3ASFA

Mama msr-1 c2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
174
structure length
174
Chain Sequence
DIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnetosome protein MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Protein binding
total genus 66
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asfA01
3LKUA 5BNWA 4EQFA 4AIFA 3ULQA 4CGWA 1WM5A 3MA5A 2KC7A 5EX0A 2V5FA 2FI7A 2P58C 4N3CA 3RU0A 5FZQA 3SZ7A 4HOUA 4RG6A 3QOUA 2XGMA 4I9CA 5G05J 4HOSA 3Q49B 3MV3B 2FO7A 2FF4A 3ZFWA 3FWVA 2YQ8A 3S7BA 1WAO1 3QWPA 2QFCA 3ZHEA 2PQRA 4JA9A 4BTAA 4GZ3A 1PC2A 5BW8C 3ASHA 2WQHA 4U0ZA 4UI9K 3CK7A 3LY8A 3CV0A 4I9EA 3U3WA 3GZ1A 4U07A 5KJLA 4G2VA 3LPZA 1NA3A 1P5QA 4HOTA 3LY9A 1HXIA 3N71A 3Q4AB 2XCBA 5JJ7A 3TGOA 3S7FA 2XEVA 3ASFA 5LCWC 2NC9A 1ZU2A 4UI9C 3Q15A 1HH8A 2PL2A 2PQNA 4IN3B 4U0SA 3VTXA 1ELWA 3KS2A 4WNDA 3SF4A 3PDNA 3MEKA 2XGOA 3QWVA 4A1SA 3CK8A 3U4TA 4Y6WA 4I17A 2L6JA 4H7XA 4B94A 5DIZA 5EX3A 4I2ZA 2ONDA 3PE3A 4JL0A 3CKBA 5KJMA 3BEEA 4HOQA 4AY6A 3TAXA 3O48A 1Y8MA 5AYWD 4G24A 2GW1A 3OXFA 4N2SA 3TG5A 3HYMB 1B89A 4N39A 4U04A 4GYWA 4JA7A 5FZSA 2HO1A 3ZPJA 3AS8A 3CVQA 3CKCA 2LNIA 2VSNA 4YVQC 3E4BA 3QDNA 4KBQA 5G04C 4AY5A 3LY7A 3CVNA 3OXGA 2VGXB 4G25A 3RO2A 2C0LA 3JYSA 5C1DA 3IEGA 3EDTB 3MKRA 4ME2A 5CCLA 1NA0A 1KT0A 3RO3A 5FTPA 4BT9A 4RG9A 1QQEA 3ASDA 3LYAA 4J8EA 2VGYA 4WNEA 4XI9A 3AS5A 3NF1A 4NQ0A 3TG4A 4JHRA 3RIBA 1TJCA 2VSYA 4NRHB 2J9QA 3QKYA 5D0OD 3CVPA 4AM9A 2C2LA 4WNGA 3GW4A 2BUGA 2KATA 5FJYA 1KT1A 5LCWJ 3CK9A 4LEUA 3ESKA 4W9RA 3S7JA 3CEQA 4UQXA 5D0QD 4N3AA 1YA0A 4BTBA 5DBKA 1FCHA 3GYZA 4UQYA 2XPIA 2KCKA 5BT1A 5FT9A 2XCCA 2JLBA 4F3VA 3FFLA 4CGVA 2LSVA 5ARFA 4XIFA 4KXKB 4G26A 4N2QA 4J8FA 3QWWA 5CHEE 5HI7A 1ELRA 2FEZA 4GA1A 5JJTA 2VGXA 5CCMA 2OOEA 3PE4A 4I2WA 5ARGA 4GCOA 3VTYA 5JJ6A 1OUVA 3RKVA 5KJKA 4O6FA 4ABNA 2I6HA 3RJVA 1ZBPA 4J8DA 1QZ2A 2KCVA 5HQ8A 1HZ4A 3URZA 3UQ3A 3LCAA 2MHKA 4Y6CA 4GZ6A 3Q5MA 2Y4TA 4APOA 1IHGA 3CVLA 4YVOA 4GA2A 4CDRA 2UWJG 3K9IA 2KCLA 2FBNA 3GZ2A 3ZGQA 1KLXA 2UY1B 3Q47B 2IFUA 5KJNA 5G05C 2VYIA 4I1AA 3S7DA 3MV2B 2Y4UA 1E96B 2PZIA 4WNFA 2AVPA 2HYZA 2XGSA 4GYOA 4GZ5A 4G23A 2VQ2A 3R9AB 4N3BA 4UI9J 4G1TA 2R5SA 1W3BA 4UQZA 5M72A 4KYOB 2HR2A 3OXLA 3AS4A 3ASGA 2LSUA 3ZN3A 3KD7A 4XI0A 5A6CA 4GPKA 2YHCA 2WPVA 1IYGA 4HORA 3ZHEB 4GCNA 2IF4A 1NZNA 3FP3A 4BWRA 1A17A 2Q7FA 5EKQD 2E2EA 4GYYA 2C0MA 3UUXA 4WUYA 4YNDA 5FZRA 4GA0A 3KAEA 5A7DB 1XNFA 4H7YA 4U0UA 3UPVA 4J0UA 2DBAA 4N5CA 3WXXA 4BT8A 2UY1A 5G04J
chains in the Genus database with same CATH superfamily
1HG5A 4EBAA 3ULQA 4CGWA 4LERA 2XPZA 3DXKG 3SBSA 1TNBA 2L0TB 3E37A 5EX0A 4FU3A 3UT7A 2P58C 4N3CA 3UIPC 2BEDA 1DC2A 2DYSE 1JWFA 2GROB 3SZ7A 2AXZA 4HOUA 3QOUA 2ZGDA 2XGMA 4I9CA 2NXPA 5G05J 1TJFA 1JUQA 3CVVA 2AW6A 2XS1A 4ZFHA 3ZYMA 3DEOA 3WG7E 2NSZA 3ZFWA 4U8VD 2ETBA 3DWLG 2H6IA 3ZHEA 4ACKA 1MX4A 3FTVA 4JA9A 4I6EA 5AQBA 3ZIMA 2KBXA 3FUIA 1OWMA 3ASHA 1SW6A 1LTXA 4ACLA 4YDEA 4DX1A 2GRQB 1N52A 3CV0A 3GZ1A 4U07A 5KJLA 2ZISA 2I9CA 4RVBA 1HXIA 3PZ4A 5ANRA 4PS8A 5JJ7A 1IQUA 4CCAA 1INZA 2WB2A 4HLLA 1SZAA 2R03A 1ZU2A 4UI9C 2PM6A 3JQ0A 1HH8A 1ELWA 3GZSA 3PDNA 3MEKA 2XGOA 5FIOA 1IKND 4EPZA 2DWZA 3AG2E 4GTVA 2VTBB 4HRMB 1SA5A 4HOQA 3T8KA 1U3DA 3AG3E 4GTOA 4A63B 3MYVA 5FQ6A 3O48A 1Y8MA 3RSEG 5AYWD 1OWPA 1UJKA 2VJ8A 3ASOE 3SGHA 2P9IG 2IOLA 3TG5A 3HYMB 1B89A 4U04A 2H6HA 4JA7A 2HO1A 3QJZA 1HE8A 4UUCA 2ZGGA 1HU3A 1TYQG 5ENNA 5KWDA 4XE0A 3CVNA 3EUVA 4G25A 3RO2A 5JHBA 4FJYA 3CHMA 3AJIA 2FULA 4OVVA 1DNPA 3L16A 5CCLA 2J07A 3RO3A 1FT2A 4J6IA 1QQEA 2EIKE 3LYAA 3NOGD 4J8EA 3CVXA 1MZCA 4M7CA 2QC9A 3IHVA 5G55A 3NF1A 5EN5D 1TJCA 1WY6A 2J9QA 4DLOA 4O1PA 3QNKA 2C2LA 3S2AA 2WXJA 2BUGA 2KATA 2CFZA 3ABME 3AG1E 1E7VA 5LCWJ 1H19A 4FLHA 2AWIA 3Q73A 4URKA 4RSYA 3S7JA 4U63A 4UQXA 4CDNA 2WVIA 4N3AA 1YA0A 2WXQA 1E8YA 2P9SG 3SNXA 2P9LG 3B7UX 5FT9A 3IV0A 2JLBA 3W9GA 4F3VA 1O1RA 2LSVA 4XIFA 4G26A 1K3ZD 2GRRB 3QWWA 3C3QA 4TXPA 1ELRA 4J8YA 4GB9A 4G8LA 3UM1A 4LUNU 3V2OA 4A55A 4F1SA 4DJAA 1WG0A 4JXTA 2VGXA 5CCMA 3DBSA 3PE4A 1L5JA 4B89A 2J4DA 3FTXA 4U95D 5FQ4A 2M63A 3VLEA 4HFGA 4O6FA 4ABNA 2WQ6A 1UN8A 4JD2G 1O1SA 4BY6A 2P9NG 1S64A 2MHKA 2YINA 4GZ6A 3ONKA 1G3NB 3OTNA 3Q5MA 3IHYA 3D9MA 4APOA 4ANWA 3CVLA 3UIOC 5BUZA 4MS6A 3T5VA 3O4ZA 4GAAA 4E85A 3RAUA 5T8IA 1DCQA 2WMNA 4E6HA 3D3MA 1S63A 3E32A 4C0EA 5ITZF 2KZTB 1TEZA 2RKKA 5G05C 5B1BE 4MLPA 2X6IA 2WXFA 4TXQA 3S7DA 1OWLA 4TXRA 3APCA 5IY5E 4KT6B 3CQGB 1U2VG 1KPSB 4Q96A 4UWKA 3PEVB 3LJNA 3R7QA 4N3BA 2WXRA 4UI9J 2MOWA 4L23A 2GRPB 3MCXA 2XZDG 4CDMA 1W3BA 1TN8A 3B13A 3PZDA 4KYOB 2HR2A 3OXLA 5E76A 4BX9A 1EF1C 3NAWA 3ZN3A 3KD7A 4YDOA 2YHCA 1OXJA 5AQAA 2WPVA 3KEAA 3CLJA 4BX8A 2J8SD 3NQPA 2Q7FA 4TUUA 2C0MA 4RLYA 3CR3A 2IJGX 3FH7A 4KZCA 4YNDA 4K0RA 2I1JA 3FY4A 4CZ2D 4QQIA 5FZRA 4OAUC 3EU9A 2R59A 3KAEA 3DSWA 5BXUA 1U3CA 3C98A 2P2CP 2V0PA 2XEHA 3FU0A 2UY1A 5EILA 2Y69E 1N0QA 2CHZA 3B7SA 1FVHA 4IRUA 2WXMA 2V5FA 2FI7A 3LEWA 4DX7D 3ZXSA 3APFA 3RU0A 3AU5A 3QC1A 1UN9A 4HOSA 3UKRG 4K5BA 4I1OB 3Q49B 5BV1A 3FTSA 4C48B 2XPYA 2YQ8A 3S7BA 1UOHA 3EIJA 2QFCA 2WXOA 3JUEA 3P2BA 4BTAA 2BF0X 1H2TC 3Q7AA 3UINC 5BW8C 4L2LA 3LS8A 3ML9A 3PEUB 3EHRA 2IU1A 4I9EA 5ANLA 3MGBA 4PS3A 1NA3A 4G11A 4GTPA 3LY9A 2Y0BG 4FC8A 4RQIA 5AAOA 3N71A 4FHKA 4GU5A 3ZXPA 1GW6A 1OCRE 5LCWC 3FUDA 4BETA 1X81A 3Q15A 1H2UA 4ILHB 4F53A 2DCPA 2XQ0A 3VTXA 3KS2A 3LDZA 4CYMD 4A1SA 3HRAA 4FHJA 3CK8A 2LO6A 2DIWA 4Y6WA 3TWXA 2OVBA 4H7XA 5EX3A 2GGFA 2WXIA 4CRWA 1FT1A 3BEEA 5HS0A 4ZHBA 3TAXA 4DI4A 2WXLA 4L7TA 3MZLB 3ML8A 3CSTA 4BSZB 2GW1A 3OXFA 4N2SA 4OVUA 4NIKA 3U66A 5FZSA 3ULYA 5JHAA 3B95A 3CKCA 5J08A 1EPUA 2AXVA 4YVQC 2Y1LE 3FUJA 1TNUA 3LY7A 5AQ7A 3HXEA 3TWWA 3JYSA 3EDTB 3MKRA 4ME2A 4BFRA 1BI8B 4PUCA 3U9WA 4RG9A 1PY1A 1SA4A 2YHEA 5EYPF 2RFMA 1X5BA 4WNEA 4PDXA 3AS5A 4NQ0A 2F8YA 4IYPA 4U8HA 1H2VC 4CT4A 3QKYA 1FPPA 4WNGA 2R17C 3GW4A 4GTMA 5HKPA 5A23A 2VTBA 4NACA 3CIAA 1Q2ZA 1N9AA 1MQSA 2DVWA 2VGEA 3UI2A 3C72A 5D0QD 3HDXA 1EDUA 3FUMA 4GTQA 4HS2A 3F6QA 1FCHA 3GYZA 5CMWA 3CHOA 2X6HA 1E90A 2XPIA 1JCQA 3TWUA 2ZXWE 3MJWA 2AJAA 3UX4A 3PREA 4CGVA 3LXUX 5ARFA 4J8FA 5EIBE 3SFYA 4B8CB 1TR4A 4B0ZA 2FEZA 1KZOA 4O60A 1N95A 3CHRA 1N4QA 4GA1A 5JJTA 4A1GA 4B93B 5FINA 3L22A 2IOSA 5CEDB 3Q7FA 4K5AB 3RJVA 5CBOA 2MRIA 1QZ2A 2KCVA 3G2VA 3URZA 1SQMA 3TWVA 3PZ3A 4YDWA 1OCCE 3Q78A 4Y6CA 2A4ZA 5ENPD 3ZYQA 2LAHA 3KEZA 2WXPA 2IEJA 1Z3XA 4HRLA 4CDRA 1RZ4A 5T4YA 1E7UA 3K9IA 3QK0A 3KSQA 4HNAD 3UTMA 4AVXA 3ZGQA 2BKGA 2NYJA 3HXCA 2V4LA 3DPYA 2WXHA 1UW4B 2Y4UA 1PAQA 4G8KA 4WNFA 3SY2A 2CFUA 1V54E 2EIJE 2LXLA 3ONLA 4U8YD 3V79K 3TXNA 2R02A 5AJDA 4Q94A 3KSLA 2WMOA 4GYOA 3QAQA 3L13A 3D9HA 4BSXA 2VQ2A 5B1AE 1YCSB 5B3SE 3DSXA 1TNOA 5E75A 3HVEA 2R5SA 4UQZA 4EBAG 3ASGA 3ZUVB 3BG0B 5CMYA 2LSUA 1S70B 5A6CA 4GPKA 1IYGA 4HORA 4HI9A 4DUIA 4KVMA 2XS8A 1N54A 5EKQD 3ZU7B 2E2EA 3L9TA 4GYYA 2F8XK 4WWPA 2BTDA 4K03A 1V55E 5EYLA 3VLDA 2RFAA 3HVEB 3PZ1A 4CT0A 3ISMC 5ENOD 3SFXA 3RRMB 4C0MA 2X3MA 4ANVA 3UPVA 3ZYKA 4JHKA 4N5CA 4XKBA 1HX8A 2EINE 1TNYA 4I43A 2KZTA 5KCMA 4GTSA 3LKUA 4EQFA 4AIFA 3PNTB 3G2UA 1VDYA 2CHXA 5JMND 2I1KA 3MA5A 2GRNB 2KC7A 5CBNA 3PVLA 1K1AA 3IBEA 2V8SE 3C3OA 1UG3A 1H6OA 4PH4B 4RG6A 1MYOA 3FTWA 2IO2C 2XENA 2JEKA 4DLQA 3NOCD 3MV3B 4BESA 2FO7A 4P29A 1KZPA 4YDYA 3V31A 3FWVA 1WAO1 4HB5A 3QWPA 4V3IA 3FU6A 3I4GA 2PQRA 5CRUA 4GZ3A 4ILGA 5J90A 1PC2A 2J49A 4UI9K 1OY3D 3I5PA 3HXDA 4JVSA 4ATGA 5ENTD 3ESLA 1NI1A 4G2VA 2KXPC 5LOZA 1BPOA 1P5QA 4HOTA 3CHPA 3DSVA 4GZDA 2XCBA 3S7FA 1S0PA 2XEVA 4XX5A 3AAAC 3ASFA 2NC9A 3FUEA 4GMJA 3LVRE 1K1BA 2ZU6B 3CGHA 4UWHA 2OV8A 2PL2A 2PQNA 4IN3B 2GRLA 4K5CA 3T8MA 2I2OA 3U4TA 5AQ9A 1HO8A 4B94A 2XZTG 4HI8A 4MBGA 4DK5A 4I2ZA 4JL0A 3CKBA 3NZUA 4ATZD 2XRYA 5KJMA 3TWSA 3SQVA 3RRUA 2VSOE 4EECA 4AOFA 1O5MA 2CG2A 4G24A 4ANXA 5CERB 3UXGA 4N39A 4GYWA 2LAIA 3ENEA 3ZPJA 4HRNA 3AS8A 2BKKB 4KZ0A 3BUAA 3ZW3A 2LNIA 1Z6TA 3T5XA 3E4BA 4GTTA 2H6GA 3ABKE 3EHMA 3QDNA 4AY5A 3PRZA 4NURA 2C0LA 3IEGA 2IY0C 3G2WA 5FTPA 4JPSA 2B6CA 4UWGA 1N4RA 4XKCA 4TRQA 4JW1A 2L0IA 3ABLE 1BI7B 3D9IA 4FP7A 4XI9A 4BERA 1OCOE 3CVWA 4JHRA 3RIBA 5FQ8A 2VSYA 3R9MA 2L6BA 5D0OD 3CVPA 1HF8A 1A5EA 1LD7A 3LVQE 1AP7A 4J8SA 3PNLB 3BU8A 4TUMA 4GMRA 5FJYA 4I6JA 1KT1A 3HIZA 3CK9A 4LEUA 4XZ4A 4DX5D 4W9RA 4HBDA 4WAFA 3X2QE 1UJJA 4FJZA 5DBKA 4EZJA 4UQYA 2KCKA 4BEPA 2XRZA 2ZIRA 5BT1A 3FEXA 2XCCA 5EDSA 1YYHA 1Z3YA 3FFLA 1ZB1A 2GRMA 4KXKB 4N2QA 5CHEE 4JEHA 5C2YA 3B7RL 1IHBA 3E33A 3G2SA 4LRZA 2X6FA 1EYHA 1ELKA 4HQDA 3ZNGA 3APDA 3FDHA 5D2MC 1MX2A 4GCOA 3VTYA 4HVBA 4FA6A 5JJ6A 2E0IA 4ANUA 1OUVA 3L82A 3RKVA 4DPRA 4C9BB 5FQ7A 2FO1E 1JCRA 1E8XA 1E8WA 4J8DA 2RG8A 3EJNA 4MKTA 3LCAA 4U96D 2XHEA 2QY7A 3EHNA 3DEPA 2JABA 4TV3A 2CHWA 5AENA 5BV0A 5KNGA 1IHGA 1QYMA 4U7EB 1WDYA 3UM2A 1MHQA 2EQXA 2FBNA 3GZ2A 2X6KA 1KLXA 3Q47B 3L17A 2AXUA 2X38A 4L2YA 2IO3C 2WXNA 5LP0A 5CRVA 3MV2B 1E96B 1HFAA 3PUKA 3D9NA 3DSUA 5CECB 3NBNB 2XGSA 3AG4E 4GZ5A 4L1BA 1LD8A 3E34A 3UM3A 3Q79A 3IXEA 3BG1B 1MJ0A 1Z5SC 1N11A 3NZSA 4I1MA 5HRYA 2LXMA 2R2LA 3UT8A 4GMLA 4O1OA 3L6AA 4APFA 3UT4A 1QBQA 3NB2A 3OAWA 3ZHEB 4N5QA 2MYOA 3RK6A 1TN7A 4BWRA 1A17A 3UMVA 3C5RA 3DXMG 4LG6A 3UUXA 4WUYA 3FU5A 1N4SA 3SD5A 3L08A 3UM0A 4FULA 2VSXE 4F7AA 5AARA 3IKOB 3JCKC 1XNFA 2QYJA 4H7YA 1IQRA 5G2NA 3SBTB 4U0UA 1BU9A 2DBAA 3WXXA 4BT8A 1E8ZA 2F0YA 1FVFA 3DSTA 4LSZE 4JHJA 5FWQA 5BNWA 3AU4A 3FTZA 1N0RA 3HG0D 3MKQA 4F1PA 4GTRA 2IONA 2P9UG 1WM5A 3CVUA 5ENQD 3FTUA 5FZQA 5EIDA 3B7BA 3SFZA 1K8KG 4AXHA 3FH5A 3PH0C 2J09A 2WM9A 3CQCB 3TWQA 3LJ3A 2FF4A 2QZAA 4Z68A 3MKQB 2J08A 3JQ1A 3PS6A 4XEIG 4A3TA 4DI3A 5AN8A 4U0ZA 2WQHA 4FADA 2OCCE 3CK7A 3UKUG 2OVFA 4JC8A 3LY8A 3FH8A 3U3WA 1BD8A 3TL5A 3ULEG 4HLEA 3LPZA 4WWNA 3Q4AB 3FUFA 2P9PG 4Q69A 3TGOA 4AJWA 3ASNE 2EIME 5ENSD 3G2TA 5D66A 3CSFA 3ZKJA 1TNZA 4U0SA 3FU3A 2CG3A 4WNDA 3SF4A 1SZ9A 3TWRA 3QWVA 3PZ2A 5H7PA 3E30A 4I17A 2L6JA 2RD0A 4JZYA 5DIZA 3QARA 2ONDA 3PE3A 4OYSA 4X8QA 1YMPA 4FLBA 2F37A 2PNNA 4AY6A 3CHSA 5KNHD 3U64A 2OEVA 4R7LA 3RRNB 4QFVA 3D9OA 2YNQA 3C3RA 1H0AA 3HXFA 4GPMA 4EZKA 3CVQA 3FUHA 2VSNA 1O1TA 2WQ7A 3FULA 3SHFA 3ZEFA 4KBQA 5G04C 3OXGA 5JA4D 2VGXB 4DX6D 5C1DA 2R05A 3EHQA 5BXOA 1TN6A 1NA0A 1KT0A 3TJPA 4BT9A 4UWFA 3ASDA 4AEZC 1H6KA 2H6FA 1N94A 3TWTA 4CEMA 3Q9NC 2VGYA 2OEWA 2P9KG 2WXKA 3D9KA 3TG4A 1NFIE 1AWCB 3L54A 1OWNA 1DVPA 4UWLA 4NRHB 3FTYA 4AM9A 3MX3A 3P1UA 3SO8A 3J5QB 2A5EA 5LX8A 5AJLA 3B7TA 3ESKA 2XEEA 4DX2A 1D9SA 1D8DA 2ETCA 3CEQA 1LF8A 3EU5A 5T3RA 4J7WA 1NL4A 3DSSA 4BTBA 1SVXA 2ILRA 3JXJA 1OCZE 1D8EA 2X6JA 1HS6A 3T9KA 4OAVB 4LNUD 1XGWA 4M3OA 4KMOA 2PM7A 4AV7A 4A3VA 3FUNA 1OT8A 5HI7A 3CHQA 3Q9UC 4ILIA 3BQOA 4PS7A 4WWOA 3SI5A 2WXGA 2OOEA 4I2WA 2DZNA 5ARGA 3R7RA 1H6PA 1BLXB 1JPLA 3I4RB 3DRAA 5KJKA 3FHEA 2I6HA 1ZBPA 1IXVA 3JXIA 1NP7A 3QB2A 1OWOA 1QNFA 3D9JA 5HQ8A 1HZ4A 3UQ3A 4L9PA 4JB8P 3VLFA 2ETAA 2HM8A 3D9LA 2A5UA 4I6GA 2Y4TA 4YVOA 4GA2A 3V30A 2UWJG 2KCLA 2B0OE 2L9BA 2EILE 3TXMA 2IQCA 3V2XA 3JUIA 5ENRD 4D10C 1DCEA 2UY1B 2IFUA 5KJNA 4F6RD 2VYIA 4I1AA 2Y3AA 4LNGA 5CEAA 3DPDA 2PZIA 2AVPA 4B8AA 3W9FA 2HYZA 1N4PA 2QYUA 1JWGA 4KVOA 3ZYLA 4G23A 1JCSA 4JEUA 4AP2A 3PUJA 4EHMA 2J4BA 4GZCA 3R9AB 3ZVVA 4IULA 4G1TA 4HXIA 3I3NA 5LFAA 5M72A 2KM4A 2V5QC 3AS4A 2HE0A 4XI0A 1Y6IA 2LUHA 4GCNA 3HHMA 4LCTA 2IF4A 5AIJA 1NZNA 3FP3A 3FEYA 3J5PA 2V4HC 3CVYA 3EIQC 1MX6A 1RW2A 4MRUA 5BPPA 3ZRHA 3HXBA 4DRXE 4GA0A 3FUKA 5A7DB 2DZOA 3D9PA 4LNBA 3Q75A 1HG2A 4EZLA 4J0UA 2DYRE 5G04J 5KBAA
chains in the Genus database with same CATH topology
1HG5A 3LKUA 4JHJA 5FWQA 4EBAA 5BNWA 3AU4A 4EQFA 3FTZA 4AIFA 3ULQA 3PNTB 4LERA 2XPZA 4CGWA 3MKQA 3G2UA 3SBSA 1VDYA 2CHXA 2CHZA 2IONA 3B7SA 1WM5A 1FVHA 4IRUA 2L0TB 2I1KA 3MA5A 3CVUA 2WXMA 2KC7A 5EX0A 2V5FA 4FU3A 2FI7A 3UT7A 3LEWA 2P58C 4N3CA 3ZXSA 3FTUA 3APFA 3PVLA 3RU0A 3AU5A 5FZQA 3IBEA 2V8SE 3SFZA 1JWFA 1UG3A 3SZ7A 4AXHA 4PH4B 2AXZA 4HOUA 4RG6A 3QOUA 2XGMA 4I9CA 2NXPA 5G05J 3QC1A 1UN9A 1TJFA 3FH5A 3FTWA 3PH0C 1JUQA 3CVVA 2J09A 4HOSA 2WM9A 3CQCB 2AW6A 2JEKA 4I1OB 4DLQA 3Q49B 5BV1A 3LJ3A 3ZYMA 3MV3B 2FO7A 3FTSA 2FF4A 2NSZA 4P29A 3ZFWA 2XPYA 3FWVA 2YQ8A 3S7BA 1WAO1 3MKQB 3EIJA 2J08A 3QWPA 2QFCA 4V3IA 3ZHEA 3FU6A 2WXOA 3I4GA 4ACKA 2PQRA 3FTVA 3P2BA 4JA9A 4I6EA 4BTAA 2BF0X 1H2TC 3JQ1A 4GZ3A 4ILGA 5J90A 1PC2A 3PS6A 3ZIMA 4A3TA 3FUIA 2J49A 4DI3A 5BW8C 4L2LA 1OWMA 2WQHA 3ASHA 4U0ZA 4FADA 3LS8A 4UI9K 3I5PA 3ML9A 3CK7A 4ACLA 2OVFA 4JVSA 4ATGA 3PEUB 2IU1A 3LY8A 4JC8A 3FH8A 1N52A 3CV0A 4I9EA 3U3WA 3ESLA 3GZ1A 4U07A 5KJLA 5ANLA 2I9CA 4G2VA 3MGBA 3TL5A 5LOZA 4HLEA 4PS3A 3LPZA 1NA3A 1BPOA 4G11A 1P5QA 4HOTA 4WWNA 3CHPA 3LY9A 4FC8A 4RVBA 1HXIA 5ANRA 3N71A 3Q4AB 4FHKA 4GZDA 4GU5A 2XCBA 3FUFA 1GW6A 4PS8A 5JJ7A 4Q69A 3S7FA 1S0PA 3TGOA 2XEVA 4XX5A 1IQUA 4AJWA 3ASFA 4CCAA 5LCWC 2NC9A 1INZA 3FUDA 3FUEA 2WB2A 4GMJA 1SZAA 1ZU2A 3G2TA 3LVRE 3CSFA 4UI9C 3Q15A 2ZU6B 3CGHA 1H2UA 4UWHA 4ILHB 2PM6A 2OV8A 1HH8A 2PL2A 2PQNA 3JQ0A 4F53A 4IN3B 2DCPA 4U0SA 2XQ0A 2GRLA 3FU3A 3T8MA 3VTXA 2CG3A 1ELWA 3GZSA 3KS2A 4WNDA 3SF4A 3PDNA 3LDZA 1SZ9A 3MEKA 2XGOA 3QWVA 2I2OA 4A1SA 4FHJA 3CK8A 2LO6A 3U4TA 2DIWA 4I17A 4Y6WA 2L6JA 2RD0A 4JZYA 4EPZA 2OVBA 4H7XA 1HO8A 4B94A 5DIZA 3QARA 5EX3A 2GGFA 2WXIA 2VTBB 4CRWA 4DK5A 4I2ZA 2ONDA 3PE3A 4OYSA 4JL0A 3CKBA 3NZUA 2XRYA 5KJMA 3BEEA 4HOQA 4FLBA 1U3DA 4AY6A 3CHSA 3RRUA 3MYVA 5FQ6A 3TAXA 3U64A 2VSOE 4EECA 4DI4A 3O48A 1Y8MA 2WXLA 4AOFA 4L7TA 5AYWD 1OWPA 4R7LA 3MZLB 3ML8A 3RRNB 1UJKA 3CSTA 2CG2A 4G24A 4ANXA 2VJ8A 2GW1A 3SGHA 3OXFA 4N2SA 4QFVA 2IOLA 3TG5A 3HYMB 4OVUA 1B89A 3D9OA 4N39A 4U04A 2YNQA 3U66A 4GYWA 4JA7A 5FZSA 2HO1A 2LAIA 3ENEA 3ZPJA 3QJZA 1H0AA 1HE8A 3AS8A 5JHAA 4EZKA 3CVQA 4KZ0A 1HU3A 3FUHA 3CKCA 3ZW3A 2LNIA 1EPUA 5J08A 1Z6TA 2AXVA 2VSNA 4YVQC 3T5XA 2WQ7A 5ENNA 3E4BA 3FULA 3FUJA 3SHFA 3ZEFA 3EHMA 3QDNA 4KBQA 5G04C 4AY5A 3LY7A 3PRZA 4XE0A 3CVNA 3OXGA 4NURA 2VGXB 4G25A 3RO2A 2C0LA 5JHBA 4FJYA 3JYSA 3CHMA 3IEGA 5C1DA 3EDTB 3MKRA 2FULA 4OVVA 4ME2A 4BFRA 1DNPA 3L16A 5CCLA 1NA0A 3G2WA 1KT0A 2J07A 4PUCA 3TJPA 3RO3A 5FTPA 4JPSA 4J6IA 3U9WA 4BT9A 4UWGA 4RG9A 1QQEA 4UWFA 3ASDA 4XKCA 4TRQA 1PY1A 4AEZC 3LYAA 2YHEA 4JW1A 2L0IA 4J8EA 1H6KA 4CEMA 3CVXA 2VGYA 1X5BA 4WNEA 4PDXA 3IHVA 5G55A 3D9IA 4FP7A 4XI9A 3AS5A 3NF1A 4NQ0A 2WXKA 3D9KA 4IYPA 3TG4A 4U8HA 3L54A 3CVWA 1OWNA 4JHRA 1DVPA 3RIBA 5FQ8A 1H2VC 1TJCA 4UWLA 2VSYA 4NRHB 1WY6A 4CT4A 2J9QA 3FTYA 3QKYA 4DLOA 5D0OD 3CVPA 4AM9A 3QNKA 2C2LA 4WNGA 3MX3A 1HF8A 3S2AA 2R17C 3P1UA 2WXJA 3GW4A 3LVQE 4J8SA 3PNLB 2BUGA 2KATA 5FJYA 4I6JA 1KT1A 2CFZA 3HIZA 1E7VA 5LCWJ 5A23A 5LX8A 1H19A 3CK9A 4FLHA 4LEUA 4XZ4A 5AJLA 3B7TA 2AWIA 3ESKA 4URKA 2VTBA 4NACA 4RSYA 4W9RA 4WAFA 3CIAA 3S7JA 1MQSA 3CEQA 1LF8A 4U63A 4UQXA 5T3RA 1UJJA 5D0QD 3HDXA 4FJZA 4CDNA 2WVIA 1EDUA 3FUMA 4N3AA 1YA0A 4BTBA 2WXQA 4HS2A 5DBKA 4EZJA 1E8YA 1FCHA 3GYZA 5CMWA 2ILRA 3CHOA 3SNXA 4UQYA 2X6HA 1E90A 2XPIA 2KCKA 2X6JA 3B7UX 2XRZA 5BT1A 1HS6A 3FEXA 5FT9A 2XCCA 5EDSA 3IV0A 3MJWA 2JLBA 3UX4A 3PREA 1XGWA 4M3OA 1Z3YA 3FFLA 4KMOA 2LSVA 2GRMA 3LXUX 5ARFA 4XIFA 4KXKB 4F3VA 4CGVA 4G26A 2PM7A 4N2QA 4J8FA 4AV7A 3QWWA 5CHEE 4A3VA 3FUNA 4JEHA 5C2YA 3B7RL 5HI7A 3CHQA 4ILIA 4B8CB 1ELRA 3G2SA 4GB9A 4LUNU 2FEZA 4LRZA 4B0ZA 4A55A 4F1SA 4DJAA 3CHRA 2X6FA 4GA1A 5JJTA 4WWOA 4PS7A 4JXTA 1EYHA 1ELKA 2VGXA 2WXGA 3SI5A 4A1GA 3APDA 5CCMA 2OOEA 3DBSA 3FDHA 1L5JA 3PE4A 4I2WA 4B89A 5ARGA 2J4DA 4GCOA 3R7RA 3FTXA 3VTYA 5FQ4A 4HVBA 1JPLA 2M63A 5JJ6A 4FA6A 3I4RB 2E0IA 4ANUA 1OUVA 3L22A 3RKVA 3VLEA 2IOSA 4HFGA 4DPRA 5KJKA 3FHEA 4C9BB 4O6FA 4ABNA 2I6HA 5FQ7A 1E8XA 1ZBPA 3RJVA 1E8WA 1NP7A 3QB2A 4J8DA 1QNFA 1OWOA 1QZ2A 1UN8A 2MRIA 3D9JA 2WQ6A 2KCVA 2RG8A 5HQ8A 3EJNA 4MKTA 3G2VA 1HZ4A 4BY6A 3URZA 1SQMA 3UQ3A 3LCAA 2MHKA 2XHEA 2QY7A 3EHNA 4Y6CA 2A4ZA 3ZYQA 2YINA 3VLFA 2LAHA 3KEZA 2HM8A 2WXPA 4GZ6A 4TV3A 3ONKA 3D9LA 2CHWA 2A5UA 3OTNA 3Q5MA 3IHYA 4I6GA 3D9MA 2Y4TA 4APOA 1Z3XA 4ANWA 5AENA 5BV0A 1IHGA 3CVLA 4YVOA 4GA2A 5BUZA 4CDRA 5T4YA 1E7UA 2UWJG 3K9IA 4MS6A 2KCLA 3T5VA 3O4ZA 2L9BA 3QK0A 4GAAA 3TXMA 4E85A 2IQCA 1MHQA 2EQXA 2FBNA 5T8IA 3GZ2A 4AVXA 2WMNA 3JUIA 2X6KA 3ZGQA 4E6HA 1KLXA 3D3MA 4D10C 2UY1B 3L17A 2AXUA 3Q47B 2X38A 4L2YA 4C0EA 2KZTB 1TEZA 2V4LA 2IFUA 5KJNA 5G05C 4MLPA 2X6IA 2WXFA 2VYIA 4I1AA 2WXHA 2Y3AA 2WXNA 1OWLA 3S7DA 5LP0A 1UW4B 3APCA 3MV2B 4KT6B 2Y4UA 1E96B 3CQGB 1HFAA 2PZIA 3DPDA 1PAQA 3PUKA 4WNFA 2AVPA 2CFUA 3ONLA 4B8AA 2HYZA 3D9NA 3TXNA 5AJDA 4Q94A 4Q96A 2WMOA 2XGSA 4GYOA 4GZ5A 1JWGA 4KVOA 3QAQA 4G23A 3ZYLA 3L13A 4JEUA 4L1BA 4AP2A 3PUJA 4UWKA 3PEVB 4BSXA 2J4BA 2VQ2A 4GZCA 3R7QA 3R9AB 4N3BA 2WXRA 4UI9J 2MOWA 3ZVVA 3BG1B 4IULA 4G1TA 4HXIA 4L23A 3I3NA 5E75A 3HVEA 5LFAA 3MCXA 4CDMA 2R5SA 1W3BA 4UQZA 5M72A 3B13A 3NZSA 4EBAG 2KM4A 3PZDA 4KYOB 2HR2A 3OXLA 4I1MA 5E76A 3AS4A 3ASGA 4BX9A 3BG0B 5CMYA 1EF1C 2LSUA 3ZN3A 3KD7A 3UT8A 4GMLA 3L6AA 4APFA 4XI0A 5A6CA 3UT4A 1Y6IA 4GPKA 2YHCA 2WPVA 1IYGA 3OAWA 4HORA 3ZHEB 3CLJA 4GCNA 4KVMA 4BX8A 3HHMA 4LCTA 2IF4A 5AIJA 1NZNA 3RK6A 3FP3A 3FEYA 4BWRA 1A17A 2Q7FA 1N54A 3NQPA 3UMVA 3CVYA 3EIQC 5EKQD 2E2EA 4GYYA 4TUUA 2C0MA 4WWPA 2BTDA 4MRUA 3CR3A 3UUXA 4K03A 4WUYA 5BPPA 3FU5A 3ZRHA 3SD5A 2IJGX 3L08A 3FH7A 4KZCA 3VLDA 4FULA 4YNDA 4K0RA 2VSXE 3HVEB 2I1JA 4CT0A 3FY4A 5FZRA 4F7AA 3RRMB 4GA0A 3FUKA 3IKOB 2R59A 3JCKC 3KAEA 4C0MA 5A7DB 1XNFA 2X3MA 3D9PA 4H7YA 4ANVA 1IQRA 1U3CA 5G2NA 3SBTB 4U0UA 3C98A 1HG2A 4EZLA 3UPVA 4J0UA 3ZYKA 2DBAA 2V0PA 4JHKA 4N5CA 4XKBA 1HX8A 3WXXA 4BT8A 1E8ZA 3FU0A 2UY1A 1FVFA 4I43A 5G04J 2KZTA 5KCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKU A;  5BNW A;  4EQF A;  4AIF A;  3ULQ A;  4CGW A;  1WM5 A;  3MA5 A;  2KC7 A;  5EX0 A;  2V5F A;  2FI7 A;  2P58 C;  4N3C A;  3RU0 A;  5FZQ A;  3SZ7 A;  4HOU A;  4RG6 A;  3QOU A;  2XGM A;  4I9C A;  5G05 J;  4HOS A;  3Q49 B;  3MV3 B;  2FO7 A;  2FF4 A;  3ZFW A;  3FWV A;  2YQ8 A;  3S7B A;  1WAO 1;  3QWP A;  2QFC A;  3ZHE A;  2PQR A;  4JA9 A;  4BTA A;  4GZ3 A;  1PC2 A;  5BW8 C;  3ASH A;  2WQH A;  4U0Z A;  4UI9 K;  3CK7 A;  3LY8 A;  3CV0 A;  4I9E A;  3U3W A;  3GZ1 A;  4U07 A;  5KJL A;  4G2V A;  3LPZ A;  1NA3 A;  1P5Q A;  4HOT A;  3LY9 A;  1HXI A;  3N71 A;  3Q4A B;  2XCB A;  5JJ7 A;  3TGO A;  3S7F A;  2XEV A;  3ASF A;  5LCW C;  2NC9 A;  1ZU2 A;  4UI9 C;  3Q15 A;  1HH8 A;  2PL2 A;  2PQN A;  4IN3 B;  4U0S A;  3VTX A;  1ELW A;  3KS2 A;  4WND A;  3SF4 A;  3PDN A;  3MEK A;  2XGO A;  3QWV A;  4A1S A;  3CK8 A;  3U4T A;  4Y6W A;  4I17 A;  2L6J A;  4H7X A;  4B94 A;  5DIZ A;  5EX3 A;  4I2Z A;  2OND A;  3PE3 A;  4JL0 A;  3CKB A;  5KJM A;  3BEE A;  4HOQ A;  4AY6 A;  3TAX A;  3O48 A;  1Y8M A;  5AYW D;  4G24 A;  2GW1 A;  3OXF A;  4N2S A;  3TG5 A;  3HYM B;  1B89 A;  4N39 A;  4U04 A;  4GYW A;  4JA7 A;  5FZS A;  2HO1 A;  3ZPJ A;  3AS8 A;  3CVQ A;  3CKC A;  2LNI A;  2VSN A;  4YVQ C;  3E4B A;  3QDN A;  4KBQ A;  5G04 C;  4AY5 A;  3LY7 A;  3CVN A;  3OXG A;  2VGX B;  4G25 A;  3RO2 A;  2C0L A;  3JYS A;  5C1D A;  3IEG A;  3EDT B;  3MKR A;  4ME2 A;  5CCL A;  1NA0 A;  1KT0 A;  3RO3 A;  5FTP A;  4BT9 A;  4RG9 A;  1QQE A;  3ASD A;  3LYA A;  4J8E A;  2VGY A;  4WNE A;  4XI9 A;  3AS5 A;  3NF1 A;  4NQ0 A;  3TG4 A;  4JHR A;  3RIB A;  1TJC A;  2VSY A;  4NRH B;  2J9Q A;  3QKY A;  5D0O D;  3CVP A;  4AM9 A;  2C2L A;  4WNG A;  3GW4 A;  2BUG A;  2KAT A;  5FJY A;  1KT1 A;  5LCW J;  3CK9 A;  4LEU A;  3ESK A;  4W9R A;  3S7J A;  3CEQ A;  4UQX A;  5D0Q D;  4N3A A;  1YA0 A;  4BTB A;  5DBK A;  1FCH A;  3GYZ A;  4UQY A;  2XPI A;  2KCK A;  5BT1 A;  5FT9 A;  2XCC A;  2JLB A;  4F3V A;  3FFL A;  4CGV A;  2LSV A;  5ARF A;  4XIF A;  4KXK B;  4G26 A;  4N2Q A;  4J8F A;  3QWW A;  5CHE E;  5HI7 A;  1ELR A;  2FEZ A;  4GA1 A;  5JJT A;  2VGX A;  5CCM A;  2OOE A;  3PE4 A;  4I2W A;  5ARG A;  4GCO A;  3VTY A;  5JJ6 A;  1OUV A;  3RKV A;  5KJK A;  4O6F A;  4ABN A;  2I6H A;  3RJV A;  1ZBP A;  4J8D A;  1QZ2 A;  2KCV A;  5HQ8 A;  1HZ4 A;  3URZ A;  3UQ3 A;  3LCA A;  2MHK A;  4Y6C A;  4GZ6 A;  3Q5M A;  2Y4T A;  4APO A;  1IHG A;  3CVL A;  4YVO A;  4GA2 A;  4CDR A;  2UWJ G;  3K9I A;  2KCL A;  2FBN A;  3GZ2 A;  3ZGQ A;  1KLX A;  2UY1 B;  3Q47 B;  2IFU A;  5KJN A;  5G05 C;  2VYI A;  4I1A A;  3S7D A;  3MV2 B;  2Y4U A;  1E96 B;  2PZI A;  4WNF A;  2AVP A;  2HYZ A;  2XGS A;  4GYO A;  4GZ5 A;  4G23 A;  2VQ2 A;  3R9A B;  4N3B A;  4UI9 J;  4G1T A;  2R5S A;  1W3B A;  4UQZ A;  5M72 A;  4KYO B;  2HR2 A;  3OXL A;  3AS4 A;  3ASG A;  2LSU A;  3ZN3 A;  3KD7 A;  4XI0 A;  5A6C A;  4GPK A;  2YHC A;  2WPV A;  1IYG A;  4HOR A;  3ZHE B;  4GCN A;  2IF4 A;  1NZN A;  3FP3 A;  4BWR A;  1A17 A;  2Q7F A;  5EKQ D;  2E2E A;  4GYY A;  2C0M A;  3UUX A;  4WUY A;  4YND A;  5FZR A;  4GA0 A;  3KAE A;  5A7D B;  1XNF A;  4H7Y A;  4U0U A;  3UPV A;  4J0U A;  2DBA A;  4N5C A;  3WXX A;  4BT8 A;  2UY1 A;  5G04 J; 
#chains in the Genus database with same CATH topology
 1HG5 A;  4EBA A;  3ULQ A;  4CGW A;  4LER A;  2XPZ A;  3DXK G;  3SBS A;  1TNB A;  2L0T B;  3E37 A;  5EX0 A;  4FU3 A;  3UT7 A;  2P58 C;  4N3C A;  3UIP C;  2BED A;  1DC2 A;  2DYS E;  1JWF A;  2GRO B;  3SZ7 A;  2AXZ A;  4HOU A;  3QOU A;  2ZGD A;  2XGM A;  4I9C A;  2NXP A;  5G05 J;  1TJF A;  1JUQ A;  3CVV A;  2AW6 A;  2XS1 A;  4ZFH A;  3ZYM A;  3DEO A;  3WG7 E;  2NSZ A;  3ZFW A;  4U8V D;  2ETB A;  3DWL G;  2H6I A;  3ZHE A;  4ACK A;  1MX4 A;  3FTV A;  4JA9 A;  4I6E A;  5AQB A;  3ZIM A;  2KBX A;  3FUI A;  1OWM A;  3ASH A;  1SW6 A;  1LTX A;  4ACL A;  4YDE A;  4DX1 A;  2GRQ B;  1N52 A;  3CV0 A;  3GZ1 A;  4U07 A;  5KJL A;  2ZIS A;  2I9C A;  4RVB A;  1HXI A;  3PZ4 A;  5ANR A;  4PS8 A;  5JJ7 A;  1IQU A;  4CCA A;  1INZ A;  2WB2 A;  4HLL A;  1SZA A;  2R03 A;  1ZU2 A;  4UI9 C;  2PM6 A;  3JQ0 A;  1HH8 A;  1ELW A;  3GZS A;  3PDN A;  3MEK A;  2XGO A;  5FIO A;  1IKN D;  4EPZ A;  2DWZ A;  3AG2 E;  4GTV A;  2VTB B;  4HRM B;  1SA5 A;  4HOQ A;  3T8K A;  1U3D A;  3AG3 E;  4GTO A;  4A63 B;  3MYV A;  5FQ6 A;  3O48 A;  1Y8M A;  3RSE G;  5AYW D;  1OWP A;  1UJK A;  2VJ8 A;  3ASO E;  3SGH A;  2P9I G;  2IOL A;  3TG5 A;  3HYM B;  1B89 A;  4U04 A;  2H6H A;  4JA7 A;  2HO1 A;  3QJZ A;  1HE8 A;  4UUC A;  2ZGG A;  1HU3 A;  1TYQ G;  5ENN A;  5KWD A;  4XE0 A;  3CVN A;  3EUV A;  4G25 A;  3RO2 A;  5JHB A;  4FJY A;  3CHM A;  3AJI A;  2FUL A;  4OVV A;  1DNP A;  3L16 A;  5CCL A;  2J07 A;  3RO3 A;  1FT2 A;  4J6I A;  1QQE A;  2EIK E;  3LYA A;  3NOG D;  4J8E A;  3CVX A;  1MZC A;  4M7C A;  2QC9 A;  3IHV A;  5G55 A;  3NF1 A;  5EN5 D;  1TJC A;  1WY6 A;  2J9Q A;  4DLO A;  4O1P A;  3QNK A;  2C2L A;  3S2A A;  2WXJ A;  2BUG A;  2KAT A;  2CFZ A;  3ABM E;  3AG1 E;  1E7V A;  5LCW J;  1H19 A;  4FLH A;  2AWI A;  3Q73 A;  4URK A;  4RSY A;  3S7J A;  4U63 A;  4UQX A;  4CDN A;  2WVI A;  4N3A A;  1YA0 A;  2WXQ A;  1E8Y A;  2P9S G;  3SNX A;  2P9L G;  3B7U X;  5FT9 A;  3IV0 A;  2JLB A;  3W9G A;  4F3V A;  1O1R A;  2LSV A;  4XIF A;  4G26 A;  1K3Z D;  2GRR B;  3QWW A;  3C3Q A;  4TXP A;  1ELR A;  4J8Y A;  4GB9 A;  4G8L A;  3UM1 A;  4LUN U;  3V2O A;  4A55 A;  4F1S A;  4DJA A;  1WG0 A;  4JXT A;  2VGX A;  5CCM A;  3DBS A;  3PE4 A;  1L5J A;  4B89 A;  2J4D A;  3FTX A;  4U95 D;  5FQ4 A;  2M63 A;  3VLE A;  4HFG A;  4O6F A;  4ABN A;  2WQ6 A;  1UN8 A;  4JD2 G;  1O1S A;  4BY6 A;  2P9N G;  1S64 A;  2MHK A;  2YIN A;  4GZ6 A;  3ONK A;  1G3N B;  3OTN A;  3Q5M A;  3IHY A;  3D9M A;  4APO A;  4ANW A;  3CVL A;  3UIO C;  5BUZ A;  4MS6 A;  3T5V A;  3O4Z A;  4GAA A;  4E85 A;  3RAU A;  5T8I A;  1DCQ A;  2WMN A;  4E6H A;  3D3M A;  1S63 A;  3E32 A;  4C0E A;  5ITZ F;  2KZT B;  1TEZ A;  2RKK A;  5G05 C;  5B1B E;  4MLP A;  2X6I A;  2WXF A;  4TXQ A;  3S7D A;  1OWL A;  4TXR A;  3APC A;  5IY5 E;  4KT6 B;  3CQG B;  1U2V G;  1KPS B;  4Q96 A;  4UWK A;  3PEV B;  3LJN A;  3R7Q A;  4N3B A;  2WXR A;  4UI9 J;  2MOW A;  4L23 A;  2GRP B;  3MCX A;  2XZD G;  4CDM A;  1W3B A;  1TN8 A;  3B13 A;  3PZD A;  4KYO B;  2HR2 A;  3OXL A;  5E76 A;  4BX9 A;  1EF1 C;  3NAW A;  3ZN3 A;  3KD7 A;  4YDO A;  2YHC A;  1OXJ A;  5AQA A;  2WPV A;  3KEA A;  3CLJ A;  4BX8 A;  2J8S D;  3NQP A;  2Q7F A;  4TUU A;  2C0M A;  4RLY A;  3CR3 A;  2IJG X;  3FH7 A;  4KZC A;  4YND A;  4K0R A;  2I1J A;  3FY4 A;  4CZ2 D;  4QQI A;  5FZR A;  4OAU C;  3EU9 A;  2R59 A;  3KAE A;  3DSW A;  5BXU A;  1U3C A;  3C98 A;  2P2C P;  2V0P A;  2XEH A;  3FU0 A;  2UY1 A;  5EIL A;  2Y69 E;  1N0Q A;  2CHZ A;  3B7S A;  1FVH A;  4IRU A;  2WXM A;  2V5F A;  2FI7 A;  3LEW A;  4DX7 D;  3ZXS A;  3APF A;  3RU0 A;  3AU5 A;  3QC1 A;  1UN9 A;  4HOS A;  3UKR G;  4K5B A;  4I1O B;  3Q49 B;  5BV1 A;  3FTS A;  4C48 B;  2XPY A;  2YQ8 A;  3S7B A;  1UOH A;  3EIJ A;  2QFC A;  2WXO A;  3JUE A;  3P2B A;  4BTA A;  2BF0 X;  1H2T C;  3Q7A A;  3UIN C;  5BW8 C;  4L2L A;  3LS8 A;  3ML9 A;  3PEU B;  3EHR A;  2IU1 A;  4I9E A;  5ANL A;  3MGB A;  4PS3 A;  1NA3 A;  4G11 A;  4GTP A;  3LY9 A;  2Y0B G;  4FC8 A;  4RQI A;  5AAO A;  3N71 A;  4FHK A;  4GU5 A;  3ZXP A;  1GW6 A;  1OCR E;  5LCW C;  3FUD A;  4BET A;  1X81 A;  3Q15 A;  1H2U A;  4ILH B;  4F53 A;  2DCP A;  2XQ0 A;  3VTX A;  3KS2 A;  3LDZ A;  4CYM D;  4A1S A;  3HRA A;  4FHJ A;  3CK8 A;  2LO6 A;  2DIW A;  4Y6W A;  3TWX A;  2OVB A;  4H7X A;  5EX3 A;  2GGF A;  2WXI A;  4CRW A;  1FT1 A;  3BEE A;  5HS0 A;  4ZHB A;  3TAX A;  4DI4 A;  2WXL A;  4L7T A;  3MZL B;  3ML8 A;  3CST A;  4BSZ B;  2GW1 A;  3OXF A;  4N2S A;  4OVU A;  4NIK A;  3U66 A;  5FZS A;  3ULY A;  5JHA A;  3B95 A;  3CKC A;  5J08 A;  1EPU A;  2AXV A;  4YVQ C;  2Y1L E;  3FUJ A;  1TNU A;  3LY7 A;  5AQ7 A;  3HXE A;  3TWW A;  3JYS A;  3EDT B;  3MKR A;  4ME2 A;  4BFR A;  1BI8 B;  4PUC A;  3U9W A;  4RG9 A;  1PY1 A;  1SA4 A;  2YHE A;  5EYP F;  2RFM A;  1X5B A;  4WNE A;  4PDX A;  3AS5 A;  4NQ0 A;  2F8Y A;  4IYP A;  4U8H A;  1H2V C;  4CT4 A;  3QKY A;  1FPP A;  4WNG A;  2R17 C;  3GW4 A;  4GTM A;  5HKP A;  5A23 A;  2VTB A;  4NAC A;  3CIA A;  1Q2Z A;  1N9A A;  1MQS A;  2DVW A;  2VGE A;  3UI2 A;  3C72 A;  5D0Q D;  3HDX A;  1EDU A;  3FUM A;  4GTQ A;  4HS2 A;  3F6Q A;  1FCH A;  3GYZ A;  5CMW A;  3CHO A;  2X6H A;  1E90 A;  2XPI A;  1JCQ A;  3TWU A;  2ZXW E;  3MJW A;  2AJA A;  3UX4 A;  3PRE A;  4CGV A;  3LXU X;  5ARF A;  4J8F A;  5EIB E;  3SFY A;  4B8C B;  1TR4 A;  4B0Z A;  2FEZ A;  1KZO A;  4O60 A;  1N95 A;  3CHR A;  1N4Q A;  4GA1 A;  5JJT A;  4A1G A;  4B93 B;  5FIN A;  3L22 A;  2IOS A;  5CED B;  3Q7F A;  4K5A B;  3RJV A;  5CBO A;  2MRI A;  1QZ2 A;  2KCV A;  3G2V A;  3URZ A;  1SQM A;  3TWV A;  3PZ3 A;  4YDW A;  1OCC E;  3Q78 A;  4Y6C A;  2A4Z A;  5ENP D;  3ZYQ A;  2LAH A;  3KEZ A;  2WXP A;  2IEJ A;  1Z3X A;  4HRL A;  4CDR A;  1RZ4 A;  5T4Y A;  1E7U A;  3K9I A;  3QK0 A;  3KSQ A;  4HNA D;  3UTM A;  4AVX A;  3ZGQ A;  2BKG A;  2NYJ A;  3HXC A;  2V4L A;  3DPY A;  2WXH A;  1UW4 B;  2Y4U A;  1PAQ A;  4G8K A;  4WNF A;  3SY2 A;  2CFU A;  1V54 E;  2EIJ E;  2LXL A;  3ONL A;  4U8Y D;  3V79 K;  3TXN A;  2R02 A;  5AJD A;  4Q94 A;  3KSL A;  2WMO A;  4GYO A;  3QAQ A;  3L13 A;  3D9H A;  4BSX A;  2VQ2 A;  5B1A E;  1YCS B;  5B3S E;  3DSX A;  1TNO A;  5E75 A;  3HVE A;  2R5S A;  4UQZ A;  4EBA G;  3ASG A;  3ZUV B;  3BG0 B;  5CMY A;  2LSU A;  1S70 B;  5A6C A;  4GPK A;  1IYG A;  4HOR A;  4HI9 A;  4DUI A;  4KVM A;  2XS8 A;  1N54 A;  5EKQ D;  3ZU7 B;  2E2E A;  3L9T A;  4GYY A;  2F8X K;  4WWP A;  2BTD A;  4K03 A;  1V55 E;  5EYL A;  3VLD A;  2RFA A;  3HVE B;  3PZ1 A;  4CT0 A;  3ISM C;  5ENO D;  3SFX A;  3RRM B;  4C0M A;  2X3M A;  4ANV A;  3UPV A;  3ZYK A;  4JHK A;  4N5C A;  4XKB A;  1HX8 A;  2EIN E;  1TNY A;  4I43 A;  2KZT A;  5KCM A;  4GTS A;  3LKU A;  4EQF A;  4AIF A;  3PNT B;  3G2U A;  1VDY A;  2CHX A;  5JMN D;  2I1K A;  3MA5 A;  2GRN B;  2KC7 A;  5CBN A;  3PVL A;  1K1A A;  3IBE A;  2V8S E;  3C3O A;  1UG3 A;  1H6O A;  4PH4 B;  4RG6 A;  1MYO A;  3FTW A;  2IO2 C;  2XEN A;  2JEK A;  4DLQ A;  3NOC D;  3MV3 B;  4BES A;  2FO7 A;  4P29 A;  1KZP A;  4YDY A;  3V31 A;  3FWV A;  1WAO 1;  4HB5 A;  3QWP A;  4V3I A;  3FU6 A;  3I4G A;  2PQR A;  5CRU A;  4GZ3 A;  4ILG A;  5J90 A;  1PC2 A;  2J49 A;  4UI9 K;  1OY3 D;  3I5P A;  3HXD A;  4JVS A;  4ATG A;  5ENT D;  3ESL A;  1NI1 A;  4G2V A;  2KXP C;  5LOZ A;  1BPO A;  1P5Q A;  4HOT A;  3CHP A;  3DSV A;  4GZD A;  2XCB A;  3S7F A;  1S0P A;  2XEV A;  4XX5 A;  3AAA C;  3ASF A;  2NC9 A;  3FUE A;  4GMJ A;  3LVR E;  1K1B A;  2ZU6 B;  3CGH A;  4UWH A;  2OV8 A;  2PL2 A;  2PQN A;  4IN3 B;  2GRL A;  4K5C A;  3T8M A;  2I2O A;  3U4T A;  5AQ9 A;  1HO8 A;  4B94 A;  2XZT G;  4HI8 A;  4MBG A;  4DK5 A;  4I2Z A;  4JL0 A;  3CKB A;  3NZU A;  4ATZ D;  2XRY A;  5KJM A;  3TWS A;  3SQV A;  3RRU A;  2VSO E;  4EEC A;  4AOF A;  1O5M A;  2CG2 A;  4G24 A;  4ANX A;  5CER B;  3UXG A;  4N39 A;  4GYW A;  2LAI A;  3ENE A;  3ZPJ A;  4HRN A;  3AS8 A;  2BKK B;  4KZ0 A;  3BUA A;  3ZW3 A;  2LNI A;  1Z6T A;  3T5X A;  3E4B A;  4GTT A;  2H6G A;  3ABK E;  3EHM A;  3QDN A;  4AY5 A;  3PRZ A;  4NUR A;  2C0L A;  3IEG A;  2IY0 C;  3G2W A;  5FTP A;  4JPS A;  2B6C A;  4UWG A;  1N4R A;  4XKC A;  4TRQ A;  4JW1 A;  2L0I A;  3ABL E;  1BI7 B;  3D9I A;  4FP7 A;  4XI9 A;  4BER A;  1OCO E;  3CVW A;  4JHR A;  3RIB A;  5FQ8 A;  2VSY A;  3R9M A;  2L6B A;  5D0O D;  3CVP A;  1HF8 A;  1A5E A;  1LD7 A;  3LVQ E;  1AP7 A;  4J8S A;  3PNL B;  3BU8 A;  4TUM A;  4GMR A;  5FJY A;  4I6J A;  1KT1 A;  3HIZ A;  3CK9 A;  4LEU A;  4XZ4 A;  4DX5 D;  4W9R A;  4HBD A;  4WAF A;  3X2Q E;  1UJJ A;  4FJZ A;  5DBK A;  4EZJ A;  4UQY A;  2KCK A;  4BEP A;  2XRZ A;  2ZIR A;  5BT1 A;  3FEX A;  2XCC A;  5EDS A;  1YYH A;  1Z3Y A;  3FFL A;  1ZB1 A;  2GRM A;  4KXK B;  4N2Q A;  5CHE E;  4JEH A;  5C2Y A;  3B7R L;  1IHB A;  3E33 A;  3G2S A;  4LRZ A;  2X6F A;  1EYH A;  1ELK A;  4HQD A;  3ZNG A;  3APD A;  3FDH A;  5D2M C;  1MX2 A;  4GCO A;  3VTY A;  4HVB A;  4FA6 A;  5JJ6 A;  2E0I A;  4ANU A;  1OUV A;  3L82 A;  3RKV A;  4DPR A;  4C9B B;  5FQ7 A;  2FO1 E;  1JCR A;  1E8X A;  1E8W A;  4J8D A;  2RG8 A;  3EJN A;  4MKT A;  3LCA A;  4U96 D;  2XHE A;  2QY7 A;  3EHN A;  3DEP A;  2JAB A;  4TV3 A;  2CHW A;  5AEN A;  5BV0 A;  5KNG A;  1IHG A;  1QYM A;  4U7E B;  1WDY A;  3UM2 A;  1MHQ A;  2EQX A;  2FBN A;  3GZ2 A;  2X6K A;  1KLX A;  3Q47 B;  3L17 A;  2AXU A;  2X38 A;  4L2Y A;  2IO3 C;  2WXN A;  5LP0 A;  5CRV A;  3MV2 B;  1E96 B;  1HFA A;  3PUK A;  3D9N A;  3DSU A;  5CEC B;  3NBN B;  2XGS A;  3AG4 E;  4GZ5 A;  4L1B A;  1LD8 A;  3E34 A;  3UM3 A;  3Q79 A;  3IXE A;  3BG1 B;  1MJ0 A;  1Z5S C;  1N11 A;  3NZS A;  4I1M A;  5HRY A;  2LXM A;  2R2L A;  3UT8 A;  4GML A;  4O1O A;  3L6A A;  4APF A;  3UT4 A;  1QBQ A;  3NB2 A;  3OAW A;  3ZHE B;  4N5Q A;  2MYO A;  3RK6 A;  1TN7 A;  4BWR A;  1A17 A;  3UMV A;  3C5R A;  3DXM G;  4LG6 A;  3UUX A;  4WUY A;  3FU5 A;  1N4S A;  3SD5 A;  3L08 A;  3UM0 A;  4FUL A;  2VSX E;  4F7A A;  5AAR A;  3IKO B;  3JCK C;  1XNF A;  2QYJ A;  4H7Y A;  1IQR A;  5G2N A;  3SBT B;  4U0U A;  1BU9 A;  2DBA A;  3WXX A;  4BT8 A;  1E8Z A;  2F0Y A;  1FVF A;  3DST A;  4LSZ E;  4JHJ A;  5FWQ A;  5BNW A;  3AU4 A;  3FTZ A;  1N0R A;  3HG0 D;  3MKQ A;  4F1P A;  4GTR A;  2ION A;  2P9U G;  1WM5 A;  3CVU A;  5ENQ D;  3FTU A;  5FZQ A;  5EID A;  3B7B A;  3SFZ A;  1K8K G;  4AXH A;  3FH5 A;  3PH0 C;  2J09 A;  2WM9 A;  3CQC B;  3TWQ A;  3LJ3 A;  2FF4 A;  2QZA A;  4Z68 A;  3MKQ B;  2J08 A;  3JQ1 A;  3PS6 A;  4XEI G;  4A3T A;  4DI3 A;  5AN8 A;  4U0Z A;  2WQH A;  4FAD A;  2OCC E;  3CK7 A;  3UKU G;  2OVF A;  4JC8 A;  3LY8 A;  3FH8 A;  3U3W A;  1BD8 A;  3TL5 A;  3ULE G;  4HLE A;  3LPZ A;  4WWN A;  3Q4A B;  3FUF A;  2P9P G;  4Q69 A;  3TGO A;  4AJW A;  3ASN E;  2EIM E;  5ENS D;  3G2T A;  5D66 A;  3CSF A;  3ZKJ A;  1TNZ A;  4U0S A;  3FU3 A;  2CG3 A;  4WND A;  3SF4 A;  1SZ9 A;  3TWR A;  3QWV A;  3PZ2 A;  5H7P A;  3E30 A;  4I17 A;  2L6J A;  2RD0 A;  4JZY A;  5DIZ A;  3QAR A;  2OND A;  3PE3 A;  4OYS A;  4X8Q A;  1YMP A;  4FLB A;  2F37 A;  2PNN A;  4AY6 A;  3CHS A;  5KNH D;  3U64 A;  2OEV A;  4R7L A;  3RRN B;  4QFV A;  3D9O A;  2YNQ A;  3C3R A;  1H0A A;  3HXF A;  4GPM A;  4EZK A;  3CVQ A;  3FUH A;  2VSN A;  1O1T A;  2WQ7 A;  3FUL A;  3SHF A;  3ZEF A;  4KBQ A;  5G04 C;  3OXG A;  5JA4 D;  2VGX B;  4DX6 D;  5C1D A;  2R05 A;  3EHQ A;  5BXO A;  1TN6 A;  1NA0 A;  1KT0 A;  3TJP A;  4BT9 A;  4UWF A;  3ASD A;  4AEZ C;  1H6K A;  2H6F A;  1N94 A;  3TWT A;  4CEM A;  3Q9N C;  2VGY A;  2OEW A;  2P9K G;  2WXK A;  3D9K A;  3TG4 A;  1NFI E;  1AWC B;  3L54 A;  1OWN A;  1DVP A;  4UWL A;  4NRH B;  3FTY A;  4AM9 A;  3MX3 A;  3P1U A;  3SO8 A;  3J5Q B;  2A5E A;  5LX8 A;  5AJL A;  3B7T A;  3ESK A;  2XEE A;  4DX2 A;  1D9S A;  1D8D A;  2ETC A;  3CEQ A;  1LF8 A;  3EU5 A;  5T3R A;  4J7W A;  1NL4 A;  3DSS A;  4BTB A;  1SVX A;  2ILR A;  3JXJ A;  1OCZ E;  1D8E A;  2X6J A;  1HS6 A;  3T9K A;  4OAV B;  4LNU D;  1XGW A;  4M3O A;  4KMO A;  2PM7 A;  4AV7 A;  4A3V A;  3FUN A;  1OT8 A;  5HI7 A;  3CHQ A;  3Q9U C;  4ILI A;  3BQO A;  4PS7 A;  4WWO A;  3SI5 A;  2WXG A;  2OOE A;  4I2W A;  2DZN A;  5ARG A;  3R7R A;  1H6P A;  1BLX B;  1JPL A;  3I4R B;  3DRA A;  5KJK A;  3FHE A;  2I6H A;  1ZBP A;  1IXV A;  3JXI A;  1NP7 A;  3QB2 A;  1OWO A;  1QNF A;  3D9J A;  5HQ8 A;  1HZ4 A;  3UQ3 A;  4L9P A;  4JB8 P;  3VLF A;  2ETA A;  2HM8 A;  3D9L A;  2A5U A;  4I6G A;  2Y4T A;  4YVO A;  4GA2 A;  3V30 A;  2UWJ G;  2KCL A;  2B0O E;  2L9B A;  2EIL E;  3TXM A;  2IQC A;  3V2X A;  3JUI A;  5ENR D;  4D10 C;  1DCE A;  2UY1 B;  2IFU A;  5KJN A;  4F6R D;  2VYI A;  4I1A A;  2Y3A A;  4LNG A;  5CEA A;  3DPD A;  2PZI A;  2AVP A;  4B8A A;  3W9F A;  2HYZ A;  1N4P A;  2QYU A;  1JWG A;  4KVO A;  3ZYL A;  4G23 A;  1JCS A;  4JEU A;  4AP2 A;  3PUJ A;  4EHM A;  2J4B A;  4GZC A;  3R9A B;  3ZVV A;  4IUL A;  4G1T A;  4HXI A;  3I3N A;  5LFA A;  5M72 A;  2KM4 A;  2V5Q C;  3AS4 A;  2HE0 A;  4XI0 A;  1Y6I A;  2LUH A;  4GCN A;  3HHM A;  4LCT A;  2IF4 A;  5AIJ A;  1NZN A;  3FP3 A;  3FEY A;  3J5P A;  2V4H C;  3CVY A;  3EIQ C;  1MX6 A;  1RW2 A;  4MRU A;  5BPP A;  3ZRH A;  3HXB A;  4DRX E;  4GA0 A;  3FUK A;  5A7D B;  2DZO A;  3D9P A;  4LNB A;  3Q75 A;  1HG2 A;  4EZL A;  4J0U A;  2DYR E;  5G04 J;  5KBA A; 
#chains in the Genus database with same CATH homology
 1HG5 A;  3LKU A;  4JHJ A;  5FWQ A;  4EBA A;  5BNW A;  3AU4 A;  4EQF A;  3FTZ A;  4AIF A;  3ULQ A;  3PNT B;  4LER A;  2XPZ A;  4CGW A;  3MKQ A;  3G2U A;  3SBS A;  1VDY A;  2CHX A;  2CHZ A;  2ION A;  3B7S A;  1WM5 A;  1FVH A;  4IRU A;  2L0T B;  2I1K A;  3MA5 A;  3CVU A;  2WXM A;  2KC7 A;  5EX0 A;  2V5F A;  4FU3 A;  2FI7 A;  3UT7 A;  3LEW A;  2P58 C;  4N3C A;  3ZXS A;  3FTU A;  3APF A;  3PVL A;  3RU0 A;  3AU5 A;  5FZQ A;  3IBE A;  2V8S E;  3SFZ A;  1JWF A;  1UG3 A;  3SZ7 A;  4AXH A;  4PH4 B;  2AXZ A;  4HOU A;  4RG6 A;  3QOU A;  2XGM A;  4I9C A;  2NXP A;  5G05 J;  3QC1 A;  1UN9 A;  1TJF A;  3FH5 A;  3FTW A;  3PH0 C;  1JUQ A;  3CVV A;  2J09 A;  4HOS A;  2WM9 A;  3CQC B;  2AW6 A;  2JEK A;  4I1O B;  4DLQ A;  3Q49 B;  5BV1 A;  3LJ3 A;  3ZYM A;  3MV3 B;  2FO7 A;  3FTS A;  2FF4 A;  2NSZ A;  4P29 A;  3ZFW A;  2XPY A;  3FWV A;  2YQ8 A;  3S7B A;  1WAO 1;  3MKQ B;  3EIJ A;  2J08 A;  3QWP A;  2QFC A;  4V3I A;  3ZHE A;  3FU6 A;  2WXO A;  3I4G A;  4ACK A;  2PQR A;  3FTV A;  3P2B A;  4JA9 A;  4I6E A;  4BTA A;  2BF0 X;  1H2T C;  3JQ1 A;  4GZ3 A;  4ILG A;  5J90 A;  1PC2 A;  3PS6 A;  3ZIM A;  4A3T A;  3FUI A;  2J49 A;  4DI3 A;  5BW8 C;  4L2L A;  1OWM A;  2WQH A;  3ASH A;  4U0Z A;  4FAD A;  3LS8 A;  4UI9 K;  3I5P A;  3ML9 A;  3CK7 A;  4ACL A;  2OVF A;  4JVS A;  4ATG A;  3PEU B;  2IU1 A;  3LY8 A;  4JC8 A;  3FH8 A;  1N52 A;  3CV0 A;  4I9E A;  3U3W A;  3ESL A;  3GZ1 A;  4U07 A;  5KJL A;  5ANL A;  2I9C A;  4G2V A;  3MGB A;  3TL5 A;  5LOZ A;  4HLE A;  4PS3 A;  3LPZ A;  1NA3 A;  1BPO A;  4G11 A;  1P5Q A;  4HOT A;  4WWN A;  3CHP A;  3LY9 A;  4FC8 A;  4RVB A;  1HXI A;  5ANR A;  3N71 A;  3Q4A B;  4FHK A;  4GZD A;  4GU5 A;  2XCB A;  3FUF A;  1GW6 A;  4PS8 A;  5JJ7 A;  4Q69 A;  3S7F A;  1S0P A;  3TGO A;  2XEV A;  4XX5 A;  1IQU A;  4AJW A;  3ASF A;  4CCA A;  5LCW C;  2NC9 A;  1INZ A;  3FUD A;  3FUE A;  2WB2 A;  4GMJ A;  1SZA A;  1ZU2 A;  3G2T A;  3LVR E;  3CSF A;  4UI9 C;  3Q15 A;  2ZU6 B;  3CGH A;  1H2U A;  4UWH A;  4ILH B;  2PM6 A;  2OV8 A;  1HH8 A;  2PL2 A;  2PQN A;  3JQ0 A;  4F53 A;  4IN3 B;  2DCP A;  4U0S A;  2XQ0 A;  2GRL A;  3FU3 A;  3T8M A;  3VTX A;  2CG3 A;  1ELW A;  3GZS A;  3KS2 A;  4WND A;  3SF4 A;  3PDN A;  3LDZ A;  1SZ9 A;  3MEK A;  2XGO A;  3QWV A;  2I2O A;  4A1S A;  4FHJ A;  3CK8 A;  2LO6 A;  3U4T A;  2DIW A;  4I17 A;  4Y6W A;  2L6J A;  2RD0 A;  4JZY A;  4EPZ A;  2OVB A;  4H7X A;  1HO8 A;  4B94 A;  5DIZ A;  3QAR A;  5EX3 A;  2GGF A;  2WXI A;  2VTB B;  4CRW A;  4DK5 A;  4I2Z A;  2OND A;  3PE3 A;  4OYS A;  4JL0 A;  3CKB A;  3NZU A;  2XRY A;  5KJM A;  3BEE A;  4HOQ A;  4FLB A;  1U3D A;  4AY6 A;  3CHS A;  3RRU A;  3MYV A;  5FQ6 A;  3TAX A;  3U64 A;  2VSO E;  4EEC A;  4DI4 A;  3O48 A;  1Y8M A;  2WXL A;  4AOF A;  4L7T A;  5AYW D;  1OWP A;  4R7L A;  3MZL B;  3ML8 A;  3RRN B;  1UJK A;  3CST A;  2CG2 A;  4G24 A;  4ANX A;  2VJ8 A;  2GW1 A;  3SGH A;  3OXF A;  4N2S A;  4QFV A;  2IOL A;  3TG5 A;  3HYM B;  4OVU A;  1B89 A;  3D9O A;  4N39 A;  4U04 A;  2YNQ A;  3U66 A;  4GYW A;  4JA7 A;  5FZS A;  2HO1 A;  2LAI A;  3ENE A;  3ZPJ A;  3QJZ A;  1H0A A;  1HE8 A;  3AS8 A;  5JHA A;  4EZK A;  3CVQ A;  4KZ0 A;  1HU3 A;  3FUH A;  3CKC A;  3ZW3 A;  2LNI A;  1EPU A;  5J08 A;  1Z6T A;  2AXV A;  2VSN A;  4YVQ C;  3T5X A;  2WQ7 A;  5ENN A;  3E4B A;  3FUL A;  3FUJ A;  3SHF A;  3ZEF A;  3EHM A;  3QDN A;  4KBQ A;  5G04 C;  4AY5 A;  3LY7 A;  3PRZ A;  4XE0 A;  3CVN A;  3OXG A;  4NUR A;  2VGX B;  4G25 A;  3RO2 A;  2C0L A;  5JHB A;  4FJY A;  3JYS A;  3CHM A;  3IEG A;  5C1D A;  3EDT B;  3MKR A;  2FUL A;  4OVV A;  4ME2 A;  4BFR A;  1DNP A;  3L16 A;  5CCL A;  1NA0 A;  3G2W A;  1KT0 A;  2J07 A;  4PUC A;  3TJP A;  3RO3 A;  5FTP A;  4JPS A;  4J6I A;  3U9W A;  4BT9 A;  4UWG A;  4RG9 A;  1QQE A;  4UWF A;  3ASD A;  4XKC A;  4TRQ A;  1PY1 A;  4AEZ C;  3LYA A;  2YHE A;  4JW1 A;  2L0I A;  4J8E A;  1H6K A;  4CEM A;  3CVX A;  2VGY A;  1X5B A;  4WNE A;  4PDX A;  3IHV A;  5G55 A;  3D9I A;  4FP7 A;  4XI9 A;  3AS5 A;  3NF1 A;  4NQ0 A;  2WXK A;  3D9K A;  4IYP A;  3TG4 A;  4U8H A;  3L54 A;  3CVW A;  1OWN A;  4JHR A;  1DVP A;  3RIB A;  5FQ8 A;  1H2V C;  1TJC A;  4UWL A;  2VSY A;  4NRH B;  1WY6 A;  4CT4 A;  2J9Q A;  3FTY A;  3QKY A;  4DLO A;  5D0O D;  3CVP A;  4AM9 A;  3QNK A;  2C2L A;  4WNG A;  3MX3 A;  1HF8 A;  3S2A A;  2R17 C;  3P1U A;  2WXJ A;  3GW4 A;  3LVQ E;  4J8S A;  3PNL B;  2BUG A;  2KAT A;  5FJY A;  4I6J A;  1KT1 A;  2CFZ A;  3HIZ A;  1E7V A;  5LCW J;  5A23 A;  5LX8 A;  1H19 A;  3CK9 A;  4FLH A;  4LEU A;  4XZ4 A;  5AJL A;  3B7T A;  2AWI A;  3ESK A;  4URK A;  2VTB A;  4NAC A;  4RSY A;  4W9R A;  4WAF A;  3CIA A;  3S7J A;  1MQS A;  3CEQ A;  1LF8 A;  4U63 A;  4UQX A;  5T3R A;  1UJJ A;  5D0Q D;  3HDX A;  4FJZ A;  4CDN A;  2WVI A;  1EDU A;  3FUM A;  4N3A A;  1YA0 A;  4BTB A;  2WXQ A;  4HS2 A;  5DBK A;  4EZJ A;  1E8Y A;  1FCH A;  3GYZ A;  5CMW A;  2ILR A;  3CHO A;  3SNX A;  4UQY A;  2X6H A;  1E90 A;  2XPI A;  2KCK A;  2X6J A;  3B7U X;  2XRZ A;  5BT1 A;  1HS6 A;  3FEX A;  5FT9 A;  2XCC A;  5EDS A;  3IV0 A;  3MJW A;  2JLB A;  3UX4 A;  3PRE A;  1XGW A;  4M3O A;  1Z3Y A;  3FFL A;  4KMO A;  2LSV A;  2GRM A;  3LXU X;  5ARF A;  4XIF A;  4KXK B;  4F3V A;  4CGV A;  4G26 A;  2PM7 A;  4N2Q A;  4J8F A;  4AV7 A;  3QWW A;  5CHE E;  4A3V A;  3FUN A;  4JEH A;  5C2Y A;  3B7R L;  5HI7 A;  3CHQ A;  4ILI A;  4B8C B;  1ELR A;  3G2S A;  4GB9 A;  4LUN U;  2FEZ A;  4LRZ A;  4B0Z A;  4A55 A;  4F1S A;  4DJA A;  3CHR A;  2X6F A;  4GA1 A;  5JJT A;  4WWO A;  4PS7 A;  4JXT A;  1EYH A;  1ELK A;  2VGX A;  2WXG A;  3SI5 A;  4A1G A;  3APD A;  5CCM A;  2OOE A;  3DBS A;  3FDH A;  1L5J A;  3PE4 A;  4I2W A;  4B89 A;  5ARG A;  2J4D A;  4GCO A;  3R7R A;  3FTX A;  3VTY A;  5FQ4 A;  4HVB A;  1JPL A;  2M63 A;  5JJ6 A;  4FA6 A;  3I4R B;  2E0I A;  4ANU A;  1OUV A;  3L22 A;  3RKV A;  3VLE A;  2IOS A;  4HFG A;  4DPR A;  5KJK A;  3FHE A;  4C9B B;  4O6F A;  4ABN A;  2I6H A;  5FQ7 A;  1E8X A;  1ZBP A;  3RJV A;  1E8W A;  1NP7 A;  3QB2 A;  4J8D A;  1QNF A;  1OWO A;  1QZ2 A;  1UN8 A;  2MRI A;  3D9J A;  2WQ6 A;  2KCV A;  2RG8 A;  5HQ8 A;  3EJN A;  4MKT A;  3G2V A;  1HZ4 A;  4BY6 A;  3URZ A;  1SQM A;  3UQ3 A;  3LCA A;  2MHK A;  2XHE A;  2QY7 A;  3EHN A;  4Y6C A;  2A4Z A;  3ZYQ A;  2YIN A;  3VLF A;  2LAH A;  3KEZ A;  2HM8 A;  2WXP A;  4GZ6 A;  4TV3 A;  3ONK A;  3D9L A;  2CHW A;  2A5U A;  3OTN A;  3Q5M A;  3IHY A;  4I6G A;  3D9M A;  2Y4T A;  4APO A;  1Z3X A;  4ANW A;  5AEN A;  5BV0 A;  1IHG A;  3CVL A;  4YVO A;  4GA2 A;  5BUZ A;  4CDR A;  5T4Y A;  1E7U A;  2UWJ G;  3K9I A;  4MS6 A;  2KCL A;  3T5V A;  3O4Z A;  2L9B A;  3QK0 A;  4GAA A;  3TXM A;  4E85 A;  2IQC A;  1MHQ A;  2EQX A;  2FBN A;  5T8I A;  3GZ2 A;  4AVX A;  2WMN A;  3JUI A;  2X6K A;  3ZGQ A;  4E6H A;  1KLX A;  3D3M A;  4D10 C;  2UY1 B;  3L17 A;  2AXU A;  3Q47 B;  2X38 A;  4L2Y A;  4C0E A;  2KZT B;  1TEZ A;  2V4L A;  2IFU A;  5KJN A;  5G05 C;  4MLP A;  2X6I A;  2WXF A;  2VYI A;  4I1A A;  2WXH A;  2Y3A A;  2WXN A;  1OWL A;  3S7D A;  5LP0 A;  1UW4 B;  3APC A;  3MV2 B;  4KT6 B;  2Y4U A;  1E96 B;  3CQG B;  1HFA A;  2PZI A;  3DPD A;  1PAQ A;  3PUK A;  4WNF A;  2AVP A;  2CFU A;  3ONL A;  4B8A A;  2HYZ A;  3D9N A;  3TXN A;  5AJD A;  4Q94 A;  4Q96 A;  2WMO A;  2XGS A;  4GYO A;  4GZ5 A;  1JWG A;  4KVO A;  3QAQ A;  4G23 A;  3ZYL A;  3L13 A;  4JEU A;  4L1B A;  4AP2 A;  3PUJ A;  4UWK A;  3PEV B;  4BSX A;  2J4B A;  2VQ2 A;  4GZC A;  3R7Q A;  3R9A B;  4N3B A;  2WXR A;  4UI9 J;  2MOW A;  3ZVV A;  3BG1 B;  4IUL A;  4G1T A;  4HXI A;  4L23 A;  3I3N A;  5E75 A;  3HVE A;  5LFA A;  3MCX A;  4CDM A;  2R5S A;  1W3B A;  4UQZ A;  5M72 A;  3B13 A;  3NZS A;  4EBA G;  2KM4 A;  3PZD A;  4KYO B;  2HR2 A;  3OXL A;  4I1M A;  5E76 A;  3AS4 A;  3ASG A;  4BX9 A;  3BG0 B;  5CMY A;  1EF1 C;  2LSU A;  3ZN3 A;  3KD7 A;  3UT8 A;  4GML A;  3L6A A;  4APF A;  4XI0 A;  5A6C A;  3UT4 A;  1Y6I A;  4GPK A;  2YHC A;  2WPV A;  1IYG A;  3OAW A;  4HOR A;  3ZHE B;  3CLJ A;  4GCN A;  4KVM A;  4BX8 A;  3HHM A;  4LCT A;  2IF4 A;  5AIJ A;  1NZN A;  3RK6 A;  3FP3 A;  3FEY A;  4BWR A;  1A17 A;  2Q7F A;  1N54 A;  3NQP A;  3UMV A;  3CVY A;  3EIQ C;  5EKQ D;  2E2E A;  4GYY A;  4TUU A;  2C0M A;  4WWP A;  2BTD A;  4MRU A;  3CR3 A;  3UUX A;  4K03 A;  4WUY A;  5BPP A;  3FU5 A;  3ZRH A;  3SD5 A;  2IJG X;  3L08 A;  3FH7 A;  4KZC A;  3VLD A;  4FUL A;  4YND A;  4K0R A;  2VSX E;  3HVE B;  2I1J A;  4CT0 A;  3FY4 A;  5FZR A;  4F7A A;  3RRM B;  4GA0 A;  3FUK A;  3IKO B;  2R59 A;  3JCK C;  3KAE A;  4C0M A;  5A7D B;  1XNF A;  2X3M A;  3D9P A;  4H7Y A;  4ANV A;  1IQR A;  1U3C A;  5G2N A;  3SBT B;  4U0U A;  3C98 A;  1HG2 A;  4EZL A;  3UPV A;  4J0U A;  3ZYK A;  2DBA A;  2V0P A;  4JHK A;  4N5C A;  4XKB A;  1HX8 A;  3WXX A;  4BT8 A;  1E8Z A;  3FU0 A;  2UY1 A;  1FVF A;  4I43 A;  5G04 J;  2KZT A;  5KCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...