3ASFA

Mama msr-1 c2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
174
structure length
174
Chain Sequence
DIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Protein binding
molecule keywords Magnetosome protein MamA
total genus 66
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asfA01
1ZBPA 3Q5MA 2KCKA 5G04C 3UQ3A 3ZGQA 1OUVA 2WQHA 4I9CA 3UUXA 2KC7A 3IEGA 4APOA 2Y4TA 5FZRA 4EQFA 4UI9K 4H7XA 4KYOB 5FT9A 4N2SA 4G25A 4I17A 4GA0A 3UPVA 4JL0A 4LEUA 4N3AA 3GW4A 3CK8A 4GA1A 3CK9A 3RKVA 3RO2A 4AM9A 3QOUA 2XGMA 4GPKA 1WAO1 2LSVA 2C0MA 3AS5A 4HOUA 3U4TA 5LCWJ 1ELRA 3SF4A 3KAEA 3Q15A 4NRHB 4N3BA 5FZSA 3EDTB 4GZ3A 5FJYA 5G05J 4BT9A 4HOSA 4KBQA 1IYGA 2VGXA 2WPVA 5BW8C 3RIBA 2VGXB 3N71A 4U07A 3VTYA 3R9AB 4U0ZA 4I1AA 2C2LA 5JJ7A 4G26A 2VGYA 4XI9A 1YA0A 3NF1A 2GW1A 3MEKA 4F3VA 3QKYA 4GYYA 4IN3B 4U04A 1QQEA 4WNDA 4CGWA 2DBAA 3URZA 3TGOA 2FEZA 4HORA 3S7JA 3TG4A 2YHCA 4GCOA 3LPZA 3TAXA 1FCHA 5LCWC 4GA2A 1ZU2A 4UI9J 2FI7A 4HOQA 2OOEA 4JA7A 5D0OD 4UQXA 5DIZA 4ABNA 5KJMA 4CDRA 2J9QA 2L6JA 4I9EA 3KS2A 3CKCA 1P5QA 2FBNA 2E2EA 3OXLA 3ZFWA 2AVPA 2JLBA 2PL2A 3PDNA 2FO7A 2UY1A 4JHRA 3O48A 5JJ6A 1E96B 3CVQA 4GYOA 5G05C 4CGVA 4GYWA 4G1TA 3LYAA 3GZ1A 2V5FA 4UI9C 3QWPA 1WM5A 4RG6A 3ZHEA 3CV0A 3S7FA 1W3BA 4KXKB 2PQNA 4AY5A 5D0QD 5EKQD 4WNEA 1XNFA 2ONDA 3S7BA 3CKBA 5AYWD 5HQ8A 2KCLA 2XPIA 1KT1A 3QWVA 2KCVA 4YNDA 3ULQA 3SZ7A 4AIFA 3QWWA 4B94A 4J8DA 2P58C 3GYZA 1ELWA 4O6FA 2QFCA 3CEQA 4ME2A 4RG9A 4WNFA 4I2WA 1TJCA 2VQ2A 5EX0A 2XCCA 4XI0A 2XGSA 4GZ5A 2FF4A 4BTBA 5JJTA 2MHKA 2PQRA 5CCLA 4HOTA 4U0SA 3RJVA 1IHGA 5BT1A 4G23A 2IFUA 3ZHEB 3Q47B 3GZ2A 4I2ZA 2LNIA 3ASHA 3MV3B 2VSYA 3ESKA 3FWVA 4J8EA 4NQ0A 4N3CA 5FTPA 2XEVA 5HI7A 3K9IA 3S7DA 3VTXA 5BNWA 4N2QA 2HYZA 5KJLA 2KATA 3RO3A 3LKUA 1PC2A 3ASGA 3MKRA 5CCMA 2XCBA 3AS8A 1KT0A 4YVOA 2IF4A 4BTAA 3OXGA 4BT8A 2VSNA 1A17A 3LY8A 4GCNA 3CVLA 1HZ4A 3BEEA 4BWRA 3MA5A 3U3WA 3JYSA 2R5SA 3OXFA 4UQYA 5CHEE 4AY6A 4H7YA 4YVQC 5ARGA 3QDNA 5C1DA 5M72A 1NA0A 4WUYA 2PZIA 3LY7A 3ZPJA 3PE4A 4N5CA 4XIFA 4WNGA 5DBKA 3ASDA 1QZ2A 2HR2A 2VYIA 3CVNA 3FP3A 5EX3A 5FZQA 1HXIA 4U0UA 3LCAA 3ZN3A 4GZ6A 2Y4UA 4UQZA 5A6CA 2BUGA 2C0LA 2YQ8A 1NZNA 4J0UA 4N39A 5KJNA 3FFLA 2UWJG 2I6HA 4Y6CA 2NC9A 3ASFA 3Q4AB 3KD7A 2HO1A 3CVPA 3HYMB 4JA9A 5A7DB 4A1SA 1KLXA 3PE3A 4Y6WA 3TG5A 3E4BA 2Q7FA 1B89A 3MV2B 4G2VA 4J8FA 5G04J 1NA3A 2XGOA 3RU0A 1HH8A 3WXXA 4G24A 2LSUA 3CK7A 4W9RA 2UY1B 3AS4A 5KJKA 3LY9A 5ARFA 1Y8MA 3Q49B
chains in the Genus database with same CATH superfamily
2OVFA 2WXNA 5FZRA 3ZRHA 3ZXPA 3HXDA 1H6KA 5G2NA 2LSVA 4HLEA 4TUUA 2B0OE 4L1BA 1D8DA 2VJ8A 3C3QA 4EZKA 3MEKA 2IOSA 2I1KA 1ZU2A 4PS8A 2OOEA 2MOWA 3CKCA 2BKKB 1ZB1A 2QY7A 2VTBB 3SO8A 1TNOA 3AU5A 4V3IA 2QZAA 1DCQA 4AJWA 1U3DA 5FQ7A 1H2UA 5AIJA 5LFAA 2R2LA 1ELKA 3Q47B 3ASHA 3MV3B 3CVUA 2L0TB 5JMND 3ESLA 3NOGD 5CCMA 4KT6B 3LVQE 4YVOA 3FUHA 1OCCE 5J90A 1Z5SC 4UQYA 1N4PA 3ZPJA 4YDOA 5EX3A 4L23A 5KJNA 3V31A 2J07A 2AXZA 2GRNB 2NC9A 2J4DA 2B6CA 3ULYA 2WXFA 4J8FA 1NA3A 1HH8A 4RLYA 1OUVA 2ZISA 2H6HA 4K0RA 1WG0A 4AXHA 4D10C 4CZ2D 2NSZA 4NURA 2HE0A 1N94A 3SI5A 2NYJA 3ABKE 3T8KA 3EDTB 4GZ3A 1HO8A 2WPVA 3RIBA 3DPYA 3CVVA 4U04A 3TWRA 5LCWC 3Q75A 1OWNA 4FHKA 2AVPA 1JWFA 3TWWA 1SA4A 3CVQA 5G05C 4JD2G 4MLPA 1XNFA 5FQ6A 5HQ8A 5KWDA 3QAQA 2BEDA 4TUMA 4UWFA 3ASOE 2P58C 3C98A 4TV3A 4BTBA 2A5EA 2IY0C 4G23A 3UTMA 4NQ0A 3TWVA 3RO3A 4GZDA 1UN8A 1BU9A 4CEMA 3TWXA 1HFAA 1HZ4A 3BEEA 3O4ZA 4EHMA 2XRZA 3Q9NC 2DZOA 3Q9UC 5M72A 3ABLE 4WNGA 3HVEB 3B7SA 4HRLA 1E8YA 3CQCB 3J5QB 1N0RA 4BETA 3F6QA 3C3RA 2A5UA 3MV2B 3NZUA 2X6FA 3G2UA 3L82A 1S70B 4MRUA 2UY1B 5CMWA 5KJKA 3BG0B 3ZGQA 5AJLA 5AENA 4K5BA 2Y4TA 3ONLA 3NQPA 4GA0A 1SW6A 4GA1A 4N3BA 4HOSA 2RG8A 2VGXA 1H19A 5ANLA 2V5QC 3DRAA 4Q94A 3NF1A 2J08A 3ASNE 5AARA 3ZUVB 4LSZE 4L2YA 1H6OA 4HFGA 2DIWA 1TEZA 2JLBA 5T4YA 4XX5A 2P9UG 3HIZA 3DWLG 2X6IA 4DUIA 4XZ4A 2MYOA 2WXPA 1D9SA 5EX0A 4R7LA 4I2WA 2VQ2A 3ONKA 2XCCA 3PZ2A 4JC8A 3GZ2A 1A5EA 3FWVA 3VTXA 4TXPA 5KNHD 2IOLA 2AWIA 5CEDB 4GCNA 3IV0A 3DEOA 1H2TC 4UQZA 3EU9A 2C0LA 4K5CA 4GTMA 3RRNB 3SBTB 4KZ0A 3CHQA 1TN7A 2Q7FA 1O1TA 3AJIA 5EILA 2LO6A 3B7UX 3RK6A 4DX7D 3NZSA 2RD0A 2V4HC 3PS6A 2GRMA 1EYHA 4G25A 3UPVA 3SD5A 4LEUA 1Z6TA 3BQOA 3PNLB 3KAEA 2WB2A 4HS2A 4BT9A 2IU1A 2C2LA 5BV1A 2WXGA 2MRIA 4LCTA 4WNDA 4CGWA 1E8XA 4BX8A 3U9WA 1O5MA 4UI9J 4RQIA 3FU6A 2L6JA 3UI2A 2WQ6A 4L9PA 4K03A 2AXVA 2JABA 2FO7A 3SFYA 5JHBA 3KEAA 4DI3A 3GZ1A 3FUMA 1HE8A 4FC8A 3D9LA 4UWKA 4AY5A 4QQIA 4YNDA 3SZ7A 3RRUA 5C1DA 4GZ5A 2Y69E 3ULEG 3C5RA 3UIPC 3ENEA 3MYVA 5FTPA 4IYPA 4JZYA 3UMVA 4KVMA 3LKUA 2R03A 3ASGA 4DRXE 2XCBA 4E85A 4BTAA 1A17A 2P9LG 2OEWA 3OXFA 4HVBA 1MJ0A 4AVXA 4OAUC 1LTXA 3HG0D 1WY6A 5DBKA 1QZ2A 3FP3A 2RFAA 4GTVA 3L22A 2I6HA 3BU8A 5EDSA 4Y6WA 3ZYLA 2FULA 3TWTA 1IQUA 3HVEA 4F1PA 1X81A 4UWHA 3IEGA 1OWLA 2CHXA 2XEEA 4GU5A 5FZSA 4MKTA 1IYGA 5FJYA 2VGXB 3VTYA 4FP7A 4U07A 3AG1E 1BD8A 4A55A 2VGYA 1MYOA 3FTVA 4IN3B 2EIKE 5AQ9A 1UW4B 2XZTG 2HM8A 4LNUD 4HOQA 5B1AE 2XENA 3ZFWA 2E2EA 2ZGGA 2UY1A 1LF8A 1E96B 2ZU6B 4HBDA 3MKQA 4GYWA 3JQ1A 2WVIA 4UUCA 1SA5A 2X38A 2P2CP 2GRRB 4O6FA 2QFCA 3CEQA 3EU5A 4HOTA 1Y6IA 4IRUA 2AJAA 2XEVA 3FH7A 3HXCA 3ABME 2ILRA 4PDXA 2J8SD 3CSFA 3D9HA 2XS8A 3FUKA 2IO2C 1HX8A 4WWOA 5ARGA 2R59A 3PZ3A 2WXQA 4LRZA 3ASDA 2YQ8A 4J0UA 3FFLA 4U95D 3DSVA 4U96D 3MGBA 2NXPA 4GPMA 2WQHA 4I6GA 2KC7A 2PM7A 1TJFA 3EIJA 3BG1B 3HDXA 1H0AA 3Q73A 3U4TA 4F1SA 2V0PA 3TXMA 4HQDA 5HKPA 5JJ7A 1K1BA 3IHVA 3LEWA 3LPZA 4LG6A 4L2LA 2LXMA 5KNGA 3OXLA 3EHNA 3V30A 4U63A 3E33A 3T5VA 2VTBA 2J09A 2KZTA 2EQXA 4RG6A 2LXLA 4OVUA 1TNZA 3CQGB 5FIOA 1PAQA 2PNNA 5BUZA 5CBOA 5A23A 4U0SA 2ZIRA 3UM2A 4J6IA 1N9AA 2YINA 4B8CB 2KATA 1PC2A 3BUAA 5LX8A 3VLEA 1TN8A 2GRQB 3T8MA 1TNUA 3LS8A 3MA5A 2R5SA 4AY6A 3ZYKA 3D3MA 4JXTA 3R7QA 3ZVVA 4JB8P 3CHMA 3FH5A 4FHJA 3ZNGA 1B89A 4G8KA 3AS4A 4B93B 3S7DA 5ARFA 3Q49B 3UQ3A 4F53A 4F6RD 4APOA 3JQ0A 1IKND 4GMLA 5ENSD 5FT9A 4J7WA 3FH8A 5H7PA 3CHOA 3IKOB 4HI9A 5CMYA 4BFRA 1S0PA 3L54A 2XS1A 5BW8C 3R9AB 3DSXA 2FEZA 3SFXA 1FCHA 3I4GA 3AG3E 1X5BA 2J9QA 4C0MA 4JVSA 2OVBA 4JPSA 5B1BE 3FUEA 4K5AB 3ZHEA 3QWPA 1WM5A 3CV0A 4PS7A 1BPOA 5ENRD 4E6HA 5LOZA 1ELWA 3EIQC 4J8EA 1E8WA 2H6FA 1YMPA 1OY3D 3MKRA 3PVLA 4HNAD 2P9IG 4B8AA 3FUJA 4FULA 4M3OA 3QNKA 2L6BA 5BV0A 4Q69A 4XIFA 4FU3A 4FADA 2RKKA 4U0UA 4I43A 3PZ1A 3ZKJA 4XKCA 5CECB 4DPRA 3ASFA 2VGEA 3UINC 4A1SA 3E37A 4G2VA 1V55E 1OCZE 5HRYA 4GB9A 3QARA 4LNGA 3I4RB 4CDNA 1E7VA 4RVBA 3RAUA 3CVWA 5LCWJ 3UT8A 5EYLA 1BI7B 4OYSA 2QYUA 3D9OA 4EECA 4A3TA 3URZA 3S7JA 2YNQA 4CDRA 4M7CA 4HXIA 4AP2A 2IONA 3T5XA 5JJ6A 4CYMD 3DSWA 1IQRA 3D9MA 2H6GA 2V5FA 5D0QD 3D9PA 2GROB 3DSSA 5EIBE 2FF4A 2QC9A 1UJJA 2IFUA 4G11A 5EN5D 4A1GA 2GRPB 3Q7AA 3JCKC 3B13A 3QC1A 5FQ8A 3G2WA 3U66A 4BSZB 4BWRA 3MCXA 3S2AA 5T8IA 2CFZA 1HG5A 3D9KA 2XPZA 4AOFA 3MX3A 2Y4UA 3DXKG 3QB2A 2Y1LE 3PE3A 4FLBA 1NL4A 3CK7A 3FTYA 4YDYA 5AQAA 3UXGA 3LY9A 2EIME 4J8YA 3JUIA 4CT4A 4G8LA 4O1OA 1K1AA 3WG7E 4JHKA 2DVWA 1WAO1 3LJNA 2WMOA 4KBQA 1MQSA 4U0ZA 2CG3A 1YA0A 4AV7A 3NAWA 1IXVA 3TGOA 2VSOE 4HORA 4GCOA 4OVVA 1KPSB 5E76A 2P9SG 2FI7A 5D0OD 5KJMA 2AW6A 3FU0A 5B3SE 3PDNA 2F37A 4O60A 3FTWA 1RZ4A 4KXKB 4XE0A 4KMOA 4Z68A 2XPIA 3QWVA 1KT1A 3QWWA 2AXUA 4J8DA 1YYHA 4WNFA 3FUNA 1MX2A 1N4SA 4U7EB 4WAFA 3ZU7B 4LERA 4N3CA 4BY6A 2VSYA 4ZHBA 4GTQA 1EF1C 2V8SE 3CGHA 2HYZA 4I6JA 3CLJA 4FA6A 3LY7A 3L13A 3RRMB 1HXIA 3LCAA 4GZ6A 2BUGA 2A4ZA 1S64A 3HYMB 2XEHA 1VDYA 3E4BA 4CRWA 4YDWA 1OCRE 4C9BB 2M63A 2BKGA 1TNYA 5EYPF 4Q96A 2KCKA 3PZ4A 5T3RA 2Y3AA 1Z3YA 4GAAA 3AG4E 3GW4A 1TYQG 3RO2A 2FO1E 2H6IA 5EIDA 3I3NA 3OAWA 2EIJE 4ACLA 4DI4A 3NB2A 5DIZA 4AEZC 5AAOA 3FTUA 4JHRA 1O1RA 3B7TA 4G1TA 3FHEA 3LYAA 1TNBA 4UI9C 3LDZA 2IEJA 2R17C 1UG3A 1FPPA 1RW2A 5AYWD 3ULQA 4AIFA 3ZW3A 1TJCA 5CCLA 3DBSA 2F0YA 3UKRG 3ESKA 5BNWA 2OCCE 3T9KA 3W9GA 3AAAC 1HF8A 1KT0A 2J4BA 4NIKA 3QDNA 1YCSB 3FUDA 1NA0A 3SY2A 3PE4A 3W9FA 5FWQA 3B7RL 3UT4A 4C0EA 1G3NB 1NZNA 3EJNA 1Z3XA 4Y6CA 4I6EA 1PY1A 5A7DB 1JUQA 3IXEA 1KLXA 3TG5A 5KBAA 3DSUA 2LSUA 3DEPA 4OAVB 3UUXA 2DCPA 3CK8A 3ZIMA 2VSXE 4U8HA 4ANWA 3SF4A 4CT0A 1U2VG 3LXUX 3CSTA 3UKUG 4G26A 4F3VA 3Q79A 1QQEA 1DC2A 3UIOC 1FVFA 3TG4A 3TAXA 4ILIA 1LD7A 4UQXA 3EUVA 3PZDA 1BLXB 3FU5A 3ZEFA 1BI8B 1S63A 2WXJA 4APFA 3V2XA 3TWSA 5C2YA 2KBXA 4ACKA 2IJGX 1GW6A 1L5JA 2ONDA 2WM9A 2ETBA 3CKBA 2KCVA 2BF0X 2XHEA 4RG9A 3DPDA 3G2SA 1AP7A 3U64A 4XI0A 1IHGA 3AG2E 4I2ZA 5HI7A 4N2QA 3MKQB 3K9IA 4NACA 3E30A 3LJ3A 1E90A 2ETAA 2IF4A 5D66A 2L9BA 3NBNB 2J49A 3JYSA 3SGHA 4H7YA 4ANVA 1OWPA 3ZYMA 3HRAA 3HXFA 3ZN3A 2VYIA 4URKA 2WXLA 1FT2A 2R02A 1LD8A 3FUFA 3PUKA 2P9KG 3Q4AB 5FQ4A 3RU0A 1ZBPA 2WXRA 4J8SA 5ENTD 4DLQA 3L17A 4WWNA 1INZA 2R05A 3Q15A 4HRMB 4GZCA 4CDMA 1SZAA 3G2TA 4XI9A 2JEKA 2DBAA 4GA2A 4KVOA 3FULA 4ABNA 1N54A 4I9EA 3KS2A 1P5QA 4WWPA 4TXRA 3O48A 4GYOA 4CGVA 1N4RA 5AJDA 1E7UA 4A63B 3KEZA 4ANUA 2MHKA 4U8YD 4HRNA 2IQCA 3APDA 4TXQA 5BT1A 4ATZD 3ZHEB 4BEPA 1OXJA 2WXOA 4JHJA 1MX4A 4XKBA 5KJLA 4HI8A 3G2VA 2RFMA 4DJAA 2VSNA 4DX2A 3EHQA 1WDYA 1IHBA 4WUYA 5G55A 1TR4A 2KXPC 2WQ7A 3I5PA 2CFUA 3CVPA 4QFVA 2L0IA 3ZXSA 4BESA 2XGOA 1QNFA 3DXMG 3VLFA 4GTRA 4JEHA 4I9CA 4JW1A 3SQVA 4KYOB 4MBGA 4N3AA 5ENPD 1SZ9A 2XGMA 3QOUA 4I1MA 4HOUA 1N11A 4X8QA 3MJWA 5G05J 4LNBA 5ANRA 1U3CA 3N71A 5LP0A 3FTSA 5ENQD 3E34A 4MS6A 2I2OA 2V4LA 2GW1A 1FVHA 2YHCA 2I9CA 2BTDA 4LUNU 2PL2A 5CEAA 5FINA 1JCRA 2F8YA 3GYZA 3QK0A 4ILGA 3SBSA 3X2QE 3RJVA 3FUIA 1QYMA 5D2MC 2OEVA 2LUHA 4GTOA 4BX9A 2ETCA 1NP7A 1SVXA 2I1JA 2X6KA 2WXMA 3OXGA 3CVLA 5J08A 3CHPA 1O1SA 3L08A 3APCA 1D8EA 3CVNA 3JXJA 3P1UA 1JPLA 3TWUA 2GGFA 4HB5A 1MX6A 2UWJG 3UX4A 2Y0BG 1N4QA 3KSQA 2HO1A 2WXHA 4ILHB 1OWMA 3CR3A 4W9RA 1DCEA 3TWQA 4GMRA 3FTXA 2CG2A 3FEYA 5AQBA 4N2SA 4I17A 4KZCA 4GPKA 4RSYA 3AS5A 2C0MA 4UWLA 4BERA 3HXBA 3HXEA 4F7AA 4DX5D 3QKYA 5JA4D 1Q2ZA 2DZNA 4GTSA 2EILE 2ZXWE 4ZFHA 5AQ7A 4IULA 1QBQA 4FJYA 2KZTB 1JWGA 2DYRE 4GTTA 1HU3A 5EKQD 3S7BA 3V2OA 4N5QA 1MHQA 3GZSA 5CBNA 1H2VC 3B95A 1OT8A 2XGSA 3HHMA 1SQMA 1UN9A 4EZJA 1FT1A 1K3ZD 5CRVA 3UT7A 3CHRA 3C72A 3MZLB 2WXIA 3UM1A 1N0QA 2CHWA 3R9MA 1E8ZA 4BT8A 3LY8A 2E0IA 1NI1A 4GTPA 5CHEE 2DWZA 1HG2A 4N5CA 2X6HA 1OWOA 3ML9A 4PS3A 3UM3A 1TN6A 3FTZA 3CIAA 3QJZA 3WXXA 4EBAA 2XQ0A 3PNTB 1Y8MA 3Q5MA 2XPYA 4TRQA 1EDUA 2IO3C 4EQFA 4UI9K 4H7XA 1H6PA 4I1OB 5KCMA 3CK9A 3RKVA 4AM9A 3ML8A 1ELRA 4NRHB 4DX6D 5BPPA 3ISMC 2GRLA 4ATGA 5IY5E 4GYYA 3CHSA 3PEVB 4HLLA 2EINE 4JA7A 5BXUA 2XRYA 4UWGA 1DNPA 2FBNA 3E32A 5E75A 4EZLA 3CVXA 2PM6A 2F8XK 3CVYA 1V54E 3D9NA 4P29A 2PQNA 3SNXA 2KCLA 3FU3A 4CCAA 4EBAG 4B94A 4XEIG 4BSXA 4ME2A 4A3VA 3IBEA 3DSTA 1MZCA 2LNIA 5ENOD 3TXNA 3PEUB 2LAIA 3AS8A 3FEXA 3U3WA 3VLDA 3R7RA 1KZPA 4PH4B 3PH0C 2OV8A 1JCQA 5A6CA 3FDHA 4L7TA 3PREA 2LAHA 1UJKA 3KSLA 5BXOA 2X3MA 3JUEA 3OTNA 4JEUA 4G24A 1XGWA 5G04C 3C3OA 1OCOE 3EHMA 3TJPA 1AWCB 4JL0A 2DYSE 3PUJA 4DLOA 3SHFA 4DK5A 3NOCD 3ZYQA 1KZOA 3FY4A 3IHYA 4EPZA 2XZDG 1EPUA 3LVRE 4B89A 2P9PG 3UM0A 1JCSA 1NFIE 5CRUA 4I1AA 4FJZA 3D9IA 3L16A 3AU4A 1UOHA 2P9NG 4B0ZA 4ANXA 4DX1A 3EHRA 3Q78A 4PUCA 2ZGDA 3L6AA 2X6JA 3S7FA 1W3BA 4GMJA 4WNEA 4U8VD 5CERB 5ENNA 3B7BA 3Q7FA 2WXKA 2KM4A 3PRZA 5HS0A 5JJTA 2PQRA 2QYJA 3L9TA 4O1PA 4YDEA 4C48B 3TL5A 4FLHA 1N95A 3P2BA 2CHZA 3JXIA 4YVQC 3D9JA 1DVPA 2PZIA 3J5PA 3V79K 2HR2A 1HS6A 5FZQA 5ITZF 4N39A 2WMNA 3APFA 5JHAA 1K8KG 3RSEG 5AN8A 1N52A 3KD7A 4JA9A 2YHEA 5G04J 3SFZA
chains in the Genus database with same CATH topology
3VLFA 4UWHA 4JEHA 2OVFA 4I9CA 3JUIA 3IEGA 4JW1A 2WXNA 5FZRA 4CT4A 1OWLA 4KYOB 3ZRHA 2CHXA 4N3AA 1H6KA 4JHKA 5G2NA 1SZ9A 2XGMA 3QOUA 1WAO1 2LSVA 4I1MA 4GU5A 4HOUA 4HLEA 4TUUA 3MJWA 4L1BA 4MKTA 5FZSA 5G05J 5FJYA 1IYGA 2WMOA 5ANRA 4KBQA 1U3CA 2VGXB 1MQSA 2VJ8A 3N71A 4FP7A 4U07A 3FTSA 3VTYA 5LP0A 4U0ZA 4EZKA 2CG3A 4MS6A 2I2OA 4A55A 2VGYA 3FTVA 1YA0A 2V4LA 2GW1A 3MEKA 4AV7A 4IN3B 3TGOA 1FVHA 2IOSA 2I1KA 2VSOE 1UW4B 4HORA 2YHCA 4GCOA 2HM8A 4OVVA 1ZU2A 5E76A 4PS8A 2FI7A 4HOQA 2OOEA 5D0OD 2MOWA 5KJMA 2AW6A 3FU0A 2I9CA 3CKCA 2BTDA 3ZFWA 2E2EA 4LUNU 2PL2A 3PDNA 2UY1A 1LF8A 1E96B 2QY7A 2ZU6B 2VTBB 3MKQA 4GYWA 3JQ1A 2WVIA 3AU5A 2X38A 3FTWA 4KXKB 4XE0A 4V3IA 4KMOA 2XPIA 3QWVA 1KT1A 3QWWA 2AXUA 4J8DA 4O6FA 3GYZA 3QK0A 4WNFA 2QFCA 3CEQA 3FUNA 4ILGA 3SBSA 4WAFA 4AJWA 1U3DA 4HOTA 5FQ7A 4LERA 1H2UA 3RJVA 5AIJA 1Y6IA 4IRUA 5LFAA 1ELKA 3FUIA 3Q47B 3ASHA 3MV3B 4N3CA 2VSYA 4BY6A 1EF1C 2V8SE 2XEVA 4BX9A 3CVUA 3FH7A 1NP7A 3CGHA 2HYZA 2L0TB 4I6JA 2ILRA 4PDXA 3ESLA 3CSFA 5CCMA 4KT6B 2I1JA 3CLJA 3LVQE 4YVOA 2X6KA 2WXMA 3OXGA 3FUKA 3FUHA 3CVLA 5J08A 5J90A 3CHPA 4FA6A 4UQYA 3L08A 3APCA 1HX8A 4WWOA 5ARGA 2R59A 2WXQA 3LY7A 4LRZA 3ZPJA 3L13A 3RRMB 3ASDA 3CVNA 5EX3A 1HXIA 3LCAA 3P1UA 1JPLA 4GZ6A 2GGFA 4L23A 2BUGA 2YQ8A 4J0UA 5KJNA 3FFLA 2UWJG 2J07A 3UX4A 2AXZA 2NC9A 2A4ZA 2J4DA 2HO1A 3HYMB 2WXHA 2WXFA 1VDYA 4ILHB 3E4BA 1OWMA 3CR3A 4CRWA 4J8FA 3MGBA 2NXPA 1NA3A 1HH8A 4C9BB 4W9RA 2M63A 1OUVA 4Q96A 2KCKA 4K0RA 4AXHA 4D10C 2WQHA 3FTXA 2CG2A 4I6GA 2KC7A 2NSZA 2PM7A 1TJFA 4NURA 3FEYA 5T3RA 3EIJA 4N2SA 2Y3AA 1Z3YA 4I17A 4GAAA 3BG1B 3GW4A 3HDXA 4KZCA 3RO2A 3SI5A 1H0AA 4GPKA 4RSYA 3AS5A 2C0MA 3U4TA 4F1SA 3I3NA 3OAWA 4UWLA 3EDTB 4GZ3A 1HO8A 2V0PA 2WPVA 3RIBA 3TXMA 4F7AA 4ACLA 5JJ7A 3CVVA 3QKYA 4U04A 4DI4A 3IHVA 5LCWC 3LEWA 3LPZA 5DIZA 4AEZC 4L2LA 1OWNA 4FHKA 4IULA 3OXLA 2AVPA 3EHNA 1JWFA 4FJYA 3FTUA 4JHRA 4U63A 2KZTB 3CVQA 5G05C 1JWGA 3T5VA 3B7TA 4G1TA 3FHEA 3LYAA 2VTBA 2J09A 2KZTA 4MLPA 4UI9C 2EQXA 4RG6A 3LDZA 4OVUA 2R17C 1HU3A 5EKQD 1UG3A 1XNFA 3S7BA 5FQ6A 5AYWD 5HQ8A 3ULQA 3QAQA 4AIFA 1MHQA 4UWFA 3CQGB 2P58C 3GZSA 3C98A 3ZW3A 1H2VC 1PAQA 1TJCA 4TV3A 4BTBA 2XGSA 3HHMA 1SQMA 5BUZA 1UN9A 5CCLA 5A23A 4U0SA 4EZJA 4G23A 3DBSA 3ESKA 4NQ0A 3UT7A 4J6IA 3CHRA 5BNWA 2YINA 3MZLB 4B8CB 2KATA 2WXIA 2CHWA 3RO3A 4GZDA 1PC2A 5LX8A 1UN8A 1E8ZA 3VLEA 1HF8A 1KT0A 4CEMA 3T8MA 4BT8A 3LY8A 1HFAA 1HZ4A 3BEEA 3LS8A 3MA5A 3O4ZA 2E0IA 2J4BA 2XRZA 2R5SA 5CHEE 4AY6A 3ZYKA 3D3MA 4JXTA 3QDNA 5M72A 3FUDA 1HG2A 1NA0A 3R7QA 3PE4A 4N5CA 3ZVVA 4WNGA 2X6HA 5FWQA 3B7RL 3CHMA 3HVEB 3B7SA 3UT4A 1OWOA 1E8YA 4C0EA 3ML9A 3CQCB 1NZNA 3EJNA 3FH5A 4FHJA 4PS3A 1Z3XA 4Y6CA 4I6EA 1PY1A 5A7DB 1JUQA 1KLXA 3TG5A 2A5UA 3FTZA 1B89A 3CIAA 3MV2B 3NZUA 3QJZA 2X6FA 3WXXA 3G2UA 4EBAA 2LSUA 4MRUA 2XQ0A 2UY1B 3AS4A 3PNTB 5CMWA 5KJKA 3S7DA 3BG0B 5ARFA 1Y8MA 3Q49B 3Q5MA 3UQ3A 3ZGQA 4F53A 2XPYA 5AJLA 5AENA 4APOA 4TRQA 3JQ0A 1EDUA 3UUXA 2Y4TA 4EQFA 4GMLA 2DCPA 3ONLA 4H7XA 4UI9K 5FT9A 3NQPA 4GA0A 4I1OB 5KCMA 3CK8A 3FH8A 3CK9A 4GA1A 3RKVA 2VSXE 4AM9A 3ZIMA 3CHOA 3IKOB 4U8HA 4ANWA 3ML8A 5CMYA 1ELRA 3SF4A 4CT0A 4BFRA 1S0PA 4NRHB 4N3BA 5BPPA 4HOSA 2RG8A 3L54A 2VGXA 2GRLA 5BW8C 4ATGA 1H19A 5ANLA 3R9AB 3LXUX 3CSTA 4G26A 4Q94A 3NF1A 4F3VA 4GYYA 1QQEA 3CHSA 3PEVB 2FEZA 2J08A 1FVFA 3TG4A 3TAXA 4ILIA 1FCHA 3I4GA 4JA7A 1X5BA 4UQXA 2J9QA 2XRYA 3PZDA 4L2YA 4C0MA 4UWGA 4HFGA 2DIWA 1DNPA 2FBNA 2OVBA 4JVSA 1TEZA 2JLBA 4JPSA 3FU5A 5E75A 4EZLA 5T4YA 3CVXA 3ZEFA 2PM6A 2WXJA 4XX5A 4APFA 5C2YA 3HIZA 3FUEA 4ACKA 3D9NA 3CVYA 3ZHEA 3QWPA 1WM5A 2IJGX 2X6IA 1GW6A 3CV0A 4P29A 2PQNA 4PS7A 1L5JA 3SNXA 2ONDA 2WM9A 4XZ4A 1BPOA 3CKBA 2KCLA 2WXPA 3FU3A 4CCAA 2KCVA 4EBAG 4E6HA 2BF0X 4B94A 5LOZA 2XHEA 4BSXA 1ELWA 4RG9A 3DPDA 4ME2A 3G2SA 4I2WA 2VQ2A 3ONKA 4R7LA 2XCCA 4XI0A 5EX0A 3U64A 4A3VA 3IBEA 4JC8A 1IHGA 3EIQC 3GZ2A 4I2ZA 2LNIA 4J8EA 3FWVA 5HI7A 1E8WA 4N2QA 3MKQB 3K9IA 3VTXA 3TXNA 3PEUB 4NACA 2LAIA 2IOLA 3MKRA 3PVLA 3LJ3A 3AS8A 1E90A 2AWIA 3FEXA 2IF4A 2L9BA 4B8AA 4GCNA 3U3WA 3IV0A 3VLDA 3R7RA 2J49A 3JYSA 3SGHA 3FUJA 4FULA 4H7YA 4M3OA 4PH4B 3QNKA 5BV0A 4ANVA 4Q69A 1H2TC 1OWPA 3ZYMA 3PH0C 4XIFA 4FU3A 3ZN3A 2VYIA 4URKA 2OV8A 2WXLA 4FADA 4U0UA 4I43A 4UQZA 5A6CA 2C0LA 3FDHA 3FUFA 3PUKA 4XKCA 4L7TA 4DPRA 3PREA 3RRNB 3ASFA 3Q4AB 2LAHA 3SBTB 1UJKA 4A1SA 4KZ0A 2X3MA 3CHQA 5FQ4A 2Q7FA 3OTNA 4G2VA 3RU0A 4JEUA 4G24A 2LO6A 3B7UX 3RK6A 1XGWA 4GB9A 3NZSA 1ZBPA 5G04C 2RD0A 2WXRA 3EHMA 3TJPA 3PS6A 3QARA 2GRMA 1EYHA 3I4RB 4G25A 3UPVA 4CDNA 3SD5A 4JL0A 4J8SA 1Z6TA 3PUJA 1E7VA 4LEUA 4DLOA 3SHFA 4DK5A 3ZYQA 4RVBA 4DLQA 3L17A 4WWNA 3CVWA 5LCWJ 1INZA 3UT8A 3FY4A 3IHYA 3PNLB 4EPZA 3KAEA 2WB2A 3Q15A 4HS2A 4BT9A 1EPUA 3LVRE 4B89A 4GZCA 4CDMA 2IU1A 1SZAA 3G2TA 4I1AA 2C2LA 4XI9A 5BV1A 2WXGA 4OYSA 3D9OA 4FJZA 2MRIA 2JEKA 4LCTA 4WNDA 4EECA 4A3TA 4CGWA 2DBAA 3URZA 1E8XA 3S7JA 4BX8A 2YNQA 3U9WA 3D9IA 4GA2A 4KVOA 4UI9J 3FULA 3L16A 3AU4A 4ABNA 4CDRA 3FU6A 1N54A 2L6JA 4I9EA 2WQ6A 3KS2A 4B0ZA 1P5QA 4HXIA 4WWPA 2IONA 2AXVA 4K03A 4AP2A 2FO7A 3O48A 3T5XA 4ANXA 5JJ6A 5JHBA 4GYOA 4PUCA 3L6AA 4CGVA 4DI3A 1IQRA 3D9MA 3GZ1A 3FUMA 2X6JA 2V5FA 1HE8A 4FC8A 3S7FA 1W3BA 4GMJA 3D9LA 4UWKA 4AY5A 5D0QD 4WNEA 5AJDA 1E7UA 3D9PA 4YNDA 3KEZA 4ANUA 5ENNA 3SZ7A 2WXKA 2KM4A 3PRZA 3RRUA 5C1DA 4GZ5A 2FF4A 5JJTA 2MHKA 2PQRA 2IQCA 3APDA 5BT1A 3ENEA 1UJJA 2IFUA 3MYVA 4G11A 3ZHEB 5FTPA 4IYPA 3TL5A 4JZYA 3UMVA 4A1GA 2WXOA 4JHJA 3JCKC 4KVMA 4XKBA 5KJLA 3B13A 3G2VA 3LKUA 3ASGA 4FLHA 3QC1A 2XCBA 5FQ8A 4DJAA 3G2WA 4E85A 3U66A 3P2BA 4BTAA 2VSNA 1A17A 4BWRA 3MCXA 3S2AA 3OXFA 4HVBA 2CHZA 5T8IA 2CFZA 4YVQC 4AVXA 3D9JA 1DVPA 1HG5A 2PZIA 4WUYA 5G55A 3D9KA 1WY6A 5DBKA 1QZ2A 2HR2A 3FP3A 1HS6A 5FZQA 2XPZA 4AOFA 3MX3A 2Y4UA 4N39A 2WMNA 3APFA 3L22A 2I6HA 5JHAA 2WQ7A 3I5PA 1N52A 3QB2A 3KD7A 3CVPA 2CFUA 4JA9A 4QFVA 3PE3A 5EDSA 4Y6WA 2YHEA 4FLBA 3ZYLA 2L0IA 3ZXSA 5G04J 2FULA 1QNFA 2XGOA 1IQUA 3CK7A 3HVEA 3FTYA 3LY9A 3SFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBP A;  3Q5M A;  2KCK A;  5G04 C;  3UQ3 A;  3ZGQ A;  1OUV A;  2WQH A;  4I9C A;  3UUX A;  2KC7 A;  3IEG A;  4APO A;  2Y4T A;  5FZR A;  4EQF A;  4UI9 K;  4H7X A;  4KYO B;  5FT9 A;  4N2S A;  4G25 A;  4I17 A;  4GA0 A;  3UPV A;  4JL0 A;  4LEU A;  4N3A A;  3GW4 A;  3CK8 A;  4GA1 A;  3CK9 A;  3RKV A;  3RO2 A;  4AM9 A;  3QOU A;  2XGM A;  4GPK A;  1WAO 1;  2LSV A;  2C0M A;  3AS5 A;  4HOU A;  3U4T A;  5LCW J;  1ELR A;  3SF4 A;  3KAE A;  3Q15 A;  4NRH B;  4N3B A;  5FZS A;  3EDT B;  4GZ3 A;  5FJY A;  5G05 J;  4BT9 A;  4HOS A;  4KBQ A;  1IYG A;  2VGX A;  2WPV A;  5BW8 C;  3RIB A;  2VGX B;  3N71 A;  4U07 A;  3VTY A;  3R9A B;  4U0Z A;  4I1A A;  2C2L A;  5JJ7 A;  4G26 A;  2VGY A;  4XI9 A;  1YA0 A;  3NF1 A;  2GW1 A;  3MEK A;  4F3V A;  3QKY A;  4GYY A;  4IN3 B;  4U04 A;  1QQE A;  4WND A;  4CGW A;  2DBA A;  3URZ A;  3TGO A;  2FEZ A;  4HOR A;  3S7J A;  3TG4 A;  2YHC A;  4GCO A;  3LPZ A;  3TAX A;  1FCH A;  5LCW C;  4GA2 A;  1ZU2 A;  4UI9 J;  2FI7 A;  4HOQ A;  2OOE A;  4JA7 A;  5D0O D;  4UQX A;  5DIZ A;  4ABN A;  5KJM A;  4CDR A;  2J9Q A;  2L6J A;  4I9E A;  3KS2 A;  3CKC A;  1P5Q A;  2FBN A;  2E2E A;  3OXL A;  3ZFW A;  2AVP A;  2JLB A;  2PL2 A;  3PDN A;  2FO7 A;  2UY1 A;  4JHR A;  3O48 A;  5JJ6 A;  1E96 B;  3CVQ A;  4GYO A;  5G05 C;  4CGV A;  4GYW A;  4G1T A;  3LYA A;  3GZ1 A;  2V5F A;  4UI9 C;  3QWP A;  1WM5 A;  4RG6 A;  3ZHE A;  3CV0 A;  3S7F A;  1W3B A;  4KXK B;  2PQN A;  4AY5 A;  5D0Q D;  5EKQ D;  4WNE A;  1XNF A;  2OND A;  3S7B A;  3CKB A;  5AYW D;  5HQ8 A;  2KCL A;  2XPI A;  1KT1 A;  3QWV A;  2KCV A;  4YND A;  3ULQ A;  3SZ7 A;  4AIF A;  3QWW A;  4B94 A;  4J8D A;  2P58 C;  3GYZ A;  1ELW A;  4O6F A;  2QFC A;  3CEQ A;  4ME2 A;  4RG9 A;  4WNF A;  4I2W A;  1TJC A;  2VQ2 A;  5EX0 A;  2XCC A;  4XI0 A;  2XGS A;  4GZ5 A;  2FF4 A;  4BTB A;  5JJT A;  2MHK A;  2PQR A;  5CCL A;  4HOT A;  4U0S A;  3RJV A;  1IHG A;  5BT1 A;  4G23 A;  2IFU A;  3ZHE B;  3Q47 B;  3GZ2 A;  4I2Z A;  2LNI A;  3ASH A;  3MV3 B;  2VSY A;  3ESK A;  3FWV A;  4J8E A;  4NQ0 A;  4N3C A;  5FTP A;  2XEV A;  5HI7 A;  3K9I A;  3S7D A;  3VTX A;  5BNW A;  4N2Q A;  2HYZ A;  5KJL A;  2KAT A;  3RO3 A;  3LKU A;  1PC2 A;  3ASG A;  3MKR A;  5CCM A;  2XCB A;  3AS8 A;  1KT0 A;  4YVO A;  2IF4 A;  4BTA A;  3OXG A;  4BT8 A;  2VSN A;  1A17 A;  3LY8 A;  4GCN A;  3CVL A;  1HZ4 A;  3BEE A;  4BWR A;  3MA5 A;  3U3W A;  3JYS A;  2R5S A;  3OXF A;  4UQY A;  5CHE E;  4AY6 A;  4H7Y A;  4YVQ C;  5ARG A;  3QDN A;  5C1D A;  5M72 A;  1NA0 A;  4WUY A;  2PZI A;  3LY7 A;  3ZPJ A;  3PE4 A;  4N5C A;  4XIF A;  4WNG A;  5DBK A;  3ASD A;  1QZ2 A;  2HR2 A;  2VYI A;  3CVN A;  3FP3 A;  5EX3 A;  5FZQ A;  1HXI A;  4U0U A;  3LCA A;  3ZN3 A;  4GZ6 A;  2Y4U A;  4UQZ A;  5A6C A;  2BUG A;  2C0L A;  2YQ8 A;  1NZN A;  4J0U A;  4N39 A;  5KJN A;  3FFL A;  2UWJ G;  2I6H A;  4Y6C A;  2NC9 A;  3ASF A;  3Q4A B;  3KD7 A;  2HO1 A;  3CVP A;  3HYM B;  4JA9 A;  5A7D B;  4A1S A;  1KLX A;  3PE3 A;  4Y6W A;  3TG5 A;  3E4B A;  2Q7F A;  1B89 A;  3MV2 B;  4G2V A;  4J8F A;  5G04 J;  1NA3 A;  2XGO A;  3RU0 A;  1HH8 A;  3WXX A;  4G24 A;  2LSU A;  3CK7 A;  4W9R A;  2UY1 B;  3AS4 A;  5KJK A;  3LY9 A;  5ARF A;  1Y8M A;  3Q49 B; 
#chains in the Genus database with same CATH topology
 2OVF A;  2WXN A;  5FZR A;  3ZRH A;  3ZXP A;  3HXD A;  1H6K A;  5G2N A;  2LSV A;  4HLE A;  4TUU A;  2B0O E;  4L1B A;  1D8D A;  2VJ8 A;  3C3Q A;  4EZK A;  3MEK A;  2IOS A;  2I1K A;  1ZU2 A;  4PS8 A;  2OOE A;  2MOW A;  3CKC A;  2BKK B;  1ZB1 A;  2QY7 A;  2VTB B;  3SO8 A;  1TNO A;  3AU5 A;  4V3I A;  2QZA A;  1DCQ A;  4AJW A;  1U3D A;  5FQ7 A;  1H2U A;  5AIJ A;  5LFA A;  2R2L A;  1ELK A;  3Q47 B;  3ASH A;  3MV3 B;  3CVU A;  2L0T B;  5JMN D;  3ESL A;  3NOG D;  5CCM A;  4KT6 B;  3LVQ E;  4YVO A;  3FUH A;  1OCC E;  5J90 A;  1Z5S C;  4UQY A;  1N4P A;  3ZPJ A;  4YDO A;  5EX3 A;  4L23 A;  5KJN A;  3V31 A;  2J07 A;  2AXZ A;  2GRN B;  2NC9 A;  2J4D A;  2B6C A;  3ULY A;  2WXF A;  4J8F A;  1NA3 A;  1HH8 A;  4RLY A;  1OUV A;  2ZIS A;  2H6H A;  4K0R A;  1WG0 A;  4AXH A;  4D10 C;  4CZ2 D;  2NSZ A;  4NUR A;  2HE0 A;  1N94 A;  3SI5 A;  2NYJ A;  3ABK E;  3T8K A;  3EDT B;  4GZ3 A;  1HO8 A;  2WPV A;  3RIB A;  3DPY A;  3CVV A;  4U04 A;  3TWR A;  5LCW C;  3Q75 A;  1OWN A;  4FHK A;  2AVP A;  1JWF A;  3TWW A;  1SA4 A;  3CVQ A;  5G05 C;  4JD2 G;  4MLP A;  1XNF A;  5FQ6 A;  5HQ8 A;  5KWD A;  3QAQ A;  2BED A;  4TUM A;  4UWF A;  3ASO E;  2P58 C;  3C98 A;  4TV3 A;  4BTB A;  2A5E A;  2IY0 C;  4G23 A;  3UTM A;  4NQ0 A;  3TWV A;  3RO3 A;  4GZD A;  1UN8 A;  1BU9 A;  4CEM A;  3TWX A;  1HFA A;  1HZ4 A;  3BEE A;  3O4Z A;  4EHM A;  2XRZ A;  3Q9N C;  2DZO A;  3Q9U C;  5M72 A;  3ABL E;  4WNG A;  3HVE B;  3B7S A;  4HRL A;  1E8Y A;  3CQC B;  3J5Q B;  1N0R A;  4BET A;  3F6Q A;  3C3R A;  2A5U A;  3MV2 B;  3NZU A;  2X6F A;  3G2U A;  3L82 A;  1S70 B;  4MRU A;  2UY1 B;  5CMW A;  5KJK A;  3BG0 B;  3ZGQ A;  5AJL A;  5AEN A;  4K5B A;  2Y4T A;  3ONL A;  3NQP A;  4GA0 A;  1SW6 A;  4GA1 A;  4N3B A;  4HOS A;  2RG8 A;  2VGX A;  1H19 A;  5ANL A;  2V5Q C;  3DRA A;  4Q94 A;  3NF1 A;  2J08 A;  3ASN E;  5AAR A;  3ZUV B;  4LSZ E;  4L2Y A;  1H6O A;  4HFG A;  2DIW A;  1TEZ A;  2JLB A;  5T4Y A;  4XX5 A;  2P9U G;  3HIZ A;  3DWL G;  2X6I A;  4DUI A;  4XZ4 A;  2MYO A;  2WXP A;  1D9S A;  5EX0 A;  4R7L A;  4I2W A;  2VQ2 A;  3ONK A;  2XCC A;  3PZ2 A;  4JC8 A;  3GZ2 A;  1A5E A;  3FWV A;  3VTX A;  4TXP A;  5KNH D;  2IOL A;  2AWI A;  5CED B;  4GCN A;  3IV0 A;  3DEO A;  1H2T C;  4UQZ A;  3EU9 A;  2C0L A;  4K5C A;  4GTM A;  3RRN B;  3SBT B;  4KZ0 A;  3CHQ A;  1TN7 A;  2Q7F A;  1O1T A;  3AJI A;  5EIL A;  2LO6 A;  3B7U X;  3RK6 A;  4DX7 D;  3NZS A;  2RD0 A;  2V4H C;  3PS6 A;  2GRM A;  1EYH A;  4G25 A;  3UPV A;  3SD5 A;  4LEU A;  1Z6T A;  3BQO A;  3PNL B;  3KAE A;  2WB2 A;  4HS2 A;  4BT9 A;  2IU1 A;  2C2L A;  5BV1 A;  2WXG A;  2MRI A;  4LCT A;  4WND A;  4CGW A;  1E8X A;  4BX8 A;  3U9W A;  1O5M A;  4UI9 J;  4RQI A;  3FU6 A;  2L6J A;  3UI2 A;  2WQ6 A;  4L9P A;  4K03 A;  2AXV A;  2JAB A;  2FO7 A;  3SFY A;  5JHB A;  3KEA A;  4DI3 A;  3GZ1 A;  3FUM A;  1HE8 A;  4FC8 A;  3D9L A;  4UWK A;  4AY5 A;  4QQI A;  4YND A;  3SZ7 A;  3RRU A;  5C1D A;  4GZ5 A;  2Y69 E;  3ULE G;  3C5R A;  3UIP C;  3ENE A;  3MYV A;  5FTP A;  4IYP A;  4JZY A;  3UMV A;  4KVM A;  3LKU A;  2R03 A;  3ASG A;  4DRX E;  2XCB A;  4E85 A;  4BTA A;  1A17 A;  2P9L G;  2OEW A;  3OXF A;  4HVB A;  1MJ0 A;  4AVX A;  4OAU C;  1LTX A;  3HG0 D;  1WY6 A;  5DBK A;  1QZ2 A;  3FP3 A;  2RFA A;  4GTV A;  3L22 A;  2I6H A;  3BU8 A;  5EDS A;  4Y6W A;  3ZYL A;  2FUL A;  3TWT A;  1IQU A;  3HVE A;  4F1P A;  1X81 A;  4UWH A;  3IEG A;  1OWL A;  2CHX A;  2XEE A;  4GU5 A;  5FZS A;  4MKT A;  1IYG A;  5FJY A;  2VGX B;  3VTY A;  4FP7 A;  4U07 A;  3AG1 E;  1BD8 A;  4A55 A;  2VGY A;  1MYO A;  3FTV A;  4IN3 B;  2EIK E;  5AQ9 A;  1UW4 B;  2XZT G;  2HM8 A;  4LNU D;  4HOQ A;  5B1A E;  2XEN A;  3ZFW A;  2E2E A;  2ZGG A;  2UY1 A;  1LF8 A;  1E96 B;  2ZU6 B;  4HBD A;  3MKQ A;  4GYW A;  3JQ1 A;  2WVI A;  4UUC A;  1SA5 A;  2X38 A;  2P2C P;  2GRR B;  4O6F A;  2QFC A;  3CEQ A;  3EU5 A;  4HOT A;  1Y6I A;  4IRU A;  2AJA A;  2XEV A;  3FH7 A;  3HXC A;  3ABM E;  2ILR A;  4PDX A;  2J8S D;  3CSF A;  3D9H A;  2XS8 A;  3FUK A;  2IO2 C;  1HX8 A;  4WWO A;  5ARG A;  2R59 A;  3PZ3 A;  2WXQ A;  4LRZ A;  3ASD A;  2YQ8 A;  4J0U A;  3FFL A;  4U95 D;  3DSV A;  4U96 D;  3MGB A;  2NXP A;  4GPM A;  2WQH A;  4I6G A;  2KC7 A;  2PM7 A;  1TJF A;  3EIJ A;  3BG1 B;  3HDX A;  1H0A A;  3Q73 A;  3U4T A;  4F1S A;  2V0P A;  3TXM A;  4HQD A;  5HKP A;  5JJ7 A;  1K1B A;  3IHV A;  3LEW A;  3LPZ A;  4LG6 A;  4L2L A;  2LXM A;  5KNG A;  3OXL A;  3EHN A;  3V30 A;  4U63 A;  3E33 A;  3T5V A;  2VTB A;  2J09 A;  2KZT A;  2EQX A;  4RG6 A;  2LXL A;  4OVU A;  1TNZ A;  3CQG B;  5FIO A;  1PAQ A;  2PNN A;  5BUZ A;  5CBO A;  5A23 A;  4U0S A;  2ZIR A;  3UM2 A;  4J6I A;  1N9A A;  2YIN A;  4B8C B;  2KAT A;  1PC2 A;  3BUA A;  5LX8 A;  3VLE A;  1TN8 A;  2GRQ B;  3T8M A;  1TNU A;  3LS8 A;  3MA5 A;  2R5S A;  4AY6 A;  3ZYK A;  3D3M A;  4JXT A;  3R7Q A;  3ZVV A;  4JB8 P;  3CHM A;  3FH5 A;  4FHJ A;  3ZNG A;  1B89 A;  4G8K A;  3AS4 A;  4B93 B;  3S7D A;  5ARF A;  3Q49 B;  3UQ3 A;  4F53 A;  4F6R D;  4APO A;  3JQ0 A;  1IKN D;  4GML A;  5ENS D;  5FT9 A;  4J7W A;  3FH8 A;  5H7P A;  3CHO A;  3IKO B;  4HI9 A;  5CMY A;  4BFR A;  1S0P A;  3L54 A;  2XS1 A;  5BW8 C;  3R9A B;  3DSX A;  2FEZ A;  3SFX A;  1FCH A;  3I4G A;  3AG3 E;  1X5B A;  2J9Q A;  4C0M A;  4JVS A;  2OVB A;  4JPS A;  5B1B E;  3FUE A;  4K5A B;  3ZHE A;  3QWP A;  1WM5 A;  3CV0 A;  4PS7 A;  1BPO A;  5ENR D;  4E6H A;  5LOZ A;  1ELW A;  3EIQ C;  4J8E A;  1E8W A;  2H6F A;  1YMP A;  1OY3 D;  3MKR A;  3PVL A;  4HNA D;  2P9I G;  4B8A A;  3FUJ A;  4FUL A;  4M3O A;  3QNK A;  2L6B A;  5BV0 A;  4Q69 A;  4XIF A;  4FU3 A;  4FAD A;  2RKK A;  4U0U A;  4I43 A;  3PZ1 A;  3ZKJ A;  4XKC A;  5CEC B;  4DPR A;  3ASF A;  2VGE A;  3UIN C;  4A1S A;  3E37 A;  4G2V A;  1V55 E;  1OCZ E;  5HRY A;  4GB9 A;  3QAR A;  4LNG A;  3I4R B;  4CDN A;  1E7V A;  4RVB A;  3RAU A;  3CVW A;  5LCW J;  3UT8 A;  5EYL A;  1BI7 B;  4OYS A;  2QYU A;  3D9O A;  4EEC A;  4A3T A;  3URZ A;  3S7J A;  2YNQ A;  4CDR A;  4M7C A;  4HXI A;  4AP2 A;  2ION A;  3T5X A;  5JJ6 A;  4CYM D;  3DSW A;  1IQR A;  3D9M A;  2H6G A;  2V5F A;  5D0Q D;  3D9P A;  2GRO B;  3DSS A;  5EIB E;  2FF4 A;  2QC9 A;  1UJJ A;  2IFU A;  4G11 A;  5EN5 D;  4A1G A;  2GRP B;  3Q7A A;  3JCK C;  3B13 A;  3QC1 A;  5FQ8 A;  3G2W A;  3U66 A;  4BSZ B;  4BWR A;  3MCX A;  3S2A A;  5T8I A;  2CFZ A;  1HG5 A;  3D9K A;  2XPZ A;  4AOF A;  3MX3 A;  2Y4U A;  3DXK G;  3QB2 A;  2Y1L E;  3PE3 A;  4FLB A;  1NL4 A;  3CK7 A;  3FTY A;  4YDY A;  5AQA A;  3UXG A;  3LY9 A;  2EIM E;  4J8Y A;  3JUI A;  4CT4 A;  4G8L A;  4O1O A;  1K1A A;  3WG7 E;  4JHK A;  2DVW A;  1WAO 1;  3LJN A;  2WMO A;  4KBQ A;  1MQS A;  4U0Z A;  2CG3 A;  1YA0 A;  4AV7 A;  3NAW A;  1IXV A;  3TGO A;  2VSO E;  4HOR A;  4GCO A;  4OVV A;  1KPS B;  5E76 A;  2P9S G;  2FI7 A;  5D0O D;  5KJM A;  2AW6 A;  3FU0 A;  5B3S E;  3PDN A;  2F37 A;  4O60 A;  3FTW A;  1RZ4 A;  4KXK B;  4XE0 A;  4KMO A;  4Z68 A;  2XPI A;  3QWV A;  1KT1 A;  3QWW A;  2AXU A;  4J8D A;  1YYH A;  4WNF A;  3FUN A;  1MX2 A;  1N4S A;  4U7E B;  4WAF A;  3ZU7 B;  4LER A;  4N3C A;  4BY6 A;  2VSY A;  4ZHB A;  4GTQ A;  1EF1 C;  2V8S E;  3CGH A;  2HYZ A;  4I6J A;  3CLJ A;  4FA6 A;  3LY7 A;  3L13 A;  3RRM B;  1HXI A;  3LCA A;  4GZ6 A;  2BUG A;  2A4Z A;  1S64 A;  3HYM B;  2XEH A;  1VDY A;  3E4B A;  4CRW A;  4YDW A;  1OCR E;  4C9B B;  2M63 A;  2BKG A;  1TNY A;  5EYP F;  4Q96 A;  2KCK A;  3PZ4 A;  5T3R A;  2Y3A A;  1Z3Y A;  4GAA A;  3AG4 E;  3GW4 A;  1TYQ G;  3RO2 A;  2FO1 E;  2H6I A;  5EID A;  3I3N A;  3OAW A;  2EIJ E;  4ACL A;  4DI4 A;  3NB2 A;  5DIZ A;  4AEZ C;  5AAO A;  3FTU A;  4JHR A;  1O1R A;  3B7T A;  4G1T A;  3FHE A;  3LYA A;  1TNB A;  4UI9 C;  3LDZ A;  2IEJ A;  2R17 C;  1UG3 A;  1FPP A;  1RW2 A;  5AYW D;  3ULQ A;  4AIF A;  3ZW3 A;  1TJC A;  5CCL A;  3DBS A;  2F0Y A;  3UKR G;  3ESK A;  5BNW A;  2OCC E;  3T9K A;  3W9G A;  3AAA C;  1HF8 A;  1KT0 A;  2J4B A;  4NIK A;  3QDN A;  1YCS B;  3FUD A;  1NA0 A;  3SY2 A;  3PE4 A;  3W9F A;  5FWQ A;  3B7R L;  3UT4 A;  4C0E A;  1G3N B;  1NZN A;  3EJN A;  1Z3X A;  4Y6C A;  4I6E A;  1PY1 A;  5A7D B;  1JUQ A;  3IXE A;  1KLX A;  3TG5 A;  5KBA A;  3DSU A;  2LSU A;  3DEP A;  4OAV B;  3UUX A;  2DCP A;  3CK8 A;  3ZIM A;  2VSX E;  4U8H A;  4ANW A;  3SF4 A;  4CT0 A;  1U2V G;  3LXU X;  3CST A;  3UKU G;  4G26 A;  4F3V A;  3Q79 A;  1QQE A;  1DC2 A;  3UIO C;  1FVF A;  3TG4 A;  3TAX A;  4ILI A;  1LD7 A;  4UQX A;  3EUV A;  3PZD A;  1BLX B;  3FU5 A;  3ZEF A;  1BI8 B;  1S63 A;  2WXJ A;  4APF A;  3V2X A;  3TWS A;  5C2Y A;  2KBX A;  4ACK A;  2IJG X;  1GW6 A;  1L5J A;  2OND A;  2WM9 A;  2ETB A;  3CKB A;  2KCV A;  2BF0 X;  2XHE A;  4RG9 A;  3DPD A;  3G2S A;  1AP7 A;  3U64 A;  4XI0 A;  1IHG A;  3AG2 E;  4I2Z A;  5HI7 A;  4N2Q A;  3MKQ B;  3K9I A;  4NAC A;  3E30 A;  3LJ3 A;  1E90 A;  2ETA A;  2IF4 A;  5D66 A;  2L9B A;  3NBN B;  2J49 A;  3JYS A;  3SGH A;  4H7Y A;  4ANV A;  1OWP A;  3ZYM A;  3HRA A;  3HXF A;  3ZN3 A;  2VYI A;  4URK A;  2WXL A;  1FT2 A;  2R02 A;  1LD8 A;  3FUF A;  3PUK A;  2P9K G;  3Q4A B;  5FQ4 A;  3RU0 A;  1ZBP A;  2WXR A;  4J8S A;  5ENT D;  4DLQ A;  3L17 A;  4WWN A;  1INZ A;  2R05 A;  3Q15 A;  4HRM B;  4GZC A;  4CDM A;  1SZA A;  3G2T A;  4XI9 A;  2JEK A;  2DBA A;  4GA2 A;  4KVO A;  3FUL A;  4ABN A;  1N54 A;  4I9E A;  3KS2 A;  1P5Q A;  4WWP A;  4TXR A;  3O48 A;  4GYO A;  4CGV A;  1N4R A;  5AJD A;  1E7U A;  4A63 B;  3KEZ A;  4ANU A;  2MHK A;  4U8Y D;  4HRN A;  2IQC A;  3APD A;  4TXQ A;  5BT1 A;  4ATZ D;  3ZHE B;  4BEP A;  1OXJ A;  2WXO A;  4JHJ A;  1MX4 A;  4XKB A;  5KJL A;  4HI8 A;  3G2V A;  2RFM A;  4DJA A;  2VSN A;  4DX2 A;  3EHQ A;  1WDY A;  1IHB A;  4WUY A;  5G55 A;  1TR4 A;  2KXP C;  2WQ7 A;  3I5P A;  2CFU A;  3CVP A;  4QFV A;  2L0I A;  3ZXS A;  4BES A;  2XGO A;  1QNF A;  3DXM G;  3VLF A;  4GTR A;  4JEH A;  4I9C A;  4JW1 A;  3SQV A;  4KYO B;  4MBG A;  4N3A A;  5ENP D;  1SZ9 A;  2XGM A;  3QOU A;  4I1M A;  4HOU A;  1N11 A;  4X8Q A;  3MJW A;  5G05 J;  4LNB A;  5ANR A;  1U3C A;  3N71 A;  5LP0 A;  3FTS A;  5ENQ D;  3E34 A;  4MS6 A;  2I2O A;  2V4L A;  2GW1 A;  1FVH A;  2YHC A;  2I9C A;  2BTD A;  4LUN U;  2PL2 A;  5CEA A;  5FIN A;  1JCR A;  2F8Y A;  3GYZ A;  3QK0 A;  4ILG A;  3SBS A;  3X2Q E;  3RJV A;  3FUI A;  1QYM A;  5D2M C;  2OEV A;  2LUH A;  4GTO A;  4BX9 A;  2ETC A;  1NP7 A;  1SVX A;  2I1J A;  2X6K A;  2WXM A;  3OXG A;  3CVL A;  5J08 A;  3CHP A;  1O1S A;  3L08 A;  3APC A;  1D8E A;  3CVN A;  3JXJ A;  3P1U A;  1JPL A;  3TWU A;  2GGF A;  4HB5 A;  1MX6 A;  2UWJ G;  3UX4 A;  2Y0B G;  1N4Q A;  3KSQ A;  2HO1 A;  2WXH A;  4ILH B;  1OWM A;  3CR3 A;  4W9R A;  1DCE A;  3TWQ A;  4GMR A;  3FTX A;  2CG2 A;  3FEY A;  5AQB A;  4N2S A;  4I17 A;  4KZC A;  4GPK A;  4RSY A;  3AS5 A;  2C0M A;  4UWL A;  4BER A;  3HXB A;  3HXE A;  4F7A A;  4DX5 D;  3QKY A;  5JA4 D;  1Q2Z A;  2DZN A;  4GTS A;  2EIL E;  2ZXW E;  4ZFH A;  5AQ7 A;  4IUL A;  1QBQ A;  4FJY A;  2KZT B;  1JWG A;  2DYR E;  4GTT A;  1HU3 A;  5EKQ D;  3S7B A;  3V2O A;  4N5Q A;  1MHQ A;  3GZS A;  5CBN A;  1H2V C;  3B95 A;  1OT8 A;  2XGS A;  3HHM A;  1SQM A;  1UN9 A;  4EZJ A;  1FT1 A;  1K3Z D;  5CRV A;  3UT7 A;  3CHR A;  3C72 A;  3MZL B;  2WXI A;  3UM1 A;  1N0Q A;  2CHW A;  3R9M A;  1E8Z A;  4BT8 A;  3LY8 A;  2E0I A;  1NI1 A;  4GTP A;  5CHE E;  2DWZ A;  1HG2 A;  4N5C A;  2X6H A;  1OWO A;  3ML9 A;  4PS3 A;  3UM3 A;  1TN6 A;  3FTZ A;  3CIA A;  3QJZ A;  3WXX A;  4EBA A;  2XQ0 A;  3PNT B;  1Y8M A;  3Q5M A;  2XPY A;  4TRQ A;  1EDU A;  2IO3 C;  4EQF A;  4UI9 K;  4H7X A;  1H6P A;  4I1O B;  5KCM A;  3CK9 A;  3RKV A;  4AM9 A;  3ML8 A;  1ELR A;  4NRH B;  4DX6 D;  5BPP A;  3ISM C;  2GRL A;  4ATG A;  5IY5 E;  4GYY A;  3CHS A;  3PEV B;  4HLL A;  2EIN E;  4JA7 A;  5BXU A;  2XRY A;  4UWG A;  1DNP A;  2FBN A;  3E32 A;  5E75 A;  4EZL A;  3CVX A;  2PM6 A;  2F8X K;  3CVY A;  1V54 E;  3D9N A;  4P29 A;  2PQN A;  3SNX A;  2KCL A;  3FU3 A;  4CCA A;  4EBA G;  4B94 A;  4XEI G;  4BSX A;  4ME2 A;  4A3V A;  3IBE A;  3DST A;  1MZC A;  2LNI A;  5ENO D;  3TXN A;  3PEU B;  2LAI A;  3AS8 A;  3FEX A;  3U3W A;  3VLD A;  3R7R A;  1KZP A;  4PH4 B;  3PH0 C;  2OV8 A;  1JCQ A;  5A6C A;  3FDH A;  4L7T A;  3PRE A;  2LAH A;  1UJK A;  3KSL A;  5BXO A;  2X3M A;  3JUE A;  3OTN A;  4JEU A;  4G24 A;  1XGW A;  5G04 C;  3C3O A;  1OCO E;  3EHM A;  3TJP A;  1AWC B;  4JL0 A;  2DYS E;  3PUJ A;  4DLO A;  3SHF A;  4DK5 A;  3NOC D;  3ZYQ A;  1KZO A;  3FY4 A;  3IHY A;  4EPZ A;  2XZD G;  1EPU A;  3LVR E;  4B89 A;  2P9P G;  3UM0 A;  1JCS A;  1NFI E;  5CRU A;  4I1A A;  4FJZ A;  3D9I A;  3L16 A;  3AU4 A;  1UOH A;  2P9N G;  4B0Z A;  4ANX A;  4DX1 A;  3EHR A;  3Q78 A;  4PUC A;  2ZGD A;  3L6A A;  2X6J A;  3S7F A;  1W3B A;  4GMJ A;  4WNE A;  4U8V D;  5CER B;  5ENN A;  3B7B A;  3Q7F A;  2WXK A;  2KM4 A;  3PRZ A;  5HS0 A;  5JJT A;  2PQR A;  2QYJ A;  3L9T A;  4O1P A;  4YDE A;  4C48 B;  3TL5 A;  4FLH A;  1N95 A;  3P2B A;  2CHZ A;  3JXI A;  4YVQ C;  3D9J A;  1DVP A;  2PZI A;  3J5P A;  3V79 K;  2HR2 A;  1HS6 A;  5FZQ A;  5ITZ F;  4N39 A;  2WMN A;  3APF A;  5JHA A;  1K8K G;  3RSE G;  5AN8 A;  1N52 A;  3KD7 A;  4JA9 A;  2YHE A;  5G04 J;  3SFZ A; 
#chains in the Genus database with same CATH homology
 3VLF A;  4UWH A;  4JEH A;  2OVF A;  4I9C A;  3JUI A;  3IEG A;  4JW1 A;  2WXN A;  5FZR A;  4CT4 A;  1OWL A;  4KYO B;  3ZRH A;  2CHX A;  4N3A A;  1H6K A;  4JHK A;  5G2N A;  1SZ9 A;  2XGM A;  3QOU A;  1WAO 1;  2LSV A;  4I1M A;  4GU5 A;  4HOU A;  4HLE A;  4TUU A;  3MJW A;  4L1B A;  4MKT A;  5FZS A;  5G05 J;  5FJY A;  1IYG A;  2WMO A;  5ANR A;  4KBQ A;  1U3C A;  2VGX B;  1MQS A;  2VJ8 A;  3N71 A;  4FP7 A;  4U07 A;  3FTS A;  3VTY A;  5LP0 A;  4U0Z A;  4EZK A;  2CG3 A;  4MS6 A;  2I2O A;  4A55 A;  2VGY A;  3FTV A;  1YA0 A;  2V4L A;  2GW1 A;  3MEK A;  4AV7 A;  4IN3 B;  3TGO A;  1FVH A;  2IOS A;  2I1K A;  2VSO E;  1UW4 B;  4HOR A;  2YHC A;  4GCO A;  2HM8 A;  4OVV A;  1ZU2 A;  5E76 A;  4PS8 A;  2FI7 A;  4HOQ A;  2OOE A;  5D0O D;  2MOW A;  5KJM A;  2AW6 A;  3FU0 A;  2I9C A;  3CKC A;  2BTD A;  3ZFW A;  2E2E A;  4LUN U;  2PL2 A;  3PDN A;  2UY1 A;  1LF8 A;  1E96 B;  2QY7 A;  2ZU6 B;  2VTB B;  3MKQ A;  4GYW A;  3JQ1 A;  2WVI A;  3AU5 A;  2X38 A;  3FTW A;  4KXK B;  4XE0 A;  4V3I A;  4KMO A;  2XPI A;  3QWV A;  1KT1 A;  3QWW A;  2AXU A;  4J8D A;  4O6F A;  3GYZ A;  3QK0 A;  4WNF A;  2QFC A;  3CEQ A;  3FUN A;  4ILG A;  3SBS A;  4WAF A;  4AJW A;  1U3D A;  4HOT A;  5FQ7 A;  4LER A;  1H2U A;  3RJV A;  5AIJ A;  1Y6I A;  4IRU A;  5LFA A;  1ELK A;  3FUI A;  3Q47 B;  3ASH A;  3MV3 B;  4N3C A;  2VSY A;  4BY6 A;  1EF1 C;  2V8S E;  2XEV A;  4BX9 A;  3CVU A;  3FH7 A;  1NP7 A;  3CGH A;  2HYZ A;  2L0T B;  4I6J A;  2ILR A;  4PDX A;  3ESL A;  3CSF A;  5CCM A;  4KT6 B;  2I1J A;  3CLJ A;  3LVQ E;  4YVO A;  2X6K A;  2WXM A;  3OXG A;  3FUK A;  3FUH A;  3CVL A;  5J08 A;  5J90 A;  3CHP A;  4FA6 A;  4UQY A;  3L08 A;  3APC A;  1HX8 A;  4WWO A;  5ARG A;  2R59 A;  2WXQ A;  3LY7 A;  4LRZ A;  3ZPJ A;  3L13 A;  3RRM B;  3ASD A;  3CVN A;  5EX3 A;  1HXI A;  3LCA A;  3P1U A;  1JPL A;  4GZ6 A;  2GGF A;  4L23 A;  2BUG A;  2YQ8 A;  4J0U A;  5KJN A;  3FFL A;  2UWJ G;  2J07 A;  3UX4 A;  2AXZ A;  2NC9 A;  2A4Z A;  2J4D A;  2HO1 A;  3HYM B;  2WXH A;  2WXF A;  1VDY A;  4ILH B;  3E4B A;  1OWM A;  3CR3 A;  4CRW A;  4J8F A;  3MGB A;  2NXP A;  1NA3 A;  1HH8 A;  4C9B B;  4W9R A;  2M63 A;  1OUV A;  4Q96 A;  2KCK A;  4K0R A;  4AXH A;  4D10 C;  2WQH A;  3FTX A;  2CG2 A;  4I6G A;  2KC7 A;  2NSZ A;  2PM7 A;  1TJF A;  4NUR A;  3FEY A;  5T3R A;  3EIJ A;  4N2S A;  2Y3A A;  1Z3Y A;  4I17 A;  4GAA A;  3BG1 B;  3GW4 A;  3HDX A;  4KZC A;  3RO2 A;  3SI5 A;  1H0A A;  4GPK A;  4RSY A;  3AS5 A;  2C0M A;  3U4T A;  4F1S A;  3I3N A;  3OAW A;  4UWL A;  3EDT B;  4GZ3 A;  1HO8 A;  2V0P A;  2WPV A;  3RIB A;  3TXM A;  4F7A A;  4ACL A;  5JJ7 A;  3CVV A;  3QKY A;  4U04 A;  4DI4 A;  3IHV A;  5LCW C;  3LEW A;  3LPZ A;  5DIZ A;  4AEZ C;  4L2L A;  1OWN A;  4FHK A;  4IUL A;  3OXL A;  2AVP A;  3EHN A;  1JWF A;  4FJY A;  3FTU A;  4JHR A;  4U63 A;  2KZT B;  3CVQ A;  5G05 C;  1JWG A;  3T5V A;  3B7T A;  4G1T A;  3FHE A;  3LYA A;  2VTB A;  2J09 A;  2KZT A;  4MLP A;  4UI9 C;  2EQX A;  4RG6 A;  3LDZ A;  4OVU A;  2R17 C;  1HU3 A;  5EKQ D;  1UG3 A;  1XNF A;  3S7B A;  5FQ6 A;  5AYW D;  5HQ8 A;  3ULQ A;  3QAQ A;  4AIF A;  1MHQ A;  4UWF A;  3CQG B;  2P58 C;  3GZS A;  3C98 A;  3ZW3 A;  1H2V C;  1PAQ A;  1TJC A;  4TV3 A;  4BTB A;  2XGS A;  3HHM A;  1SQM A;  5BUZ A;  1UN9 A;  5CCL A;  5A23 A;  4U0S A;  4EZJ A;  4G23 A;  3DBS A;  3ESK A;  4NQ0 A;  3UT7 A;  4J6I A;  3CHR A;  5BNW A;  2YIN A;  3MZL B;  4B8C B;  2KAT A;  2WXI A;  2CHW A;  3RO3 A;  4GZD A;  1PC2 A;  5LX8 A;  1UN8 A;  1E8Z A;  3VLE A;  1HF8 A;  1KT0 A;  4CEM A;  3T8M A;  4BT8 A;  3LY8 A;  1HFA A;  1HZ4 A;  3BEE A;  3LS8 A;  3MA5 A;  3O4Z A;  2E0I A;  2J4B A;  2XRZ A;  2R5S A;  5CHE E;  4AY6 A;  3ZYK A;  3D3M A;  4JXT A;  3QDN A;  5M72 A;  3FUD A;  1HG2 A;  1NA0 A;  3R7Q A;  3PE4 A;  4N5C A;  3ZVV A;  4WNG A;  2X6H A;  5FWQ A;  3B7R L;  3CHM A;  3HVE B;  3B7S A;  3UT4 A;  1OWO A;  1E8Y A;  4C0E A;  3ML9 A;  3CQC B;  1NZN A;  3EJN A;  3FH5 A;  4FHJ A;  4PS3 A;  1Z3X A;  4Y6C A;  4I6E A;  1PY1 A;  5A7D B;  1JUQ A;  1KLX A;  3TG5 A;  2A5U A;  3FTZ A;  1B89 A;  3CIA A;  3MV2 B;  3NZU A;  3QJZ A;  2X6F A;  3WXX A;  3G2U A;  4EBA A;  2LSU A;  4MRU A;  2XQ0 A;  2UY1 B;  3AS4 A;  3PNT B;  5CMW A;  5KJK A;  3S7D A;  3BG0 B;  5ARF A;  1Y8M A;  3Q49 B;  3Q5M A;  3UQ3 A;  3ZGQ A;  4F53 A;  2XPY A;  5AJL A;  5AEN A;  4APO A;  4TRQ A;  3JQ0 A;  1EDU A;  3UUX A;  2Y4T A;  4EQF A;  4GML A;  2DCP A;  3ONL A;  4H7X A;  4UI9 K;  5FT9 A;  3NQP A;  4GA0 A;  4I1O B;  5KCM A;  3CK8 A;  3FH8 A;  3CK9 A;  4GA1 A;  3RKV A;  2VSX E;  4AM9 A;  3ZIM A;  3CHO A;  3IKO B;  4U8H A;  4ANW A;  3ML8 A;  5CMY A;  1ELR A;  3SF4 A;  4CT0 A;  4BFR A;  1S0P A;  4NRH B;  4N3B A;  5BPP A;  4HOS A;  2RG8 A;  3L54 A;  2VGX A;  2GRL A;  5BW8 C;  4ATG A;  1H19 A;  5ANL A;  3R9A B;  3LXU X;  3CST A;  4G26 A;  4Q94 A;  3NF1 A;  4F3V A;  4GYY A;  1QQE A;  3CHS A;  3PEV B;  2FEZ A;  2J08 A;  1FVF A;  3TG4 A;  3TAX A;  4ILI A;  1FCH A;  3I4G A;  4JA7 A;  1X5B A;  4UQX A;  2J9Q A;  2XRY A;  3PZD A;  4L2Y A;  4C0M A;  4UWG A;  4HFG A;  2DIW A;  1DNP A;  2FBN A;  2OVB A;  4JVS A;  1TEZ A;  2JLB A;  4JPS A;  3FU5 A;  5E75 A;  4EZL A;  5T4Y A;  3CVX A;  3ZEF A;  2PM6 A;  2WXJ A;  4XX5 A;  4APF A;  5C2Y A;  3HIZ A;  3FUE A;  4ACK A;  3D9N A;  3CVY A;  3ZHE A;  3QWP A;  1WM5 A;  2IJG X;  2X6I A;  1GW6 A;  3CV0 A;  4P29 A;  2PQN A;  4PS7 A;  1L5J A;  3SNX A;  2OND A;  2WM9 A;  4XZ4 A;  1BPO A;  3CKB A;  2KCL A;  2WXP A;  3FU3 A;  4CCA A;  2KCV A;  4EBA G;  4E6H A;  2BF0 X;  4B94 A;  5LOZ A;  2XHE A;  4BSX A;  1ELW A;  4RG9 A;  3DPD A;  4ME2 A;  3G2S A;  4I2W A;  2VQ2 A;  3ONK A;  4R7L A;  2XCC A;  4XI0 A;  5EX0 A;  3U64 A;  4A3V A;  3IBE A;  4JC8 A;  1IHG A;  3EIQ C;  3GZ2 A;  4I2Z A;  2LNI A;  4J8E A;  3FWV A;  5HI7 A;  1E8W A;  4N2Q A;  3MKQ B;  3K9I A;  3VTX A;  3TXN A;  3PEU B;  4NAC A;  2LAI A;  2IOL A;  3MKR A;  3PVL A;  3LJ3 A;  3AS8 A;  1E90 A;  2AWI A;  3FEX A;  2IF4 A;  2L9B A;  4B8A A;  4GCN A;  3U3W A;  3IV0 A;  3VLD A;  3R7R A;  2J49 A;  3JYS A;  3SGH A;  3FUJ A;  4FUL A;  4H7Y A;  4M3O A;  4PH4 B;  3QNK A;  5BV0 A;  4ANV A;  4Q69 A;  1H2T C;  1OWP A;  3ZYM A;  3PH0 C;  4XIF A;  4FU3 A;  3ZN3 A;  2VYI A;  4URK A;  2OV8 A;  2WXL A;  4FAD A;  4U0U A;  4I43 A;  4UQZ A;  5A6C A;  2C0L A;  3FDH A;  3FUF A;  3PUK A;  4XKC A;  4L7T A;  4DPR A;  3PRE A;  3RRN B;  3ASF A;  3Q4A B;  2LAH A;  3SBT B;  1UJK A;  4A1S A;  4KZ0 A;  2X3M A;  3CHQ A;  5FQ4 A;  2Q7F A;  3OTN A;  4G2V A;  3RU0 A;  4JEU A;  4G24 A;  2LO6 A;  3B7U X;  3RK6 A;  1XGW A;  4GB9 A;  3NZS A;  1ZBP A;  5G04 C;  2RD0 A;  2WXR A;  3EHM A;  3TJP A;  3PS6 A;  3QAR A;  2GRM A;  1EYH A;  3I4R B;  4G25 A;  3UPV A;  4CDN A;  3SD5 A;  4JL0 A;  4J8S A;  1Z6T A;  3PUJ A;  1E7V A;  4LEU A;  4DLO A;  3SHF A;  4DK5 A;  3ZYQ A;  4RVB A;  4DLQ A;  3L17 A;  4WWN A;  3CVW A;  5LCW J;  1INZ A;  3UT8 A;  3FY4 A;  3IHY A;  3PNL B;  4EPZ A;  3KAE A;  2WB2 A;  3Q15 A;  4HS2 A;  4BT9 A;  1EPU A;  3LVR E;  4B89 A;  4GZC A;  4CDM A;  2IU1 A;  1SZA A;  3G2T A;  4I1A A;  2C2L A;  4XI9 A;  5BV1 A;  2WXG A;  4OYS A;  3D9O A;  4FJZ A;  2MRI A;  2JEK A;  4LCT A;  4WND A;  4EEC A;  4A3T A;  4CGW A;  2DBA A;  3URZ A;  1E8X A;  3S7J A;  4BX8 A;  2YNQ A;  3U9W A;  3D9I A;  4GA2 A;  4KVO A;  4UI9 J;  3FUL A;  3L16 A;  3AU4 A;  4ABN A;  4CDR A;  3FU6 A;  1N54 A;  2L6J A;  4I9E A;  2WQ6 A;  3KS2 A;  4B0Z A;  1P5Q A;  4HXI A;  4WWP A;  2ION A;  2AXV A;  4K03 A;  4AP2 A;  2FO7 A;  3O48 A;  3T5X A;  4ANX A;  5JJ6 A;  5JHB A;  4GYO A;  4PUC A;  3L6A A;  4CGV A;  4DI3 A;  1IQR A;  3D9M A;  3GZ1 A;  3FUM A;  2X6J A;  2V5F A;  1HE8 A;  4FC8 A;  3S7F A;  1W3B A;  4GMJ A;  3D9L A;  4UWK A;  4AY5 A;  5D0Q D;  4WNE A;  5AJD A;  1E7U A;  3D9P A;  4YND A;  3KEZ A;  4ANU A;  5ENN A;  3SZ7 A;  2WXK A;  2KM4 A;  3PRZ A;  3RRU A;  5C1D A;  4GZ5 A;  2FF4 A;  5JJT A;  2MHK A;  2PQR A;  2IQC A;  3APD A;  5BT1 A;  3ENE A;  1UJJ A;  2IFU A;  3MYV A;  4G11 A;  3ZHE B;  5FTP A;  4IYP A;  3TL5 A;  4JZY A;  3UMV A;  4A1G A;  2WXO A;  4JHJ A;  3JCK C;  4KVM A;  4XKB A;  5KJL A;  3B13 A;  3G2V A;  3LKU A;  3ASG A;  4FLH A;  3QC1 A;  2XCB A;  5FQ8 A;  4DJA A;  3G2W A;  4E85 A;  3U66 A;  3P2B A;  4BTA A;  2VSN A;  1A17 A;  4BWR A;  3MCX A;  3S2A A;  3OXF A;  4HVB A;  2CHZ A;  5T8I A;  2CFZ A;  4YVQ C;  4AVX A;  3D9J A;  1DVP A;  1HG5 A;  2PZI A;  4WUY A;  5G55 A;  3D9K A;  1WY6 A;  5DBK A;  1QZ2 A;  2HR2 A;  3FP3 A;  1HS6 A;  5FZQ A;  2XPZ A;  4AOF A;  3MX3 A;  2Y4U A;  4N39 A;  2WMN A;  3APF A;  3L22 A;  2I6H A;  5JHA A;  2WQ7 A;  3I5P A;  1N52 A;  3QB2 A;  3KD7 A;  3CVP A;  2CFU A;  4JA9 A;  4QFV A;  3PE3 A;  5EDS A;  4Y6W A;  2YHE A;  4FLB A;  3ZYL A;  2L0I A;  3ZXS A;  5G04 J;  2FUL A;  1QNF A;  2XGO A;  1IQU A;  3CK7 A;  3HVE A;  3FTY A;  3LY9 A;  3SFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...