3ASFA

Mama msr-1 c2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
174
structure length
174
Chain Sequence
DIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Magnetosome protein MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
total genus 66
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asfA01
4AY5A 3TG5A 4AIFA 3URZA 3KD7A 3CVQA 3PE4A 3MV2B 2PQNA 3OXLA 4UI9J 3MKRA 2IF4A 2UWJG 4H7XA 3TGOA 4I9EA 2E2EA 2Y4UA 5KJMA 2C2LA 4GZ6A 1HH8A 3R9AB 5G05J 1ELRA 5A6CA 4KYOB 5CCMA 4N3CA 4NRHB 5A7DB 2V5FA 3ZN3A 5BT1A 2XCBA 1QZ2A 3TAXA 3CK9A 1FCHA 1ZBPA 5EX0A 5JJTA 1WM5A 3RU0A 3OXFA 4I9CA 3QWVA 1XNFA 1KLXA 3ASGA 4I17A 1YA0A 4GYOA 3LKUA 5KJNA 3PDNA 5G05C 4UQZA 2XGMA 5FZRA 4IN3B 3ASFA 4WNGA 4HOSA 3UUXA 1KT0A 4GCOA 2Y4TA 2VQ2A 5D0OD 4UQXA 3PE3A 1ELWA 4BT8A 4JA7A 4J8DA 1KT1A 3GZ2A 1PC2A 2AVPA 3QDNA 5FZSA 2LNIA 1HXIA 4U04A 2XGOA 3LYAA 2XEVA 2IFUA 4H7YA 4AY6A 4RG6A 2LSVA 3FWVA 2R5SA 4KBQA 5EX3A 4GCNA 3HYMB 3ZHEA 2NC9A 3AS4A 4UI9K 5JJ6A 3ZGQA 4YVOA 5JJ7A 3AS5A 5DBKA 3CK8A 3Q49B 3VTXA 2WPVA 3GW4A 3S7DA 3Q4AB 4JHRA 4J8FA 3ASHA 4ABNA 3O48A 3MA5A 4APOA 1TJCA 2C0MA 3BEEA 5DIZA 2FO7A 4B94A 4WUYA 3LY8A 4J0UA 3S7JA 2JLBA 4UI9C 2WQHA 2HYZA 4G25A 4O6FA 4ME2A 3K9IA 2KATA 4NQ0A 4I2WA 3OXGA 4W9RA 4G1TA 4A1SA 2QFCA 3MEKA 1P5QA 5D0QD 5FJYA 3UQ3A 2L6JA 2FEZA 3FP3A 3MV3B 2C0LA 5LCWJ 2FBNA 3CKBA 1NA0A 3QKYA 2KCLA 2KCKA 3ZHEB 2I6HA 4N39A 3ZPJA 1NZNA 3NF1A 4U07A 2VGYA 4F3VA 4N3AA 3CKCA 3KAEA 5CCLA 3SZ7A 4HOQA 3TG4A 3N71A 4GZ5A 1OUVA 5KJKA 5HI7A 3S7FA 4XI9A 4AM9A 4XI0A 4GA1A 3CV0A 4CGWA 2PL2A 4Y6CA 3JYSA 5LCWC 5KJLA 4EQFA 3CK7A 5ARFA 3ZFWA 3QWWA 3Q5MA 4GPKA 1IYGA 2VSYA 4JL0A 3GZ1A 3ULQA 4HOUA 3ESKA 4U0ZA 2VYIA 2GW1A 1QQEA 2YQ8A 1Y8MA 3QWPA 4CGVA 4GYWA 2LSUA 5BNWA 1HZ4A 4HOTA 2J9QA 2OOEA 2PZIA 3U3WA 3LY9A 5AYWD 4UQYA 3U4TA 2XCCA 2YHCA 4I2ZA 3RKVA 3RO3A 3WXXA 1B89A 5FZQA 4BT9A 4G23A 2FI7A 5HQ8A 2ONDA 5FTPA 3LPZA 1E96B 4LEUA 4XIFA 4BTBA 4Y6WA 5G04J 4N3BA 4GA0A 4YNDA 4J8EA 3SF4A 3Q15A 4GZ3A 5CHEE 2KCVA 4CDRA 3RIBA 3CVPA 4GYYA 5M72A 3S7BA 2KC7A 3CVNA 2UY1B 4WNDA 4RG9A 4N2SA 1WAO1 4U0SA 3RJVA 4JA9A 2MHKA 4WNEA 4BWRA 2BUGA 4N2QA 1NA3A 3LY7A 2P58C 3KS2A 2HO1A 3QOUA 5G04C 2VGXB 3CVLA 3CEQA 5C1DA 5FT9A 2PQRA 3EDTB 4N5CA 4I1AA 5EKQD 4BTAA 3IEGA 4HORA 3GYZA 2Q7FA 4G24A 4WNFA 4G2VA 4KXKB 3AS8A 1ZU2A 4YVQC 2UY1A 1IHGA 5BW8C 1A17A 2FF4A 3E4BA 3Q47B 3ASDA 1W3BA 4GA2A 2XGSA 2VSNA 3LCAA 3RO2A 2XPIA 3UPVA 2VGXA 5ARGA 2DBAA 4U0UA 4G26A 2HR2A 3VTYA 3FFLA
chains in the Genus database with same CATH superfamily
2XRYA 2CHWA 5ANRA 3TG5A 1UG3A 1OY3D 5E76A 4DI3A 3HIZA 3C72A 3OXLA 4UI9J 3R7QA 2CFUA 3CGHA 3ONLA 4FU3A 4NACA 5T4YA 3Q9UC 5G55A 3SNXA 2Y4UA 2GROB 2OEWA 5KJMA 3I5PA 3I3NA 4OVVA 3VLEA 2DZOA 5EYLA 5BV0A 4EECA 5G05J 3PREA 5AJDA 4B0ZA 4DX2A 3HHMA 2V5FA 2DIWA 4DX5D 2IO3C 3IKOB 5BT1A 3MZLB 4TV3A 4JB8P 3UT8A 3RRMB 1E7UA 4PS3A 1FCHA 1ZBPA 4RLYA 1JCRA 3I4GA 1WM5A 3RU0A 3OXFA 1V54E 3FTWA 4GTOA 4D10C 4I17A 4GYOA 4JC8A 3EIQC 4HFGA 1LF8A 3CHPA 2OEVA 4UQZA 4V3IA 1E8YA 4IN3B 3ASFA 4JW1A 4DK5A 4HOSA 4HQDA 1HG5A 4UQXA 2IJGX 4BT8A 3ASOE 2VTBB 4ILGA 2LNIA 2H6IA 2F8XK 4FJZA 1HXIA 4AXHA 3ENEA 3SQVA 2FO1E 3FUNA 2WXHA 2I9CA 2IFUA 4H7YA 4L1BA 3B13A 3B7RL 1TN6A 3L17A 1KPSB 4C0EA 1TNYA 5EX3A 3LVRE 3HYMB 4G11A 4A63B 3RRUA 2NC9A 3AS4A 4ANUA 4C9BB 5JJ6A 2QYUA 3B7TA 4YVOA 3CK8A 4BX8A 4EBAG 4ANVA 4LCTA 2IOLA 1MX2A 1BD8A 5LOZA 3GW4A 4JZYA 3S7DA 3S2AA 5G2NA 1INZA 3NZUA 4WWPA 3ZYKA 3HDXA 3T8KA 3ASHA 5AQBA 5KWDA 3Q75A 2IU1A 4CDMA 5DIZA 1N4PA 1FT2A 2FO7A 4B94A 3ESLA 3WG7E 3EHRA 4J0UA 1O1TA 3PH0C 5ENQD 2GRLA 3SO8A 4G25A 1OWMA 5HS0A 3RSEG 2KATA 4XX5A 4W9RA 1IHBA 2LXMA 4EPZA 4F1PA 4A3TA 3RRNB 3MEKA 3UQ3A 4FHKA 2XENA 4LSZE 5T3RA 4K5BA 2J08A 5JA4D 2RD0A 1X5BA 3DXMG 5KNGA 1HFAA 2FBNA 4LNUD 2WXJA 3QKYA 2KCLA 4K0RA 4ACLA 3ZHEB 3ZNGA 4JEUA 4HI8A 1N4QA 2EILE 2NYJA 4A3VA 1H19A 4F3VA 2WM9A 3CKCA 4APFA 5CCLA 3MKQB 3CVVA 4L9PA 5J08A 4FLHA 5HI7A 3D9JA 2R17C 3CV0A 3D9OA 3MX3A 1AWCB 1DCQA 2PL2A 1Z3XA 1UOHA 3TWSA 5LX8A 2VSXE 5C2YA 3ZFWA 5ARFA 3L6AA 5A23A 3D3MA 5EN5D 3AG2E 3ESKA 4GTPA 3PUKA 3QWPA 1LD7A 4RSYA 4MBGA 1Q2ZA 4G8LA 3V2OA 2WXRA 1HZ4A 3G2UA 2F8YA 4FA6A 3CR3A 5CMYA 3RO3A 1S70B 1NFIE 5LFAA 1BU9A 2X6HA 2Y1LE 4EZKA 4Z68A 5HQ8A 4L7TA 1TNBA 3Q7FA 1E96B 4BTBA 4Y6WA 4L2LA 4WWNA 4AV7A 4HRNA 3UI2A 2XZDG 1KZPA 2XRZA 4J8EA 5JHAA 3LS8A 1N11A 2X6JA 4FHJA 2A5UA 1OXJA 4I6JA 1JCSA 4GYYA 3T5XA 2DWZA 2F37A 3DEOA 4WNDA 4U0SA 2WMOA 3L9TA 3B95A 3J5QB 3ZU7B 2BUGA 4DLQA 2I2OA 3FU3A 5G04C 2YINA 3HXCA 3CVLA 3CEQA 4FP7A 4O1OA 4F53A 2IEJA 3EDTB 2BTDA 3UT7A 5EKQD 3FU6A 3C5RA 4HORA 3DSSA 2MYOA 1TJFA 4I1MA 3UKRG 1HX8A 4DPRA 2Q7FA 3CVUA 4WNFA 1MHQA 3NOCD 1IXVA 3BU8A 5BXUA 2CG3A 3UM3A 4PUCA 1A17A 3ONKA 1W3BA 4GA2A 3PNTB 5JMND 3LCAA 1DCEA 2XPIA 3NQPA 3MGBA 2VGXA 3EU9A 4DJAA 2DBAA 3DSWA 4U0UA 2FULA 3PS6A 3KSQA 4AY5A 3FUMA 3HVEB 4AIFA 3ABKE 4HI9A 3KD7A 3CVQA 1EYHA 2AJAA 3ISMC 2IF4A 2VTBA 3TGOA 4I9EA 3C3RA 4MLPA 3D9IA 3HRAA 3E32A 4IYPA 3ABLE 1IKND 2C2LA 5BPPA 4HXIA 1DNPA 2I1KA 4GZ6A 1HH8A 1XGWA 3EU5A 4CZ2D 2CHZA 5CCMA 5A7DB 4HBDA 4OAVB 2ILRA 3B7BA 4JVSA 1E90A 1TR4A 4U7EB 5EX0A 4HRLA 3VLFA 3FUJA 2X6KA 3CVXA 3AU5A 1KLXA 2L9BA 4GZCA 2OVBA 2J4DA 2A5EA 2Y3AA 3L08A 2I1JA 3PZ1A 4F1SA 3C3OA 4GCOA 3PVLA 2H6GA 4U95D 1WY6A 3TXNA 4BEPA 1PC2A 4DLOA 3TWUA 5FZSA 2V8SE 5B1BE 2IQCA 4L2YA 4AJWA 3QJZA 1LD8A 2L6BA 4TUUA 1YCSB 3PEUB 2XGOA 4CRWA 2XEVA 2R59A 3C98A 1E8WA 4PS7A 3P1UA 4AY6A 4RG6A 2P9UG 3ZKJA 5HKPA 4NIKA 3AU4A 2ZXWE 4GCNA 4KZ0A 1EDUA 3ZHEA 4I6GA 3NAWA 1MZCA 1TNOA 4I6EA 3ABME 3FULA 1O1SA 4WAFA 5JJ7A 3HXEA 3Q49B 3VTXA 1DVPA 3ZXPA 1E7VA 2L0IA 5FQ7A 4JHRA 3E30A 3EJNA 2X6FA 4KT6B 3J5PA 4GU5A 2WXLA 3FUDA 4Q96A 4CT0A 1BI7B 3CLJA 1H6OA 2MRIA 3ML9A 3ZIMA 1FT1A 5ENNA 4A1GA 4U8HA 2JLBA 4EHMA 2XZTG 2IY0C 2WXGA 3IBEA 4KZCA 4TUMA 3ZVVA 1FVHA 4UWKA 3HG0D 2V0PA 2V4LA 3K9IA 1E8XA 3L54A 1N52A 4ACKA 2GGFA 4TXPA 1N9AA 3ZEFA 1HE8A 4J6IA 1OWPA 2H6FA 3JXIA 3NZSA 5D0QD 1PY1A 2FEZA 3CHOA 2C0LA 5LCWJ 2WVIA 4AEZC 5KNHD 3CKBA 4M3OA 2P9KG 3G2VA 2KBXA 2ETAA 2ETCA 1NZNA 2VGYA 4N3AA 5AQ9A 2WQ6A 4HOQA 4GZ5A 5KJKA 3B7SA 3S7FA 4BX9A 3FU5A 4TRQA 3EHMA 4CCAA 3IXEA 5KJLA 2KZTA 3QWWA 3Q5MA 4GPKA 1S63A 2Y0BG 1SW6A 1OCZE 4HOUA 4U0ZA 1QQEA 1Y8MA 1BPOA 3UXGA 4GYWA 4BESA 3TL5A 1H6PA 5CRVA 4N5QA 2OOEA 2PZIA 3U3WA 3LY9A 4UQYA 4KMOA 3U4TA 4QQIA 3RKVA 1K8KG 3ML8A 2VJ8A 2QY7A 4JXTA 3PEVB 3HXDA 2ETBA 3E34A 4C0MA 2J8SD 4URKA 3Q15A 2GRNB 3MCXA 3SBTB 1JPLA 5CHEE 1JWGA 3U9WA 1H6KA 4BSZB 5EYPF 1H2VC 3SGHA 2X3MA 2RFMA 4MKTA 2Y69E 1HS6A 4A55A 5M72A 2WQ7A 3FUEA 3CVNA 3EHNA 3RAUA 2P9NG 2UY1B 1TNUA 4RG9A 2H6HA 5AN8A 3HXBA 4U8YD 4JA9A 4LERA 1O1RA 4N2QA 3G2TA 3LY7A 1SA4A 3ULYA 4DI4A 3KS2A 3QK0A 3C3QA 3FUHA 3T9KA 4X8QA 1OWLA 4N5CA 1MX6A 4DX7D 4BTAA 1WG0A 2B6CA 3TWTA 3L82A 1TNZA 5J90A 4KXKB 3AS8A 4YVQC 5BW8C 4C48B 3E4BA 3ASDA 4GMRA 4XE0A 2XGSA 3ULEG 3CHSA 4GTMA 4EZLA 3T8MA 3ZYLA 3UPVA 3UT4A 4QFVA 4UUCA 3FTUA 1SA5A 3FFLA 1H0AA 1HF8A 3EHQA 2DZNA 3DXKG 2PQNA 1Z5SC 2NXPA 4L23A 4JPSA 5FQ4A 2UWJG 3ZUVB 5KBAA 4RQIA 5ENOD 4XKBA 2X6IA 3FUIA 4K5CA 2X38A 3SFYA 2V5QC 1ELRA 5A6CA 3TWWA 5AIJA 4KYOB 1IQRA 3UM0A 5LP0A 4IRUA 2AXUA 3BUAA 4HS2A 3TAXA 5JJTA 2WXIA 4I9CA 1D8DA 3LEWA 5AJLA 3FU0A 2KM4A 3MJWA 3ASGA 2IOSA 3LKUA 5KJNA 1TYQG 3PDNA 3SHFA 2PM6A 5G05C 4JD2G 4J8YA 1Z3YA 1S64A 1A5EA 2AWIA 2Y4TA 2VQ2A 5D0OD 1FVFA 2WXFA 3PE3A 5AQAA 1ELWA 4EBAA 3JQ0A 4K03A 4JA7A 3UM1A 4J8DA 3GZ2A 4HNAD 3QDNA 1OCOE 3FTXA 2BKKB 1L5JA 1MYOA 3JUIA 2XEEA 3PZ2A 4U04A 2ZIRA 3NB2A 2HE0A 1LTXA 4XKCA 2P2CP 3Q78A 1YMPA 2CHXA 2CFZA 3FY4A 5HRYA 3FTZA 2BF0X 2R5SA 2DYRE 3FUFA 4ILIA 3R7RA 1HU3A 3SFZA 4UI9K 2P9IG 3V2XA 3TXMA 4U63A 3IV0A 3HXFA 3CHRA 3ZGQA 1N0QA 2A4ZA 3AS5A 2AXVA 5DBKA 2WXPA 3DSXA 5AAOA 1JUQA 2WMNA 3ZRHA 3B7UX 1X81A 1N94A 2DVWA 2J49A 3Q4AB 3W9FA 5FWQA 2P9PG 5FQ6A 3L22A 3P2BA 3UX4A 4ABNA 4FLBA 4ANWA 3MA5A 4APOA 2C0MA 3TWQA 4E85A 3BEEA 1RW2A 3LY8A 3D9PA 3DBSA 1VDYA 1KZOA 1HO8A 4J8SA 4BFRA 4O6FA 3Q73A 4RVBA 1HG2A 4NQ0A 2EIJE 3D9NA 3CQCB 3Q7AA 5ENTD 4CT4A 2LAIA 3CHMA 4G1TA 2BKGA 4GAAA 3D9HA 2XEHA 5CBNA 1D9SA 4A1SA 2QFCA 2F0YA 1P5QA 3FP3A 3MV3B 5IY5E 4I43A 2GRRB 1H2UA 3LDZA 1K1AA 5CEAA 1BI8B 4FULA 1IQUA 1NA0A 4GTTA 3UTMA 2EINE 2I6HA 4U8VD 4N39A 3NF1A 5EILA 4U07A 5AENA 2EIME 1D8EA 5CRUA 3UIOC 3DSVA 3SI5A 3DRAA 3KAEA 2KXPC 1E8ZA 3TG4A 1OUVA 3CIAA 3FUKA 1G3NB 3Q9NC 2WXNA 4AOFA 3AG1E 4AM9A 3V31A 5H7PA 2LO6A 5CBOA 4GTSA 5ENPD 4Y6CA 3JYSA 3TWXA 4EQFA 4KVMA 3U66A 5BUZA 3ZYQA 4AVXA 4JL0A 3GZ1A 3CVYA 3D9LA 3ULQA 1N4SA 3TWVA 1H2TC 2RKKA 2VYIA 3F6QA 3T5VA 4CGVA 4EZJA 5EDSA 3KSLA 1SQMA 4AP2A 2M63A 5BNWA 4PS8A 1UJJA 3MKQA 3UIPC 2XCCA 4I2ZA 5ITZF 4LRZA 5CMWA 1YYHA 3IHVA 2BEDA 3RK6A 3FTYA 3PUJA 4ATZD 1UN9A 2ONDA 3ZYMA 5FTPA 4LEUA 4XIFA 3PZDA 4GMJA 1O5MA 5G04J 4N3BA 4GA0A 1TN8A 4YNDA 3SBSA 1OT8A 3SF4A 1QBQA 1BLXB 3BG1B 2KCVA 4CDRA 3RIBA 1Y6IA 3CVPA 4F6RD 2KC7A 2OV8A 1OWNA 2QYJA 2L0TB 4JEHA 4HVBA 2WXOA 4N2SA 1WAO1 3RJVA 3O4ZA 3L16A 4WNEA 3ZW3A 4BWRA 4G8KA 2E0IA 1MJ0A 2HO1A 2P9SG 3QOUA 2VGXB 1JCQA 4J7WA 1NP7A 5FT9A 1ELKA 5B3SE 4BY6A 4OVUA 2XQ0A 4O60A 5EIDA 3TWRA 1PAQA 3GZSA 4MRUA 1ZU2A 2NSZA 1IHGA 4ILHB 1SVXA 4UWGA 3QC1A 3Q47B 2YNQA 1Z6TA 2VSNA 3RO2A 4ZHBA 2VSOE 3FH7A 5CERB 2RFAA 4PDXA 5FINA 4E6HA 1SZ9A 1OCRE 5BV1A 4JHKA 4FADA 3VTYA 5FIOA 2AXZA 1WDYA 4Q69A 3URZA 4K5AB 3PE4A 3MV2B 3MKRA 3APDA 5AARA 4H7XA 2AW6A 2DCPA 2E2EA 3DEPA 3E37A 1SZAA 2B0OE 5AQ7A 1U2VG 4TXQA 4OYSA 3R9AB 3R9MA 1UN8A 1RZ4A 1U3CA 2IO2C 3UMVA 2J4BA 4N3CA 4NRHB 5E75A 3QB2A 4PH4B 2XHEA 3ZN3A 3FHEA 3SFXA 3UKUG 3HVEA 3ASNE 4IULA 4YDWA 2XCBA 3BG0B 5D66A 4BSXA 4KVOA 5EIBE 1QZ2A 3QARA 3CK9A 1S0PA 2OVFA 5ANLA 1TEZA 1N95A 3FH5A 4XEIG 1K1BA 3E33A 3QWVA 4HLLA 1XNFA 1OCCE 4OAUC 3UM2A 2IONA 3DWLG 1YA0A 3EIJA 2R03A 2ZU6B 2EIKE 5CECB 2QC9A 2XGMA 5FZRA 3L13A 2LAHA 2JABA 3APCA 1MQSA 1NL4A 4WNGA 3UUXA 1KT0A 4CYMD 3FEYA 4B93B 1TN7A 4GPMA 2WB2A 1KT1A 3CVWA 2AVPA 2YHEA 2EQXA 5JHBA 4BERA 2QZAA 2J09A 3LYAA 4GB9A 3UINC 3I4RB 2MOWA 3G2SA 2R05A 4CEMA 3FTVA 3PNLB 2R02A 2LSVA 3FWVA 4KBQA 1FPPA 3BQOA 2XPYA 4GZDA 4MS6A 1QNFA 3PZ4A 2XS8A 2WPVA 2HM8A 3FEXA 1N0RA 3APFA 1MX4A 3NBNB 1AP7A 5KCMA 4J8FA 2PNNA 2ZGDA 4DX1A 4HB5A 2RG8A 3O48A 4B8CB 3FTSA 1TJCA 2GRQB 3LJ3A 3CQGB 3FH8A 4ANXA 2P9LG 4WUYA 5ENSD 3S7JA 4UI9C 2WQHA 2HYZA 4XZ4A 4WWOA 5FQ8A 4ME2A 2OCCE 3SY2A 4I2WA 4GTQA 3OXGA 2WXKA 4GTRA 4B8AA 4JHJA 3MYVA 2XS1A 5FJYA 3LVQE 2L6JA 2KZTB 2R2LA 1NI1A 5BXOA 2GRPB 2KCKA 2WXQA 3OTNA 3ZPJA 1QYMA 3CHQA 2LUHA 5T8IA 3AG3E 3EUVA 3QNKA 3LJNA 3SZ7A 4UWLA 3N71A 4U96D 4LNGA 4XI9A 4XI0A 4GA1A 4CGWA 3FDHA 3CSTA 4GTVA 3X2QE 1ZB1A 2DYSE 3SD5A 5LCWC 3Q79A 4HRMB 3CK7A 4ZFHA 2CG2A 1EF1C 1IYGA 3DSTA 2VSYA 3AJIA 4BETA 5D2MC 5B1AE 2GW1A 2YQ8A 3NOGD 1N4RA 2LSUA 5ENRD 1JWFA 4YDEA 2ZISA 1UJKA 3QAQA 4HOTA 2J9QA 3DSUA 3D9MA 3PRZA 2GRMA 5AYWD 2J07A 2YHCA 2VGEA 3PZ3A 3LXUX 1N54A 3WXXA 4DUIA 3JXJA 4NURA 1B89A 4LUNU 3U64A 5FZQA 4BT9A 4G23A 4DX6D 2FI7A 4P29A 2LXLA 3LPZA 4O1PA 4UWHA 3OAWA 2WXMA 3ZXSA 4GZ3A 4FC8A 3AAAC 4HLEA 3VLDA 1GW6A 3JQ1A 3KEAA 3S7BA 2PM7A 3AG4E 4DRXE 3JUEA 3JCKC 4UWFA 2MHKA 3G2WA 4LNBA 1NA3A 4TXRA 2P58C 1K3ZD 2V4HC 4I1OB 3V79K 4R7LA 3DPDA 5C1DA 2XPZA 3CSFA 4FJYA 2PQRA 4I1AA 3IHYA 2JEKA 1OWOA 3IEGA 4GMLA 1EPUA 3GYZA 1V55E 4YDOA 4M7CA 3KEZA 4G24A 4G2VA 3D9KA 2UY1A 5CEDB 2ZGGA 2FF4A 4B89A 3DPYA 1DC2A 1UW4B 3TJPA 4Q94A 4LG6A 3V30A 5ARGA 4F7AA 4YDYA 3W9GA 4ATGA 4G26A 4CDNA 2HR2A 1U3DA
chains in the Genus database with same CATH topology
3PS6A 4Q69A 4AY5A 2XRYA 1HF8A 2CHWA 3FUMA 5ANRA 3TG5A 3HVEB 1UG3A 4AIFA 3URZA 5E76A 4DI3A 3KD7A 3HIZA 3CVQA 1EYHA 3PE4A 3MV2B 2PQNA 3OXLA 4UI9J 3R7QA 2CFUA 3MKRA 3CGHA 3ONLA 4FU3A 2IF4A 2NXPA 4NACA 4L23A 3APDA 4JPSA 2VTBA 5FQ4A 2UWJG 4H7XA 3TGOA 4I9EA 2AW6A 2DCPA 4MLPA 2E2EA 3D9IA 5G55A 5T4YA 3SNXA 4IYPA 2Y4UA 5KJMA 3I5PA 1SZAA 2C2LA 3I3NA 4XKBA 2X6IA 5BPPA 4OVVA 3VLEA 4HXIA 1DNPA 2I1KA 4GZ6A 1HH8A 4OYSA 1XGWA 3FUIA 3R9AB 1UN8A 2X38A 5BV0A 4EECA 5G05J 1ELRA 3PREA 1U3CA 5A6CA 5AJDA 2CHZA 4B0ZA 5AIJA 4KYOB 3UMVA 2J4BA 4N3CA 5CCMA 1IQRA 4NRHB 5E75A 5A7DB 3QB2A 4PH4B 2XHEA 3HHMA 2V5FA 3ZN3A 2ILRA 3FHEA 4IRUA 5LP0A 2DIWA 4JVSA 2AXUA 3IKOB 3HVEA 5BT1A 3MZLB 4IULA 1E90A 2XCBA 4TV3A 3BG0B 3UT8A 4KVOA 4BSXA 3RRMB 4HS2A 1QZ2A 1E7UA 3QARA 3TAXA 3CK9A 1S0PA 2OVFA 4PS3A 1FCHA 5ANLA 1ZBPA 5EX0A 1TEZA 5JJTA 3FH5A 2WXIA 3I4GA 1WM5A 3RU0A 3OXFA 3VLFA 4I9CA 3FUJA 3LEWA 3FTWA 5AJLA 2X6KA 3QWVA 3CVXA 1XNFA 4D10C 3AU5A 3FU0A 1KLXA 2KM4A 3MJWA 2IONA 2IOSA 3ASGA 1YA0A 4GYOA 3LKUA 4I17A 3EIJA 4JC8A 3EIQC 5KJNA 4HFGA 2L9BA 3PDNA 2ZU6B 4GZCA 3SHFA 1LF8A 2PM6A 5G05C 3CHPA 4UQZA 1Z3YA 2OVBA 2XGMA 4V3IA 1E8YA 3L13A 5FZRA 2J4DA 4IN3B 2LAHA 2Y3AA 3APCA 3ASFA 3L08A 4JW1A 2I1JA 4DK5A 1MQSA 4WNGA 4F1SA 4HOSA 3UUXA 1KT0A 4GCOA 2AWIA 2Y4TA 3PVLA 1HG5A 2VQ2A 5D0OD 1FVFA 1WY6A 3TXNA 2WXFA 3FEYA 4UQXA 2IJGX 3PE3A 1ELWA 4EBAA 4BT8A 3JQ0A 4K03A 4JA7A 2WB2A 4J8DA 1KT1A 3GZ2A 3CVWA 1PC2A 4DLOA 2AVPA 2VTBB 3QDNA 2YHEA 4ILGA 5FZSA 2LNIA 2EQXA 2IQCA 2V8SE 4L2YA 4AJWA 3QJZA 3FTXA 5JHBA 1L5JA 3JUIA 4FJZA 1HXIA 4TUUA 2J09A 4U04A 3PEUB 4AXHA 2XGOA 4CRWA 3LYAA 4GB9A 3ENEA 2XEVA 2R59A 3C98A 1E8WA 3FUNA 4PS7A 3I4RB 2WXHA 2MOWA 4XKCA 2I9CA 2IFUA 3G2SA 4H7YA 3P1UA 2CHXA 2CFZA 4AY6A 4L1BA 3B13A 4RG6A 3FY4A 3FTZA 3B7RL 4CEMA 3FTVA 3PNLB 2BF0X 2LSVA 3FWVA 3L17A 4C0EA 3AU4A 2R5SA 4KBQA 5EX3A 4GCNA 3LVRE 3HYMB 3FUFA 1EDUA 4G11A 4KZ0A 3RRUA 4ILIA 2NC9A 2XPYA 3ZHEA 4GZDA 3R7RA 3AS4A 4I6GA 1HU3A 4MS6A 4UI9K 3SFZA 4ANUA 4C9BB 5JJ6A 1QNFA 4I6EA 3TXMA 3B7TA 4U63A 3IV0A 3CHRA 3FULA 3ZGQA 4WAFA 4YVOA 2A4ZA 3AS5A 5JJ7A 2AXVA 5DBKA 3CK8A 2WXPA 4BX8A 3Q49B 3VTXA 4EBAG 1JUQA 2WMNA 3ZRHA 1DVPA 4LCTA 2IOLA 3B7UX 4ANVA 2WPVA 2HM8A 3FEXA 3APFA 5LOZA 3GW4A 1E7VA 4JZYA 2L0IA 5FQ7A 2J49A 3S7DA 3Q4AB 4JHRA 5KCMA 3S2AA 3EJNA 4J8FA 5G2NA 5FWQA 1INZA 3NZUA 2X6FA 4WWPA 5FQ6A 3ZYKA 3HDXA 2RG8A 4KT6B 3L22A 3ASHA 3P2BA 3UX4A 4ABNA 4FLBA 3O48A 4B8CB 4ANWA 3MA5A 4GU5A 3FTSA 2WXLA 3FUDA 4APOA 1TJCA 3LJ3A 2C0MA 4Q96A 4E85A 2IU1A 3CQGB 4CT0A 4CDMA 3FH8A 3BEEA 3CLJA 5DIZA 4ANXA 2FO7A 4B94A 3ESLA 4WUYA 2MRIA 3LY8A 3D9PA 3ML9A 3DBSA 4J0UA 3S7JA 1VDYA 3ZIMA 5ENNA 4A1GA 4U8HA 1HO8A 3PH0C 2JLBA 4UI9C 2WQHA 2GRLA 4J8SA 2HYZA 2WXGA 3IBEA 1OWMA 4G25A 4KZCA 3ZVVA 4BFRA 1FVHA 4UWKA 4XZ4A 4WWOA 4O6FA 4ME2A 2V0PA 2V4LA 4RVBA 5FQ8A 3K9IA 1E8XA 3L54A 1HG2A 2KATA 4NQ0A 4I2WA 3OXGA 1N52A 3D9NA 3CQCB 2WXKA 4XX5A 4ACKA 2GGFA 3ZEFA 4W9RA 1HE8A 4B8AA 4JHJA 4CT4A 2LAIA 3CHMA 4J6IA 4G1TA 4GAAA 4EPZA 1OWPA 3MYVA 4A3TA 4A1SA 2QFCA 3RRNB 3MEKA 3NZSA 1P5QA 5D0QD 5FJYA 3LVQE 3UQ3A 2L6JA 4FHKA 1PY1A 2FEZA 3CHOA 3FP3A 3MV3B 2C0LA 2KZTB 5T3RA 4I43A 5LCWJ 1H2UA 2J08A 2WVIA 4AEZC 3LDZA 2RD0A 1X5BA 1HFAA 2FBNA 4FULA 3CKBA 1IQUA 1NA0A 2WXJA 3QKYA 4M3OA 2KCLA 2KCKA 4K0RA 2WXQA 3ZHEB 4ACLA 3G2VA 2I6HA 3OTNA 4N39A 3ZPJA 4JEUA 1NZNA 3NF1A 4U07A 5AENA 2VGYA 4A3VA 1H19A 4F3VA 4N3AA 2WM9A 3CKCA 3SI5A 4APFA 3ZXSA 3CHQA 3KAEA 5T8IA 5CCLA 3MKQB 3QNKA 2WQ6A 3CVVA 3SZ7A 4HOQA 4UWLA 1E8ZA 3N71A 4GZ5A 1OUVA 3TG4A 5J08A 5KJKA 3CIAA 4FLHA 5HI7A 3FUKA 3B7SA 3D9JA 2R17C 3S7FA 2WXNA 4BX9A 4AOFA 4XI9A 3FU5A 4TRQA 3EHMA 4XI0A 4AM9A 4GA1A 3CV0A 3D9OA 3MX3A 4CCAA 2LO6A 4CGWA 3FDHA 3CSTA 2PL2A 1Z3XA 4Y6CA 3JYSA 5LCWC 3SD5A 5KJLA 5LX8A 2KZTA 2VSXE 4EQFA 4KVMA 5C2YA 5BUZA 3U66A 3CK7A 5ARFA 3ZFWA 3QWWA 3Q5MA 3ZYQA 4GPKA 2CG2A 1EF1C 1IYGA 3L6AA 5A23A 2VSYA 4AVXA 4JL0A 3D3MA 3GZ1A 3CVYA 3D9LA 3ULQA 1H2TC 4HOUA 3ESKA 4U0ZA 2VYIA 2GW1A 1QQEA 2YQ8A 1Y8MA 1BPOA 3T5VA 3PUKA 3QWPA 4CGVA 4GYWA 4RSYA 3TL5A 4EZJA 2LSUA 5EDSA 1JWFA 1SQMA 4AP2A 2M63A 5BNWA 2WXRA 4PS8A 1UJKA 1HZ4A 1UJJA 3MKQA 3QAQA 4HOTA 2J9QA 3D9MA 2OOEA 2PZIA 3PRZA 3U3WA 3LY9A 2GRMA 5AYWD 3G2UA 2J07A 4UQYA 4FA6A 4KMOA 3U4TA 2YHCA 2XCCA 3CR3A 5CMYA 4I2ZA 3LXUX 3RKVA 3RO3A 1N54A 3WXXA 5LFAA 4NURA 3ML8A 2VJ8A 1B89A 4LUNU 2QY7A 3U64A 2X6HA 5FZQA 4LRZA 4BT9A 4G23A 2FI7A 5CMWA 4JXTA 4EZKA 3IHVA 3RK6A 3PEVB 3FTYA 4P29A 5HQ8A 3PUJA 4L7TA 1UN9A 2ONDA 3ZYMA 5FTPA 3LPZA 1E96B 4LEUA 4XIFA 4BTBA 3PZDA 4GMJA 4Y6WA 5G04J 4L2LA 4N3BA 4GA0A 4C0MA 4WWNA 4AV7A 4UWHA 4YNDA 2XRZA 3SBSA 4URKA 4J8EA 3SF4A 3Q15A 3OAWA 3MCXA 3SBTB 3BG1B 1JPLA 2WXMA 3LS8A 4GZ3A 1JWGA 2KCVA 1H6KA 4FC8A 2X6JA 5CHEE 4FHJA 3U9WA 1H2VC 2A5UA 3SGHA 4HLEA 4CDRA 3RIBA 1Y6IA 3CVPA 1GW6A 2X3MA 4I6JA 3JQ1A 3VLDA 4MKTA 4GYYA 1HS6A 4A55A 3T5XA 5M72A 2WQ7A 3S7BA 2KC7A 3FUEA 2OV8A 2PM7A 1OWNA 3CVNA 3EHNA 2L0TB 4JEHA 2UY1B 4WNDA 4HVBA 2WXOA 4RG9A 3JCKC 4N2SA 1WAO1 4U0SA 4UWFA 2WMOA 3RJVA 4JA9A 3O4ZA 4LERA 2MHKA 3L16A 4WNEA 3ZW3A 5JHAA 4BWRA 2BUGA 3G2WA 3G2TA 4DLQA 4N2QA 1NA3A 3LY7A 2P58C 2I2OA 3FU3A 4I1OB 2E0IA 4R7LA 4DI4A 3KS2A 2HO1A 3QOUA 3QK0A 5G04C 3FUHA 2YINA 2VGXB 3DPDA 3CVLA 2XPZA 3CEQA 5C1DA 4FP7A 1OWLA 3CSFA 4FJYA 1NP7A 2PQRA 1ELKA 5FT9A 4BY6A 4F53A 3EDTB 4OVUA 2XQ0A 2BTDA 4N5CA 4I1AA 3UT7A 3IHYA 5EKQD 4BTAA 2JEKA 1OWOA 3FU6A 3IEGA 4GMLA 1EPUA 4HORA 3GYZA 1TJFA 4I1MA 3KEZA 1HX8A 4DPRA 2Q7FA 4G24A 5J90A 1PAQA 3CVUA 4WNFA 3GZSA 3D9KA 4G2VA 4MRUA 4KXKB 1MHQA 3AS8A 1ZU2A 4YVQC 2UY1A 2NSZA 1IHGA 2CG3A 4ILHB 5BW8C 4PUCA 1A17A 2FF4A 3E4BA 4UWGA 3QC1A 4B89A 3Q47B 3ASDA 3ONKA 2YNQA 1W3BA 4GA2A 1Z6TA 4XE0A 1UW4B 2XGSA 3PNTB 2VSNA 3CHSA 3LCAA 4EZLA 3T8MA 3RO2A 2VSOE 3TJPA 4Q94A 3FH7A 2XPIA 3ZYLA 3NQPA 3MGBA 3UPVA 4PDXA 2VGXA 4E6HA 5ARGA 4F7AA 1SZ9A 2DBAA 3UT4A 4DJAA 4QFVA 4ATGA 4U0UA 3FTUA 5BV1A 2FULA 4G26A 2HR2A 4CDNA 4JHKA 1U3DA 4FADA 3VTYA 2AXZA 3FFLA 1H0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AY5 A;  3TG5 A;  4AIF A;  3URZ A;  3KD7 A;  3CVQ A;  3PE4 A;  3MV2 B;  2PQN A;  3OXL A;  4UI9 J;  3MKR A;  2IF4 A;  2UWJ G;  4H7X A;  3TGO A;  4I9E A;  2E2E A;  2Y4U A;  5KJM A;  2C2L A;  4GZ6 A;  1HH8 A;  3R9A B;  5G05 J;  1ELR A;  5A6C A;  4KYO B;  5CCM A;  4N3C A;  4NRH B;  5A7D B;  2V5F A;  3ZN3 A;  5BT1 A;  2XCB A;  1QZ2 A;  3TAX A;  3CK9 A;  1FCH A;  1ZBP A;  5EX0 A;  5JJT A;  1WM5 A;  3RU0 A;  3OXF A;  4I9C A;  3QWV A;  1XNF A;  1KLX A;  3ASG A;  4I17 A;  1YA0 A;  4GYO A;  3LKU A;  5KJN A;  3PDN A;  5G05 C;  4UQZ A;  2XGM A;  5FZR A;  4IN3 B;  3ASF A;  4WNG A;  4HOS A;  3UUX A;  1KT0 A;  4GCO A;  2Y4T A;  2VQ2 A;  5D0O D;  4UQX A;  3PE3 A;  1ELW A;  4BT8 A;  4JA7 A;  4J8D A;  1KT1 A;  3GZ2 A;  1PC2 A;  2AVP A;  3QDN A;  5FZS A;  2LNI A;  1HXI A;  4U04 A;  2XGO A;  3LYA A;  2XEV A;  2IFU A;  4H7Y A;  4AY6 A;  4RG6 A;  2LSV A;  3FWV A;  2R5S A;  4KBQ A;  5EX3 A;  4GCN A;  3HYM B;  3ZHE A;  2NC9 A;  3AS4 A;  4UI9 K;  5JJ6 A;  3ZGQ A;  4YVO A;  5JJ7 A;  3AS5 A;  5DBK A;  3CK8 A;  3Q49 B;  3VTX A;  2WPV A;  3GW4 A;  3S7D A;  3Q4A B;  4JHR A;  4J8F A;  3ASH A;  4ABN A;  3O48 A;  3MA5 A;  4APO A;  1TJC A;  2C0M A;  3BEE A;  5DIZ A;  2FO7 A;  4B94 A;  4WUY A;  3LY8 A;  4J0U A;  3S7J A;  2JLB A;  4UI9 C;  2WQH A;  2HYZ A;  4G25 A;  4O6F A;  4ME2 A;  3K9I A;  2KAT A;  4NQ0 A;  4I2W A;  3OXG A;  4W9R A;  4G1T A;  4A1S A;  2QFC A;  3MEK A;  1P5Q A;  5D0Q D;  5FJY A;  3UQ3 A;  2L6J A;  2FEZ A;  3FP3 A;  3MV3 B;  2C0L A;  5LCW J;  2FBN A;  3CKB A;  1NA0 A;  3QKY A;  2KCL A;  2KCK A;  3ZHE B;  2I6H A;  4N39 A;  3ZPJ A;  1NZN A;  3NF1 A;  4U07 A;  2VGY A;  4F3V A;  4N3A A;  3CKC A;  3KAE A;  5CCL A;  3SZ7 A;  4HOQ A;  3TG4 A;  3N71 A;  4GZ5 A;  1OUV A;  5KJK A;  5HI7 A;  3S7F A;  4XI9 A;  4AM9 A;  4XI0 A;  4GA1 A;  3CV0 A;  4CGW A;  2PL2 A;  4Y6C A;  3JYS A;  5LCW C;  5KJL A;  4EQF A;  3CK7 A;  5ARF A;  3ZFW A;  3QWW A;  3Q5M A;  4GPK A;  1IYG A;  2VSY A;  4JL0 A;  3GZ1 A;  3ULQ A;  4HOU A;  3ESK A;  4U0Z A;  2VYI A;  2GW1 A;  1QQE A;  2YQ8 A;  1Y8M A;  3QWP A;  4CGV A;  4GYW A;  2LSU A;  5BNW A;  1HZ4 A;  4HOT A;  2J9Q A;  2OOE A;  2PZI A;  3U3W A;  3LY9 A;  5AYW D;  4UQY A;  3U4T A;  2XCC A;  2YHC A;  4I2Z A;  3RKV A;  3RO3 A;  3WXX A;  1B89 A;  5FZQ A;  4BT9 A;  4G23 A;  2FI7 A;  5HQ8 A;  2OND A;  5FTP A;  3LPZ A;  1E96 B;  4LEU A;  4XIF A;  4BTB A;  4Y6W A;  5G04 J;  4N3B A;  4GA0 A;  4YND A;  4J8E A;  3SF4 A;  3Q15 A;  4GZ3 A;  5CHE E;  2KCV A;  4CDR A;  3RIB A;  3CVP A;  4GYY A;  5M72 A;  3S7B A;  2KC7 A;  3CVN A;  2UY1 B;  4WND A;  4RG9 A;  4N2S A;  1WAO 1;  4U0S A;  3RJV A;  4JA9 A;  2MHK A;  4WNE A;  4BWR A;  2BUG A;  4N2Q A;  1NA3 A;  3LY7 A;  2P58 C;  3KS2 A;  2HO1 A;  3QOU A;  5G04 C;  2VGX B;  3CVL A;  3CEQ A;  5C1D A;  5FT9 A;  2PQR A;  3EDT B;  4N5C A;  4I1A A;  5EKQ D;  4BTA A;  3IEG A;  4HOR A;  3GYZ A;  2Q7F A;  4G24 A;  4WNF A;  4G2V A;  4KXK B;  3AS8 A;  1ZU2 A;  4YVQ C;  2UY1 A;  1IHG A;  5BW8 C;  1A17 A;  2FF4 A;  3E4B A;  3Q47 B;  3ASD A;  1W3B A;  4GA2 A;  2XGS A;  2VSN A;  3LCA A;  3RO2 A;  2XPI A;  3UPV A;  2VGX A;  5ARG A;  2DBA A;  4U0U A;  4G26 A;  2HR2 A;  3VTY A;  3FFL A; 
#chains in the Genus database with same CATH topology
 2XRY A;  2CHW A;  5ANR A;  3TG5 A;  1UG3 A;  1OY3 D;  5E76 A;  4DI3 A;  3HIZ A;  3C72 A;  3OXL A;  4UI9 J;  3R7Q A;  2CFU A;  3CGH A;  3ONL A;  4FU3 A;  4NAC A;  5T4Y A;  3Q9U C;  5G55 A;  3SNX A;  2Y4U A;  2GRO B;  2OEW A;  5KJM A;  3I5P A;  3I3N A;  4OVV A;  3VLE A;  2DZO A;  5EYL A;  5BV0 A;  4EEC A;  5G05 J;  3PRE A;  5AJD A;  4B0Z A;  4DX2 A;  3HHM A;  2V5F A;  2DIW A;  4DX5 D;  2IO3 C;  3IKO B;  5BT1 A;  3MZL B;  4TV3 A;  4JB8 P;  3UT8 A;  3RRM B;  1E7U A;  4PS3 A;  1FCH A;  1ZBP A;  4RLY A;  1JCR A;  3I4G A;  1WM5 A;  3RU0 A;  3OXF A;  1V54 E;  3FTW A;  4GTO A;  4D10 C;  4I17 A;  4GYO A;  4JC8 A;  3EIQ C;  4HFG A;  1LF8 A;  3CHP A;  2OEV A;  4UQZ A;  4V3I A;  1E8Y A;  4IN3 B;  3ASF A;  4JW1 A;  4DK5 A;  4HOS A;  4HQD A;  1HG5 A;  4UQX A;  2IJG X;  4BT8 A;  3ASO E;  2VTB B;  4ILG A;  2LNI A;  2H6I A;  2F8X K;  4FJZ A;  1HXI A;  4AXH A;  3ENE A;  3SQV A;  2FO1 E;  3FUN A;  2WXH A;  2I9C A;  2IFU A;  4H7Y A;  4L1B A;  3B13 A;  3B7R L;  1TN6 A;  3L17 A;  1KPS B;  4C0E A;  1TNY A;  5EX3 A;  3LVR E;  3HYM B;  4G11 A;  4A63 B;  3RRU A;  2NC9 A;  3AS4 A;  4ANU A;  4C9B B;  5JJ6 A;  2QYU A;  3B7T A;  4YVO A;  3CK8 A;  4BX8 A;  4EBA G;  4ANV A;  4LCT A;  2IOL A;  1MX2 A;  1BD8 A;  5LOZ A;  3GW4 A;  4JZY A;  3S7D A;  3S2A A;  5G2N A;  1INZ A;  3NZU A;  4WWP A;  3ZYK A;  3HDX A;  3T8K A;  3ASH A;  5AQB A;  5KWD A;  3Q75 A;  2IU1 A;  4CDM A;  5DIZ A;  1N4P A;  1FT2 A;  2FO7 A;  4B94 A;  3ESL A;  3WG7 E;  3EHR A;  4J0U A;  1O1T A;  3PH0 C;  5ENQ D;  2GRL A;  3SO8 A;  4G25 A;  1OWM A;  5HS0 A;  3RSE G;  2KAT A;  4XX5 A;  4W9R A;  1IHB A;  2LXM A;  4EPZ A;  4F1P A;  4A3T A;  3RRN B;  3MEK A;  3UQ3 A;  4FHK A;  2XEN A;  4LSZ E;  5T3R A;  4K5B A;  2J08 A;  5JA4 D;  2RD0 A;  1X5B A;  3DXM G;  5KNG A;  1HFA A;  2FBN A;  4LNU D;  2WXJ A;  3QKY A;  2KCL A;  4K0R A;  4ACL A;  3ZHE B;  3ZNG A;  4JEU A;  4HI8 A;  1N4Q A;  2EIL E;  2NYJ A;  4A3V A;  1H19 A;  4F3V A;  2WM9 A;  3CKC A;  4APF A;  5CCL A;  3MKQ B;  3CVV A;  4L9P A;  5J08 A;  4FLH A;  5HI7 A;  3D9J A;  2R17 C;  3CV0 A;  3D9O A;  3MX3 A;  1AWC B;  1DCQ A;  2PL2 A;  1Z3X A;  1UOH A;  3TWS A;  5LX8 A;  2VSX E;  5C2Y A;  3ZFW A;  5ARF A;  3L6A A;  5A23 A;  3D3M A;  5EN5 D;  3AG2 E;  3ESK A;  4GTP A;  3PUK A;  3QWP A;  1LD7 A;  4RSY A;  4MBG A;  1Q2Z A;  4G8L A;  3V2O A;  2WXR A;  1HZ4 A;  3G2U A;  2F8Y A;  4FA6 A;  3CR3 A;  5CMY A;  3RO3 A;  1S70 B;  1NFI E;  5LFA A;  1BU9 A;  2X6H A;  2Y1L E;  4EZK A;  4Z68 A;  5HQ8 A;  4L7T A;  1TNB A;  3Q7F A;  1E96 B;  4BTB A;  4Y6W A;  4L2L A;  4WWN A;  4AV7 A;  4HRN A;  3UI2 A;  2XZD G;  1KZP A;  2XRZ A;  4J8E A;  5JHA A;  3LS8 A;  1N11 A;  2X6J A;  4FHJ A;  2A5U A;  1OXJ A;  4I6J A;  1JCS A;  4GYY A;  3T5X A;  2DWZ A;  2F37 A;  3DEO A;  4WND A;  4U0S A;  2WMO A;  3L9T A;  3B95 A;  3J5Q B;  3ZU7 B;  2BUG A;  4DLQ A;  2I2O A;  3FU3 A;  5G04 C;  2YIN A;  3HXC A;  3CVL A;  3CEQ A;  4FP7 A;  4O1O A;  4F53 A;  2IEJ A;  3EDT B;  2BTD A;  3UT7 A;  5EKQ D;  3FU6 A;  3C5R A;  4HOR A;  3DSS A;  2MYO A;  1TJF A;  4I1M A;  3UKR G;  1HX8 A;  4DPR A;  2Q7F A;  3CVU A;  4WNF A;  1MHQ A;  3NOC D;  1IXV A;  3BU8 A;  5BXU A;  2CG3 A;  3UM3 A;  4PUC A;  1A17 A;  3ONK A;  1W3B A;  4GA2 A;  3PNT B;  5JMN D;  3LCA A;  1DCE A;  2XPI A;  3NQP A;  3MGB A;  2VGX A;  3EU9 A;  4DJA A;  2DBA A;  3DSW A;  4U0U A;  2FUL A;  3PS6 A;  3KSQ A;  4AY5 A;  3FUM A;  3HVE B;  4AIF A;  3ABK E;  4HI9 A;  3KD7 A;  3CVQ A;  1EYH A;  2AJA A;  3ISM C;  2IF4 A;  2VTB A;  3TGO A;  4I9E A;  3C3R A;  4MLP A;  3D9I A;  3HRA A;  3E32 A;  4IYP A;  3ABL E;  1IKN D;  2C2L A;  5BPP A;  4HXI A;  1DNP A;  2I1K A;  4GZ6 A;  1HH8 A;  1XGW A;  3EU5 A;  4CZ2 D;  2CHZ A;  5CCM A;  5A7D B;  4HBD A;  4OAV B;  2ILR A;  3B7B A;  4JVS A;  1E90 A;  1TR4 A;  4U7E B;  5EX0 A;  4HRL A;  3VLF A;  3FUJ A;  2X6K A;  3CVX A;  3AU5 A;  1KLX A;  2L9B A;  4GZC A;  2OVB A;  2J4D A;  2A5E A;  2Y3A A;  3L08 A;  2I1J A;  3PZ1 A;  4F1S A;  3C3O A;  4GCO A;  3PVL A;  2H6G A;  4U95 D;  1WY6 A;  3TXN A;  4BEP A;  1PC2 A;  4DLO A;  3TWU A;  5FZS A;  2V8S E;  5B1B E;  2IQC A;  4L2Y A;  4AJW A;  3QJZ A;  1LD8 A;  2L6B A;  4TUU A;  1YCS B;  3PEU B;  2XGO A;  4CRW A;  2XEV A;  2R59 A;  3C98 A;  1E8W A;  4PS7 A;  3P1U A;  4AY6 A;  4RG6 A;  2P9U G;  3ZKJ A;  5HKP A;  4NIK A;  3AU4 A;  2ZXW E;  4GCN A;  4KZ0 A;  1EDU A;  3ZHE A;  4I6G A;  3NAW A;  1MZC A;  1TNO A;  4I6E A;  3ABM E;  3FUL A;  1O1S A;  4WAF A;  5JJ7 A;  3HXE A;  3Q49 B;  3VTX A;  1DVP A;  3ZXP A;  1E7V A;  2L0I A;  5FQ7 A;  4JHR A;  3E30 A;  3EJN A;  2X6F A;  4KT6 B;  3J5P A;  4GU5 A;  2WXL A;  3FUD A;  4Q96 A;  4CT0 A;  1BI7 B;  3CLJ A;  1H6O A;  2MRI A;  3ML9 A;  3ZIM A;  1FT1 A;  5ENN A;  4A1G A;  4U8H A;  2JLB A;  4EHM A;  2XZT G;  2IY0 C;  2WXG A;  3IBE A;  4KZC A;  4TUM A;  3ZVV A;  1FVH A;  4UWK A;  3HG0 D;  2V0P A;  2V4L A;  3K9I A;  1E8X A;  3L54 A;  1N52 A;  4ACK A;  2GGF A;  4TXP A;  1N9A A;  3ZEF A;  1HE8 A;  4J6I A;  1OWP A;  2H6F A;  3JXI A;  3NZS A;  5D0Q D;  1PY1 A;  2FEZ A;  3CHO A;  2C0L A;  5LCW J;  2WVI A;  4AEZ C;  5KNH D;  3CKB A;  4M3O A;  2P9K G;  3G2V A;  2KBX A;  2ETA A;  2ETC A;  1NZN A;  2VGY A;  4N3A A;  5AQ9 A;  2WQ6 A;  4HOQ A;  4GZ5 A;  5KJK A;  3B7S A;  3S7F A;  4BX9 A;  3FU5 A;  4TRQ A;  3EHM A;  4CCA A;  3IXE A;  5KJL A;  2KZT A;  3QWW A;  3Q5M A;  4GPK A;  1S63 A;  2Y0B G;  1SW6 A;  1OCZ E;  4HOU A;  4U0Z A;  1QQE A;  1Y8M A;  1BPO A;  3UXG A;  4GYW A;  4BES A;  3TL5 A;  1H6P A;  5CRV A;  4N5Q A;  2OOE A;  2PZI A;  3U3W A;  3LY9 A;  4UQY A;  4KMO A;  3U4T A;  4QQI A;  3RKV A;  1K8K G;  3ML8 A;  2VJ8 A;  2QY7 A;  4JXT A;  3PEV B;  3HXD A;  2ETB A;  3E34 A;  4C0M A;  2J8S D;  4URK A;  3Q15 A;  2GRN B;  3MCX A;  3SBT B;  1JPL A;  5CHE E;  1JWG A;  3U9W A;  1H6K A;  4BSZ B;  5EYP F;  1H2V C;  3SGH A;  2X3M A;  2RFM A;  4MKT A;  2Y69 E;  1HS6 A;  4A55 A;  5M72 A;  2WQ7 A;  3FUE A;  3CVN A;  3EHN A;  3RAU A;  2P9N G;  2UY1 B;  1TNU A;  4RG9 A;  2H6H A;  5AN8 A;  3HXB A;  4U8Y D;  4JA9 A;  4LER A;  1O1R A;  4N2Q A;  3G2T A;  3LY7 A;  1SA4 A;  3ULY A;  4DI4 A;  3KS2 A;  3QK0 A;  3C3Q A;  3FUH A;  3T9K A;  4X8Q A;  1OWL A;  4N5C A;  1MX6 A;  4DX7 D;  4BTA A;  1WG0 A;  2B6C A;  3TWT A;  3L82 A;  1TNZ A;  5J90 A;  4KXK B;  3AS8 A;  4YVQ C;  5BW8 C;  4C48 B;  3E4B A;  3ASD A;  4GMR A;  4XE0 A;  2XGS A;  3ULE G;  3CHS A;  4GTM A;  4EZL A;  3T8M A;  3ZYL A;  3UPV A;  3UT4 A;  4QFV A;  4UUC A;  3FTU A;  1SA5 A;  3FFL A;  1H0A A;  1HF8 A;  3EHQ A;  2DZN A;  3DXK G;  2PQN A;  1Z5S C;  2NXP A;  4L23 A;  4JPS A;  5FQ4 A;  2UWJ G;  3ZUV B;  5KBA A;  4RQI A;  5ENO D;  4XKB A;  2X6I A;  3FUI A;  4K5C A;  2X38 A;  3SFY A;  2V5Q C;  1ELR A;  5A6C A;  3TWW A;  5AIJ A;  4KYO B;  1IQR A;  3UM0 A;  5LP0 A;  4IRU A;  2AXU A;  3BUA A;  4HS2 A;  3TAX A;  5JJT A;  2WXI A;  4I9C A;  1D8D A;  3LEW A;  5AJL A;  3FU0 A;  2KM4 A;  3MJW A;  3ASG A;  2IOS A;  3LKU A;  5KJN A;  1TYQ G;  3PDN A;  3SHF A;  2PM6 A;  5G05 C;  4JD2 G;  4J8Y A;  1Z3Y A;  1S64 A;  1A5E A;  2AWI A;  2Y4T A;  2VQ2 A;  5D0O D;  1FVF A;  2WXF A;  3PE3 A;  5AQA A;  1ELW A;  4EBA A;  3JQ0 A;  4K03 A;  4JA7 A;  3UM1 A;  4J8D A;  3GZ2 A;  4HNA D;  3QDN A;  1OCO E;  3FTX A;  2BKK B;  1L5J A;  1MYO A;  3JUI A;  2XEE A;  3PZ2 A;  4U04 A;  2ZIR A;  3NB2 A;  2HE0 A;  1LTX A;  4XKC A;  2P2C P;  3Q78 A;  1YMP A;  2CHX A;  2CFZ A;  3FY4 A;  5HRY A;  3FTZ A;  2BF0 X;  2R5S A;  2DYR E;  3FUF A;  4ILI A;  3R7R A;  1HU3 A;  3SFZ A;  4UI9 K;  2P9I G;  3V2X A;  3TXM A;  4U63 A;  3IV0 A;  3HXF A;  3CHR A;  3ZGQ A;  1N0Q A;  2A4Z A;  3AS5 A;  2AXV A;  5DBK A;  2WXP A;  3DSX A;  5AAO A;  1JUQ A;  2WMN A;  3ZRH A;  3B7U X;  1X81 A;  1N94 A;  2DVW A;  2J49 A;  3Q4A B;  3W9F A;  5FWQ A;  2P9P G;  5FQ6 A;  3L22 A;  3P2B A;  3UX4 A;  4ABN A;  4FLB A;  4ANW A;  3MA5 A;  4APO A;  2C0M A;  3TWQ A;  4E85 A;  3BEE A;  1RW2 A;  3LY8 A;  3D9P A;  3DBS A;  1VDY A;  1KZO A;  1HO8 A;  4J8S A;  4BFR A;  4O6F A;  3Q73 A;  4RVB A;  1HG2 A;  4NQ0 A;  2EIJ E;  3D9N A;  3CQC B;  3Q7A A;  5ENT D;  4CT4 A;  2LAI A;  3CHM A;  4G1T A;  2BKG A;  4GAA A;  3D9H A;  2XEH A;  5CBN A;  1D9S A;  4A1S A;  2QFC A;  2F0Y A;  1P5Q A;  3FP3 A;  3MV3 B;  5IY5 E;  4I43 A;  2GRR B;  1H2U A;  3LDZ A;  1K1A A;  5CEA A;  1BI8 B;  4FUL A;  1IQU A;  1NA0 A;  4GTT A;  3UTM A;  2EIN E;  2I6H A;  4U8V D;  4N39 A;  3NF1 A;  5EIL A;  4U07 A;  5AEN A;  2EIM E;  1D8E A;  5CRU A;  3UIO C;  3DSV A;  3SI5 A;  3DRA A;  3KAE A;  2KXP C;  1E8Z A;  3TG4 A;  1OUV A;  3CIA A;  3FUK A;  1G3N B;  3Q9N C;  2WXN A;  4AOF A;  3AG1 E;  4AM9 A;  3V31 A;  5H7P A;  2LO6 A;  5CBO A;  4GTS A;  5ENP D;  4Y6C A;  3JYS A;  3TWX A;  4EQF A;  4KVM A;  3U66 A;  5BUZ A;  3ZYQ A;  4AVX A;  4JL0 A;  3GZ1 A;  3CVY A;  3D9L A;  3ULQ A;  1N4S A;  3TWV A;  1H2T C;  2RKK A;  2VYI A;  3F6Q A;  3T5V A;  4CGV A;  4EZJ A;  5EDS A;  3KSL A;  1SQM A;  4AP2 A;  2M63 A;  5BNW A;  4PS8 A;  1UJJ A;  3MKQ A;  3UIP C;  2XCC A;  4I2Z A;  5ITZ F;  4LRZ A;  5CMW A;  1YYH A;  3IHV A;  2BED A;  3RK6 A;  3FTY A;  3PUJ A;  4ATZ D;  1UN9 A;  2OND A;  3ZYM A;  5FTP A;  4LEU A;  4XIF A;  3PZD A;  4GMJ A;  1O5M A;  5G04 J;  4N3B A;  4GA0 A;  1TN8 A;  4YND A;  3SBS A;  1OT8 A;  3SF4 A;  1QBQ A;  1BLX B;  3BG1 B;  2KCV A;  4CDR A;  3RIB A;  1Y6I A;  3CVP A;  4F6R D;  2KC7 A;  2OV8 A;  1OWN A;  2QYJ A;  2L0T B;  4JEH A;  4HVB A;  2WXO A;  4N2S A;  1WAO 1;  3RJV A;  3O4Z A;  3L16 A;  4WNE A;  3ZW3 A;  4BWR A;  4G8K A;  2E0I A;  1MJ0 A;  2HO1 A;  2P9S G;  3QOU A;  2VGX B;  1JCQ A;  4J7W A;  1NP7 A;  5FT9 A;  1ELK A;  5B3S E;  4BY6 A;  4OVU A;  2XQ0 A;  4O60 A;  5EID A;  3TWR A;  1PAQ A;  3GZS A;  4MRU A;  1ZU2 A;  2NSZ A;  1IHG A;  4ILH B;  1SVX A;  4UWG A;  3QC1 A;  3Q47 B;  2YNQ A;  1Z6T A;  2VSN A;  3RO2 A;  4ZHB A;  2VSO E;  3FH7 A;  5CER B;  2RFA A;  4PDX A;  5FIN A;  4E6H A;  1SZ9 A;  1OCR E;  5BV1 A;  4JHK A;  4FAD A;  3VTY A;  5FIO A;  2AXZ A;  1WDY A;  4Q69 A;  3URZ A;  4K5A B;  3PE4 A;  3MV2 B;  3MKR A;  3APD A;  5AAR A;  4H7X A;  2AW6 A;  2DCP A;  2E2E A;  3DEP A;  3E37 A;  1SZA A;  2B0O E;  5AQ7 A;  1U2V G;  4TXQ A;  4OYS A;  3R9A B;  3R9M A;  1UN8 A;  1RZ4 A;  1U3C A;  2IO2 C;  3UMV A;  2J4B A;  4N3C A;  4NRH B;  5E75 A;  3QB2 A;  4PH4 B;  2XHE A;  3ZN3 A;  3FHE A;  3SFX A;  3UKU G;  3HVE A;  3ASN E;  4IUL A;  4YDW A;  2XCB A;  3BG0 B;  5D66 A;  4BSX A;  4KVO A;  5EIB E;  1QZ2 A;  3QAR A;  3CK9 A;  1S0P A;  2OVF A;  5ANL A;  1TEZ A;  1N95 A;  3FH5 A;  4XEI G;  1K1B A;  3E33 A;  3QWV A;  4HLL A;  1XNF A;  1OCC E;  4OAU C;  3UM2 A;  2ION A;  3DWL G;  1YA0 A;  3EIJ A;  2R03 A;  2ZU6 B;  2EIK E;  5CEC B;  2QC9 A;  2XGM A;  5FZR A;  3L13 A;  2LAH A;  2JAB A;  3APC A;  1MQS A;  1NL4 A;  4WNG A;  3UUX A;  1KT0 A;  4CYM D;  3FEY A;  4B93 B;  1TN7 A;  4GPM A;  2WB2 A;  1KT1 A;  3CVW A;  2AVP A;  2YHE A;  2EQX A;  5JHB A;  4BER A;  2QZA A;  2J09 A;  3LYA A;  4GB9 A;  3UIN C;  3I4R B;  2MOW A;  3G2S A;  2R05 A;  4CEM A;  3FTV A;  3PNL B;  2R02 A;  2LSV A;  3FWV A;  4KBQ A;  1FPP A;  3BQO A;  2XPY A;  4GZD A;  4MS6 A;  1QNF A;  3PZ4 A;  2XS8 A;  2WPV A;  2HM8 A;  3FEX A;  1N0R A;  3APF A;  1MX4 A;  3NBN B;  1AP7 A;  5KCM A;  4J8F A;  2PNN A;  2ZGD A;  4DX1 A;  4HB5 A;  2RG8 A;  3O48 A;  4B8C B;  3FTS A;  1TJC A;  2GRQ B;  3LJ3 A;  3CQG B;  3FH8 A;  4ANX A;  2P9L G;  4WUY A;  5ENS D;  3S7J A;  4UI9 C;  2WQH A;  2HYZ A;  4XZ4 A;  4WWO A;  5FQ8 A;  4ME2 A;  2OCC E;  3SY2 A;  4I2W A;  4GTQ A;  3OXG A;  2WXK A;  4GTR A;  4B8A A;  4JHJ A;  3MYV A;  2XS1 A;  5FJY A;  3LVQ E;  2L6J A;  2KZT B;  2R2L A;  1NI1 A;  5BXO A;  2GRP B;  2KCK A;  2WXQ A;  3OTN A;  3ZPJ A;  1QYM A;  3CHQ A;  2LUH A;  5T8I A;  3AG3 E;  3EUV A;  3QNK A;  3LJN A;  3SZ7 A;  4UWL A;  3N71 A;  4U96 D;  4LNG A;  4XI9 A;  4XI0 A;  4GA1 A;  4CGW A;  3FDH A;  3CST A;  4GTV A;  3X2Q E;  1ZB1 A;  2DYS E;  3SD5 A;  5LCW C;  3Q79 A;  4HRM B;  3CK7 A;  4ZFH A;  2CG2 A;  1EF1 C;  1IYG A;  3DST A;  2VSY A;  3AJI A;  4BET A;  5D2M C;  5B1A E;  2GW1 A;  2YQ8 A;  3NOG D;  1N4R A;  2LSU A;  5ENR D;  1JWF A;  4YDE A;  2ZIS A;  1UJK A;  3QAQ A;  4HOT A;  2J9Q A;  3DSU A;  3D9M A;  3PRZ A;  2GRM A;  5AYW D;  2J07 A;  2YHC A;  2VGE A;  3PZ3 A;  3LXU X;  1N54 A;  3WXX A;  4DUI A;  3JXJ A;  4NUR A;  1B89 A;  4LUN U;  3U64 A;  5FZQ A;  4BT9 A;  4G23 A;  4DX6 D;  2FI7 A;  4P29 A;  2LXL A;  3LPZ A;  4O1P A;  4UWH A;  3OAW A;  2WXM A;  3ZXS A;  4GZ3 A;  4FC8 A;  3AAA C;  4HLE A;  3VLD A;  1GW6 A;  3JQ1 A;  3KEA A;  3S7B A;  2PM7 A;  3AG4 E;  4DRX E;  3JUE A;  3JCK C;  4UWF A;  2MHK A;  3G2W A;  4LNB A;  1NA3 A;  4TXR A;  2P58 C;  1K3Z D;  2V4H C;  4I1O B;  3V79 K;  4R7L A;  3DPD A;  5C1D A;  2XPZ A;  3CSF A;  4FJY A;  2PQR A;  4I1A A;  3IHY A;  2JEK A;  1OWO A;  3IEG A;  4GML A;  1EPU A;  3GYZ A;  1V55 E;  4YDO A;  4M7C A;  3KEZ A;  4G24 A;  4G2V A;  3D9K A;  2UY1 A;  5CED B;  2ZGG A;  2FF4 A;  4B89 A;  3DPY A;  1DC2 A;  1UW4 B;  3TJP A;  4Q94 A;  4LG6 A;  3V30 A;  5ARG A;  4F7A A;  4YDY A;  3W9G A;  4ATG A;  4G26 A;  4CDN A;  2HR2 A;  1U3D A; 
#chains in the Genus database with same CATH homology
 3PS6 A;  4Q69 A;  4AY5 A;  2XRY A;  1HF8 A;  2CHW A;  3FUM A;  5ANR A;  3TG5 A;  3HVE B;  1UG3 A;  4AIF A;  3URZ A;  5E76 A;  4DI3 A;  3KD7 A;  3HIZ A;  3CVQ A;  1EYH A;  3PE4 A;  3MV2 B;  2PQN A;  3OXL A;  4UI9 J;  3R7Q A;  2CFU A;  3MKR A;  3CGH A;  3ONL A;  4FU3 A;  2IF4 A;  2NXP A;  4NAC A;  4L23 A;  3APD A;  4JPS A;  2VTB A;  5FQ4 A;  2UWJ G;  4H7X A;  3TGO A;  4I9E A;  2AW6 A;  2DCP A;  4MLP A;  2E2E A;  3D9I A;  5G55 A;  5T4Y A;  3SNX A;  4IYP A;  2Y4U A;  5KJM A;  3I5P A;  1SZA A;  2C2L A;  3I3N A;  4XKB A;  2X6I A;  5BPP A;  4OVV A;  3VLE A;  4HXI A;  1DNP A;  2I1K A;  4GZ6 A;  1HH8 A;  4OYS A;  1XGW A;  3FUI A;  3R9A B;  1UN8 A;  2X38 A;  5BV0 A;  4EEC A;  5G05 J;  1ELR A;  3PRE A;  1U3C A;  5A6C A;  5AJD A;  2CHZ A;  4B0Z A;  5AIJ A;  4KYO B;  3UMV A;  2J4B A;  4N3C A;  5CCM A;  1IQR A;  4NRH B;  5E75 A;  5A7D B;  3QB2 A;  4PH4 B;  2XHE A;  3HHM A;  2V5F A;  3ZN3 A;  2ILR A;  3FHE A;  4IRU A;  5LP0 A;  2DIW A;  4JVS A;  2AXU A;  3IKO B;  3HVE A;  5BT1 A;  3MZL B;  4IUL A;  1E90 A;  2XCB A;  4TV3 A;  3BG0 B;  3UT8 A;  4KVO A;  4BSX A;  3RRM B;  4HS2 A;  1QZ2 A;  1E7U A;  3QAR A;  3TAX A;  3CK9 A;  1S0P A;  2OVF A;  4PS3 A;  1FCH A;  5ANL A;  1ZBP A;  5EX0 A;  1TEZ A;  5JJT A;  3FH5 A;  2WXI A;  3I4G A;  1WM5 A;  3RU0 A;  3OXF A;  3VLF A;  4I9C A;  3FUJ A;  3LEW A;  3FTW A;  5AJL A;  2X6K A;  3QWV A;  3CVX A;  1XNF A;  4D10 C;  3AU5 A;  3FU0 A;  1KLX A;  2KM4 A;  3MJW A;  2ION A;  2IOS A;  3ASG A;  1YA0 A;  4GYO A;  3LKU A;  4I17 A;  3EIJ A;  4JC8 A;  3EIQ C;  5KJN A;  4HFG A;  2L9B A;  3PDN A;  2ZU6 B;  4GZC A;  3SHF A;  1LF8 A;  2PM6 A;  5G05 C;  3CHP A;  4UQZ A;  1Z3Y A;  2OVB A;  2XGM A;  4V3I A;  1E8Y A;  3L13 A;  5FZR A;  2J4D A;  4IN3 B;  2LAH A;  2Y3A A;  3APC A;  3ASF A;  3L08 A;  4JW1 A;  2I1J A;  4DK5 A;  1MQS A;  4WNG A;  4F1S A;  4HOS A;  3UUX A;  1KT0 A;  4GCO A;  2AWI A;  2Y4T A;  3PVL A;  1HG5 A;  2VQ2 A;  5D0O D;  1FVF A;  1WY6 A;  3TXN A;  2WXF A;  3FEY A;  4UQX A;  2IJG X;  3PE3 A;  1ELW A;  4EBA A;  4BT8 A;  3JQ0 A;  4K03 A;  4JA7 A;  2WB2 A;  4J8D A;  1KT1 A;  3GZ2 A;  3CVW A;  1PC2 A;  4DLO A;  2AVP A;  2VTB B;  3QDN A;  2YHE A;  4ILG A;  5FZS A;  2LNI A;  2EQX A;  2IQC A;  2V8S E;  4L2Y A;  4AJW A;  3QJZ A;  3FTX A;  5JHB A;  1L5J A;  3JUI A;  4FJZ A;  1HXI A;  4TUU A;  2J09 A;  4U04 A;  3PEU B;  4AXH A;  2XGO A;  4CRW A;  3LYA A;  4GB9 A;  3ENE A;  2XEV A;  2R59 A;  3C98 A;  1E8W A;  3FUN A;  4PS7 A;  3I4R B;  2WXH A;  2MOW A;  4XKC A;  2I9C A;  2IFU A;  3G2S A;  4H7Y A;  3P1U A;  2CHX A;  2CFZ A;  4AY6 A;  4L1B A;  3B13 A;  4RG6 A;  3FY4 A;  3FTZ A;  3B7R L;  4CEM A;  3FTV A;  3PNL B;  2BF0 X;  2LSV A;  3FWV A;  3L17 A;  4C0E A;  3AU4 A;  2R5S A;  4KBQ A;  5EX3 A;  4GCN A;  3LVR E;  3HYM B;  3FUF A;  1EDU A;  4G11 A;  4KZ0 A;  3RRU A;  4ILI A;  2NC9 A;  2XPY A;  3ZHE A;  4GZD A;  3R7R A;  3AS4 A;  4I6G A;  1HU3 A;  4MS6 A;  4UI9 K;  3SFZ A;  4ANU A;  4C9B B;  5JJ6 A;  1QNF A;  4I6E A;  3TXM A;  3B7T A;  4U63 A;  3IV0 A;  3CHR A;  3FUL A;  3ZGQ A;  4WAF A;  4YVO A;  2A4Z A;  3AS5 A;  5JJ7 A;  2AXV A;  5DBK A;  3CK8 A;  2WXP A;  4BX8 A;  3Q49 B;  3VTX A;  4EBA G;  1JUQ A;  2WMN A;  3ZRH A;  1DVP A;  4LCT A;  2IOL A;  3B7U X;  4ANV A;  2WPV A;  2HM8 A;  3FEX A;  3APF A;  5LOZ A;  3GW4 A;  1E7V A;  4JZY A;  2L0I A;  5FQ7 A;  2J49 A;  3S7D A;  3Q4A B;  4JHR A;  5KCM A;  3S2A A;  3EJN A;  4J8F A;  5G2N A;  5FWQ A;  1INZ A;  3NZU A;  2X6F A;  4WWP A;  5FQ6 A;  3ZYK A;  3HDX A;  2RG8 A;  4KT6 B;  3L22 A;  3ASH A;  3P2B A;  3UX4 A;  4ABN A;  4FLB A;  3O48 A;  4B8C B;  4ANW A;  3MA5 A;  4GU5 A;  3FTS A;  2WXL A;  3FUD A;  4APO A;  1TJC A;  3LJ3 A;  2C0M A;  4Q96 A;  4E85 A;  2IU1 A;  3CQG B;  4CT0 A;  4CDM A;  3FH8 A;  3BEE A;  3CLJ A;  5DIZ A;  4ANX A;  2FO7 A;  4B94 A;  3ESL A;  4WUY A;  2MRI A;  3LY8 A;  3D9P A;  3ML9 A;  3DBS A;  4J0U A;  3S7J A;  1VDY A;  3ZIM A;  5ENN A;  4A1G A;  4U8H A;  1HO8 A;  3PH0 C;  2JLB A;  4UI9 C;  2WQH A;  2GRL A;  4J8S A;  2HYZ A;  2WXG A;  3IBE A;  1OWM A;  4G25 A;  4KZC A;  3ZVV A;  4BFR A;  1FVH A;  4UWK A;  4XZ4 A;  4WWO A;  4O6F A;  4ME2 A;  2V0P A;  2V4L A;  4RVB A;  5FQ8 A;  3K9I A;  1E8X A;  3L54 A;  1HG2 A;  2KAT A;  4NQ0 A;  4I2W A;  3OXG A;  1N52 A;  3D9N A;  3CQC B;  2WXK A;  4XX5 A;  4ACK A;  2GGF A;  3ZEF A;  4W9R A;  1HE8 A;  4B8A A;  4JHJ A;  4CT4 A;  2LAI A;  3CHM A;  4J6I A;  4G1T A;  4GAA A;  4EPZ A;  1OWP A;  3MYV A;  4A3T A;  4A1S A;  2QFC A;  3RRN B;  3MEK A;  3NZS A;  1P5Q A;  5D0Q D;  5FJY A;  3LVQ E;  3UQ3 A;  2L6J A;  4FHK A;  1PY1 A;  2FEZ A;  3CHO A;  3FP3 A;  3MV3 B;  2C0L A;  2KZT B;  5T3R A;  4I43 A;  5LCW J;  1H2U A;  2J08 A;  2WVI A;  4AEZ C;  3LDZ A;  2RD0 A;  1X5B A;  1HFA A;  2FBN A;  4FUL A;  3CKB A;  1IQU A;  1NA0 A;  2WXJ A;  3QKY A;  4M3O A;  2KCL A;  2KCK A;  4K0R A;  2WXQ A;  3ZHE B;  4ACL A;  3G2V A;  2I6H A;  3OTN A;  4N39 A;  3ZPJ A;  4JEU A;  1NZN A;  3NF1 A;  4U07 A;  5AEN A;  2VGY A;  4A3V A;  1H19 A;  4F3V A;  4N3A A;  2WM9 A;  3CKC A;  3SI5 A;  4APF A;  3ZXS A;  3CHQ A;  3KAE A;  5T8I A;  5CCL A;  3MKQ B;  3QNK A;  2WQ6 A;  3CVV A;  3SZ7 A;  4HOQ A;  4UWL A;  1E8Z A;  3N71 A;  4GZ5 A;  1OUV A;  3TG4 A;  5J08 A;  5KJK A;  3CIA A;  4FLH A;  5HI7 A;  3FUK A;  3B7S A;  3D9J A;  2R17 C;  3S7F A;  2WXN A;  4BX9 A;  4AOF A;  4XI9 A;  3FU5 A;  4TRQ A;  3EHM A;  4XI0 A;  4AM9 A;  4GA1 A;  3CV0 A;  3D9O A;  3MX3 A;  4CCA A;  2LO6 A;  4CGW A;  3FDH A;  3CST A;  2PL2 A;  1Z3X A;  4Y6C A;  3JYS A;  5LCW C;  3SD5 A;  5KJL A;  5LX8 A;  2KZT A;  2VSX E;  4EQF A;  4KVM A;  5C2Y A;  5BUZ A;  3U66 A;  3CK7 A;  5ARF A;  3ZFW A;  3QWW A;  3Q5M A;  3ZYQ A;  4GPK A;  2CG2 A;  1EF1 C;  1IYG A;  3L6A A;  5A23 A;  2VSY A;  4AVX A;  4JL0 A;  3D3M A;  3GZ1 A;  3CVY A;  3D9L A;  3ULQ A;  1H2T C;  4HOU A;  3ESK A;  4U0Z A;  2VYI A;  2GW1 A;  1QQE A;  2YQ8 A;  1Y8M A;  1BPO A;  3T5V A;  3PUK A;  3QWP A;  4CGV A;  4GYW A;  4RSY A;  3TL5 A;  4EZJ A;  2LSU A;  5EDS A;  1JWF A;  1SQM A;  4AP2 A;  2M63 A;  5BNW A;  2WXR A;  4PS8 A;  1UJK A;  1HZ4 A;  1UJJ A;  3MKQ A;  3QAQ A;  4HOT A;  2J9Q A;  3D9M A;  2OOE A;  2PZI A;  3PRZ A;  3U3W A;  3LY9 A;  2GRM A;  5AYW D;  3G2U A;  2J07 A;  4UQY A;  4FA6 A;  4KMO A;  3U4T A;  2YHC A;  2XCC A;  3CR3 A;  5CMY A;  4I2Z A;  3LXU X;  3RKV A;  3RO3 A;  1N54 A;  3WXX A;  5LFA A;  4NUR A;  3ML8 A;  2VJ8 A;  1B89 A;  4LUN U;  2QY7 A;  3U64 A;  2X6H A;  5FZQ A;  4LRZ A;  4BT9 A;  4G23 A;  2FI7 A;  5CMW A;  4JXT A;  4EZK A;  3IHV A;  3RK6 A;  3PEV B;  3FTY A;  4P29 A;  5HQ8 A;  3PUJ A;  4L7T A;  1UN9 A;  2OND A;  3ZYM A;  5FTP A;  3LPZ A;  1E96 B;  4LEU A;  4XIF A;  4BTB A;  3PZD A;  4GMJ A;  4Y6W A;  5G04 J;  4L2L A;  4N3B A;  4GA0 A;  4C0M A;  4WWN A;  4AV7 A;  4UWH A;  4YND A;  2XRZ A;  3SBS A;  4URK A;  4J8E A;  3SF4 A;  3Q15 A;  3OAW A;  3MCX A;  3SBT B;  3BG1 B;  1JPL A;  2WXM A;  3LS8 A;  4GZ3 A;  1JWG A;  2KCV A;  1H6K A;  4FC8 A;  2X6J A;  5CHE E;  4FHJ A;  3U9W A;  1H2V C;  2A5U A;  3SGH A;  4HLE A;  4CDR A;  3RIB A;  1Y6I A;  3CVP A;  1GW6 A;  2X3M A;  4I6J A;  3JQ1 A;  3VLD A;  4MKT A;  4GYY A;  1HS6 A;  4A55 A;  3T5X A;  5M72 A;  2WQ7 A;  3S7B A;  2KC7 A;  3FUE A;  2OV8 A;  2PM7 A;  1OWN A;  3CVN A;  3EHN A;  2L0T B;  4JEH A;  2UY1 B;  4WND A;  4HVB A;  2WXO A;  4RG9 A;  3JCK C;  4N2S A;  1WAO 1;  4U0S A;  4UWF A;  2WMO A;  3RJV A;  4JA9 A;  3O4Z A;  4LER A;  2MHK A;  3L16 A;  4WNE A;  3ZW3 A;  5JHA A;  4BWR A;  2BUG A;  3G2W A;  3G2T A;  4DLQ A;  4N2Q A;  1NA3 A;  3LY7 A;  2P58 C;  2I2O A;  3FU3 A;  4I1O B;  2E0I A;  4R7L A;  4DI4 A;  3KS2 A;  2HO1 A;  3QOU A;  3QK0 A;  5G04 C;  3FUH A;  2YIN A;  2VGX B;  3DPD A;  3CVL A;  2XPZ A;  3CEQ A;  5C1D A;  4FP7 A;  1OWL A;  3CSF A;  4FJY A;  1NP7 A;  2PQR A;  1ELK A;  5FT9 A;  4BY6 A;  4F53 A;  3EDT B;  4OVU A;  2XQ0 A;  2BTD A;  4N5C A;  4I1A A;  3UT7 A;  3IHY A;  5EKQ D;  4BTA A;  2JEK A;  1OWO A;  3FU6 A;  3IEG A;  4GML A;  1EPU A;  4HOR A;  3GYZ A;  1TJF A;  4I1M A;  3KEZ A;  1HX8 A;  4DPR A;  2Q7F A;  4G24 A;  5J90 A;  1PAQ A;  3CVU A;  4WNF A;  3GZS A;  3D9K A;  4G2V A;  4MRU A;  4KXK B;  1MHQ A;  3AS8 A;  1ZU2 A;  4YVQ C;  2UY1 A;  2NSZ A;  1IHG A;  2CG3 A;  4ILH B;  5BW8 C;  4PUC A;  1A17 A;  2FF4 A;  3E4B A;  4UWG A;  3QC1 A;  4B89 A;  3Q47 B;  3ASD A;  3ONK A;  2YNQ A;  1W3B A;  4GA2 A;  1Z6T A;  4XE0 A;  1UW4 B;  2XGS A;  3PNT B;  2VSN A;  3CHS A;  3LCA A;  4EZL A;  3T8M A;  3RO2 A;  2VSO E;  3TJP A;  4Q94 A;  3FH7 A;  2XPI A;  3ZYL A;  3NQP A;  3MGB A;  3UPV A;  4PDX A;  2VGX A;  4E6H A;  5ARG A;  4F7A A;  1SZ9 A;  2DBA A;  3UT4 A;  4DJA A;  4QFV A;  4ATG A;  4U0U A;  3FTU A;  5BV1 A;  2FUL A;  4G26 A;  2HR2 A;  4CDN A;  4JHK A;  1U3D A;  4FAD A;  3VTY A;  2AXZ A;  3FFL A;  1H0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...