5AARA

Structure of the ankyrin domain of an arabidopsis thaliana potassium channel
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
185
Chain Sequence
b'LPLNLCFAAIREDDLLLHQLLKRGLDPNESDNNGRTPLHIAASKGTLNCVLLLLEYHADPNCRDAEGSVPLWEAMVEGHEKVVKVLLEHGSTIDAGDVGHFACTAAEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIEMVKYLLEQGADVNKQDMHGWTPRDLAEQQGHEDIKALFRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POTASSIUM CHANNEL AKT1
publication title Structure of the Ankyrin Domain of Akt1
rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 62
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5aarA00
3EHQA 5BXUA 4LNUD 2BKKB 2A5EA 2XEHA 3JXJA 5CBOA 5HKPA 3V31A 5CEAA 2V5QC 4OAVB 1SW6A 4DX6D 3AJIA 5AQ7A 3UTMA 3V2XA 3ZUVB 4RLYA 3UI2A 3J5PA 3TWUA 4HRNA 4DX1A 2XZDG 2Y1LE 4GPMA 4LG6A 5AAOA 3AAAC 4DUIA 5CBNA 1S70B 4HNAD 1IKND 3ZU7B 1N0RA 2QYJA 4DRXE 4BETA 1YCSB 2F37A 5CECB 2P2CP 3JXIA 3JUEA 2FO1E 1TR4A 2XZTG 1QYMA 3ZKJA 3C5RA 4G8LA 3DEOA 1N0QA 4HRLA 3DEPA 5ITZF 3TWTA 3SO8A 3W9GA 4N5QA 3B7BA 4HBDA 5EIBE 4HRMB 4CZ2D 1K1BA 5EILA 3TWXA 2KBXA 2ZGGA 1BLXB 5KNGA 3TWQA 3TWSA 4A63B 1BI7B 3IXEA 4LSZE 5AN8A 1A5EA 4G8KA 5ENRD 1D9SA 3V2OA 5AQAA 5JA4D 3NOCD 4HI8A 5BXOA 5ENSD 2BKGA 3V79K 4BERA 1BU9A 1IHBA 4QQIA 4ZHBA 2ETCA 5FINA 5ENTD 5KBAA 1DCQA 1MX6A 1OY3D 5AARA 3TWVA 2VGEA 4HB5A 3TWRA 4B93B 4O1OA 2JABA 2KXPC 2HE0A 4BSZB 5ENOD 4HQDA 1UOHA 4U8YD 2RFAA 1MX2A 4K5CA 4J7WA 3TWWA 4Z68A 1YMPA 3D9HA 2NYJA 5EYPF 2AJAA 2DWZA 3F6QA 5EYLA 5CEDB 2ETBA 4F1PA 4ZFHA 2J8SD 5EIDA 3W9FA 4GMRA 3NOGD 1N11A 2ETAA 5ENQD 2V4HC 3ZNGA 3HG0D 3LJNA 4BESA 3EHRA 4YDWA 2DZNA 4BEPA 4OAUC 2XENA 5HRYA 2PNNA 5AQ9A 1IXVA 2DVWA 3EU9A 5AQBA 3Q9NC 2L6BA 3KEAA 4DX5D 4HLLA 1AP7A 5EN5D 1MJ0A 2F8YA 2MYOA 2DZOA 4O1PA 2QC9A 1WG0A 4U96D 4C48B 4DX7D 4J8YA 5HS0A 5CERB 4CYMD 3J5QB 3Q9UC 4HI9A 4U8VD 1OT8A 3NBNB 1MX4A 4YDYA 5KWDA 2B0OE 5ENPD 4U95D 5FIOA 4QFVA 4JB8P 1WDYA 4NIKA 4ATZD 4DX2A 3V30A 1DC2A 4K5BA 1YYHA 3T8KA 2XEEA 3B95A 4TUMA 1BD8A 1NFIE 4UUCA 1SVXA 4F6RD 5JMND 1K3ZD 5D66A 1AWCB 4O60A 5KNHD 2RFMA 2Y0BG 3HRAA 1MYOA 3T9KA 4K5AB 2F8XK 1G3NB 2ZGDA 1K1AA 3UXGA 1BI8B
chains in the Genus database with same CATH superfamily
3DSUA 2BKKB 1TJFA 3FH5A 4B89A 2ZISA 4OVUA 3EIJA 3L54A 3S7DA 4NRHB 5CECB 1TR4A 3ZKJA 3CVXA 3CR3A 4N2QA 3I3NA 4G8LA 1E7VA 3SZ7A 3DEPA 2RG8A 3UT8A 4EBAG 4GTMA 4XIFA 5KNGA 3UX4A 2IQCA 5G55A 3LEWA 4JD2G 3FUKA 4GPKA 1D9SA 5FT9A 5FZSA 3V79K 4J8DA 1PC2A 1HXIA 4A1GA 1ZB1A 2BTDA 4JVSA 3MA5A 4I1OB 3ULQA 2AVPA 3AS4A 4G26A 4N39A 2DWZA 4LUNU 1RW2A 2J9QA 5AYWD 3RAUA 4RG6A 3O48A 2E0IA 2MYOA 5CMYA 1S63A 3CKCA 4C0MA 4KYOB 3QWWA 4GYWA 1N54A 3RSEG 4URKA 4AOFA 4XI0A 3C3QA 2B0OE 4ANVA 3PREA 3FTYA 2KCLA 1ELRA 2R02A 1K3ZD 4B8AA 5KNHD 1UN8A 2R5SA 4OYSA 3CQGB 4K5AB 5LP0A 5BT1A 5CHEE 4UWHA 3MGBA 5ARGA 2VGXA 3LY7A 1E8WA 3FUNA 4Q94A 3OTNA 3UM2A 1IKND 3ZU7B 4BETA 1B89A 5JJ6A 3FUDA 4CT4A 3SD5A 1N0QA 3CVNA 2J09A 1OWLA 3HHMA 2XCCA 5ANRA 3PZ3A 2IY0C 2GW1A 1BPOA 3HXBA 3L16A 3PE4A 3UT4A 4ZHBA 2ETCA 3B7RL 2LAIA 4XEIG 3TWVA 4HQDA 2PM7A 3D9IA 4U8YD 3FY4A 4Z68A 2AJAA 2XPYA 3PS6A 3ZW3A 5T4YA 3AS8A 2CHXA 3FTUA 3HG0D 2AW6A 3CVQA 4BESA 5HRYA 4FJZA 4DX5D 4R7LA 5EN5D 2F8YA 3FDHA 3PEUB 3SNXA 3L9TA 1N9AA 1Y6IA 4I1AA 4YVQC 2F0YA 4RQIA 5D0OD 5G05J 2L0TB 1TNUA 2I1KA 3FTZA 1IQRA 5KWDA 3PE3A 3ULEG 3T8KA 1PAQA 3LCAA 4U63A 4XE0A 4F6RD 3E37A 3FTXA 2RKKA 5LCWJ 2OEWA 2XGSA 1KT1A 3EHQA 2A5EA 5CBOA 3D9PA 4EQFA 1H0AA 4M7CA 2IOLA 4BFRA 3V2XA 2XQ0A 4AIFA 3QKYA 2YQ8A 2H6GA 1S70B 3Q4AB 2YHEA 2RD0A 4U0ZA 4L2YA 2IF4A 3C5RA 4BT9A 1MHQA 1SZ9A 3SO8A 2R05A 1A17A 3MKRA 2GRQB 2KBXA 2ZGGA 2LNIA 3V2OA 4TUUA 4Y6CA 2WXIA 5JA4D 2LSVA 2BKGA 5KJNA 1IQUA 1HS6A 5CRUA 4FLBA 2UY1B 3VTXA 3CVYA 5LFAA 1NZNA 2WVIA 4TV3A 4RVBA 2EILE 3RRNB 1OWPA 5EIDA 4GMRA 2X3MA 1OWNA 4BEPA 4OAUC 4UQXA 1ELKA 1MJ0A 3L08A 2QC9A 4U96D 4AEZC 4HS2A 2GRLA 1H2UA 1OCOE 1JWGA 5H7PA 3E33A 3LY9A 4GA2A 4JHJA 1QZ2A 4L1BA 4ATZD 3SHFA 2HYZA 3QJZA 1OCZE 1SA4A 3HRAA 1EF1C 3D9KA 1HE8A 1O1RA 3KS2A 4MBGA 4HOTA 5CEAA 4PS3A 3E34A 4Q96A 2QFCA 1E8XA 2E2EA 3CK7A 3FHEA 1JCQA 4HRNA 1S64A 4RG9A 1N0RA 1YCSB 2P2CP 1LD7A 5FQ7A 3ZRHA 2WQHA 4F53A 2FBNA 5C2YA 3ABKE 5EILA 3ASHA 3ML9A 4KT6B 3ZPJA 4FU3A 1BI7B 2BUGA 4PS8A 2WXKA 1IHBA 3R9AB 4GA1A 5ENTD 4I9CA 3HYMB 4GYYA 1N4SA 3FH8A 4EZLA 3E4BA 1MX2A 2R59A 3VLDA 2NYJA 3HIZA 4A55A 3ONKA 2ETAA 3B7TA 3DSXA 4JXTA 4N2SA 3Q7AA 3DSVA 3EU9A 5BUZA 3BG1B 4HLLA 4YDEA 4KVOA 4B0ZA 2I6HA 4ILHB 2LXLA 2YHCA 1E90A 4GU5A 2C0MA 4UQYA 3KD7A 3QAQA 5M72A 1N95A 4UUCA 3KSQA 4CDMA 1FPPA 1HO8A 2RFMA 5DBKA 1LF8A 3CGHA 2IFUA 3HDXA 1K8KG 4BTAA 5CCLA 1TEZA 4CT0A 2KCVA 3WXXA 3Q5MA 4GTOA 2QZAA 1HZ4A 2NC9A 3CEQA 3HVEB 1W3BA 3B7BA 3UQ3A 3VLFA 4LSZE 5AN8A 4G8KA 1D8EA 3PUKA 4JA9A 3NOCD 3NF1A 1OWMA 3AU4A 3TWRA 1E8YA 3GW4A 4B93B 4G11A 2HE0A 4JEHA 2LAHA 3TWWA 2X6HA 3D9HA 3TG5A 4PDXA 4CGVA 2H6FA 3ENEA 2WXMA 3G2WA 2NSZA 3EHRA 3QDNA 4YDWA 2WXRA 3SFXA 2ZIRA 2P9UG 2XEVA 4K03A 4MKTA 4FLHA 3J5QB 2CFZA 3CVVA 4JHRA 3QWVA 5KJMA 4KZ0A 4FHKA 5CMWA 3GZSA 3SF4A 5ARFA 3HXFA 3LY8A 4XZ4A 4O60A 3ZEFA 1HFAA 2VSOE 3CSTA 2DYRE 1BI8B 4NACA 4LNUD 3CSFA 3PDNA 3PH0C 1H2TC 3UI2A 3JUIA 1O5MA 5AAOA 2XHEA 4HNAD 5D0QD 3JQ0A 5FJYA 2IU1A 3FEYA 5J08A 4BY6A 3CK9A 3Q75A 3AG2E 1DNPA 4N5QA 5EIBE 2EIKE 4HRMB 4GTQA 3TWXA 3QNKA 1XNFA 3APCA 5IY5E 3ASNE 4J8EA 1A5EA 1FVFA 5ENRD 3IHVA 3RO2A 1TNZA 4HI8A 4G24A 2P9KG 4JEUA 1WAO1 5AARA 3AG3E 3LKUA 2VSNA 4GMJA 3SFYA 3FUIA 2RFAA 4WNFA 3NAWA 3F6QA 3UT7A 5EX0A 3ZNGA 2DZNA 2JLBA 5AQ9A 4LNGA 2X38A 2DZOA 1QBQA 3NZUA 2I9CA 2XS8A 4UI9J 3S7FA 3DXKG 3PZ2A 2I2OA 2UWJG 3FUEA 1TNBA 3CHSA 4YDYA 3E32A 5FIOA 4DX2A 3V30A 4KBQA 3AU5A 1RZ4A 1V54E 2ZU6B 2LSUA 3LVRE 3CLJA 3SBSA 3FUHA 4PH4B 4MLPA 1DCEA 3LXUX 2XEHA 2L9BA 3C3RA 1SW6A 4RLYA 3I4RB 3CQCB 3FUMA 2XS1A 4N5CA 4G23A 2P9IG 4DRXE 4I2ZA 3DSSA 3NB2A 1VDYA 2XGMA 5KJKA 3TWTA 1PY1A 4HOUA 2X6JA 3GZ1A 5FZQA 3RO3A 1JWFA 3LYAA 4ACLA 3MEKA 5E75A 2Q7FA 5HQ8A 2CG3A 3EHMA 4O1OA 3TXMA 4BSZB 2P9LG 5J90A 2ETBA 2KATA 4ZFHA 4MS6A 1ZBPA 3FULA 1LD8A 2PNNA 5AQBA 2GROB 2MOWA 1TN7A 3ASDA 3JCKC 2ILRA 2FULA 2VTBB 3IV0A 4F1SA 3ASOE 4GB9A 3PRZA 1OT8A 4FHJA 3NBNB 1EYHA 2H6HA 5T3RA 3UMVA 1YYHA 1YA0A 4TUMA 1BD8A 4J8FA 1AWCB 3LJ3A 2PM6A 1H19A 4APOA 4XI9A 3APDA 3TXNA 2QY7A 2AXUA 4U0SA 2DIWA 2LUHA 4OAVB 4I43A 4G1TA 1U2VG 2V4LA 2J07A 3PNTB 4U7EB 1E8ZA 2EIME 2Y1LE 4LNBA 4LG6A 3AAAC 5CCMA 4HLEA 3FU0A 2XZTG 3FFLA 3FH7A 4UWFA 3SFZA 4WWOA 3UM0A 4AM9A 4JC8A 2PQRA 3PNLB 1Z6TA 2J4BA 2VYIA 5AIJA 3ZHEB 4AP2A 3L17A 3QB2A 4AJWA 2M63A 4BT8A 4G25A 3R9MA 4ABNA 2FI7A 4K5CA 3DPYA 1KZOA 4ME2A 2C2LA 2WM9A 1HX8A 2B6CA 4GZDA 3ZFWA 5AENA 1IXVA 3D9NA 4GTTA 4FADA 3CKBA 4BSXA 2P9SG 4I6EA 3BG0B 4JB8P 4NIKA 4DLOA 2UY1A 1DC2A 3JYSA 4C0EA 1SVXA 4BX9A 2Y3AA 4ATGA 4I1MA 2Y4UA 5DIZA 2EINE 5HI7A 4YDOA 5BXUA 3FU3A 3U4TA 3D9OA 5HKPA 3IHYA 3KAEA 4U07A 4DX6D 1KLXA 4DX1A 4BTBA 1P5QA 2HR2A 4GZ5A 3MV3B 4DUIA 5CBNA 4X8QA 1ZU2A 4AXHA 1TNYA 3DBSA 3S7BA 2IOSA 3W9GA 4HBDA 4ILGA 3T5XA 3VLEA 4YNDA 4V3IA 1Q2ZA 3B7UX 3B7SA 5G04C 5B1BE 4FP7A 3Q73A 4I2WA 3DWLG 3LPZA 4PUCA 1TJCA 3W9FA 3ZXPA 1JCSA 4GCOA 2DVWA 4CRWA 5LX8A 5B3SE 2VSXE 3Q47B 4WNGA 3UIOC 2KCKA 4A3VA 3CHMA 2WXJA 2XRZA 3QK0A 4GTPA 4FULA 4U0UA 1L5JA 3TL5A 5ENPD 3ZYLA 5ANLA 2XEEA 3ZGQA 3L22A 3MKQB 4ILIA 1XGWA 1K1AA 5T8IA 4L9PA 3Q49B 4Y6WA 1NI1A 3PEVB 4FA6A 1IHGA 3MYVA 2MHKA 4GTVA 4HOQA 3T8MA 3UTMA 3MZLB 3TWUA 1X5BA 2OEVA 3ZVVA 3JUEA 2XRYA 2L0IA 3ML8A 3I4GA 1N4PA 1INZA 1BLXB 1NA0A 2FF4A 1UN9A 3OXFA 3RU0A 3ABME 5KJLA 1NP7A 3ZYQA 4HFGA 4TRQA 3ULYA 4N3BA 2KXPC 1S0PA 2FEZA 4IULA 1UOHA 3RJVA 3HVEA 1N52A 3FEXA 2BF0X 4GTSA 2V4HC 3ISMC 5G05C 1GW6A 3RRUA 4TXRA 4O1PA 1Y8MA 4C48B 4ANXA 1N94A 3LDZA 5EX3A 1TN8A 4U8HA 2DCPA 3IKOB 3LS8A 3C72A 1EPUA 1TYQG 3CV0A 3L82A 2QYUA 4KZCA 3DPDA 3T9KA 2KZTB 1OXJA 1G3NB 3WG7E 3BU8A 2J49A 2EIJE 3PVLA 4KVMA 5AQ7A 1ELWA 3ZUVB 4F7AA 2CHWA 4PS7A 3EDTB 2WXLA 4GPMA 3ZYMA 3DSTA 3UUXA 3G2SA 4L7TA 2FO1E 2R03A 3FU6A 4OVVA 3URZA 2XGOA 3PUJA 1UJKA 3GYZA 1N4QA 4E85A 3TWQA 2IONA 3HXCA 4UWKA 4A63B 1FVHA 4UI9K 3RK6A 2X6FA 3UKRG 3U9WA 3TG4A 4WNEA 1NA3A 4HORA 1OY3D 3PZ4A 3FTSA 4M3OA 4FC8A 3U64A 3TAXA 4AY6A 2WXQA 1FT1A 4DPRA 1YMPA 5EYPF 3Q78A 3RKVA 1QNFA 1DVPA 3FTVA 2A4ZA 1E7UA 3D9MA 2WXGA 3FUJA 4XKBA 2L6BA 1HF8A 4DJAA 1AP7A 4AV7A 4DX7D 4J8YA 5HS0A 5JJ7A 2NXPA 3CVWA 3G2VA 4AY5A 5BNWA 3CVLA 5FQ4A 5EKQD 2DYSE 1NFIE 2V5FA 5ENNA 5JMND 4DI3A 5D66A 4I9EA 2H6IA 2Y0BG 2AWIA 3EUVA 3FU5A 5C1DA 2XPZA 4KXKB 3S7JA 2WXNA 3N71A 3D9JA 2V5QC 2WB2A 2GRNB 3QWPA 3C98A 4EZJA 5FQ6A 3CHQA 4HXIA 3APFA 1JCRA 5AJDA 2XCBA 3JXIA 3CHOA 3UKUG 4EZKA 4HRLA 5ITZF 3CHPA 3FP3A 4CZ2D 3CVUA 5G04J 3ZYKA 2WMNA 4GAAA 4J0UA 2GRMA 1FT2A 4LRZA 3SY2A 2OVFA 5BV0A 5AQAA 3RIBA 4RSYA 5ENSD 4LCTA 4IRUA 4ACKA 4JZYA 5FINA 5KBAA 5LOZA 4JHKA 5EDSA 1QQEA 3CVPA 3EU5A 2YINA 2GRPB 4J8SA 3NZSA 4DI4A 5ENOD 2VGXB 2R17C 3Q9NC 3UIPC 3I5PA 1WG0A 2CG2A 4K0RA 4CGWA 5KCMA 1O1TA 2PL2A 4HOSA 1Z5SC 5D2MC 3MV2B 4WUYA 2ZGDA 3IBEA 3MCXA 3UM3A 2AXVA 2HM8A 2YNQA 3PZ1A 3QC1A 4JW1A 4H7XA 3L6AA 1SZAA 4EPZA 3AJIA 4CDNA 4IYPA 2VTBA 1Z3XA 5AJLA 1HG5A 4FJYA 4NURA 3BQOA 3DEOA 2HO1A 2IJGX 2BEDA 4WNDA 2OVBA 2Y69E 3TWSA 2FO7A 5FWQA 4TXQA 5BW8C 1H2VC 5BXOA 4BERA 2CFUA 1JPLA 3UINC 3TGOA 3SQVA 4A1SA 3TJPA 3GZ2A 4D10C 1MZCA 5CEDB 3B13A 3AS5A 2GRRB 3Q79A 4E6HA 5JJTA 3ZN3A 2XPIA 3T5VA 2PZIA 3ZHEA 2X6IA 3Q9UC 4WAFA 4UWGA 3ABLE 4N3AA 3OXLA 3U3WA 4TXPA 3ZIMA 1H6PA 3D3MA 3U66A 1HU3A 3UPVA 3CHRA 3JXJA 4XX5A 5A7DB 1KPSB 3V31A 4B8CB 1UJJA 2GGFA 1Z3YA 3FWVA 4EBAA 4LERA 4XKCA 2WXHA 4CDRA 1LTXA 3G2TA 2Y4TA 2R2LA 3SBTB 5JHBA 3L13A 1K1BA 4WWPA 4GA0A 3IXEA 3ZXSA 2OCCE 4QQIA 1MX6A 2EQXA 3UM1A 2VGEA 4HB5A 3MJWA 1SQMA 2JEKA 4J7WA 4UI9C 2J8SD 5JHAA 1N11A 5A23A 1N4RA 4EECA 4GMLA 2VGYA 3QARA 4I6JA 3ASFA 1HG2A 3R7RA 4B94A 4U04A 2PQNA 4H7YA 1X81A 2WXFA 3Q15A 4U8VD 1WY6A 4LEUA 2P9PG 3NQPA 2WXOA 4GYOA 1SA5A 3B95A 2WQ6A 4JA7A 4G2VA 4L2LA 1MYOA 3QOUA 2F8XK 3EHNA 3VTYA 1EDUA 3ASGA 1O1SA 1HH8A 2AXZA 5FZRA 4APFA 1MQSA 3R7QA 3P2BA 2J4DA 2QYJA 5B1AE 2F37A 3Q7FA 2IO2C 4GZ6A 2L6JA 1IYGA 1WM5A 4KMOA 5FTPA 4UWLA 3BEEA 1NL4A 3MKQA 3ESLA 2IEJA 2X6KA 4EHMA 2LO6A 2WPVA 3AG4E 3K9IA 1BU9A 1H6KA 2A5UA 1H6OA 4HVBA 3P1UA 4GZCA 2OV8A 3SI5A 1V55E 4L23A 2WQ7A 4CCAA 1UW4B 4F1PA 4AVXA 3NOGD 3D9LA 4O6FA 4ANWA 3LJNA 2P58C 4MRUA 4ANUA 4P29A 5A6CA 1U3DA 1KT0A 3RRMB 3KEAA 3CK8A 3KSLA 1OUVA 1OWOA 4CYMD 4GZ3A 2VJ8A 3MX3A 4I6GA 3C3OA 4YVOA 4DK5A 2WXPA 1JUQA 4U95D 4QFVA 1WDYA 2OOEA 3BUAA 4K5BA 4UQZA 3E30A 1E96B 5E76A 5FQ8A 3ESKA 4I17A 4BX8A 4JL0A 2DBAA 4GTRA 1D8DA 3UXGA 3OAWA 2WMOA 3G2UA 2KM4A 3CIAA 4C9BB 5LCWC 1OCRE 2MRIA 3O4ZA 3J5PA 2XZDG 2IO3C 3X2QE 4BWRA 3DRAA 1U3CA 2J08A 3HXEA 1QYMA 3PZDA 4F3VA 2ONDA 2I1JA 3EIQC 2C0LA 4JPSA 4A3TA 2KZTA 2V0PA 3FTWA 1TN6A 1KZPA 4DLQA 1OCCE 5BV1A 3IEGA 4WWNA 1DCQA 1FCHA 3KEZA 3AG1E 4W9RA 3JQ1A 2JABA 2VQ2A 3SGHA 5BPPA 5EYLA 3ONLA 2P9NG 5CRVA 5ENQD 4J6IA 2XENA 3FUFA 4N3CA 3S2AA 3DSWA 2KC7A 2CHZA 3EJNA 5CERB 4GCNA 4HI9A 3LVQE 4Q69A 2ZXWE 1MX4A 5G2NA 2VSYA 2LXMA 4NQ0A 4CEMA 2V8SE 1UG3A 3DXMG 3HXDA 1TNOA 3OXGA 4IN3B
chains in the Genus database with same CATH topology
3EHQA 5BXUA 4LNUD 2BKKB 2A5EA 2XEHA 3JXJA 5CBOA 5HKPA 3V31A 5CEAA 2V5QC 4OAVB 1SW6A 4DX6D 3AJIA 5AQ7A 3UTMA 3V2XA 3ZUVB 4RLYA 3UI2A 3J5PA 3TWUA 4HRNA 4DX1A 2XZDG 2Y1LE 4GPMA 4LG6A 5AAOA 3AAAC 4DUIA 5CBNA 1S70B 4HNAD 1IKND 3ZU7B 1N0RA 2QYJA 4DRXE 4BETA 1YCSB 2F37A 5CECB 2P2CP 3JXIA 3JUEA 2FO1E 1TR4A 2XZTG 1QYMA 3ZKJA 3C5RA 4G8LA 3DEOA 1N0QA 4HRLA 3DEPA 5ITZF 3TWTA 3SO8A 3W9GA 4N5QA 3B7BA 4HBDA 5EIBE 4HRMB 4CZ2D 1K1BA 5EILA 3TWXA 2KBXA 2ZGGA 1BLXB 5KNGA 3TWQA 3TWSA 4A63B 1BI7B 3IXEA 4LSZE 5AN8A 1A5EA 4G8KA 5ENRD 1D9SA 3V2OA 5AQAA 5JA4D 3NOCD 4HI8A 5BXOA 5ENSD 2BKGA 3V79K 4BERA 1BU9A 1IHBA 4QQIA 4ZHBA 2ETCA 5FINA 5ENTD 5KBAA 1DCQA 1MX6A 1OY3D 5AARA 3TWVA 2VGEA 4HB5A 3TWRA 4B93B 4O1OA 2JABA 2KXPC 2HE0A 4BSZB 5ENOD 4HQDA 1UOHA 4U8YD 2RFAA 1MX2A 4K5CA 4J7WA 3TWWA 4Z68A 1YMPA 3D9HA 2NYJA 5EYPF 2AJAA 2DWZA 3F6QA 5EYLA 5CEDB 2ETBA 4F1PA 4ZFHA 2J8SD 5EIDA 3W9FA 4GMRA 3NOGD 1N11A 2ETAA 5ENQD 2V4HC 3ZNGA 3HG0D 3LJNA 4BESA 3EHRA 4YDWA 2DZNA 4BEPA 4OAUC 2XENA 5HRYA 2PNNA 5AQ9A 1IXVA 2DVWA 3EU9A 5AQBA 3Q9NC 2L6BA 3KEAA 4DX5D 4HLLA 1AP7A 5EN5D 1MJ0A 2F8YA 2MYOA 2DZOA 4O1PA 2QC9A 1WG0A 4U96D 4C48B 4DX7D 4J8YA 5HS0A 5CERB 4CYMD 3J5QB 3Q9UC 4HI9A 4U8VD 1OT8A 3NBNB 1MX4A 4YDYA 5KWDA 2B0OE 5ENPD 4U95D 5FIOA 4QFVA 4JB8P 1WDYA 4NIKA 4ATZD 4DX2A 3V30A 1DC2A 4K5BA 1YYHA 3T8KA 2XEEA 3B95A 4TUMA 1BD8A 1NFIE 4UUCA 1SVXA 4F6RD 5JMND 1K3ZD 5D66A 1AWCB 4O60A 5KNHD 2RFMA 2Y0BG 3HRAA 1MYOA 3T9KA 4K5AB 2F8XK 1G3NB 2ZGDA 1K1AA 3UXGA 1BI8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHQ A;  5BXU A;  4LNU D;  2BKK B;  2A5E A;  2XEH A;  3JXJ A;  5CBO A;  5HKP A;  3V31 A;  5CEA A;  2V5Q C;  4OAV B;  1SW6 A;  4DX6 D;  3AJI A;  5AQ7 A;  3UTM A;  3V2X A;  3ZUV B;  4RLY A;  3UI2 A;  3J5P A;  3TWU A;  4HRN A;  4DX1 A;  2XZD G;  2Y1L E;  4GPM A;  4LG6 A;  5AAO A;  3AAA C;  4DUI A;  5CBN A;  1S70 B;  4HNA D;  1IKN D;  3ZU7 B;  1N0R A;  2QYJ A;  4DRX E;  4BET A;  1YCS B;  2F37 A;  5CEC B;  2P2C P;  3JXI A;  3JUE A;  2FO1 E;  1TR4 A;  2XZT G;  1QYM A;  3ZKJ A;  3C5R A;  4G8L A;  3DEO A;  1N0Q A;  4HRL A;  3DEP A;  5ITZ F;  3TWT A;  3SO8 A;  3W9G A;  4N5Q A;  3B7B A;  4HBD A;  5EIB E;  4HRM B;  4CZ2 D;  1K1B A;  5EIL A;  3TWX A;  2KBX A;  2ZGG A;  1BLX B;  5KNG A;  3TWQ A;  3TWS A;  4A63 B;  1BI7 B;  3IXE A;  4LSZ E;  5AN8 A;  1A5E A;  4G8K A;  5ENR D;  1D9S A;  3V2O A;  5AQA A;  5JA4 D;  3NOC D;  4HI8 A;  5BXO A;  5ENS D;  2BKG A;  3V79 K;  4BER A;  1BU9 A;  1IHB A;  4QQI A;  4ZHB A;  2ETC A;  5FIN A;  5ENT D;  5KBA A;  1DCQ A;  1MX6 A;  1OY3 D;  5AAR A;  3TWV A;  2VGE A;  4HB5 A;  3TWR A;  4B93 B;  4O1O A;  2JAB A;  2KXP C;  2HE0 A;  4BSZ B;  5ENO D;  4HQD A;  1UOH A;  4U8Y D;  2RFA A;  1MX2 A;  4K5C A;  4J7W A;  3TWW A;  4Z68 A;  1YMP A;  3D9H A;  2NYJ A;  5EYP F;  2AJA A;  2DWZ A;  3F6Q A;  5EYL A;  5CED B;  2ETB A;  4F1P A;  4ZFH A;  2J8S D;  5EID A;  3W9F A;  4GMR A;  3NOG D;  1N11 A;  2ETA A;  5ENQ D;  2V4H C;  3ZNG A;  3HG0 D;  3LJN A;  4BES A;  3EHR A;  4YDW A;  2DZN A;  4BEP A;  4OAU C;  2XEN A;  5HRY A;  2PNN A;  5AQ9 A;  1IXV A;  2DVW A;  3EU9 A;  5AQB A;  3Q9N C;  2L6B A;  3KEA A;  4DX5 D;  4HLL A;  1AP7 A;  5EN5 D;  1MJ0 A;  2F8Y A;  2MYO A;  2DZO A;  4O1P A;  2QC9 A;  1WG0 A;  4U96 D;  4C48 B;  4DX7 D;  4J8Y A;  5HS0 A;  5CER B;  4CYM D;  3J5Q B;  3Q9U C;  4HI9 A;  4U8V D;  1OT8 A;  3NBN B;  1MX4 A;  4YDY A;  5KWD A;  2B0O E;  5ENP D;  4U95 D;  5FIO A;  4QFV A;  4JB8 P;  1WDY A;  4NIK A;  4ATZ D;  4DX2 A;  3V30 A;  1DC2 A;  4K5B A;  1YYH A;  3T8K A;  2XEE A;  3B95 A;  4TUM A;  1BD8 A;  1NFI E;  4UUC A;  1SVX A;  4F6R D;  5JMN D;  1K3Z D;  5D66 A;  1AWC B;  4O60 A;  5KNH D;  2RFM A;  2Y0B G;  3HRA A;  1MYO A;  3T9K A;  4K5A B;  2F8X K;  1G3N B;  2ZGD A;  1K1A A;  3UXG A;  1BI8 B; 
#chains in the Genus database with same CATH topology
 3DSU A;  2BKK B;  1TJF A;  3FH5 A;  4B89 A;  2ZIS A;  4OVU A;  3EIJ A;  3L54 A;  3S7D A;  4NRH B;  5CEC B;  1TR4 A;  3ZKJ A;  3CVX A;  3CR3 A;  4N2Q A;  3I3N A;  4G8L A;  1E7V A;  3SZ7 A;  3DEP A;  2RG8 A;  3UT8 A;  4EBA G;  4GTM A;  4XIF A;  5KNG A;  3UX4 A;  2IQC A;  5G55 A;  3LEW A;  4JD2 G;  3FUK A;  4GPK A;  1D9S A;  5FT9 A;  5FZS A;  3V79 K;  4J8D A;  1PC2 A;  1HXI A;  4A1G A;  1ZB1 A;  2BTD A;  4JVS A;  3MA5 A;  4I1O B;  3ULQ A;  2AVP A;  3AS4 A;  4G26 A;  4N39 A;  2DWZ A;  4LUN U;  1RW2 A;  2J9Q A;  5AYW D;  3RAU A;  4RG6 A;  3O48 A;  2E0I A;  2MYO A;  5CMY A;  1S63 A;  3CKC A;  4C0M A;  4KYO B;  3QWW A;  4GYW A;  1N54 A;  3RSE G;  4URK A;  4AOF A;  4XI0 A;  3C3Q A;  2B0O E;  4ANV A;  3PRE A;  3FTY A;  2KCL A;  1ELR A;  2R02 A;  1K3Z D;  4B8A A;  5KNH D;  1UN8 A;  2R5S A;  4OYS A;  3CQG B;  4K5A B;  5LP0 A;  5BT1 A;  5CHE E;  4UWH A;  3MGB A;  5ARG A;  2VGX A;  3LY7 A;  1E8W A;  3FUN A;  4Q94 A;  3OTN A;  3UM2 A;  1IKN D;  3ZU7 B;  4BET A;  1B89 A;  5JJ6 A;  3FUD A;  4CT4 A;  3SD5 A;  1N0Q A;  3CVN A;  2J09 A;  1OWL A;  3HHM A;  2XCC A;  5ANR A;  3PZ3 A;  2IY0 C;  2GW1 A;  1BPO A;  3HXB A;  3L16 A;  3PE4 A;  3UT4 A;  4ZHB A;  2ETC A;  3B7R L;  2LAI A;  4XEI G;  3TWV A;  4HQD A;  2PM7 A;  3D9I A;  4U8Y D;  3FY4 A;  4Z68 A;  2AJA A;  2XPY A;  3PS6 A;  3ZW3 A;  5T4Y A;  3AS8 A;  2CHX A;  3FTU A;  3HG0 D;  2AW6 A;  3CVQ A;  4BES A;  5HRY A;  4FJZ A;  4DX5 D;  4R7L A;  5EN5 D;  2F8Y A;  3FDH A;  3PEU B;  3SNX A;  3L9T A;  1N9A A;  1Y6I A;  4I1A A;  4YVQ C;  2F0Y A;  4RQI A;  5D0O D;  5G05 J;  2L0T B;  1TNU A;  2I1K A;  3FTZ A;  1IQR A;  5KWD A;  3PE3 A;  3ULE G;  3T8K A;  1PAQ A;  3LCA A;  4U63 A;  4XE0 A;  4F6R D;  3E37 A;  3FTX A;  2RKK A;  5LCW J;  2OEW A;  2XGS A;  1KT1 A;  3EHQ A;  2A5E A;  5CBO A;  3D9P A;  4EQF A;  1H0A A;  4M7C A;  2IOL A;  4BFR A;  3V2X A;  2XQ0 A;  4AIF A;  3QKY A;  2YQ8 A;  2H6G A;  1S70 B;  3Q4A B;  2YHE A;  2RD0 A;  4U0Z A;  4L2Y A;  2IF4 A;  3C5R A;  4BT9 A;  1MHQ A;  1SZ9 A;  3SO8 A;  2R05 A;  1A17 A;  3MKR A;  2GRQ B;  2KBX A;  2ZGG A;  2LNI A;  3V2O A;  4TUU A;  4Y6C A;  2WXI A;  5JA4 D;  2LSV A;  2BKG A;  5KJN A;  1IQU A;  1HS6 A;  5CRU A;  4FLB A;  2UY1 B;  3VTX A;  3CVY A;  5LFA A;  1NZN A;  2WVI A;  4TV3 A;  4RVB A;  2EIL E;  3RRN B;  1OWP A;  5EID A;  4GMR A;  2X3M A;  1OWN A;  4BEP A;  4OAU C;  4UQX A;  1ELK A;  1MJ0 A;  3L08 A;  2QC9 A;  4U96 D;  4AEZ C;  4HS2 A;  2GRL A;  1H2U A;  1OCO E;  1JWG A;  5H7P A;  3E33 A;  3LY9 A;  4GA2 A;  4JHJ A;  1QZ2 A;  4L1B A;  4ATZ D;  3SHF A;  2HYZ A;  3QJZ A;  1OCZ E;  1SA4 A;  3HRA A;  1EF1 C;  3D9K A;  1HE8 A;  1O1R A;  3KS2 A;  4MBG A;  4HOT A;  5CEA A;  4PS3 A;  3E34 A;  4Q96 A;  2QFC A;  1E8X A;  2E2E A;  3CK7 A;  3FHE A;  1JCQ A;  4HRN A;  1S64 A;  4RG9 A;  1N0R A;  1YCS B;  2P2C P;  1LD7 A;  5FQ7 A;  3ZRH A;  2WQH A;  4F53 A;  2FBN A;  5C2Y A;  3ABK E;  5EIL A;  3ASH A;  3ML9 A;  4KT6 B;  3ZPJ A;  4FU3 A;  1BI7 B;  2BUG A;  4PS8 A;  2WXK A;  1IHB A;  3R9A B;  4GA1 A;  5ENT D;  4I9C A;  3HYM B;  4GYY A;  1N4S A;  3FH8 A;  4EZL A;  3E4B A;  1MX2 A;  2R59 A;  3VLD A;  2NYJ A;  3HIZ A;  4A55 A;  3ONK A;  2ETA A;  3B7T A;  3DSX A;  4JXT A;  4N2S A;  3Q7A A;  3DSV A;  3EU9 A;  5BUZ A;  3BG1 B;  4HLL A;  4YDE A;  4KVO A;  4B0Z A;  2I6H A;  4ILH B;  2LXL A;  2YHC A;  1E90 A;  4GU5 A;  2C0M A;  4UQY A;  3KD7 A;  3QAQ A;  5M72 A;  1N95 A;  4UUC A;  3KSQ A;  4CDM A;  1FPP A;  1HO8 A;  2RFM A;  5DBK A;  1LF8 A;  3CGH A;  2IFU A;  3HDX A;  1K8K G;  4BTA A;  5CCL A;  1TEZ A;  4CT0 A;  2KCV A;  3WXX A;  3Q5M A;  4GTO A;  2QZA A;  1HZ4 A;  2NC9 A;  3CEQ A;  3HVE B;  1W3B A;  3B7B A;  3UQ3 A;  3VLF A;  4LSZ E;  5AN8 A;  4G8K A;  1D8E A;  3PUK A;  4JA9 A;  3NOC D;  3NF1 A;  1OWM A;  3AU4 A;  3TWR A;  1E8Y A;  3GW4 A;  4B93 B;  4G11 A;  2HE0 A;  4JEH A;  2LAH A;  3TWW A;  2X6H A;  3D9H A;  3TG5 A;  4PDX A;  4CGV A;  2H6F A;  3ENE A;  2WXM A;  3G2W A;  2NSZ A;  3EHR A;  3QDN A;  4YDW A;  2WXR A;  3SFX A;  2ZIR A;  2P9U G;  2XEV A;  4K03 A;  4MKT A;  4FLH A;  3J5Q B;  2CFZ A;  3CVV A;  4JHR A;  3QWV A;  5KJM A;  4KZ0 A;  4FHK A;  5CMW A;  3GZS A;  3SF4 A;  5ARF A;  3HXF A;  3LY8 A;  4XZ4 A;  4O60 A;  3ZEF A;  1HFA A;  2VSO E;  3CST A;  2DYR E;  1BI8 B;  4NAC A;  4LNU D;  3CSF A;  3PDN A;  3PH0 C;  1H2T C;  3UI2 A;  3JUI A;  1O5M A;  5AAO A;  2XHE A;  4HNA D;  5D0Q D;  3JQ0 A;  5FJY A;  2IU1 A;  3FEY A;  5J08 A;  4BY6 A;  3CK9 A;  3Q75 A;  3AG2 E;  1DNP A;  4N5Q A;  5EIB E;  2EIK E;  4HRM B;  4GTQ A;  3TWX A;  3QNK A;  1XNF A;  3APC A;  5IY5 E;  3ASN E;  4J8E A;  1A5E A;  1FVF A;  5ENR D;  3IHV A;  3RO2 A;  1TNZ A;  4HI8 A;  4G24 A;  2P9K G;  4JEU A;  1WAO 1;  5AAR A;  3AG3 E;  3LKU A;  2VSN A;  4GMJ A;  3SFY A;  3FUI A;  2RFA A;  4WNF A;  3NAW A;  3F6Q A;  3UT7 A;  5EX0 A;  3ZNG A;  2DZN A;  2JLB A;  5AQ9 A;  4LNG A;  2X38 A;  2DZO A;  1QBQ A;  3NZU A;  2I9C A;  2XS8 A;  4UI9 J;  3S7F A;  3DXK G;  3PZ2 A;  2I2O A;  2UWJ G;  3FUE A;  1TNB A;  3CHS A;  4YDY A;  3E32 A;  5FIO A;  4DX2 A;  3V30 A;  4KBQ A;  3AU5 A;  1RZ4 A;  1V54 E;  2ZU6 B;  2LSU A;  3LVR E;  3CLJ A;  3SBS A;  3FUH A;  4PH4 B;  4MLP A;  1DCE A;  3LXU X;  2XEH A;  2L9B A;  3C3R A;  1SW6 A;  4RLY A;  3I4R B;  3CQC B;  3FUM A;  2XS1 A;  4N5C A;  4G23 A;  2P9I G;  4DRX E;  4I2Z A;  3DSS A;  3NB2 A;  1VDY A;  2XGM A;  5KJK A;  3TWT A;  1PY1 A;  4HOU A;  2X6J A;  3GZ1 A;  5FZQ A;  3RO3 A;  1JWF A;  3LYA A;  4ACL A;  3MEK A;  5E75 A;  2Q7F A;  5HQ8 A;  2CG3 A;  3EHM A;  4O1O A;  3TXM A;  4BSZ B;  2P9L G;  5J90 A;  2ETB A;  2KAT A;  4ZFH A;  4MS6 A;  1ZBP A;  3FUL A;  1LD8 A;  2PNN A;  5AQB A;  2GRO B;  2MOW A;  1TN7 A;  3ASD A;  3JCK C;  2ILR A;  2FUL A;  2VTB B;  3IV0 A;  4F1S A;  3ASO E;  4GB9 A;  3PRZ A;  1OT8 A;  4FHJ A;  3NBN B;  1EYH A;  2H6H A;  5T3R A;  3UMV A;  1YYH A;  1YA0 A;  4TUM A;  1BD8 A;  4J8F A;  1AWC B;  3LJ3 A;  2PM6 A;  1H19 A;  4APO A;  4XI9 A;  3APD A;  3TXN A;  2QY7 A;  2AXU A;  4U0S A;  2DIW A;  2LUH A;  4OAV B;  4I43 A;  4G1T A;  1U2V G;  2V4L A;  2J07 A;  3PNT B;  4U7E B;  1E8Z A;  2EIM E;  2Y1L E;  4LNB A;  4LG6 A;  3AAA C;  5CCM A;  4HLE A;  3FU0 A;  2XZT G;  3FFL A;  3FH7 A;  4UWF A;  3SFZ A;  4WWO A;  3UM0 A;  4AM9 A;  4JC8 A;  2PQR A;  3PNL B;  1Z6T A;  2J4B A;  2VYI A;  5AIJ A;  3ZHE B;  4AP2 A;  3L17 A;  3QB2 A;  4AJW A;  2M63 A;  4BT8 A;  4G25 A;  3R9M A;  4ABN A;  2FI7 A;  4K5C A;  3DPY A;  1KZO A;  4ME2 A;  2C2L A;  2WM9 A;  1HX8 A;  2B6C A;  4GZD A;  3ZFW A;  5AEN A;  1IXV A;  3D9N A;  4GTT A;  4FAD A;  3CKB A;  4BSX A;  2P9S G;  4I6E A;  3BG0 B;  4JB8 P;  4NIK A;  4DLO A;  2UY1 A;  1DC2 A;  3JYS A;  4C0E A;  1SVX A;  4BX9 A;  2Y3A A;  4ATG A;  4I1M A;  2Y4U A;  5DIZ A;  2EIN E;  5HI7 A;  4YDO A;  5BXU A;  3FU3 A;  3U4T A;  3D9O A;  5HKP A;  3IHY A;  3KAE A;  4U07 A;  4DX6 D;  1KLX A;  4DX1 A;  4BTB A;  1P5Q A;  2HR2 A;  4GZ5 A;  3MV3 B;  4DUI A;  5CBN A;  4X8Q A;  1ZU2 A;  4AXH A;  1TNY A;  3DBS A;  3S7B A;  2IOS A;  3W9G A;  4HBD A;  4ILG A;  3T5X A;  3VLE A;  4YND A;  4V3I A;  1Q2Z A;  3B7U X;  3B7S A;  5G04 C;  5B1B E;  4FP7 A;  3Q73 A;  4I2W A;  3DWL G;  3LPZ A;  4PUC A;  1TJC A;  3W9F A;  3ZXP A;  1JCS A;  4GCO A;  2DVW A;  4CRW A;  5LX8 A;  5B3S E;  2VSX E;  3Q47 B;  4WNG A;  3UIO C;  2KCK A;  4A3V A;  3CHM A;  2WXJ A;  2XRZ A;  3QK0 A;  4GTP A;  4FUL A;  4U0U A;  1L5J A;  3TL5 A;  5ENP D;  3ZYL A;  5ANL A;  2XEE A;  3ZGQ A;  3L22 A;  3MKQ B;  4ILI A;  1XGW A;  1K1A A;  5T8I A;  4L9P A;  3Q49 B;  4Y6W A;  1NI1 A;  3PEV B;  4FA6 A;  1IHG A;  3MYV A;  2MHK A;  4GTV A;  4HOQ A;  3T8M A;  3UTM A;  3MZL B;  3TWU A;  1X5B A;  2OEV A;  3ZVV A;  3JUE A;  2XRY A;  2L0I A;  3ML8 A;  3I4G A;  1N4P A;  1INZ A;  1BLX B;  1NA0 A;  2FF4 A;  1UN9 A;  3OXF A;  3RU0 A;  3ABM E;  5KJL A;  1NP7 A;  3ZYQ A;  4HFG A;  4TRQ A;  3ULY A;  4N3B A;  2KXP C;  1S0P A;  2FEZ A;  4IUL A;  1UOH A;  3RJV A;  3HVE A;  1N52 A;  3FEX A;  2BF0 X;  4GTS A;  2V4H C;  3ISM C;  5G05 C;  1GW6 A;  3RRU A;  4TXR A;  4O1P A;  1Y8M A;  4C48 B;  4ANX A;  1N94 A;  3LDZ A;  5EX3 A;  1TN8 A;  4U8H A;  2DCP A;  3IKO B;  3LS8 A;  3C72 A;  1EPU A;  1TYQ G;  3CV0 A;  3L82 A;  2QYU A;  4KZC A;  3DPD A;  3T9K A;  2KZT B;  1OXJ A;  1G3N B;  3WG7 E;  3BU8 A;  2J49 A;  2EIJ E;  3PVL A;  4KVM A;  5AQ7 A;  1ELW A;  3ZUV B;  4F7A A;  2CHW A;  4PS7 A;  3EDT B;  2WXL A;  4GPM A;  3ZYM A;  3DST A;  3UUX A;  3G2S A;  4L7T A;  2FO1 E;  2R03 A;  3FU6 A;  4OVV A;  3URZ A;  2XGO A;  3PUJ A;  1UJK A;  3GYZ A;  1N4Q A;  4E85 A;  3TWQ A;  2ION A;  3HXC A;  4UWK A;  4A63 B;  1FVH A;  4UI9 K;  3RK6 A;  2X6F A;  3UKR G;  3U9W A;  3TG4 A;  4WNE A;  1NA3 A;  4HOR A;  1OY3 D;  3PZ4 A;  3FTS A;  4M3O A;  4FC8 A;  3U64 A;  3TAX A;  4AY6 A;  2WXQ A;  1FT1 A;  4DPR A;  1YMP A;  5EYP F;  3Q78 A;  3RKV A;  1QNF A;  1DVP A;  3FTV A;  2A4Z A;  1E7U A;  3D9M A;  2WXG A;  3FUJ A;  4XKB A;  2L6B A;  1HF8 A;  4DJA A;  1AP7 A;  4AV7 A;  4DX7 D;  4J8Y A;  5HS0 A;  5JJ7 A;  2NXP A;  3CVW A;  3G2V A;  4AY5 A;  5BNW A;  3CVL A;  5FQ4 A;  5EKQ D;  2DYS E;  1NFI E;  2V5F A;  5ENN A;  5JMN D;  4DI3 A;  5D66 A;  4I9E A;  2H6I A;  2Y0B G;  2AWI A;  3EUV A;  3FU5 A;  5C1D A;  2XPZ A;  4KXK B;  3S7J A;  2WXN A;  3N71 A;  3D9J A;  2V5Q C;  2WB2 A;  2GRN B;  3QWP A;  3C98 A;  4EZJ A;  5FQ6 A;  3CHQ A;  4HXI A;  3APF A;  1JCR A;  5AJD A;  2XCB A;  3JXI A;  3CHO A;  3UKU G;  4EZK A;  4HRL A;  5ITZ F;  3CHP A;  3FP3 A;  4CZ2 D;  3CVU A;  5G04 J;  3ZYK A;  2WMN A;  4GAA A;  4J0U A;  2GRM A;  1FT2 A;  4LRZ A;  3SY2 A;  2OVF A;  5BV0 A;  5AQA A;  3RIB A;  4RSY A;  5ENS D;  4LCT A;  4IRU A;  4ACK A;  4JZY A;  5FIN A;  5KBA A;  5LOZ A;  4JHK A;  5EDS A;  1QQE A;  3CVP A;  3EU5 A;  2YIN A;  2GRP B;  4J8S A;  3NZS A;  4DI4 A;  5ENO D;  2VGX B;  2R17 C;  3Q9N C;  3UIP C;  3I5P A;  1WG0 A;  2CG2 A;  4K0R A;  4CGW A;  5KCM A;  1O1T A;  2PL2 A;  4HOS A;  1Z5S C;  5D2M C;  3MV2 B;  4WUY A;  2ZGD A;  3IBE A;  3MCX A;  3UM3 A;  2AXV A;  2HM8 A;  2YNQ A;  3PZ1 A;  3QC1 A;  4JW1 A;  4H7X A;  3L6A A;  1SZA A;  4EPZ A;  3AJI A;  4CDN A;  4IYP A;  2VTB A;  1Z3X A;  5AJL A;  1HG5 A;  4FJY A;  4NUR A;  3BQO A;  3DEO A;  2HO1 A;  2IJG X;  2BED A;  4WND A;  2OVB A;  2Y69 E;  3TWS A;  2FO7 A;  5FWQ A;  4TXQ A;  5BW8 C;  1H2V C;  5BXO A;  4BER A;  2CFU A;  1JPL A;  3UIN C;  3TGO A;  3SQV A;  4A1S A;  3TJP A;  3GZ2 A;  4D10 C;  1MZC A;  5CED B;  3B13 A;  3AS5 A;  2GRR B;  3Q79 A;  4E6H A;  5JJT A;  3ZN3 A;  2XPI A;  3T5V A;  2PZI A;  3ZHE A;  2X6I A;  3Q9U C;  4WAF A;  4UWG A;  3ABL E;  4N3A A;  3OXL A;  3U3W A;  4TXP A;  3ZIM A;  1H6P A;  3D3M A;  3U66 A;  1HU3 A;  3UPV A;  3CHR A;  3JXJ A;  4XX5 A;  5A7D B;  1KPS B;  3V31 A;  4B8C B;  1UJJ A;  2GGF A;  1Z3Y A;  3FWV A;  4EBA A;  4LER A;  4XKC A;  2WXH A;  4CDR A;  1LTX A;  3G2T A;  2Y4T A;  2R2L A;  3SBT B;  5JHB A;  3L13 A;  1K1B A;  4WWP A;  4GA0 A;  3IXE A;  3ZXS A;  2OCC E;  4QQI A;  1MX6 A;  2EQX A;  3UM1 A;  2VGE A;  4HB5 A;  3MJW A;  1SQM A;  2JEK A;  4J7W A;  4UI9 C;  2J8S D;  5JHA A;  1N11 A;  5A23 A;  1N4R A;  4EEC A;  4GML A;  2VGY A;  3QAR A;  4I6J A;  3ASF A;  1HG2 A;  3R7R A;  4B94 A;  4U04 A;  2PQN A;  4H7Y A;  1X81 A;  2WXF A;  3Q15 A;  4U8V D;  1WY6 A;  4LEU A;  2P9P G;  3NQP A;  2WXO A;  4GYO A;  1SA5 A;  3B95 A;  2WQ6 A;  4JA7 A;  4G2V A;  4L2L A;  1MYO A;  3QOU A;  2F8X K;  3EHN A;  3VTY A;  1EDU A;  3ASG A;  1O1S A;  1HH8 A;  2AXZ A;  5FZR A;  4APF A;  1MQS A;  3R7Q A;  3P2B A;  2J4D A;  2QYJ A;  5B1A E;  2F37 A;  3Q7F A;  2IO2 C;  4GZ6 A;  2L6J A;  1IYG A;  1WM5 A;  4KMO A;  5FTP A;  4UWL A;  3BEE A;  1NL4 A;  3MKQ A;  3ESL A;  2IEJ A;  2X6K A;  4EHM A;  2LO6 A;  2WPV A;  3AG4 E;  3K9I A;  1BU9 A;  1H6K A;  2A5U A;  1H6O A;  4HVB A;  3P1U A;  4GZC A;  2OV8 A;  3SI5 A;  1V55 E;  4L23 A;  2WQ7 A;  4CCA A;  1UW4 B;  4F1P A;  4AVX A;  3NOG D;  3D9L A;  4O6F A;  4ANW A;  3LJN A;  2P58 C;  4MRU A;  4ANU A;  4P29 A;  5A6C A;  1U3D A;  1KT0 A;  3RRM B;  3KEA A;  3CK8 A;  3KSL A;  1OUV A;  1OWO A;  4CYM D;  4GZ3 A;  2VJ8 A;  3MX3 A;  4I6G A;  3C3O A;  4YVO A;  4DK5 A;  2WXP A;  1JUQ A;  4U95 D;  4QFV A;  1WDY A;  2OOE A;  3BUA A;  4K5B A;  4UQZ A;  3E30 A;  1E96 B;  5E76 A;  5FQ8 A;  3ESK A;  4I17 A;  4BX8 A;  4JL0 A;  2DBA A;  4GTR A;  1D8D A;  3UXG A;  3OAW A;  2WMO A;  3G2U A;  2KM4 A;  3CIA A;  4C9B B;  5LCW C;  1OCR E;  2MRI A;  3O4Z A;  3J5P A;  2XZD G;  2IO3 C;  3X2Q E;  4BWR A;  3DRA A;  1U3C A;  2J08 A;  3HXE A;  1QYM A;  3PZD A;  4F3V A;  2OND A;  2I1J A;  3EIQ C;  2C0L A;  4JPS A;  4A3T A;  2KZT A;  2V0P A;  3FTW A;  1TN6 A;  1KZP A;  4DLQ A;  1OCC E;  5BV1 A;  3IEG A;  4WWN A;  1DCQ A;  1FCH A;  3KEZ A;  3AG1 E;  4W9R A;  3JQ1 A;  2JAB A;  2VQ2 A;  3SGH A;  5BPP A;  5EYL A;  3ONL A;  2P9N G;  5CRV A;  5ENQ D;  4J6I A;  2XEN A;  3FUF A;  4N3C A;  3S2A A;  3DSW A;  2KC7 A;  2CHZ A;  3EJN A;  5CER B;  4GCN A;  4HI9 A;  3LVQ E;  4Q69 A;  2ZXW E;  1MX4 A;  5G2N A;  2VSY A;  2LXM A;  4NQ0 A;  4CEM A;  2V8S E;  1UG3 A;  3DXM G;  3HXD A;  1TNO A;  3OXG A;  4IN3 B; 
#chains in the Genus database with same CATH homology
 3EHQ A;  5BXU A;  4LNU D;  2BKK B;  2A5E A;  2XEH A;  3JXJ A;  5CBO A;  5HKP A;  3V31 A;  5CEA A;  2V5Q C;  4OAV B;  1SW6 A;  4DX6 D;  3AJI A;  5AQ7 A;  3UTM A;  3V2X A;  3ZUV B;  4RLY A;  3UI2 A;  3J5P A;  3TWU A;  4HRN A;  4DX1 A;  2XZD G;  2Y1L E;  4GPM A;  4LG6 A;  5AAO A;  3AAA C;  4DUI A;  5CBN A;  1S70 B;  4HNA D;  1IKN D;  3ZU7 B;  1N0R A;  2QYJ A;  4DRX E;  4BET A;  1YCS B;  2F37 A;  5CEC B;  2P2C P;  3JXI A;  3JUE A;  2FO1 E;  1TR4 A;  2XZT G;  1QYM A;  3ZKJ A;  3C5R A;  4G8L A;  3DEO A;  1N0Q A;  4HRL A;  3DEP A;  5ITZ F;  3TWT A;  3SO8 A;  3W9G A;  4N5Q A;  3B7B A;  4HBD A;  5EIB E;  4HRM B;  4CZ2 D;  1K1B A;  5EIL A;  3TWX A;  2KBX A;  2ZGG A;  1BLX B;  5KNG A;  3TWQ A;  3TWS A;  4A63 B;  1BI7 B;  3IXE A;  4LSZ E;  5AN8 A;  1A5E A;  4G8K A;  5ENR D;  1D9S A;  3V2O A;  5AQA A;  5JA4 D;  3NOC D;  4HI8 A;  5BXO A;  5ENS D;  2BKG A;  3V79 K;  4BER A;  1BU9 A;  1IHB A;  4QQI A;  4ZHB A;  2ETC A;  5FIN A;  5ENT D;  5KBA A;  1DCQ A;  1MX6 A;  1OY3 D;  5AAR A;  3TWV A;  2VGE A;  4HB5 A;  3TWR A;  4B93 B;  4O1O A;  2JAB A;  2KXP C;  2HE0 A;  4BSZ B;  5ENO D;  4HQD A;  1UOH A;  4U8Y D;  2RFA A;  1MX2 A;  4K5C A;  4J7W A;  3TWW A;  4Z68 A;  1YMP A;  3D9H A;  2NYJ A;  5EYP F;  2AJA A;  2DWZ A;  3F6Q A;  5EYL A;  5CED B;  2ETB A;  4F1P A;  4ZFH A;  2J8S D;  5EID A;  3W9F A;  4GMR A;  3NOG D;  1N11 A;  2ETA A;  5ENQ D;  2V4H C;  3ZNG A;  3HG0 D;  3LJN A;  4BES A;  3EHR A;  4YDW A;  2DZN A;  4BEP A;  4OAU C;  2XEN A;  5HRY A;  2PNN A;  5AQ9 A;  1IXV A;  2DVW A;  3EU9 A;  5AQB A;  3Q9N C;  2L6B A;  3KEA A;  4DX5 D;  4HLL A;  1AP7 A;  5EN5 D;  1MJ0 A;  2F8Y A;  2MYO A;  2DZO A;  4O1P A;  2QC9 A;  1WG0 A;  4U96 D;  4C48 B;  4DX7 D;  4J8Y A;  5HS0 A;  5CER B;  4CYM D;  3J5Q B;  3Q9U C;  4HI9 A;  4U8V D;  1OT8 A;  3NBN B;  1MX4 A;  4YDY A;  5KWD A;  2B0O E;  5ENP D;  4U95 D;  5FIO A;  4QFV A;  4JB8 P;  1WDY A;  4NIK A;  4ATZ D;  4DX2 A;  3V30 A;  1DC2 A;  4K5B A;  1YYH A;  3T8K A;  2XEE A;  3B95 A;  4TUM A;  1BD8 A;  1NFI E;  4UUC A;  1SVX A;  4F6R D;  5JMN D;  1K3Z D;  5D66 A;  1AWC B;  4O60 A;  5KNH D;  2RFM A;  2Y0B G;  3HRA A;  1MYO A;  3T9K A;  4K5A B;  2F8X K;  1G3N B;  2ZGD A;  1K1A A;  3UXG A;  1BI8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...