBN B;  3KAE A;  4B89 A;  5AAO A;  2IO2 C;  3IHY A;  5IY5 E;  2X3M A;  1IQU A;  3UIO C;  5CEA A;  4TRQ A;  3JYS A;  1U3D A;  3D3M A;  3NOC D;  4DX1 A;  2OV8 A;  2YHC A;  3CR3 A;  4UQZ A;  4F1S A;  3FY4 A;  3PDN A;  2WXO A;  2J08 A;  4O60 A;  2VJ8 A;  4UQX A;  5FZS A;  1LF8 A;  4A63 B;  2KM4 A;  4V3I A;  5A6C A;  4GTR A;  2WQ7 A;  4LNG A;  1EPU A;  3CVU A;  3UKU G;  3QWV A;  4EZK A;  3UPV A;  1FVH A;  3AS8 A;  4K5A B;  3FUH A;  5C2Y A;  1EDU A;  1MQS A;  3PZD A;  3FEY A;  3B13 A;  2WQ6 A;  4JEH A;  3EU5 A;  4PS7 A;  1SA4 A;  3C98 A;  1S70 B;  4LNU D;  3LY7 A;  5ANR A;  3D9N A;  2DZN A;  4CGW A;  5JJ7 A;  1HXI A;  3AG2 E;  3FDH A;  2P9I G;  5J08 A;  4ACK A;  3VLF A;  4HRN A;  1YMP A;  1UJJ A;  3HIZ A;  2DVW A;  2WMO A;  2ZIR A;  3ZXS A;  3LVR E;  1H2T C;  2F8X K;  4EZJ A;  2XEN A;  4AM9 A;  5BV0 A;  4U0S A;  5AIJ A;  1E8X A;  2VSY A;  1OCZ E;  2C0L A;  4J0U A;  4B94 A;  4GYO A;  4HI9 A;  4F3V A;  1ZU2 A;  3MEK A;  3PS6 A;  2L6B A;  4FJZ A;  2L0I A;  1QZ2 A;  4E85 A;  1LTX A;  5H7P A;  4GMR A;  3TWU A;  2B0O E;  4FLB A;  4A3T A;  2XPZ A;  1U2V G;  5JJT A;  4KT6 B;  2R2L A;  4WNE A;  1TNO A;  3MV2 B;  2OVF A;  4JW1 A;  1TR4 A;  1FT2 A;  3DBS A;  4HQD A;  3C3O A;  4I17 A;  3K9I A;  3ZHE B;  3FTW A;  1TN6 A;  5CRU A;  3SBT B;  2P2C P;  4I1M A;  2IOL A;  1DC2 A;  1O1R A;  1Z6T A;  5EX0 A;  1IQR A;  3S2A A;  4HFG A;  2WXI A;  1B89 A;  3V2O A;  5CEC B;  3FUD A;  4K5B A;  4CT4 A;  4ME2 A;  5CED B;  4GTP A;  4HNA D;  2VQ2 A;  3FUL A;  1TN7 A;  3CVV A;  3D9M A;  1BD8 A;  5T8I A;  2X6J A;  4N5Q A;  2VTB A;  3ML8 A;  1RW2 A;  1ELR A;  3PE3 A;  1OCC E;  3U66 A;  3D9K A;  4N2Q A;  1N11 A;  4N3C A;  5JHA A;  1K8K G;  3J5P A;  5CMY A;  2WXH A;  2QFC A;  3PEV B;  1K1B A;  4FJY A;  3I4R B;  2PNN A;  3C5R A;  3T8K A;  2MRI A;  1HH8 A;  3HXF A;  4GU5 A;  2I2O A;  5G04 J;  2ZGD A;  5ENR D;  4WNF A;  1Z3X A;  4KZC A;  5ENP D;  2LO6 A;  2NSZ A;  2RKK A;  4BSX A;  1H6O A;  3AS5 A;  3FTU A;  4RQI A;  4DX5 D;  2E2E A;  5AJD A;  3SF4 A;  3HXE A;  2V8S E;  2WXN A;  3Q5M A;  3ASG A;  4HOS A;  2H6F A;  4U0U A;  3MCX A;  5CMW A;  5G55 A;  3QWP A;  5DBK A;  3ZKJ A;  5AN8 A;  2A5E A;  2OEW A;  4HOT A;  3L08 A;  2CG2 A;  2ILR A;  3QDN A;  3ZIM A;  2EIL E;  3Q9N C;  4CYM D;  4KYO B;  1O1T A;  2ZIS A;  4DI4 A;  3LJN A;  3UM0 A;  4XZ4 A;  2DIW A;  5HS0 A;  4AY5 A;  3U64 A;  3MYV A;  5KJN A;  2A5U A;  1BI8 B;  4DJA A;  4XKC A;  3PNL B;  4DX2 A;  4LUN U;  2FO7 A;  3DSW A;  4URK A;  4N39 A;  4MKT A;  1HG2 A;  3PZ1 A;  4FHK A;  2JLB A;  3CHQ A;  4GTO A;  1V54 E;  5BUZ A;  5ARF A;  4B8A A;  4RG9 A;  2Y69 E;  3BQO A;  3UIN C;  4WWP A;  4HLE A;  3ZUV B;  3TWV A;  3MGB A;  3EHM A;  4C0E A;  1H19 A;  1ELK A;  3TWX A;  1QBQ A;  2L6J A;  2DYS E;  3LS8 A;  4AVX A;  3JUE A;  1MX2 A;  1KT0 A;  1HF8 A;  4BX9 A;  3OAW A;  2WXP A;  3PEU B;  4F7A A;  5HQ8 A;  3RRN B;  2Y4U A;  3HVE A;  3EJN A;  3BUA A;  3SO8 A;  1HZ4 A;  4G24 A;  1KT1 A;  2GRQ B;  4LCT A;  2QY7 A;  4HOU A;  1SZ9 A;  5DIZ A;  3TWW A;  3ZYQ A;  5EKQ D;  3L9T A;  3AU4 A;  2HM8 A;  2XGO A;  3FU5 A;  2RG8 A;  4TXR A;  2VTB B;  4CZ2 D;  1SQM A;  4LEU A;  3LY9 A;  3NOG D;  4LER A;  1OT8 A;  2J07 A;  4QQI A;  2GRN B;  2XZD G;  1DVP A;  3ASH A;  4GZ6 A;  2J8S D;  2WXM A;  4CDR A;  4GMJ A;  4JC8 A;  4UWK A;  4A1S A;  2IEJ A;  2GRL A;  3FP3 A;  3S7J A;  4L2Y A;  5FZQ A;  4FAD A;  3VTX A;  3Q79 A;  3P1U A;  4W9R A;  3NZS A;  1HE8 A;  3B95 A;  4FA6 A;  3SQV A;  4U8V D;  3ENE A;  3LPZ A;  3UM2 A;  2HO1 A;  3IXE A;  2AVP A;  4GA0 A;  1OXJ A;  3APC A;  3L54 A;  1WDY A;  4HS2 A;  3MA5 A;  3D9L A;  4LSZ E;  2LXL A;  5AEN A;  3EUV A;  3R7Q A;  2PM6 A;  3B7R L;  3Q73 A;  2V5Q C;  3NZU A;  3HXB A;  4A1G A;  3E4B A;  4DLO A;  1TNY A;  3R9A B;  3L16 A;  3FUJ A;  1BI7 B;  3S7F A;  1S64 A;  2X6I A;  4I6J A;  2ZU6 B;  4N3B A;  1H6P A;  1N95 A;  4R7L A;  3L22 A;  2PQR A;  3LJ3 A;  5KJL A;  3W9G A;  3PNT B;  3Q78 A;  5E75 A;  3GYZ A;  4J8E A;  4PS3 A;  1OWM A;  3SGH A;  2JAB A;  3BEE A;  3CK8 A;  3EHR A;  3PH0 C;  5CBN A;  4AJW A;  3ZHE A;  1NP7 A;  4KXK B;  4U7E B;  3LCA A;  3CST A;  3CEQ A;  1WG0 A;  4Q96 A;  1PY1 A;  4TXQ A;  3PUK A;  1KLX A;  2WMN A;  2OEV A;  1E7U A;  4I2W A;  4Y6W A;  4UWG A;  3EHN A;  5LOZ A;  5CCL A;  4ANW A;  4NIK A;  1SA5 A;  4HRM B;  2V4H C;  4BTA A;  4CEM A;  3TGO A;  1JUQ A;  4JHR A;  3MV3 B;  2YHE A;  2XQ0 A;  3CQC B;  2BUG A;  2X6F A;  4N3A A;  3SFY A;  5A23 A;  1UW4 B;  3T8M A;  2VYI A;  3HXD A;  4GYW A;  4XEI G;  4GB9 A;  2VSN A;  2XRY A;  1TEZ A;  1IKN D;  2CHX A;  3UTM A;  4MBG A;  3TJP A;  3HVE B;  5ENQ D;  2IF4 A;  2IFU A;  3G2U A;  3LXU X;  4WNG A;  4WWN A;  4FU3 A;  2RD0 A;  3FH5 A;  1N4Q A;  4IYP A;  1E7V A;  1Q2Z A;  2NC9 A;  1A17 A;  1FPP A;  3TAX A;  4RVB A;  3QAR A;  4YDY A;  4CGV A;  3CV0 A;  2I1K A;  3ZVV A;  3C72 A;  2KCK A;  4WWO A;  2IJG X;  1DCQ A;  4B8C B;  3RJV A;  1JCQ A;  1IXV A;  3Q4A B;  3URZ A;  3CVL A;  4KVO A;  5BW8 C;  3RIB A;  1MJ0 A;  3CLJ A;  3SZ7 A;  3PRZ A;  3KSL A;  4IN3 B;  4BX8 A;  2I9C A;  3QWW A;  5KJM A;  4DK5 A;  3LDZ A;  1DCE A;  3L13 A;  4OVV A;  3CHO A;  2AW6 A;  3Q49 B;  5ENO D;  2YIN A;  2FEZ A;  3R9M A;  4GZ5 A;  1JCS A;  4MRU A;  3X2Q E;  4U8H A;  3EIJ A;  5CRV A;  5FIN A;  5LP0 A;  3RSE G;  3P2B A;  2EIN E;  4GA1 A;  2A4Z A;  4JA9 A;  2VGY A;  1QNF A;  4ATZ D;  2PQN A;  2NXP A;  3FFL A;  3L17 A;  5FQ8 A;  1WY6 A;  4OAV B;  3FUF A;  2HE0 A;  4AIF A;  4L7T A;  3MKQ B;  5HI7 A;  2WXL A;  1BPO A;  1L5J A;  4JHK A;  4EBA A;  4EPZ A;  3ZXP A;  3QAQ A;  2MOW A;  5KNG A;  3T5X A;  3V2X A;  3W9F A;  4DI3 A;  2R5S A;  1MYO A;  2KCL A;  3ZFW A;  4C48 B;  1N4R A;  1TNZ A;  1UOH A;  3DRA A;  2ION A;  3RU0 A;  3FTS A;  2EIM E;  3C3R A;  3FUK A;  4J8S A;  4XX5 A;  3AG3 E;  4ILH B;  2IQC A;  3T5V A;  3ISM C;  3I4G A;  2UWJ G;  4YDW A;  3TG5 A;  4EQF A;  1OWL A;  3ESL A;  3RK6 A;  3BG1 B;  4Z68 A;  2HYZ A;  2QZA A;  5D0Q D;  4HVB A;  4UWL A;  3OXL A;  1S0P A;  4I1O B;  4FLH A;  1H2V C;  3ZGQ A;  1OWO A;  3IV0 A;  2ETC A;  2R02 A;  4I43 A;  3KSQ A;  4UWF A;  1A5E A;  1EYH A;  4C0M A;  4F53 A;  3MX3 A;  3WXX A;  2J09 A;  5A7D B;  5CBO A;  2MHK A;  5EID A;  5B3S E;  2C2L A;  2I1J A;  2F37 A;  4WUY A;  5KNH D;  3PZ4 A;  2ZXW E;  2GRP B;  3D9O A;  2V0P A;  3E37 A;  3ZYL A;  4GTM A;  5M72 A;  3MJW A;  4UWH A;  1K3Z D;  5FIO A;  3AS4 A;  2KXP C;  4AXH A;  2E0I A;  3IKO B;  4I6E A;  2CHW A;  3D9I A;  4YDE A;  4YVQ C;  3ESK A;  4U8Y D;  1O5M A;  2PM7 A;  3TWS A;  4I9E A;  1DNP A;  3CK7 A;  2XPI A;  2IY0 C;  2Q7F A;  3FTZ A;  1U3C A;  1JPL A;  3ZU7 B;  3APD A;  4K0R A;  3UM1 A;  1YYH A;  2XGM A;  2XS1 A;  2M63 A;  2EIJ E;  3FU3 A;  3NAW A;  2XEV A;  4ZFH A;  3DEO A;  4FP7 A;  5JMN D;  2XEE A;  4CDM A;  2GRM A;  2MYO A;  5ITZ F; 
#chains in the Genus database with same CATH homology
 1HO8 A;  3ZYM A;  2KM4 A;  4HS2 A;  4V3I A;  3MA5 A;  5A6C A;  3D9L A;  4J8F A;  5AEN A;  3FU6 A;  2WQ7 A;  3QJZ A;  1EPU A;  4BWR A;  3FH7 A;  3CVU A;  4TUU A;  3QWV A;  3R7Q A;  3VLD A;  1PC2 A;  4EZK A;  1H0A A;  2PM6 A;  1ELW A;  3B7R L;  3UPV A;  1FVH A;  3AS8 A;  3FUH A;  3B7S A;  3NZU A;  3CKC A;  4H7X A;  4AP2 A;  3TL5 A;  4A1G A;  5C2Y A;  3E4B A;  3ZPJ A;  5KCM A;  4DLO A;  1EDU A;  1MQS A;  5FQ6 A;  3PZD A;  1NA0 A;  2AXU A;  3B13 A;  3CVN A;  3FEY A;  3L16 A;  3FUJ A;  3R9A B;  2WQ6 A;  4JEH A;  3LVQ E;  3S7F A;  3SI5 A;  4PS7 A;  2XPY A;  3C98 A;  3O48 A;  4LRZ A;  3FUM A;  3LY7 A;  4NQ0 A;  3D9N A;  5ANR A;  2WXK A;  3CVX A;  2X6I A;  4I6J A;  2ZU6 B;  4CGW A;  3ZRH A;  1XNF A;  4N3B A;  5JJ7 A;  1HXI A;  2JEK A;  4R7L A;  3L22 A;  2PQR A;  3FDH A;  1FVF A;  1N52 A;  3LJ3 A;  3G2T A;  3U9W A;  4CT0 A;  2X6K A;  3SBS A;  3VLF A;  4ACK A;  5J08 A;  5KJL A;  3PNT B;  5AJL A;  5E75 A;  3GYZ A;  1UJJ A;  4J8E A;  4K03 A;  3HIZ A;  4PS3 A;  1OWM A;  3SGH A;  2WMO A;  2WQH A;  2YQ8 A;  2FI7 A;  3BEE A;  1N54 A;  3CK8 A;  4AV7 A;  2WVI A;  3PH0 C;  4AJW A;  1UJK A;  3CHR A;  3FTV A;  3ZHE A;  4MLP A;  3ZXS A;  4N2S A;  4EBA G;  3TXM A;  4UI9 J;  1NP7 A;  4KXK B;  1WM5 A;  3LCA A;  3LVR E;  4I1A A;  4IUL A;  3UQ3 A;  1QQE A;  3CST A;  3SFZ A;  3Q47 B;  5AYW D;  1H2T C;  3CEQ A;  3HDX A;  4EZJ A;  4AM9 A;  5BV0 A;  3LEW A;  4PH4 B;  4Q96 A;  1PY1 A;  2FBN A;  4U0S A;  5AIJ A;  1E8X A;  3ONL A;  3QNK A;  4JHJ A;  3UX4 A;  1ZBP A;  2VSY A;  4HOQ A;  2C0L A;  4J0U A;  5FQ7 A;  4B94 A;  4JEU A;  3CHS A;  4GYO A;  4IRU A;  4JA7 A;  4O6F A;  2WM9 A;  1E8W A;  3PUK A;  4F3V A;  3GW4 A;  2BF0 X;  1KLX A;  1ZU2 A;  4AEZ C;  1TJC A;  2WMN A;  2GW1 A;  2J49 A;  1SZA A;  1E7U A;  4I2W A;  3JUI A;  3MEK A;  4OYS A;  4U07 A;  3CQG B;  3EHN A;  2X38 A;  3PS6 A;  4UWG A;  4Y6W A;  5LOZ A;  3ZEF A;  3OTN A;  5CCL A;  4ANW A;  1JWG A;  4ANV A;  4BY6 A;  4FJZ A;  3FHE A;  2L0I A;  5E76 A;  2CHZ A;  1QZ2 A;  4E85 A;  3B7T A;  4NUR A;  3PE4 A;  4BTA A;  3MKR A;  2OVB A;  4APF A;  4CEM A;  3D9P A;  1OUV A;  5BNW A;  3TGO A;  1JUQ A;  4JHR A;  4FLB A;  3MV3 B;  2YHE A;  4JXT A;  4A3T A;  2XQ0 A;  2XPZ A;  5KJK A;  2FF4 A;  3CQC B;  2X6F A;  2BUG A;  4N3A A;  5A23 A;  1UW4 B;  3T8M A;  5JJT A;  2VYI A;  3FH8 A;  4KT6 B;  4WNE A;  4GYW A;  4XI0 A;  3ULQ A;  1PAQ A;  3ONK A;  4GCO A;  3TG4 A;  1UN8 A;  4G1T A;  3MV2 B;  2VSN A;  2XRY A;  4GB9 A;  2OVF A;  4JW1 A;  4UI9 C;  3U4T A;  2XHE A;  1XGW A;  3FU0 A;  1TEZ A;  1NZN A;  3DBS A;  2CHX A;  4FC8 A;  4G2V A;  2Y4T A;  1OWN A;  5FZR A;  2LSV A;  3TJP A;  3HVE B;  5G04 C;  4AY6 A;  3JCK C;  1HG5 A;  4I17 A;  3K9I A;  3ZHE B;  3FTW A;  5FT9 A;  4NAC A;  2X6H A;  4G26 A;  2IF4 A;  4GCN A;  2IFU A;  3G2U A;  3MZL B;  3SBT B;  4HOR A;  2L9B A;  3LXU X;  4KZ0 A;  4FHJ A;  5D0O D;  4WNG A;  4I1M A;  2IOL A;  4WWN A;  4HXI A;  1Y8M A;  1INZ A;  1Z6T A;  3ZN3 A;  4M3O A;  4U63 A;  4FU3 A;  5EX0 A;  1IQR A;  3FTY A;  4U04 A;  1IYG A;  3S2A A;  3IHV A;  2RD0 A;  2XGS A;  2WXI A;  3FH5 A;  4HFG A;  3S7D A;  1B89 A;  4NRH B;  4IYP A;  4C9B B;  3FUD A;  4L2L A;  4CT4 A;  4I9C A;  1JWF A;  4ME2 A;  3RRM B;  5LCW C;  2VQ2 A;  1E7V A;  4G23 A;  4DLQ A;  3FUL A;  3CVV A;  3PVL A;  3D9M A;  4D10 C;  2NC9 A;  5T8I A;  2LAH A;  1A17 A;  3HHM A;  3PRE A;  5BT1 A;  2X6J A;  4GAA A;  3TAX A;  2VTB A;  4RVB A;  2WPV A;  4BFR A;  3ML8 A;  3NQP A;  3QAR A;  3I5P A;  4JZY A;  4XI9 A;  5G05 C;  3NF1 A;  4CGV A;  3CV0 A;  4BT9 A;  3CKB A;  1ELR A;  3PE3 A;  2I1K A;  3U66 A;  3ML9 A;  3D9K A;  3B7U X;  4WND A;  3MKQ A;  4N2Q A;  5JHA A;  2V4L A;  4N3C A;  2CG3 A;  5ARG A;  1HS6 A;  3ZVV A;  2XRZ A;  2KCK A;  4P29 A;  4WWO A;  2IJG X;  5CMY A;  3CVY A;  2WXH A;  4B8C B;  3L6A A;  2R17 C;  3RJV A;  2QFC A;  3PEV B;  3Q4A B;  4FJY A;  3I4R B;  3URZ A;  2OOE A;  2AXZ A;  2IU1 A;  3CVL A;  2YNQ A;  3QB2 A;  4KVO A;  2Y3A A;  5BW8 C;  5JHB A;  3RIB A;  2MRI A;  1HH8 A;  4GU5 A;  4BT8 A;  3CLJ A;  4Q94 A;  3SZ7 A;  1P5Q A;  3PRZ A;  2I2O A;  5G04 J;  4IN3 B;  3EIQ C;  3N71 A;  4AOF A;  1NA3 A;  4N5C A;  3RKV A;  4BX8 A;  4ANU A;  4WNF A;  1Z3X A;  4KZC A;  2LO6 A;  2I9C A;  5FWQ A;  3CSF A;  3QWW A;  2WXR A;  4DK5 A;  5KJM A;  2NSZ A;  3LDZ A;  3SNX A;  4BSX A;  3LY8 A;  2DCP A;  3L13 A;  5BPP A;  2WXG A;  3AS5 A;  3EDT B;  4OVV A;  3CHO A;  2AXV A;  3FTU A;  4DPR A;  2AW6 A;  3Q49 B;  3ZYK A;  2R59 A;  4GZ3 A;  2E2E A;  2KCV A;  2YIN A;  2FEZ A;  4QFV A;  4TV3 A;  2P58 C;  4GZ5 A;  5AJD A;  4CRW A;  3SF4 A;  4MRU A;  1OWP A;  4U8H A;  3QKY A;  2V8S E;  2VSX E;  3EIJ A;  4ILG A;  1HX8 A;  4XKB A;  2WXN A;  5LCW J;  3G2W A;  2XCC A;  3Q5M A;  4KMO A;  4L1B A;  1E8Z A;  3S7B A;  4ABN A;  5LP0 A;  3ASG A;  4HOS A;  1HU3 A;  3P2B A;  4GA1 A;  4ILI A;  2A4Z A;  4JA9 A;  2VGY A;  3VTY A;  4U0Z A;  4U0U A;  1QNF A;  2PQN A;  3AU5 A;  2NXP A;  3MCX A;  3TXN A;  3FFL A;  3L17 A;  3QWP A;  5FQ8 A;  1WY6 A;  5G05 J;  3FUF A;  5DBK A;  5G55 A;  5T4Y A;  5CMW A;  4AIF A;  4L23 A;  3G2V A;  3KD7 A;  4L7T A;  5C1D A;  3MKQ B;  5HI7 A;  5G2N A;  4MS6 A;  5LFA A;  1H6K A;  2WXL A;  2HR2 A;  1BPO A;  1L5J A;  1Z3Y A;  4JHK A;  4KVM A;  3UT8 A;  4PUC A;  4I2Z A;  4EBA A;  3L08 A;  3CGH A;  5ENN A;  4EPZ A;  4XE0 A;  2PL2 A;  2CG2 A;  3UUX A;  2KC7 A;  2ILR A;  3GZS A;  3QDN A;  3QAQ A;  2MOW A;  3KEZ A;  3UMV A;  4BTB A;  5EDS A;  4GZC A;  3U3W A;  1IHG A;  5ANL A;  4GZD A;  1W3B A;  3T5X A;  3UT7 A;  3ZIM A;  1GW6 A;  4YND A;  2FUL A;  4KYO B;  4DI3 A;  3R7R A;  4H7Y A;  2UY1 A;  4DI4 A;  2R5S A;  5FJY A;  2KZT A;  4FUL A;  2KCL A;  4XZ4 A;  3PUJ A;  3ZFW A;  2DIW A;  4B0Z A;  4AY5 A;  3U64 A;  3QK0 A;  3MYV A;  5KJN A;  1EF1 C;  4J8D A;  2A5U A;  2LAI A;  4DJA A;  2ION A;  3FTS A;  4XKC A;  3FUK A;  3DPD A;  4J8S A;  3PNL B;  3GZ1 A;  4WAF A;  4XX5 A;  3RU0 A;  2LSU A;  4PDX A;  1H2U A;  4LUN U;  3RO3 A;  4YVO A;  2AWI A;  2FO7 A;  4ILH B;  4KBQ A;  3CVW A;  2IQC A;  2WB2 A;  1WAO 1;  4URK A;  4N39 A;  4MKT A;  3FUE A;  3T5V A;  2VGX A;  5FQ4 A;  1HG2 A;  4FHK A;  2JLB A;  4G11 A;  3FEX A;  3I4G A;  1TJF A;  3CHQ A;  2L0T B;  4RSY A;  2UWJ G;  3FUI A;  3RO2 A;  5BUZ A;  5CCM A;  4GA2 A;  3TG5 A;  5ARF A;  2DBA A;  4ACL A;  4EQF A;  1OWL A;  3ESL A;  4EZL A;  4B8A A;  4RG9 A;  1MHQ A;  3RK6 A;  4WWP A;  4HLE A;  3ASF A;  3BG1 B;  3CHM A;  3O4Z A;  2HYZ A;  3HYM B;  5D0Q D;  2WXJ A;  4HVB A;  2IOS A;  3CIA A;  4UWL A;  3OXL A;  4GML A;  4CCA A;  1S0P A;  3MGB A;  3CK9 A;  4JVS A;  1YA0 A;  4FLH A;  4I1O B;  3EHM A;  1H2V C;  3IEG A;  3ZGQ A;  4C0E A;  5JJ6 A;  3G2S A;  3ASD A;  1H19 A;  4A3V A;  1ELK A;  2PZI A;  3VLE A;  4APO A;  4Q69 A;  3D9J A;  1OWO A;  2L6J A;  2C0M A;  3IV0 A;  3LYA A;  1Y6I A;  3SHF A;  4Y6C A;  5LX8 A;  4I43 A;  3LS8 A;  2OND A;  4UWF A;  4AVX A;  2I6H A;  1EYH A;  1X5B A;  4C0M A;  1KT0 A;  1HF8 A;  2KAT A;  2CFU A;  3GZ2 A;  3QC1 A;  4F53 A;  3MX3 A;  5FTP A;  2VSO E;  3WXX A;  3OXG A;  5T3R A;  4BX9 A;  3ZW3 A;  3OAW A;  2J09 A;  4UI9 K;  4ATG A;  2WXP A;  3PEU B;  5A7D B;  4F7A A;  5HQ8 A;  2MHK A;  3RRN B;  2UY1 B;  3IBE A;  3APF A;  2Y4U A;  2KZT B;  3HVE A;  3EJN A;  2WXF A;  5BV1 A;  4HOT A;  2C2L A;  2I1J A;  1HZ4 A;  4G24 A;  3OXF A;  1KT1 A;  4WUY A;  5CHE E;  3UT4 A;  4LCT A;  2QY7 A;  4HOU A;  1SZ9 A;  4JPS A;  3FTX A;  3D9O A;  4GYY A;  2V0P A;  5DIZ A;  4EEC A;  2VGX B;  3ZYQ A;  3JQ0 A;  3ZYL A;  5EKQ D;  4UQY A;  3CHP A;  3CVQ A;  4PS8 A;  3AU4 A;  5M72 A;  3KS2 A;  3MJW A;  2HM8 A;  4OVU A;  4RG6 A;  2XCB A;  2XGO A;  4UWH A;  3SD5 A;  3FWV A;  4JL0 A;  3FU5 A;  2RG8 A;  2V5F A;  4A55 A;  2J4D A;  3AS4 A;  4AXH A;  2E0I A;  4ANX A;  2VTB B;  2J4B A;  3IKO B;  1SQM A;  4LEU A;  3LY9 A;  3RRU A;  1E8Y A;  4LER A;  2J07 A;  3FUN A;  4I6E A;  1UG3 A;  2CHW A;  3D9I A;  4YVQ C;  4J6I A;  3Q15 A;  3ESK A;  3BG0 B;  1DVP A;  3ASH A;  4GZ6 A;  4GPK A;  2WXM A;  3JQ1 A;  4CDR A;  3KAE A;  4GMJ A;  4JC8 A;  2PM7 A;  4B89 A;  4I9E A;  4UWK A;  1DNP A;  3IHY A;  4A1S A;  3LKU A;  3I3N A;  3CK7 A;  2GRL A;  1IQU A;  2X3M A;  3CVP A;  2XPI A;  4XIF A;  5J90 A;  3FP3 A;  3S7J A;  2BTD A;  2Q7F A;  4L2Y A;  4TRQ A;  3JYS A;  5FZQ A;  3FTZ A;  1U3D A;  4E6H A;  1U3C A;  4FAD A;  3VTX A;  1E96 B;  3D3M A;  1JPL A;  1FCH A;  1VDY A;  3APD A;  3P1U A;  2OV8 A;  2YHC A;  4W9R A;  4K0R A;  2J9Q A;  3NZS A;  1HE8 A;  4FA6 A;  1HFA A;  4I6G A;  2XGM A;  3CR3 A;  3ENE A;  3LPZ A;  4UQZ A;  4G25 A;  2M63 A;  4F1S A;  3FY4 A;  3PDN A;  3QOU A;  2WXO A;  2EQX A;  2J08 A;  2HO1 A;  3FU3 A;  1E90 A;  2XEV A;  2WXQ A;  2AVP A;  2VJ8 A;  4UQX A;  5FZS A;  1UN9 A;  2GGF A;  4FP7 A;  4CDN A;  2CFZ A;  4GA0 A;  4CDM A;  3APC A;  2LNI A;  2GRM A;  1LF8 A;  3L54 A;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...