3ASFA

Mama msr-1 c2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
174
structure length
174
Chain Sequence
b'DIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnetosome protein MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Protein binding
total genus 66
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asfA01
2XCCA 4APOA 1A17A 2E2EA 2LSVA 2PZIA 4I2WA 4GPKA 4GA1A 2VYIA 4G26A 4IN3B 1NA0A 2C2LA 2VGXB 3Q4AB 3ZHEA 3RJVA 3FWVA 5HQ8A 4N3AA 2R5SA 4A1SA 3FFLA 4AY6A 2BUGA 3WXXA 5BT1A 3CVQA 3ESKA 3QDNA 3QKYA 4U0ZA 3O48A 1HH8A 2FBNA 4U07A 3PE4A 4WNFA 5ARFA 4Y6CA 4N5CA 5G05C 5HI7A 2ONDA 4BT8A 3CVLA 2PQNA 5ARGA 4HOUA 2FF4A 3GW4A 2FI7A 4I17A 5JJ7A 5KJNA 1ZU2A 3S7JA 2XPIA 3ULQA 3U3WA 2PQRA 2Q7FA 2P58C 2YQ8A 5DBKA 2GW1A 4HORA 4HOSA 4NQ0A 3LKUA 3UQ3A 5BNWA 4U0UA 4XIFA 3Q5MA 2I6HA 4HOQA 5EX3A 4WUYA 2VGYA 2KCKA 2AVPA 4GA0A 5FJYA 4N39A 4AM9A 2UWJG 1Y8MA 3TAXA 4UI9C 3CK8A 3ASDA 3MKRA 4I2ZA 3VTYA 3CKBA 3LYAA 4UQXA 4G1TA 1KT0A 4N2SA 3GYZA 3QWVA 1ZBPA 4GYWA 5A7DB 4YVQC 1TJCA 3LPZA 3CV0A 1W3BA 4LEUA 3MV3B 5KJMA 2XCBA 1IYGA 2HO1A 4KBQA 4WNEA 2J9QA 2XGMA 2VSYA 2DBAA 3RIBA 3TG4A 1NZNA 4H7XA 3TG5A 3GZ1A 3FP3A 3Q47B 4J0UA 5DIZA 3UPVA 3KS2A 2MHKA 3LY8A 4CGWA 4XI0A 4YVOA 4F3VA 3N71A 4BWRA 3E4BA 4YNDA 3ZPJA 4G25A 4CGVA 2IFUA 4O6FA 2Y4TA 2KCVA 3TGOA 3AS8A 5KJKA 4UQZA 1FCHA 2NC9A 3QWWA 4CDRA 3ASHA 5JJ6A 3S7FA 2KCLA 3U4TA 5CCLA 4N2QA 1WAO1 5LCWJ 2UY1A 3HYMB 5D0QD 4G24A 3KAEA 3OXGA 3EDTB 3Q15A 4J8FA 1IHGA 5LCWC 4JL0A 3ZN3A 4I9CA 4UI9K 5FZSA 4U04A 5FT9A 3K9IA 2QFCA 4JA9A 1QZ2A 3PDNA 2UY1B 5CHEE 4GZ5A 3LY9A 3MA5A 4W9RA 4AIFA 3LY7A 4N3BA 4RG9A 1E96B 2V5FA 3ZFWA 4Y6WA 1OUVA 1YA0A 3VTXA 2WPVA 5EKQD 4BTAA 4NRHB 3CK7A 5G04J 3BEEA 4GCNA 4GA2A 2C0LA 3QWPA 2PL2A 4I1AA 4JA7A 3CEQA 2KC7A 2OOEA 4J8EA 5D0OD 3S7DA 2JLBA 1NA3A 3CK9A 3ASGA 2XGSA 5AYWD 1KT1A 5CCMA 4ME2A 1PC2A 5KJLA 1QQEA 4I9EA 4H7YA 2KATA 5EX0A 5FZRA 4N3CA 4U0SA 2FO7A 1WM5A 4GZ3A 3KD7A 3CVPA 1XNFA 4B94A 5G05J 4ABNA 2HYZA 2WQHA 5A6CA 3PE3A 4GCOA 2YHCA 3MV2B 1P5QA 3SZ7A 4HOTA 3RO2A 3S7BA 3SF4A 2XGOA 4GYOA 3ZHEB 3QOUA 2C0MA 5JJTA 4JHRA 3AS5A 4J8DA 2LSUA 3JYSA 3RKVA 3URZA 4EQFA 5FTPA 3NF1A 4KXKB 4RG6A 4G23A 3ZGQA 1ELRA 3R9AB 3UUXA 5BW8C 3OXLA 4UI9J 4BTBA 5C1DA 3MEKA 3LCAA 1HXIA 1B89A 4WNGA 3CKCA 1HZ4A 1ELWA 4KYOB 4G2VA 3RU0A 4BT9A 1KLXA 2Y4UA 3IEGA 2XEVA 2LNIA 2VQ2A 3Q49B 2HR2A 5FZQA 2VGXA 2IF4A 4GYYA 2FEZA 4AY5A 3RO3A 2VSNA 3ASFA 3AS4A 4UQYA 5G04C 4GZ6A 5M72A 4WNDA 2L6JA 4XI9A 3GZ2A 3CVNA 3OXFA
chains in the Genus database with same CATH superfamily
4APOA 5KWDA 2PZIA 4GPKA 2VYIA 3CQGB 3V31A 4BSXA 4P29A 1OWMA 2X6FA 1DC2A 3P1UA 3TL5A 3L13A 4U63A 3RJVA 3FWVA 3FU5A 1HS6A 4FLBA 1L5JA 2X6JA 3PH0C 1EPUA 2R05A 5BT1A 2BKKB 3QDNA 4R7LA 3MKQB 5G2NA 3O48A 2FBNA 3TXMA 3ZYMA 3EIQC 4FHJA 3PE4A 3UIOC 2DZOA 1H6OA 2VJ8A 4B8AA 1OCRE 3Q9UC 4Y6CA 4FA6A 3D9NA 4BX8A 4N5CA 4YDOA 3CVYA 3L54A 3T5XA 1NL4A 3FU6A 4G8LA 3BUAA 1TNBA 3GW4A 3DSSA 4I17A 3SFYA 5JJ7A 5KJNA 4JXTA 3I3NA 1UOHA 1N4QA 2XPIA 5B3SE 5CBOA 4FP7A 1ELKA 3ULQA 2IO2C 3U3WA 3QARA 2XS1A 2PQRA 4XKBA 2P58C 3T9KA 2X6IA 5AAOA 4NURA 5BNWA 1HO8A 4XIFA 5LP0A 4TXPA 2KCKA 4OVVA 3CVVA 5FJYA 5H7PA 3LXUX 4TV3A 4A55A 1AWCB 4UI9C 2DCPA 5T3RA 1FPPA 3ZKJA 4NACA 2A5UA 5EN5D 1TN7A 3MKRA 4I2ZA 4I6GA 3CKBA 3PREA 5EYPF 3L16A 2CFZA 5ANLA 4F1SA 5A7DB 3LEWA 3MV3B 1BI8B 4DLQA 3UKRG 1MJ0A 2XGMA 3FHEA 1K3ZD 3GZ1A 2DZNA 3SBSA 3FUMA 3UPVA 3D9LA 2VTBA 3FH8A 3BU8A 4GTOA 4AVXA 1HG5A 3DBSA 4KVMA 3AG2E 4GPMA 4YNDA 3ZPJA 2RFAA 3S2AA 1NI1A 4FC8A 2ZXWE 4G25A 2DWZA 1MX6A 3FEXA 2KCVA 3AS8A 3CHPA 4UQZA 1FCHA 2NC9A 3ASHA 4GZDA 3S7FA 4U8VD 1V54E 3U4TA 4XZ4A 1SA5A 4LRZA 4B89A 3DSUA 2ETBA 4YDYA 4HRLA 1K1BA 1WY6A 4G24A 5D2MC 3JQ0A 3NZSA 4IYPA 4GTTA 5LCWC 2ZIRA 1Z5SC 5FT9A 4GTPA 4FHKA 2NXPA 3VLDA 3HG0D 2UY1B 3PRZA 5CHEE 2H6IA 3CVXA 3D9OA 4DX7D 4AIFA 3FU3A 3AG4E 2GRPB 5A23A 4X8QA 3NZUA 3LY7A 2XRZA 4N3BA 4RG9A 1JCSA 2XHEA 4EPZA 2KZTA 3ZUVB 1V55E 5CMWA 3ZFWA 1OUVA 3PUJA 1PAQA 3CK7A 4QQIA 5G04J 4GCNA 3CEQA 4A63B 2KC7A 2OOEA 2F8XK 5D0OD 4AJWA 3VLFA 3D9HA 2JLBA 3PZ1A 2R17C 2XGSA 4GTQA 1KT1A 1MX2A 3QK0A 1IXVA 2XEHA 1JPLA 2RFMA 4KVOA 4WAFA 1NFIE 3QAQA 3U66A 4HI8A 4ME2A 2PM7A 3PZ4A 1PC2A 5BXUA 5KJLA 1TNZA 1XGWA 2V5QC 3ZRHA 1OCCE 5LOZA 3SFZA 4PUCA 1H2VC 4N3CA 4U0SA 4CEMA 4LUNU 5FQ8A 3MJWA 2WQHA 5A6CA 1IQRA 1TR4A 3D9MA 2YHCA 3MV2B 3ZXPA 3SZ7A 1KPSB 4GMRA 4OAUC 2VSOE 4HOTA 2XEEA 3RO2A 3SF4A 2ETAA 2XGOA 1YYHA 4GYOA 3ESLA 3ZHEB 3UINC 4M7CA 4BETA 3AS5A 3FUKA 2P9KG 1SQMA 1DCEA 4KZCA 5ITZF 3TWSA 4HS2A 3JUIA 4G23A 4V3IA 1U3DA 3OXLA 3APDA 1FVFA 3CHQA 2J4DA 4G8KA 1BU9A 2ILRA 2MYOA 3L82A 1HU3A 3FU0A 4D10C 1VDYA 4PS7A 1IKND 4G2VA 3CHMA 2AXUA 2XEVA 2VQ2A 5FIOA 2IF4A 2ZU6B 3RO3A 3P2BA 4GU5A 4HRMB 4MKTA 3AU4A 3ASFA 2XRYA 1N54A 1Q2ZA 4UQYA 5G04C 2H6GA 2P9UG 3B7TA 3CVNA 1BD8A 2ETCA 3ONKA 3V2OA 5FWQA 5T4YA 1JUQA 3QNKA 2X6HA 1NA0A 4YDEA 3Q9NC 1OWNA 3I4RB 1SA4A 1E7UA 4N3AA 3GZSA 4A1SA 3FFLA 3WXXA 3CVQA 2EINE 3QKYA 2WXMA 4U07A 1H6KA 3T5VA 3FEYA 3LVQE 1SVXA 4ANWA 3TWRA 2GROB 3PS6A 3CVLA 1E8XA 5ARGA 3TWQA 4GAAA 1KZOA 2F8YA 1BI7B 3DXKG 3D9PA 2V0PA 4RSYA 2NYJA 3FUEA 3S7JA 4ANUA 4M3OA 3ML8A 5J90A 3DPYA 4BEPA 3HXFA 5EIBE 5KNGA 1IHBA 5DBKA 2GW1A 3J5PA 5B1BE 4HORA 4NIKA 4HOSA 4NQ0A 3U64A 5HKPA 1TNYA 4HOQA 2FO1E 2VGYA 4L2YA 2AVPA 2KXPC 2UWJG 3NOCD 1GW6A 5CEAA 1OWLA 5KNHD 3HDXA 3ASDA 4K5AB 3VTYA 4PS3A 1WDYA 4UQXA 1TNOA 4G1TA 1A5EA 4N2SA 2IJGX 1ZBPA 3R7QA 2WVIA 4GYWA 3LPZA 3CV0A 2I2OA 1TNUA 3UM3A 4LEUA 3D3MA 3EIJA 3PNTB 5G55A 4O1OA 4Q94A 4KBQA 4DX2A 2VSYA 3RIBA 1UJKA 3TG4A 4IULA 3T8KA 4ANXA 1JCQA 3FP3A 3Q75A 4J0UA 1LD7A 3FTXA 3KS2A 4CGWA 4YVOA 5E75A 2ZGGA 1PY1A 3L6AA 4K0RA 3ZW3A 2AJAA 3JXIA 1FVHA 4J8SA 3B95A 1LD8A 2L9BA 1OXJA 2CHWA 1HE8A 1O1TA 3PNLB 2WXNA 3ULEG 4F7AA 3TGOA 3PUKA 4JZYA 5AQAA 3G2VA 3QWWA 4ILHB 3UX4A 4CDRA 3I4GA 3ZYQA 4DI4A 3FUIA 1WAO1 1SZAA 4XX5A 4AEZC 5LCWJ 2WXIA 3FTUA 2UY1A 3HYMB 3LVRE 5CBNA 3HVEB 3OAWA 3OXGA 1OT8A 3Q15A 4DX1A 4APFA 2J8SD 2IOLA 2Y1LE 3IHYA 5FQ4A 2IU1A 5AN8A 3RK6A 4U04A 3K9IA 1TYQG 4EZKA 2L0TB 3LS8A 1QNFA 2IO3C 2HE0A 4OYSA 4GTRA 2BTDA 3PZ2A 3ZXSA 5AJDA 3TWVA 3BG0B 3MGBA 4C0EA 4A1GA 4GTMA 5AARA 3HIZA 3UT4A 3UM1A 3TWWA 3NQPA 2RKKA 4Y6WA 1YA0A 3EHQA 4OVUA 2V4HC 3AG3E 3E34A 5T8IA 1FT2A 3QWPA 2PL2A 4I1AA 2XENA 4J8EA 3MYVA 5JMND 3S7DA 4CDMA 1H2UA 1NA3A 5AYWD 5CCMA 3FH7A 1N9AA 3I5PA 1QQEA 2XZDG 4I9EA 3C3QA 4WWNA 2KATA 3HRAA 3UIPC 4ILIA 5CMYA 2FO7A 3E32A 1S64A 2X6KA 4Q96A 1SZ9A 4CRWA 3KD7A 4JPSA 2RG8A 3IXEA 1XNFA 4G11A 2YINA 3F6QA 5AQ7A 1E8ZA 4YDWA 3ZYLA 3W9GA 3MZLB 5FQ7A 2LAHA 3IBEA 3C5RA 4RQIA 4I43A 3QOUA 3E37A 5AENA 4DX5D 3CHRA 4J8DA 3WG7E 1D9SA 4ACLA 4EZLA 4JD2G 5EDSA 3B7SA 5FTPA 3IHVA 5EIDA 4KXKB 4RG6A 4UWLA 3UMVA 1K1AA 3EHRA 3ZGQA 1ELRA 4LNUD 4JHJA 3Q78A 2X3MA 2CHXA 4F1PA 3DSXA 4BTBA 2RD0A 4FADA 3FDHA 3MEKA 3LCAA 1B89A 4WNGA 3CKCA 1ELWA 2LXLA 3MX3A 4KYOB 1N4RA 1TEZA 2AXVA 3PEUB 4DLOA 2AWIA 1KLXA 3IEGA 5FZQA 4DK5A 3KEZA 2XZTG 1YMPA 1K8KG 4CT0A 2GGFA 3AS4A 3LJ3A 4LERA 5ENSD 3TWTA 2BKGA 3HXBA 2GRNB 1LTXA 4LCTA 1A17A 5CEDB 2B0OE 4DPRA 4ANVA 5AJLA 2DYRE 4L7TA 2P9LG 3DSTA 2A5EA 3FY4A 4IN3B 4LG6A 3U9WA 2C2LA 3Q4AB 5HQ8A 2IOSA 5AQ9A 1ZB1A 2QC9A 4AY6A 2BUGA 3CSTA 4F6RD 3B7RL 4U0ZA 1HH8A 3G2SA 2H6FA 3RSEG 2WXLA 4ILGA 4WNFA 2WQ7A 5ARFA 4FU3A 4FULA 2YHEA 1N95A 3V2XA 4K03A 4GZCA 5ENRD 2XS8A 4ATGA 4RVBA 2ONDA 2XQ0A 2VTBB 3SD5A 4HOUA 4AOFA 3CHOA 3EU5A 2LO6A 1MQSA 2VSXE 4JB8P 1ZU2A 1NP7A 2WXHA 1MZCA 3OTNA 4A3VA 2Q7FA 2WM9A 2GRQB 2XPZA 4KT6B 3LKUA 3UQ3A 4U0UA 2YNQA 3Q5MA 2I6HA 2JABA 3JXJA 4TRQA 2B6CA 4N39A 3UXGA 3APFA 5CRUA 3D9KA 4DRXE 1Y8MA 3TAXA 4JC8A 3RRMB 3EHMA 4GTSA 1INZA 4XEIG 2EILE 2I1KA 2QZAA 3FTSA 3QWVA 4FLHA 3SBTB 4YVQC 3MKQA 4DX6D 3BG1B 5KJMA 1IYGA 3CR3A 4WNEA 1IQUA 2J9QA 4UWGA 3AJIA 3LDZA 3TG5A 1BLXB 3FUDA 1U3CA 4K5BA 3Q47B 5DIZA 2KZTB 3LY8A 1WG0A 4F3VA 4BWRA 1RW2A 3HVEA 2OCCE 2FULA 4AV7A 3E4BA 3SHFA 1TJFA 2IFUA 3ONLA 2DVWA 4HLLA 4FJZA 2Y4TA 3KSQA 5KJKA 3PZ3A 4HNAD 2WXOA 2KCLA 4N2QA 4GTVA 4C48B 2OV8A 4O1PA 3TWXA 3CSFA 3KAEA 4K5CA 1D8EA 3EDTB 5C2YA 3DXMG 4Z68A 2A4ZA 4XKCA 4I9CA 3HXDA 4BESA 2QFCA 1EDUA 2QYJA 4BFRA 4JA9A 1OY3D 3IKOB 4E6HA 2I1JA 3SY2A 3PDNA 2P9NG 4UWHA 3HXCA 4GZ5A 3G2WA 2CFUA 4JEUA 4JVSA 3CVUA 5E76A 3JUEA 3Q79A 2V5FA 4AP2A 3Q73A 2L6BA 3LJNA 2WMOA 4I6JA 4HFGA 3EHNA 4BTAA 1Y6IA 4LSZE 1E90A 4ZHBA 2C0LA 3C3RA 4J6IA 3ML9A 4J7WA 2Y69E 3CGHA 3CK9A 4E85A 3ASGA 1N4PA 4HVBA 1D8DA 2GRMA 4U8HA 3QJZA 1N94A 1MHQA 4XE0A 2J4BA 1HF8A 3BQOA 2BF0X 3TWUA 3G2UA 5EX0A 3TJPA 3DEOA 4DUIA 2CHZA 2X38A 4HB5A 3CVPA 2L0IA 1H6PA 3VLEA 3ZNGA 4URKA 5G05J 2R59A 3KEAA 4ABNA 3B7UX 4B0ZA 2AXZA 4GCOA 2MOWA 2AW6A 3HXEA 2P9PG 2WXPA 1AP7A 1RZ4A 2ZISA 2WMNA 4UWKA 1DNPA 1SW6A 2DIWA 2XPYA 3PVLA 3S7BA 5CERB 1KZPA 4GMLA 2C0MA 4JHRA 2LSUA 3ABME 5BXOA 3DEPA 2OVBA 1OCZE 3C72A 1YCSB 1UJJA 2F37A 5JHAA 4PS8A 4ATZD 4EBAA 3URZA 3FULA 4EQFA 5BV0A 3APCA 3NF1A 3DSVA 1JCRA 4WWPA 1MX4A 3D9IA 3R9AB 3CQCB 5AQBA 5HS0A 3EUVA 5BW8C 3DRAA 5AIJA 4U7EB 1E8WA 3ZVVA 4LNBA 3FTWA 3QC1A 4TUMA 1HXIA 2E0IA 3B7BA 2GRRB 2R2LA 4B8CB 1JWFA 3PZDA 4U95D 4EHMA 3JQ1A 3RU0A 1H19A 3CLJA 4U96D 1MYOA 2Y4UA 1EYHA 3Q49B 2HR2A 3ZIMA 5BUZA 4PH4B 3KSLA 2FEZA 4GYYA 4AY5A 3FUJA 3UT7A 4BY6A 4WNDA 1S0PA 2I9CA 2L6JA 3NOGD 4XI9A 3GZ2A 3FUHA 2WXQA 3OXFA 4J8YA 2XCCA 3C98A 4HLEA 2E2EA 2LSVA 3JCKC 5BV1A 1U2VG 4I2WA 4GA1A 4IRUA 3X2QE 1UW4B 4G26A 5HRYA 1O1RA 3R9MA 2VGXB 1E7VA 3ZHEA 1BPOA 5ENOD 3FTVA 1Z3XA 2R5SA 4L1BA 1QYMA 4RLYA 3ESKA 2IEJA 2QY7A 2BEDA 4A3TA 5FINA 4L2LA 3G2TA 4EBAG 5ENQD 4MLPA 4JHKA 1N11A 4CCAA 5CRVA 2WXJA 2OEVA 5CECB 5G05C 5HI7A 4BT8A 2PQNA 2Y3AA 4CT4A 4KZ0A 3B13A 2FF4A 2FI7A 4HRNA 4C0MA 2LUHA 2KBXA 4CYMD 1FT1A 5FQ6A 2VGEA 3J5QB 4L9PA 3L08A 2OEWA 1N0QA 1DVPA 5EILA 2P9SG 2GRLA 1UN8A 2CG3A 2HM8A 4ZFHA 2YQ8A 2MRIA 3ZU7B 3O4ZA 3ZYKA 4OAVB 5EX3A 3ABLE 4WUYA 4GA0A 2PNNA 1Z3YA 2R02A 4AM9A 3UT8A 3CK8A 4EECA 3UTMA 3QB2A 1TN8A 5ENNA 3LYAA 2H6HA 1KT0A 4I1MA 4TXQA 3GYZA 1EF1C 1JWGA 4QFVA 3SI5A 4U8YD 1TJCA 1W3BA 2XCBA 1QBQA 3ULYA 2EIJE 2DYSE 2HO1A 2DBAA 4Q69A 1NZNA 4H7XA 5LFAA 4HI9A 2MHKA 4XI0A 2F0YA 3NB2A 1N0RA 3N71A 5KCMA 1UN9A 1H2TC 3D9JA 3DSWA 5LX8A 1G3NB 4L23A 3V30A 4AXHA 3L9TA 4CGVA 1S63A 2IQCA 4HBDA 4O6FA 1E8YA 4FJYA 3UM0A 4BSZB 4PDXA 2WXGA 5JJ6A 3UKUG 4LNGA 5CCLA 1HFAA 1H0AA 4HQDA 3V79K 5D0QD 2V4LA 2J08A 1LF8A 3EJNA 3RRNB 4DJAA 4BERA 4J8FA 2QYUA 1IHGA 3R7RA 3EU9A 4JL0A 3ZN3A 4UI9K 5FZSA 1OWOA 3ZEFA 1QZ2A 2P2CP 3C3OA 2J07A 5ENPD 2WQ6A 3RRUA 3ENEA 3LY9A 3MA5A 4W9RA 3SQVA 3ISMC 4I6EA 2J09A 1X5BA 2J49A 3Q7AA 5J08A 4DI3A 2ZGDA 1S70B 2LAIA 1Z6TA 3UI2A 1E96B 3FTYA 3CHSA 3VTXA 2WPVA 3TXNA 2LXMA 5D66A 4JW1A 5EKQD 4C9BB 4NRHB 1O5MA 3BEEA 3E33A 4GA2A 3T8MA 3ASOE 2IONA 5BPPA 3RAUA 4JA7A 1UG3A 5B1AE 4ACKA 2EIKE 3ABKE 4TXRA 4I1OB 4N5QA 4KMOA 2NSZA 2EQXA 2Y0BG 4GMJA 3IV0A 4MRUA 4JEHA 1O1SA 3FTZA 3SO8A 4H7YA 5FZRA 1HX8A 3W9FA 5ANRA 1WM5A 4GZ3A 3SNXA 3L17A 2WXFA 2IY0C 1HG2A 4B94A 3NBNB 2HYZA 4CDNA 3CVWA 4MS6A 3PE3A 2KM4A 3AAAC 5IY5E 1P5QA 3AU5A 3FH5A 1TN6A 3CIAA 5JJTA 2R03A 3MCXA 4O60A 2M63A 3DPDA 2V8SE 3FUNA 4UUCA 2WB2A 3JYSA 3E30A 1X81A 3RKVA 1N52A 4TUUA 3SFXA 5JHBA 3DWLG 3UUXA 4B93B 1OCOE 2EIME 3UM2A 1N4SA 5EYLA 5KBAA 3ASNE 4UI9J 3FUFA 5C1DA 2WXKA 4MBGA 2PM6A 3PEVB 1HZ4A 4GB9A 2P9IG 1OWPA 2OVFA 5JA4D 2WXRA 4BT9A 2LNIA 1DCQA 4UWFA 2VGXA 4BX9A 3HHMA 2VSNA 4WWOA 3AG1E 3Q7FA 2JEKA 5ENTD 3L22A 4EZJA 4CZ2D 4GZ6A 4HXIA 3SGHA 5M72A 2CG2A 4F53A 3NAWA
chains in the Genus database with same CATH topology
2XCCA 3C98A 3ONKA 4APOA 4HLEA 4LCTA 1A17A 2E2EA 2LSVA 3JCKC 5BV1A 2PZIA 4I2WA 4GPKA 4GA1A 4DPRA 5FWQA 5T4YA 5AJLA 4ANVA 1JUQA 2VYIA 3CQGB 4IRUA 4L7TA 4BSXA 4P29A 1UW4B 4G26A 3FY4A 4IN3B 3QNKA 2X6HA 1OWMA 1NA0A 3U9WA 2C2LA 2X6FA 3P1UA 2VGXB 1OWNA 1E7VA 3Q4AB 3ZHEA 3TL5A 1BPOA 3L13A 4U63A 3I4RB 3FTVA 1Z3XA 3FWVA 3RJVA 3FU5A 5HQ8A 1E7UA 1HS6A 2IOSA 2R5SA 3GZSA 4FLBA 4L1BA 1L5JA 4N3AA 4A1SA 2X6JA 3FFLA 3PH0C 4AY6A 2BUGA 3CSTA 3WXXA 1EPUA 5BT1A 3CVQA 3B7RL 3ESKA 3QDNA 4R7LA 3QKYA 2QY7A 4U0ZA 4A3TA 3MKQB 5G2NA 3O48A 1HH8A 2FBNA 3G2SA 4L2LA 2WXMA 3TXMA 3ZYMA 3EIQC 4FHJA 4U07A 2WXLA 3G2TA 3PE4A 4ILGA 4EBAG 1H6KA 4MLPA 4WNFA 4JHKA 3T5VA 2WQ7A 5ARFA 3FEYA 2VJ8A 4FU3A 4FULA 2YHEA 4B8AA 3LVQE 4Y6CA 4FA6A 4K03A 4CCAA 3D9NA 4GZCA 4ANWA 4BX8A 4N5CA 2WXJA 3CVYA 3L54A 3T5XA 5G05C 4ATGA 4RVBA 5HI7A 2ONDA 4BT8A 3PS6A 3CVLA 2PQNA 3FU6A 2Y3AA 4CT4A 1E8XA 5ARGA 2XQ0A 2VTBB 3SD5A 4GAAA 4KZ0A 3B13A 4HOUA 4AOFA 2FF4A 3CHOA 3GW4A 2FI7A 4I17A 3D9PA 2LO6A 2V0PA 1MQSA 4RSYA 5JJ7A 5KJNA 4C0MA 2VSXE 3FUEA 3I3NA 4JXTA 1ZU2A 3S7JA 2XPIA 5FQ6A 4ANUA 4M3OA 3ML8A 1NP7A 2WXHA 5J90A 4FP7A 1ELKA 3ULQA 3L08A 3U3WA 3QARA 2PQRA 3OTNA 4A3VA 1DVPA 2Q7FA 4XKBA 2P58C 2WM9A 2GRLA 1UN8A 2CG3A 2HM8A 2X6IA 2YQ8A 5DBKA 2GW1A 4HORA 2MRIA 2XPZA 4NURA 3O4ZA 4HOSA 4NQ0A 3ZYKA 4KT6B 3LKUA 3UQ3A 5BNWA 4U0UA 1HO8A 2YNQA 4XIFA 3Q5MA 2I6HA 3U64A 5LP0A 4HOQA 5EX3A 4WUYA 4TRQA 2VGYA 2KCKA 4L2YA 4OVVA 2AVPA 3CVVA 4GA0A 5FJYA 1Z3YA 4N39A 4AM9A 3APFA 3LXUX 2UWJG 4TV3A 4A55A 1GW6A 3D9KA 3UT8A 1Y8MA 3TAXA 1OWLA 2DCPA 3CK8A 4UI9C 5T3RA 3HDXA 4JC8A 4NACA 4EECA 3RRMB 3QB2A 3ASDA 2A5UA 3EHMA 3MKRA 4I2ZA 4I6GA 3VTYA 1INZA 4PS3A 3CKBA 3PREA 5ENNA 3LYAA 4UQXA 2I1KA 4G1TA 1KT0A 4I1MA 4N2SA 3L16A 3FTSA 2CFZA 3GYZA 3QWVA 2IJGX 5ANLA 1EF1C 1ZBPA 4FLHA 4F1SA 1JWGA 4QFVA 3R7QA 3SBTB 2WVIA 3SI5A 4GYWA 5A7DB 4YVQC 1TJCA 3LPZA 3CV0A 2I2OA 1W3BA 4LEUA 3LEWA 3MV3B 3MKQA 4DLQA 3D3MA 3BG1B 5KJMA 2XCBA 3EIJA 3PNTB 1IYGA 5G55A 3CR3A 4Q94A 2HO1A 4KBQA 4WNEA 1IQUA 2J9QA 2XGMA 2VSYA 2DBAA 4UWGA 3RIBA 3LDZA 3FHEA 1UJKA 4Q69A 3TG4A 1NZNA 4H7XA 4IULA 4ANXA 5LFAA 3TG5A 3GZ1A 3FUDA 1U3CA 3FP3A 3Q47B 4J0UA 3SBSA 3FUMA 5DIZA 2KZTB 3UPVA 3FTXA 2MHKA 3KS2A 3D9LA 3LY8A 2VTBA 3FH8A 4CGWA 4XI0A 4YVOA 4AVXA 5E75A 1HG5A 4F3VA 3DBSA 4KVMA 3N71A 5KCMA 1PY1A 3L6AA 4K0RA 4BWRA 3ZW3A 1FVHA 4J8SA 1UN9A 1H2TC 3D9JA 3HVEA 2FULA 4AV7A 5LX8A 3E4BA 4YNDA 3SHFA 3ZPJA 3S2AA 4FC8A 4L23A 2L9BA 1TJFA 4AXHA 2CHWA 4G25A 4CGVA 2IFUA 1HE8A 3ONLA 2IQCA 3FEXA 4FJZA 4O6FA 2Y4TA 3PNLB 2KCVA 1E8YA 2WXNA 4F7AA 3TGOA 3PUKA 4JZYA 3AS8A 4FJYA 3CHPA 5KJKA 4UQZA 1FCHA 2NC9A 4PDXA 3G2VA 3QWWA 4ILHB 3UX4A 4CDRA 3I4GA 2WXGA 2WXOA 3ASHA 4GZDA 5JJ6A 3S7FA 3ZYQA 4DI4A 2KCLA 3U4TA 5CCLA 1HFAA 1H0AA 3FUIA 4N2QA 1WAO1 1SZAA 4XZ4A 4LRZA 4B89A 4XX5A 4AEZC 5LCWJ 2WXIA 3FTUA 2UY1A 3HYMB 2OV8A 3LVRE 5D0QD 2V4LA 1WY6A 3HVEB 4G24A 2J08A 3CSFA 3KAEA 3OAWA 1LF8A 3EJNA 3OXGA 3RRNB 3JQ0A 4DJAA 3EDTB 3Q15A 4APFA 2IOLA 5C2YA 3IHYA 4J8FA 2A4ZA 1IHGA 3NZSA 4IYPA 3R7RA 5FQ4A 5LCWC 4JL0A 3ZN3A 2IU1A 4XKCA 4I9CA 4UI9K 5FZSA 1OWOA 3RK6A 4U04A 5FT9A 3K9IA 4FHKA 2QFCA 1EDUA 2NXPA 4BFRA 4JA9A 3VLDA 4EZKA 2L0TB 3ZEFA 1QZ2A 3IKOB 4E6HA 3LS8A 2I1JA 2J07A 1QNFA 3PDNA 2UY1B 4OYSA 3PRZA 4UWHA 5CHEE 4GZ5A 3CVXA 2BTDA 3D9OA 3G2WA 2WQ6A 3RRUA 3ZXSA 3ENEA 3LY9A 5AJDA 2CFUA 3FU3A 3BG0B 3MA5A 4W9RA 4AIFA 4I6EA 4JEUA 2J09A 1X5BA 2J49A 3MGBA 4JVSA 4C0EA 4A1GA 5A23A 5J08A 4DI3A 3CVUA 3NZUA 3LY7A 5E76A 3HIZA 3UT4A 2XRZA 2LAIA 4N3BA 1Z6TA 4RG9A 2XHEA 1E96B 3NQPA 2V5FA 4AP2A 4EPZA 2KZTA 5CMWA 3FTYA 3ZFWA 4Y6WA 1OUVA 3CHSA 1YA0A 3VTXA 2WPVA 3TXNA 2WMOA 4I6JA 4HFGA 4JW1A 4OVUA 3PUJA 3EHNA 1PAQA 5EKQD 4BTAA 4C9BB 1Y6IA 4NRHB 5T8IA 3CK7A 5G04J 3BEEA 4GCNA 4GA2A 1E90A 2C0LA 3QWPA 2PL2A 2IONA 4I1AA 3T8MA 5BPPA 4J6IA 4JA7A 3CEQA 2KC7A 2OOEA 4J8EA 5D0OD 1UG3A 3ML9A 4ACKA 3MYVA 3CGHA 4AJWA 3S7DA 3VLFA 2JLBA 4CDMA 1H2UA 2R17C 1NA3A 3CK9A 4E85A 3ASGA 2XGSA 4I1OB 5AYWD 1KT1A 5CCMA 4KMOA 3QK0A 4HVBA 3FH7A 2NSZA 1JPLA 2GRMA 4KVOA 3QJZA 4U8HA 2EQXA 4WAFA 1MHQA 4XE0A 2J4BA 3QAQA 3U66A 4GMJA 1HF8A 3IV0A 4ME2A 2PM7A 1PC2A 3I5PA 4MRUA 2BF0X 5KJLA 1XGWA 1QQEA 4JEHA 3FTZA 3ZRHA 4I9EA 4WWNA 5LOZA 4H7YA 2KATA 3SFZA 3G2UA 4PUCA 1H2VC 4ILIA 5CMYA 4N3CA 1HX8A 5EX0A 5FZRA 4U0SA 3TJPA 2FO7A 2X6KA 2CHZA 5ANRA 4CEMA 1WM5A 4GZ3A 2X38A 3SNXA 3L17A 4Q96A 4LUNU 2WXFA 5FQ8A 1SZ9A 4CRWA 3KD7A 3MJWA 4JPSA 3CVPA 2L0IA 2RG8A 3VLEA 1XNFA 1HG2A 4G11A 4URKA 4B94A 5G05J 2R59A 4ABNA 2HYZA 2WQHA 2YINA 4CDNA 5A6CA 3B7UX 1IQRA 1E8ZA 4B0ZA 3CVWA 4MS6A 2AXZA 3PE3A 4GCOA 3D9MA 3ZYLA 2KM4A 2YHCA 3MV2B 2MOWA 2AW6A 1P5QA 3SZ7A 3AU5A 3MZLB 2WXPA 5FQ7A 2LAHA 2WMNA 4UWKA 1DNPA 2VSOE 4HOTA 2DIWA 2XPYA 3IBEA 3PVLA 3RO2A 3FH5A 3CIAA 3S7BA 3SF4A 2XGOA 4GYOA 3ESLA 3QOUA 4I43A 3ZHEB 4GMLA 2C0MA 5JJTA 3MCXA 4JHRA 5AENA 3AS5A 2M63A 3DPDA 2V8SE 3FUNA 3CHRA 3FUKA 4J8DA 2LSUA 2WB2A 1SQMA 4ACLA 4EZLA 2OVBA 4KZCA 3JYSA 1UJJA 5JHAA 4PS8A 5EDSA 3RKVA 1N52A 4HS2A 3JUIA 3URZA 4EBAA 3B7SA 3FULA 5FTPA 4EQFA 3IHVA 5BV0A 4TUUA 3APCA 3NF1A 4KXKB 4RG6A 4UWLA 4G23A 3UMVA 5JHBA 4WWPA 4V3IA 3D9IA 3ZGQA 1ELRA 3CQCB 3R9AB 3UUXA 1U3DA 5BW8C 4JHJA 3OXLA 5AIJA 2X3MA 3APDA 1FVFA 3CHQA 2CHXA 2J4DA 1E8WA 3ZVVA 4UI9J 4BTBA 3FUFA 2RD0A 5C1DA 2WXKA 3FTWA 4FADA 3QC1A 3FDHA 2ILRA 2PM6A 3MEKA 3LCAA 1B89A 1HXIA 2E0IA 3PEVB 4WNGA 3CKCA 1ELWA 1HZ4A 1HU3A 4GB9A 3FU0A 4D10C 1VDYA 1OWPA 4PS7A 4B8CB 2OVFA 1JWFA 3MX3A 3PZDA 4KYOB 4G2VA 1TEZA 3JQ1A 3RU0A 1H19A 2WXRA 3CLJA 4BT9A 2AXVA 3CHMA 3PEUB 4DLOA 2AXUA 2AWIA 1KLXA 2Y4UA 1EYHA 2XEVA 3IEGA 2LNIA 2VQ2A 3Q49B 4UWFA 2HR2A 5FZQA 4DK5A 2VGXA 3ZIMA 2IF4A 4BX9A 5BUZA 4PH4B 2ZU6B 3HHMA 2FEZA 4GYYA 3KEZA 3P2BA 3RO3A 4AY5A 3FUJA 4GU5A 3UT7A 2VSNA 4WWOA 4MKTA 2JEKA 3AU4A 3ASFA 4BY6A 2XRYA 4CT0A 1N54A 3L22A 2GGFA 3AS4A 3LJ3A 4LERA 4UQYA 5G04C 4EZJA 4GZ6A 4HXIA 3SGHA 5M72A 4WNDA 2CG2A 1S0PA 2I9CA 2L6JA 4XI9A 3B7TA 3FUHA 2WXQA 3GZ2A 3CVNA 3OXFA 4F53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XCC A;  4APO A;  1A17 A;  2E2E A;  2LSV A;  2PZI A;  4I2W A;  4GPK A;  4GA1 A;  2VYI A;  4G26 A;  4IN3 B;  1NA0 A;  2C2L A;  2VGX B;  3Q4A B;  3ZHE A;  3RJV A;  3FWV A;  5HQ8 A;  4N3A A;  2R5S A;  4A1S A;  3FFL A;  4AY6 A;  2BUG A;  3WXX A;  5BT1 A;  3CVQ A;  3ESK A;  3QDN A;  3QKY A;  4U0Z A;  3O48 A;  1HH8 A;  2FBN A;  4U07 A;  3PE4 A;  4WNF A;  5ARF A;  4Y6C A;  4N5C A;  5G05 C;  5HI7 A;  2OND A;  4BT8 A;  3CVL A;  2PQN A;  5ARG A;  4HOU A;  2FF4 A;  3GW4 A;  2FI7 A;  4I17 A;  5JJ7 A;  5KJN A;  1ZU2 A;  3S7J A;  2XPI A;  3ULQ A;  3U3W A;  2PQR A;  2Q7F A;  2P58 C;  2YQ8 A;  5DBK A;  2GW1 A;  4HOR A;  4HOS A;  4NQ0 A;  3LKU A;  3UQ3 A;  5BNW A;  4U0U A;  4XIF A;  3Q5M A;  2I6H A;  4HOQ A;  5EX3 A;  4WUY A;  2VGY A;  2KCK A;  2AVP A;  4GA0 A;  5FJY A;  4N39 A;  4AM9 A;  2UWJ G;  1Y8M A;  3TAX A;  4UI9 C;  3CK8 A;  3ASD A;  3MKR A;  4I2Z A;  3VTY A;  3CKB A;  3LYA A;  4UQX A;  4G1T A;  1KT0 A;  4N2S A;  3GYZ A;  3QWV A;  1ZBP A;  4GYW A;  5A7D B;  4YVQ C;  1TJC A;  3LPZ A;  3CV0 A;  1W3B A;  4LEU A;  3MV3 B;  5KJM A;  2XCB A;  1IYG A;  2HO1 A;  4KBQ A;  4WNE A;  2J9Q A;  2XGM A;  2VSY A;  2DBA A;  3RIB A;  3TG4 A;  1NZN A;  4H7X A;  3TG5 A;  3GZ1 A;  3FP3 A;  3Q47 B;  4J0U A;  5DIZ A;  3UPV A;  3KS2 A;  2MHK A;  3LY8 A;  4CGW A;  4XI0 A;  4YVO A;  4F3V A;  3N71 A;  4BWR A;  3E4B A;  4YND A;  3ZPJ A;  4G25 A;  4CGV A;  2IFU A;  4O6F A;  2Y4T A;  2KCV A;  3TGO A;  3AS8 A;  5KJK A;  4UQZ A;  1FCH A;  2NC9 A;  3QWW A;  4CDR A;  3ASH A;  5JJ6 A;  3S7F A;  2KCL A;  3U4T A;  5CCL A;  4N2Q A;  1WAO 1;  5LCW J;  2UY1 A;  3HYM B;  5D0Q D;  4G24 A;  3KAE A;  3OXG A;  3EDT B;  3Q15 A;  4J8F A;  1IHG A;  5LCW C;  4JL0 A;  3ZN3 A;  4I9C A;  4UI9 K;  5FZS A;  4U04 A;  5FT9 A;  3K9I A;  2QFC A;  4JA9 A;  1QZ2 A;  3PDN A;  2UY1 B;  5CHE E;  4GZ5 A;  3LY9 A;  3MA5 A;  4W9R A;  4AIF A;  3LY7 A;  4N3B A;  4RG9 A;  1E96 B;  2V5F A;  3ZFW A;  4Y6W A;  1OUV A;  1YA0 A;  3VTX A;  2WPV A;  5EKQ D;  4BTA A;  4NRH B;  3CK7 A;  5G04 J;  3BEE A;  4GCN A;  4GA2 A;  2C0L A;  3QWP A;  2PL2 A;  4I1A A;  4JA7 A;  3CEQ A;  2KC7 A;  2OOE A;  4J8E A;  5D0O D;  3S7D A;  2JLB A;  1NA3 A;  3CK9 A;  3ASG A;  2XGS A;  5AYW D;  1KT1 A;  5CCM A;  4ME2 A;  1PC2 A;  5KJL A;  1QQE A;  4I9E A;  4H7Y A;  2KAT A;  5EX0 A;  5FZR A;  4N3C A;  4U0S A;  2FO7 A;  1WM5 A;  4GZ3 A;  3KD7 A;  3CVP A;  1XNF A;  4B94 A;  5G05 J;  4ABN A;  2HYZ A;  2WQH A;  5A6C A;  3PE3 A;  4GCO A;  2YHC A;  3MV2 B;  1P5Q A;  3SZ7 A;  4HOT A;  3RO2 A;  3S7B A;  3SF4 A;  2XGO A;  4GYO A;  3ZHE B;  3QOU A;  2C0M A;  5JJT A;  4JHR A;  3AS5 A;  4J8D A;  2LSU A;  3JYS A;  3RKV A;  3URZ A;  4EQF A;  5FTP A;  3NF1 A;  4KXK B;  4RG6 A;  4G23 A;  3ZGQ A;  1ELR A;  3R9A B;  3UUX A;  5BW8 C;  3OXL A;  4UI9 J;  4BTB A;  5C1D A;  3MEK A;  3LCA A;  1HXI A;  1B89 A;  4WNG A;  3CKC A;  1HZ4 A;  1ELW A;  4KYO B;  4G2V A;  3RU0 A;  4BT9 A;  1KLX A;  2Y4U A;  3IEG A;  2XEV A;  2LNI A;  2VQ2 A;  3Q49 B;  2HR2 A;  5FZQ A;  2VGX A;  2IF4 A;  4GYY A;  2FEZ A;  4AY5 A;  3RO3 A;  2VSN A;  3ASF A;  3AS4 A;  4UQY A;  5G04 C;  4GZ6 A;  5M72 A;  4WND A;  2L6J A;  4XI9 A;  3GZ2 A;  3CVN A;  3OXF A; 
#chains in the Genus database with same CATH topology
 4APO A;  5KWD A;  2PZI A;  4GPK A;  2VYI A;  3CQG B;  3V31 A;  4BSX A;  4P29 A;  1OWM A;  2X6F A;  1DC2 A;  3P1U A;  3TL5 A;  3L13 A;  4U63 A;  3RJV A;  3FWV A;  3FU5 A;  1HS6 A;  4FLB A;  1L5J A;  2X6J A;  3PH0 C;  1EPU A;  2R05 A;  5BT1 A;  2BKK B;  3QDN A;  4R7L A;  3MKQ B;  5G2N A;  3O48 A;  2FBN A;  3TXM A;  3ZYM A;  3EIQ C;  4FHJ A;  3PE4 A;  3UIO C;  2DZO A;  1H6O A;  2VJ8 A;  4B8A A;  1OCR E;  3Q9U C;  4Y6C A;  4FA6 A;  3D9N A;  4BX8 A;  4N5C A;  4YDO A;  3CVY A;  3L54 A;  3T5X A;  1NL4 A;  3FU6 A;  4G8L A;  3BUA A;  1TNB A;  3GW4 A;  3DSS A;  4I17 A;  3SFY A;  5JJ7 A;  5KJN A;  4JXT A;  3I3N A;  1UOH A;  1N4Q A;  2XPI A;  5B3S E;  5CBO A;  4FP7 A;  1ELK A;  3ULQ A;  2IO2 C;  3U3W A;  3QAR A;  2XS1 A;  2PQR A;  4XKB A;  2P58 C;  3T9K A;  2X6I A;  5AAO A;  4NUR A;  5BNW A;  1HO8 A;  4XIF A;  5LP0 A;  4TXP A;  2KCK A;  4OVV A;  3CVV A;  5FJY A;  5H7P A;  3LXU X;  4TV3 A;  4A55 A;  1AWC B;  4UI9 C;  2DCP A;  5T3R A;  1FPP A;  3ZKJ A;  4NAC A;  2A5U A;  5EN5 D;  1TN7 A;  3MKR A;  4I2Z A;  4I6G A;  3CKB A;  3PRE A;  5EYP F;  3L16 A;  2CFZ A;  5ANL A;  4F1S A;  5A7D B;  3LEW A;  3MV3 B;  1BI8 B;  4DLQ A;  3UKR G;  1MJ0 A;  2XGM A;  3FHE A;  1K3Z D;  3GZ1 A;  2DZN A;  3SBS A;  3FUM A;  3UPV A;  3D9L A;  2VTB A;  3FH8 A;  3BU8 A;  4GTO A;  4AVX A;  1HG5 A;  3DBS A;  4KVM A;  3AG2 E;  4GPM A;  4YND A;  3ZPJ A;  2RFA A;  3S2A A;  1NI1 A;  4FC8 A;  2ZXW E;  4G25 A;  2DWZ A;  1MX6 A;  3FEX A;  2KCV A;  3AS8 A;  3CHP A;  4UQZ A;  1FCH A;  2NC9 A;  3ASH A;  4GZD A;  3S7F A;  4U8V D;  1V54 E;  3U4T A;  4XZ4 A;  1SA5 A;  4LRZ A;  4B89 A;  3DSU A;  2ETB A;  4YDY A;  4HRL A;  1K1B A;  1WY6 A;  4G24 A;  5D2M C;  3JQ0 A;  3NZS A;  4IYP A;  4GTT A;  5LCW C;  2ZIR A;  1Z5S C;  5FT9 A;  4GTP A;  4FHK A;  2NXP A;  3VLD A;  3HG0 D;  2UY1 B;  3PRZ A;  5CHE E;  2H6I A;  3CVX A;  3D9O A;  4DX7 D;  4AIF A;  3FU3 A;  3AG4 E;  2GRP B;  5A23 A;  4X8Q A;  3NZU A;  3LY7 A;  2XRZ A;  4N3B A;  4RG9 A;  1JCS A;  2XHE A;  4EPZ A;  2KZT A;  3ZUV B;  1V55 E;  5CMW A;  3ZFW A;  1OUV A;  3PUJ A;  1PAQ A;  3CK7 A;  4QQI A;  5G04 J;  4GCN A;  3CEQ A;  4A63 B;  2KC7 A;  2OOE A;  2F8X K;  5D0O D;  4AJW A;  3VLF A;  3D9H A;  2JLB A;  3PZ1 A;  2R17 C;  2XGS A;  4GTQ A;  1KT1 A;  1MX2 A;  3QK0 A;  1IXV A;  2XEH A;  1JPL A;  2RFM A;  4KVO A;  4WAF A;  1NFI E;  3QAQ A;  3U66 A;  4HI8 A;  4ME2 A;  2PM7 A;  3PZ4 A;  1PC2 A;  5BXU A;  5KJL A;  1TNZ A;  1XGW A;  2V5Q C;  3ZRH A;  1OCC E;  5LOZ A;  3SFZ A;  4PUC A;  1H2V C;  4N3C A;  4U0S A;  4CEM A;  4LUN U;  5FQ8 A;  3MJW A;  2WQH A;  5A6C A;  1IQR A;  1TR4 A;  3D9M A;  2YHC A;  3MV2 B;  3ZXP A;  3SZ7 A;  1KPS B;  4GMR A;  4OAU C;  2VSO E;  4HOT A;  2XEE A;  3RO2 A;  3SF4 A;  2ETA A;  2XGO A;  1YYH A;  4GYO A;  3ESL A;  3ZHE B;  3UIN C;  4M7C A;  4BET A;  3AS5 A;  3FUK A;  2P9K G;  1SQM A;  1DCE A;  4KZC A;  5ITZ F;  3TWS A;  4HS2 A;  3JUI A;  4G23 A;  4V3I A;  1U3D A;  3OXL A;  3APD A;  1FVF A;  3CHQ A;  2J4D A;  4G8K A;  1BU9 A;  2ILR A;  2MYO A;  3L82 A;  1HU3 A;  3FU0 A;  4D10 C;  1VDY A;  4PS7 A;  1IKN D;  4G2V A;  3CHM A;  2AXU A;  2XEV A;  2VQ2 A;  5FIO A;  2IF4 A;  2ZU6 B;  3RO3 A;  3P2B A;  4GU5 A;  4HRM B;  4MKT A;  3AU4 A;  3ASF A;  2XRY A;  1N54 A;  1Q2Z A;  4UQY A;  5G04 C;  2H6G A;  2P9U G;  3B7T A;  3CVN A;  1BD8 A;  2ETC A;  3ONK A;  3V2O A;  5FWQ A;  5T4Y A;  1JUQ A;  3QNK A;  2X6H A;  1NA0 A;  4YDE A;  3Q9N C;  1OWN A;  3I4R B;  1SA4 A;  1E7U A;  4N3A A;  3GZS A;  4A1S A;  3FFL A;  3WXX A;  3CVQ A;  2EIN E;  3QKY A;  2WXM A;  4U07 A;  1H6K A;  3T5V A;  3FEY A;  3LVQ E;  1SVX A;  4ANW A;  3TWR A;  2GRO B;  3PS6 A;  3CVL A;  1E8X A;  5ARG A;  3TWQ A;  4GAA A;  1KZO A;  2F8Y A;  1BI7 B;  3DXK G;  3D9P A;  2V0P A;  4RSY A;  2NYJ A;  3FUE A;  3S7J A;  4ANU A;  4M3O A;  3ML8 A;  5J90 A;  3DPY A;  4BEP A;  3HXF A;  5EIB E;  5KNG A;  1IHB A;  5DBK A;  2GW1 A;  3J5P A;  5B1B E;  4HOR A;  4NIK A;  4HOS A;  4NQ0 A;  3U64 A;  5HKP A;  1TNY A;  4HOQ A;  2FO1 E;  2VGY A;  4L2Y A;  2AVP A;  2KXP C;  2UWJ G;  3NOC D;  1GW6 A;  5CEA A;  1OWL A;  5KNH D;  3HDX A;  3ASD A;  4K5A B;  3VTY A;  4PS3 A;  1WDY A;  4UQX A;  1TNO A;  4G1T A;  1A5E A;  4N2S A;  2IJG X;  1ZBP A;  3R7Q A;  2WVI A;  4GYW A;  3LPZ A;  3CV0 A;  2I2O A;  1TNU A;  3UM3 A;  4LEU A;  3D3M A;  3EIJ A;  3PNT B;  5G55 A;  4O1O A;  4Q94 A;  4KBQ A;  4DX2 A;  2VSY A;  3RIB A;  1UJK A;  3TG4 A;  4IUL A;  3T8K A;  4ANX A;  1JCQ A;  3FP3 A;  3Q75 A;  4J0U A;  1LD7 A;  3FTX A;  3KS2 A;  4CGW A;  4YVO A;  5E75 A;  2ZGG A;  1PY1 A;  3L6A A;  4K0R A;  3ZW3 A;  2AJA A;  3JXI A;  1FVH A;  4J8S A;  3B95 A;  1LD8 A;  2L9B A;  1OXJ A;  2CHW A;  1HE8 A;  1O1T A;  3PNL B;  2WXN A;  3ULE G;  4F7A A;  3TGO A;  3PUK A;  4JZY A;  5AQA A;  3G2V A;  3QWW A;  4ILH B;  3UX4 A;  4CDR A;  3I4G A;  3ZYQ A;  4DI4 A;  3FUI A;  1WAO 1;  1SZA A;  4XX5 A;  4AEZ C;  5LCW J;  2WXI A;  3FTU A;  2UY1 A;  3HYM B;  3LVR E;  5CBN A;  3HVE B;  3OAW A;  3OXG A;  1OT8 A;  3Q15 A;  4DX1 A;  4APF A;  2J8S D;  2IOL A;  2Y1L E;  3IHY A;  5FQ4 A;  2IU1 A;  5AN8 A;  3RK6 A;  4U04 A;  3K9I A;  1TYQ G;  4EZK A;  2L0T B;  3LS8 A;  1QNF A;  2IO3 C;  2HE0 A;  4OYS A;  4GTR A;  2BTD A;  3PZ2 A;  3ZXS A;  5AJD A;  3TWV A;  3BG0 B;  3MGB A;  4C0E A;  4A1G A;  4GTM A;  5AAR A;  3HIZ A;  3UT4 A;  3UM1 A;  3TWW A;  3NQP A;  2RKK A;  4Y6W A;  1YA0 A;  3EHQ A;  4OVU A;  2V4H C;  3AG3 E;  3E34 A;  5T8I A;  1FT2 A;  3QWP A;  2PL2 A;  4I1A A;  2XEN A;  4J8E A;  3MYV A;  5JMN D;  3S7D A;  4CDM A;  1H2U A;  1NA3 A;  5AYW D;  5CCM A;  3FH7 A;  1N9A A;  3I5P A;  1QQE A;  2XZD G;  4I9E A;  3C3Q A;  4WWN A;  2KAT A;  3HRA A;  3UIP C;  4ILI A;  5CMY A;  2FO7 A;  3E32 A;  1S64 A;  2X6K A;  4Q96 A;  1SZ9 A;  4CRW A;  3KD7 A;  4JPS A;  2RG8 A;  3IXE A;  1XNF A;  4G11 A;  2YIN A;  3F6Q A;  5AQ7 A;  1E8Z A;  4YDW A;  3ZYL A;  3W9G A;  3MZL B;  5FQ7 A;  2LAH A;  3IBE A;  3C5R A;  4RQI A;  4I43 A;  3QOU A;  3E37 A;  5AEN A;  4DX5 D;  3CHR A;  4J8D A;  3WG7 E;  1D9S A;  4ACL A;  4EZL A;  4JD2 G;  5EDS A;  3B7S A;  5FTP A;  3IHV A;  5EID A;  4KXK B;  4RG6 A;  4UWL A;  3UMV A;  1K1A A;  3EHR A;  3ZGQ A;  1ELR A;  4LNU D;  4JHJ A;  3Q78 A;  2X3M A;  2CHX A;  4F1P A;  3DSX A;  4BTB A;  2RD0 A;  4FAD A;  3FDH A;  3MEK A;  3LCA A;  1B89 A;  4WNG A;  3CKC A;  1ELW A;  2LXL A;  3MX3 A;  4KYO B;  1N4R A;  1TEZ A;  2AXV A;  3PEU B;  4DLO A;  2AWI A;  1KLX A;  3IEG A;  5FZQ A;  4DK5 A;  3KEZ A;  2XZT G;  1YMP A;  1K8K G;  4CT0 A;  2GGF A;  3AS4 A;  3LJ3 A;  4LER A;  5ENS D;  3TWT A;  2BKG A;  3HXB A;  2GRN B;  1LTX A;  4LCT A;  1A17 A;  5CED B;  2B0O E;  4DPR A;  4ANV A;  5AJL A;  2DYR E;  4L7T A;  2P9L G;  3DST A;  2A5E A;  3FY4 A;  4IN3 B;  4LG6 A;  3U9W A;  2C2L A;  3Q4A B;  5HQ8 A;  2IOS A;  5AQ9 A;  1ZB1 A;  2QC9 A;  4AY6 A;  2BUG A;  3CST A;  4F6R D;  3B7R L;  4U0Z A;  1HH8 A;  3G2S A;  2H6F A;  3RSE G;  2WXL A;  4ILG A;  4WNF A;  2WQ7 A;  5ARF A;  4FU3 A;  4FUL A;  2YHE A;  1N95 A;  3V2X A;  4K03 A;  4GZC A;  5ENR D;  2XS8 A;  4ATG A;  4RVB A;  2OND A;  2XQ0 A;  2VTB B;  3SD5 A;  4HOU A;  4AOF A;  3CHO A;  3EU5 A;  2LO6 A;  1MQS A;  2VSX E;  4JB8 P;  1ZU2 A;  1NP7 A;  2WXH A;  1MZC A;  3OTN A;  4A3V A;  2Q7F A;  2WM9 A;  2GRQ B;  2XPZ A;  4KT6 B;  3LKU A;  3UQ3 A;  4U0U A;  2YNQ A;  3Q5M A;  2I6H A;  2JAB A;  3JXJ A;  4TRQ A;  2B6C A;  4N39 A;  3UXG A;  3APF A;  5CRU A;  3D9K A;  4DRX E;  1Y8M A;  3TAX A;  4JC8 A;  3RRM B;  3EHM A;  4GTS A;  1INZ A;  4XEI G;  2EIL E;  2I1K A;  2QZA A;  3FTS A;  3QWV A;  4FLH A;  3SBT B;  4YVQ C;  3MKQ A;  4DX6 D;  3BG1 B;  5KJM A;  1IYG A;  3CR3 A;  4WNE A;  1IQU A;  2J9Q A;  4UWG A;  3AJI A;  3LDZ A;  3TG5 A;  1BLX B;  3FUD A;  1U3C A;  4K5B A;  3Q47 B;  5DIZ A;  2KZT B;  3LY8 A;  1WG0 A;  4F3V A;  4BWR A;  1RW2 A;  3HVE A;  2OCC E;  2FUL A;  4AV7 A;  3E4B A;  3SHF A;  1TJF A;  2IFU A;  3ONL A;  2DVW A;  4HLL A;  4FJZ A;  2Y4T A;  3KSQ A;  5KJK A;  3PZ3 A;  4HNA D;  2WXO A;  2KCL A;  4N2Q A;  4GTV A;  4C48 B;  2OV8 A;  4O1P A;  3TWX A;  3CSF A;  3KAE A;  4K5C A;  1D8E A;  3EDT B;  5C2Y A;  3DXM G;  4Z68 A;  2A4Z A;  4XKC A;  4I9C A;  3HXD A;  4BES A;  2QFC A;  1EDU A;  2QYJ A;  4BFR A;  4JA9 A;  1OY3 D;  3IKO B;  4E6H A;  2I1J A;  3SY2 A;  3PDN A;  2P9N G;  4UWH A;  3HXC A;  4GZ5 A;  3G2W A;  2CFU A;  4JEU A;  4JVS A;  3CVU A;  5E76 A;  3JUE A;  3Q79 A;  2V5F A;  4AP2 A;  3Q73 A;  2L6B A;  3LJN A;  2WMO A;  4I6J A;  4HFG A;  3EHN A;  4BTA A;  1Y6I A;  4LSZ E;  1E90 A;  4ZHB A;  2C0L A;  3C3R A;  4J6I A;  3ML9 A;  4J7W A;  2Y69 E;  3CGH A;  3CK9 A;  4E85 A;  3ASG A;  1N4P A;  4HVB A;  1D8D A;  2GRM A;  4U8H A;  3QJZ A;  1N94 A;  1MHQ A;  4XE0 A;  2J4B A;  1HF8 A;  3BQO A;  2BF0 X;  3TWU A;  3G2U A;  5EX0 A;  3TJP A;  3DEO A;  4DUI A;  2CHZ A;  2X38 A;  4HB5 A;  3CVP A;  2L0I A;  1H6P A;  3VLE A;  3ZNG A;  4URK A;  5G05 J;  2R59 A;  3KEA A;  4ABN A;  3B7U X;  4B0Z A;  2AXZ A;  4GCO A;  2MOW A;  2AW6 A;  3HXE A;  2P9P G;  2WXP A;  1AP7 A;  1RZ4 A;  2ZIS A;  2WMN A;  4UWK A;  1DNP A;  1SW6 A;  2DIW A;  2XPY A;  3PVL A;  3S7B A;  5CER B;  1KZP A;  4GML A;  2C0M A;  4JHR A;  2LSU A;  3ABM E;  5BXO A;  3DEP A;  2OVB A;  1OCZ E;  3C72 A;  1YCS B;  1UJJ A;  2F37 A;  5JHA A;  4PS8 A;  4ATZ D;  4EBA A;  3URZ A;  3FUL A;  4EQF A;  5BV0 A;  3APC A;  3NF1 A;  3DSV A;  1JCR A;  4WWP A;  1MX4 A;  3D9I A;  3R9A B;  3CQC B;  5AQB A;  5HS0 A;  3EUV A;  5BW8 C;  3DRA A;  5AIJ A;  4U7E B;  1E8W A;  3ZVV A;  4LNB A;  3FTW A;  3QC1 A;  4TUM A;  1HXI A;  2E0I A;  3B7B A;  2GRR B;  2R2L A;  4B8C B;  1JWF A;  3PZD A;  4U95 D;  4EHM A;  3JQ1 A;  3RU0 A;  1H19 A;  3CLJ A;  4U96 D;  1MYO A;  2Y4U A;  1EYH A;  3Q49 B;  2HR2 A;  3ZIM A;  5BUZ A;  4PH4 B;  3KSL A;  2FEZ A;  4GYY A;  4AY5 A;  3FUJ A;  3UT7 A;  4BY6 A;  4WND A;  1S0P A;  2I9C A;  2L6J A;  3NOG D;  4XI9 A;  3GZ2 A;  3FUH A;  2WXQ A;  3OXF A;  4J8Y A;  2XCC A;  3C98 A;  4HLE A;  2E2E A;  2LSV A;  3JCK C;  5BV1 A;  1U2V G;  4I2W A;  4GA1 A;  4IRU A;  3X2Q E;  1UW4 B;  4G26 A;  5HRY A;  1O1R A;  3R9M A;  2VGX B;  1E7V A;  3ZHE A;  1BPO A;  5ENO D;  3FTV A;  1Z3X A;  2R5S A;  4L1B A;  1QYM A;  4RLY A;  3ESK A;  2IEJ A;  2QY7 A;  2BED A;  4A3T A;  5FIN A;  4L2L A;  3G2T A;  4EBA G;  5ENQ D;  4MLP A;  4JHK A;  1N11 A;  4CCA A;  5CRV A;  2WXJ A;  2OEV A;  5CEC B;  5G05 C;  5HI7 A;  4BT8 A;  2PQN A;  2Y3A A;  4CT4 A;  4KZ0 A;  3B13 A;  2FF4 A;  2FI7 A;  4HRN A;  4C0M A;  2LUH A;  2KBX A;  4CYM D;  1FT1 A;  5FQ6 A;  2VGE A;  3J5Q B;  4L9P A;  3L08 A;  2OEW A;  1N0Q A;  1DVP A;  5EIL A;  2P9S G;  2GRL A;  1UN8 A;  2CG3 A;  2HM8 A;  4ZFH A;  2YQ8 A;  2MRI A;  3ZU7 B;  3O4Z A;  3ZYK A;  4OAV B;  5EX3 A;  3ABL E;  4WUY A;  4GA0 A;  2PNN A;  1Z3Y A;  2R02 A;  4AM9 A;  3UT8 A;  3CK8 A;  4EEC A;  3UTM A;  3QB2 A;  1TN8 A;  5ENN A;  3LYA A;  2H6H A;  1KT0 A;  4I1M A;  4TXQ A;  3GYZ A;  1EF1 C;  1JWG A;  4QFV A;  3SI5 A;  4U8Y D;  1TJC A;  1W3B A;  2XCB A;  1QBQ A;  3ULY A;  2EIJ E;  2DYS E;  2HO1 A;  2DBA A;  4Q69 A;  1NZN A;  4H7X A;  5LFA A;  4HI9 A;  2MHK A;  4XI0 A;  2F0Y A;  3NB2 A;  1N0R A;  3N71 A;  5KCM A;  1UN9 A;  1H2T C;  3D9J A;  3DSW A;  5LX8 A;  1G3N B;  4L23 A;  3V30 A;  4AXH A;  3L9T A;  4CGV A;  1S63 A;  2IQC A;  4HBD A;  4O6F A;  1E8Y A;  4FJY A;  3UM0 A;  4BSZ B;  4PDX A;  2WXG A;  5JJ6 A;  3UKU G;  4LNG A;  5CCL A;  1HFA A;  1H0A A;  4HQD A;  3V79 K;  5D0Q D;  2V4L A;  2J08 A;  1LF8 A;  3EJN A;  3RRN B;  4DJA A;  4BER A;  4J8F A;  2QYU A;  1IHG A;  3R7R A;  3EU9 A;  4JL0 A;  3ZN3 A;  4UI9 K;  5FZS A;  1OWO A;  3ZEF A;  1QZ2 A;  2P2C P;  3C3O A;  2J07 A;  5ENP D;  2WQ6 A;  3RRU A;  3ENE A;  3LY9 A;  3MA5 A;  4W9R A;  3SQV A;  3ISM C;  4I6E A;  2J09 A;  1X5B A;  2J49 A;  3Q7A A;  5J08 A;  4DI3 A;  2ZGD A;  1S70 B;  2LAI A;  1Z6T A;  3UI2 A;  1E96 B;  3FTY A;  3CHS A;  3VTX A;  2WPV A;  3TXN A;  2LXM A;  5D66 A;  4JW1 A;  5EKQ D;  4C9B B;  4NRH B;  1O5M A;  3BEE A;  3E33 A;  4GA2 A;  3T8M A;  3ASO E;  2ION A;  5BPP A;  3RAU A;  4JA7 A;  1UG3 A;  5B1A E;  4ACK A;  2EIK E;  3ABK E;  4TXR A;  4I1O B;  4N5Q A;  4KMO A;  2NSZ A;  2EQX A;  2Y0B G;  4GMJ A;  3IV0 A;  4MRU A;  4JEH A;  1O1S A;  3FTZ A;  3SO8 A;  4H7Y A;  5FZR A;  1HX8 A;  3W9F A;  5ANR A;  1WM5 A;  4GZ3 A;  3SNX A;  3L17 A;  2WXF A;  2IY0 C;  1HG2 A;  4B94 A;  3NBN B;  2HYZ A;  4CDN A;  3CVW A;  4MS6 A;  3PE3 A;  2KM4 A;  3AAA C;  5IY5 E;  1P5Q A;  3AU5 A;  3FH5 A;  1TN6 A;  3CIA A;  5JJT A;  2R03 A;  3MCX A;  4O60 A;  2M63 A;  3DPD A;  2V8S E;  3FUN A;  4UUC A;  2WB2 A;  3JYS A;  3E30 A;  1X81 A;  3RKV A;  1N52 A;  4TUU A;  3SFX A;  5JHB A;  3DWL G;  3UUX A;  4B93 B;  1OCO E;  2EIM E;  3UM2 A;  1N4S A;  5EYL A;  5KBA A;  3ASN E;  4UI9 J;  3FUF A;  5C1D A;  2WXK A;  4MBG A;  2PM6 A;  3PEV B;  1HZ4 A;  4GB9 A;  2P9I G;  1OWP A;  2OVF A;  5JA4 D;  2WXR A;  4BT9 A;  2LNI A;  1DCQ A;  4UWF A;  2VGX A;  4BX9 A;  3HHM A;  2VSN A;  4WWO A;  3AG1 E;  3Q7F A;  2JEK A;  5ENT D;  3L22 A;  4EZJ A;  4CZ2 D;  4GZ6 A;  4HXI A;  3SGH A;  5M72 A;  2CG2 A;  4F53 A;  3NAW A; 
#chains in the Genus database with same CATH homology
 2XCC A;  3C98 A;  3ONK A;  4APO A;  4HLE A;  4LCT A;  1A17 A;  2E2E A;  2LSV A;  3JCK C;  5BV1 A;  2PZI A;  4I2W A;  4GPK A;  4GA1 A;  4DPR A;  5FWQ A;  5T4Y A;  5AJL A;  4ANV A;  1JUQ A;  2VYI A;  3CQG B;  4IRU A;  4L7T A;  4BSX A;  4P29 A;  1UW4 B;  4G26 A;  3FY4 A;  4IN3 B;  3QNK A;  2X6H A;  1OWM A;  1NA0 A;  3U9W A;  2C2L A;  2X6F A;  3P1U A;  2VGX B;  1OWN A;  1E7V A;  3Q4A B;  3ZHE A;  3TL5 A;  1BPO A;  3L13 A;  4U63 A;  3I4R B;  3FTV A;  1Z3X A;  3FWV A;  3RJV A;  3FU5 A;  5HQ8 A;  1E7U A;  1HS6 A;  2IOS A;  2R5S A;  3GZS A;  4FLB A;  4L1B A;  1L5J A;  4N3A A;  4A1S A;  2X6J A;  3FFL A;  3PH0 C;  4AY6 A;  2BUG A;  3CST A;  3WXX A;  1EPU A;  5BT1 A;  3CVQ A;  3B7R L;  3ESK A;  3QDN A;  4R7L A;  3QKY A;  2QY7 A;  4U0Z A;  4A3T A;  3MKQ B;  5G2N A;  3O48 A;  1HH8 A;  2FBN A;  3G2S A;  4L2L A;  2WXM A;  3TXM A;  3ZYM A;  3EIQ C;  4FHJ A;  4U07 A;  2WXL A;  3G2T A;  3PE4 A;  4ILG A;  4EBA G;  1H6K A;  4MLP A;  4WNF A;  4JHK A;  3T5V A;  2WQ7 A;  5ARF A;  3FEY A;  2VJ8 A;  4FU3 A;  4FUL A;  2YHE A;  4B8A A;  3LVQ E;  4Y6C A;  4FA6 A;  4K03 A;  4CCA A;  3D9N A;  4GZC A;  4ANW A;  4BX8 A;  4N5C A;  2WXJ A;  3CVY A;  3L54 A;  3T5X A;  5G05 C;  4ATG A;  4RVB A;  5HI7 A;  2OND A;  4BT8 A;  3PS6 A;  3CVL A;  2PQN A;  3FU6 A;  2Y3A A;  4CT4 A;  1E8X A;  5ARG A;  2XQ0 A;  2VTB B;  3SD5 A;  4GAA A;  4KZ0 A;  3B13 A;  4HOU A;  4AOF A;  2FF4 A;  3CHO A;  3GW4 A;  2FI7 A;  4I17 A;  3D9P A;  2LO6 A;  2V0P A;  1MQS A;  4RSY A;  5JJ7 A;  5KJN A;  4C0M A;  2VSX E;  3FUE A;  3I3N A;  4JXT A;  1ZU2 A;  3S7J A;  2XPI A;  5FQ6 A;  4ANU A;  4M3O A;  3ML8 A;  1NP7 A;  2WXH A;  5J90 A;  4FP7 A;  1ELK A;  3ULQ A;  3L08 A;  3U3W A;  3QAR A;  2PQR A;  3OTN A;  4A3V A;  1DVP A;  2Q7F A;  4XKB A;  2P58 C;  2WM9 A;  2GRL A;  1UN8 A;  2CG3 A;  2HM8 A;  2X6I A;  2YQ8 A;  5DBK A;  2GW1 A;  4HOR A;  2MRI A;  2XPZ A;  4NUR A;  3O4Z A;  4HOS A;  4NQ0 A;  3ZYK A;  4KT6 B;  3LKU A;  3UQ3 A;  5BNW A;  4U0U A;  1HO8 A;  2YNQ A;  4XIF A;  3Q5M A;  2I6H A;  3U64 A;  5LP0 A;  4HOQ A;  5EX3 A;  4WUY A;  4TRQ A;  2VGY A;  2KCK A;  4L2Y A;  4OVV A;  2AVP A;  3CVV A;  4GA0 A;  5FJY A;  1Z3Y A;  4N39 A;  4AM9 A;  3APF A;  3LXU X;  2UWJ G;  4TV3 A;  4A55 A;  1GW6 A;  3D9K A;  3UT8 A;  1Y8M A;  3TAX A;  1OWL A;  2DCP A;  3CK8 A;  4UI9 C;  5T3R A;  3HDX A;  4JC8 A;  4NAC A;  4EEC A;  3RRM B;  3QB2 A;  3ASD A;  2A5U A;  3EHM A;  3MKR A;  4I2Z A;  4I6G A;  3VTY A;  1INZ A;  4PS3 A;  3CKB A;  3PRE A;  5ENN A;  3LYA A;  4UQX A;  2I1K A;  4G1T A;  1KT0 A;  4I1M A;  4N2S A;  3L16 A;  3FTS A;  2CFZ A;  3GYZ A;  3QWV A;  2IJG X;  5ANL A;  1EF1 C;  1ZBP A;  4FLH A;  4F1S A;  1JWG A;  4QFV A;  3R7Q A;  3SBT B;  2WVI A;  3SI5 A;  4GYW A;  5A7D B;  4YVQ C;  1TJC A;  3LPZ A;  3CV0 A;  2I2O A;  1W3B A;  4LEU A;  3LEW A;  3MV3 B;  3MKQ A;  4DLQ A;  3D3M A;  3BG1 B;  5KJM A;  2XCB A;  3EIJ A;  3PNT B;  1IYG A;  5G55 A;  3CR3 A;  4Q94 A;  2HO1 A;  4KBQ A;  4WNE A;  1IQU A;  2J9Q A;  2XGM A;  2VSY A;  2DBA A;  4UWG A;  3RIB A;  3LDZ A;  3FHE A;  1UJK A;  4Q69 A;  3TG4 A;  1NZN A;  4H7X A;  4IUL A;  4ANX A;  5LFA A;  3TG5 A;  3GZ1 A;  3FUD A;  1U3C A;  3FP3 A;  3Q47 B;  4J0U A;  3SBS A;  3FUM A;  5DIZ A;  2KZT B;  3UPV A;  3FTX A;  2MHK A;  3KS2 A;  3D9L A;  3LY8 A;  2VTB A;  3FH8 A;  4CGW A;  4XI0 A;  4YVO A;  4AVX A;  5E75 A;  1HG5 A;  4F3V A;  3DBS A;  4KVM A;  3N71 A;  5KCM A;  1PY1 A;  3L6A A;  4K0R A;  4BWR A;  3ZW3 A;  1FVH A;  4J8S A;  1UN9 A;  1H2T C;  3D9J A;  3HVE A;  2FUL A;  4AV7 A;  5LX8 A;  3E4B A;  4YND A;  3SHF A;  3ZPJ A;  3S2A A;  4FC8 A;  4L23 A;  2L9B A;  1TJF A;  4AXH A;  2CHW A;  4G25 A;  4CGV A;  2IFU A;  1HE8 A;  3ONL A;  2IQC A;  3FEX A;  4FJZ A;  4O6F A;  2Y4T A;  3PNL B;  2KCV A;  1E8Y A;  2WXN A;  4F7A A;  3TGO A;  3PUK A;  4JZY A;  3AS8 A;  4FJY A;  3CHP A;  5KJK A;  4UQZ A;  1FCH A;  2NC9 A;  4PDX A;  3G2V A;  3QWW A;  4ILH B;  3UX4 A;  4CDR A;  3I4G A;  2WXG A;  2WXO A;  3ASH A;  4GZD A;  5JJ6 A;  3S7F A;  3ZYQ A;  4DI4 A;  2KCL A;  3U4T A;  5CCL A;  1HFA A;  1H0A A;  3FUI A;  4N2Q A;  1WAO 1;  1SZA A;  4XZ4 A;  4LRZ A;  4B89 A;  4XX5 A;  4AEZ C;  5LCW J;  2WXI A;  3FTU A;  2UY1 A;  3HYM B;  2OV8 A;  3LVR E;  5D0Q D;  2V4L A;  1WY6 A;  3HVE B;  4G24 A;  2J08 A;  3CSF A;  3KAE A;  3OAW A;  1LF8 A;  3EJN A;  3OXG A;  3RRN B;  3JQ0 A;  4DJA A;  3EDT B;  3Q15 A;  4APF A;  2IOL A;  5C2Y A;  3IHY A;  4J8F A;  2A4Z A;  1IHG A;  3NZS A;  4IYP A;  3R7R A;  5FQ4 A;  5LCW C;  4JL0 A;  3ZN3 A;  2IU1 A;  4XKC A;  4I9C A;  4UI9 K;  5FZS A;  1OWO A;  3RK6 A;  4U04 A;  5FT9 A;  3K9I A;  4FHK A;  2QFC A;  1EDU A;  2NXP A;  4BFR A;  4JA9 A;  3VLD A;  4EZK A;  2L0T B;  3ZEF A;  1QZ2 A;  3IKO B;  4E6H A;  3LS8 A;  2I1J A;  2J07 A;  1QNF A;  3PDN A;  2UY1 B;  4OYS A;  3PRZ A;  4UWH A;  5CHE E;  4GZ5 A;  3CVX A;  2BTD A;  3D9O A;  3G2W A;  2WQ6 A;  3RRU A;  3ZXS A;  3ENE A;  3LY9 A;  5AJD A;  2CFU A;  3FU3 A;  3BG0 B;  3MA5 A;  4W9R A;  4AIF A;  4I6E A;  4JEU A;  2J09 A;  1X5B A;  2J49 A;  3MGB A;  4JVS A;  4C0E A;  4A1G A;  5A23 A;  5J08 A;  4DI3 A;  3CVU A;  3NZU A;  3LY7 A;  5E76 A;  3HIZ A;  3UT4 A;  2XRZ A;  2LAI A;  4N3B A;  1Z6T A;  4RG9 A;  2XHE A;  1E96 B;  3NQP A;  2V5F A;  4AP2 A;  4EPZ A;  2KZT A;  5CMW A;  3FTY A;  3ZFW A;  4Y6W A;  1OUV A;  3CHS A;  1YA0 A;  3VTX A;  2WPV A;  3TXN A;  2WMO A;  4I6J A;  4HFG A;  4JW1 A;  4OVU A;  3PUJ A;  3EHN A;  1PAQ A;  5EKQ D;  4BTA A;  4C9B B;  1Y6I A;  4NRH B;  5T8I A;  3CK7 A;  5G04 J;  3BEE A;  4GCN A;  4GA2 A;  1E90 A;  2C0L A;  3QWP A;  2PL2 A;  2ION A;  4I1A A;  3T8M A;  5BPP A;  4J6I A;  4JA7 A;  3CEQ A;  2KC7 A;  2OOE A;  4J8E A;  5D0O D;  1UG3 A;  3ML9 A;  4ACK A;  3MYV A;  3CGH A;  4AJW A;  3S7D A;  3VLF A;  2JLB A;  4CDM A;  1H2U A;  2R17 C;  1NA3 A;  3CK9 A;  4E85 A;  3ASG A;  2XGS A;  4I1O B;  5AYW D;  1KT1 A;  5CCM A;  4KMO A;  3QK0 A;  4HVB A;  3FH7 A;  2NSZ A;  1JPL A;  2GRM A;  4KVO A;  3QJZ A;  4U8H A;  2EQX A;  4WAF A;  1MHQ A;  4XE0 A;  2J4B A;  3QAQ A;  3U66 A;  4GMJ A;  1HF8 A;  3IV0 A;  4ME2 A;  2PM7 A;  1PC2 A;  3I5P A;  4MRU A;  2BF0 X;  5KJL A;  1XGW A;  1QQE A;  4JEH A;  3FTZ A;  3ZRH A;  4I9E A;  4WWN A;  5LOZ A;  4H7Y A;  2KAT A;  3SFZ A;  3G2U A;  4PUC A;  1H2V C;  4ILI A;  5CMY A;  4N3C A;  1HX8 A;  5EX0 A;  5FZR A;  4U0S A;  3TJP A;  2FO7 A;  2X6K A;  2CHZ A;  5ANR A;  4CEM A;  1WM5 A;  4GZ3 A;  2X38 A;  3SNX A;  3L17 A;  4Q96 A;  4LUN U;  2WXF A;  5FQ8 A;  1SZ9 A;  4CRW A;  3KD7 A;  3MJW A;  4JPS A;  3CVP A;  2L0I A;  2RG8 A;  3VLE A;  1XNF A;  1HG2 A;  4G11 A;  4URK A;  4B94 A;  5G05 J;  2R59 A;  4ABN A;  2HYZ A;  2WQH A;  2YIN A;  4CDN A;  5A6C A;  3B7U X;  1IQR A;  1E8Z A;  4B0Z A;  3CVW A;  4MS6 A;  2AXZ A;  3PE3 A;  4GCO A;  3D9M A;  3ZYL A;  2KM4 A;  2YHC A;  3MV2 B;  2MOW A;  2AW6 A;  1P5Q A;  3SZ7 A;  3AU5 A;  3MZL B;  2WXP A;  5FQ7 A;  2LAH A;  2WMN A;  4UWK A;  1DNP A;  2VSO E;  4HOT A;  2DIW A;  2XPY A;  3IBE A;  3PVL A;  3RO2 A;  3FH5 A;  3CIA A;  3S7B A;  3SF4 A;  2XGO A;  4GYO A;  3ESL A;  3QOU A;  4I43 A;  3ZHE B;  4GML A;  2C0M A;  5JJT A;  3MCX A;  4JHR A;  5AEN A;  3AS5 A;  2M63 A;  3DPD A;  2V8S E;  3FUN A;  3CHR A;  3FUK A;  4J8D A;  2LSU A;  2WB2 A;  1SQM A;  4ACL A;  4EZL A;  2OVB A;  4KZC A;  3JYS A;  1UJJ A;  5JHA A;  4PS8 A;  5EDS A;  3RKV A;  1N52 A;  4HS2 A;  3JUI A;  3URZ A;  4EBA A;  3B7S A;  3FUL A;  5FTP A;  4EQF A;  3IHV A;  5BV0 A;  4TUU A;  3APC A;  3NF1 A;  4KXK B;  4RG6 A;  4UWL A;  4G23 A;  3UMV A;  5JHB A;  4WWP A;  4V3I A;  3D9I A;  3ZGQ A;  1ELR A;  3CQC B;  3R9A B;  3UUX A;  1U3D A;  5BW8 C;  4JHJ A;  3OXL A;  5AIJ A;  2X3M A;  3APD A;  1FVF A;  3CHQ A;  2CHX A;  2J4D A;  1E8W A;  3ZVV A;  4UI9 J;  4BTB A;  3FUF A;  2RD0 A;  5C1D A;  2WXK A;  3FTW A;  4FAD A;  3QC1 A;  3FDH A;  2ILR A;  2PM6 A;  3MEK A;  3LCA A;  1B89 A;  1HXI A;  2E0I A;  3PEV B;  4WNG A;  3CKC A;  1ELW A;  1HZ4 A;  1HU3 A;  4GB9 A;  3FU0 A;  4D10 C;  1VDY A;  1OWP A;  4PS7 A;  4B8C B;  2OVF A;  1JWF A;  3MX3 A;  3PZD A;  4KYO B;  4G2V A;  1TEZ A;  3JQ1 A;  3RU0 A;  1H19 A;  2WXR A;  3CLJ A;  4BT9 A;  2AXV A;  3CHM A;  3PEU B;  4DLO A;  2AXU A;  2AWI A;  1KLX A;  2Y4U A;  1EYH A;  2XEV A;  3IEG A;  2LNI A;  2VQ2 A;  3Q49 B;  4UWF A;  2HR2 A;  5FZQ A;  4DK5 A;  2VGX A;  3ZIM A;  2IF4 A;  4BX9 A;  5BUZ A;  4PH4 B;  2ZU6 B;  3HHM A;  2FEZ A;  4GYY A;  3KEZ A;  3P2B A;  3RO3 A;  4AY5 A;  3FUJ A;  4GU5 A;  3UT7 A;  2VSN A;  4WWO A;  4MKT A;  2JEK A;  3AU4 A;  3ASF A;  4BY6 A;  2XRY A;  4CT0 A;  1N54 A;  3L22 A;  2GGF A;  3AS4 A;  3LJ3 A;  4LER A;  4UQY A;  5G04 C;  4EZJ A;  4GZ6 A;  4HXI A;  3SGH A;  5M72 A;  4WND A;  2CG2 A;  1S0P A;  2I9C A;  2L6J A;  4XI9 A;  3B7T A;  3FUH A;  2WXQ A;  3GZ2 A;  3CVN A;  3OXF A;  4F53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...