5AARA

Structure of the ankyrin domain of an arabidopsis thaliana potassium channel
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
185
Chain Sequence
LPLNLCFAAIREDDLLLHQLLKRGLDPNESDNNGRTPLHIAASKGTLNCVLLLLEYHADPNCRDAEGSVPLWEAMVEGHEKVVKVLLEHGSTIDAGDVGHFACTAAEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIEMVKYLLEQGADVNKQDMHGWTPRDLAEQQGHEDIKALFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POTASSIUM CHANNEL AKT1
publication title Structure of the Ankyrin Domain of Akt1
rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 62
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5aarA00
4U96D 3JUEA 5KWDA 5ENSD 1S70B 2F37A 4QQIA 5AQAA 4N5QA 5KBAA 4TUMA 5ENOD 3IXEA 1MYOA 1SVXA 5AAOA 3W9FA 3ZNGA 2ZGGA 4QFVA 4U8YD 2HE0A 5KNHD 3HRAA 1AWCB 3J5PA 4HRNA 2F8YA 4A63B 2B0OE 5ENTD 4DX1A 3C5RA 4HBDA 1BLXB 5EILA 5AARA 5JA4D 3V79K 2DZOA 4YDWA 2FO1E 3JXJA 3T8KA 5ENQD 2ETAA 2V5QC 4LNUD 2XEHA 2XEEA 3DEOA 5KNGA 3EHRA 1G3NB 2KXPC 3HG0D 3TWTA 4U95D 3V2XA 1UOHA 2QYJA 2NYJA 3F6QA 4LG6A 4B93B 1SW6A 4J7WA 1WDYA 4BSZB 2MYOA 4K5BA 3D9HA 1OT8A 5ITZF 5AQ7A 5BXUA 2XZDG 3J5QB 2ETBA 2ETCA 1YCSB 4HRLA 4DX2A 1TR4A 3Q9NC 5CERB 5CBOA 3NBNB 1AP7A 5FIOA 2F8XK 1DCQA 2RFMA 3UXGA 2P2CP 3TWVA 1MJ0A 4DX7D 2AJAA 4OAUC 2Y0BG 4ZFHA 3NOGD 3Q9UC 3AAAC 5D66A 3SO8A 1MX4A 5EYLA 5FINA 5HS0A 1N0QA 3ZKJA 4ATZD 5EIBE 1MX2A 2RFAA 1A5EA 4BETA 3ZU7B 5HRYA 2QC9A 4DRXE 5CEAA 4RLYA 1YYHA 3UI2A 1K3ZD 5AQ9A 4BEPA 1K1AA 1N0RA 3JXIA 4HB5A 4HI9A 4DUIA 5ENRD 1WG0A 2VGEA 3EHQA 4Z68A 4HNAD 4K5CA 4HRMB 2ZGDA 2V4HC 3TWWA 4JB8P 3V30A 5CEDB 4UUCA 5AQBA 1IHBA 4K5AB 5EIDA 5HKPA 1BU9A 4OAVB 2DZNA 4CZ2D 1MX6A 4F6RD 4DX5D 1N11A 4YDYA 3AJIA 3TWQA 3TWRA 3TWXA 1D9SA 4HI8A 2A5EA 3B95A 2DVWA 1BI8B 4G8KA 4G8LA 4HQDA 4F1PA 3NOCD 2PNNA 4HLLA 2JABA 3T9KA 1YMPA 4U8VD 3EU9A 3V2OA 1K1BA 3W9GA 4BESA 5BXOA 1IXVA 4BERA 5EN5D 3DEPA 2L6BA 4GPMA 1BD8A 3UTMA 5JMND 3V31A 3TWUA 5AN8A 4CYMD 2Y1LE 4DX6D 4C48B 2XENA 5CBNA 2J8SD 2BKGA 1NFIE 5EYPF 2KBXA 4LSZE 4O1OA 1QYMA 4O60A 1DC2A 3B7BA 2XZTG 4NIKA 5CECB 3ZUVB 2BKKB 1BI7B 4GMRA 1IKND 5ENPD 4ZHBA 3KEAA 3TWSA 4O1PA 1OY3D 3LJNA 4J8YA 2DWZA
chains in the Genus database with same CATH superfamily
5M72A 4CGVA 1MYOA 4FLHA 1FVFA 2CFUA 2E2EA 2NC9A 2F8YA 3AU5A 4A63B 4JHKA 4I1AA 2HM8A 3BG1B 2VTBA 1H2UA 2WQ6A 3TG4A 1Z6TA 3SZ7A 4HOUA 5DIZA 4GMLA 4D10C 4PS8A 2LXMA 3ASDA 1N4QA 2Q7FA 3E4BA 1HO8A 5T4YA 2VGYA 1FT1A 4DX2A 1Y6IA 3NBNB 1N52A 2KCVA 3E34A 4KZCA 2AJAA 1NP7A 2V4LA 2KATA 3QNKA 4ANUA 5FINA 4XZ4A 2WXQA 4G25A 2L6JA 3UT8A 4B8CB 3ZFWA 2RD0A 4OVVA 3EHNA 4JA9A 2V4HC 3FDHA 4UUCA 4WWNA 3MEKA 3GW4A 3TWQA 3FHEA 4U0UA 2QZAA 1ZBPA 2J49A 3ULEG 5CRUA 2XCBA 3P2BA 3EUVA 2JABA 4TXRA 5BXOA 4EPZA 4BERA 4JW1A 5C1DA 2MHKA 2PM6A 2DCPA 2WXNA 3PUKA 1DC2A 2KBXA 3FEYA 4O1OA 5LOZA 4L1BA 2OV8A 3UM0A 3ZUVB 3X2QE 1BI7B 1UJJA 4CRWA 3TWSA 1N54A 3Q15A 3SQVA 5EKQD 4APOA 4FU3A 4JEUA 2VTBB 4JVSA 2NXPA 4XI9A 2B0OE 3FU5A 4YDWA 2WXOA 2X6JA 3QJZA 4U63A 1KZPA 2XEEA 1G3NB 4K0RA 3RO2A 3SFXA 4JEHA 3DXMG 3EU5A 1WDYA 5HI7A 3CSFA 1DNPA 1QNFA 4I1MA 4DX7D 5KJLA 3AG1E 4ILHB 5HS0A 2OEWA 5HRYA 3ZVVA 2A5UA 2J4DA 3KEZA 4OYSA 4M3OA 2VQ2A 3R7RA 3LJ3A 4GA0A 3TWWA 5CEDB 3L17A 4GTPA 3IKOB 3RIBA 5G55A 3LVQE 1MX6A 1OXJA 5FQ6A 1HFAA 4DI3A 3NZSA 2AXZA 3KSQA 4NQ0A 2I1JA 3O48A 2VGXA 3TWUA 4XKBA 4NRHB 3ULQA 4C48B 3ZYMA 4PH4B 3TG5A 1KT1A 5G05J 3WXXA 3UKUG 4KVOA 3ZPJA 2J08A 4UQZA 4QQIA 1PY1A 4UQXA 1D8DA 3CIAA 4U8YD 5KCMA 2FF4A 3C3RA 5ENTD 3FH7A 2DZOA 2R2LA 5BNWA 4F3VA 4J8EA 1JCQA 3DBSA 3ZW3A 4TV3A 3V2XA 4GTMA 3CHQA 3TXNA 3B7UX 2LXLA 5JHAA 4GCNA 4GYYA 3IEGA 5H7PA 1E8YA 3SFZA 3UXGA 4TXPA 4F53A 3SO8A 3LEWA 4HB5A 3AS4A 2WXPA 4EZLA 4CDNA 3CR3A 3ABKE 3Q75A 1TN6A 3U4TA 2B6CA 1TNBA 2XS1A 3CHMA 1HS6A 1RW2A 3CVNA 4GTTA 1UN9A 3DEPA 1BD8A 2XS8A 4JHRA 5AN8A 4FJZA 5G05C 3RJVA 3PEUB 3ASOE 1KZOA 4U0SA 5B1AE 5ENPD 4ACLA 4OVUA 4WAFA 5KWDA 4BY6A 3UM3A 3GYZA 1X81A 3SD5A 3HRAA 4KT6B 3RSEG 4RG9A 2HYZA 2V8SE 3PDNA 4AM9A 4FJYA 2XEHA 3PZ3A 3EHMA 3MCXA 1WM5A 1PC2A 2Y4TA 3LXUX 4BFRA 3B7RL 4J0UA 5ITZF 1QZ2A 5FTPA 2ETCA 1JWFA 3B7SA 4Y6CA 3D9PA 2CG2A 1DCQA 2E0IA 4PS7A 1MJ0A 4FHKA 4YVQC 1N94A 5LCWJ 1K3ZD 4Q94A 1K1AA 3LY8A 3OAWA 3EHQA 4Z68A 5BUZA 3IHYA 4ATGA 5CHEE 1V54E 1P5QA 2PM7A 1H0AA 5KJKA 3ENEA 2CHWA 3SNXA 4HQDA 4F1PA 4MKTA 3FUHA 4UWFA 2J4BA 1HF8A 1IYGA 4E6HA 3C72A 1IQRA 4J8FA 4GA2A 4O60A 3B7BA 5CECB 3IBEA 4PDXA 3RU0A 4ZHBA 3IV0A 5FZRA 4C0EA 2PQRA 4C0MA 3BEEA 3URZA 2H6HA 5EIDA 4U96D 5ENSD 4LNBA 4YNDA 1L5JA 1HX8A 4BX8A 1SVXA 2ZGGA 2IOLA 3UM2A 3E33A 3QWVA 1BLXB 4ANWA 2FO1E 4JZYA 4L23A 4LNUD 4U95D 4Y6WA 3FP3A 2I9CA 3F6QA 3HXEA 1XNFA 4J7WA 4I1OB 3Q5MA 4ABNA 4KVMA 3UIPC 5LCWC 4NACA 1WAO1 3AAAC 5ANRA 4AIFA 4H7YA 4BETA 4BTBA 2KCKA 1S63A 1HG5A 2FO7A 3G2WA 4JXTA 3JXIA 4GMJA 1OUVA 2I2OA 1X5BA 1E7VA 4K5CA 4ANXA 3MKQB 4HOTA 3HDXA 2R5SA 5LP0A 4CCAA 2AWIA 4L9PA 3K9IA 3OXFA 1N11A 2EILE 4YDYA 5CRVA 1SQMA 2P9IG 4YDOA 3B95A 2DVWA 3JCKC 2WM9A 3BQOA 1VDYA 1W3BA 5CCMA 3ZHEA 1O1RA 3D9LA 3CVQA 4ANVA 1D8EA 1HE8A 2MOWA 4TXQA 5B1BE 3ASNE 2A4ZA 4R7LA 3G2TA 3FU0A 1FVHA 3C3QA 3TGOA 3ZRHA 4EECA 2EINE 3PZ1A 2X6HA 3CQGB 4A1SA 4HORA 3RKVA 5E76A 3QOUA 2DYRE 2WXGA 2HO1A 3TWTA 1UN8A 3UQ3A 1UOHA 4PUCA 4BSZB 2MYOA 2C0LA 3CVVA 5BXUA 3Q4AB 1S0PA 2X6IA 1TNOA 2F8XK 5BV1A 3I3NA 3ZKJA 4AVXA 1A5EA 3ZU7B 4AV7A 3D9KA 5CEAA 1HU3A 1YYHA 4G1TA 3MZLB 3UI2A 2R17C 3AS5A 2VGEA 4TRQA 4MS6A 2C0MA 2Y4UA 3V30A 2J9QA 1JCSA 3QARA 4CZ2D 4F6RD 2WVIA 4H7XA 3SBTB 3SI5A 4NURA 5CMYA 2R59A 3FUIA 3CHSA 3ZHEB 3AS8A 4WWPA 3V2OA 3PREA 1A17A 2JLBA 4L2YA 3ESKA 2WXIA 2ZIRA 2UY1B 4AEZC 2CFZA 2LNIA 4JPSA 3Q7AA 4RSYA 4UI9K 5KBAA 4N5QA 2BUGA 4XIFA 3L13A 3CVXA 3D9IA 3PH0C 1AWCB 2XPIA 3J5PA 3R9MA 2IJGX 3NQPA 3L54A 3HYMB 2H6GA 1HG2A 1OCOE 1MQSA 1ELKA 1H19A 1H2VC 3DSUA 4LERA 4KZ0A 1H2TC 3CEQA 3DSTA 4IYPA 4IN3B 4A55A 1UW4B 4GB9A 2IQCA 4B93B 2CHXA 4GTQA 3UPVA 1Z3XA 3PE3A 2XHEA 1JWGA 3OTNA 1AP7A 3G2UA 1QBQA 3JUIA 3D9OA 5FZQA 2XPZA 1MX2A 1EPUA 2MRIA 4RLYA 3O4ZA 4EZKA 3FTUA 3SGHA 5JHBA 3RO3A 4DUIA 4JB8P 2GW1A 3Q78A 5C2YA 4P29A 2I6HA 3NZUA 3IHVA 2IONA 1SZ9A 3UX4A 4U8VD 4CDMA 4UWLA 3V31A 4IRUA 4GZDA 3R7QA 4HLEA 3PVLA 4BTAA 2WXLA 3RRMB 4N2QA 5EX0A 3FUKA 3FUMA 3UINC 4HOQA 1K8KG 3W9FA 2P9UG 4CGWA 4MBGA 3E32A 3RRNB 4HRNA 3CVLA 4DX1A 3FUNA 5AARA 1DVPA 4V3IA 3HXBA 4EBAA 4FP7A 2R05A 1U3CA 4HOSA 2H6FA 2IOSA 1N4PA 4KBQA 3D3MA 1TEZA 1E8WA 1PAQA 1TR4A 2KM4A 4GAAA 2FBNA 2R02A 3CLJA 1U3DA 4J8DA 5FQ8A 4YDEA 3FFLA 4Q96A 4GZCA 3LPZA 3NF1A 2QYUA 4HFGA 5KJMA 5A23A 2LUHA 2P9KG 4WNGA 4GZ6A 4DLQA 2XPYA 2VSYA 2VSOE 4XE0A 3AJIA 4U04A 4HVBA 4M7CA 2GRMA 4I2WA 1IXVA 2FULA 2WXMA 3CVWA 4G11A 3WG7E 5JMND 1KPSB 2Y1LE 3DSXA 5CCLA 2VSNA 1QYMA 3PEVB 3SFYA 4G23A 3MYVA 3JYSA 3LDZA 4XEIG 3IXEA 4EBAG 1TNUA 3ZEFA 3FU3A 1TJFA 2IO2C 3U64A 4A3VA 3NB2A 1IHGA 5FZSA 2OCCE 1KLXA 3D9NA 5KNGA 3DXKG 5AJLA 4AY6A 1Q2ZA 4GTSA 3HIZA 1OT8A 1E96B 5AYWD 4RQIA 3VTXA 3GZSA 3TWVA 4RG6A 3NOGD 3ASHA 3HHMA 3B13A 4DRXE 3QKYA 3ONKA 3JQ0A 1QQEA 2DIWA 3SY2A 1E8XA 1RZ4A 5G04J 3OXLA 3T5VA 1UJKA 4JD2G 4DX5D 3LS8A 4GYOA 3FY4A 5ARGA 2R03A 2NSZA 4EHMA 2EQXA 4N5CA 3T5XA 5LX8A 3W9GA 2ILRA 4LUNU 1YA0A 2X38A 3APDA 4FC8A 3CGHA 4I6GA 1NA0A 2VJ8A 5EYPF 3SHFA 3MKQA 2GRLA 3CVUA 5JJTA 3Q49B 3CK7A 2P9SG 3CK9A 5AQAA 3DPYA 2VSXE 2WXKA 2P9NG 4N39A 1TN8A 2ZISA 3T8KA 3QWPA 3CVPA 4L2LA 5BT1A 2M63A 4WNEA 4F1SA 3PS6A 5AQ7A 1UG3A 4HXIA 5JJ6A 4U8HA 4I9CA 1TJCA 2QFCA 2OVFA 2P2CP 3G2SA 2IEJA 3L08A 2QC9A 2UWJG 3KD7A 4O6FA 5FQ7A 3R9AB 5G04C 5ENRD 4G2VA 4HS2A 3FUJA 5HQ8A 2XEVA 3ESLA 2AXVA 3PNTB 1KT0A 3MGBA 1IHBA 4GZ3A 4I17A 1OWNA 2EIME 3KSLA 1OWPA 3L6AA 4AOFA 1D9SA 1SZAA 4E85A 1TYQG 1MHQA 4G8KA 1BI8B 2X3MA 4HLLA 4JC8A 1YMPA 4A3TA 4F7AA 4RVBA 5EN5D 3VLFA 2L6BA 1ELRA 4UI9C 4GA1A 3I4GA 4CYMD 3LYAA 1EDUA 3AG2E 5AIJA 2IFUA 4LSZE 2KZTB 3EJNA 5BPPA 4FHJA 3PUJA 4GMRA 3UT7A 4DLOA 1E90A 3HVEA 1S70B 3RK6A 3NAWA 4ME2A 2LAHA 4DJAA 5FT9A 4UWHA 3MX3A 4MRUA 2WXJA 2WXFA 5KJNA 4GTOA 4ILIA 3PE4A 3S2AA 5BW8C 5JA4D 3L9TA 2OVBA 1JPLA 2WQ7A 3CKBA 4A1GA 4I43A 1N9AA 2UY1A 2P58C 3D9JA 4LCTA 2OOEA 2L9BA 3J5QB 2GROB 3MV2B 2CHZA 2RFMA 3BU8A 4B0ZA 4AP2A 3Q79A 5D66A 1MX4A 1JCRA 5B3SE 2AW6A 3ZXSA 5AQ9A 3FTWA 1XGWA 3CV0A 2L0TB 3ASGA 3CVYA 2AVPA 3FH8A 2EIKE 5HKPA 1BU9A 4OAVB 2LSVA 5A7DB 3TWRA 3TWXA 4CT4A 3T9KA 4GCOA 1NA3A 4N3AA 5ANLA 3D9MA 1NZNA 4N3BA 3S7JA 4GPMA 3UTMA 4FADA 3ABME 2XENA 4JA7A 1N4SA 2BKGA 1NFIE 2PZIA 1GW6A 3P1UA 1V55E 3RAUA 3HVEB 1ZU2A 1EYHA 3E37A 3Q7FA 3JUEA 5LFAA 1Z3YA 4TUUA 4TUMA 3CSTA 3ISMC 4YVOA 1OCZE 2CG3A 4KMOA 5KNHD 3S7FA 3SF4A 3FWVA 4HBDA 3AG4E 3UM1A 3DRAA 5ENQD 1HZ4A 2DBAA 2KXPC 3FUDA 3UUXA 2WMOA 4FLBA 1U2VG 2RG8A 4EZJA 3DPDA 1SW6A 4CDRA 2X6FA 3ML9A 2ETBA 3Q9NC 5FIOA 4BT9A 3DSWA 5ENNA 3CHRA 5EYLA 4Q69A 3E30A 3CKCA 4HI9A 2F0YA 2LAIA 4WNFA 4XKCA 3PZ4A 3PZ2A 3FEXA 4I2ZA 2C2LA 3MA5A 4G8LA 3I5PA 1LD8A 4W9RA 3MJWA 3ULYA 2BTDA 3MV3B 1OCCE 1OWOA 4DX6D 3I4RB 4UWGA 2PQNA 4GTRA 3S7DA 4NIKA 3LY9A 4U07A 2BKKB 3MKRA 3QB2A 3TXMA 2Y69E 1OY3D 5G2NA 2GRNB 1S64A 5ARFA 3FTXA 3UIOC 3EIQC 2YNQA 2LO6A 4IULA 2ZXWE 5AENA 2HE0A 4N3CA 2GRPB 3DWLG 2XGOA 3V79K 5EILA 3UT4A 2XRZA 3VLEA 2J09A 1H6KA 3RRUA 4AXHA 3DEOA 3HG0D 4GU5A 3DSSA 3DSVA 3D9HA 3ASFA 4GTVA 5CBOA 1H6PA 3QDNA 3CK8A 4LEUA 3Q9UC 3T8MA 2PL2A 3ML8A 3LKUA 1Z5SC 5A6CA 2P9LG 4MLPA 2WB2A 2XRYA 4C9BB 4HRMB 2BF0X 1LD7A 2IO3C 3LY7A 2WXHA 2VYIA 2GRQB 4ACKA 1MZCA 3JQ1A 1OCRE 1FPPA 3ZIMA 2A5EA 5E75A 2XGMA 2PNNA 3CQCB 5IY5E 1H6OA 4DPRA 3L82A 5FQ4A 1NL4A 3VLDA 5JJ7A 2LSUA 3APFA 3L22A 4B94A 3B7TA 3FTVA 4I6JA 4LNGA 1IQUA 3KEAA 1LTXA 4O1PA 1Y8MA 4J8YA 4GZ5A 1HH8A 4BWRA 3VTYA 4LRZA 3ZNGA 4QFVA 3FULA 4EQFA 3BUAA 3S7BA 2FEZA 2ETAA 2V5QC 4BX9A 2YINA 2NYJA 3OXGA 4LG6A 3L16A 5J08A 3U66A 4HRLA 3GZ2A 3C98A 1EF1C 1SA5A 3FTYA 3FH5A 1INZA 2Y3AA 5EIBE 2V5FA 4B89A 3HXDA 3ZN3A 2VGXB 1B89A 4BEPA 5D0QD 4KXKB 4DI4A 3TAXA 1E7UA 2IF4A 2YQ8A 4GPKA 2P9PG 4WNDA 3U9WA 4APFA 3G2VA 3QK0A 4BT8A 2XGSA 3EU9A 3Q47B 1K1BA 4I6EA 2FI7A 4UQYA 4JL0A 1FT2A 4DK5A 2QY7A 2OEVA 2HR2A 1E8ZA 5CBNA 2J8SD 5D0OD 1SA4A 2XZTG 3Q73A 3FTZA 5CMWA 2L0IA 3HXCA 3LJNA 3U3WA 3QAQA 5EDSA 4U7EB 3FU6A 4X8QA 3SBSA 4XX5A 3BG0B 5FJYA 1OWMA 4UI9J 2DYSE 3ZGQA 5FWQA 3ZYKA 5T3RA 2KZTA 1ELWA 5EX3A 3FUEA 4ILGA 1OWLA 2XZDG 3FUFA 1YCSB 5CERB 4URKA 3ZYQA 4OAUC 4ZFHA 4ATZD 1N0QA 4XI0A 2RFAA 3EIJA 3UKRG 2ZU6B 3HXFA 5BV0A 2V0PA 1N0RA 4G26A 1WG0A 4HNAD 2ONDA 4BSXA 1O1TA 2I1KA 2ZGDA 4JHJA 5AQBA 2DZNA 2IU1A 3ZYLA 3QWWA 4FA6A 2BEDA 1HXIA 1N95A 3CHOA 1JUQA 4BESA 4GYWA 2GGFA 3FTSA 1O1SA 2H6IA 3C3OA 2AXUA 1O5MA 4J6IA 2WPVA 4N2SA 2XQ0A 1IKND 3PNLB 3APCA 2F37A 3QC1A 1BPOA 5ENOD 4AJWA 1WY6A 5AAOA 3LCAA 1N4RA 1ZB1A 2YHCA 2WQHA 3ONLA 3C5RA 3JXJA 4CEMA 4WWOA 3EHRA 3ZXPA 3AG3E 3EDTB 2JEKA 2QYJA 1TN7A 5D2MC 3PZDA 2IY0C 4K5BA 2EIJE 4PS3A 3TJPA 3PRZA 4CT0A 2RKKA 2YHEA 2WXRA 2Y0BG 5AJDA 3LVRE 1FCHA 3KAEA 3GZ1A 1LF8A 3ABLE 3TL5A 2KC7A 4KYOB 5DBKA 2X6KA 3AU4A 4B8AA 1TNYA 4K5AB 3CHPA 1DCEA 2GRRB 2J07A 4L7TA 4HI8A 4UWKA 4FULA 3NOCD 2XCCA 4J8SA 2KCLA 4WUYA 4I9EA 1TNZA 3N71A 4U0ZA 1NI1A 3UMVA 2WMNA 5J90A 4K03A 4G24A 5T8IA 3KS2A 4AY5A 2DWZA
chains in the Genus database with same CATH topology
4U96D 3JUEA 5KWDA 5ENSD 1S70B 2F37A 4QQIA 5AQAA 4N5QA 5KBAA 4TUMA 5ENOD 3IXEA 1MYOA 1SVXA 5AAOA 3W9FA 3ZNGA 2ZGGA 4QFVA 4U8YD 2HE0A 5KNHD 3HRAA 1AWCB 3J5PA 4HRNA 2F8YA 4A63B 2B0OE 5ENTD 4DX1A 3C5RA 4HBDA 1BLXB 5EILA 5AARA 5JA4D 3V79K 2DZOA 4YDWA 2FO1E 3JXJA 3T8KA 5ENQD 2ETAA 2V5QC 4LNUD 2XEHA 2XEEA 3DEOA 5KNGA 3EHRA 1G3NB 2KXPC 3HG0D 3TWTA 4U95D 3V2XA 1UOHA 2QYJA 2NYJA 3F6QA 4LG6A 4B93B 1SW6A 4J7WA 1WDYA 4BSZB 2MYOA 4K5BA 3D9HA 1OT8A 5ITZF 5AQ7A 5BXUA 2XZDG 3J5QB 2ETBA 2ETCA 1YCSB 4HRLA 4DX2A 1TR4A 3Q9NC 5CERB 5CBOA 3NBNB 1AP7A 5FIOA 2F8XK 1DCQA 2RFMA 3UXGA 2P2CP 3TWVA 1MJ0A 4DX7D 2AJAA 4OAUC 2Y0BG 4ZFHA 3NOGD 3Q9UC 3AAAC 5D66A 3SO8A 1MX4A 5EYLA 5FINA 5HS0A 1N0QA 3ZKJA 4ATZD 5EIBE 1MX2A 2RFAA 1A5EA 4BETA 3ZU7B 5HRYA 2QC9A 4DRXE 5CEAA 4RLYA 1YYHA 3UI2A 1K3ZD 5AQ9A 4BEPA 1K1AA 1N0RA 3JXIA 4HB5A 4HI9A 4DUIA 5ENRD 1WG0A 2VGEA 3EHQA 4Z68A 4HNAD 4K5CA 4HRMB 2ZGDA 2V4HC 3TWWA 4JB8P 3V30A 5CEDB 4UUCA 5AQBA 1IHBA 4K5AB 5EIDA 5HKPA 1BU9A 4OAVB 2DZNA 4CZ2D 1MX6A 4F6RD 4DX5D 1N11A 4YDYA 3AJIA 3TWQA 3TWRA 3TWXA 1D9SA 4HI8A 2A5EA 3B95A 2DVWA 1BI8B 4G8KA 4G8LA 4HQDA 4F1PA 3NOCD 2PNNA 4HLLA 2JABA 3T9KA 1YMPA 4U8VD 3EU9A 3V2OA 1K1BA 3W9GA 4BESA 5BXOA 1IXVA 4BERA 5EN5D 3DEPA 2L6BA 4GPMA 1BD8A 3UTMA 5JMND 3V31A 3TWUA 5AN8A 4CYMD 2Y1LE 4DX6D 4C48B 2XENA 5CBNA 2J8SD 2BKGA 1NFIE 5EYPF 2KBXA 4LSZE 4O1OA 1QYMA 4O60A 1DC2A 3B7BA 2XZTG 4NIKA 5CECB 3ZUVB 2BKKB 1BI7B 4GMRA 1IKND 5ENPD 4ZHBA 3KEAA 3TWSA 4O1PA 1OY3D 3LJNA 4J8YA 2DWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U96 D;  3JUE A;  5KWD A;  5ENS D;  1S70 B;  2F37 A;  4QQI A;  5AQA A;  4N5Q A;  5KBA A;  4TUM A;  5ENO D;  3IXE A;  1MYO A;  1SVX A;  5AAO A;  3W9F A;  3ZNG A;  2ZGG A;  4QFV A;  4U8Y D;  2HE0 A;  5KNH D;  3HRA A;  1AWC B;  3J5P A;  4HRN A;  2F8Y A;  4A63 B;  2B0O E;  5ENT D;  4DX1 A;  3C5R A;  4HBD A;  1BLX B;  5EIL A;  5AAR A;  5JA4 D;  3V79 K;  2DZO A;  4YDW A;  2FO1 E;  3JXJ A;  3T8K A;  5ENQ D;  2ETA A;  2V5Q C;  4LNU D;  2XEH A;  2XEE A;  3DEO A;  5KNG A;  3EHR A;  1G3N B;  2KXP C;  3HG0 D;  3TWT A;  4U95 D;  3V2X A;  1UOH A;  2QYJ A;  2NYJ A;  3F6Q A;  4LG6 A;  4B93 B;  1SW6 A;  4J7W A;  1WDY A;  4BSZ B;  2MYO A;  4K5B A;  3D9H A;  1OT8 A;  5ITZ F;  5AQ7 A;  5BXU A;  2XZD G;  3J5Q B;  2ETB A;  2ETC A;  1YCS B;  4HRL A;  4DX2 A;  1TR4 A;  3Q9N C;  5CER B;  5CBO A;  3NBN B;  1AP7 A;  5FIO A;  2F8X K;  1DCQ A;  2RFM A;  3UXG A;  2P2C P;  3TWV A;  1MJ0 A;  4DX7 D;  2AJA A;  4OAU C;  2Y0B G;  4ZFH A;  3NOG D;  3Q9U C;  3AAA C;  5D66 A;  3SO8 A;  1MX4 A;  5EYL A;  5FIN A;  5HS0 A;  1N0Q A;  3ZKJ A;  4ATZ D;  5EIB E;  1MX2 A;  2RFA A;  1A5E A;  4BET A;  3ZU7 B;  5HRY A;  2QC9 A;  4DRX E;  5CEA A;  4RLY A;  1YYH A;  3UI2 A;  1K3Z D;  5AQ9 A;  4BEP A;  1K1A A;  1N0R A;  3JXI A;  4HB5 A;  4HI9 A;  4DUI A;  5ENR D;  1WG0 A;  2VGE A;  3EHQ A;  4Z68 A;  4HNA D;  4K5C A;  4HRM B;  2ZGD A;  2V4H C;  3TWW A;  4JB8 P;  3V30 A;  5CED B;  4UUC A;  5AQB A;  1IHB A;  4K5A B;  5EID A;  5HKP A;  1BU9 A;  4OAV B;  2DZN A;  4CZ2 D;  1MX6 A;  4F6R D;  4DX5 D;  1N11 A;  4YDY A;  3AJI A;  3TWQ A;  3TWR A;  3TWX A;  1D9S A;  4HI8 A;  2A5E A;  3B95 A;  2DVW A;  1BI8 B;  4G8K A;  4G8L A;  4HQD A;  4F1P A;  3NOC D;  2PNN A;  4HLL A;  2JAB A;  3T9K A;  1YMP A;  4U8V D;  3EU9 A;  3V2O A;  1K1B A;  3W9G A;  4BES A;  5BXO A;  1IXV A;  4BER A;  5EN5 D;  3DEP A;  2L6B A;  4GPM A;  1BD8 A;  3UTM A;  5JMN D;  3V31 A;  3TWU A;  5AN8 A;  4CYM D;  2Y1L E;  4DX6 D;  4C48 B;  2XEN A;  5CBN A;  2J8S D;  2BKG A;  1NFI E;  5EYP F;  2KBX A;  4LSZ E;  4O1O A;  1QYM A;  4O60 A;  1DC2 A;  3B7B A;  2XZT G;  4NIK A;  5CEC B;  3ZUV B;  2BKK B;  1BI7 B;  4GMR A;  1IKN D;  5ENP D;  4ZHB A;  3KEA A;  3TWS A;  4O1P A;  1OY3 D;  3LJN A;  4J8Y A;  2DWZ A; 
#chains in the Genus database with same CATH topology
 5M72 A;  4CGV A;  1MYO A;  4FLH A;  1FVF A;  2CFU A;  2E2E A;  2NC9 A;  2F8Y A;  3AU5 A;  4A63 B;  4JHK A;  4I1A A;  2HM8 A;  3BG1 B;  2VTB A;  1H2U A;  2WQ6 A;  3TG4 A;  1Z6T A;  3SZ7 A;  4HOU A;  5DIZ A;  4GML A;  4D10 C;  4PS8 A;  2LXM A;  3ASD A;  1N4Q A;  2Q7F A;  3E4B A;  1HO8 A;  5T4Y A;  2VGY A;  1FT1 A;  4DX2 A;  1Y6I A;  3NBN B;  1N52 A;  2KCV A;  3E34 A;  4KZC A;  2AJA A;  1NP7 A;  2V4L A;  2KAT A;  3QNK A;  4ANU A;  5FIN A;  4XZ4 A;  2WXQ A;  4G25 A;  2L6J A;  3UT8 A;  4B8C B;  3ZFW A;  2RD0 A;  4OVV A;  3EHN A;  4JA9 A;  2V4H C;  3FDH A;  4UUC A;  4WWN A;  3MEK A;  3GW4 A;  3TWQ A;  3FHE A;  4U0U A;  2QZA A;  1ZBP A;  2J49 A;  3ULE G;  5CRU A;  2XCB A;  3P2B A;  3EUV A;  2JAB A;  4TXR A;  5BXO A;  4EPZ A;  4BER A;  4JW1 A;  5C1D A;  2MHK A;  2PM6 A;  2DCP A;  2WXN A;  3PUK A;  1DC2 A;  2KBX A;  3FEY A;  4O1O A;  5LOZ A;  4L1B A;  2OV8 A;  3UM0 A;  3ZUV B;  3X2Q E;  1BI7 B;  1UJJ A;  4CRW A;  3TWS A;  1N54 A;  3Q15 A;  3SQV A;  5EKQ D;  4APO A;  4FU3 A;  4JEU A;  2VTB B;  4JVS A;  2NXP A;  4XI9 A;  2B0O E;  3FU5 A;  4YDW A;  2WXO A;  2X6J A;  3QJZ A;  4U63 A;  1KZP A;  2XEE A;  1G3N B;  4K0R A;  3RO2 A;  3SFX A;  4JEH A;  3DXM G;  3EU5 A;  1WDY A;  5HI7 A;  3CSF A;  1DNP A;  1QNF A;  4I1M A;  4DX7 D;  5KJL A;  3AG1 E;  4ILH B;  5HS0 A;  2OEW A;  5HRY A;  3ZVV A;  2A5U A;  2J4D A;  3KEZ A;  4OYS A;  4M3O A;  2VQ2 A;  3R7R A;  3LJ3 A;  4GA0 A;  3TWW A;  5CED B;  3L17 A;  4GTP A;  3IKO B;  3RIB A;  5G55 A;  3LVQ E;  1MX6 A;  1OXJ A;  5FQ6 A;  1HFA A;  4DI3 A;  3NZS A;  2AXZ A;  3KSQ A;  4NQ0 A;  2I1J A;  3O48 A;  2VGX A;  3TWU A;  4XKB A;  4NRH B;  3ULQ A;  4C48 B;  3ZYM A;  4PH4 B;  3TG5 A;  1KT1 A;  5G05 J;  3WXX A;  3UKU G;  4KVO A;  3ZPJ A;  2J08 A;  4UQZ A;  4QQI A;  1PY1 A;  4UQX A;  1D8D A;  3CIA A;  4U8Y D;  5KCM A;  2FF4 A;  3C3R A;  5ENT D;  3FH7 A;  2DZO A;  2R2L A;  5BNW A;  4F3V A;  4J8E A;  1JCQ A;  3DBS A;  3ZW3 A;  4TV3 A;  3V2X A;  4GTM A;  3CHQ A;  3TXN A;  3B7U X;  2LXL A;  5JHA A;  4GCN A;  4GYY A;  3IEG A;  5H7P A;  1E8Y A;  3SFZ A;  3UXG A;  4TXP A;  4F53 A;  3SO8 A;  3LEW A;  4HB5 A;  3AS4 A;  2WXP A;  4EZL A;  4CDN A;  3CR3 A;  3ABK E;  3Q75 A;  1TN6 A;  3U4T A;  2B6C A;  1TNB A;  2XS1 A;  3CHM A;  1HS6 A;  1RW2 A;  3CVN A;  4GTT A;  1UN9 A;  3DEP A;  1BD8 A;  2XS8 A;  4JHR A;  5AN8 A;  4FJZ A;  5G05 C;  3RJV A;  3PEU B;  3ASO E;  1KZO A;  4U0S A;  5B1A E;  5ENP D;  4ACL A;  4OVU A;  4WAF A;  5KWD A;  4BY6 A;  3UM3 A;  3GYZ A;  1X81 A;  3SD5 A;  3HRA A;  4KT6 B;  3RSE G;  4RG9 A;  2HYZ A;  2V8S E;  3PDN A;  4AM9 A;  4FJY A;  2XEH A;  3PZ3 A;  3EHM A;  3MCX A;  1WM5 A;  1PC2 A;  2Y4T A;  3LXU X;  4BFR A;  3B7R L;  4J0U A;  5ITZ F;  1QZ2 A;  5FTP A;  2ETC A;  1JWF A;  3B7S A;  4Y6C A;  3D9P A;  2CG2 A;  1DCQ A;  2E0I A;  4PS7 A;  1MJ0 A;  4FHK A;  4YVQ C;  1N94 A;  5LCW J;  1K3Z D;  4Q94 A;  1K1A A;  3LY8 A;  3OAW A;  3EHQ A;  4Z68 A;  5BUZ A;  3IHY A;  4ATG A;  5CHE E;  1V54 E;  1P5Q A;  2PM7 A;  1H0A A;  5KJK A;  3ENE A;  2CHW A;  3SNX A;  4HQD A;  4F1P A;  4MKT A;  3FUH A;  4UWF A;  2J4B A;  1HF8 A;  1IYG A;  4E6H A;  3C72 A;  1IQR A;  4J8F A;  4GA2 A;  4O60 A;  3B7B A;  5CEC B;  3IBE A;  4PDX A;  3RU0 A;  4ZHB A;  3IV0 A;  5FZR A;  4C0E A;  2PQR A;  4C0M A;  3BEE A;  3URZ A;  2H6H A;  5EID A;  4U96 D;  5ENS D;  4LNB A;  4YND A;  1L5J A;  1HX8 A;  4BX8 A;  1SVX A;  2ZGG A;  2IOL A;  3UM2 A;  3E33 A;  3QWV A;  1BLX B;  4ANW A;  2FO1 E;  4JZY A;  4L23 A;  4LNU D;  4U95 D;  4Y6W A;  3FP3 A;  2I9C A;  3F6Q A;  3HXE A;  1XNF A;  4J7W A;  4I1O B;  3Q5M A;  4ABN A;  4KVM A;  3UIP C;  5LCW C;  4NAC A;  1WAO 1;  3AAA C;  5ANR A;  4AIF A;  4H7Y A;  4BET A;  4BTB A;  2KCK A;  1S63 A;  1HG5 A;  2FO7 A;  3G2W A;  4JXT A;  3JXI A;  4GMJ A;  1OUV A;  2I2O A;  1X5B A;  1E7V A;  4K5C A;  4ANX A;  3MKQ B;  4HOT A;  3HDX A;  2R5S A;  5LP0 A;  4CCA A;  2AWI A;  4L9P A;  3K9I A;  3OXF A;  1N11 A;  2EIL E;  4YDY A;  5CRV A;  1SQM A;  2P9I G;  4YDO A;  3B95 A;  2DVW A;  3JCK C;  2WM9 A;  3BQO A;  1VDY A;  1W3B A;  5CCM A;  3ZHE A;  1O1R A;  3D9L A;  3CVQ A;  4ANV A;  1D8E A;  1HE8 A;  2MOW A;  4TXQ A;  5B1B E;  3ASN E;  2A4Z A;  4R7L A;  3G2T A;  3FU0 A;  1FVH A;  3C3Q A;  3TGO A;  3ZRH A;  4EEC A;  2EIN E;  3PZ1 A;  2X6H A;  3CQG B;  4A1S A;  4HOR A;  3RKV A;  5E76 A;  3QOU A;  2DYR E;  2WXG A;  2HO1 A;  3TWT A;  1UN8 A;  3UQ3 A;  1UOH A;  4PUC A;  4BSZ B;  2MYO A;  2C0L A;  3CVV A;  5BXU A;  3Q4A B;  1S0P A;  2X6I A;  1TNO A;  2F8X K;  5BV1 A;  3I3N A;  3ZKJ A;  4AVX A;  1A5E A;  3ZU7 B;  4AV7 A;  3D9K A;  5CEA A;  1HU3 A;  1YYH A;  4G1T A;  3MZL B;  3UI2 A;  2R17 C;  3AS5 A;  2VGE A;  4TRQ A;  4MS6 A;  2C0M A;  2Y4U A;  3V30 A;  2J9Q A;  1JCS A;  3QAR A;  4CZ2 D;  4F6R D;  2WVI A;  4H7X A;  3SBT B;  3SI5 A;  4NUR A;  5CMY A;  2R59 A;  3FUI A;  3CHS A;  3ZHE B;  3AS8 A;  4WWP A;  3V2O A;  3PRE A;  1A17 A;  2JLB A;  4L2Y A;  3ESK A;  2WXI A;  2ZIR A;  2UY1 B;  4AEZ C;  2CFZ A;  2LNI A;  4JPS A;  3Q7A A;  4RSY A;  4UI9 K;  5KBA A;  4N5Q A;  2BUG A;  4XIF A;  3L13 A;  3CVX A;  3D9I A;  3PH0 C;  1AWC B;  2XPI A;  3J5P A;  3R9M A;  2IJG X;  3NQP A;  3L54 A;  3HYM B;  2H6G A;  1HG2 A;  1OCO E;  1MQS A;  1ELK A;  1H19 A;  1H2V C;  3DSU A;  4LER A;  4KZ0 A;  1H2T C;  3CEQ A;  3DST A;  4IYP A;  4IN3 B;  4A55 A;  1UW4 B;  4GB9 A;  2IQC A;  4B93 B;  2CHX A;  4GTQ A;  3UPV A;  1Z3X A;  3PE3 A;  2XHE A;  1JWG A;  3OTN A;  1AP7 A;  3G2U A;  1QBQ A;  3JUI A;  3D9O A;  5FZQ A;  2XPZ A;  1MX2 A;  1EPU A;  2MRI A;  4RLY A;  3O4Z A;  4EZK A;  3FTU A;  3SGH A;  5JHB A;  3RO3 A;  4DUI A;  4JB8 P;  2GW1 A;  3Q78 A;  5C2Y A;  4P29 A;  2I6H A;  3NZU A;  3IHV A;  2ION A;  1SZ9 A;  3UX4 A;  4U8V D;  4CDM A;  4UWL A;  3V31 A;  4IRU A;  4GZD A;  3R7Q A;  4HLE A;  3PVL A;  4BTA A;  2WXL A;  3RRM B;  4N2Q A;  5EX0 A;  3FUK A;  3FUM A;  3UIN C;  4HOQ A;  1K8K G;  3W9F A;  2P9U G;  4CGW A;  4MBG A;  3E32 A;  3RRN B;  4HRN A;  3CVL A;  4DX1 A;  3FUN A;  5AAR A;  1DVP A;  4V3I A;  3HXB A;  4EBA A;  4FP7 A;  2R05 A;  1U3C A;  4HOS A;  2H6F A;  2IOS A;  1N4P A;  4KBQ A;  3D3M A;  1TEZ A;  1E8W A;  1PAQ A;  1TR4 A;  2KM4 A;  4GAA A;  2FBN A;  2R02 A;  3CLJ A;  1U3D A;  4J8D A;  5FQ8 A;  4YDE A;  3FFL A;  4Q96 A;  4GZC A;  3LPZ A;  3NF1 A;  2QYU A;  4HFG A;  5KJM A;  5A23 A;  2LUH A;  2P9K G;  4WNG A;  4GZ6 A;  4DLQ A;  2XPY A;  2VSY A;  2VSO E;  4XE0 A;  3AJI A;  4U04 A;  4HVB A;  4M7C A;  2GRM A;  4I2W A;  1IXV A;  2FUL A;  2WXM A;  3CVW A;  4G11 A;  3WG7 E;  5JMN D;  1KPS B;  2Y1L E;  3DSX A;  5CCL A;  2VSN A;  1QYM A;  3PEV B;  3SFY A;  4G23 A;  3MYV A;  3JYS A;  3LDZ A;  4XEI G;  3IXE A;  4EBA G;  1TNU A;  3ZEF A;  3FU3 A;  1TJF A;  2IO2 C;  3U64 A;  4A3V A;  3NB2 A;  1IHG A;  5FZS A;  2OCC E;  1KLX A;  3D9N A;  5KNG A;  3DXK G;  5AJL A;  4AY6 A;  1Q2Z A;  4GTS A;  3HIZ A;  1OT8 A;  1E96 B;  5AYW D;  4RQI A;  3VTX A;  3GZS A;  3TWV A;  4RG6 A;  3NOG D;  3ASH A;  3HHM A;  3B13 A;  4DRX E;  3QKY A;  3ONK A;  3JQ0 A;  1QQE A;  2DIW A;  3SY2 A;  1E8X A;  1RZ4 A;  5G04 J;  3OXL A;  3T5V A;  1UJK A;  4JD2 G;  4DX5 D;  3LS8 A;  4GYO A;  3FY4 A;  5ARG A;  2R03 A;  2NSZ A;  4EHM A;  2EQX A;  4N5C A;  3T5X A;  5LX8 A;  3W9G A;  2ILR A;  4LUN U;  1YA0 A;  2X38 A;  3APD A;  4FC8 A;  3CGH A;  4I6G A;  1NA0 A;  2VJ8 A;  5EYP F;  3SHF A;  3MKQ A;  2GRL A;  3CVU A;  5JJT A;  3Q49 B;  3CK7 A;  2P9S G;  3CK9 A;  5AQA A;  3DPY A;  2VSX E;  2WXK A;  2P9N G;  4N39 A;  1TN8 A;  2ZIS A;  3T8K A;  3QWP A;  3CVP A;  4L2L A;  5BT1 A;  2M63 A;  4WNE A;  4F1S A;  3PS6 A;  5AQ7 A;  1UG3 A;  4HXI A;  5JJ6 A;  4U8H A;  4I9C A;  1TJC A;  2QFC A;  2OVF A;  2P2C P;  3G2S A;  2IEJ A;  3L08 A;  2QC9 A;  2UWJ G;  3KD7 A;  4O6F A;  5FQ7 A;  3R9A B;  5G04 C;  5ENR D;  4G2V A;  4HS2 A;  3FUJ A;  5HQ8 A;  2XEV A;  3ESL A;  2AXV A;  3PNT B;  1KT0 A;  3MGB A;  1IHB A;  4GZ3 A;  4I17 A;  1OWN A;  2EIM E;  3KSL A;  1OWP A;  3L6A A;  4AOF A;  1D9S A;  1SZA A;  4E85 A;  1TYQ G;  1MHQ A;  4G8K A;  1BI8 B;  2X3M A;  4HLL A;  4JC8 A;  1YMP A;  4A3T A;  4F7A A;  4RVB A;  5EN5 D;  3VLF A;  2L6B A;  1ELR A;  4UI9 C;  4GA1 A;  3I4G A;  4CYM D;  3LYA A;  1EDU A;  3AG2 E;  5AIJ A;  2IFU A;  4LSZ E;  2KZT B;  3EJN A;  5BPP A;  4FHJ A;  3PUJ A;  4GMR A;  3UT7 A;  4DLO A;  1E90 A;  3HVE A;  1S70 B;  3RK6 A;  3NAW A;  4ME2 A;  2LAH A;  4DJA A;  5FT9 A;  4UWH A;  3MX3 A;  4MRU A;  2WXJ A;  2WXF A;  5KJN A;  4GTO A;  4ILI A;  3PE4 A;  3S2A A;  5BW8 C;  5JA4 D;  3L9T A;  2OVB A;  1JPL A;  2WQ7 A;  3CKB A;  4A1G A;  4I43 A;  1N9A A;  2UY1 A;  2P58 C;  3D9J A;  4LCT A;  2OOE A;  2L9B A;  3J5Q B;  2GRO B;  3MV2 B;  2CHZ A;  2RFM A;  3BU8 A;  4B0Z A;  4AP2 A;  3Q79 A;  5D66 A;  1MX4 A;  1JCR A;  5B3S E;  2AW6 A;  3ZXS A;  5AQ9 A;  3FTW A;  1XGW A;  3CV0 A;  2L0T B;  3ASG A;  3CVY A;  2AVP A;  3FH8 A;  2EIK E;  5HKP A;  1BU9 A;  4OAV B;  2LSV A;  5A7D B;  3TWR A;  3TWX A;  4CT4 A;  3T9K A;  4GCO A;  1NA3 A;  4N3A A;  5ANL A;  3D9M A;  1NZN A;  4N3B A;  3S7J A;  4GPM A;  3UTM A;  4FAD A;  3ABM E;  2XEN A;  4JA7 A;  1N4S A;  2BKG A;  1NFI E;  2PZI A;  1GW6 A;  3P1U A;  1V55 E;  3RAU A;  3HVE B;  1ZU2 A;  1EYH A;  3E37 A;  3Q7F A;  3JUE A;  5LFA A;  1Z3Y A;  4TUU A;  4TUM A;  3CST A;  3ISM C;  4YVO A;  1OCZ E;  2CG3 A;  4KMO A;  5KNH D;  3S7F A;  3SF4 A;  3FWV A;  4HBD A;  3AG4 E;  3UM1 A;  3DRA A;  5ENQ D;  1HZ4 A;  2DBA A;  2KXP C;  3FUD A;  3UUX A;  2WMO A;  4FLB A;  1U2V G;  2RG8 A;  4EZJ A;  3DPD A;  1SW6 A;  4CDR A;  2X6F A;  3ML9 A;  2ETB A;  3Q9N C;  5FIO A;  4BT9 A;  3DSW A;  5ENN A;  3CHR A;  5EYL A;  4Q69 A;  3E30 A;  3CKC A;  4HI9 A;  2F0Y A;  2LAI A;  4WNF A;  4XKC A;  3PZ4 A;  3PZ2 A;  3FEX A;  4I2Z A;  2C2L A;  3MA5 A;  4G8L A;  3I5P A;  1LD8 A;  4W9R A;  3MJW A;  3ULY A;  2BTD A;  3MV3 B;  1OCC E;  1OWO A;  4DX6 D;  3I4R B;  4UWG A;  2PQN A;  4GTR A;  3S7D A;  4NIK A;  3LY9 A;  4U07 A;  2BKK B;  3MKR A;  3QB2 A;  3TXM A;  2Y69 E;  1OY3 D;  5G2N A;  2GRN B;  1S64 A;  5ARF A;  3FTX A;  3UIO C;  3EIQ C;  2YNQ A;  2LO6 A;  4IUL A;  2ZXW E;  5AEN A;  2HE0 A;  4N3C A;  2GRP B;  3DWL G;  2XGO A;  3V79 K;  5EIL A;  3UT4 A;  2XRZ A;  3VLE A;  2J09 A;  1H6K A;  3RRU A;  4AXH A;  3DEO A;  3HG0 D;  4GU5 A;  3DSS A;  3DSV A;  3D9H A;  3ASF A;  4GTV A;  5CBO A;  1H6P A;  3QDN A;  3CK8 A;  4LEU A;  3Q9U C;  3T8M A;  2PL2 A;  3ML8 A;  3LKU A;  1Z5S C;  5A6C A;  2P9L G;  4MLP A;  2WB2 A;  2XRY A;  4C9B B;  4HRM B;  2BF0 X;  1LD7 A;  2IO3 C;  3LY7 A;  2WXH A;  2VYI A;  2GRQ B;  4ACK A;  1MZC A;  3JQ1 A;  1OCR E;  1FPP A;  3ZIM A;  2A5E A;  5E75 A;  2XGM A;  2PNN A;  3CQC B;  5IY5 E;  1H6O A;  4DPR A;  3L82 A;  5FQ4 A;  1NL4 A;  3VLD A;  5JJ7 A;  2LSU A;  3APF A;  3L22 A;  4B94 A;  3B7T A;  3FTV A;  4I6J A;  4LNG A;  1IQU A;  3KEA A;  1LTX A;  4O1P A;  1Y8M A;  4J8Y A;  4GZ5 A;  1HH8 A;  4BWR A;  3VTY A;  4LRZ A;  3ZNG A;  4QFV A;  3FUL A;  4EQF A;  3BUA A;  3S7B A;  2FEZ A;  2ETA A;  2V5Q C;  4BX9 A;  2YIN A;  2NYJ A;  3OXG A;  4LG6 A;  3L16 A;  5J08 A;  3U66 A;  4HRL A;  3GZ2 A;  3C98 A;  1EF1 C;  1SA5 A;  3FTY A;  3FH5 A;  1INZ A;  2Y3A A;  5EIB E;  2V5F A;  4B89 A;  3HXD A;  3ZN3 A;  2VGX B;  1B89 A;  4BEP A;  5D0Q D;  4KXK B;  4DI4 A;  3TAX A;  1E7U A;  2IF4 A;  2YQ8 A;  4GPK A;  2P9P G;  4WND A;  3U9W A;  4APF A;  3G2V A;  3QK0 A;  4BT8 A;  2XGS A;  3EU9 A;  3Q47 B;  1K1B A;  4I6E A;  2FI7 A;  4UQY A;  4JL0 A;  1FT2 A;  4DK5 A;  2QY7 A;  2OEV A;  2HR2 A;  1E8Z A;  5CBN A;  2J8S D;  5D0O D;  1SA4 A;  2XZT G;  3Q73 A;  3FTZ A;  5CMW A;  2L0I A;  3HXC A;  3LJN A;  3U3W A;  3QAQ A;  5EDS A;  4U7E B;  3FU6 A;  4X8Q A;  3SBS A;  4XX5 A;  3BG0 B;  5FJY A;  1OWM A;  4UI9 J;  2DYS E;  3ZGQ A;  5FWQ A;  3ZYK A;  5T3R A;  2KZT A;  1ELW A;  5EX3 A;  3FUE A;  4ILG A;  1OWL A;  2XZD G;  3FUF A;  1YCS B;  5CER B;  4URK A;  3ZYQ A;  4OAU C;  4ZFH A;  4ATZ D;  1N0Q A;  4XI0 A;  2RFA A;  3EIJ A;  3UKR G;  2ZU6 B;  3HXF A;  5BV0 A;  2V0P A;  1N0R A;  4G26 A;  1WG0 A;  4HNA D;  2OND A;  4BSX A;  1O1T A;  2I1K A;  2ZGD A;  4JHJ A;  5AQB A;  2DZN A;  2IU1 A;  3ZYL A;  3QWW A;  4FA6 A;  2BED A;  1HXI A;  1N95 A;  3CHO A;  1JUQ A;  4BES A;  4GYW A;  2GGF A;  3FTS A;  1O1S A;  2H6I A;  3C3O A;  2AXU A;  1O5M A;  4J6I A;  2WPV A;  4N2S A;  2XQ0 A;  1IKN D;  3PNL B;  3APC A;  2F37 A;  3QC1 A;  1BPO A;  5ENO D;  4AJW A;  1WY6 A;  5AAO A;  3LCA A;  1N4R A;  1ZB1 A;  2YHC A;  2WQH A;  3ONL A;  3C5R A;  3JXJ A;  4CEM A;  4WWO A;  3EHR A;  3ZXP A;  3AG3 E;  3EDT B;  2JEK A;  2QYJ A;  1TN7 A;  5D2M C;  3PZD A;  2IY0 C;  4K5B A;  2EIJ E;  4PS3 A;  3TJP A;  3PRZ A;  4CT0 A;  2RKK A;  2YHE A;  2WXR A;  2Y0B G;  5AJD A;  3LVR E;  1FCH A;  3KAE A;  3GZ1 A;  1LF8 A;  3ABL E;  3TL5 A;  2KC7 A;  4KYO B;  5DBK A;  2X6K A;  3AU4 A;  4B8A A;  1TNY A;  4K5A B;  3CHP A;  1DCE A;  2GRR B;  2J07 A;  4L7T A;  4HI8 A;  4UWK A;  4FUL A;  3NOC D;  2XCC A;  4J8S A;  2KCL A;  4WUY A;  4I9E A;  1TNZ A;  3N71 A;  4U0Z A;  1NI1 A;  3UMV A;  2WMN A;  5J90 A;  4K03 A;  4G24 A;  5T8I A;  3KS2 A;  4AY5 A;  2DWZ A; 
#chains in the Genus database with same CATH homology
 4U96 D;  3JUE A;  5KWD A;  5ENS D;  1S70 B;  2F37 A;  4QQI A;  5AQA A;  4N5Q A;  5KBA A;  4TUM A;  5ENO D;  3IXE A;  1MYO A;  1SVX A;  5AAO A;  3W9F A;  3ZNG A;  2ZGG A;  4QFV A;  4U8Y D;  2HE0 A;  5KNH D;  3HRA A;  1AWC B;  3J5P A;  4HRN A;  2F8Y A;  4A63 B;  2B0O E;  5ENT D;  4DX1 A;  3C5R A;  4HBD A;  1BLX B;  5EIL A;  5AAR A;  5JA4 D;  3V79 K;  2DZO A;  4YDW A;  2FO1 E;  3JXJ A;  3T8K A;  5ENQ D;  2ETA A;  2V5Q C;  4LNU D;  2XEH A;  2XEE A;  3DEO A;  5KNG A;  3EHR A;  1G3N B;  2KXP C;  3HG0 D;  3TWT A;  4U95 D;  3V2X A;  1UOH A;  2QYJ A;  2NYJ A;  3F6Q A;  4LG6 A;  4B93 B;  1SW6 A;  4J7W A;  1WDY A;  4BSZ B;  2MYO A;  4K5B A;  3D9H A;  1OT8 A;  5ITZ F;  5AQ7 A;  5BXU A;  2XZD G;  3J5Q B;  2ETB A;  2ETC A;  1YCS B;  4HRL A;  4DX2 A;  1TR4 A;  3Q9N C;  5CER B;  5CBO A;  3NBN B;  1AP7 A;  5FIO A;  2F8X K;  1DCQ A;  2RFM A;  3UXG A;  2P2C P;  3TWV A;  1MJ0 A;  4DX7 D;  2AJA A;  4OAU C;  2Y0B G;  4ZFH A;  3NOG D;  3Q9U C;  3AAA C;  5D66 A;  3SO8 A;  1MX4 A;  5EYL A;  5FIN A;  5HS0 A;  1N0Q A;  3ZKJ A;  4ATZ D;  5EIB E;  1MX2 A;  2RFA A;  1A5E A;  4BET A;  3ZU7 B;  5HRY A;  2QC9 A;  4DRX E;  5CEA A;  4RLY A;  1YYH A;  3UI2 A;  1K3Z D;  5AQ9 A;  4BEP A;  1K1A A;  1N0R A;  3JXI A;  4HB5 A;  4HI9 A;  4DUI A;  5ENR D;  1WG0 A;  2VGE A;  3EHQ A;  4Z68 A;  4HNA D;  4K5C A;  4HRM B;  2ZGD A;  2V4H C;  3TWW A;  4JB8 P;  3V30 A;  5CED B;  4UUC A;  5AQB A;  1IHB A;  4K5A B;  5EID A;  5HKP A;  1BU9 A;  4OAV B;  2DZN A;  4CZ2 D;  1MX6 A;  4F6R D;  4DX5 D;  1N11 A;  4YDY A;  3AJI A;  3TWQ A;  3TWR A;  3TWX A;  1D9S A;  4HI8 A;  2A5E A;  3B95 A;  2DVW A;  1BI8 B;  4G8K A;  4G8L A;  4HQD A;  4F1P A;  3NOC D;  2PNN A;  4HLL A;  2JAB A;  3T9K A;  1YMP A;  4U8V D;  3EU9 A;  3V2O A;  1K1B A;  3W9G A;  4BES A;  5BXO A;  1IXV A;  4BER A;  5EN5 D;  3DEP A;  2L6B A;  4GPM A;  1BD8 A;  3UTM A;  5JMN D;  3V31 A;  3TWU A;  5AN8 A;  4CYM D;  2Y1L E;  4DX6 D;  4C48 B;  2XEN A;  5CBN A;  2J8S D;  2BKG A;  1NFI E;  5EYP F;  2KBX A;  4LSZ E;  4O1O A;  1QYM A;  4O60 A;  1DC2 A;  3B7B A;  2XZT G;  4NIK A;  5CEC B;  3ZUV B;  2BKK B;  1BI7 B;  4GMR A;  1IKN D;  5ENP D;  4ZHB A;  3KEA A;  3TWS A;  4O1P A;  1OY3 D;  3LJN A;  4J8Y A;  2DWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...