4ACLA

3d structure of dotu from francisella novicida
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
155
structure length
155
Chain Sequence
b'DFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVDEKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPQICYQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKHIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TSSL
publication title The Structure of the Conserved Type Six Secretion Protein Tssl (Dotu) from Francisella Novicida
pubmed doi rcsb
source organism Francisella novicida
molecule tags Protein transport
total genus 58
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.590 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4aclA00
4ACKA 4ACLA 3U66A 4V3IA
chains in the Genus database with same CATH superfamily
5FIOA 1H6PA 3Q15A 3BU8A 4M3OA 2GROB 2XCCA 1SZ9A 2FI7A 3T9KA 2F8XK 1W3BA 2FO7A 2UY1A 4FHKA 4DI4A 1SZAA 5B1AE 4ABNA 2LSUA 3TJPA 3UT8A 4WAFA 2MOWA 4GA0A 1KPSB 2QYUA 4OVUA 1TNBA 3LDZA 1KT1A 3FU5A 4XIFA 4UI9K 3CKCA 2DWZA 3E30A 5BUZA 2QC9A 4XI9A 4A1SA 1JWGA 1BLXB 3HXFA 3W9FA 4H7XA 3E4BA 2H6HA 3O4ZA 3G2SA 3FEXA 1S70B 3PUKA 2CFUA 2OEVA 4ATGA 2AXUA 1FVHA 4CT4A 4IULA 3AU5A 5D0OD 3OXLA 4I1MA 4XX5A 4UQZA 4APFA 4N3AA 5D66A 1H2UA 4PS7A 3EU9A 2ZISA 1ZB1A 4J8SA 1HXIA 3LJ3A 4K03A 3CHOA 1UOHA 2WXRA 3L13A 2ETBA 3CEQA 4B89A 2KCKA 2CHZA 2A5UA 4AXHA 3CVWA 2I9CA 4JW1A 3SFYA 4C48B 3IBEA 4AEZC 1EPUA 2ILRA 2AWIA 4KVOA 4UWGA 3OXFA 3AJIA 4KVMA 1JCQA 2WXKA 3V2OA 3ZFWA 4I9EA 4HVBA 1N0QA 4EZLA 4I1AA 1B89A 2Y0BG 2JEKA 4L23A 3SBTB 5T3RA 3BUAA 4HBDA 3B13A 1N4QA 3EHQA 4F53A 3AG1E 3UT4A 4YVOA 2XHEA 3HXCA 2XGMA 3WXXA 3TWTA 3FP3A 3Q7AA 3B7BA 2OCCE 3OAWA 1WY6A 4JXTA 4HI9A 4KZ0A 4EBAA 3QC1A 3TGOA 2CFZA 1D8DA 5FQ4A 4BSZB 1MX4A 2WQHA 2NXPA 3HXBA 4P29A 4Y6WA 3MKRA 1EF1C 2GRLA 1AP7A 3UTMA 3CGHA 4ME2A 2AJAA 3LYAA 4BTAA 2R05A 3ZXPA 3NZUA 3I3NA 3QB2A 1Z6TA 5B3SE 2J4BA 3ZHEA 3FTZA 2VGXB 2WXHA 2QYJA 4Y6CA 3ZUVB 2GRQB 2CG2A 3E33A 4BY6A 1TR4A 2FF4A 1IXVA 3MGBA 4LCTA 3RAUA 2VTBB 3G2TA 2ETCA 4Q94A 5E76A 3EDTB 4GZDA 5E75A 3DEPA 3LPZA 4XI0A 4GPMA 2LSVA 2VGXA 5FQ6A 1N52A 2AXVA 3UM2A 2JLBA 5EYLA 3S2AA 4GYYA 3TWUA 5G55A 2VTBA 4FULA 1OWPA 1NL4A 4LSZE 4PUCA 2VSNA 1A5EA 3ASFA 1OWOA 1JCRA 1SW6A 4AY5A 3PZDA 3ZVVA 1PAQA 2F37A 3BQOA 3UT7A 3SBSA 4EECA 1OWLA 3ZYQA 1TEZA 4N2QA 4JPSA 4BT9A 4B8AA 3EIQC 1GW6A 4BSXA 2J4DA 4L9PA 3APFA 3DSWA 1HS6A 4UWHA 3SO8A 3WG7E 1LF8A 3MJWA 3CHRA 4XKBA 3SD5A 1FVFA 3GZ1A 3G2VA 1HO8A 2E2EA 3HG0D 4KYOB 3D9PA 3HXEA 3GZSA 4GPKA 3ISMC 3CQGB 1E8YA 2OOEA 4GTMA 5BW8C 2MHKA 4G2VA 5AENA 3NF1A 2YINA 5CBOA 4F3VA 1H6KA 5CCLA 2P58C 1G3NB 5AQAA 4V3IA 2DBAA 2BF0X 4HXIA 2KZTB 5EILA 1K1BA 3EU5A 3QK0A 3FHEA 1N9AA 2EIJE 3PVLA 4MLPA 5AIJA 1MQSA 4J0UA 2CHWA 1YYHA 4F1SA 1PY1A 4HORA 1QZ2A 2GRNB 2PQRA 3S7FA 3V31A 2RFAA 3ZKJA 4IRUA 4TV3A 2IJGX 5LCWC 2X6JA 2WXFA 2KZTA 1NP7A 4U0SA 1E8XA 4JB8P 4N5QA 1A17A 2FO1E 1TJCA 3MKQB 1Z3YA 4U8HA 3CSTA 1ELRA 5FZQA 2AVPA 4JC8A 3R9MA 5A7DB 1BPOA 4B93B 1YMPA 1N0RA 2RD0A 2YHEA 2PL2A 4EPZA 2X6IA 2WXOA 4ACKA 4G8LA 1N94A 3N71A 4A55A 3FFLA 5FWQA 4NACA 3CHSA 3JXIA 3PEVB 3MKQA 1KZPA 4JHKA 3MYVA 5JMND 4K5AB 4KT6B 4XEIG 3FH5A 3FU3A 3ULQA 1MJ0A 2PM7A 3RIBA 1SA4A 4GMJA 3SFZA 2KCVA 2VSYA 3C98A 2ZXWE 5HI7A 4KXKB 2WMOA 3SI5A 2B6CA 1H2VC 2WMNA 3QJZA 4E85A 5G04C 2VGYA 2Q7FA 4JA7A 3SF4A 5KJNA 2DYRE 3DSVA 3RK6A 1EDUA 5AQ9A 1FPPA 1O1TA 4U0UA 4A63B 2YHCA 5AJLA 4PS8A 4CDNA 4GU5A 3L82A 1E8WA 5IY5E 3R9AB 3KS2A 4U63A 4AV7A 3S7BA 4DX6D 2WVIA 4L1BA 1BI7B 4G24A 3PRZA 1DCEA 4WNFA 4AP2A 1H2TC 3AG2E 3AAAC 3EHRA 3TWRA 1IHGA 1ELKA 3CIAA 4G11A 4AY6A 1E7UA 2RFMA 2L9BA 3GYZA 3I4GA 1HG5A 1HFAA 2HE0A 3VLFA 4BX9A 5CEDB 2OV8A 1E7VA 1OCCE 2P9IG 3U9WA 1EYHA 2OVBA 4N5CA 3S7JA 4U7EB 4HLLA 3ESKA 3L16A 4K5BA 5AQ7A 3L22A 3TWXA 1LTXA 1DC2A 2ZU6B 3AS4A 5D0QD 2LXLA 2IO3C 3D9HA 4UI9J 4XE0A 4I43A 1N95A 3CVLA 5AYWD 4DPRA 3ZIMA 2XRZA 3FUNA 3QARA 2IEJA 5FINA 5KJMA 5EX0A 3UKUG 4I2ZA 4DJAA 2CG3A 1TN8A 4BERA 3EJNA 1UW4B 3IKOB 2I2OA 2P9KG 3RO3A 3JYSA 3ZEFA 4U07A 3GW4A 3KAEA 1OY3D 1QBQA 1TNUA 2J07A 4RLYA 2NYJA 3LY8A 2XQ0A 5FZRA 3B7UX 4FADA 5ENQD 2WXPA 5C1DA 2LUHA 3UMVA 1UJKA 3JCKC 2VQ2A 4PS3A 3I5PA 5T4YA 4DX1A 3C3OA 2PNNA 3CVUA 3VLDA 4BESA 3T5XA 2XCBA 4HRNA 3ASOE 4GTTA 1S0PA 3R7RA 2DZNA 3X2QE 2ONDA 4BTBA 2DCPA 3SNXA 4GZ5A 1L5JA 1RW2A 3CVYA 4NQ0A 2XGOA 3ULYA 3QKYA 5EDSA 4FC8A 3RRMB 1H19A 4LNGA 5ENNA 2ZGDA 3KEZA 3ESLA 4DLQA 4PH4B 3SQVA 1XGWA 2XS8A 5D2MC 3UKRG 1MZCA 4U0ZA 3UXGA 4O1OA 4CGVA 4JHJA 3RRNB 4UQXA 1TNYA 1V55E 4MRUA 4N3BA 3D9OA 2ZGGA 3Q78A 1K3ZD 4DX7D 2X3MA 4WNDA 2XPZA 4J6IA 4C9BB 4BWRA 4LG6A 2IU1A 5A23A 4UWKA 5KNGA 3FTVA 4N39A 5KNHD 1FT2A 2WXQA 2FEZA 4CT0A 3MZLB 1D8EA 2V4HC 2IO2C 3S7DA 3UUXA 5CCMA 4DX5D 3LY7A 3ASDA 4NRHB 1HU3A 1N54A 4HLEA 4GTRA 3CVXA 2J08A 4HOSA 2Y3AA 4RG6A 3LVQE 3L9TA 4ACLA 1SVXA 5C2YA 1LD7A 2EQXA 3QAQA 4O6FA 1N4RA 3ASNE 5EN5D 4FLBA 2VSXE 5JJ7A 4CGWA 2R59A 3HVEB 1IKND 4BX8A 3FUKA 1X81A 2P9PG 2X38A 1TYQG 3MV2B 5CHEE 1WDYA 2V4LA 3NOGD 2IOLA 4L2YA 5KCMA 3CHQA 2BTDA 5BXOA 5ENTD 3QWWA 4J8EA 2R17C 5JA4D 2X6FA 4LNUD 4GTOA 3HDXA 4TXQA 4KMOA 5ANRA 2XEEA 2XGSA 3HVEA 1IQRA 2H6GA 5J90A 3D9NA 4GZ3A 4GTVA 2KM4A 3PUJA 2XPYA 4N3CA 2A4ZA 2R2LA 3KD7A 2J9QA 3NB2A 3ZW3A 4ANUA 4BT8A 3UM3A 4WWPA 4C0EA 1BU9A 4UUCA 2MYOA 5ARGA 1SA5A 1QNFA 1TN7A 3CVNA 5HQ8A 1TJFA 3CK9A 2WXGA 3SHFA 2C0MA 3TWQA 3HRAA 5M72A 1OWMA 4TXPA 3CLJA 1PC2A 4G8KA 5EKQD 4GMLA 4HQDA 1RZ4A 5KBAA 5BXUA 1ELWA 4RSYA 2XS1A 4HOUA 3FUJA 3C3RA 3J5PA 1JPLA 3FULA 5ENSD 1HF8A 1E96B 1AWCB 3Q9NC 3I4RB 4J7WA 2XPIA 4AVXA 3Q73A 2H6FA 2R02A 3PS6A 1WG0A 4G26A 3PDNA 1Y6IA 2LO6A 4OAVB 4LEUA 2IOSA 4LUNU 3AS8A 4EHMA 4G25A 3PREA 1P5QA 3QWVA 3DPDA 2IQCA 1V54E 5BPPA 3E32A 1KZOA 3DSSA 4E6HA 3KEAA 4I17A 2ZIRA 3ZGQA 2L0TB 3QNKA 4UWLA 4ANWA 2X6KA 4JEHA 3CHPA 4GZCA 3FTYA 2I6HA 5J08A 5BNWA 4G23A 4GYOA 3MEKA 1IHBA 3J5QB 3PZ1A 3LVRE 4GTSA 1NZNA 3B95A 4MS6A 1HZ4A 4HI8A 4U8VD 3UM1A 1IYGA 2CHXA 2V0PA 2F8YA 2Y1LE 4U04A 2LAIA 3UM0A 1HG2A 1DVPA 4TRQA 3FUFA 3MA5A 3U4TA 2VJ8A 3FUEA 3UX4A 3CK7A 1SQMA 3ULEG 1INZA 3CV0A 4ILGA 3VTXA 5BT1A 4BEPA 2P9LG 4GYWA 1D9SA 3TG5A 5CRUA 2DYSE 3E34A 2L0IA 3NZSA 3DXMG 5ENPD 3CK8A 5ARFA 3ML8A 3B7RL 4A3TA 3E37A 3Q47B 4YDOA 4XZ4A 4RQIA 4APOA 2J49A 3R7QA 4G1TA 5FJYA 5LOZA 3B7SA 3TL5A 3Q4AB 3HYMB 3RKVA 4WWNA 4GA1A 5HKPA 2KBXA 1E8ZA 4U95D 1E90A 4GCNA 2BUGA 3T5VA 2KXPC 2UWJG 3TAXA 1NA0A 4YDYA 3HHMA 2BEDA 3FH7A 4HRMB 5H7PA 4GTQA 3HIZA 2WQ7A 2ETAA 4GAAA 3D9IA 1UN9A 2WXJA 4OAUC 5KJLA 2X6HA 4JZYA 2Y4TA 3CR3A 5JJ6A 2UY1B 2HR2A 5LFAA 3MV3B 3EHNA 4JEUA 4DK5A 5CBNA 1Q2ZA 3CQCB 3APCA 4XKCA 4AJWA 2XEVA 3UPVA 3B7TA 3CVPA 1VDYA 4X8QA 5JHAA 2WXNA 3IEGA 3KSQA 3CSFA 3ENEA 1NA3A 5FQ8A 3SY2A 4UQYA 3FUDA 2HO1A 3TWWA 3ONKA 2PQNA 4L7TA 2RG8A 1TNZA 5EIDA 4YVQC 2DVWA 4KZCA 4B94A 4DX2A 5AARA 3AG4E 2EINE 3DWLG 2IONA 4EZKA 5LX8A 4QQIA 3NQPA 4O1PA 4GCOA 4RG9A 3QOUA 3LCAA 5KJKA 1UG3A 1BI8B 3FTUA 3C5RA 4ANVA 1HH8A 1N4PA 4IN3B 3BG1B 3DBSA 3ZRHA 4K5CA 1OXJA 1MX2A 3FEYA 2WXIA 3L54A 3L17A 3FU0A 1LD8A 1QYMA 2A5EA 5CECB 3O48A 1U3CA 3L08A 3TWVA 4FHJA 1ZU2A 5JHBA 3UI2A 3TG4A 2C2LA 4RVBA 3F6QA 3MCXA 2KC7A 4HS2A 2WQ6A 3SGHA 3CVVA 4YNDA 3QDNA 2R03A 5CRVA 4ZFHA 5AN8A 3Q5MA 2J09A 1S64A 4DUIA 3ABLE 3ZYLA 3D9MA 3DPYA 1N4SA 1MHQA 4UI9C 2LAHA 1UJJA 2V5QC 4GTPA 3SZ7A 5BV1A 4EQFA 2P9NG 4IYPA 5EYPF 3K9IA 4GB9A 4CYMD 4MBGA 4WNGA 1TNOA 2P9SG 3AS5A 3IHYA 4B8CB 3ZN3A 2VGEA 1QQEA 4AOFA 4WUYA 1KLXA 2GW1A 2YQ8A 4WWOA 3BEEA 3FDHA 3IXEA 5DBKA 4TUUA 4GA2A 4Z68A 3DSXA 3ML9A 3Q49B 3BG0B 1S63A 1BD8A 3D9LA 2KCLA 3FUHA 3PNTB 2OEWA 2LNIA 2NSZA 1O1SA 3VTYA 1Z3XA 4B0ZA 3JQ1A 5FTPA 3D9JA 3DSTA 3IV0A 3ZHEB 3OXGA 1H0AA 3VLEA 5FT9A 4JD2G 2AW6A 3G2UA 4LRZA 4BFRA 4URKA 2Y4UA 2HM8A 4I2WA 2I1JA 4C0MA 2B0OE 4CZ2D 1YCSB 2WXMA 1FCHA 4KBQA 4YDEA 2IFUA 3ZU7B 5ENOD 3DRAA 3V30A 3JUEA 3ABME 4I6JA 4YDWA 3UIOC 3UQ3A 4J8FA 3D9KA 3FTXA 1HX8A 5LP0A 4WNEA 3RO2A 5CERB 3FUMA 3DEOA 5CEAA 2Y69E 3TXNA 1H6OA 3P2BA 4I6GA 3G2WA 2BKGA 1U2VG 2M63A 3PZ2A 3PE3A 4QFVA 1UN8A 3EHMA 2XRYA 4FJYA 3U64A 2VSOE 1OCRE 4HB5A 4U96D 5HS0A 3LXUX 3JXJA 4CRWA 1TN6A 4K0RA 5LCWJ 3FY4A 3ZXSA 5AAOA 4FA6A 2FULA 3JQ0A 4HFGA 1NFIE 4BETA 2H6IA 2WM9A 4ATZD 3P1UA 2DZOA 5FQ7A 3KSLA 2IF4A 3PH0C 2L6BA 4U8YD 2WPVA 2GRMA 1OCZE 4R7LA 4N2SA 4DLOA 3PEUB 3ASHA 3FH8A 3CVQA 3URZA 2NC9A 2LXMA 4ILHB 3T8MA 3DXKG 3TXMA 1OCOE 3CHMA 5BV0A 3U3WA 4CEMA 2XZDG 4JHRA 3SFXA 4J8YA 2P2CP 2WXLA 3PZ3A 1WM5A 3L6AA 3PE4A 5HRYA 1XNFA 3EUVA 3ZYMA 1NI1A 4HOQA 3FTWA 4HRLA 4JA9A 3RRUA 4OYSA 5G05J 4HNAD 1DNPA 3MX3A 5G04J 1OWNA 5G2NA 3W9GA 2WB2A 3ONLA 3LJNA 2HYZA 4AIFA 2BKKB 1WAO1 4AM9A 4EZJA 2GRRB 3V2XA 4FLHA 2DIWA 5EIBE 3Q7FA 4Q69A 1OUVA 4W9RA 5AJDA 2J8SD 3FWVA 2AXZA 1YA0A 3FUIA 5ITZF 4H7YA 2FBNA 1Z5SC 4O60A 1K8KG 4CDMA 4FJZA 3ZPJA 2OVFA 3PNLB 2PZIA 5JJTA 3DSUA 4Q96A 4GMRA 1HE8A 3ABKE 3QWPA 4I1OB 4ZHBA 1IQUA 4HOTA 2L6JA 3PZ4A 1OT8A 2EIME 4NIKA 4CCAA 2RKKA 4DI3A 2GGFA 4FP7A 4J8DA 1JUQA 4JVSA 1O5MA 2R5SA 4L2LA 1JWFA 4MKTA 3U66A 2EILE 3D3MA 3NAWA 1JCSA 4ANXA 2VYIA 2C0LA 4PDXA 3UINC 4LERA 4I6EA 1K1AA 3FTSA 4ILIA 5B1BE 1MX6A 5ANLA 1ZBPA 2XENA 3Q9UC 3TWSA 3Q75A 1MYOA 3LS8A 5CMYA 4DRXE 3GZ2A 1KT0A 3CKBA 4F1PA 2GRPB 5ENRD 3AG3E 4GZ6A 4D10C 2E0IA 3LY9A 3FU6A 5DIZA 3Q79A 3ZNGA 3ZYKA 2V5FA 4LNBA 4EBAG 2V8SE 4A1GA 2KATA 2XEHA 3T8KA 2I1KA 5G05C 4JL0A 3IHVA 4TXRA 4M7CA 1Y8MA 4OVVA 2XZTG 4UWFA 4A3VA 2QY7A 5FZSA 5EX3A 2IY0C 3EIJA 3V79K 4FU3A 3UIPC 3NOCD 1U3DA 2P9UG 2PM6A 1DCQA 2QFCA 3RSEG 2JABA 5A6CA 1X5BA 1O1RA 3RJVA 4I9CA 5KWDA 3AU4A 3OTNA 4F7AA 3C3QA 3NBNB 3LKUA 2YNQA 5T8IA 3ASGA 2F0YA 4TUMA 4CDRA 2EIKE 2QZAA 5AQBA 5CMWA 3HXDA 3C72A 1N11A 4NURA 4F6RD 3LEWA 3JUIA 1FT1A 2MRIA 3RU0A 3APDA
chains in the Genus database with same CATH topology
4ANUA 1ELRA 5FZQA 2AVPA 3Q15A 4JC8A 4IYPA 4BT8A 4M3OA 3K9IA 4WWPA 4GB9A 5A7DB 4C0EA 1BPOA 2XCCA 1SZ9A 2FI7A 2RD0A 2YHEA 1W3BA 2FO7A 2PL2A 5ARGA 4WNGA 2UY1A 4FHKA 4DI4A 4EPZA 2X6IA 1SZAA 1QNFA 2WXOA 3AS5A 3CVNA 3IHYA 4ACKA 3ZN3A 4B8CB 4ABNA 3N71A 1QQEA 4AOFA 4WUYA 1KLXA 4A55A 2GW1A 2YQ8A 4WWOA 5HQ8A 3FFLA 2LSUA 1TJFA 3BEEA 3FDHA 3CK9A 5FWQA 2WXGA 3SHFA 2C0MA 4NACA 5DBKA 5M72A 1OWMA 4TUUA 4GA2A 3CHSA 3PEVB 3ML9A 3MKQA 3Q49B 3TJPA 3UT8A 3BG0B 4WAFA 4JHKA 3CLJA 3MYVA 1PC2A 3D9LA 2MOWA 5EKQD 4GMLA 2KCLA 3FUHA 4KT6B 3PNTB 3FH5A 3FU3A 4GA0A 3ULQA 2LNIA 2NSZA 2PM7A 1ELWA 4OVUA 4RSYA 3RIBA 4HOUA 3LDZA 3FUJA 3VTYA 1KT1A 1Z3XA 4GMJA 4B0ZA 1JPLA 3SFZA 3JQ1A 5FTPA 3D9JA 3FU5A 3FULA 4UI9K 2KCVA 3IV0A 1HF8A 4XIFA 1E96B 3CKCA 2VSYA 3C98A 3ZHEB 3I4RB 5HI7A 4KXKB 5BUZA 2WMOA 3OXGA 4XI9A 4A1SA 1H0AA 1JWGA 3SI5A 3VLEA 1H2VC 2XPIA 5FT9A 4H7XA 3E4BA 4AVXA 2AW6A 2WMNA 3G2UA 3O4ZA 3QJZA 4LRZA 3G2SA 3PS6A 4E85A 5G04C 2VGYA 3FEXA 4BFRA 2Q7FA 4G26A 4URKA 3PUKA 4JA7A 3SF4A 5KJNA 2Y4UA 3PDNA 2HM8A 4I2WA 2CFUA 3RK6A 1Y6IA 1EDUA 2I1JA 4C0MA 2LO6A 2WXMA 4U0UA 4LEUA 2YHCA 5AJLA 4PS8A 1FCHA 4CDNA 4GU5A 2IOSA 4KBQA 4LUNU 4ATGA 2AXUA 2IFUA 1FVHA 3AS8A 4CT4A 4IULA 1E8WA 3AU5A 5D0OD 3OXLA 4I1MA 4XX5A 4G25A 4UQZA 3PREA 4APFA 1P5QA 4I6JA 4N3AA 3R9AB 3KS2A 4U63A 4AV7A 1H2UA 3QWVA 4PS7A 3DPDA 2IQCA 3S7BA 3UQ3A 4J8FA 2WVIA 3D9KA 4L1BA 5BPPA 3FTXA 4G24A 3PRZA 4J8SA 1HX8A 1HXIA 3LJ3A 4K03A 3CHOA 4WNFA 5LP0A 4WNEA 2WXRA 3RO2A 3L13A 4AP2A 1H2TC 3CEQA 4B89A 3FUMA 2KCKA 4E6HA 2CHZA 2A5UA 4AXHA 3CVWA 4I17A 3TXNA 1IHGA 1ELKA 3CIAA 4G11A 2I9CA 4JW1A 3ZGQA 4AY6A 3IBEA 4AEZC 1EPUA 3P2BA 1E7UA 4I6GA 3G2WA 2L0TB 2L9BA 3GYZA 3I4GA 2ILRA 2AWIA 3QNKA 1HG5A 4KVOA 2M63A 4UWLA 4UWGA 1HFAA 3OXFA 4KVMA 3ZW3A 3PE3A 4ANWA 4QFVA 3VLFA 1UN8A 4BX9A 2X6KA 3EHMA 4JEHA 3CHPA 2WXKA 2OV8A 2XRYA 4FJYA 1E7VA 3U64A 2VSOE 4GZCA 3FTYA 3ZFWA 2I6HA 5J08A 4I9EA 4HVBA 5BNWA 4G23A 3U9WA 4GYOA 1EYHA 2OVBA 3MEKA 4N5CA 4EZLA 3S7JA 4I1AA 3LXUX 4CRWA 3ESKA 3L16A 4K0RA 3LVRE 5LCWJ 1B89A 3L22A 1NZNA 2JEKA 2ZU6B 3AS4A 3FY4A 5D0QD 3ZXSA 4L23A 3SBTB 5T3RA 4UI9J 4XE0A 4FA6A 2FULA 3JQ0A 4HFGA 4I43A 3CVLA 4MS6A 3B13A 1HZ4A 2WM9A 4F53A 5AYWD 2CHXA 4DPRA 3P1UA 3ZIMA 2XRZA 1IYGA 5FQ7A 2V0PA 3FUNA 3QARA 3UT4A 4YVOA 2XHEA 2IF4A 2XGMA 4U04A 2LAIA 3WXXA 1HG2A 1DVPA 5KJMA 5EX0A 3PH0C 4TRQA 3FP3A 3FUFA 3MA5A 4I2ZA 3U4TA 2WPVA 2GRMA 4DJAA 2VJ8A 3FUEA 3OAWA 2CG3A 1WY6A 4R7LA 3EJNA 3UX4A 1UW4B 3CK7A 3IKOB 4JXTA 4N2SA 4DLOA 2I2OA 3PEUB 4KZ0A 4EBAA 3ASHA 1SQMA 3FH8A 3RO3A 1INZA 3CV0A 4ILGA 3CVQA 3VTXA 3JYSA 5BT1A 3URZA 4GYWA 3QC1A 2NC9A 3TGOA 3TG5A 2CFZA 3ZEFA 5FQ4A 4U07A 3GW4A 4ILHB 2WQHA 3KAEA 3T8MA 2L0IA 3NZSA 2NXPA 3TXMA 4P29A 3CK8A 3MKRA 4Y6WA 5ARFA 3CHMA 1EF1C 3ML8A 2GRLA 5BV0A 2J07A 3B7RL 4A3TA 4CEMA 3U3WA 3CGHA 4ME2A 3Q47B 3LYAA 4BTAA 4JHRA 4XZ4A 3LY8A 2XQ0A 3NZUA 4APOA 2J49A 3I3NA 3QB2A 3B7UX 1Z6TA 5FZRA 4FADA 3R7QA 2WXLA 4G1TA 5FJYA 5LOZA 2WXPA 2J4BA 5C1DA 3B7SA 1WM5A 3L6AA 3TL5A 3PE4A 3Q4AB 3UMVA 1XNFA 3ZYMA 3ZHEA 1UJKA 3HYMB 3FTZA 4HOQA 3FTWA 2VGXB 2WXHA 3JCKC 3RKVA 2VQ2A 4Y6CA 4PS3A 3I5PA 4WWNA 5T4YA 4JA9A 4GA1A 3CVUA 3RRUA 2CG2A 1E8ZA 4OYSA 3VLDA 1E90A 4GCNA 5G05J 2BUGA 1DNPA 2XCBA 3T5XA 3T5VA 3MX3A 4BY6A 5G04J 1S0PA 1OWNA 2UWJG 5G2NA 3R7RA 3TAXA 1NA0A 2FF4A 3MGBA 4LCTA 3HHMA 2ONDA 4BTBA 2VTBB 2WB2A 3ONLA 2DCPA 3SNXA 4GZ5A 3FH7A 2HYZA 4AIFA 1L5JA 1WAO1 3G2TA 3CVYA 4AM9A 4EZJA 3HIZA 2WQ7A 4NQ0A 2XGOA 4Q94A 4GAAA 3D9IA 5E76A 1UN9A 3EDTB 4FLHA 3QKYA 2DIWA 4FC8A 5EDSA 4GZDA 3RRMB 1H19A 5E75A 3LPZA 4XI0A 4Q69A 1OUVA 2LSVA 4W9RA 5AJDA 5ENNA 2VGXA 3FWVA 2AXZA 1YA0A 3FUIA 5FQ6A 2WXJA 3KEZA 4H7YA 5KJLA 2FBNA 2X6HA 3ESLA 4JZYA 4DLQA 1N52A 4CDMA 2AXVA 2Y4TA 3CR3A 4PH4B 4FJZA 3ZPJA 2OVFA 1XGWA 2JLBA 2HR2A 2UY1B 3PNLB 2PZIA 3MV3B 5JJ6A 3S2AA 4GYYA 5LFAA 5JJTA 3EHNA 4Q96A 4JEUA 1HE8A 3QWPA 4I1OB 4DK5A 1IQUA 4U0ZA 5G55A 2VTBA 4FULA 4HOTA 3CQCB 1OWPA 3APCA 4PUCA 4XKCA 2L6JA 4AJWA 4CGVA 2XEVA 3UPVA 4JHJA 2VSNA 3B7TA 3RRNB 3ASFA 4UQXA 4CCAA 3CVPA 4MRUA 4DI3A 1VDYA 2GGFA 1OWOA 4FP7A 4N3BA 4J8DA 1JUQA 3D9OA 4JVSA 3PZDA 3ZVVA 2R5SA 4L2LA 1JWFA 4MKTA 1PAQA 4AY5A 5JHAA 3U66A 2WXNA 3D3MA 2X3MA 3IEGA 4WNDA 2XPZA 4J6IA 3UT7A 3CSFA 3ENEA 4ANXA 3SBSA 4EECA 2VYIA 1NA3A 2C0LA 4PDXA 1OWLA 3ZYQA 5FQ8A 1TEZA 4C9BB 4N2QA 4JPSA 4BWRA 4BT9A 4UQYA 3EIQC 4B8AA 1GW6A 3FUDA 4LERA 4BSXA 2IU1A 5A23A 4I6EA 3FTSA 2J4DA 2HO1A 4ILIA 4UWKA 3ONKA 3FTVA 2PQNA 4L7TA 3APFA 1HS6A 4N39A 2RG8A 5ANLA 1ZBPA 4UWHA 4YVQC 3LS8A 4KZCA 5CMYA 2WXQA 4B94A 3GZ2A 1LF8A 2FEZA 3MJWA 3MZLB 4CT0A 1KT0A 2IONA 3CHRA 4EZKA 3CKBA 4XKBA 3SD5A 5LX8A 3S7DA 1FVFA 4GZ6A 3UUXA 5CCMA 4D10C 2E0IA 3LY9A 3NQPA 3LY7A 3ASDA 4NRHB 1HU3A 3FU6A 5DIZA 1N54A 3GZ1A 3G2VA 1HO8A 4GCOA 4RG9A 2E2EA 3QOUA 4KYOB 3LCAA 3D9PA 3ZYKA 4HLEA 3GZSA 5KJKA 3CVXA 1UG3A 4GPKA 3CQGB 3FTUA 2J08A 4HOSA 1E8YA 4ANVA 2Y3AA 1HH8A 4IN3B 4RG6A 2V5FA 3BG1B 3LVQE 2OOEA 3DBSA 5BW8C 3ZRHA 4EBAG 2V8SE 2MHKA 4A1GA 2KATA 3FEYA 2WXIA 4G2VA 4ACLA 2I1KA 3L54A 5AENA 3NF1A 5G05C 2YINA 5C2YA 4JL0A 3IHVA 3L17A 2EQXA 3FU0A 3QAQA 4O6FA 1Y8MA 4OVVA 4UWFA 4A3VA 4F3VA 2QY7A 2VSXE 4FLBA 5FZSA 5EX3A 1H6KA 5CCLA 4CGWA 5JJ7A 3EIJA 2P58C 2R59A 3O48A 1U3CA 3L08A 3HVEB 4V3IA 4FU3A 2DBAA 1U3DA 3FUKA 2BF0X 4FHJA 4BX8A 1ZU2A 5JHBA 2PM6A 4HXIA 2QFCA 3TG4A 2X38A 2KZTB 2C2LA 3MV2B 4RVBA 3MCXA 5CHEE 1X5BA 2KC7A 5A6CA 2V4LA 4HS2A 3RJVA 2WQ6A 3SGHA 2IOLA 4I9CA 4L2YA 5KCMA 3QK0A 3AU4A 3FHEA 3OTNA 4F7AA 3CHQA 2BTDA 3LKUA 3CVVA 3PVLA 2YNQA 4MLPA 3QDNA 3QWWA 4J8EA 4YNDA 5AIJA 1MQSA 4J0UA 2CHWA 2R17C 4F1SA 2X6FA 1PY1A 5T8IA 3ASGA 4HORA 3HDXA 1QZ2A 4KMOA 5ANRA 2PQRA 3Q5MA 3S7FA 2J09A 4CDRA 2XGSA 3HVEA 4IRUA 4TV3A 5CMWA 2IJGX 3ZYLA 5LCWC 2X6JA 3D9MA 1IQRA 2WXFA 1MHQA 4UI9C 2LAHA 1NP7A 2KZTA 4NURA 3D9NA 1E8XA 4U0SA 5J90A 1UJJA 4GZ3A 2KM4A 3PUJA 1A17A 3LEWA 3JUIA 2XPYA 4N3CA 3SZ7A 5BV1A 2A4ZA 1TJCA 2MRIA 4EQFA 3RU0A 3KD7A 3MKQB 1Z3YA 4U8HA 2J9QA 3APDA 3CSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ACK A;  4ACL A;  3U66 A;  4V3I A; 
#chains in the Genus database with same CATH topology
 5FIO A;  1H6P A;  3Q15 A;  3BU8 A;  4M3O A;  2GRO B;  2XCC A;  1SZ9 A;  2FI7 A;  3T9K A;  2F8X K;  1W3B A;  2FO7 A;  2UY1 A;  4FHK A;  4DI4 A;  1SZA A;  5B1A E;  4ABN A;  2LSU A;  3TJP A;  3UT8 A;  4WAF A;  2MOW A;  4GA0 A;  1KPS B;  2QYU A;  4OVU A;  1TNB A;  3LDZ A;  1KT1 A;  3FU5 A;  4XIF A;  4UI9 K;  3CKC A;  2DWZ A;  3E30 A;  5BUZ A;  2QC9 A;  4XI9 A;  4A1S A;  1JWG A;  1BLX B;  3HXF A;  3W9F A;  4H7X A;  3E4B A;  2H6H A;  3O4Z A;  3G2S A;  3FEX A;  1S70 B;  3PUK A;  2CFU A;  2OEV A;  4ATG A;  2AXU A;  1FVH A;  4CT4 A;  4IUL A;  3AU5 A;  5D0O D;  3OXL A;  4I1M A;  4XX5 A;  4UQZ A;  4APF A;  4N3A A;  5D66 A;  1H2U A;  4PS7 A;  3EU9 A;  2ZIS A;  1ZB1 A;  4J8S A;  1HXI A;  3LJ3 A;  4K03 A;  3CHO A;  1UOH A;  2WXR A;  3L13 A;  2ETB A;  3CEQ A;  4B89 A;  2KCK A;  2CHZ A;  2A5U A;  4AXH A;  3CVW A;  2I9C A;  4JW1 A;  3SFY A;  4C48 B;  3IBE A;  4AEZ C;  1EPU A;  2ILR A;  2AWI A;  4KVO A;  4UWG A;  3OXF A;  3AJI A;  4KVM A;  1JCQ A;  2WXK A;  3V2O A;  3ZFW A;  4I9E A;  4HVB A;  1N0Q A;  4EZL A;  4I1A A;  1B89 A;  2Y0B G;  2JEK A;  4L23 A;  3SBT B;  5T3R A;  3BUA A;  4HBD A;  3B13 A;  1N4Q A;  3EHQ A;  4F53 A;  3AG1 E;  3UT4 A;  4YVO A;  2XHE A;  3HXC A;  2XGM A;  3WXX A;  3TWT A;  3FP3 A;  3Q7A A;  3B7B A;  2OCC E;  3OAW A;  1WY6 A;  4JXT A;  4HI9 A;  4KZ0 A;  4EBA A;  3QC1 A;  3TGO A;  2CFZ A;  1D8D A;  5FQ4 A;  4BSZ B;  1MX4 A;  2WQH A;  2NXP A;  3HXB A;  4P29 A;  4Y6W A;  3MKR A;  1EF1 C;  2GRL A;  1AP7 A;  3UTM A;  3CGH A;  4ME2 A;  2AJA A;  3LYA A;  4BTA A;  2R05 A;  3ZXP A;  3NZU A;  3I3N A;  3QB2 A;  1Z6T A;  5B3S E;  2J4B A;  3ZHE A;  3FTZ A;  2VGX B;  2WXH A;  2QYJ A;  4Y6C A;  3ZUV B;  2GRQ B;  2CG2 A;  3E33 A;  4BY6 A;  1TR4 A;  2FF4 A;  1IXV A;  3MGB A;  4LCT A;  3RAU A;  2VTB B;  3G2T A;  2ETC A;  4Q94 A;  5E76 A;  3EDT B;  4GZD A;  5E75 A;  3DEP A;  3LPZ A;  4XI0 A;  4GPM A;  2LSV A;  2VGX A;  5FQ6 A;  1N52 A;  2AXV A;  3UM2 A;  2JLB A;  5EYL A;  3S2A A;  4GYY A;  3TWU A;  5G55 A;  2VTB A;  4FUL A;  1OWP A;  1NL4 A;  4LSZ E;  4PUC A;  2VSN A;  1A5E A;  3ASF A;  1OWO A;  1JCR A;  1SW6 A;  4AY5 A;  3PZD A;  3ZVV A;  1PAQ A;  2F37 A;  3BQO A;  3UT7 A;  3SBS A;  4EEC A;  1OWL A;  3ZYQ A;  1TEZ A;  4N2Q A;  4JPS A;  4BT9 A;  4B8A A;  3EIQ C;  1GW6 A;  4BSX A;  2J4D A;  4L9P A;  3APF A;  3DSW A;  1HS6 A;  4UWH A;  3SO8 A;  3WG7 E;  1LF8 A;  3MJW A;  3CHR A;  4XKB A;  3SD5 A;  1FVF A;  3GZ1 A;  3G2V A;  1HO8 A;  2E2E A;  3HG0 D;  4KYO B;  3D9P A;  3HXE A;  3GZS A;  4GPK A;  3ISM C;  3CQG B;  1E8Y A;  2OOE A;  4GTM A;  5BW8 C;  2MHK A;  4G2V A;  5AEN A;  3NF1 A;  2YIN A;  5CBO A;  4F3V A;  1H6K A;  5CCL A;  2P58 C;  1G3N B;  5AQA A;  4V3I A;  2DBA A;  2BF0 X;  4HXI A;  2KZT B;  5EIL A;  1K1B A;  3EU5 A;  3QK0 A;  3FHE A;  1N9A A;  2EIJ E;  3PVL A;  4MLP A;  5AIJ A;  1MQS A;  4J0U A;  2CHW A;  1YYH A;  4F1S A;  1PY1 A;  4HOR A;  1QZ2 A;  2GRN B;  2PQR A;  3S7F A;  3V31 A;  2RFA A;  3ZKJ A;  4IRU A;  4TV3 A;  2IJG X;  5LCW C;  2X6J A;  2WXF A;  2KZT A;  1NP7 A;  4U0S A;  1E8X A;  4JB8 P;  4N5Q A;  1A17 A;  2FO1 E;  1TJC A;  3MKQ B;  1Z3Y A;  4U8H A;  3CST A;  1ELR A;  5FZQ A;  2AVP A;  4JC8 A;  3R9M A;  5A7D B;  1BPO A;  4B93 B;  1YMP A;  1N0R A;  2RD0 A;  2YHE A;  2PL2 A;  4EPZ A;  2X6I A;  2WXO A;  4ACK A;  4G8L A;  1N94 A;  3N71 A;  4A55 A;  3FFL A;  5FWQ A;  4NAC A;  3CHS A;  3JXI A;  3PEV B;  3MKQ A;  1KZP A;  4JHK A;  3MYV A;  5JMN D;  4K5A B;  4KT6 B;  4XEI G;  3FH5 A;  3FU3 A;  3ULQ A;  1MJ0 A;  2PM7 A;  3RIB A;  1SA4 A;  4GMJ A;  3SFZ A;  2KCV A;  2VSY A;  3C98 A;  2ZXW E;  5HI7 A;  4KXK B;  2WMO A;  3SI5 A;  2B6C A;  1H2V C;  2WMN A;  3QJZ A;  4E85 A;  5G04 C;  2VGY A;  2Q7F A;  4JA7 A;  3SF4 A;  5KJN A;  2DYR E;  3DSV A;  3RK6 A;  1EDU A;  5AQ9 A;  1FPP A;  1O1T A;  4U0U A;  4A63 B;  2YHC A;  5AJL A;  4PS8 A;  4CDN A;  4GU5 A;  3L82 A;  1E8W A;  5IY5 E;  3R9A B;  3KS2 A;  4U63 A;  4AV7 A;  3S7B A;  4DX6 D;  2WVI A;  4L1B A;  1BI7 B;  4G24 A;  3PRZ A;  1DCE A;  4WNF A;  4AP2 A;  1H2T C;  3AG2 E;  3AAA C;  3EHR A;  3TWR A;  1IHG A;  1ELK A;  3CIA A;  4G11 A;  4AY6 A;  1E7U A;  2RFM A;  2L9B A;  3GYZ A;  3I4G A;  1HG5 A;  1HFA A;  2HE0 A;  3VLF A;  4BX9 A;  5CED B;  2OV8 A;  1E7V A;  1OCC E;  2P9I G;  3U9W A;  1EYH A;  2OVB A;  4N5C A;  3S7J A;  4U7E B;  4HLL A;  3ESK A;  3L16 A;  4K5B A;  5AQ7 A;  3L22 A;  3TWX A;  1LTX A;  1DC2 A;  2ZU6 B;  3AS4 A;  5D0Q D;  2LXL A;  2IO3 C;  3D9H A;  4UI9 J;  4XE0 A;  4I43 A;  1N95 A;  3CVL A;  5AYW D;  4DPR A;  3ZIM A;  2XRZ A;  3FUN A;  3QAR A;  2IEJ A;  5FIN A;  5KJM A;  5EX0 A;  3UKU G;  4I2Z A;  4DJA A;  2CG3 A;  1TN8 A;  4BER A;  3EJN A;  1UW4 B;  3IKO B;  2I2O A;  2P9K G;  3RO3 A;  3JYS A;  3ZEF A;  4U07 A;  3GW4 A;  3KAE A;  1OY3 D;  1QBQ A;  1TNU A;  2J07 A;  4RLY A;  2NYJ A;  3LY8 A;  2XQ0 A;  5FZR A;  3B7U X;  4FAD A;  5ENQ D;  2WXP A;  5C1D A;  2LUH A;  3UMV A;  1UJK A;  3JCK C;  2VQ2 A;  4PS3 A;  3I5P A;  5T4Y A;  4DX1 A;  3C3O A;  2PNN A;  3CVU A;  3VLD A;  4BES A;  3T5X A;  2XCB A;  4HRN A;  3ASO E;  4GTT A;  1S0P A;  3R7R A;  2DZN A;  3X2Q E;  2OND A;  4BTB A;  2DCP A;  3SNX A;  4GZ5 A;  1L5J A;  1RW2 A;  3CVY A;  4NQ0 A;  2XGO A;  3ULY A;  3QKY A;  5EDS A;  4FC8 A;  3RRM B;  1H19 A;  4LNG A;  5ENN A;  2ZGD A;  3KEZ A;  3ESL A;  4DLQ A;  4PH4 B;  3SQV A;  1XGW A;  2XS8 A;  5D2M C;  3UKR G;  1MZC A;  4U0Z A;  3UXG A;  4O1O A;  4CGV A;  4JHJ A;  3RRN B;  4UQX A;  1TNY A;  1V55 E;  4MRU A;  4N3B A;  3D9O A;  2ZGG A;  3Q78 A;  1K3Z D;  4DX7 D;  2X3M A;  4WND A;  2XPZ A;  4J6I A;  4C9B B;  4BWR A;  4LG6 A;  2IU1 A;  5A23 A;  4UWK A;  5KNG A;  3FTV A;  4N39 A;  5KNH D;  1FT2 A;  2WXQ A;  2FEZ A;  4CT0 A;  3MZL B;  1D8E A;  2V4H C;  2IO2 C;  3S7D A;  3UUX A;  5CCM A;  4DX5 D;  3LY7 A;  3ASD A;  4NRH B;  1HU3 A;  1N54 A;  4HLE A;  4GTR A;  3CVX A;  2J08 A;  4HOS A;  2Y3A A;  4RG6 A;  3LVQ E;  3L9T A;  4ACL A;  1SVX A;  5C2Y A;  1LD7 A;  2EQX A;  3QAQ A;  4O6F A;  1N4R A;  3ASN E;  5EN5 D;  4FLB A;  2VSX E;  5JJ7 A;  4CGW A;  2R59 A;  3HVE B;  1IKN D;  4BX8 A;  3FUK A;  1X81 A;  2P9P G;  2X38 A;  1TYQ G;  3MV2 B;  5CHE E;  1WDY A;  2V4L A;  3NOG D;  2IOL A;  4L2Y A;  5KCM A;  3CHQ A;  2BTD A;  5BXO A;  5ENT D;  3QWW A;  4J8E A;  2R17 C;  5JA4 D;  2X6F A;  4LNU D;  4GTO A;  3HDX A;  4TXQ A;  4KMO A;  5ANR A;  2XEE A;  2XGS A;  3HVE A;  1IQR A;  2H6G A;  5J90 A;  3D9N A;  4GZ3 A;  4GTV A;  2KM4 A;  3PUJ A;  2XPY A;  4N3C A;  2A4Z A;  2R2L A;  3KD7 A;  2J9Q A;  3NB2 A;  3ZW3 A;  4ANU A;  4BT8 A;  3UM3 A;  4WWP A;  4C0E A;  1BU9 A;  4UUC A;  2MYO A;  5ARG A;  1SA5 A;  1QNF A;  1TN7 A;  3CVN A;  5HQ8 A;  1TJF A;  3CK9 A;  2WXG A;  3SHF A;  2C0M A;  3TWQ A;  3HRA A;  5M72 A;  1OWM A;  4TXP A;  3CLJ A;  1PC2 A;  4G8K A;  5EKQ D;  4GML A;  4HQD A;  1RZ4 A;  5KBA A;  5BXU A;  1ELW A;  4RSY A;  2XS1 A;  4HOU A;  3FUJ A;  3C3R A;  3J5P A;  1JPL A;  3FUL A;  5ENS D;  1HF8 A;  1E96 B;  1AWC B;  3Q9N C;  3I4R B;  4J7W A;  2XPI A;  4AVX A;  3Q73 A;  2H6F A;  2R02 A;  3PS6 A;  1WG0 A;  4G26 A;  3PDN A;  1Y6I A;  2LO6 A;  4OAV B;  4LEU A;  2IOS A;  4LUN U;  3AS8 A;  4EHM A;  4G25 A;  3PRE A;  1P5Q A;  3QWV A;  3DPD A;  2IQC A;  1V54 E;  5BPP A;  3E32 A;  1KZO A;  3DSS A;  4E6H A;  3KEA A;  4I17 A;  2ZIR A;  3ZGQ A;  2L0T B;  3QNK A;  4UWL A;  4ANW A;  2X6K A;  4JEH A;  3CHP A;  4GZC A;  3FTY A;  2I6H A;  5J08 A;  5BNW A;  4G23 A;  4GYO A;  3MEK A;  1IHB A;  3J5Q B;  3PZ1 A;  3LVR E;  4GTS A;  1NZN A;  3B95 A;  4MS6 A;  1HZ4 A;  4HI8 A;  4U8V D;  3UM1 A;  1IYG A;  2CHX A;  2V0P A;  2F8Y A;  2Y1L E;  4U04 A;  2LAI A;  3UM0 A;  1HG2 A;  1DVP A;  4TRQ A;  3FUF A;  3MA5 A;  3U4T A;  2VJ8 A;  3FUE A;  3UX4 A;  3CK7 A;  1SQM A;  3ULE G;  1INZ A;  3CV0 A;  4ILG A;  3VTX A;  5BT1 A;  4BEP A;  2P9L G;  4GYW A;  1D9S A;  3TG5 A;  5CRU A;  2DYS E;  3E34 A;  2L0I A;  3NZS A;  3DXM G;  5ENP D;  3CK8 A;  5ARF A;  3ML8 A;  3B7R L;  4A3T A;  3E37 A;  3Q47 B;  4YDO A;  4XZ4 A;  4RQI A;  4APO A;  2J49 A;  3R7Q A;  4G1T A;  5FJY A;  5LOZ A;  3B7S A;  3TL5 A;  3Q4A B;  3HYM B;  3RKV A;  4WWN A;  4GA1 A;  5HKP A;  2KBX A;  1E8Z A;  4U95 D;  1E90 A;  4GCN A;  2BUG A;  3T5V A;  2KXP C;  2UWJ G;  3TAX A;  1NA0 A;  4YDY A;  3HHM A;  2BED A;  3FH7 A;  4HRM B;  5H7P A;  4GTQ A;  3HIZ A;  2WQ7 A;  2ETA A;  4GAA A;  3D9I A;  1UN9 A;  2WXJ A;  4OAU C;  5KJL A;  2X6H A;  4JZY A;  2Y4T A;  3CR3 A;  5JJ6 A;  2UY1 B;  2HR2 A;  5LFA A;  3MV3 B;  3EHN A;  4JEU A;  4DK5 A;  5CBN A;  1Q2Z A;  3CQC B;  3APC A;  4XKC A;  4AJW A;  2XEV A;  3UPV A;  3B7T A;  3CVP A;  1VDY A;  4X8Q A;  5JHA A;  2WXN A;  3IEG A;  3KSQ A;  3CSF A;  3ENE A;  1NA3 A;  5FQ8 A;  3SY2 A;  4UQY A;  3FUD A;  2HO1 A;  3TWW A;  3ONK A;  2PQN A;  4L7T A;  2RG8 A;  1TNZ A;  5EID A;  4YVQ C;  2DVW A;  4KZC A;  4B94 A;  4DX2 A;  5AAR A;  3AG4 E;  2EIN E;  3DWL G;  2ION A;  4EZK A;  5LX8 A;  4QQI A;  3NQP A;  4O1P A;  4GCO A;  4RG9 A;  3QOU A;  3LCA A;  5KJK A;  1UG3 A;  1BI8 B;  3FTU A;  3C5R A;  4ANV A;  1HH8 A;  1N4P A;  4IN3 B;  3BG1 B;  3DBS A;  3ZRH A;  4K5C A;  1OXJ A;  1MX2 A;  3FEY A;  2WXI A;  3L54 A;  3L17 A;  3FU0 A;  1LD8 A;  1QYM A;  2A5E A;  5CEC B;  3O48 A;  1U3C A;  3L08 A;  3TWV A;  4FHJ A;  1ZU2 A;  5JHB A;  3UI2 A;  3TG4 A;  2C2L A;  4RVB A;  3F6Q A;  3MCX A;  2KC7 A;  4HS2 A;  2WQ6 A;  3SGH A;  3CVV A;  4YND A;  3QDN A;  2R03 A;  5CRV A;  4ZFH A;  5AN8 A;  3Q5M A;  2J09 A;  1S64 A;  4DUI A;  3ABL E;  3ZYL A;  3D9M A;  3DPY A;  1N4S A;  1MHQ A;  4UI9 C;  2LAH A;  1UJJ A;  2V5Q C;  4GTP A;  3SZ7 A;  5BV1 A;  4EQF A;  2P9N G;  4IYP A;  5EYP F;  3K9I A;  4GB9 A;  4CYM D;  4MBG A;  4WNG A;  1TNO A;  2P9S G;  3AS5 A;  3IHY A;  4B8C B;  3ZN3 A;  2VGE A;  1QQE A;  4AOF A;  4WUY A;  1KLX A;  2GW1 A;  2YQ8 A;  4WWO A;  3BEE A;  3FDH A;  3IXE A;  5DBK A;  4TUU A;  4GA2 A;  4Z68 A;  3DSX A;  3ML9 A;  3Q49 B;  3BG0 B;  1S63 A;  1BD8 A;  3D9L A;  2KCL A;  3FUH A;  3PNT B;  2OEW A;  2LNI A;  2NSZ A;  1O1S A;  3VTY A;  1Z3X A;  4B0Z A;  3JQ1 A;  5FTP A;  3D9J A;  3DST A;  3IV0 A;  3ZHE B;  3OXG A;  1H0A A;  3VLE A;  5FT9 A;  4JD2 G;  2AW6 A;  3G2U A;  4LRZ A;  4BFR A;  4URK A;  2Y4U A;  2HM8 A;  4I2W A;  2I1J A;  4C0M A;  2B0O E;  4CZ2 D;  1YCS B;  2WXM A;  1FCH A;  4KBQ A;  4YDE A;  2IFU A;  3ZU7 B;  5ENO D;  3DRA A;  3V30 A;  3JUE A;  3ABM E;  4I6J A;  4YDW A;  3UIO C;  3UQ3 A;  4J8F A;  3D9K A;  3FTX A;  1HX8 A;  5LP0 A;  4WNE A;  3RO2 A;  5CER B;  3FUM A;  3DEO A;  5CEA A;  2Y69 E;  3TXN A;  1H6O A;  3P2B A;  4I6G A;  3G2W A;  2BKG A;  1U2V G;  2M63 A;  3PZ2 A;  3PE3 A;  4QFV A;  1UN8 A;  3EHM A;  2XRY A;  4FJY A;  3U64 A;  2VSO E;  1OCR E;  4HB5 A;  4U96 D;  5HS0 A;  3LXU X;  3JXJ A;  4CRW A;  1TN6 A;  4K0R A;  5LCW J;  3FY4 A;  3ZXS A;  5AAO A;  4FA6 A;  2FUL A;  3JQ0 A;  4HFG A;  1NFI E;  4BET A;  2H6I A;  2WM9 A;  4ATZ D;  3P1U A;  2DZO A;  5FQ7 A;  3KSL A;  2IF4 A;  3PH0 C;  2L6B A;  4U8Y D;  2WPV A;  2GRM A;  1OCZ E;  4R7L A;  4N2S A;  4DLO A;  3PEU B;  3ASH A;  3FH8 A;  3CVQ A;  3URZ A;  2NC9 A;  2LXM A;  4ILH B;  3T8M A;  3DXK G;  3TXM A;  1OCO E;  3CHM A;  5BV0 A;  3U3W A;  4CEM A;  2XZD G;  4JHR A;  3SFX A;  4J8Y A;  2P2C P;  2WXL A;  3PZ3 A;  1WM5 A;  3L6A A;  3PE4 A;  5HRY A;  1XNF A;  3EUV A;  3ZYM A;  1NI1 A;  4HOQ A;  3FTW A;  4HRL A;  4JA9 A;  3RRU A;  4OYS A;  5G05 J;  4HNA D;  1DNP A;  3MX3 A;  5G04 J;  1OWN A;  5G2N A;  3W9G A;  2WB2 A;  3ONL A;  3LJN A;  2HYZ A;  4AIF A;  2BKK B;  1WAO 1;  4AM9 A;  4EZJ A;  2GRR B;  3V2X A;  4FLH A;  2DIW A;  5EIB E;  3Q7F A;  4Q69 A;  1OUV A;  4W9R A;  5AJD A;  2J8S D;  3FWV A;  2AXZ A;  1YA0 A;  3FUI A;  5ITZ F;  4H7Y A;  2FBN A;  1Z5S C;  4O60 A;  1K8K G;  4CDM A;  4FJZ A;  3ZPJ A;  2OVF A;  3PNL B;  2PZI A;  5JJT A;  3DSU A;  4Q96 A;  4GMR A;  1HE8 A;  3ABK E;  3QWP A;  4I1O B;  4ZHB A;  1IQU A;  4HOT A;  2L6J A;  3PZ4 A;  1OT8 A;  2EIM E;  4NIK A;  4CCA A;  2RKK A;  4DI3 A;  2GGF A;  4FP7 A;  4J8D A;  1JUQ A;  4JVS A;  1O5M A;  2R5S A;  4L2L A;  1JWF A;  4MKT A;  3U66 A;  2EIL E;  3D3M A;  3NAW A;  1JCS A;  4ANX A;  2VYI A;  2C0L A;  4PDX A;  3UIN C;  4LER A;  4I6E A;  1K1A A;  3FTS A;  4ILI A;  5B1B E;  1MX6 A;  5ANL A;  1ZBP A;  2XEN A;  3Q9U C;  3TWS A;  3Q75 A;  1MYO A;  3LS8 A;  5CMY A;  4DRX E;  3GZ2 A;  1KT0 A;  3CKB A;  4F1P A;  2GRP B;  5ENR D;  3AG3 E;  4GZ6 A;  4D10 C;  2E0I A;  3LY9 A;  3FU6 A;  5DIZ A;  3Q79 A;  3ZNG A;  3ZYK A;  2V5F A;  4LNB A;  4EBA G;  2V8S E;  4A1G A;  2KAT A;  2XEH A;  3T8K A;  2I1K A;  5G05 C;  4JL0 A;  3IHV A;  4TXR A;  4M7C A;  1Y8M A;  4OVV A;  2XZT G;  4UWF A;  4A3V A;  2QY7 A;  5FZS A;  5EX3 A;  2IY0 C;  3EIJ A;  3V79 K;  4FU3 A;  3UIP C;  3NOC D;  1U3D A;  2P9U G;  2PM6 A;  1DCQ A;  2QFC A;  3RSE G;  2JAB A;  5A6C A;  1X5B A;  1O1R A;  3RJV A;  4I9C A;  5KWD A;  3AU4 A;  3OTN A;  4F7A A;  3C3Q A;  3NBN B;  3LKU A;  2YNQ A;  5T8I A;  3ASG A;  2F0Y A;  4TUM A;  4CDR A;  2EIK E;  2QZA A;  5AQB A;  5CMW A;  3HXD A;  3C72 A;  1N11 A;  4NUR A;  4F6R D;  3LEW A;  3JUI A;  1FT1 A;  2MRI A;  3RU0 A;  3APD A; 
#chains in the Genus database with same CATH homology
 4ANU A;  1ELR A;  5FZQ A;  2AVP A;  3Q15 A;  4JC8 A;  4IYP A;  4BT8 A;  4M3O A;  3K9I A;  4WWP A;  4GB9 A;  5A7D B;  4C0E A;  1BPO A;  2XCC A;  1SZ9 A;  2FI7 A;  2RD0 A;  2YHE A;  1W3B A;  2FO7 A;  2PL2 A;  5ARG A;  4WNG A;  2UY1 A;  4FHK A;  4DI4 A;  4EPZ A;  2X6I A;  1SZA A;  1QNF A;  2WXO A;  3AS5 A;  3CVN A;  3IHY A;  4ACK A;  3ZN3 A;  4B8C B;  4ABN A;  3N71 A;  1QQE A;  4AOF A;  4WUY A;  1KLX A;  4A55 A;  2GW1 A;  2YQ8 A;  4WWO A;  5HQ8 A;  3FFL A;  2LSU A;  1TJF A;  3BEE A;  3FDH A;  3CK9 A;  5FWQ A;  2WXG A;  3SHF A;  2C0M A;  4NAC A;  5DBK A;  5M72 A;  1OWM A;  4TUU A;  4GA2 A;  3CHS A;  3PEV B;  3ML9 A;  3MKQ A;  3Q49 B;  3TJP A;  3UT8 A;  3BG0 B;  4WAF A;  4JHK A;  3CLJ A;  3MYV A;  1PC2 A;  3D9L A;  2MOW A;  5EKQ D;  4GML A;  2KCL A;  3FUH A;  4KT6 B;  3PNT B;  3FH5 A;  3FU3 A;  4GA0 A;  3ULQ A;  2LNI A;  2NSZ A;  2PM7 A;  1ELW A;  4OVU A;  4RSY A;  3RIB A;  4HOU A;  3LDZ A;  3FUJ A;  3VTY A;  1KT1 A;  1Z3X A;  4GMJ A;  4B0Z A;  1JPL A;  3SFZ A;  3JQ1 A;  5FTP A;  3D9J A;  3FU5 A;  3FUL A;  4UI9 K;  2KCV A;  3IV0 A;  1HF8 A;  4XIF A;  1E96 B;  3CKC A;  2VSY A;  3C98 A;  3ZHE B;  3I4R B;  5HI7 A;  4KXK B;  5BUZ A;  2WMO A;  3OXG A;  4XI9 A;  4A1S A;  1H0A A;  1JWG A;  3SI5 A;  3VLE A;  1H2V C;  2XPI A;  5FT9 A;  4H7X A;  3E4B A;  4AVX A;  2AW6 A;  2WMN A;  3G2U A;  3O4Z A;  3QJZ A;  4LRZ A;  3G2S A;  3PS6 A;  4E85 A;  5G04 C;  2VGY A;  3FEX A;  4BFR A;  2Q7F A;  4G26 A;  4URK A;  3PUK A;  4JA7 A;  3SF4 A;  5KJN A;  2Y4U A;  3PDN A;  2HM8 A;  4I2W A;  2CFU A;  3RK6 A;  1Y6I A;  1EDU A;  2I1J A;  4C0M A;  2LO6 A;  2WXM A;  4U0U A;  4LEU A;  2YHC A;  5AJL A;  4PS8 A;  1FCH A;  4CDN A;  4GU5 A;  2IOS A;  4KBQ A;  4LUN U;  4ATG A;  2AXU A;  2IFU A;  1FVH A;  3AS8 A;  4CT4 A;  4IUL A;  1E8W A;  3AU5 A;  5D0O D;  3OXL A;  4I1M A;  4XX5 A;  4G25 A;  4UQZ A;  3PRE A;  4APF A;  1P5Q A;  4I6J A;  4N3A A;  3R9A B;  3KS2 A;  4U63 A;  4AV7 A;  1H2U A;  3QWV A;  4PS7 A;  3DPD A;  2IQC A;  3S7B A;  3UQ3 A;  4J8F A;  2WVI A;  3D9K A;  4L1B A;  5BPP A;  3FTX A;  4G24 A;  3PRZ A;  4J8S A;  1HX8 A;  1HXI A;  3LJ3 A;  4K03 A;  3CHO A;  4WNF A;  5LP0 A;  4WNE A;  2WXR A;  3RO2 A;  3L13 A;  4AP2 A;  1H2T C;  3CEQ A;  4B89 A;  3FUM A;  2KCK A;  4E6H A;  2CHZ A;  2A5U A;  4AXH A;  3CVW A;  4I17 A;  3TXN A;  1IHG A;  1ELK A;  3CIA A;  4G11 A;  2I9C A;  4JW1 A;  3ZGQ A;  4AY6 A;  3IBE A;  4AEZ C;  1EPU A;  3P2B A;  1E7U A;  4I6G A;  3G2W A;  2L0T B;  2L9B A;  3GYZ A;  3I4G A;  2ILR A;  2AWI A;  3QNK A;  1HG5 A;  4KVO A;  2M63 A;  4UWL A;  4UWG A;  1HFA A;  3OXF A;  4KVM A;  3ZW3 A;  3PE3 A;  4ANW A;  4QFV A;  3VLF A;  1UN8 A;  4BX9 A;  2X6K A;  3EHM A;  4JEH A;  3CHP A;  2WXK A;  2OV8 A;  2XRY A;  4FJY A;  1E7V A;  3U64 A;  2VSO E;  4GZC A;  3FTY A;  3ZFW A;  2I6H A;  5J08 A;  4I9E A;  4HVB A;  5BNW A;  4G23 A;  3U9W A;  4GYO A;  1EYH A;  2OVB A;  3MEK A;  4N5C A;  4EZL A;  3S7J A;  4I1A A;  3LXU X;  4CRW A;  3ESK A;  3L16 A;  4K0R A;  3LVR E;  5LCW J;  1B89 A;  3L22 A;  1NZN A;  2JEK A;  2ZU6 B;  3AS4 A;  3FY4 A;  5D0Q D;  3ZXS A;  4L23 A;  3SBT B;  5T3R A;  4UI9 J;  4XE0 A;  4FA6 A;  2FUL A;  3JQ0 A;  4HFG A;  4I43 A;  3CVL A;  4MS6 A;  3B13 A;  1HZ4 A;  2WM9 A;  4F53 A;  5AYW D;  2CHX A;  4DPR A;  3P1U A;  3ZIM A;  2XRZ A;  1IYG A;  5FQ7 A;  2V0P A;  3FUN A;  3QAR A;  3UT4 A;  4YVO A;  2XHE A;  2IF4 A;  2XGM A;  4U04 A;  2LAI A;  3WXX A;  1HG2 A;  1DVP A;  5KJM A;  5EX0 A;  3PH0 C;  4TRQ A;  3FP3 A;  3FUF A;  3MA5 A;  4I2Z A;  3U4T A;  2WPV A;  2GRM A;  4DJA A;  2VJ8 A;  3FUE A;  3OAW A;  2CG3 A;  1WY6 A;  4R7L A;  3EJN A;  3UX4 A;  1UW4 B;  3CK7 A;  3IKO B;  4JXT A;  4N2S A;  4DLO A;  2I2O A;  3PEU B;  4KZ0 A;  4EBA A;  3ASH A;  1SQM A;  3FH8 A;  3RO3 A;  1INZ A;  3CV0 A;  4ILG A;  3CVQ A;  3VTX A;  3JYS A;  5BT1 A;  3URZ A;  4GYW A;  3QC1 A;  2NC9 A;  3TGO A;  3TG5 A;  2CFZ A;  3ZEF A;  5FQ4 A;  4U07 A;  3GW4 A;  4ILH B;  2WQH A;  3KAE A;  3T8M A;  2L0I A;  3NZS A;  2NXP A;  3TXM A;  4P29 A;  3CK8 A;  3MKR A;  4Y6W A;  5ARF A;  3CHM A;  1EF1 C;  3ML8 A;  2GRL A;  5BV0 A;  2J07 A;  3B7R L;  4A3T A;  4CEM A;  3U3W A;  3CGH A;  4ME2 A;  3Q47 B;  3LYA A;  4BTA A;  4JHR A;  4XZ4 A;  3LY8 A;  2XQ0 A;  3NZU A;  4APO A;  2J49 A;  3I3N A;  3QB2 A;  3B7U X;  1Z6T A;  5FZR A;  4FAD A;  3R7Q A;  2WXL A;  4G1T A;  5FJY A;  5LOZ A;  2WXP A;  2J4B A;  5C1D A;  3B7S A;  1WM5 A;  3L6A A;  3TL5 A;  3PE4 A;  3Q4A B;  3UMV A;  1XNF A;  3ZYM A;  3ZHE A;  1UJK A;  3HYM B;  3FTZ A;  4HOQ A;  3FTW A;  2VGX B;  2WXH A;  3JCK C;  3RKV A;  2VQ2 A;  4Y6C A;  4PS3 A;  3I5P A;  4WWN A;  5T4Y A;  4JA9 A;  4GA1 A;  3CVU A;  3RRU A;  2CG2 A;  1E8Z A;  4OYS A;  3VLD A;  1E90 A;  4GCN A;  5G05 J;  2BUG A;  1DNP A;  2XCB A;  3T5X A;  3T5V A;  3MX3 A;  4BY6 A;  5G04 J;  1S0P A;  1OWN A;  2UWJ G;  5G2N A;  3R7R A;  3TAX A;  1NA0 A;  2FF4 A;  3MGB A;  4LCT A;  3HHM A;  2OND A;  4BTB A;  2VTB B;  2WB2 A;  3ONL A;  2DCP A;  3SNX A;  4GZ5 A;  3FH7 A;  2HYZ A;  4AIF A;  1L5J A;  1WAO 1;  3G2T A;  3CVY A;  4AM9 A;  4EZJ A;  3HIZ A;  2WQ7 A;  4NQ0 A;  2XGO A;  4Q94 A;  4GAA A;  3D9I A;  5E76 A;  1UN9 A;  3EDT B;  4FLH A;  3QKY A;  2DIW A;  4FC8 A;  5EDS A;  4GZD A;  3RRM B;  1H19 A;  5E75 A;  3LPZ A;  4XI0 A;  4Q69 A;  1OUV A;  2LSV A;  4W9R A;  5AJD A;  5ENN A;  2VGX A;  3FWV A;  2AXZ A;  1YA0 A;  3FUI A;  5FQ6 A;  2WXJ A;  3KEZ A;  4H7Y A;  5KJL A;  2FBN A;  2X6H A;  3ESL A;  4JZY A;  4DLQ A;  1N52 A;  4CDM A;  2AXV A;  2Y4T A;  3CR3 A;  4PH4 B;  4FJZ A;  3ZPJ A;  2OVF A;  1XGW A;  2JLB A;  2HR2 A;  2UY1 B;  3PNL B;  2PZI A;  3MV3 B;  5JJ6 A;  3S2A A;  4GYY A;  5LFA A;  5JJT A;  3EHN A;  4Q96 A;  4JEU A;  1HE8 A;  3QWP A;  4I1O B;  4DK5 A;  1IQU A;  4U0Z A;  5G55 A;  2VTB A;  4FUL A;  4HOT A;  3CQC B;  1OWP A;  3APC A;  4PUC A;  4XKC A;  2L6J A;  4AJW A;  4CGV A;  2XEV A;  3UPV A;  4JHJ A;  2VSN A;  3B7T A;  3RRN B;  3ASF A;  4UQX A;  4CCA A;  3CVP A;  4MRU A;  4DI3 A;  1VDY A;  2GGF A;  1OWO A;  4FP7 A;  4N3B A;  4J8D A;  1JUQ A;  3D9O A;  4JVS A;  3PZD A;  3ZVV A;  2R5S A;  4L2L A;  1JWF A;  4MKT A;  1PAQ A;  4AY5 A;  5JHA A;  3U66 A;  2WXN A;  3D3M A;  2X3M A;  3IEG A;  4WND A;  2XPZ A;  4J6I A;  3UT7 A;  3CSF A;  3ENE A;  4ANX A;  3SBS A;  4EEC A;  2VYI A;  1NA3 A;  2C0L A;  4PDX A;  1OWL A;  3ZYQ A;  5FQ8 A;  1TEZ A;  4C9B B;  4N2Q A;  4JPS A;  4BWR A;  4BT9 A;  4UQY A;  3EIQ C;  4B8A A;  1GW6 A;  3FUD A;  4LER A;  4BSX A;  2IU1 A;  5A23 A;  4I6E A;  3FTS A;  2J4D A;  2HO1 A;  4ILI A;  4UWK A;  3ONK A;  3FTV A;  2PQN A;  4L7T A;  3APF A;  1HS6 A;  4N39 A;  2RG8 A;  5ANL A;  1ZBP A;  4UWH A;  4YVQ C;  3LS8 A;  4KZC A;  5CMY A;  2WXQ A;  4B94 A;  3GZ2 A;  1LF8 A;  2FEZ A;  3MJW A;  3MZL B;  4CT0 A;  1KT0 A;  2ION A;  3CHR A;  4EZK A;  3CKB A;  4XKB A;  3SD5 A;  5LX8 A;  3S7D A;  1FVF A;  4GZ6 A;  3UUX A;  5CCM A;  4D10 C;  2E0I A;  3LY9 A;  3NQP A;  3LY7 A;  3ASD A;  4NRH B;  1HU3 A;  3FU6 A;  5DIZ A;  1N54 A;  3GZ1 A;  3G2V A;  1HO8 A;  4GCO A;  4RG9 A;  2E2E A;  3QOU A;  4KYO B;  3LCA A;  3D9P A;  3ZYK A;  4HLE A;  3GZS A;  5KJK A;  3CVX A;  1UG3 A;  4GPK A;  3CQG B;  3FTU A;  2J08 A;  4HOS A;  1E8Y A;  4ANV A;  2Y3A A;  1HH8 A;  4IN3 B;  4RG6 A;  2V5F A;  3BG1 B;  3LVQ E;  2OOE A;  3DBS A;  5BW8 C;  3ZRH A;  4EBA G;  2V8S E;  2MHK A;  4A1G A;  2KAT A;  3FEY A;  2WXI A;  4G2V A;  4ACL A;  2I1K A;  3L54 A;  5AEN A;  3NF1 A;  5G05 C;  2YIN A;  5C2Y A;  4JL0 A;  3IHV A;  3L17 A;  2EQX A;  3FU0 A;  3QAQ A;  4O6F A;  1Y8M A;  4OVV A;  4UWF A;  4A3V A;  4F3V A;  2QY7 A;  2VSX E;  4FLB A;  5FZS A;  5EX3 A;  1H6K A;  5CCL A;  4CGW A;  5JJ7 A;  3EIJ A;  2P58 C;  2R59 A;  3O48 A;  1U3C A;  3L08 A;  3HVE B;  4V3I A;  4FU3 A;  2DBA A;  1U3D A;  3FUK A;  2BF0 X;  4FHJ A;  4BX8 A;  1ZU2 A;  5JHB A;  2PM6 A;  4HXI A;  2QFC A;  3TG4 A;  2X38 A;  2KZT B;  2C2L A;  3MV2 B;  4RVB A;  3MCX A;  5CHE E;  1X5B A;  2KC7 A;  5A6C A;  2V4L A;  4HS2 A;  3RJV A;  2WQ6 A;  3SGH A;  2IOL A;  4I9C A;  4L2Y A;  5KCM A;  3QK0 A;  3AU4 A;  3FHE A;  3OTN A;  4F7A A;  3CHQ A;  2BTD A;  3LKU A;  3CVV A;  3PVL A;  2YNQ A;  4MLP A;  3QDN A;  3QWW A;  4J8E A;  4YND A;  5AIJ A;  1MQS A;  4J0U A;  2CHW A;  2R17 C;  4F1S A;  2X6F A;  1PY1 A;  5T8I A;  3ASG A;  4HOR A;  3HDX A;  1QZ2 A;  4KMO A;  5ANR A;  2PQR A;  3Q5M A;  3S7F A;  2J09 A;  4CDR A;  2XGS A;  3HVE A;  4IRU A;  4TV3 A;  5CMW A;  2IJG X;  3ZYL A;  5LCW C;  2X6J A;  3D9M A;  1IQR A;  2WXF A;  1MHQ A;  4UI9 C;  2LAH A;  1NP7 A;  2KZT A;  4NUR A;  3D9N A;  1E8X A;  4U0S A;  5J90 A;  1UJJ A;  4GZ3 A;  2KM4 A;  3PUJ A;  1A17 A;  3LEW A;  3JUI A;  2XPY A;  4N3C A;  3SZ7 A;  5BV1 A;  2A4Z A;  1TJC A;  2MRI A;  4EQF A;  3RU0 A;  3KD7 A;  3MKQ B;  1Z3Y A;  4U8H A;  2J9Q A;  3APD A;  3CST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...