3ASFA

Mama msr-1 c2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
174
structure length
174
Chain Sequence
DIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Protein binding
molecule keywords Magnetosome protein MamA
total genus 66
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asfA01
2XPIA 5A7DB 5DIZA 3CK9A 4G26A 1WM5A 3KD7A 3QOUA 4GPKA 2IF4A 4BWRA 4CGWA 1NZNA 3QWWA 4KXKB 2L6JA 4BT9A 2XGSA 3OXLA 4YVQC 3AS5A 3E4BA 4O6FA 3K9IA 3RU0A 1PC2A 1ELWA 2VSNA 4KYOB 4HORA 4ME2A 4AIFA 3EDTB 4BTBA 5CCMA 2YQ8A 3LYAA 4G2VA 4B94A 2Q7FA 5KJNA 2OOEA 3PE3A 3KAEA 4H7YA 4I17A 4RG9A 4GYYA 4WNFA 5G04J 2Y4UA 2UY1B 3UQ3A 4J8FA 3KS2A 4HOTA 4AY6A 2FI7A 4YVOA 4APOA 5CHEE 3ZHEB 4H7XA 3CVLA 3Q15A 3VTYA 1FCHA 3CVNA 4EQFA 1E96B 5EX3A 2KATA 3R9AB 4BT8A 2WPVA 2KC7A 3MEKA 4N2QA 2XCBA 2PQNA 4LEUA 4G24A 3LKUA 4BTAA 4AM9A 1KLXA 3JYSA 3MV2B 4Y6WA 1HXIA 4Y6CA 4GA1A 4GYOA 4GZ5A 3U3WA 4IN3B 3WXXA 3CKCA 4G1TA 4RG6A 2KCVA 3TG4A 4WNGA 3CK7A 3LPZA 2LNIA 3ZGQA 5JJ7A 2VGXA 4HOSA 4UI9J 1HZ4A 4XI0A 5HI7A 3CVPA 2QFCA 2YHCA 3O48A 5M72A 2UY1A 2FO7A 3MKRA 3QWPA 4NRHB 3OXGA 2WQHA 5FT9A 3URZA 5KJLA 4GCNA 3S7FA 2HO1A 1KT0A 3TG5A 1HH8A 3LY9A 3LY8A 5BNWA 3ZPJA 3CVQA 3GZ1A 4GCOA 1QZ2A 2VSYA 3OXFA 4N3BA 4U07A 4WNDA 4WNEA 5EKQD 4F3VA 2FEZA 4N3CA 1NA0A 3CK8A 3FWVA 4ABNA 2DBAA 3U4TA 2XGMA 4KBQA 3RO3A 2C0LA 3N71A 3SZ7A 4CGVA 4N39A 3TAXA 3NF1A 4J0UA 5ARFA 1NA3A 4G25A 4I1AA 2I6HA 2JLBA 3LY7A 3CKBA 3Q5MA 4J8DA 4U0SA 3ZFWA 1Y8MA 2BUGA 2HR2A 4AY5A 4GZ6A 1B89A 2GW1A 5D0OD 2UWJG 2C0MA 4I2WA 3ZN3A 1IYGA 4A1SA 4G23A 5AYWD 1ZBPA 3MA5A 4GA0A 4I9CA 4XI9A 5JJ6A 2KCKA 3IEGA 3RO2A 3Q4AB 5A6CA 5BT1A 5ARGA 2E2EA 4UQZA 3RIBA 1TJCA 2VYIA 3AS4A 3PE4A 4JHRA 4I2ZA 1ELRA 4N2SA 2VQ2A 3PDNA 1ZU2A 2HYZA 2ONDA 5D0QD 5C1DA 3QWVA 2V5FA 2C2LA 4U0UA 2VGXB 4GZ3A 4WUYA 1XNFA 3HYMB 2AVPA 2LSVA 2MHKA 5FZSA 3ASGA 3TGOA 1QQEA 5FZRA 5G05J 3QKYA 1A17A 1P5QA 2XGOA 4GYWA 4NQ0A 2XEVA 4UQXA 2LSUA 4JA9A 2NC9A 2J9QA 3RKVA 5FJYA 3QDNA 3AS8A 3GYZA 2XCCA 4JL0A 2IFUA 4U0ZA 4J8EA 2PL2A 4U04A 1OUVA 4JA7A 3UUXA 3FFLA 3GW4A 4UQYA 3MV3B 5G05C 3RJVA 3ESKA 3GZ2A 1KT1A 4N5CA 3LCAA 4XIFA 3UPVA 4N3AA 3ZHEA 3Q49B 4W9RA 5KJKA 2PQRA 5FTPA 5LCWJ 3SF4A 1WAO1 1IHGA 2KCLA 2P58C 2PZIA 4I9EA 3ULQA 2FBNA 4GA2A 5DBKA 2R5SA 3ASDA 1W3BA 5G04C 2FF4A 4CDRA 5LCWC 4YNDA 3FP3A 4HOQA 4UI9C 3S7DA 5KJMA 2VGYA 5FZQA 3CEQA 4HOUA 5BW8C 3S7BA 3VTXA 2Y4TA 3Q47B 3CV0A 5CCLA 5HQ8A 5JJTA 1YA0A 3ASHA 3S7JA 3BEEA 4UI9K 3ASFA 5EX0A
chains in the Genus database with same CATH superfamily
3QAQA 2AXZA 3E32A 2I1JA 2XS8A 3PRZA 3UT7A 4Q96A 1OCRE 4RVBA 4G2VA 4B94A 5EIBE 5KJNA 1UW4B 3UQ3A 2J08A 1SA4A 3DWLG 3V79K 1AWCB 4K5CA 4KVOA 2VTBA 3NQPA 4UI9J 4XI0A 3D9OA 3P2BA 4LG6A 3U66A 2RFAA 3FU5A 3FUFA 3VLDA 2LUHA 2I1KA 2Y69E 3UIPC 4BX8A 3LY7A 3SHFA 3NBNB 3DXMG 2WXPA 1JUQA 1HS6A 1OXJA 3NB2A 5AYWD 1UN8A 1HG5A 4U0UA 3UIOC 2L0TB 2BEDA 4GPMA 1P5QA 4JEUA 1QNFA 5JMND 2PL2A 4U04A 3WG7E 2WQ6A 5C2YA 3FTUA 3GW4A 4GTTA 4BERA 3DSVA 5H7PA 4WWPA 5CMWA 2EIJE 4A3VA 1TNUA 5CERB 1KZPA 3QB2A 3TXMA 2RG8A 3CK9A 3B7SA 3W9FA 5BV0A 3IKOB 4U95D 4LERA 2KZTB 4ACLA 4EZJA 1OWNA 3NOGD 4CDMA 2UY1B 1TNYA 3DBSA 1TNOA 2NSZA 3CVUA 1MX2A 4GU5A 1INZA 4HOSA 3LPZA 4F53A 5M72A 2YHCA 4DRXE 2Y3AA 4XZ4A 2F8YA 3EU9A 2DBAA 1H6PA 3ZEFA 3UKRG 2VSOE 1IXVA 1B89A 3ZN3A 4DK5A 4G23A 2VYIA 4FLHA 1VDYA 2VTBB 4L2LA 4DLQA 3CHOA 1HF8A 4EZLA 5CRVA 4OAVB 3D9HA 3FFLA 3G2TA 3TJPA 3GZ2A 1S0PA 1S70B 1K1BA 1OWLA 5AARA 1K1AA 2KCLA 2KZTA 2P58C 4WWNA 4LNGA 4GA2A 2XPZA 2WM9A 2KXPC 1YCSB 4AJWA 4GTPA 5BW8C 4A55A 3PZ2A 5ENPD 4GPKA 4B89A 5CBNA 3L08A 3ZXSA 2V4LA 2P9SG 1LD8A 4ILHB 5CBOA 4YDYA 3CHRA 1XGWA 4I1MA 1EF1C 5B1BE 5LOZA 2X6KA 2V0PA 3MZLB 2ZGDA 3ZHEB 1YYHA 2KATA 4BT8A 3SNXA 3FY4A 4J6IA 4N5QA 3CKCA 4GTOA 1X5BA 2DCPA 3OXGA 4HI9A 4L23A 2CG3A 4C48B 2EINE 3QNKA 1H2UA 3TAXA 3NF1A 2IJGX 2EILE 5ARFA 2DZOA 3MKQA 4JB8P 3Q73A 5KBAA 3T5VA 4GZ6A 4FJZA 5BUZA 4G8KA 1JCSA 1N95A 2X6FA 4GA0A 3Q4AB 1MX4A 2L0IA 3L13A 1MX6A 3ASGA 4FHKA 5BPPA 1GW6A 3HDXA 2X6HA 4BX9A 4EECA 3RKVA 5FJYA 3CVXA 3UX4A 4GTVA 3FUNA 2PQRA 1O1RA 4HXIA 4I9EA 4FLBA 4ILGA 4URKA 3B7UX 3PUKA 3NZUA 4HLLA 3S7JA 3MX3A 1MYOA 1WM5A 4I43A 1NZNA 1TYQG 4KXKB 3J5QB 2VJ8A 4I17A 1H6KA 3VTYA 3UM2A 1OY3D 3R9AB 4FA6A 1YMPA 4N2QA 3MV2B 4U8HA 3L22A 4HQDA 2X6IA 4RG6A 3OTNA 3TG4A 1HZ4A 3DSTA 4HB5A 1SVXA 1MHQA 4GCNA 4Q94A 3LY9A 3CVQA 4PS7A 4WNDA 4TRQA 1NA0A 4KVMA 4GB9A 4G25A 2I6HA 4CT0A 4AY5A 2DYSE 3UM1A 4LCTA 5BT1A 4E6HA 2B6CA 2QZAA 5C1DA 3CSFA 2AVPA 5FZSA 2IQCA 1OCZE 5FZRA 5G05J 4JHKA 1D8DA 1O1SA 2NC9A 5LX8A 3ZYMA 5LP0A 4J8EA 3ZVVA 3UUXA 3HG0D 3JCKC 1L5JA 4N3AA 3ZHEA 4C0EA 2FBNA 1DCEA 4UI9C 3F6QA 3T8MA 1NP7A 5CCLA 3BEEA 1OWMA 2WVIA 3E4BA 3ULYA 4HORA 2QYJA 3C3OA 1EYHA 5CCMA 2XEEA 4EPZA 4MBGA 4UWKA 4XKCA 2GGFA 5B3SE 2ETBA 2BKKB 5EX3A 1H2VC 3C72A 4KMOA 3DSWA 2P9PG 4GYOA 2LXMA 3WXXA 4GMJA 3HXFA 4G1TA 5KNHD 3HXEA 3SGHA 1FVHA 5EN5D 2UY1A 2X6JA 4KZ0A 4O1PA 4FU3A 2KBXA 3PZ3A 1TNZA 3FWVA 3ESLA 1E7UA 2ZISA 3PZ1A 4HNAD 4AOFA 4ACKA 3EUVA 4UWHA 4JD2G 1ZBPA 1WDYA 2XENA 3IEGA 3RO2A 3BU8A 1DVPA 4AP2A 3PDNA 3ZYQA 3ONLA 2XQ0A 4O1OA 2WXJA 1A5EA 3FEXA 4HRLA 4UWLA 2J9QA 2FO1E 1RZ4A 3FUKA 5BXOA 1LTXA 5AQ7A 3V31A 4N5CA 2CG2A 3CLJA 1IHGA 5DBKA 4A3TA 4OAUC 3T9KA 3ZU7B 1Q2ZA 3QK0A 4HOUA 4L1BA 2R2LA 2XZTG 3PZDA 1N0RA 3Q47B 3FULA 3ASHA 2XRYA 4BY6A 4G26A 3QOUA 4M7CA 3KEZA 5KCMA 4HBDA 3IBEA 3ZRHA 4M3OA 5EILA 2J4BA 4D10C 3TWWA 2MRIA 3PE3A 4CZ2D 4EBAG 3B13A 4YVOA 3FUEA 3EIQC 4H7XA 4BESA 1E96B 4DI4A 3MYVA 4G24A 2JEKA 2WXIA 5HI7A 3TL5A 2LXLA 4UWFA 3Q79A 4C0MA 3N71A 4U0SA 3ZW3A 3PNTB 3LVQE 1Z3YA 3PREA 5J08A 4DPRA 2H6GA 5LFAA 3B7BA 5AENA 3Q75A 1U3DA 1OWOA 4N2SA 1TR4A 3IV0A 3TWTA 4QQIA 3ML8A 1JPLA 1QQEA 3QKYA 1TN6A 3CHPA 4DX6D 4U0ZA 3L9TA 3GZSA 5CECB 4GTSA 3APDA 5EYPF 2V5QC 2FF4A 3U64A 5E76A 2IY0C 3CEQA 4K5AB 1N4SA 3S7BA 2Y4TA 5HQ8A 1KPSB 5AJDA 4B93B 5T4YA 4FP7A 3C3QA 3PNLB 3AG3E 2XGSA 2AW6A 4CDNA 1BLXB 3RU0A 4I6GA 1ELWA 1AP7A 4TUMA 2YQ8A 4A63B 5G55A 5D2MC 2XS1A 1N9AA 1S63A 1TJFA 2J8SD 2DYRE 3C3RA 4GTQA 4GA1A 1DNPA 3D9JA 2IONA 4F6RD 3FUIA 4XKBA 3AG1E 3S7FA 4CCAA 3FHEA 3GZ1A 3OXFA 2CHWA 2FEZA 4N3CA 2QY7A 3JUEA 3U4TA 2XGMA 4ATZD 1OCCE 3ZXPA 2L9BA 1HO8A 2C0MA 5JJ6A 5CEAA 2X3MA 4JHJA 2E2EA 4CEMA 5ENNA 2C2LA 1E8YA 3TGOA 4GYWA 2XGOA 5KNGA 3SFZA 3SBSA 3FUJA 2F0YA 4GMRA 3V30A 3AAAC 1OUVA 3JQ1A 4U7EB 1IHBA 3I3NA 4CYMD 3SBTB 3TWQA 4NACA 4Z68A 3ML9A 1HU3A 1N4QA 1G3NB 3UM3A 4JZYA 4XX5A 2GRQB 2MYOA 4RQIA 4KYOB 3DEPA 4ANXA 5AJLA 3LYAA 2Y4UA 4J8FA 2FI7A 5CHEE 3CVNA 4EQFA 3ZYKA 1IKND 2PM6A 2PQNA 5FWQA 3C98A 2P9NG 2I2OA 2KCVA 3CQGB 2KM4A 1UN9A 3FTYA 3MKRA 5HRYA 5KJLA 2E0IA 1IQRA 5BNWA 2WXQA 2ILRA 4ABNA 4JW1A 3SFYA 3APCA 4RSYA 1D9SA 3PH0C 4DJAA 3L82A 3MGBA 4EHMA 3DSSA 3I5PA 4AEZC 3ABLE 2DIWA 4WAFA 4HI8A 4I9CA 3FUHA 3PE4A 4I2ZA 4GTMA 2CHXA 3J5PA 2MOWA 1O5MA 2PM7A 3BG0B 4GZ3A 3B7RL 3FTVA 2F37A 3FTWA 3FH5A 4NQ0A 4G8LA 3P1UA 3EHRA 2IFUA 3EU5A 3AJIA 3IXEA 3QJZA 3MV3B 2ETAA 3UPVA 4IYPA 2PZIA 5AAOA 4TXQA 3AU5A 2P2CP 1E8ZA 3R7RA 2GRLA 2VGEA 3DSUA 4UI9K 3EHQA 2XEHA 2WMOA 1FT2A 4HS2A 1H2TC 2IO2C 3SD5A 4A1GA 5FQ4A 4AY6A 3L17A 2H6IA 3MKQB 1H0AA 2WXNA 3E30A 3RRMB 1BI7B 2XCBA 4OVVA 3UM0A 1OT8A 4B8AA 1H19A 3DSXA 2ZGGA 1BD8A 3CK7A 2LNIA 3ZGQA 4U63A 2P9KG 4EBAA 1K8KG 3CK8A 4KBQA 3RO3A 3I4GA 1D8EA 4UUCA 3ZFWA 3L54A 1N4RA 2GW1A 1V55E 3Q9UC 3ABME 3VLEA 5ARGA 4RLYA 2R02A 4OYSA 4U96D 1ZU2A 5AQ9A 4TV3A 4BETA 3TWRA 3CVWA 2X38A 4UQXA 3CVVA 3S2AA 2XCCA 3MJWA 5G05C 1IQUA 3ESKA 3SY2A 3C5RA 3LJNA 3PZ4A 3KSLA 3ZIMA 3FU3A 3L16A 4GZCA 2ZXWE 4AM9A 4BWRA 2WB2A 3FTZA 3LJ3A 3OXLA 2OEVA 5ANRA 3DPYA 4BTBA 3Q78A 5HKPA 2Q7FA 1S64A 2GROB 4K03A 3FUDA 3KS2A 3Q15A 2WPVA 3MEKA 4MKTA 4LEUA 1E90A 4LRZA 5D66A 4B8CB 3UXGA 4LNBA 2L6BA 2VGXA 2FO7A 3QWPA 1FVFA 2AJAA 5FQ8A 1SA5A 4PDXA 3RK6A 3E33A 2C0LA 3SZ7A 5ENRD 3CKBA 1SZAA 3D9LA 4JEHA 4A1SA 2A5EA 4X8QA 3L6AA 4L9PA 2XHEA 1TN7A 5D0QD 1ZB1A 5JHBA 2QC9A 4I6JA 4WUYA 2XRZA 1LD7A 4GTRA 3RRUA 3CVYA 2GRRB 2OVBA 1V54E 3RSEG 5G04C 1NFIE 4DLOA 3FTXA 4UWGA 2RFMA 1N11A 2XPIA 3B7TA 2IF4A 4DX5D 3ISMC 2HM8A 3QC1A 4DX1A 2WQ7A 2WXOA 4HOTA 1BI8B 2EIME 3CVLA 4OVUA 4APFA 4BSXA 1HFAA 1KLXA 1JWGA 4Y6CA 4J8SA 3NAWA 2AWIA 5T3RA 2VSXE 2DVWA 4TXRA 2ETCA 4NRHB 4G11A 2WQHA 3UINC 1HX8A 3ZPJA 1QZ2A 2VSYA 5CEDB 4TUUA 4CGVA 1UOHA 2BF0X 2OEWA 3R7QA 3SFXA 2WXFA 2M63A 5E75A 2GRNB 4I2WA 4XI9A 2B0OE 3AS4A 4FHJA 2YHEA 1ELRA 2ONDA 2V5FA 2LSVA 3FUMA 3NOCD 1OWPA 3G2SA 3CQCB 3AS8A 3GYZA 2IEJA 1HE8A 3LCAA 3D9MA 5FQ7A 3UKUG 1JCRA 3RRNB 2J07A 4EZKA 3FP3A 3AG2E 3VLFA 5EX0A 2HE0A 2YINA 4ANWA 3ULEG 1DC2A 2J4DA 2AXUA 4BT9A 4NIKA 2OCCE 4AIFA 4PS8A 2I9CA 5G04J 4RG9A 4O60A 3CHMA 3E34A 5JA4D 3LEWA 3APFA 4JPSA 2DWZA 5KWDA 3D9KA 4HRMB 4IN3B 2QFCA 5A23A 2A4ZA 3PUJA 1SW6A 4F3VA 1U2VG 3CHSA 5JHAA 2DZNA 5FIOA 4NURA 4ANUA 1IYGA 2CHZA 3HXBA 4CT4A 4YDEA 4KZCA 3IHVA 1PY1A 1JWFA 4K5BA 2IO3C 5IY5E 1RW2A 4J7WA 2MHKA 2WXGA 3R9MA 2LSUA 1OCOE 3QDNA 4JL0A 3FTSA 4JA7A 4XIFA 2P9IG 1E8WA 2H6FA 2LAHA 1O1TA 2P9UG 4L7TA 4LNUD 4CDRA 2RKKA 5AQBA 4GZDA 3X2QE 4HOQA 1Z5SC 5AN8A 3ONKA 4IULA 2LAIA 3JXIA 1TEZA 2F8XK 5JJTA 3RJVA 2CFZA 5AQAA 5A7DB 3TWVA 3QWWA 2L6JA 4P29A 2VSNA 2WXLA 3SQVA 5ANLA 3O4ZA 5ENSD 3HVEB 4ATGA 1N0QA 4XE0A 3G2UA 4F1PA 4GZ5A 4Q69A 4KT6B 2J09A 3CVPA 3PS6A 3BUAA 4WWOA 4DX7D 1QBQA 3HIZA 2IU1A 1SZ9A 4N39A 3D9NA 2NXPA 4FULA 4AVXA 3AG4E 4V3IA 4ANVA 2WXKA 4JC8A 4BSZB 3RIBA 4DI3A 1Z3XA 2EIKE 3HXDA 4MS6A 1WY6A 1U3CA 2EQXA 2V4HC 2GRPB 3Q9NC 5FINA 3ABKE 3EIJA 2WXMA 3HRAA 3SF4A 3SI5A 3ASDA 2PNNA 4F1SA 4YNDA 5FZQA 3VTXA 3CV0A 4HRNA 1YA0A 1JCQA 1EPUA 4PS3A 4C9BB 3KD7A 3Q7FA 4CGWA 3AS5A 4LUNU 1PC2A 1MJ0A 2V8SE 3ENEA 4J8YA 3EJNA 3KAEA 1PAQA 4APOA 4FADA 2BKGA 3ZUVB 3UI2A 4F7AA 4WNGA 4FC8A 3ZYLA 2CFUA 4AXHA 1MZCA 3EHMA 4K0RA 3JQ0A 3SO8A 5B1AE 3FEYA 4E85A 3CR3A 2HO1A 1KT0A 3UT8A 3G2VA 1HH8A 1X81A 3ZNGA 4PH4B 1N4PA 5AIJA 3TWXA 1TN8A 3Q7AA 2BTDA 3Q5MA 5EIDA 2RD0A 1Y8MA 3TWUA 5D0OD 2R05A 4DX2A 3MA5A 3QARA 5A6CA 1H6OA 3DPDA 5G2NA 4UQZA 1TJCA 4MLPA 2HYZA 5EYLA 2VGXB 1XNFA 1LF8A 4YDWA 4QFVA 2IOLA 4FJYA 2ZIRA 5CRUA 1BU9A 2XPYA 3HXCA 5J90A 3DXKG 2WXRA 1N94A 1QYMA 4U8YD 3Q49B 1K3ZD 3I4RB 3PVLA 2R5SA 4B0ZA 1W3BA 3FU6A 4XEIG 3S7DA 5ENTD 4ILIA 4ZHBA 4GAAA 3T5XA 2Y1LE 4O6FA 1Y6IA 3ASNE 5ENQD 4ME2A 2AXVA 3RAUA 2OOEA 4GYYA 2WMNA 2JABA 2H6HA 2R03A 4CRWA 1FCHA 3UTMA 2OVFA 3D9IA 2KC7A 3B95A 1FT1A 4HVBA 3LKUA 3JYSA 4Y6WA 3V2OA 3U3WA 3W9GA 1UJJA 5HS0A 4HLEA 1KZOA 5ENOD 1DCQA 3URZA 3G2WA 3TG5A 3EHNA 3LY8A 4N3BA 5EKQD 4U07A 1UG3A 2R17C 3HVEA 1NI1A 1NA3A 4MRUA 2XZDG 5ITZF 2HR2A 2BUGA 3CHQA 3FU0A 1ELKA 4GMLA 3CGHA 3U9WA 4IRUA 4JHRA 4AV7A 4DUIA 3QWVA 3DEOA 3JXJA 4PUCA 3HYMB 1UJKA 3E37A 4JXTA 3TXNA 2XEVA 3CIAA 4JA9A 5T8IA 2WXHA 2IOSA 4UQYA 3D9PA 1N52A 5KJKA 2QYUA 5FTPA 1WAO1 3ULQA 5KJMA 4HFGA 2A5UA 3LS8A 3CSTA 1SQMA 3BQOA 1BPOA 4L2YA 3ASFA 5DIZA 3ASOE 1E8XA 2Y0BG 2NYJA 4YVQC 3K9IA 3KEAA 3EDTB 1Z6TA 4U8VD 4H7YA 4WNFA 4I1OB 4BEPA 3AU4A 1WG0A 2ZU6B 1MQSA 2FULA 2P9LG 4BTAA 1EDUA 3FH8A 2J49A 5EDSA 1HXIA 5BV1A 2GRMA 5JJ7A 3FDHA 3ZKJA 3TWSA 3LXUX 3O48A 5FQ6A 5FT9A 3UT4A 5CMYA 3NZSA 4BFRA 4GCOA 4WNEA 1E7VA 3OAWA 3V2XA 3IHYA 3BG1B 4J0UA 4I1AA 4J8DA 2JLBA 2LO6A 3PEUB 2YNQA 2R59A 2UWJG 3FH7A 5BXUA 3KSQA 2KCKA 1FPPA 2VQ2A 4YDOA 4ZFHA 4JVSA 4I6EA 1A17A 1N54A 3T8KA 3UMVA 2OV8A 1KT1A 4TXPA 4W9RA 3DRAA 5LCWJ 3HHMA 3PEVB 1TNBA 3D3MA 3LDZA 4R7LA 5LCWC 4LSZE 3MCXA 2VGYA 3LVRE 1NL4A 3JUIA 1HG2A
chains in the Genus database with same CATH topology
2WMOA 5A7DB 1OWMA 3QAQA 4HS2A 2AXZA 1H2TC 3QWWA 2I1JA 2L6JA 4P29A 2WVIA 3E4BA 3PRZA 3UT7A 2VSNA 4HORA 4Q96A 4RVBA 1EYHA 2WXLA 5CCMA 4G2VA 5ANLA 4B94A 4EPZA 3SD5A 5KJNA 3O4ZA 4UWKA 1UW4B 4XKCA 3HVEB 4A1GA 4ATGA 2GGFA 5FQ4A 3UQ3A 2J08A 4AY6A 3L17A 3MKQB 1H0AA 2WXNA 5EX3A 4XE0A 3RRMB 1H2VC 3G2UA 4KMOA 2XCBA 4OVVA 4B8AA 4KVOA 4GYOA 4GZ5A 4Q69A 4KT6B 1H19A 3WXXA 4GMJA 4G1TA 2J09A 2VTBA 3CK7A 2LNIA 3ZGQA 4U63A 3NQPA 4UI9J 3SGHA 4XI0A 1FVHA 3CVPA 3D9OA 3P2BA 2UY1A 4EBAA 2X6JA 3U66A 3PS6A 3FU5A 4KZ0A 4FU3A 3FUFA 4WWOA 3VLDA 2I1KA 3CK8A 3ESLA 3FWVA 1E7UA 4KBQA 3RO3A 4BX8A 3I4GA 3HIZA 2IU1A 1SZ9A 4N39A 3D9NA 3ZFWA 3LY7A 2NXPA 4FULA 4AVXA 4AOFA 4ACKA 3L54A 3SHFA 2GW1A 2WXPA 1JUQA 1HS6A 4V3IA 2WXKA 4UWHA 4JC8A 4ANVA 5AYWD 1ZBPA 3IEGA 3RO2A 3VLEA 5ARGA 1DVPA 1UN8A 4OYSA 3RIBA 4AP2A 4DI3A 3PDNA 3ZYQA 1ZU2A 3ONLA 1HG5A 1Z3XA 4U0UA 2L0TB 4TV3A 2XQ0A 2WXJA 3CVWA 4MS6A 1WY6A 2X38A 1P5QA 3FEXA 4JEUA 4UQXA 4UWLA 3CVVA 1U3CA 2EQXA 3S2AA 2J9QA 1QNFA 2XCCA 3FUKA 3MJWA 2PL2A 4U04A 2WQ6A 5C2YA 3FTUA 3GW4A 5G05C 1IQUA 3ESKA 4N5CA 2CG2A 3EIJA 3CLJA 2WXMA 3SF4A 1IHGA 4WWPA 5DBKA 3ASDA 3SI5A 4A3TA 4A3VA 5CMWA 4F1SA 3QB2A 4YNDA 3ZIMA 3FU3A 3QK0A 5FZQA 4HOUA 4L1BA 3TXMA 3L16A 3PZDA 3VTXA 3Q47B 3CV0A 4GZCA 3FULA 1YA0A 3ASHA 1EPUA 4PS3A 2XRYA 4AM9A 4C9BB 4BY6A 2RG8A 3CK9A 4G26A 3KD7A 3QOUA 3B7SA 3KEZA 5KCMA 4BWRA 4CGWA 3FTZA 2WB2A 3LJ3A 3OXLA 5BV0A 3AS5A 3IKOB 4LUNU 3IBEA 4LERA 5ANRA 3ZRHA 1PC2A 4M3OA 2KZTB 4ACLA 4BTBA 2J4BA 2Q7FA 2V8SE 3ENEA 4D10C 4EZJA 3EJNA 1OWNA 2MRIA 3KAEA 3PE3A 4EBAG 4CDMA 2UY1B 4K03A 3FUDA 1PAQA 3B13A 3KS2A 4YVOA 3FUEA 4APOA 3EIQC 4H7XA 3DBSA 3Q15A 1E96B 4DI4A 2WPVA 3MEKA 2NSZA 4MKTA 4FADA 4LEUA 3MYVA 4G24A 3CVUA 1E90A 2JEKA 2WXIA 4LRZA 4B8CB 4GU5A 1INZA 4F7AA 4WNGA 4HOSA 3LPZA 4FC8A 2VGXA 3ZYLA 5HI7A 4F53A 5M72A 2CFUA 2YHCA 4AXHA 2FO7A 3EHMA 3QWPA 3TL5A 4K0RA 1FVFA 3JQ0A 4UWFA 5FQ8A 3FEYA 4E85A 3CR3A 2HO1A 1KT0A 2Y3AA 3G2VA 1HH8A 4PDXA 4XZ4A 3UT8A 3RK6A 4PH4B 2DBAA 4C0MA 2C0LA 5AIJA 3ZEFA 3N71A 3SZ7A 2VSOE 4U0SA 2BTDA 3CKBA 3Q5MA 3ZW3A 1SZAA 1Y8MA 2RD0A 3LVQE 3PNTB 1Z3YA 3PREA 5J08A 4DPRA 1B89A 5D0OD 3D9LA 3ZN3A 4DK5A 4JEHA 4G23A 4A1SA 3MA5A 3QARA 5A6CA 5LFAA 5AENA 3DPDA 5G2NA 3L6AA 4UQZA 1TJCA 2VYIA 2XHEA 4MLPA 4FLHA 1U3DA 1OWOA 4N2SA 1VDYA 3IV0A 2HYZA 5D0QD 2VTBB 4L2LA 5JHBA 2VGXB 4I6JA 4WUYA 1XNFA 1LF8A 3ML8A 4UI9K 2XRZA 4DLQA 1JPLA 1QQEA 4QFVA 3QKYA 3CHOA 3CHPA 2IOLA 3RRUA 4FJYA 3CVYA 2OVBA 2XPYA 5J90A 4U0ZA 1HF8A 4EZLA 3GZSA 3FFLA 3G2TA 3TJPA 3GZ2A 2WXRA 1S0PA 3APDA 3Q49B 1OWLA 3I4RB 2KCLA 2KZTA 2P58C 4WWNA 3PVLA 4GA2A 2R5SA 2XPZA 4B0ZA 2WM9A 1W3BA 5G04C 2FF4A 3FU6A 3U64A 5E76A 3S7DA 4AJWA 4ILIA 5BW8C 3CEQA 3S7BA 4A55A 4GAAA 4DLOA 2Y4TA 3FTXA 5HQ8A 5AJDA 4UWGA 5T4YA 4FP7A 2XPIA 4GPKA 3B7TA 2IF4A 3T5XA 2HM8A 3PNLB 4B89A 2XGSA 2AW6A 4O6FA 4CDNA 3L08A 3RU0A 3ZXSA 4I6GA 1Y6IA 1ELWA 2V4LA 4ILHB 4ME2A 3QC1A 2AXVA 3CHRA 1XGWA 2YQ8A 5G55A 2OOEA 4I1MA 1EF1C 2WQ7A 2WXOA 4GYYA 5LOZA 2WMNA 2X6KA 4HOTA 2V0PA 3MZLB 3ZHEB 4CRWA 3CVLA 1FCHA 4OVUA 2KATA 2OVFA 4BT8A 3D9IA 2KC7A 4APFA 1TJFA 1HFAA 4BSXA 3SNXA 4HVBA 3LKUA 1KLXA 3JYSA 4Y6WA 1JWGA 3FY4A 4GA1A 4Y6CA 3U3WA 4J8SA 1DNPA 4J6IA 3CKCA 3D9JA 1UJJA 2AWIA 2IONA 1X5BA 3FUIA 4XKBA 2DCPA 4HLEA 5T3RA 2VSXE 4NRHB 3OXGA 4G11A 2WQHA 3URZA 3S7FA 3G2WA 1HX8A 3TG5A 3EHNA 4L23A 3LY8A 4CCAA 3FHEA 3ZPJA 3GZ1A 1QZ2A 2VSYA 3OXFA 2CHWA 4N3BA 4U07A 5EKQD 2CG3A 2FEZA 4N3CA 2QY7A 4TUUA 3U4TA 2XGMA 1UG3A 3QNKA 2R17C 1H2UA 3HVEA 4CGVA 3TAXA 3NF1A 2IJGX 5ARFA 1NA3A 4MRUA 2L9BA 2BF0X 3MKQA 2HR2A 2BUGA 3R7QA 3CHQA 2WXFA 3T5VA 1HO8A 4GZ6A 3FU0A 2M63A 4FJZA 1ELKA 5E75A 5BUZA 4GMLA 2C0MA 4I2WA 3CGHA 5JJ6A 3U9WA 2X3MA 2X6FA 4GA0A 4XI9A 4JHJA 3Q4AB 2E2EA 4IRUA 3AS4A 4JHRA 4FHJA 4AV7A 2YHEA 1ELRA 2ONDA 4CEMA 3QWVA 5ENNA 2V5FA 2C2LA 4PUCA 3HYMB 1UJKA 2L0IA 2LSVA 3L13A 3FUMA 3ASGA 1E8YA 4FHKA 3TXNA 4JXTA 5BPPA 1GW6A 3TGOA 3HDXA 2X6HA 1OWPA 2XGOA 3G2SA 4GYWA 2XEVA 3CIAA 3SFZA 3SBSA 4BX9A 4JA9A 3CQCB 4EECA 3RKVA 3FUJA 5FJYA 3AS8A 3GYZA 5T8IA 2WXHA 3CVXA 3UX4A 1OUVA 2IOSA 1HE8A 3JQ1A 4UQYA 3D9PA 1N52A 3LCAA 3D9MA 3FUNA 3I3NA 5FQ7A 5KJKA 2PQRA 5FTPA 1WAO1 4HXIA 4I9EA 3ULQA 4FLBA 3SBTB 3RRNB 2J07A 4ILGA 4URKA 3B7UX 4NACA 4EZKA 3FP3A 3ML9A 5KJMA 4HFGA 2A5UA 3LS8A 1HU3A 3CSTA 1SQMA 3NZUA 3PUKA 3VLFA 1BPOA 3S7JA 3MX3A 4L2YA 3ASFA 5EX0A 5DIZA 2YINA 4ANWA 1WM5A 4I43A 1NZNA 1E8XA 4JZYA 2J4DA 4KXKB 2AXUA 4XX5A 4BT9A 4YVQC 3K9IA 4KYOB 4ANXA 4AIFA 3EDTB 1Z6TA 5AJLA 3LYAA 2VJ8A 4PS8A 2I9CA 4H7YA 4I17A 4RG9A 4WNFA 5G04J 2Y4UA 4I1OB 4J8FA 2FI7A 3AU4A 3CHMA 5CHEE 1H6KA 3VTYA 3CVNA 4EQFA 2ZU6B 1MQSA 3ZYKA 3LEWA 3R9AB 4FA6A 2FULA 3APFA 4JPSA 4N2QA 2PM6A 2PQNA 4BTAA 5FWQA 1EDUA 3FH8A 3MV2B 3C98A 3D9KA 2J49A 1HXIA 3L22A 2X6IA 4U8HA 5EDSA 5BV1A 4IN3B 2GRMA 2I2OA 3OTNA 2KCVA 4RG6A 3CQGB 2KM4A 3TG4A 5JJ7A 1HZ4A 3FDHA 1UN9A 2QFCA 3LXUX 3O48A 1MHQA 5A23A 3FTYA 3MKRA 5FQ6A 5FT9A 5KJLA 4GCNA 3UT4A 2E0IA 4Q94A 5CMYA 1IQRA 3NZSA 2A4ZA 3LY9A 3PUJA 4BFRA 5BNWA 2WXQA 3CVQA 4GCOA 4PS7A 4WNDA 4WNEA 4TRQA 4F3VA 1E7VA 3OAWA 3CHSA 1NA0A 2ILRA 4ABNA 4JW1A 5JHAA 4KVMA 3APCA 3IHYA 4RSYA 4GB9A 3BG1B 3PH0C 4J0UA 4DJAA 4G25A 4I1AA 2I6HA 2JLBA 2LO6A 4J8DA 3MGBA 4CT0A 4AY5A 3I5PA 4AEZC 4NURA 4ANUA 3PEUB 2YNQA 2R59A 2UWJG 2DIWA 4WAFA 1IYGA 3FH7A 2CHZA 4I9CA 4LCTA 3FUHA 4CT4A 2KCKA 5BT1A 4KZCA 3PE4A 4E6HA 3IHVA 1PY1A 4I2ZA 2VQ2A 2CHXA 5C1DA 1JWFA 3CSFA 2MOWA 3BG0B 2PM7A 4GZ3A 3B7RL 2AVPA 3FTVA 2MHKA 4JVSA 5FZSA 2IQCA 5FZRA 2WXGA 5G05J 4I6EA 3FTWA 1A17A 4JHKA 3FH5A 4NQ0A 2LSUA 2NC9A 1N54A 3P1UA 3QDNA 5LX8A 3ZYMA 5LP0A 4JL0A 2IFUA 4J8EA 3UMVA 3ZVVA 3FTSA 4JA7A 3UUXA 3QJZA 2OV8A 3RJVA 3MV3B 1KT1A 3JCKC 3UPVA 4XIFA 1L5JA 4N3AA 3ZHEA 4IYPA 4W9RA 4C0EA 1E8WA 5LCWJ 3HHMA 2PZIA 2LAHA 4L7TA 2FBNA 3PEVB 3D3MA 3LDZA 3AU5A 4R7LA 4CDRA 5LCWC 4GZDA 3MCXA 4HOQA 4UI9C 2VGYA 3ONKA 3T8MA 4IULA 2LAIA 1E8ZA 3LVRE 1NP7A 3JUIA 1TEZA 5CCLA 3R7RA 2GRLA 1HG2A 5JJTA 3BEEA 2CFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPI A;  5A7D B;  5DIZ A;  3CK9 A;  4G26 A;  1WM5 A;  3KD7 A;  3QOU A;  4GPK A;  2IF4 A;  4BWR A;  4CGW A;  1NZN A;  3QWW A;  4KXK B;  2L6J A;  4BT9 A;  2XGS A;  3OXL A;  4YVQ C;  3AS5 A;  3E4B A;  4O6F A;  3K9I A;  3RU0 A;  1PC2 A;  1ELW A;  2VSN A;  4KYO B;  4HOR A;  4ME2 A;  4AIF A;  3EDT B;  4BTB A;  5CCM A;  2YQ8 A;  3LYA A;  4G2V A;  4B94 A;  2Q7F A;  5KJN A;  2OOE A;  3PE3 A;  3KAE A;  4H7Y A;  4I17 A;  4RG9 A;  4GYY A;  4WNF A;  5G04 J;  2Y4U A;  2UY1 B;  3UQ3 A;  4J8F A;  3KS2 A;  4HOT A;  4AY6 A;  2FI7 A;  4YVO A;  4APO A;  5CHE E;  3ZHE B;  4H7X A;  3CVL A;  3Q15 A;  3VTY A;  1FCH A;  3CVN A;  4EQF A;  1E96 B;  5EX3 A;  2KAT A;  3R9A B;  4BT8 A;  2WPV A;  2KC7 A;  3MEK A;  4N2Q A;  2XCB A;  2PQN A;  4LEU A;  4G24 A;  3LKU A;  4BTA A;  4AM9 A;  1KLX A;  3JYS A;  3MV2 B;  4Y6W A;  1HXI A;  4Y6C A;  4GA1 A;  4GYO A;  4GZ5 A;  3U3W A;  4IN3 B;  3WXX A;  3CKC A;  4G1T A;  4RG6 A;  2KCV A;  3TG4 A;  4WNG A;  3CK7 A;  3LPZ A;  2LNI A;  3ZGQ A;  5JJ7 A;  2VGX A;  4HOS A;  4UI9 J;  1HZ4 A;  4XI0 A;  5HI7 A;  3CVP A;  2QFC A;  2YHC A;  3O48 A;  5M72 A;  2UY1 A;  2FO7 A;  3MKR A;  3QWP A;  4NRH B;  3OXG A;  2WQH A;  5FT9 A;  3URZ A;  5KJL A;  4GCN A;  3S7F A;  2HO1 A;  1KT0 A;  3TG5 A;  1HH8 A;  3LY9 A;  3LY8 A;  5BNW A;  3ZPJ A;  3CVQ A;  3GZ1 A;  4GCO A;  1QZ2 A;  2VSY A;  3OXF A;  4N3B A;  4U07 A;  4WND A;  4WNE A;  5EKQ D;  4F3V A;  2FEZ A;  4N3C A;  1NA0 A;  3CK8 A;  3FWV A;  4ABN A;  2DBA A;  3U4T A;  2XGM A;  4KBQ A;  3RO3 A;  2C0L A;  3N71 A;  3SZ7 A;  4CGV A;  4N39 A;  3TAX A;  3NF1 A;  4J0U A;  5ARF A;  1NA3 A;  4G25 A;  4I1A A;  2I6H A;  2JLB A;  3LY7 A;  3CKB A;  3Q5M A;  4J8D A;  4U0S A;  3ZFW A;  1Y8M A;  2BUG A;  2HR2 A;  4AY5 A;  4GZ6 A;  1B89 A;  2GW1 A;  5D0O D;  2UWJ G;  2C0M A;  4I2W A;  3ZN3 A;  1IYG A;  4A1S A;  4G23 A;  5AYW D;  1ZBP A;  3MA5 A;  4GA0 A;  4I9C A;  4XI9 A;  5JJ6 A;  2KCK A;  3IEG A;  3RO2 A;  3Q4A B;  5A6C A;  5BT1 A;  5ARG A;  2E2E A;  4UQZ A;  3RIB A;  1TJC A;  2VYI A;  3AS4 A;  3PE4 A;  4JHR A;  4I2Z A;  1ELR A;  4N2S A;  2VQ2 A;  3PDN A;  1ZU2 A;  2HYZ A;  2OND A;  5D0Q D;  5C1D A;  3QWV A;  2V5F A;  2C2L A;  4U0U A;  2VGX B;  4GZ3 A;  4WUY A;  1XNF A;  3HYM B;  2AVP A;  2LSV A;  2MHK A;  5FZS A;  3ASG A;  3TGO A;  1QQE A;  5FZR A;  5G05 J;  3QKY A;  1A17 A;  1P5Q A;  2XGO A;  4GYW A;  4NQ0 A;  2XEV A;  4UQX A;  2LSU A;  4JA9 A;  2NC9 A;  2J9Q A;  3RKV A;  5FJY A;  3QDN A;  3AS8 A;  3GYZ A;  2XCC A;  4JL0 A;  2IFU A;  4U0Z A;  4J8E A;  2PL2 A;  4U04 A;  1OUV A;  4JA7 A;  3UUX A;  3FFL A;  3GW4 A;  4UQY A;  3MV3 B;  5G05 C;  3RJV A;  3ESK A;  3GZ2 A;  1KT1 A;  4N5C A;  3LCA A;  4XIF A;  3UPV A;  4N3A A;  3ZHE A;  3Q49 B;  4W9R A;  5KJK A;  2PQR A;  5FTP A;  5LCW J;  3SF4 A;  1WAO 1;  1IHG A;  2KCL A;  2P58 C;  2PZI A;  4I9E A;  3ULQ A;  2FBN A;  4GA2 A;  5DBK A;  2R5S A;  3ASD A;  1W3B A;  5G04 C;  2FF4 A;  4CDR A;  5LCW C;  4YND A;  3FP3 A;  4HOQ A;  4UI9 C;  3S7D A;  5KJM A;  2VGY A;  5FZQ A;  3CEQ A;  4HOU A;  5BW8 C;  3S7B A;  3VTX A;  2Y4T A;  3Q47 B;  3CV0 A;  5CCL A;  5HQ8 A;  5JJT A;  1YA0 A;  3ASH A;  3S7J A;  3BEE A;  4UI9 K;  3ASF A;  5EX0 A; 
#chains in the Genus database with same CATH topology
 3QAQ A;  2AXZ A;  3E32 A;  2I1J A;  2XS8 A;  3PRZ A;  3UT7 A;  4Q96 A;  1OCR E;  4RVB A;  4G2V A;  4B94 A;  5EIB E;  5KJN A;  1UW4 B;  3UQ3 A;  2J08 A;  1SA4 A;  3DWL G;  3V79 K;  1AWC B;  4K5C A;  4KVO A;  2VTB A;  3NQP A;  4UI9 J;  4XI0 A;  3D9O A;  3P2B A;  4LG6 A;  3U66 A;  2RFA A;  3FU5 A;  3FUF A;  3VLD A;  2LUH A;  2I1K A;  2Y69 E;  3UIP C;  4BX8 A;  3LY7 A;  3SHF A;  3NBN B;  3DXM G;  2WXP A;  1JUQ A;  1HS6 A;  1OXJ A;  3NB2 A;  5AYW D;  1UN8 A;  1HG5 A;  4U0U A;  3UIO C;  2L0T B;  2BED A;  4GPM A;  1P5Q A;  4JEU A;  1QNF A;  5JMN D;  2PL2 A;  4U04 A;  3WG7 E;  2WQ6 A;  5C2Y A;  3FTU A;  3GW4 A;  4GTT A;  4BER A;  3DSV A;  5H7P A;  4WWP A;  5CMW A;  2EIJ E;  4A3V A;  1TNU A;  5CER B;  1KZP A;  3QB2 A;  3TXM A;  2RG8 A;  3CK9 A;  3B7S A;  3W9F A;  5BV0 A;  3IKO B;  4U95 D;  4LER A;  2KZT B;  4ACL A;  4EZJ A;  1OWN A;  3NOG D;  4CDM A;  2UY1 B;  1TNY A;  3DBS A;  1TNO A;  2NSZ A;  3CVU A;  1MX2 A;  4GU5 A;  1INZ A;  4HOS A;  3LPZ A;  4F53 A;  5M72 A;  2YHC A;  4DRX E;  2Y3A A;  4XZ4 A;  2F8Y A;  3EU9 A;  2DBA A;  1H6P A;  3ZEF A;  3UKR G;  2VSO E;  1IXV A;  1B89 A;  3ZN3 A;  4DK5 A;  4G23 A;  2VYI A;  4FLH A;  1VDY A;  2VTB B;  4L2L A;  4DLQ A;  3CHO A;  1HF8 A;  4EZL A;  5CRV A;  4OAV B;  3D9H A;  3FFL A;  3G2T A;  3TJP A;  3GZ2 A;  1S0P A;  1S70 B;  1K1B A;  1OWL A;  5AAR A;  1K1A A;  2KCL A;  2KZT A;  2P58 C;  4WWN A;  4LNG A;  4GA2 A;  2XPZ A;  2WM9 A;  2KXP C;  1YCS B;  4AJW A;  4GTP A;  5BW8 C;  4A55 A;  3PZ2 A;  5ENP D;  4GPK A;  4B89 A;  5CBN A;  3L08 A;  3ZXS A;  2V4L A;  2P9S G;  1LD8 A;  4ILH B;  5CBO A;  4YDY A;  3CHR A;  1XGW A;  4I1M A;  1EF1 C;  5B1B E;  5LOZ A;  2X6K A;  2V0P A;  3MZL B;  2ZGD A;  3ZHE B;  1YYH A;  2KAT A;  4BT8 A;  3SNX A;  3FY4 A;  4J6I A;  4N5Q A;  3CKC A;  4GTO A;  1X5B A;  2DCP A;  3OXG A;  4HI9 A;  4L23 A;  2CG3 A;  4C48 B;  2EIN E;  3QNK A;  1H2U A;  3TAX A;  3NF1 A;  2IJG X;  2EIL E;  5ARF A;  2DZO A;  3MKQ A;  4JB8 P;  3Q73 A;  5KBA A;  3T5V A;  4GZ6 A;  4FJZ A;  5BUZ A;  4G8K A;  1JCS A;  1N95 A;  2X6F A;  4GA0 A;  3Q4A B;  1MX4 A;  2L0I A;  3L13 A;  1MX6 A;  3ASG A;  4FHK A;  5BPP A;  1GW6 A;  3HDX A;  2X6H A;  4BX9 A;  4EEC A;  3RKV A;  5FJY A;  3CVX A;  3UX4 A;  4GTV A;  3FUN A;  2PQR A;  1O1R A;  4HXI A;  4I9E A;  4FLB A;  4ILG A;  4URK A;  3B7U X;  3PUK A;  3NZU A;  4HLL A;  3S7J A;  3MX3 A;  1MYO A;  1WM5 A;  4I43 A;  1NZN A;  1TYQ G;  4KXK B;  3J5Q B;  2VJ8 A;  4I17 A;  1H6K A;  3VTY A;  3UM2 A;  1OY3 D;  3R9A B;  4FA6 A;  1YMP A;  4N2Q A;  3MV2 B;  4U8H A;  3L22 A;  4HQD A;  2X6I A;  4RG6 A;  3OTN A;  3TG4 A;  1HZ4 A;  3DST A;  4HB5 A;  1SVX A;  1MHQ A;  4GCN A;  4Q94 A;  3LY9 A;  3CVQ A;  4PS7 A;  4WND A;  4TRQ A;  1NA0 A;  4KVM A;  4GB9 A;  4G25 A;  2I6H A;  4CT0 A;  4AY5 A;  2DYS E;  3UM1 A;  4LCT A;  5BT1 A;  4E6H A;  2B6C A;  2QZA A;  5C1D A;  3CSF A;  2AVP A;  5FZS A;  2IQC A;  1OCZ E;  5FZR A;  5G05 J;  4JHK A;  1D8D A;  1O1S A;  2NC9 A;  5LX8 A;  3ZYM A;  5LP0 A;  4J8E A;  3ZVV A;  3UUX A;  3HG0 D;  3JCK C;  1L5J A;  4N3A A;  3ZHE A;  4C0E A;  2FBN A;  1DCE A;  4UI9 C;  3F6Q A;  3T8M A;  1NP7 A;  5CCL A;  3BEE A;  1OWM A;  2WVI A;  3E4B A;  3ULY A;  4HOR A;  2QYJ A;  3C3O A;  1EYH A;  5CCM A;  2XEE A;  4EPZ A;  4MBG A;  4UWK A;  4XKC A;  2GGF A;  5B3S E;  2ETB A;  2BKK B;  5EX3 A;  1H2V C;  3C72 A;  4KMO A;  3DSW A;  2P9P G;  4GYO A;  2LXM A;  3WXX A;  4GMJ A;  3HXF A;  4G1T A;  5KNH D;  3HXE A;  3SGH A;  1FVH A;  5EN5 D;  2UY1 A;  2X6J A;  4KZ0 A;  4O1P A;  4FU3 A;  2KBX A;  3PZ3 A;  1TNZ A;  3FWV A;  3ESL A;  1E7U A;  2ZIS A;  3PZ1 A;  4HNA D;  4AOF A;  4ACK A;  3EUV A;  4UWH A;  4JD2 G;  1ZBP A;  1WDY A;  2XEN A;  3IEG A;  3RO2 A;  3BU8 A;  1DVP A;  4AP2 A;  3PDN A;  3ZYQ A;  3ONL A;  2XQ0 A;  4O1O A;  2WXJ A;  1A5E A;  3FEX A;  4HRL A;  4UWL A;  2J9Q A;  2FO1 E;  1RZ4 A;  3FUK A;  5BXO A;  1LTX A;  5AQ7 A;  3V31 A;  4N5C A;  2CG2 A;  3CLJ A;  1IHG A;  5DBK A;  4A3T A;  4OAU C;  3T9K A;  3ZU7 B;  1Q2Z A;  3QK0 A;  4HOU A;  4L1B A;  2R2L A;  2XZT G;  3PZD A;  1N0R A;  3Q47 B;  3FUL A;  3ASH A;  2XRY A;  4BY6 A;  4G26 A;  3QOU A;  4M7C A;  3KEZ A;  5KCM A;  4HBD A;  3IBE A;  3ZRH A;  4M3O A;  5EIL A;  2J4B A;  4D10 C;  3TWW A;  2MRI A;  3PE3 A;  4CZ2 D;  4EBA G;  3B13 A;  4YVO A;  3FUE A;  3EIQ C;  4H7X A;  4BES A;  1E96 B;  4DI4 A;  3MYV A;  4G24 A;  2JEK A;  2WXI A;  5HI7 A;  3TL5 A;  2LXL A;  4UWF A;  3Q79 A;  4C0M A;  3N71 A;  4U0S A;  3ZW3 A;  3PNT B;  3LVQ E;  1Z3Y A;  3PRE A;  5J08 A;  4DPR A;  2H6G A;  5LFA A;  3B7B A;  5AEN A;  3Q75 A;  1U3D A;  1OWO A;  4N2S A;  1TR4 A;  3IV0 A;  3TWT A;  4QQI A;  3ML8 A;  1JPL A;  1QQE A;  3QKY A;  1TN6 A;  3CHP A;  4DX6 D;  4U0Z A;  3L9T A;  3GZS A;  5CEC B;  4GTS A;  3APD A;  5EYP F;  2V5Q C;  2FF4 A;  3U64 A;  5E76 A;  2IY0 C;  3CEQ A;  4K5A B;  1N4S A;  3S7B A;  2Y4T A;  5HQ8 A;  1KPS B;  5AJD A;  4B93 B;  5T4Y A;  4FP7 A;  3C3Q A;  3PNL B;  3AG3 E;  2XGS A;  2AW6 A;  4CDN A;  1BLX B;  3RU0 A;  4I6G A;  1ELW A;  1AP7 A;  4TUM A;  2YQ8 A;  4A63 B;  5G55 A;  5D2M C;  2XS1 A;  1N9A A;  1S63 A;  1TJF A;  2J8S D;  2DYR E;  3C3R A;  4GTQ A;  4GA1 A;  1DNP A;  3D9J A;  2ION A;  4F6R D;  3FUI A;  4XKB A;  3AG1 E;  3S7F A;  4CCA A;  3FHE A;  3GZ1 A;  3OXF A;  2CHW A;  2FEZ A;  4N3C A;  2QY7 A;  3JUE A;  3U4T A;  2XGM A;  4ATZ D;  1OCC E;  3ZXP A;  2L9B A;  1HO8 A;  2C0M A;  5JJ6 A;  5CEA A;  2X3M A;  4JHJ A;  2E2E A;  4CEM A;  5ENN A;  2C2L A;  1E8Y A;  3TGO A;  4GYW A;  2XGO A;  5KNG A;  3SFZ A;  3SBS A;  3FUJ A;  2F0Y A;  4GMR A;  3V30 A;  3AAA C;  1OUV A;  3JQ1 A;  4U7E B;  1IHB A;  3I3N A;  4CYM D;  3SBT B;  3TWQ A;  4NAC A;  4Z68 A;  3ML9 A;  1HU3 A;  1N4Q A;  1G3N B;  3UM3 A;  4JZY A;  4XX5 A;  2GRQ B;  2MYO A;  4RQI A;  4KYO B;  3DEP A;  4ANX A;  5AJL A;  3LYA A;  2Y4U A;  4J8F A;  2FI7 A;  5CHE E;  3CVN A;  4EQF A;  3ZYK A;  1IKN D;  2PM6 A;  2PQN A;  5FWQ A;  3C98 A;  2P9N G;  2I2O A;  2KCV A;  3CQG B;  2KM4 A;  1UN9 A;  3FTY A;  3MKR A;  5HRY A;  5KJL A;  2E0I A;  1IQR A;  5BNW A;  2WXQ A;  2ILR A;  4ABN A;  4JW1 A;  3SFY A;  3APC A;  4RSY A;  1D9S A;  3PH0 C;  4DJA A;  3L82 A;  3MGB A;  4EHM A;  3DSS A;  3I5P A;  4AEZ C;  3ABL E;  2DIW A;  4WAF A;  4HI8 A;  4I9C A;  3FUH A;  3PE4 A;  4I2Z A;  4GTM A;  2CHX A;  3J5P A;  2MOW A;  1O5M A;  2PM7 A;  3BG0 B;  4GZ3 A;  3B7R L;  3FTV A;  2F37 A;  3FTW A;  3FH5 A;  4NQ0 A;  4G8L A;  3P1U A;  3EHR A;  2IFU A;  3EU5 A;  3AJI A;  3IXE A;  3QJZ A;  3MV3 B;  2ETA A;  3UPV A;  4IYP A;  2PZI A;  5AAO A;  4TXQ A;  3AU5 A;  2P2C P;  1E8Z A;  3R7R A;  2GRL A;  2VGE A;  3DSU A;  4UI9 K;  3EHQ A;  2XEH A;  2WMO A;  1FT2 A;  4HS2 A;  1H2T C;  2IO2 C;  3SD5 A;  4A1G A;  5FQ4 A;  4AY6 A;  3L17 A;  2H6I A;  3MKQ B;  1H0A A;  2WXN A;  3E30 A;  3RRM B;  1BI7 B;  2XCB A;  4OVV A;  3UM0 A;  1OT8 A;  4B8A A;  1H19 A;  3DSX A;  2ZGG A;  1BD8 A;  3CK7 A;  2LNI A;  3ZGQ A;  4U63 A;  2P9K G;  4EBA A;  1K8K G;  3CK8 A;  4KBQ A;  3RO3 A;  3I4G A;  1D8E A;  4UUC A;  3ZFW A;  3L54 A;  1N4R A;  2GW1 A;  1V55 E;  3Q9U C;  3ABM E;  3VLE A;  5ARG A;  4RLY A;  2R02 A;  4OYS A;  4U96 D;  1ZU2 A;  5AQ9 A;  4TV3 A;  4BET A;  3TWR A;  3CVW A;  2X38 A;  4UQX A;  3CVV A;  3S2A A;  2XCC A;  3MJW A;  5G05 C;  1IQU A;  3ESK A;  3SY2 A;  3C5R A;  3LJN A;  3PZ4 A;  3KSL A;  3ZIM A;  3FU3 A;  3L16 A;  4GZC A;  2ZXW E;  4AM9 A;  4BWR A;  2WB2 A;  3FTZ A;  3LJ3 A;  3OXL A;  2OEV A;  5ANR A;  3DPY A;  4BTB A;  3Q78 A;  5HKP A;  2Q7F A;  1S64 A;  2GRO B;  4K03 A;  3FUD A;  3KS2 A;  3Q15 A;  2WPV A;  3MEK A;  4MKT A;  4LEU A;  1E90 A;  4LRZ A;  5D66 A;  4B8C B;  3UXG A;  4LNB A;  2L6B A;  2VGX A;  2FO7 A;  3QWP A;  1FVF A;  2AJA A;  5FQ8 A;  1SA5 A;  4PDX A;  3RK6 A;  3E33 A;  2C0L A;  3SZ7 A;  5ENR D;  3CKB A;  1SZA A;  3D9L A;  4JEH A;  4A1S A;  2A5E A;  4X8Q A;  3L6A A;  4L9P A;  2XHE A;  1TN7 A;  5D0Q D;  1ZB1 A;  5JHB A;  2QC9 A;  4I6J A;  4WUY A;  2XRZ A;  1LD7 A;  4GTR A;  3RRU A;  3CVY A;  2GRR B;  2OVB A;  1V54 E;  3RSE G;  5G04 C;  1NFI E;  4DLO A;  3FTX A;  4UWG A;  2RFM A;  1N11 A;  2XPI A;  3B7T A;  2IF4 A;  4DX5 D;  3ISM C;  2HM8 A;  3QC1 A;  4DX1 A;  2WQ7 A;  2WXO A;  4HOT A;  1BI8 B;  2EIM E;  3CVL A;  4OVU A;  4APF A;  4BSX A;  1HFA A;  1KLX A;  1JWG A;  4Y6C A;  4J8S A;  3NAW A;  2AWI A;  5T3R A;  2VSX E;  2DVW A;  4TXR A;  2ETC A;  4NRH B;  4G11 A;  2WQH A;  3UIN C;  1HX8 A;  3ZPJ A;  1QZ2 A;  2VSY A;  5CED B;  4TUU A;  4CGV A;  1UOH A;  2BF0 X;  2OEW A;  3R7Q A;  3SFX A;  2WXF A;  2M63 A;  5E75 A;  2GRN B;  4I2W A;  4XI9 A;  2B0O E;  3AS4 A;  4FHJ A;  2YHE A;  1ELR A;  2OND A;  2V5F A;  2LSV A;  3FUM A;  3NOC D;  1OWP A;  3G2S A;  3CQC B;  3AS8 A;  3GYZ A;  2IEJ A;  1HE8 A;  3LCA A;  3D9M A;  5FQ7 A;  3UKU G;  1JCR A;  3RRN B;  2J07 A;  4EZK A;  3FP3 A;  3AG2 E;  3VLF A;  5EX0 A;  2HE0 A;  2YIN A;  4ANW A;  3ULE G;  1DC2 A;  2J4D A;  2AXU A;  4BT9 A;  4NIK A;  2OCC E;  4AIF A;  4PS8 A;  2I9C A;  5G04 J;  4RG9 A;  4O60 A;  3CHM A;  3E34 A;  5JA4 D;  3LEW A;  3APF A;  4JPS A;  2DWZ A;  5KWD A;  3D9K A;  4HRM B;  4IN3 B;  2QFC A;  5A23 A;  2A4Z A;  3PUJ A;  1SW6 A;  4F3V A;  1U2V G;  3CHS A;  5JHA A;  2DZN A;  5FIO A;  4NUR A;  4ANU A;  1IYG A;  2CHZ A;  3HXB A;  4CT4 A;  4YDE A;  4KZC A;  3IHV A;  1PY1 A;  1JWF A;  4K5B A;  2IO3 C;  5IY5 E;  1RW2 A;  4J7W A;  2MHK A;  2WXG A;  3R9M A;  2LSU A;  1OCO E;  3QDN A;  4JL0 A;  3FTS A;  4JA7 A;  4XIF A;  2P9I G;  1E8W A;  2H6F A;  2LAH A;  1O1T A;  2P9U G;  4L7T A;  4LNU D;  4CDR A;  2RKK A;  5AQB A;  4GZD A;  3X2Q E;  4HOQ A;  1Z5S C;  5AN8 A;  3ONK A;  4IUL A;  2LAI A;  3JXI A;  1TEZ A;  2F8X K;  5JJT A;  3RJV A;  2CFZ A;  5AQA A;  5A7D B;  3TWV A;  3QWW A;  2L6J A;  4P29 A;  2VSN A;  2WXL A;  3SQV A;  5ANL A;  3O4Z A;  5ENS D;  3HVE B;  4ATG A;  1N0Q A;  4XE0 A;  3G2U A;  4F1P A;  4GZ5 A;  4Q69 A;  4KT6 B;  2J09 A;  3CVP A;  3PS6 A;  3BUA A;  4WWO A;  4DX7 D;  1QBQ A;  3HIZ A;  2IU1 A;  1SZ9 A;  4N39 A;  3D9N A;  2NXP A;  4FUL A;  4AVX A;  3AG4 E;  4V3I A;  4ANV A;  2WXK A;  4JC8 A;  4BSZ B;  3RIB A;  4DI3 A;  1Z3X A;  2EIK E;  3HXD A;  4MS6 A;  1WY6 A;  1U3C A;  2EQX A;  2V4H C;  2GRP B;  3Q9N C;  5FIN A;  3ABK E;  3EIJ A;  2WXM A;  3HRA A;  3SF4 A;  3SI5 A;  3ASD A;  2PNN A;  4F1S A;  4YND A;  5FZQ A;  3VTX A;  3CV0 A;  4HRN A;  1YA0 A;  1JCQ A;  1EPU A;  4PS3 A;  4C9B B;  3KD7 A;  3Q7F A;  4CGW A;  3AS5 A;  4LUN U;  1PC2 A;  1MJ0 A;  2V8S E;  3ENE A;  4J8Y A;  3EJN A;  3KAE A;  1PAQ A;  4APO A;  4FAD A;  2BKG A;  3ZUV B;  3UI2 A;  4F7A A;  4WNG A;  4FC8 A;  3ZYL A;  2CFU A;  4AXH A;  1MZC A;  3EHM A;  4K0R A;  3JQ0 A;  3SO8 A;  5B1A E;  3FEY A;  4E85 A;  3CR3 A;  2HO1 A;  1KT0 A;  3UT8 A;  3G2V A;  1HH8 A;  1X81 A;  3ZNG A;  4PH4 B;  1N4P A;  5AIJ A;  3TWX A;  1TN8 A;  3Q7A A;  2BTD A;  3Q5M A;  5EID A;  2RD0 A;  1Y8M A;  3TWU A;  5D0O D;  2R05 A;  4DX2 A;  3MA5 A;  3QAR A;  5A6C A;  1H6O A;  3DPD A;  5G2N A;  4UQZ A;  1TJC A;  4MLP A;  2HYZ A;  5EYL A;  2VGX B;  1XNF A;  1LF8 A;  4YDW A;  4QFV A;  2IOL A;  4FJY A;  2ZIR A;  5CRU A;  1BU9 A;  2XPY A;  3HXC A;  5J90 A;  3DXK G;  2WXR A;  1N94 A;  1QYM A;  4U8Y D;  3Q49 B;  1K3Z D;  3I4R B;  3PVL A;  2R5S A;  4B0Z A;  1W3B A;  3FU6 A;  4XEI G;  3S7D A;  5ENT D;  4ILI A;  4ZHB A;  4GAA A;  3T5X A;  2Y1L E;  4O6F A;  1Y6I A;  3ASN E;  5ENQ D;  4ME2 A;  2AXV A;  3RAU A;  2OOE A;  4GYY A;  2WMN A;  2JAB A;  2H6H A;  2R03 A;  4CRW A;  1FCH A;  3UTM A;  2OVF A;  3D9I A;  2KC7 A;  3B95 A;  1FT1 A;  4HVB A;  3LKU A;  3JYS A;  4Y6W A;  3V2O A;  3U3W A;  3W9G A;  1UJJ A;  5HS0 A;  4HLE A;  1KZO A;  5ENO D;  1DCQ A;  3URZ A;  3G2W A;  3TG5 A;  3EHN A;  3LY8 A;  4N3B A;  5EKQ D;  4U07 A;  1UG3 A;  2R17 C;  3HVE A;  1NI1 A;  1NA3 A;  4MRU A;  2XZD G;  5ITZ F;  2HR2 A;  2BUG A;  3CHQ A;  3FU0 A;  1ELK A;  4GML A;  3CGH A;  3U9W A;  4IRU A;  4JHR A;  4AV7 A;  4DUI A;  3QWV A;  3DEO A;  3JXJ A;  4PUC A;  3HYM B;  1UJK A;  3E37 A;  4JXT A;  3TXN A;  2XEV A;  3CIA A;  4JA9 A;  5T8I A;  2WXH A;  2IOS A;  4UQY A;  3D9P A;  1N52 A;  5KJK A;  2QYU A;  5FTP A;  1WAO 1;  3ULQ A;  5KJM A;  4HFG A;  2A5U A;  3LS8 A;  3CST A;  1SQM A;  3BQO A;  1BPO A;  4L2Y A;  3ASF A;  5DIZ A;  3ASO E;  1E8X A;  2Y0B G;  2NYJ A;  4YVQ C;  3K9I A;  3KEA A;  3EDT B;  1Z6T A;  4U8V D;  4H7Y A;  4WNF A;  4I1O B;  4BEP A;  3AU4 A;  1WG0 A;  2ZU6 B;  1MQS A;  2FUL A;  2P9L G;  4BTA A;  1EDU A;  3FH8 A;  2J49 A;  5EDS A;  1HXI A;  5BV1 A;  2GRM A;  5JJ7 A;  3FDH A;  3ZKJ A;  3TWS A;  3LXU X;  3O48 A;  5FQ6 A;  5FT9 A;  3UT4 A;  5CMY A;  3NZS A;  4BFR A;  4GCO A;  4WNE A;  1E7V A;  3OAW A;  3V2X A;  3IHY A;  3BG1 B;  4J0U A;  4I1A A;  4J8D A;  2JLB A;  2LO6 A;  3PEU B;  2YNQ A;  2R59 A;  2UWJ G;  3FH7 A;  5BXU A;  3KSQ A;  2KCK A;  1FPP A;  2VQ2 A;  4YDO A;  4ZFH A;  4JVS A;  4I6E A;  1A17 A;  1N54 A;  3T8K A;  3UMV A;  2OV8 A;  1KT1 A;  4TXP A;  4W9R A;  3DRA A;  5LCW J;  3HHM A;  3PEV B;  1TNB A;  3D3M A;  3LDZ A;  4R7L A;  5LCW C;  4LSZ E;  3MCX A;  2VGY A;  3LVR E;  1NL4 A;  3JUI A;  1HG2 A; 
#chains in the Genus database with same CATH homology
 2WMO A;  5A7D B;  1OWM A;  3QAQ A;  4HS2 A;  2AXZ A;  1H2T C;  3QWW A;  2I1J A;  2L6J A;  4P29 A;  2WVI A;  3E4B A;  3PRZ A;  3UT7 A;  2VSN A;  4HOR A;  4Q96 A;  4RVB A;  1EYH A;  2WXL A;  5CCM A;  4G2V A;  5ANL A;  4B94 A;  4EPZ A;  3SD5 A;  5KJN A;  3O4Z A;  4UWK A;  1UW4 B;  4XKC A;  3HVE B;  4A1G A;  4ATG A;  2GGF A;  5FQ4 A;  3UQ3 A;  2J08 A;  4AY6 A;  3L17 A;  3MKQ B;  1H0A A;  2WXN A;  5EX3 A;  4XE0 A;  3RRM B;  1H2V C;  3G2U A;  4KMO A;  2XCB A;  4OVV A;  4B8A A;  4KVO A;  4GYO A;  4GZ5 A;  4Q69 A;  4KT6 B;  1H19 A;  3WXX A;  4GMJ A;  4G1T A;  2J09 A;  2VTB A;  3CK7 A;  2LNI A;  3ZGQ A;  4U63 A;  3NQP A;  4UI9 J;  3SGH A;  4XI0 A;  1FVH A;  3CVP A;  3D9O A;  3P2B A;  2UY1 A;  4EBA A;  2X6J A;  3U66 A;  3PS6 A;  3FU5 A;  4KZ0 A;  4FU3 A;  3FUF A;  4WWO A;  3VLD A;  2I1K A;  3CK8 A;  3ESL A;  3FWV A;  1E7U A;  4KBQ A;  3RO3 A;  4BX8 A;  3I4G A;  3HIZ A;  2IU1 A;  1SZ9 A;  4N39 A;  3D9N A;  3ZFW A;  3LY7 A;  2NXP A;  4FUL A;  4AVX A;  4AOF A;  4ACK A;  3L54 A;  3SHF A;  2GW1 A;  2WXP A;  1JUQ A;  1HS6 A;  4V3I A;  2WXK A;  4UWH A;  4JC8 A;  4ANV A;  5AYW D;  1ZBP A;  3IEG A;  3RO2 A;  3VLE A;  5ARG A;  1DVP A;  1UN8 A;  4OYS A;  3RIB A;  4AP2 A;  4DI3 A;  3PDN A;  3ZYQ A;  1ZU2 A;  3ONL A;  1HG5 A;  1Z3X A;  4U0U A;  2L0T B;  4TV3 A;  2XQ0 A;  2WXJ A;  3CVW A;  4MS6 A;  1WY6 A;  2X38 A;  1P5Q A;  3FEX A;  4JEU A;  4UQX A;  4UWL A;  3CVV A;  1U3C A;  2EQX A;  3S2A A;  2J9Q A;  1QNF A;  2XCC A;  3FUK A;  3MJW A;  2PL2 A;  4U04 A;  2WQ6 A;  5C2Y A;  3FTU A;  3GW4 A;  5G05 C;  1IQU A;  3ESK A;  4N5C A;  2CG2 A;  3EIJ A;  3CLJ A;  2WXM A;  3SF4 A;  1IHG A;  4WWP A;  5DBK A;  3ASD A;  3SI5 A;  4A3T A;  4A3V A;  5CMW A;  4F1S A;  3QB2 A;  4YND A;  3ZIM A;  3FU3 A;  3QK0 A;  5FZQ A;  4HOU A;  4L1B A;  3TXM A;  3L16 A;  3PZD A;  3VTX A;  3Q47 B;  3CV0 A;  4GZC A;  3FUL A;  1YA0 A;  3ASH A;  1EPU A;  4PS3 A;  2XRY A;  4AM9 A;  4C9B B;  4BY6 A;  2RG8 A;  3CK9 A;  4G26 A;  3KD7 A;  3QOU A;  3B7S A;  3KEZ A;  5KCM A;  4BWR A;  4CGW A;  3FTZ A;  2WB2 A;  3LJ3 A;  3OXL A;  5BV0 A;  3AS5 A;  3IKO B;  4LUN U;  3IBE A;  4LER A;  5ANR A;  3ZRH A;  1PC2 A;  4M3O A;  2KZT B;  4ACL A;  4BTB A;  2J4B A;  2Q7F A;  2V8S E;  3ENE A;  4D10 C;  4EZJ A;  3EJN A;  1OWN A;  2MRI A;  3KAE A;  3PE3 A;  4EBA G;  4CDM A;  2UY1 B;  4K03 A;  3FUD A;  1PAQ A;  3B13 A;  3KS2 A;  4YVO A;  3FUE A;  4APO A;  3EIQ C;  4H7X A;  3DBS A;  3Q15 A;  1E96 B;  4DI4 A;  2WPV A;  3MEK A;  2NSZ A;  4MKT A;  4FAD A;  4LEU A;  3MYV A;  4G24 A;  3CVU A;  1E90 A;  2JEK A;  2WXI A;  4LRZ A;  4B8C B;  4GU5 A;  1INZ A;  4F7A A;  4WNG A;  4HOS A;  3LPZ A;  4FC8 A;  2VGX A;  3ZYL A;  5HI7 A;  4F53 A;  5M72 A;  2CFU A;  2YHC A;  4AXH A;  2FO7 A;  3EHM A;  3QWP A;  3TL5 A;  4K0R A;  1FVF A;  3JQ0 A;  4UWF A;  5FQ8 A;  3FEY A;  4E85 A;  3CR3 A;  2HO1 A;  1KT0 A;  2Y3A A;  3G2V A;  1HH8 A;  4PDX A;  4XZ4 A;  3UT8 A;  3RK6 A;  4PH4 B;  2DBA A;  4C0M A;  2C0L A;  5AIJ A;  3ZEF A;  3N71 A;  3SZ7 A;  2VSO E;  4U0S A;  2BTD A;  3CKB A;  3Q5M A;  3ZW3 A;  1SZA A;  1Y8M A;  2RD0 A;  3LVQ E;  3PNT B;  1Z3Y A;  3PRE A;  5J08 A;  4DPR A;  1B89 A;  5D0O D;  3D9L A;  3ZN3 A;  4DK5 A;  4JEH A;  4G23 A;  4A1S A;  3MA5 A;  3QAR A;  5A6C A;  5LFA A;  5AEN A;  3DPD A;  5G2N A;  3L6A A;  4UQZ A;  1TJC A;  2VYI A;  2XHE A;  4MLP A;  4FLH A;  1U3D A;  1OWO A;  4N2S A;  1VDY A;  3IV0 A;  2HYZ A;  5D0Q D;  2VTB B;  4L2L A;  5JHB A;  2VGX B;  4I6J A;  4WUY A;  1XNF A;  1LF8 A;  3ML8 A;  4UI9 K;  2XRZ A;  4DLQ A;  1JPL A;  1QQE A;  4QFV A;  3QKY A;  3CHO A;  3CHP A;  2IOL A;  3RRU A;  4FJY A;  3CVY A;  2OVB A;  2XPY A;  5J90 A;  4U0Z A;  1HF8 A;  4EZL A;  3GZS A;  3FFL A;  3G2T A;  3TJP A;  3GZ2 A;  2WXR A;  1S0P A;  3APD A;  3Q49 B;  1OWL A;  3I4R B;  2KCL A;  2KZT A;  2P58 C;  4WWN A;  3PVL A;  4GA2 A;  2R5S A;  2XPZ A;  4B0Z A;  2WM9 A;  1W3B A;  5G04 C;  2FF4 A;  3FU6 A;  3U64 A;  5E76 A;  3S7D A;  4AJW A;  4ILI A;  5BW8 C;  3CEQ A;  3S7B A;  4A55 A;  4GAA A;  4DLO A;  2Y4T A;  3FTX A;  5HQ8 A;  5AJD A;  4UWG A;  5T4Y A;  4FP7 A;  2XPI A;  4GPK A;  3B7T A;  2IF4 A;  3T5X A;  2HM8 A;  3PNL B;  4B89 A;  2XGS A;  2AW6 A;  4O6F A;  4CDN A;  3L08 A;  3RU0 A;  3ZXS A;  4I6G A;  1Y6I A;  1ELW A;  2V4L A;  4ILH B;  4ME2 A;  3QC1 A;  2AXV A;  3CHR A;  1XGW A;  2YQ8 A;  5G55 A;  2OOE A;  4I1M A;  1EF1 C;  2WQ7 A;  2WXO A;  4GYY A;  5LOZ A;  2WMN A;  2X6K A;  4HOT A;  2V0P A;  3MZL B;  3ZHE B;  4CRW A;  3CVL A;  1FCH A;  4OVU A;  2KAT A;  2OVF A;  4BT8 A;  3D9I A;  2KC7 A;  4APF A;  1TJF A;  1HFA A;  4BSX A;  3SNX A;  4HVB A;  3LKU A;  1KLX A;  3JYS A;  4Y6W A;  1JWG A;  3FY4 A;  4GA1 A;  4Y6C A;  3U3W A;  4J8S A;  1DNP A;  4J6I A;  3CKC A;  3D9J A;  1UJJ A;  2AWI A;  2ION A;  1X5B A;  3FUI A;  4XKB A;  2DCP A;  4HLE A;  5T3R A;  2VSX E;  4NRH B;  3OXG A;  4G11 A;  2WQH A;  3URZ A;  3S7F A;  3G2W A;  1HX8 A;  3TG5 A;  3EHN A;  4L23 A;  3LY8 A;  4CCA A;  3FHE A;  3ZPJ A;  3GZ1 A;  1QZ2 A;  2VSY A;  3OXF A;  2CHW A;  4N3B A;  4U07 A;  5EKQ D;  2CG3 A;  2FEZ A;  4N3C A;  2QY7 A;  4TUU A;  3U4T A;  2XGM A;  1UG3 A;  3QNK A;  2R17 C;  1H2U A;  3HVE A;  4CGV A;  3TAX A;  3NF1 A;  2IJG X;  5ARF A;  1NA3 A;  4MRU A;  2L9B A;  2BF0 X;  3MKQ A;  2HR2 A;  2BUG A;  3R7Q A;  3CHQ A;  2WXF A;  3T5V A;  1HO8 A;  4GZ6 A;  3FU0 A;  2M63 A;  4FJZ A;  1ELK A;  5E75 A;  5BUZ A;  4GML A;  2C0M A;  4I2W A;  3CGH A;  5JJ6 A;  3U9W A;  2X3M A;  2X6F A;  4GA0 A;  4XI9 A;  4JHJ A;  3Q4A B;  2E2E A;  4IRU A;  3AS4 A;  4JHR A;  4FHJ A;  4AV7 A;  2YHE A;  1ELR A;  2OND A;  4CEM A;  3QWV A;  5ENN A;  2V5F A;  2C2L A;  4PUC A;  3HYM B;  1UJK A;  2L0I A;  2LSV A;  3L13 A;  3FUM A;  3ASG A;  1E8Y A;  4FHK A;  3TXN A;  4JXT A;  5BPP A;  1GW6 A;  3TGO A;  3HDX A;  2X6H A;  1OWP A;  2XGO A;  3G2S A;  4GYW A;  2XEV A;  3CIA A;  3SFZ A;  3SBS A;  4BX9 A;  4JA9 A;  3CQC B;  4EEC A;  3RKV A;  3FUJ A;  5FJY A;  3AS8 A;  3GYZ A;  5T8I A;  2WXH A;  3CVX A;  3UX4 A;  1OUV A;  2IOS A;  1HE8 A;  3JQ1 A;  4UQY A;  3D9P A;  1N52 A;  3LCA A;  3D9M A;  3FUN A;  3I3N A;  5FQ7 A;  5KJK A;  2PQR A;  5FTP A;  1WAO 1;  4HXI A;  4I9E A;  3ULQ A;  4FLB A;  3SBT B;  3RRN B;  2J07 A;  4ILG A;  4URK A;  3B7U X;  4NAC A;  4EZK A;  3FP3 A;  3ML9 A;  5KJM A;  4HFG A;  2A5U A;  3LS8 A;  1HU3 A;  3CST A;  1SQM A;  3NZU A;  3PUK A;  3VLF A;  1BPO A;  3S7J A;  3MX3 A;  4L2Y A;  3ASF A;  5EX0 A;  5DIZ A;  2YIN A;  4ANW A;  1WM5 A;  4I43 A;  1NZN A;  1E8X A;  4JZY A;  2J4D A;  4KXK B;  2AXU A;  4XX5 A;  4BT9 A;  4YVQ C;  3K9I A;  4KYO B;  4ANX A;  4AIF A;  3EDT B;  1Z6T A;  5AJL A;  3LYA A;  2VJ8 A;  4PS8 A;  2I9C A;  4H7Y A;  4I17 A;  4RG9 A;  4WNF A;  5G04 J;  2Y4U A;  4I1O B;  4J8F A;  2FI7 A;  3AU4 A;  3CHM A;  5CHE E;  1H6K A;  3VTY A;  3CVN A;  4EQF A;  2ZU6 B;  1MQS A;  3ZYK A;  3LEW A;  3R9A B;  4FA6 A;  2FUL A;  3APF A;  4JPS A;  4N2Q A;  2PM6 A;  2PQN A;  4BTA A;  5FWQ A;  1EDU A;  3FH8 A;  3MV2 B;  3C98 A;  3D9K A;  2J49 A;  1HXI A;  3L22 A;  2X6I A;  4U8H A;  5EDS A;  5BV1 A;  4IN3 B;  2GRM A;  2I2O A;  3OTN A;  2KCV A;  4RG6 A;  3CQG B;  2KM4 A;  3TG4 A;  5JJ7 A;  1HZ4 A;  3FDH A;  1UN9 A;  2QFC A;  3LXU X;  3O48 A;  1MHQ A;  5A23 A;  3FTY A;  3MKR A;  5FQ6 A;  5FT9 A;  5KJL A;  4GCN A;  3UT4 A;  2E0I A;  4Q94 A;  5CMY A;  1IQR A;  3NZS A;  2A4Z A;  3LY9 A;  3PUJ A;  4BFR A;  5BNW A;  2WXQ A;  3CVQ A;  4GCO A;  4PS7 A;  4WND A;  4WNE A;  4TRQ A;  4F3V A;  1E7V A;  3OAW A;  3CHS A;  1NA0 A;  2ILR A;  4ABN A;  4JW1 A;  5JHA A;  4KVM A;  3APC A;  3IHY A;  4RSY A;  4GB9 A;  3BG1 B;  3PH0 C;  4J0U A;  4DJA A;  4G25 A;  4I1A A;  2I6H A;  2JLB A;  2LO6 A;  4J8D A;  3MGB A;  4CT0 A;  4AY5 A;  3I5P A;  4AEZ C;  4NUR A;  4ANU A;  3PEU B;  2YNQ A;  2R59 A;  2UWJ G;  2DIW A;  4WAF A;  1IYG A;  3FH7 A;  2CHZ A;  4I9C A;  4LCT A;  3FUH A;  4CT4 A;  2KCK A;  5BT1 A;  4KZC A;  3PE4 A;  4E6H A;  3IHV A;  1PY1 A;  4I2Z A;  2VQ2 A;  2CHX A;  5C1D A;  1JWF A;  3CSF A;  2MOW A;  3BG0 B;  2PM7 A;  4GZ3 A;  3B7R L;  2AVP A;  3FTV A;  2MHK A;  4JVS A;  5FZS A;  2IQC A;  5FZR A;  2WXG A;  5G05 J;  4I6E A;  3FTW A;  1A17 A;  4JHK A;  3FH5 A;  4NQ0 A;  2LSU A;  2NC9 A;  1N54 A;  3P1U A;  3QDN A;  5LX8 A;  3ZYM A;  5LP0 A;  4JL0 A;  2IFU A;  4J8E A;  3UMV A;  3ZVV A;  3FTS A;  4JA7 A;  3UUX A;  3QJZ A;  2OV8 A;  3RJV A;  3MV3 B;  1KT1 A;  3JCK C;  3UPV A;  4XIF A;  1L5J A;  4N3A A;  3ZHE A;  4IYP A;  4W9R A;  4C0E A;  1E8W A;  5LCW J;  3HHM A;  2PZI A;  2LAH A;  4L7T A;  2FBN A;  3PEV B;  3D3M A;  3LDZ A;  3AU5 A;  4R7L A;  4CDR A;  5LCW C;  4GZD A;  3MCX A;  4HOQ A;  4UI9 C;  2VGY A;  3ONK A;  3T8M A;  4IUL A;  2LAI A;  1E8Z A;  3LVR E;  1NP7 A;  3JUI A;  1TEZ A;  5CCL A;  3R7R A;  2GRL A;  1HG2 A;  5JJT A;  3BEE A;  2CFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...