5AARA

Structure of the ankyrin domain of an arabidopsis thaliana potassium channel
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
185
Chain Sequence
LPLNLCFAAIREDDLLLHQLLKRGLDPNESDNNGRTPLHIAASKGTLNCVLLLLEYHADPNCRDAEGSVPLWEAMVEGHEKVVKVLLEHGSTIDAGDVGHFACTAAEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIEMVKYLLEQGADVNKQDMHGWTPRDLAEQQGHEDIKALFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords POTASSIUM CHANNEL AKT1
publication title Structure of the Ankyrin Domain of Akt1
rcsb
source organism Arabidopsis thaliana
total genus 62
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5aarA00
4HRNA 4RLYA 1N0QA 3W9GA 2DZNA 2L6BA 3HG0D 5EILA 3TWRA 4BSZB 3AJIA 3C5RA 3T8KA 1N11A 4OAUC 2ETAA 5HRYA 4K5BA 3TWUA 1BI7B 5EIDA 4HBDA 2XEEA 4NIKA 4BETA 1DC2A 3EHRA 2ZGDA 5CERB 4K5AB 3D9HA 3SO8A 2NYJA 5BXOA 2XEHA 3J5PA 4U95D 5KBAA 5ENSD 4Z68A 4HI8A 5AAOA 4F6RD 4QFVA 2BKGA 4U8YD 2ZGGA 2KXPC 4HB5A 3HRAA 3JUEA 3JXJA 4HI9A 4G8LA 1YYHA 4QQIA 2ETBA 4UUCA 5AQ9A 5KWDA 5BXUA 1MX2A 3F6QA 4CYMD 1TR4A 4LG6A 5FINA 5HS0A 5D66A 3AAAC 3DEPA 3TWVA 2P2CP 4BERA 1AP7A 3TWSA 1IKND 1YMPA 1G3NB 3W9FA 4CZ2D 1OY3D 2DZOA 4HQDA 1D9SA 2V4HC 4O60A 5EN5D 1WDYA 1MX6A 4C48B 4BESA 2BKKB 4DX6D 2ETCA 4G8KA 2RFAA 3B7BA 5JA4D 4U96D 3IXEA 1MYOA 2QC9A 5CBOA 4A63B 5AARA 3J5QB 2Y0BG 1NFIE 4HRLA 4K5CA 4DUIA 5AN8A 2RFMA 3TWTA 1WG0A 5HKPA 5CEDB 3ZUVB 1BLXB 2MYOA 4LSZE 3T9KA 3TWWA 4ATZD 1YCSB 3KEAA 4HNAD 4N5QA 4YDWA 3ZKJA 4DRXE 4F1PA 4U8VD 1A5EA 4DX2A 3DEOA 5EIBE 5ENQD 3Q9NC 1BI8B 1AWCB 4J8YA 3EU9A 3LJNA 4B93B 3NOCD 1BD8A 3EHQA 2DVWA 1SW6A 2HE0A 5EYPF 3V2XA 3NBNB 3JXIA 5ENRD 3V30A 3TWXA 2XENA 2B0OE 2J8SD 3UI2A 3UTMA 4ZHBA 1K3ZD 5ITZF 2KBXA 4O1PA 1QYMA 4GMRA 4GPMA 2JABA 5FIOA 1S70B 1DCQA 4DX7D 2DWZA 4HRMB 3ZU7B 4DX5D 1IHBA 1MX4A 4TUMA 2QYJA 2F8XK 4DX1A 2VGEA 2XZTG 5ENOD 1IXVA 1OT8A 4JB8P 4O1OA 4ZFHA 3Q9UC 5AQBA 3ZNGA 4J7WA 5KNGA 4LNUD 1UOHA 3UXGA 3B95A 4HLLA 5JMND 1SVXA 2FO1E 2F8YA 5CBNA 5CEAA 1N0RA 5AQ7A 4OAVB 3V31A 1BU9A 2PNNA 1K1AA 3V2OA 4YDYA 5KNHD 4BEPA 5CECB 2XZDG 1MJ0A 3V79K 3NOGD 2F37A 2Y1LE 5ENPD 5ENTD 5AQAA 2V5QC 1K1BA 2AJAA 5EYLA 2A5EA 3TWQA
chains in the Genus database with same CATH superfamily
5EILA 4ANVA 2XPZA 1DC2A 4DLQA 2IU1A 2GRQB 2NYJA 4JEHA 2VSXE 2Y69E 3BU8A 4JPSA 3U4TA 4L1BA 2WXMA 2XS8A 3DSTA 5HQ8A 3QAQA 3Q49B 1HG5A 1TR4A 2AXZA 4J8FA 2L0IA 3TWVA 5H7PA 1D9SA 4CDMA 4JEUA 3G2WA 1N52A 1FVHA 2OVBA 2C0LA 1JCSA 3SFXA 2DBAA 4B0ZA 4FLHA 4U63A 4CGVA 3UMVA 3MZLB 3TAXA 4K5CA 4WNDA 2RFMA 3TWTA 2FF4A 3ZGQA 2RD0A 2FULA 4TRQA 3AG3E 1UN9A 4WWOA 4BFRA 2V4LA 2P9SG 2LUHA 3NBNB 2IOSA 3UI2A 5ANRA 1N4QA 3CV0A 1FPPA 2HO1A 3FUHA 4GA2A 4PUCA 3PUKA 1HO8A 5ENOD 1IXVA 4U0SA 1N54A 5CRUA 4LNUD 2ZU6B 3ASDA 5ANLA 3R9MA 4RG9A 2XS1A 2IEJA 4OAVB 2CFZA 3AU4A 4RQIA 2AWIA 2WMNA 3VTYA 5FQ7A 3LVQE 5FZQA 3RO2A 3UM1A 2DZNA 1H6KA 4WNEA 5J08A 4Q96A 2FI7A 5EX3A 2R5SA 2XGOA 4KBQA 3JXJA 2GGFA 2QY7A 4UUCA 2UY1B 2VQ2A 3FUFA 3ESKA 1G3NB 1OY3D 4GTMA 4AVXA 3E32A 3O4ZA 1E8YA 2QYUA 1LD7A 3SBSA 3UUXA 1OWNA 2WVIA 4XKBA 4CGWA 2MOWA 3CHPA 1A17A 1XGWA 3GZ2A 5G55A 3ZKJA 4U8VD 4DX2A 3EHMA 3ONLA 2BF0X 3L16A 2R03A 3CQGB 3OAWA 1P5QA 3VLFA 1HU3A 5ENRD 4ZHBA 4TUUA 2JABA 4N39A 4DI3A 3SBTB 4B8AA 4A1GA 1FVFA 1INZA 4O1OA 3ZRHA 4ATGA 5LP0A 4XI9A 5JJ7A 1N9AA 1UOHA 4EZJA 4UWGA 2J9QA 2I1JA 5JMND 2FO1E 3V31A 2AVPA 1S63A 4YDEA 2AJAA 2WXOA 3CVPA 3CHSA 5CCLA 2KATA 3T5XA 1KT1A 3AJIA 5HRYA 3FUMA 1OCCE 4EQFA 4OYSA 2WQHA 2EINE 3PNTB 3TL5A 3HIZA 2NSZA 4KT6B 2H6HA 2XRYA 3PZ4A 5A6CA 3L82A 2OVFA 4I1AA 2XCBA 4JW1A 2WXJA 2BKKB 3UT7A 4G8KA 4BX9A 2LAIA 1QBQA 4ABNA 3PVLA 2ZIRA 3ASNE 4N3CA 3IKOB 4JHJA 1U2VG 3CK9A 2EIME 3MGBA 3C72A 4G26A 4HOUA 4BY6A 2CG3A 3EHQA 3FTSA 2HR2A 3RO3A 4JZYA 3QB2A 4O1PA 2IQCA 5FIOA 1OWLA 3UX4A 1X5BA 2DWZA 4CRWA 1MX4A 1TEZA 2Y3AA 4HOQA 3TXMA 3CIAA 2IY0C 3Q9UC 3D3MA 2J49A 3GZSA 2CFUA 3BG1B 2DIWA 3PE3A 2KCLA 2FO7A 5AQ7A 3QDNA 4BEPA 5CECB 4N2QA 2XZDG 1H19A 2F37A 2UWJG 4GZCA 1JCQA 1MHQA 4FC8A 1OWMA 3KD7A 3HDXA 2XEHA 3B7UX 4KVOA 4AXHA 3ZVVA 2VGYA 3S7DA 3LXUX 3PNLB 4GZ5A 4WAFA 2LSVA 4UQXA 3JUEA 5KWDA 2V5FA 3PH0C 1YMPA 1HX8A 3SNXA 3ML8A 3ONKA 3FH5A 3EJNA 4FJZA 5AARA 4DUIA 4I9CA 4N5CA 4AP2A 1ELWA 4HNAD 3BEEA 3NQPA 3OXLA 4IYPA 4UWKA 3I4RB 1TJFA 3PZ3A 4Y6WA 2JEKA 4HXIA 2LXLA 2B6CA 2J8SD 2R2LA 1EPUA 3CVQA 2X6JA 4A55A 3CHMA 3FUDA 1IHBA 4DX5D 4I9EA 5AJDA 2XZTG 3ENEA 3FTZA 4ANXA 4BWRA 3R7QA 4GA0A 1QNFA 3U3WA 4OVVA 4UQZA 4A3VA 3RIBA 2OEWA 4W9RA 3KEZA 2R02A 1BI7B 4B8CB 3UINC 2X6FA 4NIKA 5BXOA 4Z68A 1Y6IA 3TGOA 2BKGA 3KSQA 5CHEE 5AQ9A 3D9KA 1KZPA 3LJ3A 2P2CP 3JUIA 1XNFA 4O60A 3FU0A 3G2SA 2Q7FA 3SQVA 4GZDA 1D8DA 3DXKG 1UN8A 1NI1A 4YVOA 3J5QB 2CHZA 3Q79A 1UW4B 3KS2A 3ZUVB 1E7UA 3T9KA 4DRXE 3PDNA 1DCEA 3MV2B 5ENQD 4O6FA 3FULA 3CVVA 3UM0A 4I1OB 5B1AE 3CK8A 2YHCA 2WXNA 1GW6A 4GPMA 5AIJA 2EIJE 3AU5A 3URZA 3ESLA 2WXIA 3CHOA 2ZXWE 4DX1A 2WM9A 1OXJA 1Y8MA 4D10C 4YNDA 5HI7A 4IRUA 2XCCA 3L9TA 1UJJA 3PEVB 4KZ0A 2V5QC 5EYLA 4GYWA 3RKVA 4HRNA 4Q69A 1E8WA 2GRNB 3W9GA 2CG2A 3Q7AA 4GCOA 4JD2G 3SI5A 4AIFA 4WNGA 2P9PG 2R59A 4GTVA 5FQ4A 4BETA 1EDUA 2M63A 4G25A 3ZPJA 1TYQG 5ENSD 4GTQA 1NA0A 1O1SA 4M7CA 4EZLA 4U8YD 3FTXA 4HB5A 2X6HA 3CGHA 3AG4E 3BUAA 3HRAA 1ZBPA 2NXPA 4QQIA 3FEYA 3SD5A 4E85A 4TV3A 1U3DA 3P1UA 4F3VA 3TXNA 3ZEFA 3ASHA 3CVNA 3LVRE 4B94A 4LEUA 1WDYA 1TN6A 3L17A 4ME2A 3ULQA 3D9PA 4I2WA 5T8IA 2BTDA 3G2VA 2HYZA 4EPZA 1O1RA 4J6IA 2V8SE 3JYSA 1QQEA 3TWWA 2E2EA 3EDTB 3O48A 2LSUA 4U07A 1BI8B 2WQ6A 2WXQA 4G2VA 2J08A 4HVBA 4MBGA 3NOCD 4KMOA 1X81A 3WG7E 2CHWA 3V30A 3UTMA 4DI4A 5DBKA 4YDOA 4X8QA 3Q47B 4WNFA 1KPSB 3ZU7B 2OEVA 4G1TA 2VGXA 4AOFA 1TNBA 4CEMA 2GROB 2XGMA 3JCKC 1S64A 3APFA 4JA9A 2OV8A 5EKQD 4C0EA 1D8EA 1V55E 3FHEA 4RLYA 5G05J 3L54A 5JHBA 3LYAA 3ZFWA 2XEEA 2WXRA 1ZU2A 3B7RL 1MZCA 2YQ8A 4MKTA 4FLBA 4MS6A 3FY4A 3AS8A 1TNOA 3QNKA 3UPVA 4RSYA 1QZ2A 4DJAA 2DZOA 3HHMA 5C1DA 2R17C 3CVLA 2VJ8A 2I1KA 4C48B 4G11A 3PZDA 3ULYA 2PQRA 3PREA 2QZAA 3RK6A 5CBOA 4A63B 3DSSA 4U0ZA 2Y0BG 2GRRB 4HRLA 3ZIMA 1YCSB 1NZNA 2MHKA 5LCWJ 3FUKA 2XPIA 1AWCB 4RVBA 2J09A 4WWNA 3LKUA 4U8HA 4I6JA 2AXVA 3TWXA 3LY9A 2IONA 3NF1A 3T5VA 1UG3A 4ZFHA 4J0UA 4GB9A 4R7LA 2KM4A 3UM3A 4RG6A 1HZ4A 3DSWA 2WB2A 3LDZA 3PE4A 3G2UA 3HXDA 3NOGD 5ENTD 4M3OA 1UJKA 4DPRA 5G04C 5FZRA 5D2MC 3SFZA 1WY6A 2YHEA 4BSZB 2RKKA 5AYWD 3QWWA 2IO2C 4FULA 1HE8A 4HI8A 4L2LA 4CCAA 4BSXA 3GZ1A 2X6KA 2VSNA 4UWLA 4XIFA 1JWGA 4FU3A 3DPYA 3ZYMA 3W9FA 4MLPA 1MX6A 1U3CA 3X2QE 3RRMB 3ZYQA 3EIJA 4AJWA 4J8SA 3IXEA 4WUYA 4G23A 1NL4A 5ARGA 1RZ4A 1BLXB 3FUEA 4BTBA 1A5EA 1JWFA 3ZXSA 2XEVA 2CHXA 2P9UG 3G2TA 4B93B 2EQXA 4MRUA 4UWHA 3PUJA 5T4YA 2WXLA 3OTNA 4ANUA 5CRVA 1PAQA 2WXFA 3LY8A 2EIKE 4L23A 3SHFA 2VGEA 3CHRA 1K8KG 4ANWA 5G2NA 3CKCA 2VYIA 5CEAA 4GYYA 1N4RA 1K1AA 2XGSA 5KNHD 3FWVA 3V79K 3S7JA 2VGXB 3S2AA 5A7DB 3TWQA 3VTXA 3P2BA 3HG0D 4H7XA 2H6FA 3IEGA 4AY6A 3D9HA 3J5PA 3C3RA 3PZ2A 1PC2A 4PS3A 4F6RD 3PRZA 4EECA 2P9KG 4CDNA 1TNUA 2ILRA 1HS6A 3IHYA 3FDHA 4CZ2D 3LY7A 2HM8A 2I6HA 3QJZA 4ILHB 3B7BA 3S7FA 5JJTA 3ABLE 5FJYA 1SQMA 3MA5A 5KJLA 3DXMG 3JQ1A 1YA0A 4YVQC 3UM2A 2FBNA 1SZ9A 3DEOA 2KCKA 4XKCA 3VLDA 1N94A 1JUQA 4TXQA 4TXRA 4A3TA 4AEZC 4ILGA 2PZIA 3MKQA 1WAO1 1QYMA 1HFAA 4Y6CA 5CMWA 1V54E 4F53A 4WWPA 1TNYA 3ULEG 3NAWA 4HLLA 1E90A 4EZKA 5CBNA 4N2SA 3QK0A 1K1BA 4NQ0A 5G05C 4CDRA 1OCZE 3E34A 4UI9J 5JHAA 2ETAA 4LRZA 4HBDA 2XQ0A 3RRNB 1NP7A 1ELRA 1E7VA 4N3AA 4KXKB 3SZ7A 5IY5E 3R7RA 4XEIG 1WM5A 5HS0A 5FINA 5D66A 3IHVA 3LCAA 5J90A 2I2OA 3PZ1A 2P9NG 1N4PA 3SF4A 4GZ3A 4BESA 2RFAA 3L6AA 1Q2ZA 5BT1A 1IQRA 1DNPA 5AJLA 4YDWA 3LPZA 2P9LG 4PH4B 3C98A 3DSVA 3PS6A 3HVEA 3E4BA 2LXMA 3FTVA 4TXPA 3IBEA 2IFUA 3QKYA 4GU5A 1DCQA 4FADA 2V0PA 4J8DA 3JQ0A 5AQBA 2YINA 4JC8A 5FZSA 4EBAG 4XX5A 1LF8A 5EX0A 2DYRE 5BV1A 2P58C 3OXFA 4HS2A 4K0RA 1O1TA 3TWRA 3C5RA 5KJNA 5T3RA 1HG2A 1TN7A 1KT0A 4NACA 2E0IA 2ZGGA 3I3NA 3BQOA 1H0AA 2XPYA 2EILE 5M72A 3ZN3A 3HYMB 4GMLA 4U0UA 4CYMD 2VSYA 4UWFA 2PL2A 3FP3A 3CVUA 4HQDA 2V4HC 2JLBA 5ARFA 4HLEA 1JPLA 1LTXA 5BPPA 3BG0B 3LEWA 4JHKA 2NC9A 1TJCA 3ZYLA 4HOSA 2H6GA 2GW1A 3RRUA 1WG0A 5LOZA 2AW6A 2L6JA 4LSZE 4N5QA 5A23A 2A5UA 3Q9NC 3UKRG 3ABKE 4KYOB 1TNZA 2DVWA 2WXKA 3V2XA 2YNQA 5ITZF 2IF4A 1N95A 3L22A 3NZSA 1S70B 3D9MA 3APDA 3ZHEA 1JCRA 2QYJA 4C0MA 2ONDA 4GCNA 3MKQB 4BTAA 3Q5MA 1N4SA 1EF1C 4JVSA 4PDXA 2FEZA 1HF8A 3UT8A 2PNNA 3AS4A 4I1MA 4LCTA 4ILIA 4APOA 3CLJA 2L6BA 4NURA 3T8KA 3ISMC 3ZXPA 3C3OA 2ZGDA 2OCCE 5FQ8A 5BW8C 4GPKA 2J4BA 4FHJA 3LS8A 3CVXA 4UI9K 1OCRE 4F1SA 3TG4A 2WXPA 1YYHA 2X6IA 5BXUA 1MX2A 4LG6A 3AAAC 3DRAA 3DEPA 4HORA 3TWSA 3FU6A 2ETCA 2R05A 4IN3B 5JA4D 3UT4A 1MYOA 3Q15A 5AN8A 2C0MA 1O5MA 5CEDB 1TN8A 3MCXA 3HXFA 2WXHA 4I6EA 2XRZA 1DVPA 3EU9A 5BV0A 3T8MA 4JHRA 3ASGA 5EYPF 3ASOE 1W3BA 3JXIA 1HXIA 2PQNA 3Q78A 3KAEA 3Q7FA 4LNBA 1H6OA 3HVEB 2P9IG 2F8XK 2J4DA 5KCMA 1FCHA 4JB8P 3ZNGA 1SA5A 3UXGA 3IV0A 4GMJA 4BT8A 1SVXA 5KJKA 3L08A 2H6IA 1E8ZA 4JXTA 3CSFA 3DSUA 4FHKA 4CT0A 1H2TC 3CVYA 1Z3XA 3SGHA 2DYSE 3K9IA 4UI9C 3SFYA 4XI0A 4OAUC 3FU5A 4PS8A 3FUJA 4BT9A 4K5AB 3SO8A 3HXEA 5AENA 3B13A 1FT2A 3FTUA 4HI9A 1ELKA 4FA6A 3ASFA 3HXBA 4BERA 3U64A 4LUNU 4I6GA 3FH8A 3E33A 2AXUA 4GTSA 1KZOA 4URKA 4GTRA 5C2YA 5HKPA 2OOEA 4IULA 4ATZD 5DIZA 5E75A 1H2VC 3U66A 5EIBE 4APFA 3LJNA 5ENNA 1BD8A 4N3BA 3CK7A 2XENA 3C3QA 4GAAA 1HH8A 3E37A 2QFCA 4AY5A 4XZ4A 3CKBA 2LNIA 3UQ3A 4GTPA 4F7AA 2I9CA 5CMYA 1BPOA 2DCPA 4B89A 2X38A 2F8YA 3D9LA 1N0RA 2BEDA 2F0YA 1NA3A 4YDYA 5FT9A 3ZHEB 1H2UA 2Y1LE 5FQ6A 5E76A 4XE0A 3QARA 3WXXA 3NB2A 1N11A 3Q75A 4KZCA 3ABME 5LFAA 4DK5A 4G24A 1H6PA 4L9PA 1OCOE 4AV7A 3S7BA 3F6QA 2L0TB 1SZAA 3FUNA 1IKND 4JL0A 3TG5A 3DBSA 5FWQA 4U96D 1Z5SC 3ML9A 2KZTA 1NFIE 3RAUA 3MEKA 4GTTA 3R9AB 3FUIA 3DSXA 3SY2A 2VTBA 1MQSA 4GA1A 2MRIA 3D9JA 2WXGA 4GTOA 2B0OE 1E8XA 1KLXA 2KBXA 5BUZA 4C9BB 3QWVA 1Z3YA 4EBAA 2J07A 2IO3C 3MYVA 3RJVA 5KNGA 2KCVA 3APCA 3GYZA 2Y4UA 2KC7A 3E30A 3Q4AB 4CT4A 5AQAA 4I17A 2IOLA 1Z6TA 3FTYA 1SA4A 3D9IA 5B1BE 4KVMA 5EIDA 4DLOA 4U95D 5D0OD 1IQUA 5AAOA 3D9OA 3FFLA 5LX8A 4I43A 4GYOA 4HOTA 3D9NA 1EYHA 1VDYA 4A1SA 4LNGA 4V3IA 3FU3A 3MKRA 3Q73A 4P29A 4L7TA 3MJWA 1AP7A 3CEQA 3GW4A 2L9BA 3NZUA 2VSOE 4UQYA 4DX6D 1B89A 3MV3B 3AS5A 4AM9A 3FH7A 4JA7A 3EU5A 2WPVA 5EDSA 2WMOA 4H7YA 4OVUA 3QC1A 2HE0A 5D0QD 3QOUA 4NRHB 5KJMA 3B7TA 4GMRA 3HXCA 3CSTA 3AG2E 4ACKA 3DWLG 4DX7D 5G04J 4ACLA 2GRMA 5JJ6A 4TUMA 3UKUG 5LCWC 1OT8A 3CVWA 5CCMA 2PM7A 4J7WA 1OUVA 3B95A 4GZ6A 5B3SE 1BU9A 1MJ0A 3UIOC 2GRLA 4I2ZA 2LAHA 2PM6A 4FJYA 3EUVA 3N71A 4U7EB 1LD8A 1N0QA 3RSEG 4K5BA 3L13A 3TWUA 2XHEA 2UY1A 1ZB1A 3EHRA 2Y4TA 3MX3A 1E96B 5CERB 1OWPA 5KBAA 4K03A 4QFVA 2KXPC 2A4ZA 4J8EA 2C2LA 3DPDA 4G8LA 2ETBA 1IHGA 3I5PA 3CHQA 1L5JA 3ZW3A 3FTWA 3CR3A 5EN5D 3ZYKA 4FP7A 2WQ7A 2RG8A 3AG1E 1S0PA 2QC9A 4PS7A 5FTPA 3QWPA 3OXGA 2MYOA 4HFGA 4U04A 3EIQC 2LO6A 3KEAA 4F1PA 3KSLA 1IYGA 4EHMA 4J8YA 2KZTB 3I4GA 3PEUB 3UIPC 2GRPB 1SW6A 3FEXA 4BX8A 3B7SA 4LERA 1K3ZD 1PY1A 2ZISA 2VTBB 3VLEA 3CQCB 4HRMB 4L2YA 5BNWA 2IJGX 1FT1A 1RW2A 3TJPA 4Q94A 1OWOA 4E6HA 2X3MA 3RU0A 5ENPD 3U9WA 2BUGA 3EHNA 3V2OA 2A5EA
chains in the Genus database with same CATH topology
4HRNA 4RLYA 1N0QA 3W9GA 2DZNA 2L6BA 3HG0D 5EILA 3TWRA 4BSZB 3AJIA 3C5RA 3T8KA 1N11A 4OAUC 2ETAA 5HRYA 4K5BA 3TWUA 1BI7B 5EIDA 4HBDA 2XEEA 4NIKA 4BETA 1DC2A 3EHRA 2ZGDA 5CERB 4K5AB 3D9HA 3SO8A 2NYJA 5BXOA 2XEHA 3J5PA 4U95D 5KBAA 5ENSD 4Z68A 4HI8A 5AAOA 4F6RD 4QFVA 2BKGA 4U8YD 2ZGGA 2KXPC 4HB5A 3HRAA 3JUEA 3JXJA 4HI9A 4G8LA 1YYHA 4QQIA 2ETBA 4UUCA 5AQ9A 5KWDA 5BXUA 1MX2A 3F6QA 4CYMD 1TR4A 4LG6A 5FINA 5HS0A 5D66A 3AAAC 3DEPA 3TWVA 2P2CP 4BERA 1AP7A 3TWSA 1IKND 1YMPA 1G3NB 3W9FA 4CZ2D 1OY3D 2DZOA 4HQDA 1D9SA 2V4HC 4O60A 5EN5D 1WDYA 1MX6A 4C48B 4BESA 2BKKB 4DX6D 2ETCA 4G8KA 2RFAA 3B7BA 5JA4D 4U96D 3IXEA 1MYOA 2QC9A 5CBOA 4A63B 5AARA 3J5QB 2Y0BG 1NFIE 4HRLA 4K5CA 4DUIA 5AN8A 2RFMA 3TWTA 1WG0A 5HKPA 5CEDB 3ZUVB 1BLXB 2MYOA 4LSZE 3T9KA 3TWWA 4ATZD 1YCSB 3KEAA 4HNAD 4N5QA 4YDWA 3ZKJA 4DRXE 4F1PA 4U8VD 1A5EA 4DX2A 3DEOA 5EIBE 5ENQD 3Q9NC 1BI8B 1AWCB 4J8YA 3EU9A 3LJNA 4B93B 3NOCD 1BD8A 3EHQA 2DVWA 1SW6A 2HE0A 5EYPF 3V2XA 3NBNB 3JXIA 5ENRD 3V30A 3TWXA 2XENA 2B0OE 2J8SD 3UI2A 3UTMA 4ZHBA 1K3ZD 5ITZF 2KBXA 4O1PA 1QYMA 4GMRA 4GPMA 2JABA 5FIOA 1S70B 1DCQA 4DX7D 2DWZA 4HRMB 3ZU7B 4DX5D 1IHBA 1MX4A 4TUMA 2QYJA 2F8XK 4DX1A 2VGEA 2XZTG 5ENOD 1IXVA 1OT8A 4JB8P 4O1OA 4ZFHA 3Q9UC 5AQBA 3ZNGA 4J7WA 5KNGA 4LNUD 1UOHA 3UXGA 3B95A 4HLLA 5JMND 1SVXA 2FO1E 2F8YA 5CBNA 5CEAA 1N0RA 5AQ7A 4OAVB 3V31A 1BU9A 2PNNA 1K1AA 3V2OA 4YDYA 5KNHD 4BEPA 5CECB 2XZDG 1MJ0A 3V79K 3NOGD 2F37A 2Y1LE 5ENPD 5ENTD 5AQAA 2V5QC 1K1BA 2AJAA 5EYLA 2A5EA 3TWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRN A;  4RLY A;  1N0Q A;  3W9G A;  2DZN A;  2L6B A;  3HG0 D;  5EIL A;  3TWR A;  4BSZ B;  3AJI A;  3C5R A;  3T8K A;  1N11 A;  4OAU C;  2ETA A;  5HRY A;  4K5B A;  3TWU A;  1BI7 B;  5EID A;  4HBD A;  2XEE A;  4NIK A;  4BET A;  1DC2 A;  3EHR A;  2ZGD A;  5CER B;  4K5A B;  3D9H A;  3SO8 A;  2NYJ A;  5BXO A;  2XEH A;  3J5P A;  4U95 D;  5KBA A;  5ENS D;  4Z68 A;  4HI8 A;  5AAO A;  4F6R D;  4QFV A;  2BKG A;  4U8Y D;  2ZGG A;  2KXP C;  4HB5 A;  3HRA A;  3JUE A;  3JXJ A;  4HI9 A;  4G8L A;  1YYH A;  4QQI A;  2ETB A;  4UUC A;  5AQ9 A;  5KWD A;  5BXU A;  1MX2 A;  3F6Q A;  4CYM D;  1TR4 A;  4LG6 A;  5FIN A;  5HS0 A;  5D66 A;  3AAA C;  3DEP A;  3TWV A;  2P2C P;  4BER A;  1AP7 A;  3TWS A;  1IKN D;  1YMP A;  1G3N B;  3W9F A;  4CZ2 D;  1OY3 D;  2DZO A;  4HQD A;  1D9S A;  2V4H C;  4O60 A;  5EN5 D;  1WDY A;  1MX6 A;  4C48 B;  4BES A;  2BKK B;  4DX6 D;  2ETC A;  4G8K A;  2RFA A;  3B7B A;  5JA4 D;  4U96 D;  3IXE A;  1MYO A;  2QC9 A;  5CBO A;  4A63 B;  5AAR A;  3J5Q B;  2Y0B G;  1NFI E;  4HRL A;  4K5C A;  4DUI A;  5AN8 A;  2RFM A;  3TWT A;  1WG0 A;  5HKP A;  5CED B;  3ZUV B;  1BLX B;  2MYO A;  4LSZ E;  3T9K A;  3TWW A;  4ATZ D;  1YCS B;  3KEA A;  4HNA D;  4N5Q A;  4YDW A;  3ZKJ A;  4DRX E;  4F1P A;  4U8V D;  1A5E A;  4DX2 A;  3DEO A;  5EIB E;  5ENQ D;  3Q9N C;  1BI8 B;  1AWC B;  4J8Y A;  3EU9 A;  3LJN A;  4B93 B;  3NOC D;  1BD8 A;  3EHQ A;  2DVW A;  1SW6 A;  2HE0 A;  5EYP F;  3V2X A;  3NBN B;  3JXI A;  5ENR D;  3V30 A;  3TWX A;  2XEN A;  2B0O E;  2J8S D;  3UI2 A;  3UTM A;  4ZHB A;  1K3Z D;  5ITZ F;  2KBX A;  4O1P A;  1QYM A;  4GMR A;  4GPM A;  2JAB A;  5FIO A;  1S70 B;  1DCQ A;  4DX7 D;  2DWZ A;  4HRM B;  3ZU7 B;  4DX5 D;  1IHB A;  1MX4 A;  4TUM A;  2QYJ A;  2F8X K;  4DX1 A;  2VGE A;  2XZT G;  5ENO D;  1IXV A;  1OT8 A;  4JB8 P;  4O1O A;  4ZFH A;  3Q9U C;  5AQB A;  3ZNG A;  4J7W A;  5KNG A;  4LNU D;  1UOH A;  3UXG A;  3B95 A;  4HLL A;  5JMN D;  1SVX A;  2FO1 E;  2F8Y A;  5CBN A;  5CEA A;  1N0R A;  5AQ7 A;  4OAV B;  3V31 A;  1BU9 A;  2PNN A;  1K1A A;  3V2O A;  4YDY A;  5KNH D;  4BEP A;  5CEC B;  2XZD G;  1MJ0 A;  3V79 K;  3NOG D;  2F37 A;  2Y1L E;  5ENP D;  5ENT D;  5AQA A;  2V5Q C;  1K1B A;  2AJA A;  5EYL A;  2A5E A;  3TWQ A; 
#chains in the Genus database with same CATH topology
 5EIL A;  4ANV A;  2XPZ A;  1DC2 A;  4DLQ A;  2IU1 A;  2GRQ B;  2NYJ A;  4JEH A;  2VSX E;  2Y69 E;  3BU8 A;  4JPS A;  3U4T A;  4L1B A;  2WXM A;  2XS8 A;  3DST A;  5HQ8 A;  3QAQ A;  3Q49 B;  1HG5 A;  1TR4 A;  2AXZ A;  4J8F A;  2L0I A;  3TWV A;  5H7P A;  1D9S A;  4CDM A;  4JEU A;  3G2W A;  1N52 A;  1FVH A;  2OVB A;  2C0L A;  1JCS A;  3SFX A;  2DBA A;  4B0Z A;  4FLH A;  4U63 A;  4CGV A;  3UMV A;  3MZL B;  3TAX A;  4K5C A;  4WND A;  2RFM A;  3TWT A;  2FF4 A;  3ZGQ A;  2RD0 A;  2FUL A;  4TRQ A;  3AG3 E;  1UN9 A;  4WWO A;  4BFR A;  2V4L A;  2P9S G;  2LUH A;  3NBN B;  2IOS A;  3UI2 A;  5ANR A;  1N4Q A;  3CV0 A;  1FPP A;  2HO1 A;  3FUH A;  4GA2 A;  4PUC A;  3PUK A;  1HO8 A;  5ENO D;  1IXV A;  4U0S A;  1N54 A;  5CRU A;  4LNU D;  2ZU6 B;  3ASD A;  5ANL A;  3R9M A;  4RG9 A;  2XS1 A;  2IEJ A;  4OAV B;  2CFZ A;  3AU4 A;  4RQI A;  2AWI A;  2WMN A;  3VTY A;  5FQ7 A;  3LVQ E;  5FZQ A;  3RO2 A;  3UM1 A;  2DZN A;  1H6K A;  4WNE A;  5J08 A;  4Q96 A;  2FI7 A;  5EX3 A;  2R5S A;  2XGO A;  4KBQ A;  3JXJ A;  2GGF A;  2QY7 A;  4UUC A;  2UY1 B;  2VQ2 A;  3FUF A;  3ESK A;  1G3N B;  1OY3 D;  4GTM A;  4AVX A;  3E32 A;  3O4Z A;  1E8Y A;  2QYU A;  1LD7 A;  3SBS A;  3UUX A;  1OWN A;  2WVI A;  4XKB A;  4CGW A;  2MOW A;  3CHP A;  1A17 A;  1XGW A;  3GZ2 A;  5G55 A;  3ZKJ A;  4U8V D;  4DX2 A;  3EHM A;  3ONL A;  2BF0 X;  3L16 A;  2R03 A;  3CQG B;  3OAW A;  1P5Q A;  3VLF A;  1HU3 A;  5ENR D;  4ZHB A;  4TUU A;  2JAB A;  4N39 A;  4DI3 A;  3SBT B;  4B8A A;  4A1G A;  1FVF A;  1INZ A;  4O1O A;  3ZRH A;  4ATG A;  5LP0 A;  4XI9 A;  5JJ7 A;  1N9A A;  1UOH A;  4EZJ A;  4UWG A;  2J9Q A;  2I1J A;  5JMN D;  2FO1 E;  3V31 A;  2AVP A;  1S63 A;  4YDE A;  2AJA A;  2WXO A;  3CVP A;  3CHS A;  5CCL A;  2KAT A;  3T5X A;  1KT1 A;  3AJI A;  5HRY A;  3FUM A;  1OCC E;  4EQF A;  4OYS A;  2WQH A;  2EIN E;  3PNT B;  3TL5 A;  3HIZ A;  2NSZ A;  4KT6 B;  2H6H A;  2XRY A;  3PZ4 A;  5A6C A;  3L82 A;  2OVF A;  4I1A A;  2XCB A;  4JW1 A;  2WXJ A;  2BKK B;  3UT7 A;  4G8K A;  4BX9 A;  2LAI A;  1QBQ A;  4ABN A;  3PVL A;  2ZIR A;  3ASN E;  4N3C A;  3IKO B;  4JHJ A;  1U2V G;  3CK9 A;  2EIM E;  3MGB A;  3C72 A;  4G26 A;  4HOU A;  4BY6 A;  2CG3 A;  3EHQ A;  3FTS A;  2HR2 A;  3RO3 A;  4JZY A;  3QB2 A;  4O1P A;  2IQC A;  5FIO A;  1OWL A;  3UX4 A;  1X5B A;  2DWZ A;  4CRW A;  1MX4 A;  1TEZ A;  2Y3A A;  4HOQ A;  3TXM A;  3CIA A;  2IY0 C;  3Q9U C;  3D3M A;  2J49 A;  3GZS A;  2CFU A;  3BG1 B;  2DIW A;  3PE3 A;  2KCL A;  2FO7 A;  5AQ7 A;  3QDN A;  4BEP A;  5CEC B;  4N2Q A;  2XZD G;  1H19 A;  2F37 A;  2UWJ G;  4GZC A;  1JCQ A;  1MHQ A;  4FC8 A;  1OWM A;  3KD7 A;  3HDX A;  2XEH A;  3B7U X;  4KVO A;  4AXH A;  3ZVV A;  2VGY A;  3S7D A;  3LXU X;  3PNL B;  4GZ5 A;  4WAF A;  2LSV A;  4UQX A;  3JUE A;  5KWD A;  2V5F A;  3PH0 C;  1YMP A;  1HX8 A;  3SNX A;  3ML8 A;  3ONK A;  3FH5 A;  3EJN A;  4FJZ A;  5AAR A;  4DUI A;  4I9C A;  4N5C A;  4AP2 A;  1ELW A;  4HNA D;  3BEE A;  3NQP A;  3OXL A;  4IYP A;  4UWK A;  3I4R B;  1TJF A;  3PZ3 A;  4Y6W A;  2JEK A;  4HXI A;  2LXL A;  2B6C A;  2J8S D;  2R2L A;  1EPU A;  3CVQ A;  2X6J A;  4A55 A;  3CHM A;  3FUD A;  1IHB A;  4DX5 D;  4I9E A;  5AJD A;  2XZT G;  3ENE A;  3FTZ A;  4ANX A;  4BWR A;  3R7Q A;  4GA0 A;  1QNF A;  3U3W A;  4OVV A;  4UQZ A;  4A3V A;  3RIB A;  2OEW A;  4W9R A;  3KEZ A;  2R02 A;  1BI7 B;  4B8C B;  3UIN C;  2X6F A;  4NIK A;  5BXO A;  4Z68 A;  1Y6I A;  3TGO A;  2BKG A;  3KSQ A;  5CHE E;  5AQ9 A;  3D9K A;  1KZP A;  3LJ3 A;  2P2C P;  3JUI A;  1XNF A;  4O60 A;  3FU0 A;  3G2S A;  2Q7F A;  3SQV A;  4GZD A;  1D8D A;  3DXK G;  1UN8 A;  1NI1 A;  4YVO A;  3J5Q B;  2CHZ A;  3Q79 A;  1UW4 B;  3KS2 A;  3ZUV B;  1E7U A;  3T9K A;  4DRX E;  3PDN A;  1DCE A;  3MV2 B;  5ENQ D;  4O6F A;  3FUL A;  3CVV A;  3UM0 A;  4I1O B;  5B1A E;  3CK8 A;  2YHC A;  2WXN A;  1GW6 A;  4GPM A;  5AIJ A;  2EIJ E;  3AU5 A;  3URZ A;  3ESL A;  2WXI A;  3CHO A;  2ZXW E;  4DX1 A;  2WM9 A;  1OXJ A;  1Y8M A;  4D10 C;  4YND A;  5HI7 A;  4IRU A;  2XCC A;  3L9T A;  1UJJ A;  3PEV B;  4KZ0 A;  2V5Q C;  5EYL A;  4GYW A;  3RKV A;  4HRN A;  4Q69 A;  1E8W A;  2GRN B;  3W9G A;  2CG2 A;  3Q7A A;  4GCO A;  4JD2 G;  3SI5 A;  4AIF A;  4WNG A;  2P9P G;  2R59 A;  4GTV A;  5FQ4 A;  4BET A;  1EDU A;  2M63 A;  4G25 A;  3ZPJ A;  1TYQ G;  5ENS D;  4GTQ A;  1NA0 A;  1O1S A;  4M7C A;  4EZL A;  4U8Y D;  3FTX A;  4HB5 A;  2X6H A;  3CGH A;  3AG4 E;  3BUA A;  3HRA A;  1ZBP A;  2NXP A;  4QQI A;  3FEY A;  3SD5 A;  4E85 A;  4TV3 A;  1U3D A;  3P1U A;  4F3V A;  3TXN A;  3ZEF A;  3ASH A;  3CVN A;  3LVR E;  4B94 A;  4LEU A;  1WDY A;  1TN6 A;  3L17 A;  4ME2 A;  3ULQ A;  3D9P A;  4I2W A;  5T8I A;  2BTD A;  3G2V A;  2HYZ A;  4EPZ A;  1O1R A;  4J6I A;  2V8S E;  3JYS A;  1QQE A;  3TWW A;  2E2E A;  3EDT B;  3O48 A;  2LSU A;  4U07 A;  1BI8 B;  2WQ6 A;  2WXQ A;  4G2V A;  2J08 A;  4HVB A;  4MBG A;  3NOC D;  4KMO A;  1X81 A;  3WG7 E;  2CHW A;  3V30 A;  3UTM A;  4DI4 A;  5DBK A;  4YDO A;  4X8Q A;  3Q47 B;  4WNF A;  1KPS B;  3ZU7 B;  2OEV A;  4G1T A;  2VGX A;  4AOF A;  1TNB A;  4CEM A;  2GRO B;  2XGM A;  3JCK C;  1S64 A;  3APF A;  4JA9 A;  2OV8 A;  5EKQ D;  4C0E A;  1D8E A;  1V55 E;  3FHE A;  4RLY A;  5G05 J;  3L54 A;  5JHB A;  3LYA A;  3ZFW A;  2XEE A;  2WXR A;  1ZU2 A;  3B7R L;  1MZC A;  2YQ8 A;  4MKT A;  4FLB A;  4MS6 A;  3FY4 A;  3AS8 A;  1TNO A;  3QNK A;  3UPV A;  4RSY A;  1QZ2 A;  4DJA A;  2DZO A;  3HHM A;  5C1D A;  2R17 C;  3CVL A;  2VJ8 A;  2I1K A;  4C48 B;  4G11 A;  3PZD A;  3ULY A;  2PQR A;  3PRE A;  2QZA A;  3RK6 A;  5CBO A;  4A63 B;  3DSS A;  4U0Z A;  2Y0B G;  2GRR B;  4HRL A;  3ZIM A;  1YCS B;  1NZN A;  2MHK A;  5LCW J;  3FUK A;  2XPI A;  1AWC B;  4RVB A;  2J09 A;  4WWN A;  3LKU A;  4U8H A;  4I6J A;  2AXV A;  3TWX A;  3LY9 A;  2ION A;  3NF1 A;  3T5V A;  1UG3 A;  4ZFH A;  4J0U A;  4GB9 A;  4R7L A;  2KM4 A;  3UM3 A;  4RG6 A;  1HZ4 A;  3DSW A;  2WB2 A;  3LDZ A;  3PE4 A;  3G2U A;  3HXD A;  3NOG D;  5ENT D;  4M3O A;  1UJK A;  4DPR A;  5G04 C;  5FZR A;  5D2M C;  3SFZ A;  1WY6 A;  2YHE A;  4BSZ B;  2RKK A;  5AYW D;  3QWW A;  2IO2 C;  4FUL A;  1HE8 A;  4HI8 A;  4L2L A;  4CCA A;  4BSX A;  3GZ1 A;  2X6K A;  2VSN A;  4UWL A;  4XIF A;  1JWG A;  4FU3 A;  3DPY A;  3ZYM A;  3W9F A;  4MLP A;  1MX6 A;  1U3C A;  3X2Q E;  3RRM B;  3ZYQ A;  3EIJ A;  4AJW A;  4J8S A;  3IXE A;  4WUY A;  4G23 A;  1NL4 A;  5ARG A;  1RZ4 A;  1BLX B;  3FUE A;  4BTB A;  1A5E A;  1JWF A;  3ZXS A;  2XEV A;  2CHX A;  2P9U G;  3G2T A;  4B93 B;  2EQX A;  4MRU A;  4UWH A;  3PUJ A;  5T4Y A;  2WXL A;  3OTN A;  4ANU A;  5CRV A;  1PAQ A;  2WXF A;  3LY8 A;  2EIK E;  4L23 A;  3SHF A;  2VGE A;  3CHR A;  1K8K G;  4ANW A;  5G2N A;  3CKC A;  2VYI A;  5CEA A;  4GYY A;  1N4R A;  1K1A A;  2XGS A;  5KNH D;  3FWV A;  3V79 K;  3S7J A;  2VGX B;  3S2A A;  5A7D B;  3TWQ A;  3VTX A;  3P2B A;  3HG0 D;  4H7X A;  2H6F A;  3IEG A;  4AY6 A;  3D9H A;  3J5P A;  3C3R A;  3PZ2 A;  1PC2 A;  4PS3 A;  4F6R D;  3PRZ A;  4EEC A;  2P9K G;  4CDN A;  1TNU A;  2ILR A;  1HS6 A;  3IHY A;  3FDH A;  4CZ2 D;  3LY7 A;  2HM8 A;  2I6H A;  3QJZ A;  4ILH B;  3B7B A;  3S7F A;  5JJT A;  3ABL E;  5FJY A;  1SQM A;  3MA5 A;  5KJL A;  3DXM G;  3JQ1 A;  1YA0 A;  4YVQ C;  3UM2 A;  2FBN A;  1SZ9 A;  3DEO A;  2KCK A;  4XKC A;  3VLD A;  1N94 A;  1JUQ A;  4TXQ A;  4TXR A;  4A3T A;  4AEZ C;  4ILG A;  2PZI A;  3MKQ A;  1WAO 1;  1QYM A;  1HFA A;  4Y6C A;  5CMW A;  1V54 E;  4F53 A;  4WWP A;  1TNY A;  3ULE G;  3NAW A;  4HLL A;  1E90 A;  4EZK A;  5CBN A;  4N2S A;  3QK0 A;  1K1B A;  4NQ0 A;  5G05 C;  4CDR A;  1OCZ E;  3E34 A;  4UI9 J;  5JHA A;  2ETA A;  4LRZ A;  4HBD A;  2XQ0 A;  3RRN B;  1NP7 A;  1ELR A;  1E7V A;  4N3A A;  4KXK B;  3SZ7 A;  5IY5 E;  3R7R A;  4XEI G;  1WM5 A;  5HS0 A;  5FIN A;  5D66 A;  3IHV A;  3LCA A;  5J90 A;  2I2O A;  3PZ1 A;  2P9N G;  1N4P A;  3SF4 A;  4GZ3 A;  4BES A;  2RFA A;  3L6A A;  1Q2Z A;  5BT1 A;  1IQR A;  1DNP A;  5AJL A;  4YDW A;  3LPZ A;  2P9L G;  4PH4 B;  3C98 A;  3DSV A;  3PS6 A;  3HVE A;  3E4B A;  2LXM A;  3FTV A;  4TXP A;  3IBE A;  2IFU A;  3QKY A;  4GU5 A;  1DCQ A;  4FAD A;  2V0P A;  4J8D A;  3JQ0 A;  5AQB A;  2YIN A;  4JC8 A;  5FZS A;  4EBA G;  4XX5 A;  1LF8 A;  5EX0 A;  2DYR E;  5BV1 A;  2P58 C;  3OXF A;  4HS2 A;  4K0R A;  1O1T A;  3TWR A;  3C5R A;  5KJN A;  5T3R A;  1HG2 A;  1TN7 A;  1KT0 A;  4NAC A;  2E0I A;  2ZGG A;  3I3N A;  3BQO A;  1H0A A;  2XPY A;  2EIL E;  5M72 A;  3ZN3 A;  3HYM B;  4GML A;  4U0U A;  4CYM D;  2VSY A;  4UWF A;  2PL2 A;  3FP3 A;  3CVU A;  4HQD A;  2V4H C;  2JLB A;  5ARF A;  4HLE A;  1JPL A;  1LTX A;  5BPP A;  3BG0 B;  3LEW A;  4JHK A;  2NC9 A;  1TJC A;  3ZYL A;  4HOS A;  2H6G A;  2GW1 A;  3RRU A;  1WG0 A;  5LOZ A;  2AW6 A;  2L6J A;  4LSZ E;  4N5Q A;  5A23 A;  2A5U A;  3Q9N C;  3UKR G;  3ABK E;  4KYO B;  1TNZ A;  2DVW A;  2WXK A;  3V2X A;  2YNQ A;  5ITZ F;  2IF4 A;  1N95 A;  3L22 A;  3NZS A;  1S70 B;  3D9M A;  3APD A;  3ZHE A;  1JCR A;  2QYJ A;  4C0M A;  2OND A;  4GCN A;  3MKQ B;  4BTA A;  3Q5M A;  1N4S A;  1EF1 C;  4JVS A;  4PDX A;  2FEZ A;  1HF8 A;  3UT8 A;  2PNN A;  3AS4 A;  4I1M A;  4LCT A;  4ILI A;  4APO A;  3CLJ A;  2L6B A;  4NUR A;  3T8K A;  3ISM C;  3ZXP A;  3C3O A;  2ZGD A;  2OCC E;  5FQ8 A;  5BW8 C;  4GPK A;  2J4B A;  4FHJ A;  3LS8 A;  3CVX A;  4UI9 K;  1OCR E;  4F1S A;  3TG4 A;  2WXP A;  1YYH A;  2X6I A;  5BXU A;  1MX2 A;  4LG6 A;  3AAA C;  3DRA A;  3DEP A;  4HOR A;  3TWS A;  3FU6 A;  2ETC A;  2R05 A;  4IN3 B;  5JA4 D;  3UT4 A;  1MYO A;  3Q15 A;  5AN8 A;  2C0M A;  1O5M A;  5CED B;  1TN8 A;  3MCX A;  3HXF A;  2WXH A;  4I6E A;  2XRZ A;  1DVP A;  3EU9 A;  5BV0 A;  3T8M A;  4JHR A;  3ASG A;  5EYP F;  3ASO E;  1W3B A;  3JXI A;  1HXI A;  2PQN A;  3Q78 A;  3KAE A;  3Q7F A;  4LNB A;  1H6O A;  3HVE B;  2P9I G;  2F8X K;  2J4D A;  5KCM A;  1FCH A;  4JB8 P;  3ZNG A;  1SA5 A;  3UXG A;  3IV0 A;  4GMJ A;  4BT8 A;  1SVX A;  5KJK A;  3L08 A;  2H6I A;  1E8Z A;  4JXT A;  3CSF A;  3DSU A;  4FHK A;  4CT0 A;  1H2T C;  3CVY A;  1Z3X A;  3SGH A;  2DYS E;  3K9I A;  4UI9 C;  3SFY A;  4XI0 A;  4OAU C;  3FU5 A;  4PS8 A;  3FUJ A;  4BT9 A;  4K5A B;  3SO8 A;  3HXE A;  5AEN A;  3B13 A;  1FT2 A;  3FTU A;  4HI9 A;  1ELK A;  4FA6 A;  3ASF A;  3HXB A;  4BER A;  3U64 A;  4LUN U;  4I6G A;  3FH8 A;  3E33 A;  2AXU A;  4GTS A;  1KZO A;  4URK A;  4GTR A;  5C2Y A;  5HKP A;  2OOE A;  4IUL A;  4ATZ D;  5DIZ A;  5E75 A;  1H2V C;  3U66 A;  5EIB E;  4APF A;  3LJN A;  5ENN A;  1BD8 A;  4N3B A;  3CK7 A;  2XEN A;  3C3Q A;  4GAA A;  1HH8 A;  3E37 A;  2QFC A;  4AY5 A;  4XZ4 A;  3CKB A;  2LNI A;  3UQ3 A;  4GTP A;  4F7A A;  2I9C A;  5CMY A;  1BPO A;  2DCP A;  4B89 A;  2X38 A;  2F8Y A;  3D9L A;  1N0R A;  2BED A;  2F0Y A;  1NA3 A;  4YDY A;  5FT9 A;  3ZHE B;  1H2U A;  2Y1L E;  5FQ6 A;  5E76 A;  4XE0 A;  3QAR A;  3WXX A;  3NB2 A;  1N11 A;  3Q75 A;  4KZC A;  3ABM E;  5LFA A;  4DK5 A;  4G24 A;  1H6P A;  4L9P A;  1OCO E;  4AV7 A;  3S7B A;  3F6Q A;  2L0T B;  1SZA A;  3FUN A;  1IKN D;  4JL0 A;  3TG5 A;  3DBS A;  5FWQ A;  4U96 D;  1Z5S C;  3ML9 A;  2KZT A;  1NFI E;  3RAU A;  3MEK A;  4GTT A;  3R9A B;  3FUI A;  3DSX A;  3SY2 A;  2VTB A;  1MQS A;  4GA1 A;  2MRI A;  3D9J A;  2WXG A;  4GTO A;  2B0O E;  1E8X A;  1KLX A;  2KBX A;  5BUZ A;  4C9B B;  3QWV A;  1Z3Y A;  4EBA A;  2J07 A;  2IO3 C;  3MYV A;  3RJV A;  5KNG A;  2KCV A;  3APC A;  3GYZ A;  2Y4U A;  2KC7 A;  3E30 A;  3Q4A B;  4CT4 A;  5AQA A;  4I17 A;  2IOL A;  1Z6T A;  3FTY A;  1SA4 A;  3D9I A;  5B1B E;  4KVM A;  5EID A;  4DLO A;  4U95 D;  5D0O D;  1IQU A;  5AAO A;  3D9O A;  3FFL A;  5LX8 A;  4I43 A;  4GYO A;  4HOT A;  3D9N A;  1EYH A;  1VDY A;  4A1S A;  4LNG A;  4V3I A;  3FU3 A;  3MKR A;  3Q73 A;  4P29 A;  4L7T A;  3MJW A;  1AP7 A;  3CEQ A;  3GW4 A;  2L9B A;  3NZU A;  2VSO E;  4UQY A;  4DX6 D;  1B89 A;  3MV3 B;  3AS5 A;  4AM9 A;  3FH7 A;  4JA7 A;  3EU5 A;  2WPV A;  5EDS A;  2WMO A;  4H7Y A;  4OVU A;  3QC1 A;  2HE0 A;  5D0Q D;  3QOU A;  4NRH B;  5KJM A;  3B7T A;  4GMR A;  3HXC A;  3CST A;  3AG2 E;  4ACK A;  3DWL G;  4DX7 D;  5G04 J;  4ACL A;  2GRM A;  5JJ6 A;  4TUM A;  3UKU G;  5LCW C;  1OT8 A;  3CVW A;  5CCM A;  2PM7 A;  4J7W A;  1OUV A;  3B95 A;  4GZ6 A;  5B3S E;  1BU9 A;  1MJ0 A;  3UIO C;  2GRL A;  4I2Z A;  2LAH A;  2PM6 A;  4FJY A;  3EUV A;  3N71 A;  4U7E B;  1LD8 A;  1N0Q A;  3RSE G;  4K5B A;  3L13 A;  3TWU A;  2XHE A;  2UY1 A;  1ZB1 A;  3EHR A;  2Y4T A;  3MX3 A;  1E96 B;  5CER B;  1OWP A;  5KBA A;  4K03 A;  4QFV A;  2KXP C;  2A4Z A;  4J8E A;  2C2L A;  3DPD A;  4G8L A;  2ETB A;  1IHG A;  3I5P A;  3CHQ A;  1L5J A;  3ZW3 A;  3FTW A;  3CR3 A;  5EN5 D;  3ZYK A;  4FP7 A;  2WQ7 A;  2RG8 A;  3AG1 E;  1S0P A;  2QC9 A;  4PS7 A;  5FTP A;  3QWP A;  3OXG A;  2MYO A;  4HFG A;  4U04 A;  3EIQ C;  2LO6 A;  3KEA A;  4F1P A;  3KSL A;  1IYG A;  4EHM A;  4J8Y A;  2KZT B;  3I4G A;  3PEU B;  3UIP C;  2GRP B;  1SW6 A;  3FEX A;  4BX8 A;  3B7S A;  4LER A;  1K3Z D;  1PY1 A;  2ZIS A;  2VTB B;  3VLE A;  3CQC B;  4HRM B;  4L2Y A;  5BNW A;  2IJG X;  1FT1 A;  1RW2 A;  3TJP A;  4Q94 A;  1OWO A;  4E6H A;  2X3M A;  3RU0 A;  5ENP D;  3U9W A;  2BUG A;  3EHN A;  3V2O A;  2A5E A; 
#chains in the Genus database with same CATH homology
 4HRN A;  4RLY A;  1N0Q A;  3W9G A;  2DZN A;  2L6B A;  3HG0 D;  5EIL A;  3TWR A;  4BSZ B;  3AJI A;  3C5R A;  3T8K A;  1N11 A;  4OAU C;  2ETA A;  5HRY A;  4K5B A;  3TWU A;  1BI7 B;  5EID A;  4HBD A;  2XEE A;  4NIK A;  4BET A;  1DC2 A;  3EHR A;  2ZGD A;  5CER B;  4K5A B;  3D9H A;  3SO8 A;  2NYJ A;  5BXO A;  2XEH A;  3J5P A;  4U95 D;  5KBA A;  5ENS D;  4Z68 A;  4HI8 A;  5AAO A;  4F6R D;  4QFV A;  2BKG A;  4U8Y D;  2ZGG A;  2KXP C;  4HB5 A;  3HRA A;  3JUE A;  3JXJ A;  4HI9 A;  4G8L A;  1YYH A;  4QQI A;  2ETB A;  4UUC A;  5AQ9 A;  5KWD A;  5BXU A;  1MX2 A;  3F6Q A;  4CYM D;  1TR4 A;  4LG6 A;  5FIN A;  5HS0 A;  5D66 A;  3AAA C;  3DEP A;  3TWV A;  2P2C P;  4BER A;  1AP7 A;  3TWS A;  1IKN D;  1YMP A;  1G3N B;  3W9F A;  4CZ2 D;  1OY3 D;  2DZO A;  4HQD A;  1D9S A;  2V4H C;  4O60 A;  5EN5 D;  1WDY A;  1MX6 A;  4C48 B;  4BES A;  2BKK B;  4DX6 D;  2ETC A;  4G8K A;  2RFA A;  3B7B A;  5JA4 D;  4U96 D;  3IXE A;  1MYO A;  2QC9 A;  5CBO A;  4A63 B;  5AAR A;  3J5Q B;  2Y0B G;  1NFI E;  4HRL A;  4K5C A;  4DUI A;  5AN8 A;  2RFM A;  3TWT A;  1WG0 A;  5HKP A;  5CED B;  3ZUV B;  1BLX B;  2MYO A;  4LSZ E;  3T9K A;  3TWW A;  4ATZ D;  1YCS B;  3KEA A;  4HNA D;  4N5Q A;  4YDW A;  3ZKJ A;  4DRX E;  4F1P A;  4U8V D;  1A5E A;  4DX2 A;  3DEO A;  5EIB E;  5ENQ D;  3Q9N C;  1BI8 B;  1AWC B;  4J8Y A;  3EU9 A;  3LJN A;  4B93 B;  3NOC D;  1BD8 A;  3EHQ A;  2DVW A;  1SW6 A;  2HE0 A;  5EYP F;  3V2X A;  3NBN B;  3JXI A;  5ENR D;  3V30 A;  3TWX A;  2XEN A;  2B0O E;  2J8S D;  3UI2 A;  3UTM A;  4ZHB A;  1K3Z D;  5ITZ F;  2KBX A;  4O1P A;  1QYM A;  4GMR A;  4GPM A;  2JAB A;  5FIO A;  1S70 B;  1DCQ A;  4DX7 D;  2DWZ A;  4HRM B;  3ZU7 B;  4DX5 D;  1IHB A;  1MX4 A;  4TUM A;  2QYJ A;  2F8X K;  4DX1 A;  2VGE A;  2XZT G;  5ENO D;  1IXV A;  1OT8 A;  4JB8 P;  4O1O A;  4ZFH A;  3Q9U C;  5AQB A;  3ZNG A;  4J7W A;  5KNG A;  4LNU D;  1UOH A;  3UXG A;  3B95 A;  4HLL A;  5JMN D;  1SVX A;  2FO1 E;  2F8Y A;  5CBN A;  5CEA A;  1N0R A;  5AQ7 A;  4OAV B;  3V31 A;  1BU9 A;  2PNN A;  1K1A A;  3V2O A;  4YDY A;  5KNH D;  4BEP A;  5CEC B;  2XZD G;  1MJ0 A;  3V79 K;  3NOG D;  2F37 A;  2Y1L E;  5ENP D;  5ENT D;  5AQA A;  2V5Q C;  1K1B A;  2AJA A;  5EYL A;  2A5E A;  3TWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...