4ACLA

3d structure of dotu from francisella novicida
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
155
structure length
155
Chain Sequence
DFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVDEKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPQICYQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKHIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Conserved Type Six Secretion Protein Tssl (Dotu) from Francisella Novicida
pubmed doi rcsb
source organism Francisella novicida
molecule tags Protein transport
molecule keywords TSSL
total genus 58
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.590 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4aclA00
4V3IA 4ACLA 3U66A 4ACKA
chains in the Genus database with same CATH superfamily
2YHEA 5KNGA 3LDZA 5BPPA 4CGWA 2WXIA 3W9FA 3UUXA 4AM9A 2KZTB 4IULA 3LY8A 2ONDA 4GZ5A 3SFYA 1HO8A 1HU3A 3L54A 5CHEE 2EQXA 4IYPA 2KCVA 3PS6A 3B7BA 1KT1A 3PNTB 4N3CA 4CGVA 3ULQA 3CK9A 2IO2C 3RJVA 4ANUA 1DVPA 3FH8A 3QARA 2IY0C 4K0RA 4FULA 4WAFA 2MOWA 4CT0A 3E34A 3FEXA 4AV7A 4HFGA 2NYJA 4FP7A 2XPYA 2XGMA 3UT8A 4OVUA 3S7FA 1H6OA 5ENTD 3B7SA 1W3BA 3DSVA 3TXMA 4HOSA 3FWVA 2XEHA 4WNFA 4UI9C 1HXIA 4WNEA 2WXHA 3AG2E 1EF1C 4I43A 2FO1E 2L6JA 2GRPB 3UX4A 1S63A 2DZOA 5AENA 3E32A 2LXLA 3UT7A 1X5BA 1TN8A 5KNHD 1E96B 3RIBA 4ANXA 1ELKA 2VGEA 5BV0A 3FUKA 2WXPA 1QZ2A 3R7RA 3TWQA 5EKQD 1N95A 1PC2A 1JWFA 1O1SA 4HQDA 4UWFA 3DPDA 4A63B 3EHQA 1MHQA 4CDNA 3MV2B 2X3MA 3PE4A 4UQXA 1IKND 3FH7A 2R59A 1AP7A 3E37A 3NBNB 3ML9A 4U8HA 3QAQA 3T5VA 5G55A 2HM8A 3UT4A 3BEEA 3CV0A 3FUMA 3D9KA 4P29A 1WDYA 3CSFA 4HORA 2XZTG 1N4PA 2Q7FA 1KZPA 3FTXA 4U95D 2PM6A 2CHZA 3EHRA 3G2TA 4U07A 4HXIA 5LFAA 1MZCA 2WXRA 3FH5A 1HF8A 1WM5A 4I6JA 3LKUA 2IOLA 5G04C 3IHVA 3PREA 5JJTA 3FUJA 4F1SA 4AP2A 5AIJA 3RU0A 1OT8A 5C2YA 2XGOA 2J09A 3CHMA 2HO1A 4EZKA 1U3CA 2ZU6B 2C2LA 4FHJA 3SF4A 4J0UA 3UIPC 1FCHA 1TNOA 3PZ1A 1JPLA 3HDXA 3QJZA 4B8AA 3CVWA 4PS7A 4E85A 4JA9A 5HI7A 4J8FA 5CRVA 2WXNA 2CHXA 3QWWA 5HQ8A 2AW6A 3E4BA 2XPZA 3E30A 1O1RA 2OOEA 1ZB1A 4BERA 5ENQD 2BKGA 4DLQA 3FTVA 2KCLA 4NIKA 2J49A 2CHWA 3FTZA 3ASDA 4GCOA 5BNWA 4K5CA 4DX1A 4I1MA 4J8EA 4JHRA 3KSQA 4GU5A 2GRNB 2VSNA 3GZSA 3UQ3A 4I6EA 1QYMA 3DBSA 5DBKA 3DEOA 1MX6A 2FO7A 2NXPA 3OAWA 4G1TA 2B6CA 2YINA 2OVFA 3AAAC 4AOFA 2EIKE 5BXUA 2WPVA 3BG1B 2I2OA 2CG3A 1TYQG 2BTDA 3FP3A 2LAIA 1SQMA 5CRUA 5CECB 3DSSA 4XZ4A 2VSYA 2X6FA 3MGBA 3X2QE 3IHYA 4JEHA 3KS2A 4A3VA 4GYYA 3P1UA 4TV3A 1YYHA 3ASNE 5BV1A 5FWQA 3UMVA 1S0PA 4DX7D 4HRMB 5EIDA 5HRYA 3SHFA 4AIFA 1UN8A 4AJWA 3J5PA 3B13A 3JUEA 3Q15A 4U8VD 4JVSA 1N0RA 1BI8B 2H6GA 3LXUX 4JZYA 2P2CP 3TWTA 2ETCA 2WXFA 3CVXA 4LSZE 4RVBA 4BSZB 3G2VA 2VGYA 3TWXA 4FC8A 4LUNU 2DVWA 4R7LA 2KATA 5BXOA 4I2WA 3JXIA 4UWGA 3ZXSA 3RO3A 4I17A 1A17A 2RFMA 5AQ9A 3FHEA 2J4DA 3Q5MA 2X6JA 2LAHA 5ENSD 1OUVA 3GZ2A 3C3QA 3EIJA 4J8DA 4WWOA 2WXLA 2P58C 1TNYA 1G3NB 1UOHA 4EBAG 4N5CA 2Y0BG 2ETAA 5CERB 3ZN3A 4YVQC 4TXRA 3L9TA 4HOUA 3FUIA 4N39A 2V4HC 1YMPA 2L9BA 3Q9UC 3DXMG 3D9PA 5AN8A 3NZSA 1E8ZA 2PZIA 3AG3E 3QWVA 4GTMA 5T4YA 3L6AA 4GZ3A 3ZVVA 1HS6A 4L2YA 4C0EA 1Z3XA 4ZHBA 1WAO1 2MYOA 4EQFA 4L9PA 1KLXA 2E0IA 1BI7B 4H7XA 4HI8A 1Z6TA 3DXKG 5FTPA 2V0PA 5B3SE 4C48B 4QFVA 3PH0C 2V8SE 1SA4A 3L22A 2DYSE 3UKUG 5J08A 1NA3A 3VLDA 2BEDA 5LP0A 3KEZA 3L13A 4RG6A 1H19A 4YDWA 4CZ2D 1V55E 2ZISA 4Z68A 4HS2A 4G11A 3O4ZA 5A7DB 4GTVA 2H6IA 2J4BA 4G2VA 1OXJA 3CSTA 1MYOA 3TL5A 4WNDA 2V4LA 2A4ZA 3C3OA 5KWDA 2R05A 3OXFA 3IV0A 2WXJA 3D3MA 4OVVA 5H7PA 4ACKA 2P9PG 4TUUA 1TNBA 4Y6WA 3LVQE 1BLXB 3ESLA 3PZ4A 3CKBA 5KJLA 1OCCE 2Y1LE 2NSZA 1BU9A 4TUMA 2GRRB 3I5PA 4YDYA 3D9JA 3SNXA 3ZU7B 4GA0A 3UIOC 1N4QA 4CRWA 2FI7A 2GRLA 3OXGA 3QK0A 2J08A 3AS5A 2P9NG 3QNKA 3CVVA 2BUGA 3OXLA 4TXQA 5M72A 2IQCA 2ETBA 3AU4A 3Q4AB 4DJAA 3ZIMA 1MX4A 4XIFA 4GCNA 2XRYA 2DYRE 4LCTA 3PZ3A 4ATZD 3GZ1A 4IN3B 4GZDA 3UINC 4O60A 2BKKB 4CT4A 3D9OA 3CQGB 4N3AA 4DK5A 4EECA 3EU9A 2CG2A 3ABLE 2QFCA 3JYSA 3HXCA 1JCRA 3T8MA 2P9LG 4CDRA 2XRZA 1MJ0A 3SFXA 2GROB 5EN5D 1LTXA 4M7CA 4I9EA 4DUIA 1NZNA 2NC9A 2HR2A 3FUFA 4KZ0A 3LS8A 1BPOA 4KVMA 2V5FA 2Y69E 2GGFA 2UY1B 3L82A 2X6IA 4GTRA 5G05J 1DC2A 3TWUA 1N54A 2QYUA 1LF8A 3D9IA 3ZEFA 1S64A 3NAWA 3Q79A 4JW1A 1JCQA 2FULA 2E2EA 4A55A 3EU5A 3V79K 1XGWA 1HFAA 2I9CA 3I3NA 1H6KA 3SQVA 3ZYMA 3R7QA 3RO2A 2X6HA 3P2BA 2OEWA 4HOQA 1DCQA 2WMOA 3T5XA 2LSUA 4ILGA 4EZLA 2AXVA 5ITZF 4GTOA 2DZNA 1PAQA 4BFRA 4AEZC 4BT9A 5JA4D 2RKKA 2AWIA 4YNDA 4MKTA 3S7BA 3IXEA 4BTBA 1PY1A 4I1AA 3ZKJA 5CEDB 2VTBA 3CIAA 5CEAA 2XCCA 4DX6D 2KBXA 2XCBA 4WWNA 2J9QA 3BG0B 4KYOB 3ZGQA 4Q94A 4ABNA 3HXEA 4BY6A 2V5QC 3ABME 4U0SA 3ISMC 3CLJA 2L0IA 5CMYA 2KXPC 4LNGA 4FADA 3T8KA 3LJ3A 5EIBE 3U9WA 5A6CA 4BEPA 4XE0A 1NL4A 5FZQA 3ESKA 5FQ6A 4L1BA 1FVHA 1WG0A 2F0YA 1KT0A 3ZHEB 2CFZA 4BTAA 3ULEG 1EDUA 1IHGA 3ZW3A 4UWKA 2FEZA 5D0OD 3CVYA 2XQ0A 2WQHA 3SI5A 1TN6A 1HG2A 3LJNA 1LD8A 3Q78A 5CBOA 4I9CA 3CR3A 3G2UA 1MQSA 3FTSA 3E33A 2QY7A 3SY2A 3CQCB 1QQEA 3U4TA 3NQPA 2WXMA 3EHNA 3RRUA 4G8KA 2QYJA 3HRAA 3APFA 1FT2A 3ABKE 4JHKA 2OEVA 5JJ6A 1BD8A 3FTYA 2P9UG 4X8QA 5ENOD 2YHCA 5AARA 4GTTA 2WB2A 3ZPJA 3FTWA 5D2MC 2LXMA 4DRXE 2VQ2A 3PUJA 4V3IA 3NOGD 4D10C 2IEJA 5EYLA 3QDNA 3V31A 5AQBA 3U64A 1H6PA 4OYSA 2IOSA 3QKYA 4G25A 1MX2A 5KJMA 3B7UX 4K03A 1VDYA 3Q7FA 5D66A 3FU0A 3WG7E 3ZYKA 1TJFA 3S2AA 4HB5A 5EDSA 1E8XA 4YVOA 5E75A 4O6FA 3AJIA 3PE3A 4KZCA 3T9KA 4WNGA 3FUHA 1HG5A 1X81A 4U0UA 2UWJG 3FUEA 5CMWA 1QBQA 3SBSA 2L6BA 4GZCA 2X6KA 2IU1A 4UQYA 1TNZA 5CCMA 2DIWA 4QQIA 5EYPF 4XX5A 1QNFA 3TWRA 1E7UA 2XS1A 2WVIA 3CVQA 3Q47B 5FJYA 4I6GA 3RK6A 1Q2ZA 1OWMA 3LVRE 4GA2A 2DWZA 4IRUA 3B7TA 2I1KA 5LOZA 3C72A 3HXFA 2GRMA 5B1AE 5ENRD 4LRZA 4JPSA 1NP7A 3Q49B 4BESA 1EPUA 3FEYA 4FLHA 3NOCD 5J90A 4ILIA 2HE0A 3TWWA 4FA6A 5ENPD 1S70B 1SZ9A 3KAEA 3SBTB 3UM3A 3I4RB 2DBAA 2JEKA 4BX8A 3G2WA 3MCXA 3JQ1A 2P9KG 5FQ8A 3RAUA 3C3RA 3HVEB 4MBGA 3HVEA 3FULA 3WXXA 1Y8MA 3MYVA 4NQ0A 4DX2A 1OY3D 1N52A 3JXJA 1K3ZD 4MRUA 5T3RA 4BT8A 3S7DA 2X38A 1FT1A 1NFIE 2F37A 2EINE 2M63A 2Y4TA 4G8LA 4GA1A 3R9MA 1IQUA 4ACLA 1N11A 3LY9A 3PEUB 4N5QA 4F7AA 1TN7A 1U2VG 1SW6A 3DSTA 4OAUC 2XENA 3ZXPA 2R17C 5FQ4A 1GW6A 3GYZA 4WWPA 2C0LA 2P9IG 4KMOA 1LD7A 3V2XA 4KBQA 3LEWA 4KXKB 3FTUA 4CCAA 1ELRA 1IQRA 5DIZA 4GYOA 4AY5A 4I1OB 4BX9A 1IYGA 2I1JA 4N3BA 4K5BA 4PDXA 2PL2A 1N4SA 3AS4A 4U63A 4B8CB 1IHBA 4K5AB 3FU6A 5EILA 4YDEA 3EIQC 2EILE 3TG5A 3JQ0A 2RD0A 3AG4E 4NRHB 4HRLA 1FVFA 1KZOA 4EBAA 4LNBA 4UWHA 4E6HA 4RLYA 3BUAA 3ONLA 3UI2A 4GTQA 2AXUA 4DLOA 3FFLA 4LG6A 1E8WA 3UPVA 3ZNGA 3MX3A 1Y6IA 4N2SA 3Q73A 5IY5E 2IFUA 1SZAA 4G26A 4PS3A 1Z5SC 2J07A 1AWCB 3LPZA 2CFUA 4RQIA 3PZ2A 1N4RA 1YA0A 4GPMA 4M3OA 4GPKA 4J6IA 3B7RL 4DI3A 1UW4B 3MJWA 1RZ4A 1N0QA 5BT1A 4HBDA 4EHMA 4GB9A 3MEKA 4A1GA 2RFAA 4UI9K 3CK7A 5ANLA 4GTPA 3RKVA 2WMNA 4LEUA 2A5EA 3L16A 2XGSA 1E7VA 1A5EA 1TEZA 3L17A 3Q75A 4A1SA 5BUZA 1YCSB 3DPYA 2WM9A 2ZGGA 3QB2A 4APFA 4ANWA 4WUYA 2Y3AA 1JWGA 4GTSA 4XKBA 4ZFHA 2KCKA 4HLEA 3B95A 5AJLA 4HNAD 3F6QA 1JUQA 4GMRA 5ANRA 4I2ZA 3TJPA 4ILHB 3I4GA 1OWNA 4JB8P 3UM2A 3CVPA 1UN9A 3NB2A 4CDMA 3SFZA 4LERA 4AY6A 1OWPA 4B89A 3SGHA 4OAVB 3TXNA 2BF0X 4GZ6A 2OCCE 2AVPA 4BSXA 1E8YA 3JCKC 4HVBA 4C9BB 3V30A 3U3WA 4W9RA 3NZUA 3UM0A 3ML8A 3AG1E 3ZFWA 3HXBA 5JHBA 1KPSB 4BWRA 4KVOA 2XEVA 3DSXA 3APCA 4F6RD 3PZDA 1ELWA 3D9MA 4F3VA 1SA5A 5E76A 2EIME 4F53A 3CHRA 3NF1A 2HYZA 5ENNA 1UJKA 3JUIA 4GMLA 3RSEG 3DRAA 1HE8A 2FF4A 4BETA 5C1DA 3HG0D 3LY7A 4UWLA 5G05C 4U04A 4APOA 3EHMA 2DCPA 3VLEA 4FLBA 2J8SD 4PUCA 4UI9J 3PDNA 3RRNB 3ZHEA 5B1BE 2ILRA 1L5JA 3ZYQA 2EIJE 2PNNA 3D9HA 2PQRA 2VTBB 5AQAA 3MKRA 2GRQB 3SO8A 3QC1A 4EPZA 2VGXB 3FUDA 1Z3YA 4L7TA 1INZA 4DX5D 5T8IA 4URKA 5G2NA 2PM7A 1D8EA 3APDA 4JL0A 2VSOE 4XI9A 1TNUA 2P9SG 4RG9A 3ULYA 4HRNA 3TGOA 2RG8A 1ZU2A 3Q9NC 3MA5A 4U8YD 1E90A 1K1BA 3DSUA 4G24A 4CYMD 5FIOA 2F8XK 2R03A 3FDHA 3EUVA 1H2UA 3O48A 3RRMB 5KJKA 2UY1A 3G2SA 3MKQB 2QZAA 4FU3A 4HOTA 2L0TB 3ZUVB 3CVLA 3HIZA 5CBNA 3FU3A 4JXTA 2IF4A 4FJYA 1H2VC 2KZTA 4C0MA 1OWLA 1H2TC 3ASFA 4TXPA 1NI1A 2FBNA 3UTMA 2A5UA 3K9IA 2KM4A 4L2LA 2R5SA 2XS8A 3BQOA 5A23A 2WXKA 3LCAA 5HKPA 5AJDA 4HI9A 4ATGA 2LUHA 2H6FA 4GYWA 5BW8C 3J5QB 4TRQA 3MKQA 4HLLA 2B0OE 1HZ4A 4FJZA 2YNQA 5CCLA 4Q69A 1D8DA 4CEMA 1RW2A 1SVXA 2XZDG 3W9GA 3CHPA 4A3TA 3URZA 3ASGA 2KC7A 3UXGA 2XHEA 3FY4A 5LX8A 5ARFA 1P5QA 1U3DA 2VJ8A 3SD5A 4B0ZA 3UM1A 4JC8A 1B89A 3VTXA 3Q7AA 2LO6A 1XNFA 3QOUA 4NACA 2WXGA 5AAOA 3VTYA 3HXDA 4JHJA 4B94A 3KSLA 5KCMA 1O5MA 4LNUD 1N94A 2XPIA 4PS8A 5KJNA 1K8KG 1UG3A 3C5RA 2R2LA 2WXQA 5FZSA 4U7EB 4XEIG 3CVUA 1TR4A 2VYIA 4O1OA 2WXOA 3L08A 3ASHA 1WY6A 4J8SA 5LCWC 3AS8A 2GW1A 3UKRG 3TWVA 3DEPA 1TJCA 3ZYLA 4JA7A 4DI4A 2MHKA 1OCZE 3R9AB 2JLBA 3C98A 4H7YA 4L23A 3KD7A 2XEEA 5EX0A 3TAXA 4FHKA 4J8YA 2Y4UA 4NURA 2MRIA 5EX3A 1D9SA 1UJJA 2YQ8A 4F1PA 3EDTB 3PRZA 3V2OA 1IXVA 5AYWD 5HS0A 2AJAA 3FU5A 5FQ7A 2IJGX 4UUCA 2VSXE 4Y6CA 5JJ7A 3ZRHA 4KT6B 4MS6A 1HH8A 4ANVA 4Q96A 4AVXA 3S7JA 4JEUA 3FUNA 3MV3B 3AU5A 2LNIA 3CHOA 3PUKA 3OTNA 3IKOB 1NA0A 1V54E 2ZGDA 2OV8A 4YDOA 3CHSA 3CHQA 3TWSA 5JMND 1OCRE 2OVBA 4DPRA 4EZJA 4GAAA 1ZBPA 4UQZA 3EJNA 5FZRA 1EYHA 3SZ7A 3IEGA 4PH4B 2VGXA 1OWOA 3LYAA 3CKCA 3PVLA 1DCEA 3ENEA 4G23A 5FINA 3DSWA 1DNPA 4GMJA 3PEVB 4XI0A 4XKCA 5D0QD 4MLPA 1K1AA 5JHAA 1H0AA 1JCSA 5ARGA 3TG4A 2R02A 2C0MA 3CEQA 5FT9A 5G04J 3U66A 3VLFA 2ZIRA 2IONA 5LCWJ 2F8YA 3D9NA 4B93B 2WQ7A 1OCOE 2LSVA 3ASOE 3HYMB 4J7WA 2JABA 3GW4A 3HHMA 3MZLB 5KBAA 4JD2G 2IO3C 1O1TA 2H6HA 3BU8A 4AXHA 3QWPA 3ONKA 4ME2A 5AQ7A 2PQNA 3KEAA 4RSYA 3CVNA 2AXZA 1FPPA 2I6HA 3CGHA 1N9AA 4U0ZA 3N71A 2WQ6A 4O1PA 3IBEA 2ZXWE 3D9LA 4U96D 3CK8A 1HX8A 2QC9A 3PNLB 4N2QA 3DWLG
chains in the Genus database with same CATH topology
2YHEA 3PZDA 3ZN3A 3FTYA 1ELWA 3D9MA 4YVQC 4F3VA 3LDZA 5BPPA 4CGWA 2WXIA 4HOUA 3FUIA 4N39A 2YHCA 5E76A 4F53A 2WB2A 3UUXA 2L9BA 3CHRA 3NF1A 4AM9A 3ZPJA 2HYZA 2KZTB 3D9PA 3FTWA 5ENNA 1UJKA 3JUIA 4IULA 3LY8A 3NZSA 1E8ZA 4GMLA 2VQ2A 2PZIA 3PUJA 2ONDA 3QWVA 4GZ5A 4V3IA 5T4YA 1HO8A 3L6AA 4GZ3A 1HE8A 2FF4A 3ZVVA 4D10C 5C1DA 1HU3A 3QDNA 3LY7A 1HS6A 4UWLA 3U64A 3L54A 5CHEE 2EQXA 5G05C 4OYSA 4IYPA 4L2YA 4U04A 2IOSA 2KCVA 3PS6A 4C0EA 1Z3XA 3QKYA 1WAO1 4APOA 3EHMA 4G25A 4EQFA 2DCPA 3VLEA 4FLBA 5KJMA 4PUCA 3B7UX 4UI9J 4K03A 3PDNA 1VDYA 1KT1A 3PNTB 3RRNB 3ZHEA 1KLXA 2E0IA 4N3CA 2ILRA 1L5JA 3FU0A 4H7XA 3ZYKA 3ULQA 1TJFA 3S2AA 4CGVA 3CK9A 3ZYQA 3RJVA 4ANUA 5EDSA 1Z6TA 2PQRA 2VTBB 1DVPA 3FH8A 1E8XA 3MKRA 3QARA 5FTPA 2V0PA 4YVOA 4K0RA 5E75A 4O6FA 3QC1A 4EPZA 4QFVA 2VGXB 3FUDA 3PH0C 4FULA 3PE3A 2V8SE 3L22A 1Z3YA 4L7TA 4KZCA 1INZA 4WAFA 5T8IA 4URKA 5G2NA 5J08A 2PM7A 3APDA 1NA3A 3VLDA 2MOWA 2VSOE 4JL0A 4XI9A 3FEXA 4WNGA 4CT0A 3FUHA 5LP0A 4AV7A 4RG9A 3KEZA 3L13A 4HFGA 4RG6A 1H19A 1HG5A 4U0UA 4FP7A 2UWJG 3FUEA 2XPYA 2RG8A 3TGOA 2XGMA 1ZU2A 3UT8A 4OVUA 3S7FA 3MA5A 5CMWA 1E90A 4G24A 3SBSA 4HS2A 4G11A 4GZCA 2X6KA 3B7SA 2IU1A 4UQYA 5CCMA 1W3BA 2DIWA 3O4ZA 3FDHA 5A7DB 1H2UA 3O48A 3RRMB 5KJKA 2UY1A 3G2SA 3MKQB 4XX5A 3TXMA 4HOSA 1QNFA 2J4BA 4G2VA 3FWVA 4FU3A 1E7UA 3CSTA 2WVIA 3CVQA 3Q47B 4HOTA 2L0TB 4WNFA 4I6GA 5FJYA 3RK6A 4UI9C 1OWMA 3LVRE 4GA2A 3CVLA 3TL5A 4IRUA 3HIZA 2V4LA 3B7TA 2A4ZA 1HXIA 2I1KA 4WNDA 3OXFA 4WNEA 5LOZA 2WXHA 1EF1C 3IV0A 4I43A 2GRMA 3FU3A 4JXTA 2IF4A 2WXJA 3D3MA 4LRZA 2L6JA 4OVVA 4JPSA 3UX4A 4ACKA 4FJYA 1NP7A 4TUUA 1H2VC 2KZTA 4Y6WA 3Q49B 1EPUA 3LVQE 3FEYA 5AENA 3UT7A 4FLHA 4C0MA 1X5BA 1OWLA 3ESLA 1H2TC 1E96B 3ASFA 3RIBA 4ILIA 1ELKA 3CKBA 4ANXA 5BV0A 2FBNA 5KJLA 3FUKA 2NSZA 1QZ2A 2WXPA 3R7RA 2A5UA 3K9IA 4FA6A 5EKQD 2KM4A 4L2LA 2R5SA 1PC2A 1SZ9A 1JWFA 3I5PA 3KAEA 3SBTB 5A23A 2WXKA 3LCAA 3D9JA 5AJDA 3SNXA 3I4RB 2DBAA 3DPDA 4UWFA 4ATGA 4GA0A 1MHQA 2JEKA 4CDNA 3MV2B 4BX8A 2X3MA 3PE4A 4CRWA 2FI7A 4UQXA 3FH7A 4GYWA 3G2WA 2R59A 3MCXA 2GRLA 5BW8C 3JQ1A 3OXGA 3QK0A 4TRQA 5FQ8A 2J08A 3AS5A 3MKQA 3QNKA 3CVVA 2BUGA 3HVEB 3ML9A 4U8HA 3HVEA 3OXLA 5M72A 3FULA 3QAQA 2IQCA 3WXXA 3T5VA 1Y8MA 5G55A 3MYVA 4NQ0A 1HZ4A 1N52A 3AU4A 4FJZA 2HM8A 3Q4AB 2YNQA 4MRUA 3BEEA 3CV0A 5T3RA 3UT4A 3ZIMA 4CEMA 4DJAA 4Q69A 5CCLA 4BT8A 3S7DA 4XIFA 3FUMA 2X38A 2XRYA 4GCNA 3D9KA 4LCTA 4P29A 3GZ1A 4IN3B 4GZDA 3CSFA 4CT4A 2M63A 4HORA 2Y4TA 3CHPA 3D9OA 3CQGB 4GA1A 4A3TA 4N3AA 1IQUA 3URZA 4ACLA 2Q7FA 3FTXA 4DK5A 2PM6A 3LY9A 3PEUB 3ASGA 2CHZA 4F7AA 3G2TA 4U07A 4HXIA 5LFAA 2KC7A 2WXRA 3FH5A 1HF8A 2XHEA 3FY4A 4EECA 5LX8A 5ARFA 2CG2A 2R17C 5FQ4A 1GW6A 2QFCA 1P5QA 1U3DA 3GYZA 1WM5A 3JYSA 4I6JA 4WWPA 3T8MA 2VJ8A 3SD5A 3LKUA 2C0LA 4B0ZA 4CDRA 4JC8A 2IOLA 4KMOA 1B89A 3VTXA 5G04C 2XRZA 3IHVA 3PREA 5JJTA 3FUJA 2LO6A 4KBQA 3LEWA 4F1SA 4AP2A 4KXKB 5AIJA 3RU0A 3FTUA 5C2YA 4CCAA 1XNFA 2XGOA 1ELRA 1IQRA 3QOUA 4NACA 4I9EA 2WXGA 5DIZA 2J09A 1NZNA 4GYOA 4AY5A 2NC9A 3VTYA 4I1OB 4JHJA 4B94A 4BX9A 3CHMA 2HO1A 2HR2A 1IYGA 5KCMA 4EZKA 3FUFA 2I1JA 4KZ0A 4N3BA 1U3CA 2ZU6B 3LS8A 2C2LA 2XPIA 1BPOA 4PS8A 4PDXA 5KJNA 4KVMA 1UG3A 4FHJA 2V5FA 3SF4A 4J0UA 2GGFA 2PL2A 2UY1B 2WXQA 1FCHA 5FZSA 3CVUA 3AS4A 1JPLA 2VYIA 2X6IA 4U63A 2WXOA 4B8CB 3HDXA 3QJZA 3L08A 4B8AA 3ASHA 5G05J 3FU6A 1WY6A 4J8SA 5LCWC 3CVWA 3AS8A 4PS7A 2GW1A 4E85A 4JA9A 5HI7A 1N54A 3EIQC 4J8FA 1TJCA 5J90A 3TG5A 1LF8A 3ZYLA 3D9IA 2WXNA 3ZEFA 2CHXA 4JA7A 4DI4A 2MHKA 3QWWA 3R9AB 2JLBA 4JW1A 3C98A 4H7YA 5HQ8A 4L23A 3JQ0A 2AW6A 2FULA 3E4BA 2E2EA 3KD7A 2RD0A 2XPZA 4NRHB 4A55A 1FVFA 5EX0A 4EBAA 2OOEA 3TAXA 4UWHA 4E6HA 4FHKA 2Y4UA 4NURA 4DLQA 1XGWA 2MRIA 3ONLA 1HFAA 2I9CA 5EX3A 3FTVA 3I3NA 1H6KA 3ZYMA 1UJJA 3R7QA 2YQ8A 2KCLA 3RO2A 2X6HA 3P2BA 2J49A 2AXUA 3EDTB 4HOQA 3PRZA 4DLOA 2CHWA 3FFLA 3FTZA 3ASDA 2WMOA 5AYWD 3T5XA 4GCOA 2LSUA 4ILGA 5BNWA 3FU5A 1E8WA 5FQ7A 3UPVA 4EZLA 4I1MA 2IJGX 3MX3A 2VSXE 4J8EA 1Y6IA 4JHRA 4Y6CA 5JJ7A 3ZRHA 2AXVA 4N2SA 4GU5A 4KT6B 4MS6A 1HH8A 2IFUA 1SZAA 4G26A 4ANVA 2VSNA 4Q96A 3GZSA 3S7JA 4AVXA 1PAQA 4PS3A 3UQ3A 4I6EA 4JEUA 4BFRA 4AEZC 4BT9A 3DBSA 3FUNA 3MV3B 5DBKA 2AWIA 2J07A 3AU5A 3LPZA 2FO7A 2LNIA 3CHOA 2NXPA 3OAWA 2CFUA 4G1TA 4YNDA 4MKTA 3S7BA 2YINA 2OVFA 4AOFA 1YA0A 3PUKA 3OTNA 4BTBA 2WPVA 3BG1B 3IKOB 1PY1A 2I2OA 1NA0A 4I1AA 2CG3A 2BTDA 2OV8A 3FP3A 4M3OA 4GPKA 2LAIA 1SQMA 4J6IA 3B7RL 4DI3A 2VTBA 3CIAA 3CHSA 3CHQA 1UW4B 4XZ4A 2XCCA 3MJWA 2X6FA 2VSYA 3MGBA 2OVBA 4DPRA 4EZJA 4GAAA 3IHYA 2XCBA 1ZBPA 4JEHA 2J9QA 3BG0B 4WWNA 4UQZA 3KS2A 5BT1A 3EJNA 4KYOB 5FZRA 4GB9A 3ZGQA 4Q94A 3MEKA 4A1GA 1EYHA 4ABNA 4A3VA 3SZ7A 4GYYA 3IEGA 4PH4B 2VGXA 4UI9K 3P1UA 3CK7A 4TV3A 4BY6A 1OWOA 3LYAA 5ANLA 5BV1A 3CKCA 5FWQA 3RKVA 3UMVA 2WMNA 3PVLA 4LEUA 3L16A 2XGSA 1S0PA 4U0SA 3CLJA 3ENEA 4G23A 1E7VA 1DNPA 3SHFA 4GMJA 4AIFA 3PEVB 2L0IA 1UN8A 4XI0A 5CMYA 1TEZA 4XKCA 5D0QD 4MLPA 4FADA 5JHAA 3L17A 4AJWA 1H0AA 3B13A 3Q15A 3LJ3A 4A1SA 5BUZA 3TG4A 5ARGA 3U9WA 2WM9A 4JVSA 2C0MA 5A6CA 3QB2A 4APFA 4ANWA 4WUYA 3LXUX 3CEQA 4JZYA 4XE0A 5FT9A 5G04J 2Y3AA 1JWGA 4XKBA 5FZQA 3ESKA 2KCKA 3VLFA 4HLEA 3U66A 5FQ6A 2IONA 5LCWJ 4L1BA 1FVHA 2WXFA 5AJLA 3CVXA 1KT0A 3D9NA 4RVBA 2WQ7A 2LSVA 3ZHEB 3HYMB 2CFZA 1JUQA 4BTAA 3G2VA 1EDUA 1IHGA 2VGYA 5ANRA 3ZW3A 4UWKA 4I2ZA 2FEZA 5D0OD 3CVYA 3TJPA 3GW4A 2XQ0A 3I4GA 3HHMA 4FC8A 4ILHB 1OWNA 4LUNU 2WQHA 3SI5A 4R7LA 3MZLB 2KATA 4I2WA 1HG2A 4UWGA 3ZXSA 3RO3A 3CVPA 1UN9A 4I17A 1A17A 4CDMA 3SFZA 4LERA 4AXHA 4AY6A 3QWPA 3ONKA 3FHEA 2J4DA 1OWPA 4B89A 3Q5MA 4ME2A 3SGHA 2PQNA 2X6JA 2LAHA 3TXNA 4RSYA 2BF0X 4I9CA 1OUVA 3CR3A 3CVNA 2AXZA 3G2UA 3GZ2A 4GZ6A 2AVPA 1MQSA 3EIJA 2I6HA 3FTSA 4BSXA 1E8YA 3JCKC 4HVBA 3CGHA 2QY7A 4C9BB 4J8DA 4U0ZA 3N71A 3CQCB 2WQ6A 1QQEA 3IBEA 3U4TA 3U3WA 3NQPA 2WXMA 4W9RA 4WWOA 3D9LA 3NZUA 3EHNA 3ML8A 2WXLA 3RRUA 3ZFWA 2P58C 3CK8A 5JHBA 1HX8A 3PNLB 4BWRA 3APFA 4KVOA 4JHKA 2XEVA 3APCA 4EBAG 4N2QA 5JJ6A 4N5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3I A;  4ACL A;  3U66 A;  4ACK A; 
#chains in the Genus database with same CATH topology
 2YHE A;  5KNG A;  3LDZ A;  5BPP A;  4CGW A;  2WXI A;  3W9F A;  3UUX A;  4AM9 A;  2KZT B;  4IUL A;  3LY8 A;  2OND A;  4GZ5 A;  3SFY A;  1HO8 A;  1HU3 A;  3L54 A;  5CHE E;  2EQX A;  4IYP A;  2KCV A;  3PS6 A;  3B7B A;  1KT1 A;  3PNT B;  4N3C A;  4CGV A;  3ULQ A;  3CK9 A;  2IO2 C;  3RJV A;  4ANU A;  1DVP A;  3FH8 A;  3QAR A;  2IY0 C;  4K0R A;  4FUL A;  4WAF A;  2MOW A;  4CT0 A;  3E34 A;  3FEX A;  4AV7 A;  4HFG A;  2NYJ A;  4FP7 A;  2XPY A;  2XGM A;  3UT8 A;  4OVU A;  3S7F A;  1H6O A;  5ENT D;  3B7S A;  1W3B A;  3DSV A;  3TXM A;  4HOS A;  3FWV A;  2XEH A;  4WNF A;  4UI9 C;  1HXI A;  4WNE A;  2WXH A;  3AG2 E;  1EF1 C;  4I43 A;  2FO1 E;  2L6J A;  2GRP B;  3UX4 A;  1S63 A;  2DZO A;  5AEN A;  3E32 A;  2LXL A;  3UT7 A;  1X5B A;  1TN8 A;  5KNH D;  1E96 B;  3RIB A;  4ANX A;  1ELK A;  2VGE A;  5BV0 A;  3FUK A;  2WXP A;  1QZ2 A;  3R7R A;  3TWQ A;  5EKQ D;  1N95 A;  1PC2 A;  1JWF A;  1O1S A;  4HQD A;  4UWF A;  3DPD A;  4A63 B;  3EHQ A;  1MHQ A;  4CDN A;  3MV2 B;  2X3M A;  3PE4 A;  4UQX A;  1IKN D;  3FH7 A;  2R59 A;  1AP7 A;  3E37 A;  3NBN B;  3ML9 A;  4U8H A;  3QAQ A;  3T5V A;  5G55 A;  2HM8 A;  3UT4 A;  3BEE A;  3CV0 A;  3FUM A;  3D9K A;  4P29 A;  1WDY A;  3CSF A;  4HOR A;  2XZT G;  1N4P A;  2Q7F A;  1KZP A;  3FTX A;  4U95 D;  2PM6 A;  2CHZ A;  3EHR A;  3G2T A;  4U07 A;  4HXI A;  5LFA A;  1MZC A;  2WXR A;  3FH5 A;  1HF8 A;  1WM5 A;  4I6J A;  3LKU A;  2IOL A;  5G04 C;  3IHV A;  3PRE A;  5JJT A;  3FUJ A;  4F1S A;  4AP2 A;  5AIJ A;  3RU0 A;  1OT8 A;  5C2Y A;  2XGO A;  2J09 A;  3CHM A;  2HO1 A;  4EZK A;  1U3C A;  2ZU6 B;  2C2L A;  4FHJ A;  3SF4 A;  4J0U A;  3UIP C;  1FCH A;  1TNO A;  3PZ1 A;  1JPL A;  3HDX A;  3QJZ A;  4B8A A;  3CVW A;  4PS7 A;  4E85 A;  4JA9 A;  5HI7 A;  4J8F A;  5CRV A;  2WXN A;  2CHX A;  3QWW A;  5HQ8 A;  2AW6 A;  3E4B A;  2XPZ A;  3E30 A;  1O1R A;  2OOE A;  1ZB1 A;  4BER A;  5ENQ D;  2BKG A;  4DLQ A;  3FTV A;  2KCL A;  4NIK A;  2J49 A;  2CHW A;  3FTZ A;  3ASD A;  4GCO A;  5BNW A;  4K5C A;  4DX1 A;  4I1M A;  4J8E A;  4JHR A;  3KSQ A;  4GU5 A;  2GRN B;  2VSN A;  3GZS A;  3UQ3 A;  4I6E A;  1QYM A;  3DBS A;  5DBK A;  3DEO A;  1MX6 A;  2FO7 A;  2NXP A;  3OAW A;  4G1T A;  2B6C A;  2YIN A;  2OVF A;  3AAA C;  4AOF A;  2EIK E;  5BXU A;  2WPV A;  3BG1 B;  2I2O A;  2CG3 A;  1TYQ G;  2BTD A;  3FP3 A;  2LAI A;  1SQM A;  5CRU A;  5CEC B;  3DSS A;  4XZ4 A;  2VSY A;  2X6F A;  3MGB A;  3X2Q E;  3IHY A;  4JEH A;  3KS2 A;  4A3V A;  4GYY A;  3P1U A;  4TV3 A;  1YYH A;  3ASN E;  5BV1 A;  5FWQ A;  3UMV A;  1S0P A;  4DX7 D;  4HRM B;  5EID A;  5HRY A;  3SHF A;  4AIF A;  1UN8 A;  4AJW A;  3J5P A;  3B13 A;  3JUE A;  3Q15 A;  4U8V D;  4JVS A;  1N0R A;  1BI8 B;  2H6G A;  3LXU X;  4JZY A;  2P2C P;  3TWT A;  2ETC A;  2WXF A;  3CVX A;  4LSZ E;  4RVB A;  4BSZ B;  3G2V A;  2VGY A;  3TWX A;  4FC8 A;  4LUN U;  2DVW A;  4R7L A;  2KAT A;  5BXO A;  4I2W A;  3JXI A;  4UWG A;  3ZXS A;  3RO3 A;  4I17 A;  1A17 A;  2RFM A;  5AQ9 A;  3FHE A;  2J4D A;  3Q5M A;  2X6J A;  2LAH A;  5ENS D;  1OUV A;  3GZ2 A;  3C3Q A;  3EIJ A;  4J8D A;  4WWO A;  2WXL A;  2P58 C;  1TNY A;  1G3N B;  1UOH A;  4EBA G;  4N5C A;  2Y0B G;  2ETA A;  5CER B;  3ZN3 A;  4YVQ C;  4TXR A;  3L9T A;  4HOU A;  3FUI A;  4N39 A;  2V4H C;  1YMP A;  2L9B A;  3Q9U C;  3DXM G;  3D9P A;  5AN8 A;  3NZS A;  1E8Z A;  2PZI A;  3AG3 E;  3QWV A;  4GTM A;  5T4Y A;  3L6A A;  4GZ3 A;  3ZVV A;  1HS6 A;  4L2Y A;  4C0E A;  1Z3X A;  4ZHB A;  1WAO 1;  2MYO A;  4EQF A;  4L9P A;  1KLX A;  2E0I A;  1BI7 B;  4H7X A;  4HI8 A;  1Z6T A;  3DXK G;  5FTP A;  2V0P A;  5B3S E;  4C48 B;  4QFV A;  3PH0 C;  2V8S E;  1SA4 A;  3L22 A;  2DYS E;  3UKU G;  5J08 A;  1NA3 A;  3VLD A;  2BED A;  5LP0 A;  3KEZ A;  3L13 A;  4RG6 A;  1H19 A;  4YDW A;  4CZ2 D;  1V55 E;  2ZIS A;  4Z68 A;  4HS2 A;  4G11 A;  3O4Z A;  5A7D B;  4GTV A;  2H6I A;  2J4B A;  4G2V A;  1OXJ A;  3CST A;  1MYO A;  3TL5 A;  4WND A;  2V4L A;  2A4Z A;  3C3O A;  5KWD A;  2R05 A;  3OXF A;  3IV0 A;  2WXJ A;  3D3M A;  4OVV A;  5H7P A;  4ACK A;  2P9P G;  4TUU A;  1TNB A;  4Y6W A;  3LVQ E;  1BLX B;  3ESL A;  3PZ4 A;  3CKB A;  5KJL A;  1OCC E;  2Y1L E;  2NSZ A;  1BU9 A;  4TUM A;  2GRR B;  3I5P A;  4YDY A;  3D9J A;  3SNX A;  3ZU7 B;  4GA0 A;  3UIO C;  1N4Q A;  4CRW A;  2FI7 A;  2GRL A;  3OXG A;  3QK0 A;  2J08 A;  3AS5 A;  2P9N G;  3QNK A;  3CVV A;  2BUG A;  3OXL A;  4TXQ A;  5M72 A;  2IQC A;  2ETB A;  3AU4 A;  3Q4A B;  4DJA A;  3ZIM A;  1MX4 A;  4XIF A;  4GCN A;  2XRY A;  2DYR E;  4LCT A;  3PZ3 A;  4ATZ D;  3GZ1 A;  4IN3 B;  4GZD A;  3UIN C;  4O60 A;  2BKK B;  4CT4 A;  3D9O A;  3CQG B;  4N3A A;  4DK5 A;  4EEC A;  3EU9 A;  2CG2 A;  3ABL E;  2QFC A;  3JYS A;  3HXC A;  1JCR A;  3T8M A;  2P9L G;  4CDR A;  2XRZ A;  1MJ0 A;  3SFX A;  2GRO B;  5EN5 D;  1LTX A;  4M7C A;  4I9E A;  4DUI A;  1NZN A;  2NC9 A;  2HR2 A;  3FUF A;  4KZ0 A;  3LS8 A;  1BPO A;  4KVM A;  2V5F A;  2Y69 E;  2GGF A;  2UY1 B;  3L82 A;  2X6I A;  4GTR A;  5G05 J;  1DC2 A;  3TWU A;  1N54 A;  2QYU A;  1LF8 A;  3D9I A;  3ZEF A;  1S64 A;  3NAW A;  3Q79 A;  4JW1 A;  1JCQ A;  2FUL A;  2E2E A;  4A55 A;  3EU5 A;  3V79 K;  1XGW A;  1HFA A;  2I9C A;  3I3N A;  1H6K A;  3SQV A;  3ZYM A;  3R7Q A;  3RO2 A;  2X6H A;  3P2B A;  2OEW A;  4HOQ A;  1DCQ A;  2WMO A;  3T5X A;  2LSU A;  4ILG A;  4EZL A;  2AXV A;  5ITZ F;  4GTO A;  2DZN A;  1PAQ A;  4BFR A;  4AEZ C;  4BT9 A;  5JA4 D;  2RKK A;  2AWI A;  4YND A;  4MKT A;  3S7B A;  3IXE A;  4BTB A;  1PY1 A;  4I1A A;  3ZKJ A;  5CED B;  2VTB A;  3CIA A;  5CEA A;  2XCC A;  4DX6 D;  2KBX A;  2XCB A;  4WWN A;  2J9Q A;  3BG0 B;  4KYO B;  3ZGQ A;  4Q94 A;  4ABN A;  3HXE A;  4BY6 A;  2V5Q C;  3ABM E;  4U0S A;  3ISM C;  3CLJ A;  2L0I A;  5CMY A;  2KXP C;  4LNG A;  4FAD A;  3T8K A;  3LJ3 A;  5EIB E;  3U9W A;  5A6C A;  4BEP A;  4XE0 A;  1NL4 A;  5FZQ A;  3ESK A;  5FQ6 A;  4L1B A;  1FVH A;  1WG0 A;  2F0Y A;  1KT0 A;  3ZHE B;  2CFZ A;  4BTA A;  3ULE G;  1EDU A;  1IHG A;  3ZW3 A;  4UWK A;  2FEZ A;  5D0O D;  3CVY A;  2XQ0 A;  2WQH A;  3SI5 A;  1TN6 A;  1HG2 A;  3LJN A;  1LD8 A;  3Q78 A;  5CBO A;  4I9C A;  3CR3 A;  3G2U A;  1MQS A;  3FTS A;  3E33 A;  2QY7 A;  3SY2 A;  3CQC B;  1QQE A;  3U4T A;  3NQP A;  2WXM A;  3EHN A;  3RRU A;  4G8K A;  2QYJ A;  3HRA A;  3APF A;  1FT2 A;  3ABK E;  4JHK A;  2OEV A;  5JJ6 A;  1BD8 A;  3FTY A;  2P9U G;  4X8Q A;  5ENO D;  2YHC A;  5AAR A;  4GTT A;  2WB2 A;  3ZPJ A;  3FTW A;  5D2M C;  2LXM A;  4DRX E;  2VQ2 A;  3PUJ A;  4V3I A;  3NOG D;  4D10 C;  2IEJ A;  5EYL A;  3QDN A;  3V31 A;  5AQB A;  3U64 A;  1H6P A;  4OYS A;  2IOS A;  3QKY A;  4G25 A;  1MX2 A;  5KJM A;  3B7U X;  4K03 A;  1VDY A;  3Q7F A;  5D66 A;  3FU0 A;  3WG7 E;  3ZYK A;  1TJF A;  3S2A A;  4HB5 A;  5EDS A;  1E8X A;  4YVO A;  5E75 A;  4O6F A;  3AJI A;  3PE3 A;  4KZC A;  3T9K A;  4WNG A;  3FUH A;  1HG5 A;  1X81 A;  4U0U A;  2UWJ G;  3FUE A;  5CMW A;  1QBQ A;  3SBS A;  2L6B A;  4GZC A;  2X6K A;  2IU1 A;  4UQY A;  1TNZ A;  5CCM A;  2DIW A;  4QQI A;  5EYP F;  4XX5 A;  1QNF A;  3TWR A;  1E7U A;  2XS1 A;  2WVI A;  3CVQ A;  3Q47 B;  5FJY A;  4I6G A;  3RK6 A;  1Q2Z A;  1OWM A;  3LVR E;  4GA2 A;  2DWZ A;  4IRU A;  3B7T A;  2I1K A;  5LOZ A;  3C72 A;  3HXF A;  2GRM A;  5B1A E;  5ENR D;  4LRZ A;  4JPS A;  1NP7 A;  3Q49 B;  4BES A;  1EPU A;  3FEY A;  4FLH A;  3NOC D;  5J90 A;  4ILI A;  2HE0 A;  3TWW A;  4FA6 A;  5ENP D;  1S70 B;  1SZ9 A;  3KAE A;  3SBT B;  3UM3 A;  3I4R B;  2DBA A;  2JEK A;  4BX8 A;  3G2W A;  3MCX A;  3JQ1 A;  2P9K G;  5FQ8 A;  3RAU A;  3C3R A;  3HVE B;  4MBG A;  3HVE A;  3FUL A;  3WXX A;  1Y8M A;  3MYV A;  4NQ0 A;  4DX2 A;  1OY3 D;  1N52 A;  3JXJ A;  1K3Z D;  4MRU A;  5T3R A;  4BT8 A;  3S7D A;  2X38 A;  1FT1 A;  1NFI E;  2F37 A;  2EIN E;  2M63 A;  2Y4T A;  4G8L A;  4GA1 A;  3R9M A;  1IQU A;  4ACL A;  1N11 A;  3LY9 A;  3PEU B;  4N5Q A;  4F7A A;  1TN7 A;  1U2V G;  1SW6 A;  3DST A;  4OAU C;  2XEN A;  3ZXP A;  2R17 C;  5FQ4 A;  1GW6 A;  3GYZ A;  4WWP A;  2C0L A;  2P9I G;  4KMO A;  1LD7 A;  3V2X A;  4KBQ A;  3LEW A;  4KXK B;  3FTU A;  4CCA A;  1ELR A;  1IQR A;  5DIZ A;  4GYO A;  4AY5 A;  4I1O B;  4BX9 A;  1IYG A;  2I1J A;  4N3B A;  4K5B A;  4PDX A;  2PL2 A;  1N4S A;  3AS4 A;  4U63 A;  4B8C B;  1IHB A;  4K5A B;  3FU6 A;  5EIL A;  4YDE A;  3EIQ C;  2EIL E;  3TG5 A;  3JQ0 A;  2RD0 A;  3AG4 E;  4NRH B;  4HRL A;  1FVF A;  1KZO A;  4EBA A;  4LNB A;  4UWH A;  4E6H A;  4RLY A;  3BUA A;  3ONL A;  3UI2 A;  4GTQ A;  2AXU A;  4DLO A;  3FFL A;  4LG6 A;  1E8W A;  3UPV A;  3ZNG A;  3MX3 A;  1Y6I A;  4N2S A;  3Q73 A;  5IY5 E;  2IFU A;  1SZA A;  4G26 A;  4PS3 A;  1Z5S C;  2J07 A;  1AWC B;  3LPZ A;  2CFU A;  4RQI A;  3PZ2 A;  1N4R A;  1YA0 A;  4GPM A;  4M3O A;  4GPK A;  4J6I A;  3B7R L;  4DI3 A;  1UW4 B;  3MJW A;  1RZ4 A;  1N0Q A;  5BT1 A;  4HBD A;  4EHM A;  4GB9 A;  3MEK A;  4A1G A;  2RFA A;  4UI9 K;  3CK7 A;  5ANL A;  4GTP A;  3RKV A;  2WMN A;  4LEU A;  2A5E A;  3L16 A;  2XGS A;  1E7V A;  1A5E A;  1TEZ A;  3L17 A;  3Q75 A;  4A1S A;  5BUZ A;  1YCS B;  3DPY A;  2WM9 A;  2ZGG A;  3QB2 A;  4APF A;  4ANW A;  4WUY A;  2Y3A A;  1JWG A;  4GTS A;  4XKB A;  4ZFH A;  2KCK A;  4HLE A;  3B95 A;  5AJL A;  4HNA D;  3F6Q A;  1JUQ A;  4GMR A;  5ANR A;  4I2Z A;  3TJP A;  4ILH B;  3I4G A;  1OWN A;  4JB8 P;  3UM2 A;  3CVP A;  1UN9 A;  3NB2 A;  4CDM A;  3SFZ A;  4LER A;  4AY6 A;  1OWP A;  4B89 A;  3SGH A;  4OAV B;  3TXN A;  2BF0 X;  4GZ6 A;  2OCC E;  2AVP A;  4BSX A;  1E8Y A;  3JCK C;  4HVB A;  4C9B B;  3V30 A;  3U3W A;  4W9R A;  3NZU A;  3UM0 A;  3ML8 A;  3AG1 E;  3ZFW A;  3HXB A;  5JHB A;  1KPS B;  4BWR A;  4KVO A;  2XEV A;  3DSX A;  3APC A;  4F6R D;  3PZD A;  1ELW A;  3D9M A;  4F3V A;  1SA5 A;  5E76 A;  2EIM E;  4F53 A;  3CHR A;  3NF1 A;  2HYZ A;  5ENN A;  1UJK A;  3JUI A;  4GML A;  3RSE G;  3DRA A;  1HE8 A;  2FF4 A;  4BET A;  5C1D A;  3HG0 D;  3LY7 A;  4UWL A;  5G05 C;  4U04 A;  4APO A;  3EHM A;  2DCP A;  3VLE A;  4FLB A;  2J8S D;  4PUC A;  4UI9 J;  3PDN A;  3RRN B;  3ZHE A;  5B1B E;  2ILR A;  1L5J A;  3ZYQ A;  2EIJ E;  2PNN A;  3D9H A;  2PQR A;  2VTB B;  5AQA A;  3MKR A;  2GRQ B;  3SO8 A;  3QC1 A;  4EPZ A;  2VGX B;  3FUD A;  1Z3Y A;  4L7T A;  1INZ A;  4DX5 D;  5T8I A;  4URK A;  5G2N A;  2PM7 A;  1D8E A;  3APD A;  4JL0 A;  2VSO E;  4XI9 A;  1TNU A;  2P9S G;  4RG9 A;  3ULY A;  4HRN A;  3TGO A;  2RG8 A;  1ZU2 A;  3Q9N C;  3MA5 A;  4U8Y D;  1E90 A;  1K1B A;  3DSU A;  4G24 A;  4CYM D;  5FIO A;  2F8X K;  2R03 A;  3FDH A;  3EUV A;  1H2U A;  3O48 A;  3RRM B;  5KJK A;  2UY1 A;  3G2S A;  3MKQ B;  2QZA A;  4FU3 A;  4HOT A;  2L0T B;  3ZUV B;  3CVL A;  3HIZ A;  5CBN A;  3FU3 A;  4JXT A;  2IF4 A;  4FJY A;  1H2V C;  2KZT A;  4C0M A;  1OWL A;  1H2T C;  3ASF A;  4TXP A;  1NI1 A;  2FBN A;  3UTM A;  2A5U A;  3K9I A;  2KM4 A;  4L2L A;  2R5S A;  2XS8 A;  3BQO A;  5A23 A;  2WXK A;  3LCA A;  5HKP A;  5AJD A;  4HI9 A;  4ATG A;  2LUH A;  2H6F A;  4GYW A;  5BW8 C;  3J5Q B;  4TRQ A;  3MKQ A;  4HLL A;  2B0O E;  1HZ4 A;  4FJZ A;  2YNQ A;  5CCL A;  4Q69 A;  1D8D A;  4CEM A;  1RW2 A;  1SVX A;  2XZD G;  3W9G A;  3CHP A;  4A3T A;  3URZ A;  3ASG A;  2KC7 A;  3UXG A;  2XHE A;  3FY4 A;  5LX8 A;  5ARF A;  1P5Q A;  1U3D A;  2VJ8 A;  3SD5 A;  4B0Z A;  3UM1 A;  4JC8 A;  1B89 A;  3VTX A;  3Q7A A;  2LO6 A;  1XNF A;  3QOU A;  4NAC A;  2WXG A;  5AAO A;  3VTY A;  3HXD A;  4JHJ A;  4B94 A;  3KSL A;  5KCM A;  1O5M A;  4LNU D;  1N94 A;  2XPI A;  4PS8 A;  5KJN A;  1K8K G;  1UG3 A;  3C5R A;  2R2L A;  2WXQ A;  5FZS A;  4U7E B;  4XEI G;  3CVU A;  1TR4 A;  2VYI A;  4O1O A;  2WXO A;  3L08 A;  3ASH A;  1WY6 A;  4J8S A;  5LCW C;  3AS8 A;  2GW1 A;  3UKR G;  3TWV A;  3DEP A;  1TJC A;  3ZYL A;  4JA7 A;  4DI4 A;  2MHK A;  1OCZ E;  3R9A B;  2JLB A;  3C98 A;  4H7Y A;  4L23 A;  3KD7 A;  2XEE A;  5EX0 A;  3TAX A;  4FHK A;  4J8Y A;  2Y4U A;  4NUR A;  2MRI A;  5EX3 A;  1D9S A;  1UJJ A;  2YQ8 A;  4F1P A;  3EDT B;  3PRZ A;  3V2O A;  1IXV A;  5AYW D;  5HS0 A;  2AJA A;  3FU5 A;  5FQ7 A;  2IJG X;  4UUC A;  2VSX E;  4Y6C A;  5JJ7 A;  3ZRH A;  4KT6 B;  4MS6 A;  1HH8 A;  4ANV A;  4Q96 A;  4AVX A;  3S7J A;  4JEU A;  3FUN A;  3MV3 B;  3AU5 A;  2LNI A;  3CHO A;  3PUK A;  3OTN A;  3IKO B;  1NA0 A;  1V54 E;  2ZGD A;  2OV8 A;  4YDO A;  3CHS A;  3CHQ A;  3TWS A;  5JMN D;  1OCR E;  2OVB A;  4DPR A;  4EZJ A;  4GAA A;  1ZBP A;  4UQZ A;  3EJN A;  5FZR A;  1EYH A;  3SZ7 A;  3IEG A;  4PH4 B;  2VGX A;  1OWO A;  3LYA A;  3CKC A;  3PVL A;  1DCE A;  3ENE A;  4G23 A;  5FIN A;  3DSW A;  1DNP A;  4GMJ A;  3PEV B;  4XI0 A;  4XKC A;  5D0Q D;  4MLP A;  1K1A A;  5JHA A;  1H0A A;  1JCS A;  5ARG A;  3TG4 A;  2R02 A;  2C0M A;  3CEQ A;  5FT9 A;  5G04 J;  3U66 A;  3VLF A;  2ZIR A;  2ION A;  5LCW J;  2F8Y A;  3D9N A;  4B93 B;  2WQ7 A;  1OCO E;  2LSV A;  3ASO E;  3HYM B;  4J7W A;  2JAB A;  3GW4 A;  3HHM A;  3MZL B;  5KBA A;  4JD2 G;  2IO3 C;  1O1T A;  2H6H A;  3BU8 A;  4AXH A;  3QWP A;  3ONK A;  4ME2 A;  5AQ7 A;  2PQN A;  3KEA A;  4RSY A;  3CVN A;  2AXZ A;  1FPP A;  2I6H A;  3CGH A;  1N9A A;  4U0Z A;  3N71 A;  2WQ6 A;  4O1P A;  3IBE A;  2ZXW E;  3D9L A;  4U96 D;  3CK8 A;  1HX8 A;  2QC9 A;  3PNL B;  4N2Q A;  3DWL G; 
#chains in the Genus database with same CATH homology
 2YHE A;  3PZD A;  3ZN3 A;  3FTY A;  1ELW A;  3D9M A;  4YVQ C;  4F3V A;  3LDZ A;  5BPP A;  4CGW A;  2WXI A;  4HOU A;  3FUI A;  4N39 A;  2YHC A;  5E76 A;  4F53 A;  2WB2 A;  3UUX A;  2L9B A;  3CHR A;  3NF1 A;  4AM9 A;  3ZPJ A;  2HYZ A;  2KZT B;  3D9P A;  3FTW A;  5ENN A;  1UJK A;  3JUI A;  4IUL A;  3LY8 A;  3NZS A;  1E8Z A;  4GML A;  2VQ2 A;  2PZI A;  3PUJ A;  2OND A;  3QWV A;  4GZ5 A;  4V3I A;  5T4Y A;  1HO8 A;  3L6A A;  4GZ3 A;  1HE8 A;  2FF4 A;  3ZVV A;  4D10 C;  5C1D A;  1HU3 A;  3QDN A;  3LY7 A;  1HS6 A;  4UWL A;  3U64 A;  3L54 A;  5CHE E;  2EQX A;  5G05 C;  4OYS A;  4IYP A;  4L2Y A;  4U04 A;  2IOS A;  2KCV A;  3PS6 A;  4C0E A;  1Z3X A;  3QKY A;  1WAO 1;  4APO A;  3EHM A;  4G25 A;  4EQF A;  2DCP A;  3VLE A;  4FLB A;  5KJM A;  4PUC A;  3B7U X;  4UI9 J;  4K03 A;  3PDN A;  1VDY A;  1KT1 A;  3PNT B;  3RRN B;  3ZHE A;  1KLX A;  2E0I A;  4N3C A;  2ILR A;  1L5J A;  3FU0 A;  4H7X A;  3ZYK A;  3ULQ A;  1TJF A;  3S2A A;  4CGV A;  3CK9 A;  3ZYQ A;  3RJV A;  4ANU A;  5EDS A;  1Z6T A;  2PQR A;  2VTB B;  1DVP A;  3FH8 A;  1E8X A;  3MKR A;  3QAR A;  5FTP A;  2V0P A;  4YVO A;  4K0R A;  5E75 A;  4O6F A;  3QC1 A;  4EPZ A;  4QFV A;  2VGX B;  3FUD A;  3PH0 C;  4FUL A;  3PE3 A;  2V8S E;  3L22 A;  1Z3Y A;  4L7T A;  4KZC A;  1INZ A;  4WAF A;  5T8I A;  4URK A;  5G2N A;  5J08 A;  2PM7 A;  3APD A;  1NA3 A;  3VLD A;  2MOW A;  2VSO E;  4JL0 A;  4XI9 A;  3FEX A;  4WNG A;  4CT0 A;  3FUH A;  5LP0 A;  4AV7 A;  4RG9 A;  3KEZ A;  3L13 A;  4HFG A;  4RG6 A;  1H19 A;  1HG5 A;  4U0U A;  4FP7 A;  2UWJ G;  3FUE A;  2XPY A;  2RG8 A;  3TGO A;  2XGM A;  1ZU2 A;  3UT8 A;  4OVU A;  3S7F A;  3MA5 A;  5CMW A;  1E90 A;  4G24 A;  3SBS A;  4HS2 A;  4G11 A;  4GZC A;  2X6K A;  3B7S A;  2IU1 A;  4UQY A;  5CCM A;  1W3B A;  2DIW A;  3O4Z A;  3FDH A;  5A7D B;  1H2U A;  3O48 A;  3RRM B;  5KJK A;  2UY1 A;  3G2S A;  3MKQ B;  4XX5 A;  3TXM A;  4HOS A;  1QNF A;  2J4B A;  4G2V A;  3FWV A;  4FU3 A;  1E7U A;  3CST A;  2WVI A;  3CVQ A;  3Q47 B;  4HOT A;  2L0T B;  4WNF A;  4I6G A;  5FJY A;  3RK6 A;  4UI9 C;  1OWM A;  3LVR E;  4GA2 A;  3CVL A;  3TL5 A;  4IRU A;  3HIZ A;  2V4L A;  3B7T A;  2A4Z A;  1HXI A;  2I1K A;  4WND A;  3OXF A;  4WNE A;  5LOZ A;  2WXH A;  1EF1 C;  3IV0 A;  4I43 A;  2GRM A;  3FU3 A;  4JXT A;  2IF4 A;  2WXJ A;  3D3M A;  4LRZ A;  2L6J A;  4OVV A;  4JPS A;  3UX4 A;  4ACK A;  4FJY A;  1NP7 A;  4TUU A;  1H2V C;  2KZT A;  4Y6W A;  3Q49 B;  1EPU A;  3LVQ E;  3FEY A;  5AEN A;  3UT7 A;  4FLH A;  4C0M A;  1X5B A;  1OWL A;  3ESL A;  1H2T C;  1E96 B;  3ASF A;  3RIB A;  4ILI A;  1ELK A;  3CKB A;  4ANX A;  5BV0 A;  2FBN A;  5KJL A;  3FUK A;  2NSZ A;  1QZ2 A;  2WXP A;  3R7R A;  2A5U A;  3K9I A;  4FA6 A;  5EKQ D;  2KM4 A;  4L2L A;  2R5S A;  1PC2 A;  1SZ9 A;  1JWF A;  3I5P A;  3KAE A;  3SBT B;  5A23 A;  2WXK A;  3LCA A;  3D9J A;  5AJD A;  3SNX A;  3I4R B;  2DBA A;  3DPD A;  4UWF A;  4ATG A;  4GA0 A;  1MHQ A;  2JEK A;  4CDN A;  3MV2 B;  4BX8 A;  2X3M A;  3PE4 A;  4CRW A;  2FI7 A;  4UQX A;  3FH7 A;  4GYW A;  3G2W A;  2R59 A;  3MCX A;  2GRL A;  5BW8 C;  3JQ1 A;  3OXG A;  3QK0 A;  4TRQ A;  5FQ8 A;  2J08 A;  3AS5 A;  3MKQ A;  3QNK A;  3CVV A;  2BUG A;  3HVE B;  3ML9 A;  4U8H A;  3HVE A;  3OXL A;  5M72 A;  3FUL A;  3QAQ A;  2IQC A;  3WXX A;  3T5V A;  1Y8M A;  5G55 A;  3MYV A;  4NQ0 A;  1HZ4 A;  1N52 A;  3AU4 A;  4FJZ A;  2HM8 A;  3Q4A B;  2YNQ A;  4MRU A;  3BEE A;  3CV0 A;  5T3R A;  3UT4 A;  3ZIM A;  4CEM A;  4DJA A;  4Q69 A;  5CCL A;  4BT8 A;  3S7D A;  4XIF A;  3FUM A;  2X38 A;  2XRY A;  4GCN A;  3D9K A;  4LCT A;  4P29 A;  3GZ1 A;  4IN3 B;  4GZD A;  3CSF A;  4CT4 A;  2M63 A;  4HOR A;  2Y4T A;  3CHP A;  3D9O A;  3CQG B;  4GA1 A;  4A3T A;  4N3A A;  1IQU A;  3URZ A;  4ACL A;  2Q7F A;  3FTX A;  4DK5 A;  2PM6 A;  3LY9 A;  3PEU B;  3ASG A;  2CHZ A;  4F7A A;  3G2T A;  4U07 A;  4HXI A;  5LFA A;  2KC7 A;  2WXR A;  3FH5 A;  1HF8 A;  2XHE A;  3FY4 A;  4EEC A;  5LX8 A;  5ARF A;  2CG2 A;  2R17 C;  5FQ4 A;  1GW6 A;  2QFC A;  1P5Q A;  1U3D A;  3GYZ A;  1WM5 A;  3JYS A;  4I6J A;  4WWP A;  3T8M A;  2VJ8 A;  3SD5 A;  3LKU A;  2C0L A;  4B0Z A;  4CDR A;  4JC8 A;  2IOL A;  4KMO A;  1B89 A;  3VTX A;  5G04 C;  2XRZ A;  3IHV A;  3PRE A;  5JJT A;  3FUJ A;  2LO6 A;  4KBQ A;  3LEW A;  4F1S A;  4AP2 A;  4KXK B;  5AIJ A;  3RU0 A;  3FTU A;  5C2Y A;  4CCA A;  1XNF A;  2XGO A;  1ELR A;  1IQR A;  3QOU A;  4NAC A;  4I9E A;  2WXG A;  5DIZ A;  2J09 A;  1NZN A;  4GYO A;  4AY5 A;  2NC9 A;  3VTY A;  4I1O B;  4JHJ A;  4B94 A;  4BX9 A;  3CHM A;  2HO1 A;  2HR2 A;  1IYG A;  5KCM A;  4EZK A;  3FUF A;  2I1J A;  4KZ0 A;  4N3B A;  1U3C A;  2ZU6 B;  3LS8 A;  2C2L A;  2XPI A;  1BPO A;  4PS8 A;  4PDX A;  5KJN A;  4KVM A;  1UG3 A;  4FHJ A;  2V5F A;  3SF4 A;  4J0U A;  2GGF A;  2PL2 A;  2UY1 B;  2WXQ A;  1FCH A;  5FZS A;  3CVU A;  3AS4 A;  1JPL A;  2VYI A;  2X6I A;  4U63 A;  2WXO A;  4B8C B;  3HDX A;  3QJZ A;  3L08 A;  4B8A A;  3ASH A;  5G05 J;  3FU6 A;  1WY6 A;  4J8S A;  5LCW C;  3CVW A;  3AS8 A;  4PS7 A;  2GW1 A;  4E85 A;  4JA9 A;  5HI7 A;  1N54 A;  3EIQ C;  4J8F A;  1TJC A;  5J90 A;  3TG5 A;  1LF8 A;  3ZYL A;  3D9I A;  2WXN A;  3ZEF A;  2CHX A;  4JA7 A;  4DI4 A;  2MHK A;  3QWW A;  3R9A B;  2JLB A;  4JW1 A;  3C98 A;  4H7Y A;  5HQ8 A;  4L23 A;  3JQ0 A;  2AW6 A;  2FUL A;  3E4B A;  2E2E A;  3KD7 A;  2RD0 A;  2XPZ A;  4NRH B;  4A55 A;  1FVF A;  5EX0 A;  4EBA A;  2OOE A;  3TAX A;  4UWH A;  4E6H A;  4FHK A;  2Y4U A;  4NUR A;  4DLQ A;  1XGW A;  2MRI A;  3ONL A;  1HFA A;  2I9C A;  5EX3 A;  3FTV A;  3I3N A;  1H6K A;  3ZYM A;  1UJJ A;  3R7Q A;  2YQ8 A;  2KCL A;  3RO2 A;  2X6H A;  3P2B A;  2J49 A;  2AXU A;  3EDT B;  4HOQ A;  3PRZ A;  4DLO A;  2CHW A;  3FFL A;  3FTZ A;  3ASD A;  2WMO A;  5AYW D;  3T5X A;  4GCO A;  2LSU A;  4ILG A;  5BNW A;  3FU5 A;  1E8W A;  5FQ7 A;  3UPV A;  4EZL A;  4I1M A;  2IJG X;  3MX3 A;  2VSX E;  4J8E A;  1Y6I A;  4JHR A;  4Y6C A;  5JJ7 A;  3ZRH A;  2AXV A;  4N2S A;  4GU5 A;  4KT6 B;  4MS6 A;  1HH8 A;  2IFU A;  1SZA A;  4G26 A;  4ANV A;  2VSN A;  4Q96 A;  3GZS A;  3S7J A;  4AVX A;  1PAQ A;  4PS3 A;  3UQ3 A;  4I6E A;  4JEU A;  4BFR A;  4AEZ C;  4BT9 A;  3DBS A;  3FUN A;  3MV3 B;  5DBK A;  2AWI A;  2J07 A;  3AU5 A;  3LPZ A;  2FO7 A;  2LNI A;  3CHO A;  2NXP A;  3OAW A;  2CFU A;  4G1T A;  4YND A;  4MKT A;  3S7B A;  2YIN A;  2OVF A;  4AOF A;  1YA0 A;  3PUK A;  3OTN A;  4BTB A;  2WPV A;  3BG1 B;  3IKO B;  1PY1 A;  2I2O A;  1NA0 A;  4I1A A;  2CG3 A;  2BTD A;  2OV8 A;  3FP3 A;  4M3O A;  4GPK A;  2LAI A;  1SQM A;  4J6I A;  3B7R L;  4DI3 A;  2VTB A;  3CIA A;  3CHS A;  3CHQ A;  1UW4 B;  4XZ4 A;  2XCC A;  3MJW A;  2X6F A;  2VSY A;  3MGB A;  2OVB A;  4DPR A;  4EZJ A;  4GAA A;  3IHY A;  2XCB A;  1ZBP A;  4JEH A;  2J9Q A;  3BG0 B;  4WWN A;  4UQZ A;  3KS2 A;  5BT1 A;  3EJN A;  4KYO B;  5FZR A;  4GB9 A;  3ZGQ A;  4Q94 A;  3MEK A;  4A1G A;  1EYH A;  4ABN A;  4A3V A;  3SZ7 A;  4GYY A;  3IEG A;  4PH4 B;  2VGX A;  4UI9 K;  3P1U A;  3CK7 A;  4TV3 A;  4BY6 A;  1OWO A;  3LYA A;  5ANL A;  5BV1 A;  3CKC A;  5FWQ A;  3RKV A;  3UMV A;  2WMN A;  3PVL A;  4LEU A;  3L16 A;  2XGS A;  1S0P A;  4U0S A;  3CLJ A;  3ENE A;  4G23 A;  1E7V A;  1DNP A;  3SHF A;  4GMJ A;  4AIF A;  3PEV B;  2L0I A;  1UN8 A;  4XI0 A;  5CMY A;  1TEZ A;  4XKC A;  5D0Q D;  4MLP A;  4FAD A;  5JHA A;  3L17 A;  4AJW A;  1H0A A;  3B13 A;  3Q15 A;  3LJ3 A;  4A1S A;  5BUZ A;  3TG4 A;  5ARG A;  3U9W A;  2WM9 A;  4JVS A;  2C0M A;  5A6C A;  3QB2 A;  4APF A;  4ANW A;  4WUY A;  3LXU X;  3CEQ A;  4JZY A;  4XE0 A;  5FT9 A;  5G04 J;  2Y3A A;  1JWG A;  4XKB A;  5FZQ A;  3ESK A;  2KCK A;  3VLF A;  4HLE A;  3U66 A;  5FQ6 A;  2ION A;  5LCW J;  4L1B A;  1FVH A;  2WXF A;  5AJL A;  3CVX A;  1KT0 A;  3D9N A;  4RVB A;  2WQ7 A;  2LSV A;  3ZHE B;  3HYM B;  2CFZ A;  1JUQ A;  4BTA A;  3G2V A;  1EDU A;  1IHG A;  2VGY A;  5ANR A;  3ZW3 A;  4UWK A;  4I2Z A;  2FEZ A;  5D0O D;  3CVY A;  3TJP A;  3GW4 A;  2XQ0 A;  3I4G A;  3HHM A;  4FC8 A;  4ILH B;  1OWN A;  4LUN U;  2WQH A;  3SI5 A;  4R7L A;  3MZL B;  2KAT A;  4I2W A;  1HG2 A;  4UWG A;  3ZXS A;  3RO3 A;  3CVP A;  1UN9 A;  4I17 A;  1A17 A;  4CDM A;  3SFZ A;  4LER A;  4AXH A;  4AY6 A;  3QWP A;  3ONK A;  3FHE A;  2J4D A;  1OWP A;  4B89 A;  3Q5M A;  4ME2 A;  3SGH A;  2PQN A;  2X6J A;  2LAH A;  3TXN A;  4RSY A;  2BF0 X;  4I9C A;  1OUV A;  3CR3 A;  3CVN A;  2AXZ A;  3G2U A;  3GZ2 A;  4GZ6 A;  2AVP A;  1MQS A;  3EIJ A;  2I6H A;  3FTS A;  4BSX A;  1E8Y A;  3JCK C;  4HVB A;  3CGH A;  2QY7 A;  4C9B B;  4J8D A;  4U0Z A;  3N71 A;  3CQC B;  2WQ6 A;  1QQE A;  3IBE A;  3U4T A;  3U3W A;  3NQP A;  2WXM A;  4W9R A;  4WWO A;  3D9L A;  3NZU A;  3EHN A;  3ML8 A;  2WXL A;  3RRU A;  3ZFW A;  2P58 C;  3CK8 A;  5JHB A;  1HX8 A;  3PNL B;  4BWR A;  3APF A;  4KVO A;  4JHK A;  2XEV A;  3APC A;  4EBA G;  4N2Q A;  5JJ6 A;  4N5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...