4ACLA

3d structure of dotu from francisella novicida
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
155
structure length
155
Chain Sequence
DFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVDEKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPQICYQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKHIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TSSL
publication title The Structure of the Conserved Type Six Secretion Protein Tssl (Dotu) from Francisella Novicida
pubmed doi rcsb
source organism Francisella novicida
molecule tags Protein transport
total genus 58
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.590 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4aclA00
4V3IA 3U66A 4ACKA 4ACLA
chains in the Genus database with same CATH superfamily
1TN6A 3UM2A 4O1OA 3G2VA 3CVWA 3FUIA 4UQZA 3V31A 2AW6A 1ELRA 4WWOA 2JEKA 3SFXA 1YYHA 4KZCA 3BEEA 1OCOE 2VTBA 3RK6A 3AU4A 4UWLA 5T8IA 4I1MA 3MKRA 2L6JA 1H2UA 4IYPA 3UI2A 4ATGA 1MJ0A 3JXJA 2YINA 3B7TA 3HIZA 3UPVA 1KLXA 3MX3A 1IQUA 3HVEB 4WNGA 2DYRE 5AQ9A 4CZ2D 5J08A 4KT6B 1Y8MA 4BSXA 4E85A 3AAAC 4DJAA 3NAWA 5LCWJ 1EDUA 4MLPA 2X6HA 1DVPA 3PS6A 2KC7A 3CVVA 1MHQA 3ZGQA 3C3QA 4I17A 4KXKB 5AARA 3CSFA 4GA2A 5KNGA 2OEVA 5HS0A 2LXLA 4HI8A 3FHEA 4BTBA 5FINA 3KSQA 2J09A 4EQFA 4APFA 2VQ2A 1E8ZA 4J8FA 4GMLA 1E7UA 3FY4A 4GTOA 5ENSD 5LX8A 3CVNA 4JC8A 3X2QE 2YNQA 2EIKE 1E8WA 4L1BA 4L7TA 1OWLA 1E8XA 3FH5A 4EECA 2Y0BG 3EU5A 4ILGA 3CLJA 2LNIA 4A63B 2GGFA 4G26A 4UWHA 1U2VG 3FTUA 2V4LA 5KCMA 4GZ3A 4JL0A 1W3BA 4LNGA 4GCNA 3V2OA 3DBSA 1DC2A 3FH8A 3TWTA 1Z3YA 2AXUA 1MX2A 4HORA 5FJYA 1QQEA 4I2ZA 3CR3A 4TXRA 4UI9K 4BTAA 3CK7A 2R59A 1GW6A 3CV0A 3R7QA 2P9NG 2CHWA 3ASFA 3QB2A 4B8CB 3CVPA 2XGMA 3L9TA 1U3DA 3LY9A 3ASDA 5D0OD 3GYZA 2IF4A 2B6CA 3VLDA 4M3OA 5CCMA 1D9SA 4P29A 4G8LA 3FFLA 4OVVA 4J8DA 2F8YA 4DLQA 4L23A 4PS3A 3CHQA 1YCSB 4DX2A 3Q73A 3APDA 3C3RA 1TNZA 3UM3A 4MS6A 3T8KA 2IY0C 5HQ8A 4DX6D 3ASOE 4U7EB 2KCVA 3DSVA 1QZ2A 3HVEA 4DRXE 5AJLA 3UM0A 1D8EA 3TG4A 3PNLB 1Z3XA 5ANRA 1U3CA 3L08A 5EYLA 2FULA 1SW6A 3GW4A 2IO3C 4GZ5A 4WWPA 3E33A 4JHRA 3HHMA 5G2NA 4FA6A 3LVQE 2AVPA 3DSUA 1HG5A 1NL4A 1E90A 3ZYKA 3OXFA 1JCRA 3DSTA 1K8KG 3FU3A 4I1AA 1UN8A 4XI0A 3HG0D 5FZQA 4DX5D 2ZGGA 2LAHA 3DXKG 3FTWA 4J8EA 3UUXA 2DCPA 2V0PA 3D9NA 4I6JA 5FZRA 5CCLA 2ZU6B 2P9LG 3SFZA 1H0AA 4DI3A 3FTYA 2UWJG 4URKA 2F0YA 2VSOE 3S7FA 2C0LA 1A17A 2X3MA 3Q9UC 5AIJA 3AG2E 5DIZA 3BUAA 3SGHA 1SA5A 1UJJA 4GTSA 3TGOA 4IRUA 2IOSA 3ULQA 5C1DA 3OXLA 3JCKC 3FUJA 1LD8A 1OT8A 3CSTA 4EHMA 1EF1C 1O1TA 2RFAA 3BU8A 3OXGA 3LPZA 2L6BA 2PL2A 3QAQA 5AQBA 3T8MA 1HO8A 4WAFA 1YMPA 2LAIA 4IN3B 4GZCA 2V4HC 3BG0B 3DRAA 1N0QA 4N2SA 4YDWA 2DBAA 4B94A 4F7AA 3FU5A 1OXJA 2RD0A 1D8DA 4NRHB 5ITZF 2CHXA 2HO1A 4G25A 3TXNA 4ATZD 3ZN3A 1H6OA 2P9IG 1H6KA 1UW4B 2WXQA 2FI7A 3LS8A 3UT4A 3AU5A 3ABME 1ZU2A 3JUEA 4B0ZA 3I3NA 1N4SA 2AXZA 4HNAD 4LEUA 3ML8A 4WNEA 4V3IA 4BT9A 4N3CA 4ZFHA 4GU5A 1TYQG 3L13A 4R7LA 2OCCE 1ZB1A 1O5MA 3FUEA 2WQ6A 1WAO1 2WVIA 3DPDA 3PUKA 2Y69E 3G2SA 3SD5A 3D3MA 3CIAA 3C98A 5DBKA 2XS8A 4ACKA 4UWKA 3KAEA 3N71A 2R03A 1N11A 2VGXB 2J49A 3TWVA 5IY5E 5EDSA 3I5PA 1S63A 1WG0A 3FUDA 4GZDA 3IHVA 2F8XK 1IYGA 3EJNA 2DYSE 4AOFA 4HVBA 1SZAA 3APFA 3PNTB 1TN8A 2KXPC 4JEUA 3L54A 3ZXSA 1NA3A 3V79K 4CGVA 2XZTG 4GMRA 3P1UA 2WQ7A 3JQ0A 1LF8A 3I4GA 2IQCA 3UIPC 4GTRA 4CRWA 1EYHA 2X6IA 4ANUA 3IXEA 2VSXE 3CVLA 5LCWC 4JXTA 5KBAA 4A55A 4X8QA 2X6KA 3URZA 2BKGA 2QYUA 4GMJA 4LUNU 3HXDA 4WWNA 2J4BA 4FHJA 5AYWD 4YVQC 3DEPA 1PAQA 3QARA 5CMWA 2BEDA 5H7PA 3LYAA 4Q69A 3PE4A 4BFRA 3NOGD 1MX6A 1O1RA 2X6FA 4HQDA 2PNNA 4JHKA 3ZXPA 3HDXA 3QOUA 4YNDA 4HBDA 4A1SA 5JJTA 3ISMC 1AWCB 1IHGA 4E6HA 1E7VA 3ZRHA 5AJDA 4AXHA 4M7CA 4TRQA 2BTDA 4CDRA 4K0RA 3CHSA 1FT1A 1K1AA 4BY6A 3S2AA 3G2UA 3ZKJA 1WY6A 1N0RA 3S7BA 4GAAA 3B7SA 4GCOA 5D2MC 4APOA 2YQ8A 2WXOA 2ZISA 3ZU7B 3E32A 3TWXA 4AP2A 3BQOA 1A5EA 1P5QA 4HLEA 4KYOB 4I2WA 2IO2C 1JCQA 3L6AA 3RO3A 4OAVB 3S7DA 1Y6IA 1JWFA 4MRUA 5EKQD 2DWZA 1DCEA 3FUHA 3UMVA 4JD2G 4JZYA 2OEWA 2WXHA 4HS2A 3CHPA 3UINC 4EZKA 2R02A 5EILA 5AN8A 3PZ1A 1WDYA 5KJMA 4KMOA 2WB2A 3Q4AB 4U8YD 2XRYA 3SQVA 1PY1A 1UN9A 4HFGA 4I43A 1E8YA 3CVQA 2VGXA 4K5AB 1HFAA 1NP7A 2XENA 2Q7FA 3UIOC 3VTYA 4RG6A 4DX7D 3UTMA 3AG1E 3BG1B 4CGWA 3Q9NC 3CQCB 4B93B 2VGEA 4AM9A 2OOEA 5BV0A 1V55E 4G1TA 4IULA 4HXIA 1HF8A 5HI7A 4HOSA 3Q79A 4U63A 3PZ4A 4JW1A 4EZLA 3NQPA 4K5BA 3ZEFA 3QDNA 3J5QB 3MV3B 4Q94A 4AVXA 5FQ8A 3FULA 4J8YA 4XKCA 1Z5SC 1TEZA 4Z68A 2OV8A 4DLOA 1RW2A 3RU0A 2R17C 3LCAA 2XGOA 3PREA 1BU9A 4U95D 3QK0A 2GW1A 5CMYA 3RSEG 3DSWA 2DZNA 1TN7A 3I4RB 5ENQD 1INZA 2A5EA 2KATA 2QFCA 3B7BA 4MKTA 4N3BA 5EYPF 1BI7B 3PZDA 4O1PA 4FJZA 4AIFA 3CHRA 4ZHBA 5FWQA 2CFZA 3FEXA 3CQGB 3FEYA 1ELKA 2XEHA 1XNFA 5ENTD 5AQ7A 4GTPA 3HXEA 5A7DB 3ZW3A 2VSYA 3JYSA 2WM9A 4J0UA 4BX9A 4PDXA 4TV3A 5KJNA 5CBOA 2MHKA 5EIBE 3SNXA 4BT8A 2ZGDA 3P2BA 4CT0A 5ENOD 1L5JA 5ENPD 5FQ6A 3UM1A 3TWSA 3O48A 4BERA 1H6PA 1X81A 3NBNB 3QC1A 2Y1LE 3SY2A 5B3SE 1QYMA 2XHEA 4WUYA 3C3OA 4N5QA 2ONDA 1UJKA 3APCA 3HRAA 1N4RA 2QY7A 4U0UA 2ETAA 1HH8A 3L82A 3ESKA 4PS8A 1IHBA 2I6HA 3VTXA 4K03A 3ZNGA 5FZSA 3PH0C 2PZIA 5KJLA 3L22A 3DSSA 5CECB 2X38A 4GA0A 4HLLA 5J90A 4ABNA 4FLBA 2XS1A 4BESA 2L0TB 2FF4A 3CHMA 3MJWA 1BLXB 4YDEA 3JUIA 1JUQA 1K1BA 1TNOA 2GROB 5HRYA 3D9HA 2BKKB 3CHOA 4N39A 3CVUA 1JPLA 4LG6A 1BD8A 4JA7A 2FEZA 2ETBA 3Q7AA 4GPKA 1H19A 3ONKA 2IU1A 5A23A 4F6RD 4CT4A 3PE3A 2IOLA 1IKND 2BF0X 3FUMA 4UI9J 1N94A 1HX8A 3V30A 4N5CA 1NZNA 2FBNA 4GYYA 4OYSA 5CHEE 3RRMB 5LFAA 4RQIA 3EHQA 4U96D 1N4QA 5EIDA 1FVFA 2NSZA 3DSXA 4RVBA 1KT1A 4DK5A 3MZLB 2Y4TA 5BXOA 3Q15A 1S0PA 1HXIA 2P9KG 2JABA 4HOUA 2FO1E 4PS7A 5ARFA 1OWNA 3RRUA 5CRUA 3ASNE 2B0OE 3LY7A 5KWDA 2RKKA 1SQMA 4A3TA 4OAUC 4GTTA 3LEWA 5AQAA 5FT9A 4GYOA 5BW8C 4FADA 4D10C 5EX0A 1Z6TA 4I9CA 2VTBB 4W9RA 3FDHA 2IEJA 4KZ0A 3EHRA 4TXQA 3ZVVA 1FVHA 4UWFA 3TXMA 3HXBA 2WQHA 2JLBA 3D9KA 3UKUG 2XPYA 4UUCA 4DX1A 4LSZE 3U9WA 2EIJE 2KM4A 3HYMB 3UQ3A 2AWIA 2KBXA 3DWLG 1B89A 2NC9A 4HRMB 4J8SA 3PEVB 4EPZA 4EBAG 3FTZA 4HRLA 4G8KA 3QJZA 5BUZA 2MOWA 2M63A 3FTXA 3FH7A 3QKYA 2XEEA 4GPMA 4C48B 1TNYA 3PZ3A 2XEVA 1ELWA 4AJWA 4HRNA 5JJ6A 4U0SA 2RFMA 5BV1A 3E4BA 2WPVA 2KZTB 5ENRD 3SO8A 1NFIE 2GRPB 2KCKA 3SFYA 1K3ZD 3AJIA 5JHAA 3GZSA 2HE0A 4C0MA 2CG3A 2Y3AA 4TUMA 2R05A 5G04J 4NQ0A 3QNKA 1KZOA 4G24A 5KJKA 1X5BA 3V2XA 2P9PG 3Q78A 2J8SD 3VLFA 2IJGX 4I6GA 4UWGA 4QFVA 3WG7E 5EN5D 5AENA 2HR2A 4CEMA 3T5VA 4AY5A 1N52A 3B7UX 4QQIA 2GRLA 2XCBA 2RG8A 2P9UG 3EDTB 3PEUB 3B95A 4L2YA 3PUJA 2P2CP 2H6IA 4EBAA 4I6EA 4CDMA 4CCAA 4FJYA 4ANWA 3E37A 4FU3A 4F53A 4UQYA 2E2EA 3KEZA 3CKCA 1EPUA 4LRZA 3Q75A 2H6GA 3KD7A 3DEOA 4U0ZA 2UY1B 4XIFA 1OCRE 1DNPA 2WXKA 5B1BE 3GZ2A 5T3RA 5BNWA 2XRZA 3CK8A 4CDNA 4XZ4A 2PM7A 1TNUA 3MGBA 3S7JA 3Q49B 1UG3A 3JXIA 4J7WA 1QBQA 5JA4D 4K5CA 5JHBA 2A4ZA 1MX4A 2P9SG 3ZYQA 1NA0A 3TWUA 2MYOA 1FCHA 4WNFA 5E76A 2WXLA 1PC2A 4O6FA 4Y6WA 3EIQC 2L9BA 2QZAA 2C0MA 3R7RA 2OVFA 3IHYA 3ZUVB 2LSUA 3UKRG 2V5QC 3CK9A 3QWPA 3ABLE 3KSLA 5FTPA 1O1SA 2I9CA 2KZTA 4GYWA 3NF1A 2E0IA 4NIKA 4ACLA 3ULEG 3L17A 3SHFA 4PUCA 3U4TA 3MA5A 3LDZA 3G2TA 4NACA 3E30A 4MBGA 2NXPA 2YHCA 4N3AA 1TNBA 3C5RA 2HYZA 4XE0A 3IEGA 4B89A 3NOCD 3IKOB 3OTNA 1OWOA 1KZPA 4GB9A 1SVXA 3FP3A 3ASGA 3TG5A 4JEHA 5CBNA 3KS2A 5LOZA 3RJVA 2Y4UA 1V54E 3MCXA 4AY6A 4F1PA 2F37A 5B1AE 4G2VA 3FU0A 3AS8A 4KBQA 2J07A 3ASHA 2LSVA 4I1OB 5ARGA 2AJAA 2ILRA 3LJNA 3CGHA 4UQXA 2OVBA 4BSZB 4NURA 1N4PA 3FUFA 2XCCA 4KVOA 4TUUA 2J4DA 1BPOA 2ZXWE 3D9JA 1LTXA 4N2QA 5CERB 1S64A 4Q96A 4JPSA 1Q2ZA 3O4ZA 1H2TC 2BUGA 4PH4B 1MYOA 5JJ7A 5T4YA 2QC9A 4Y6CA 4GTQA 2R2LA 3SBSA 2UY1A 2WXJA 4XX5A 2VJ8A 1HE8A 2L0IA 4UI9C 2GRQB 3L16A 5C2YA 3TJPA 2I2OA 3SI5A 3F6QA 3AG3E 3TWQA 3IBEA 2IONA 3LXUX 4RLYA 3IV0A 4A3VA 4C9BB 3UX4A 3EHMA 4ME2A 1N95A 3ZHEB 3PVLA 3NZSA 1G3NB 3LJ3A 3ZYLA 4YDOA 5FQ7A 1S70B 2GRMA 5D0QD 1FT2A 3CEQA 2FO7A 1YA0A 4GZ6A 3QWWA 3RO2A 4G23A 2J08A 1RZ4A 2WXNA 1MZCA 2VSNA 2VGYA 1SA4A 4LERA 4DI4A 2XGSA 4JHJA 1SZ9A 5M72A 5ENNA 4BWRA 2CG2A 3RRNB 2HM8A 3J5PA 2I1JA 5G55A 2A5UA 3AS4A 4HOQA 4F1SA 3QWVA 4B8AA 2XPIA 1OCZE 3U66A 4BEPA 2V5FA 4HB5A 5CEDB 3GZ1A 5EX3A 3CVYA 3C72A 1KPSB 4C0EA 4JB8P 5CEAA 3WXXA 1AP7A 2R5SA 3R9MA 3U64A 4JA9A 3G2WA 3D9IA 1JCSA 3FUKA 4FULA 2WXGA 3ZYMA 2XPZA 3VLEA 4U8HA 4EZJA 3T5XA 1OWMA 1FPPA 5AAOA 2PQNA 3E34A 4L2LA 3FUNA 5BPPA 2XQ0A 3ZPJA 2H6FA 4XEIG 3PRZA 3MKQB 1TJCA 5FIOA 2NYJA 3MV2B 3CKBA 1HZ4A 3LKUA 4WNDA 3EUVA 3ENEA 4BX8A 1LD7A 3D9OA 4FC8A 4GTVA 3EHNA 5CRVA 2WXMA 3W9FA 4TXPA 3DXMG 3FU6A 2AXVA 5G04C 3Q47B 3SF4A 2EQXA 1OUVA 2CHZA 2XZDG 1N54A 4XKBA 3Q7FA 4U07A 2WXFA 1OWPA 2V8SE 2LXMA 3ONLA 3RKVA 5G05C 2YHEA 2CFUA 3FTSA 4ILHB 1IQRA 1UOHA 1WM5A 4CYMD 2LO6A 1QNFA 3K9IA 4HI9A 2IFUA 4AEZC 3ESLA 2J9QA 3D9MA 5BXUA 1BI8B 2DIWA 3HXFA 1TR4A 1XGWA 4DPRA 5FQ4A 1E96B 4F3VA 1VDYA 3AG4E 3ML9A 4AV7A 4YVOA 4ANXA 4LNBA 5BT1A 3RAUA 3W9GA 3TAXA 4ILIA 4I9EA 3MYVA 1DCQA 4A1GA 1H2VC 3FTVA 3EU9A 5A6CA 2P58C 3ZHEA 3AS5A 1OCCE 2EILE 1HG2A 1KT0A 3ULYA 5LP0A 1HU3A 3PZ2A 2KCLA 3T9KA 2ETCA 2ZIRA 3SBTB 3TWRA 2QYJA 2WXPA 3CVXA 5JMND 4KVMA 4HOTA 4J6IA 4L9PA 3UT7A 3PDNA 3LVRE 3ABKE 3D9LA 4FLHA 3OAWA 5ANLA 2LUHA 4BETA 2C2LA 5KNHD 3NZUA 3MEKA 3UT8A 3TL5A 4H7YA 5G05J 3FWVA 5HKPA 4GTMA 1N9AA 2EIME 2MRIA 4LCTA 2DVWA 2WMOA 4O60A 1ZBPA 4ANVA 2H6HA 3D9PA 3UXGA 2I1KA 3TWWA 1OY3D 1MQSA 2GRNB 2WXIA 3U3WA 4LNUD 3SZ7A 3HXCA 4GA1A 2PM6A 4H7XA 3LY8A 2EINE 4FP7A 4FHKA 4RG9A 3R9AB 3ZFWA 1HS6A 2GRRB 4XI9A 4OVUA 3MKQA 4YDYA 2WMNA 3DPYA 5E75A 3JQ1A 3Q5MA 2PQRA 3KEAA 5D66A 2VYIA 3B7RL 2X6JA 4DUIA 3NB2A 4G11A 1IXVA 4U8VD 1JWGA 3RIBA 1TJFA 1NI1A 2DZOA 3EIJA 4RSYA 4JVSA 4U04A 3ZIMA 3B13A 2WXRA
chains in the Genus database with same CATH topology
4FLBA 2AXZA 4LEUA 3ML8A 4WNEA 4G2VA 3FU0A 4V3IA 3AS8A 4BT9A 3G2VA 2L0TB 3CVWA 3FUIA 4N3CA 2FF4A 2AW6A 1ELRA 4UQZA 4GU5A 3CHMA 3MJWA 4KBQA 4WWOA 2J07A 3L13A 3JUIA 4R7LA 2JEKA 3ASHA 2LSVA 4I1OB 5ARGA 4KZCA 3BEEA 2ILRA 1JUQA 2VTBA 3FUEA 3RK6A 3CGHA 3CHOA 4N39A 3AU4A 3CVUA 4UQXA 1JPLA 4UWLA 2WQ6A 2OVBA 5T8IA 1WAO1 2WVIA 4I1MA 3MKRA 2L6JA 1H2UA 4IYPA 3DPDA 4JA7A 3PUKA 4NURA 2FEZA 3G2SA 3SD5A 4ATGA 4GPKA 3D3MA 2YINA 3CIAA 3C98A 1H19A 5DBKA 3FUFA 4ACKA 4UWKA 3KAEA 2XCCA 3N71A 3ONKA 4KVOA 2IU1A 3B7TA 4TUUA 2J4DA 1BPOA 5A23A 3HIZA 2VGXB 2J49A 3UPVA 4CT4A 5EDSA 3D9JA 3PE3A 4N2QA 2IOLA 1KLXA 3MX3A 4Q96A 1IQUA 2BF0X 3I5PA 3HVEB 4JPSA 3FUMA 3O4ZA 4WNGA 1H2TC 3FUDA 4GZDA 4UI9J 3IHVA 1IYGA 1HX8A 2BUGA 4PH4B 5JJ7A 5J08A 5T4YA 4KT6B 1Y8MA 4N5CA 4Y6CA 3EJNA 1NZNA 3SBSA 4BSXA 2UY1A 2FBNA 4AOFA 4GYYA 4E85A 2WXJA 4OYSA 5CHEE 3RRMB 4HVBA 4XX5A 1SZAA 5LFAA 3APFA 3PNTB 4DJAA 2VJ8A 1HE8A 2L0IA 4JEUA 3L54A 1FVFA 4UI9C 1EDUA 2NSZA 4RVBA 3ZXSA 5LCWJ 4MLPA 1KT1A 2X6HA 3L16A 4DK5A 5C2YA 1NA3A 1DVPA 3MZLB 2Y4TA 4CGVA 3TJPA 3P1UA 1S0PA 3Q15A 3JQ0A 1HXIA 2I2OA 3PS6A 2WQ7A 1LF8A 3I4GA 2IQCA 2KC7A 3SI5A 4HOUA 3CVVA 1MHQA 4CRWA 3ZGQA 1EYHA 2X6IA 3IBEA 4ANUA 2IONA 2VSXE 3CVLA 3LXUX 4PS7A 5ARFA 5LCWC 4JXTA 3IV0A 4A55A 1OWNA 4A3VA 4I17A 2X6KA 4KXKB 3URZA 4C9BB 3RRUA 3UX4A 3EHMA 4ME2A 3ZHEB 3LY7A 3CSFA 3PVLA 4GA2A 4GMJA 1SQMA 4A3TA 4LUNU 3LEWA 4WWNA 3NZSA 5FT9A 3LJ3A 4GYOA 2J4BA 4FHJA 3FHEA 5BW8C 4D10C 4BTBA 4FADA 5EX0A 1Z6TA 5AYWD 3ZYLA 5FQ7A 4I9CA 2VTBB 2GRMA 5D0QD 4YVQC 3CEQA 2FO7A 1YA0A 2J09A 3FDHA 4GZ6A 3QWWA 4W9RA 3RO2A 4EQFA 1PAQA 4G23A 2J08A 4KZ0A 4APFA 3QARA 5CMWA 2VQ2A 3ZVVA 1E8ZA 4J8FA 1FVHA 3LYAA 4Q69A 3PE4A 4BFRA 2WXNA 4GMLA 4UWFA 1E7UA 3TXMA 2VSNA 2VGYA 3FY4A 4LERA 4DI4A 2XGSA 4JHJA 5LX8A 2X6FA 2WQHA 2JLBA 1SZ9A 3D9KA 5M72A 4JHKA 3CVNA 3HDXA 5ENNA 2XPYA 4BWRA 2CG2A 2HM8A 3QOUA 2I1JA 4JC8A 5G55A 2YNQA 4YNDA 3RRNB 1E8WA 2A5UA 3U9WA 3AS4A 4L1BA 4HOQA 4L7TA 4A1SA 4F1SA 1OWLA 2KM4A 3HYMB 3QWVA 5JJTA 3UQ3A 2AWIA 1E8XA 4B8AA 3FH5A 4EECA 2XPIA 1B89A 2NC9A 3U66A 1IHGA 2V5FA 4ILGA 4E6HA 1E7VA 3ZRHA 4J8SA 3PEVB 5AJDA 4EPZA 4AXHA 3GZ1A 4EBAG 3FTZA 3CLJA 4TRQA 2BTDA 5EX3A 3QJZA 5BUZA 3CVYA 4CDRA 4K0RA 3CHSA 2LNIA 2MOWA 2M63A 2GGFA 3FTXA 4C0EA 3FH7A 3QKYA 4G26A 4UWHA 4BY6A 3WXXA 2R5SA 3S2AA 2XEVA 1ELWA 3G2UA 4AJWA 3FTUA 2V4LA 1WY6A 5JJ6A 3U64A 4JA9A 5KCMA 4U0SA 5BV1A 4GZ3A 3E4BA 3G2WA 2WPVA 4JL0A 3S7BA 3D9IA 4GAAA 1W3BA 3FUKA 4FULA 4GCNA 2KZTB 3B7SA 4GCOA 2WXGA 4APOA 2YQ8A 3DBSA 5J90A 2WXOA 3FH8A 3ZYMA 2XPZA 3VLEA 4U8HA 2KCKA 3T5XA 1OWMA 4EZJA 1Z3YA 2PQNA 2AXUA 4L2LA 3FUNA 3GZSA 4AP2A 5BPPA 5FJYA 2XQ0A 5JHAA 4HORA 3ZPJA 1P5QA 1QQEA 3MKQB 3PRZA 4I2ZA 1TJCA 3CR3A 4UI9K 3MV2B 4BTAA 4C0MA 2CG3A 3CKBA 2Y3AA 3CK7A 1HZ4A 3LKUA 4KYOB 4I2WA 4HLEA 2R59A 1GW6A 3CV0A 4WNDA 3L6AA 5G04J 4NQ0A 3R7QA 3QNKA 3ASFA 2CHWA 3ENEA 4BX8A 3RO3A 4G24A 3S7DA 3QB2A 4B8CB 3D9OA 1Y6IA 1JWFA 4MRUA 5EKQD 5KJKA 4FC8A 3CVPA 3UMVA 3FUHA 1X5BA 2XGMA 3EHNA 4JZYA 2WXMA 1U3DA 3LY9A 2WXHA 3ASDA 3CHPA 4HS2A 3FU6A 4EZKA 2AXVA 5G04C 3Q47B 3SF4A 5D0OD 2EQXA 2IF4A 3GYZA 3VLFA 1OUVA 2IJGX 3VLDA 2CHZA 4M3OA 5CCMA 1N54A 4I6GA 4P29A 5KJMA 4KMOA 2WB2A 3Q4AB 4XKBA 2XRYA 4UWGA 4QFVA 4U07A 3FFLA 4OVVA 4J8DA 4DLQA 2HR2A 5AENA 4CEMA 3T5VA 4AY5A 4L23A 1PY1A 1UN9A 4PS3A 3CHQA 2WXFA 1OWPA 2V8SE 4HFGA 3ONLA 4I43A 3APDA 1E8YA 1N52A 3RKVA 3B7UX 3CVQA 2VGXA 5G05C 4MS6A 1HFAA 2YHEA 1NP7A 2CFUA 5HQ8A 3FTSA 2GRLA 2KCVA 2Q7FA 1QZ2A 2XCBA 4ILHB 1IQRA 2RG8A 3HVEA 3VTYA 5AJLA 4RG6A 3EDTB 3PEUB 3TG4A 3BG1B 4CGWA 3PNLB 1Z3XA 5ANRA 4L2YA 1U3CA 1WM5A 3L08A 3CQCB 2LO6A 3PUJA 4AM9A 1QNFA 2OOEA 3K9IA 2FULA 5BV0A 2IFUA 3GW4A 4G1TA 4IULA 3ESLA 1HF8A 4HXIA 4AEZC 5HI7A 4HOSA 2J9QA 4U63A 4GZ5A 4EBAA 3D9MA 4I6EA 4CDMA 4JW1A 4CCAA 4WWPA 4FJYA 4ANWA 4EZLA 4JHRA 2DIWA 3NQPA 3HHMA 5G2NA 4FU3A 4FA6A 4F53A 4UQYA 3LVQE 2AVPA 2E2EA 3KEZA 3QDNA 3ZEFA 1XGWA 1HG5A 1E90A 3MV3B 4DPRA 4Q94A 5FQ4A 3CKCA 1E96B 4AVXA 4F3VA 1VDYA 1EPUA 3OXFA 4LRZA 3ML9A 5FQ8A 3ZYKA 4AV7A 3KD7A 3FULA 4YVOA 4ANXA 5BT1A 3TAXA 4ILIA 3FU3A 4I1AA 4XKCA 4I9EA 1UN8A 3MYVA 4U0ZA 4XI0A 2UY1B 4A1GA 1H2VC 5FZQA 4XIFA 3FTVA 1TEZA 2OV8A 5A6CA 2LAHA 4DLOA 1DNPA 2P58C 3FTWA 2WXKA 3GZ2A 4J8EA 5T3RA 5BNWA 3ZHEA 3AS5A 3UUXA 3CK8A 2XRZA 3RU0A 4CDNA 1HG2A 2DCPA 2V0PA 3D9NA 4I6JA 4XZ4A 5FZRA 2PM7A 2ZU6B 5CCLA 2R17C 3LCAA 1KT0A 3SFZA 1H0AA 3MGBA 3S7JA 5LP0A 1HU3A 4DI3A 2XGOA 3Q49B 3FTYA 1UG3A 2UWJG 4URKA 2KCLA 3PREA 2VSOE 3QK0A 3SBTB 2GW1A 3S7FA 5CMYA 2WXPA 5JHBA 3CVXA 2A4ZA 3I4RB 4KVMA 2C0LA 1INZA 1A17A 2KATA 2X3MA 4HOTA 5AIJA 2QFCA 3ZYQA 1NA0A 4MKTA 4J6IA 5DIZA 4N3BA 3UT7A 3PDNA 1FCHA 4WNFA 3PZDA 5E76A 3SGHA 1UJJA 4FJZA 3LVRE 3TGOA 4AIFA 4IRUA 2IOSA 3CHRA 3D9LA 4FLHA 3ULQA 5C1DA 2WXLA 2CFZA 3FEXA 3OXLA 5FWQA 3CQGB 3FEYA 3OAWA 5ANLA 1PC2A 3JCKC 4O6FA 1ELKA 4Y6WA 3FUJA 3EIQC 2L9BA 2C2LA 1XNFA 3NZUA 5A7DB 3MEKA 3ZW3A 3CSTA 2VSYA 3UT8A 3JYSA 3TL5A 2C0MA 2WM9A 4J0UA 3R7RA 1EF1C 4BX9A 4H7YA 4PDXA 4TV3A 2OVFA 3IHYA 5KJNA 5G05J 2MHKA 3OXGA 2LSUA 3SNXA 3FWVA 4BT8A 3LPZA 3CK9A 2MRIA 3QWPA 3P2BA 4LCTA 4CT0A 1L5JA 2WMOA 1ZBPA 4ANVA 5FTPA 2PL2A 3D9PA 3QAQA 3T8MA 2I1KA 1HO8A 4WAFA 3ZIMA 5FQ6A 2I9CA 1MQSA 2LAIA 2WXIA 3O48A 2KZTA 4GZCA 4IN3B 3U3WA 3BG0B 3QC1A 4GYWA 3SZ7A 4N2SA 4GA1A 2PM6A 2DBAA 4H7XA 3LY8A 3NF1A 4B94A 2E0IA 4FP7A 4FHKA 4RG9A 3R9AB 3ZFWA 4ACLA 1HS6A 2XHEA 4XI9A 4WUYA 3L17A 3SHFA 4F7AA 4OVUA 3MKQA 4PUCA 3FU5A 3U4TA 2RD0A 3MA5A 3LDZA 3G2TA 2WMNA 4NACA 4NRHB 2NXPA 2ONDA 1UJKA 2YHCA 4N3AA 2CHXA 3APCA 5E75A 2HO1A 2HYZA 3JQ1A 2QY7A 4XE0A 3Q5MA 2PQRA 4G25A 4U0UA 3TXNA 3IEGA 4B89A 1HH8A 3ESKA 4PS8A 3IKOB 3OTNA 3ZN3A 2VYIA 1H6KA 3B7RL 1OWOA 1UW4B 2X6JA 2I6HA 3VTXA 2WXQA 2FI7A 3LS8A 3UT4A 4GB9A 3FP3A 3ASGA 4G11A 4K03A 1JWGA 3AU5A 1ZU2A 3TG5A 4JEHA 5FZSA 3PH0C 1TJFA 3RIBA 4B0ZA 3I3NA 3KS2A 5LOZA 3RJVA 2PZIA 2Y4UA 3EIJA 4RSYA 5KJLA 4JVSA 3L22A 3MCXA 4AY6A 2X38A 4U04A 4GA0A 4ABNA 3B13A 2WXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3I A;  3U66 A;  4ACK A;  4ACL A; 
#chains in the Genus database with same CATH topology
 1TN6 A;  3UM2 A;  4O1O A;  3G2V A;  3CVW A;  3FUI A;  4UQZ A;  3V31 A;  2AW6 A;  1ELR A;  4WWO A;  2JEK A;  3SFX A;  1YYH A;  4KZC A;  3BEE A;  1OCO E;  2VTB A;  3RK6 A;  3AU4 A;  4UWL A;  5T8I A;  4I1M A;  3MKR A;  2L6J A;  1H2U A;  4IYP A;  3UI2 A;  4ATG A;  1MJ0 A;  3JXJ A;  2YIN A;  3B7T A;  3HIZ A;  3UPV A;  1KLX A;  3MX3 A;  1IQU A;  3HVE B;  4WNG A;  2DYR E;  5AQ9 A;  4CZ2 D;  5J08 A;  4KT6 B;  1Y8M A;  4BSX A;  4E85 A;  3AAA C;  4DJA A;  3NAW A;  5LCW J;  1EDU A;  4MLP A;  2X6H A;  1DVP A;  3PS6 A;  2KC7 A;  3CVV A;  1MHQ A;  3ZGQ A;  3C3Q A;  4I17 A;  4KXK B;  5AAR A;  3CSF A;  4GA2 A;  5KNG A;  2OEV A;  5HS0 A;  2LXL A;  4HI8 A;  3FHE A;  4BTB A;  5FIN A;  3KSQ A;  2J09 A;  4EQF A;  4APF A;  2VQ2 A;  1E8Z A;  4J8F A;  4GML A;  1E7U A;  3FY4 A;  4GTO A;  5ENS D;  5LX8 A;  3CVN A;  4JC8 A;  3X2Q E;  2YNQ A;  2EIK E;  1E8W A;  4L1B A;  4L7T A;  1OWL A;  1E8X A;  3FH5 A;  4EEC A;  2Y0B G;  3EU5 A;  4ILG A;  3CLJ A;  2LNI A;  4A63 B;  2GGF A;  4G26 A;  4UWH A;  1U2V G;  3FTU A;  2V4L A;  5KCM A;  4GZ3 A;  4JL0 A;  1W3B A;  4LNG A;  4GCN A;  3V2O A;  3DBS A;  1DC2 A;  3FH8 A;  3TWT A;  1Z3Y A;  2AXU A;  1MX2 A;  4HOR A;  5FJY A;  1QQE A;  4I2Z A;  3CR3 A;  4TXR A;  4UI9 K;  4BTA A;  3CK7 A;  2R59 A;  1GW6 A;  3CV0 A;  3R7Q A;  2P9N G;  2CHW A;  3ASF A;  3QB2 A;  4B8C B;  3CVP A;  2XGM A;  3L9T A;  1U3D A;  3LY9 A;  3ASD A;  5D0O D;  3GYZ A;  2IF4 A;  2B6C A;  3VLD A;  4M3O A;  5CCM A;  1D9S A;  4P29 A;  4G8L A;  3FFL A;  4OVV A;  4J8D A;  2F8Y A;  4DLQ A;  4L23 A;  4PS3 A;  3CHQ A;  1YCS B;  4DX2 A;  3Q73 A;  3APD A;  3C3R A;  1TNZ A;  3UM3 A;  4MS6 A;  3T8K A;  2IY0 C;  5HQ8 A;  4DX6 D;  3ASO E;  4U7E B;  2KCV A;  3DSV A;  1QZ2 A;  3HVE A;  4DRX E;  5AJL A;  3UM0 A;  1D8E A;  3TG4 A;  3PNL B;  1Z3X A;  5ANR A;  1U3C A;  3L08 A;  5EYL A;  2FUL A;  1SW6 A;  3GW4 A;  2IO3 C;  4GZ5 A;  4WWP A;  3E33 A;  4JHR A;  3HHM A;  5G2N A;  4FA6 A;  3LVQ E;  2AVP A;  3DSU A;  1HG5 A;  1NL4 A;  1E90 A;  3ZYK A;  3OXF A;  1JCR A;  3DST A;  1K8K G;  3FU3 A;  4I1A A;  1UN8 A;  4XI0 A;  3HG0 D;  5FZQ A;  4DX5 D;  2ZGG A;  2LAH A;  3DXK G;  3FTW A;  4J8E A;  3UUX A;  2DCP A;  2V0P A;  3D9N A;  4I6J A;  5FZR A;  5CCL A;  2ZU6 B;  2P9L G;  3SFZ A;  1H0A A;  4DI3 A;  3FTY A;  2UWJ G;  4URK A;  2F0Y A;  2VSO E;  3S7F A;  2C0L A;  1A17 A;  2X3M A;  3Q9U C;  5AIJ A;  3AG2 E;  5DIZ A;  3BUA A;  3SGH A;  1SA5 A;  1UJJ A;  4GTS A;  3TGO A;  4IRU A;  2IOS A;  3ULQ A;  5C1D A;  3OXL A;  3JCK C;  3FUJ A;  1LD8 A;  1OT8 A;  3CST A;  4EHM A;  1EF1 C;  1O1T A;  2RFA A;  3BU8 A;  3OXG A;  3LPZ A;  2L6B A;  2PL2 A;  3QAQ A;  5AQB A;  3T8M A;  1HO8 A;  4WAF A;  1YMP A;  2LAI A;  4IN3 B;  4GZC A;  2V4H C;  3BG0 B;  3DRA A;  1N0Q A;  4N2S A;  4YDW A;  2DBA A;  4B94 A;  4F7A A;  3FU5 A;  1OXJ A;  2RD0 A;  1D8D A;  4NRH B;  5ITZ F;  2CHX A;  2HO1 A;  4G25 A;  3TXN A;  4ATZ D;  3ZN3 A;  1H6O A;  2P9I G;  1H6K A;  1UW4 B;  2WXQ A;  2FI7 A;  3LS8 A;  3UT4 A;  3AU5 A;  3ABM E;  1ZU2 A;  3JUE A;  4B0Z A;  3I3N A;  1N4S A;  2AXZ A;  4HNA D;  4LEU A;  3ML8 A;  4WNE A;  4V3I A;  4BT9 A;  4N3C A;  4ZFH A;  4GU5 A;  1TYQ G;  3L13 A;  4R7L A;  2OCC E;  1ZB1 A;  1O5M A;  3FUE A;  2WQ6 A;  1WAO 1;  2WVI A;  3DPD A;  3PUK A;  2Y69 E;  3G2S A;  3SD5 A;  3D3M A;  3CIA A;  3C98 A;  5DBK A;  2XS8 A;  4ACK A;  4UWK A;  3KAE A;  3N71 A;  2R03 A;  1N11 A;  2VGX B;  2J49 A;  3TWV A;  5IY5 E;  5EDS A;  3I5P A;  1S63 A;  1WG0 A;  3FUD A;  4GZD A;  3IHV A;  2F8X K;  1IYG A;  3EJN A;  2DYS E;  4AOF A;  4HVB A;  1SZA A;  3APF A;  3PNT B;  1TN8 A;  2KXP C;  4JEU A;  3L54 A;  3ZXS A;  1NA3 A;  3V79 K;  4CGV A;  2XZT G;  4GMR A;  3P1U A;  2WQ7 A;  3JQ0 A;  1LF8 A;  3I4G A;  2IQC A;  3UIP C;  4GTR A;  4CRW A;  1EYH A;  2X6I A;  4ANU A;  3IXE A;  2VSX E;  3CVL A;  5LCW C;  4JXT A;  5KBA A;  4A55 A;  4X8Q A;  2X6K A;  3URZ A;  2BKG A;  2QYU A;  4GMJ A;  4LUN U;  3HXD A;  4WWN A;  2J4B A;  4FHJ A;  5AYW D;  4YVQ C;  3DEP A;  1PAQ A;  3QAR A;  5CMW A;  2BED A;  5H7P A;  3LYA A;  4Q69 A;  3PE4 A;  4BFR A;  3NOG D;  1MX6 A;  1O1R A;  2X6F A;  4HQD A;  2PNN A;  4JHK A;  3ZXP A;  3HDX A;  3QOU A;  4YND A;  4HBD A;  4A1S A;  5JJT A;  3ISM C;  1AWC B;  1IHG A;  4E6H A;  1E7V A;  3ZRH A;  5AJD A;  4AXH A;  4M7C A;  4TRQ A;  2BTD A;  4CDR A;  4K0R A;  3CHS A;  1FT1 A;  1K1A A;  4BY6 A;  3S2A A;  3G2U A;  3ZKJ A;  1WY6 A;  1N0R A;  3S7B A;  4GAA A;  3B7S A;  4GCO A;  5D2M C;  4APO A;  2YQ8 A;  2WXO A;  2ZIS A;  3ZU7 B;  3E32 A;  3TWX A;  4AP2 A;  3BQO A;  1A5E A;  1P5Q A;  4HLE A;  4KYO B;  4I2W A;  2IO2 C;  1JCQ A;  3L6A A;  3RO3 A;  4OAV B;  3S7D A;  1Y6I A;  1JWF A;  4MRU A;  5EKQ D;  2DWZ A;  1DCE A;  3FUH A;  3UMV A;  4JD2 G;  4JZY A;  2OEW A;  2WXH A;  4HS2 A;  3CHP A;  3UIN C;  4EZK A;  2R02 A;  5EIL A;  5AN8 A;  3PZ1 A;  1WDY A;  5KJM A;  4KMO A;  2WB2 A;  3Q4A B;  4U8Y D;  2XRY A;  3SQV A;  1PY1 A;  1UN9 A;  4HFG A;  4I43 A;  1E8Y A;  3CVQ A;  2VGX A;  4K5A B;  1HFA A;  1NP7 A;  2XEN A;  2Q7F A;  3UIO C;  3VTY A;  4RG6 A;  4DX7 D;  3UTM A;  3AG1 E;  3BG1 B;  4CGW A;  3Q9N C;  3CQC B;  4B93 B;  2VGE A;  4AM9 A;  2OOE A;  5BV0 A;  1V55 E;  4G1T A;  4IUL A;  4HXI A;  1HF8 A;  5HI7 A;  4HOS A;  3Q79 A;  4U63 A;  3PZ4 A;  4JW1 A;  4EZL A;  3NQP A;  4K5B A;  3ZEF A;  3QDN A;  3J5Q B;  3MV3 B;  4Q94 A;  4AVX A;  5FQ8 A;  3FUL A;  4J8Y A;  4XKC A;  1Z5S C;  1TEZ A;  4Z68 A;  2OV8 A;  4DLO A;  1RW2 A;  3RU0 A;  2R17 C;  3LCA A;  2XGO A;  3PRE A;  1BU9 A;  4U95 D;  3QK0 A;  2GW1 A;  5CMY A;  3RSE G;  3DSW A;  2DZN A;  1TN7 A;  3I4R B;  5ENQ D;  1INZ A;  2A5E A;  2KAT A;  2QFC A;  3B7B A;  4MKT A;  4N3B A;  5EYP F;  1BI7 B;  3PZD A;  4O1P A;  4FJZ A;  4AIF A;  3CHR A;  4ZHB A;  5FWQ A;  2CFZ A;  3FEX A;  3CQG B;  3FEY A;  1ELK A;  2XEH A;  1XNF A;  5ENT D;  5AQ7 A;  4GTP A;  3HXE A;  5A7D B;  3ZW3 A;  2VSY A;  3JYS A;  2WM9 A;  4J0U A;  4BX9 A;  4PDX A;  4TV3 A;  5KJN A;  5CBO A;  2MHK A;  5EIB E;  3SNX A;  4BT8 A;  2ZGD A;  3P2B A;  4CT0 A;  5ENO D;  1L5J A;  5ENP D;  5FQ6 A;  3UM1 A;  3TWS A;  3O48 A;  4BER A;  1H6P A;  1X81 A;  3NBN B;  3QC1 A;  2Y1L E;  3SY2 A;  5B3S E;  1QYM A;  2XHE A;  4WUY A;  3C3O A;  4N5Q A;  2OND A;  1UJK A;  3APC A;  3HRA A;  1N4R A;  2QY7 A;  4U0U A;  2ETA A;  1HH8 A;  3L82 A;  3ESK A;  4PS8 A;  1IHB A;  2I6H A;  3VTX A;  4K03 A;  3ZNG A;  5FZS A;  3PH0 C;  2PZI A;  5KJL A;  3L22 A;  3DSS A;  5CEC B;  2X38 A;  4GA0 A;  4HLL A;  5J90 A;  4ABN A;  4FLB A;  2XS1 A;  4BES A;  2L0T B;  2FF4 A;  3CHM A;  3MJW A;  1BLX B;  4YDE A;  3JUI A;  1JUQ A;  1K1B A;  1TNO A;  2GRO B;  5HRY A;  3D9H A;  2BKK B;  3CHO A;  4N39 A;  3CVU A;  1JPL A;  4LG6 A;  1BD8 A;  4JA7 A;  2FEZ A;  2ETB A;  3Q7A A;  4GPK A;  1H19 A;  3ONK A;  2IU1 A;  5A23 A;  4F6R D;  4CT4 A;  3PE3 A;  2IOL A;  1IKN D;  2BF0 X;  3FUM A;  4UI9 J;  1N94 A;  1HX8 A;  3V30 A;  4N5C A;  1NZN A;  2FBN A;  4GYY A;  4OYS A;  5CHE E;  3RRM B;  5LFA A;  4RQI A;  3EHQ A;  4U96 D;  1N4Q A;  5EID A;  1FVF A;  2NSZ A;  3DSX A;  4RVB A;  1KT1 A;  4DK5 A;  3MZL B;  2Y4T A;  5BXO A;  3Q15 A;  1S0P A;  1HXI A;  2P9K G;  2JAB A;  4HOU A;  2FO1 E;  4PS7 A;  5ARF A;  1OWN A;  3RRU A;  5CRU A;  3ASN E;  2B0O E;  3LY7 A;  5KWD A;  2RKK A;  1SQM A;  4A3T A;  4OAU C;  4GTT A;  3LEW A;  5AQA A;  5FT9 A;  4GYO A;  5BW8 C;  4FAD A;  4D10 C;  5EX0 A;  1Z6T A;  4I9C A;  2VTB B;  4W9R A;  3FDH A;  2IEJ A;  4KZ0 A;  3EHR A;  4TXQ A;  3ZVV A;  1FVH A;  4UWF A;  3TXM A;  3HXB A;  2WQH A;  2JLB A;  3D9K A;  3UKU G;  2XPY A;  4UUC A;  4DX1 A;  4LSZ E;  3U9W A;  2EIJ E;  2KM4 A;  3HYM B;  3UQ3 A;  2AWI A;  2KBX A;  3DWL G;  1B89 A;  2NC9 A;  4HRM B;  4J8S A;  3PEV B;  4EPZ A;  4EBA G;  3FTZ A;  4HRL A;  4G8K A;  3QJZ A;  5BUZ A;  2MOW A;  2M63 A;  3FTX A;  3FH7 A;  3QKY A;  2XEE A;  4GPM A;  4C48 B;  1TNY A;  3PZ3 A;  2XEV A;  1ELW A;  4AJW A;  4HRN A;  5JJ6 A;  4U0S A;  2RFM A;  5BV1 A;  3E4B A;  2WPV A;  2KZT B;  5ENR D;  3SO8 A;  1NFI E;  2GRP B;  2KCK A;  3SFY A;  1K3Z D;  3AJI A;  5JHA A;  3GZS A;  2HE0 A;  4C0M A;  2CG3 A;  2Y3A A;  4TUM A;  2R05 A;  5G04 J;  4NQ0 A;  3QNK A;  1KZO A;  4G24 A;  5KJK A;  1X5B A;  3V2X A;  2P9P G;  3Q78 A;  2J8S D;  3VLF A;  2IJG X;  4I6G A;  4UWG A;  4QFV A;  3WG7 E;  5EN5 D;  5AEN A;  2HR2 A;  4CEM A;  3T5V A;  4AY5 A;  1N52 A;  3B7U X;  4QQI A;  2GRL A;  2XCB A;  2RG8 A;  2P9U G;  3EDT B;  3PEU B;  3B95 A;  4L2Y A;  3PUJ A;  2P2C P;  2H6I A;  4EBA A;  4I6E A;  4CDM A;  4CCA A;  4FJY A;  4ANW A;  3E37 A;  4FU3 A;  4F53 A;  4UQY A;  2E2E A;  3KEZ A;  3CKC A;  1EPU A;  4LRZ A;  3Q75 A;  2H6G A;  3KD7 A;  3DEO A;  4U0Z A;  2UY1 B;  4XIF A;  1OCR E;  1DNP A;  2WXK A;  5B1B E;  3GZ2 A;  5T3R A;  5BNW A;  2XRZ A;  3CK8 A;  4CDN A;  4XZ4 A;  2PM7 A;  1TNU A;  3MGB A;  3S7J A;  3Q49 B;  1UG3 A;  3JXI A;  4J7W A;  1QBQ A;  5JA4 D;  4K5C A;  5JHB A;  2A4Z A;  1MX4 A;  2P9S G;  3ZYQ A;  1NA0 A;  3TWU A;  2MYO A;  1FCH A;  4WNF A;  5E76 A;  2WXL A;  1PC2 A;  4O6F A;  4Y6W A;  3EIQ C;  2L9B A;  2QZA A;  2C0M A;  3R7R A;  2OVF A;  3IHY A;  3ZUV B;  2LSU A;  3UKR G;  2V5Q C;  3CK9 A;  3QWP A;  3ABL E;  3KSL A;  5FTP A;  1O1S A;  2I9C A;  2KZT A;  4GYW A;  3NF1 A;  2E0I A;  4NIK A;  4ACL A;  3ULE G;  3L17 A;  3SHF A;  4PUC A;  3U4T A;  3MA5 A;  3LDZ A;  3G2T A;  4NAC A;  3E30 A;  4MBG A;  2NXP A;  2YHC A;  4N3A A;  1TNB A;  3C5R A;  2HYZ A;  4XE0 A;  3IEG A;  4B89 A;  3NOC D;  3IKO B;  3OTN A;  1OWO A;  1KZP A;  4GB9 A;  1SVX A;  3FP3 A;  3ASG A;  3TG5 A;  4JEH A;  5CBN A;  3KS2 A;  5LOZ A;  3RJV A;  2Y4U A;  1V54 E;  3MCX A;  4AY6 A;  4F1P A;  2F37 A;  5B1A E;  4G2V A;  3FU0 A;  3AS8 A;  4KBQ A;  2J07 A;  3ASH A;  2LSV A;  4I1O B;  5ARG A;  2AJA A;  2ILR A;  3LJN A;  3CGH A;  4UQX A;  2OVB A;  4BSZ B;  4NUR A;  1N4P A;  3FUF A;  2XCC A;  4KVO A;  4TUU A;  2J4D A;  1BPO A;  2ZXW E;  3D9J A;  1LTX A;  4N2Q A;  5CER B;  1S64 A;  4Q96 A;  4JPS A;  1Q2Z A;  3O4Z A;  1H2T C;  2BUG A;  4PH4 B;  1MYO A;  5JJ7 A;  5T4Y A;  2QC9 A;  4Y6C A;  4GTQ A;  2R2L A;  3SBS A;  2UY1 A;  2WXJ A;  4XX5 A;  2VJ8 A;  1HE8 A;  2L0I A;  4UI9 C;  2GRQ B;  3L16 A;  5C2Y A;  3TJP A;  2I2O A;  3SI5 A;  3F6Q A;  3AG3 E;  3TWQ A;  3IBE A;  2ION A;  3LXU X;  4RLY A;  3IV0 A;  4A3V A;  4C9B B;  3UX4 A;  3EHM A;  4ME2 A;  1N95 A;  3ZHE B;  3PVL A;  3NZS A;  1G3N B;  3LJ3 A;  3ZYL A;  4YDO A;  5FQ7 A;  1S70 B;  2GRM A;  5D0Q D;  1FT2 A;  3CEQ A;  2FO7 A;  1YA0 A;  4GZ6 A;  3QWW A;  3RO2 A;  4G23 A;  2J08 A;  1RZ4 A;  2WXN A;  1MZC A;  2VSN A;  2VGY A;  1SA4 A;  4LER A;  4DI4 A;  2XGS A;  4JHJ A;  1SZ9 A;  5M72 A;  5ENN A;  4BWR A;  2CG2 A;  3RRN B;  2HM8 A;  3J5P A;  2I1J A;  5G55 A;  2A5U A;  3AS4 A;  4HOQ A;  4F1S A;  3QWV A;  4B8A A;  2XPI A;  1OCZ E;  3U66 A;  4BEP A;  2V5F A;  4HB5 A;  5CED B;  3GZ1 A;  5EX3 A;  3CVY A;  3C72 A;  1KPS B;  4C0E A;  4JB8 P;  5CEA A;  3WXX A;  1AP7 A;  2R5S A;  3R9M A;  3U64 A;  4JA9 A;  3G2W A;  3D9I A;  1JCS A;  3FUK A;  4FUL A;  2WXG A;  3ZYM A;  2XPZ A;  3VLE A;  4U8H A;  4EZJ A;  3T5X A;  1OWM A;  1FPP A;  5AAO A;  2PQN A;  3E34 A;  4L2L A;  3FUN A;  5BPP A;  2XQ0 A;  3ZPJ A;  2H6F A;  4XEI G;  3PRZ A;  3MKQ B;  1TJC A;  5FIO A;  2NYJ A;  3MV2 B;  3CKB A;  1HZ4 A;  3LKU A;  4WND A;  3EUV A;  3ENE A;  4BX8 A;  1LD7 A;  3D9O A;  4FC8 A;  4GTV A;  3EHN A;  5CRV A;  2WXM A;  3W9F A;  4TXP A;  3DXM G;  3FU6 A;  2AXV A;  5G04 C;  3Q47 B;  3SF4 A;  2EQX A;  1OUV A;  2CHZ A;  2XZD G;  1N54 A;  4XKB A;  3Q7F A;  4U07 A;  2WXF A;  1OWP A;  2V8S E;  2LXM A;  3ONL A;  3RKV A;  5G05 C;  2YHE A;  2CFU A;  3FTS A;  4ILH B;  1IQR A;  1UOH A;  1WM5 A;  4CYM D;  2LO6 A;  1QNF A;  3K9I A;  4HI9 A;  2IFU A;  4AEZ C;  3ESL A;  2J9Q A;  3D9M A;  5BXU A;  1BI8 B;  2DIW A;  3HXF A;  1TR4 A;  1XGW A;  4DPR A;  5FQ4 A;  1E96 B;  4F3V A;  1VDY A;  3AG4 E;  3ML9 A;  4AV7 A;  4YVO A;  4ANX A;  4LNB A;  5BT1 A;  3RAU A;  3W9G A;  3TAX A;  4ILI A;  4I9E A;  3MYV A;  1DCQ A;  4A1G A;  1H2V C;  3FTV A;  3EU9 A;  5A6C A;  2P58 C;  3ZHE A;  3AS5 A;  1OCC E;  2EIL E;  1HG2 A;  1KT0 A;  3ULY A;  5LP0 A;  1HU3 A;  3PZ2 A;  2KCL A;  3T9K A;  2ETC A;  2ZIR A;  3SBT B;  3TWR A;  2QYJ A;  2WXP A;  3CVX A;  5JMN D;  4KVM A;  4HOT A;  4J6I A;  4L9P A;  3UT7 A;  3PDN A;  3LVR E;  3ABK E;  3D9L A;  4FLH A;  3OAW A;  5ANL A;  2LUH A;  4BET A;  2C2L A;  5KNH D;  3NZU A;  3MEK A;  3UT8 A;  3TL5 A;  4H7Y A;  5G05 J;  3FWV A;  5HKP A;  4GTM A;  1N9A A;  2EIM E;  2MRI A;  4LCT A;  2DVW A;  2WMO A;  4O60 A;  1ZBP A;  4ANV A;  2H6H A;  3D9P A;  3UXG A;  2I1K A;  3TWW A;  1OY3 D;  1MQS A;  2GRN B;  2WXI A;  3U3W A;  4LNU D;  3SZ7 A;  3HXC A;  4GA1 A;  2PM6 A;  4H7X A;  3LY8 A;  2EIN E;  4FP7 A;  4FHK A;  4RG9 A;  3R9A B;  3ZFW A;  1HS6 A;  2GRR B;  4XI9 A;  4OVU A;  3MKQ A;  4YDY A;  2WMN A;  3DPY A;  5E75 A;  3JQ1 A;  3Q5M A;  2PQR A;  3KEA A;  5D66 A;  2VYI A;  3B7R L;  2X6J A;  4DUI A;  3NB2 A;  4G11 A;  1IXV A;  4U8V D;  1JWG A;  3RIB A;  1TJF A;  1NI1 A;  2DZO A;  3EIJ A;  4RSY A;  4JVS A;  4U04 A;  3ZIM A;  3B13 A;  2WXR A; 
#chains in the Genus database with same CATH homology
 4FLB A;  2AXZ A;  4LEU A;  3ML8 A;  4WNE A;  4G2V A;  3FU0 A;  4V3I A;  3AS8 A;  4BT9 A;  3G2V A;  2L0T B;  3CVW A;  3FUI A;  4N3C A;  2FF4 A;  2AW6 A;  1ELR A;  4UQZ A;  4GU5 A;  3CHM A;  3MJW A;  4KBQ A;  4WWO A;  2J07 A;  3L13 A;  3JUI A;  4R7L A;  2JEK A;  3ASH A;  2LSV A;  4I1O B;  5ARG A;  4KZC A;  3BEE A;  2ILR A;  1JUQ A;  2VTB A;  3FUE A;  3RK6 A;  3CGH A;  3CHO A;  4N39 A;  3AU4 A;  3CVU A;  4UQX A;  1JPL A;  4UWL A;  2WQ6 A;  2OVB A;  5T8I A;  1WAO 1;  2WVI A;  4I1M A;  3MKR A;  2L6J A;  1H2U A;  4IYP A;  3DPD A;  4JA7 A;  3PUK A;  4NUR A;  2FEZ A;  3G2S A;  3SD5 A;  4ATG A;  4GPK A;  3D3M A;  2YIN A;  3CIA A;  3C98 A;  1H19 A;  5DBK A;  3FUF A;  4ACK A;  4UWK A;  3KAE A;  2XCC A;  3N71 A;  3ONK A;  4KVO A;  2IU1 A;  3B7T A;  4TUU A;  2J4D A;  1BPO A;  5A23 A;  3HIZ A;  2VGX B;  2J49 A;  3UPV A;  4CT4 A;  5EDS A;  3D9J A;  3PE3 A;  4N2Q A;  2IOL A;  1KLX A;  3MX3 A;  4Q96 A;  1IQU A;  2BF0 X;  3I5P A;  3HVE B;  4JPS A;  3FUM A;  3O4Z A;  4WNG A;  1H2T C;  3FUD A;  4GZD A;  4UI9 J;  3IHV A;  1IYG A;  1HX8 A;  2BUG A;  4PH4 B;  5JJ7 A;  5J08 A;  5T4Y A;  4KT6 B;  1Y8M A;  4N5C A;  4Y6C A;  3EJN A;  1NZN A;  3SBS A;  4BSX A;  2UY1 A;  2FBN A;  4AOF A;  4GYY A;  4E85 A;  2WXJ A;  4OYS A;  5CHE E;  3RRM B;  4HVB A;  4XX5 A;  1SZA A;  5LFA A;  3APF A;  3PNT B;  4DJA A;  2VJ8 A;  1HE8 A;  2L0I A;  4JEU A;  3L54 A;  1FVF A;  4UI9 C;  1EDU A;  2NSZ A;  4RVB A;  3ZXS A;  5LCW J;  4MLP A;  1KT1 A;  2X6H A;  3L16 A;  4DK5 A;  5C2Y A;  1NA3 A;  1DVP A;  3MZL B;  2Y4T A;  4CGV A;  3TJP A;  3P1U A;  1S0P A;  3Q15 A;  3JQ0 A;  1HXI A;  2I2O A;  3PS6 A;  2WQ7 A;  1LF8 A;  3I4G A;  2IQC A;  2KC7 A;  3SI5 A;  4HOU A;  3CVV A;  1MHQ A;  4CRW A;  3ZGQ A;  1EYH A;  2X6I A;  3IBE A;  4ANU A;  2ION A;  2VSX E;  3CVL A;  3LXU X;  4PS7 A;  5ARF A;  5LCW C;  4JXT A;  3IV0 A;  4A55 A;  1OWN A;  4A3V A;  4I17 A;  2X6K A;  4KXK B;  3URZ A;  4C9B B;  3RRU A;  3UX4 A;  3EHM A;  4ME2 A;  3ZHE B;  3LY7 A;  3CSF A;  3PVL A;  4GA2 A;  4GMJ A;  1SQM A;  4A3T A;  4LUN U;  3LEW A;  4WWN A;  3NZS A;  5FT9 A;  3LJ3 A;  4GYO A;  2J4B A;  4FHJ A;  3FHE A;  5BW8 C;  4D10 C;  4BTB A;  4FAD A;  5EX0 A;  1Z6T A;  5AYW D;  3ZYL A;  5FQ7 A;  4I9C A;  2VTB B;  2GRM A;  5D0Q D;  4YVQ C;  3CEQ A;  2FO7 A;  1YA0 A;  2J09 A;  3FDH A;  4GZ6 A;  3QWW A;  4W9R A;  3RO2 A;  4EQF A;  1PAQ A;  4G23 A;  2J08 A;  4KZ0 A;  4APF A;  3QAR A;  5CMW A;  2VQ2 A;  3ZVV A;  1E8Z A;  4J8F A;  1FVH A;  3LYA A;  4Q69 A;  3PE4 A;  4BFR A;  2WXN A;  4GML A;  4UWF A;  1E7U A;  3TXM A;  2VSN A;  2VGY A;  3FY4 A;  4LER A;  4DI4 A;  2XGS A;  4JHJ A;  5LX8 A;  2X6F A;  2WQH A;  2JLB A;  1SZ9 A;  3D9K A;  5M72 A;  4JHK A;  3CVN A;  3HDX A;  5ENN A;  2XPY A;  4BWR A;  2CG2 A;  2HM8 A;  3QOU A;  2I1J A;  4JC8 A;  5G55 A;  2YNQ A;  4YND A;  3RRN B;  1E8W A;  2A5U A;  3U9W A;  3AS4 A;  4L1B A;  4HOQ A;  4L7T A;  4A1S A;  4F1S A;  1OWL A;  2KM4 A;  3HYM B;  3QWV A;  5JJT A;  3UQ3 A;  2AWI A;  1E8X A;  4B8A A;  3FH5 A;  4EEC A;  2XPI A;  1B89 A;  2NC9 A;  3U66 A;  1IHG A;  2V5F A;  4ILG A;  4E6H A;  1E7V A;  3ZRH A;  4J8S A;  3PEV B;  5AJD A;  4EPZ A;  4AXH A;  3GZ1 A;  4EBA G;  3FTZ A;  3CLJ A;  4TRQ A;  2BTD A;  5EX3 A;  3QJZ A;  5BUZ A;  3CVY A;  4CDR A;  4K0R A;  3CHS A;  2LNI A;  2MOW A;  2M63 A;  2GGF A;  3FTX A;  4C0E A;  3FH7 A;  3QKY A;  4G26 A;  4UWH A;  4BY6 A;  3WXX A;  2R5S A;  3S2A A;  2XEV A;  1ELW A;  3G2U A;  4AJW A;  3FTU A;  2V4L A;  1WY6 A;  5JJ6 A;  3U64 A;  4JA9 A;  5KCM A;  4U0S A;  5BV1 A;  4GZ3 A;  3E4B A;  3G2W A;  2WPV A;  4JL0 A;  3S7B A;  3D9I A;  4GAA A;  1W3B A;  3FUK A;  4FUL A;  4GCN A;  2KZT B;  3B7S A;  4GCO A;  2WXG A;  4APO A;  2YQ8 A;  3DBS A;  5J90 A;  2WXO A;  3FH8 A;  3ZYM A;  2XPZ A;  3VLE A;  4U8H A;  2KCK A;  3T5X A;  1OWM A;  4EZJ A;  1Z3Y A;  2PQN A;  2AXU A;  4L2L A;  3FUN A;  3GZS A;  4AP2 A;  5BPP A;  5FJY A;  2XQ0 A;  5JHA A;  4HOR A;  3ZPJ A;  1P5Q A;  1QQE A;  3MKQ B;  3PRZ A;  4I2Z A;  1TJC A;  3CR3 A;  4UI9 K;  3MV2 B;  4BTA A;  4C0M A;  2CG3 A;  3CKB A;  2Y3A A;  3CK7 A;  1HZ4 A;  3LKU A;  4KYO B;  4I2W A;  4HLE A;  2R59 A;  1GW6 A;  3CV0 A;  4WND A;  3L6A A;  5G04 J;  4NQ0 A;  3R7Q A;  3QNK A;  3ASF A;  2CHW A;  3ENE A;  4BX8 A;  3RO3 A;  4G24 A;  3S7D A;  3QB2 A;  4B8C B;  3D9O A;  1Y6I A;  1JWF A;  4MRU A;  5EKQ D;  5KJK A;  4FC8 A;  3CVP A;  3UMV A;  3FUH A;  1X5B A;  2XGM A;  3EHN A;  4JZY A;  2WXM A;  1U3D A;  3LY9 A;  2WXH A;  3ASD A;  3CHP A;  4HS2 A;  3FU6 A;  4EZK A;  2AXV A;  5G04 C;  3Q47 B;  3SF4 A;  5D0O D;  2EQX A;  2IF4 A;  3GYZ A;  3VLF A;  1OUV A;  2IJG X;  3VLD A;  2CHZ A;  4M3O A;  5CCM A;  1N54 A;  4I6G A;  4P29 A;  5KJM A;  4KMO A;  2WB2 A;  3Q4A B;  4XKB A;  2XRY A;  4UWG A;  4QFV A;  4U07 A;  3FFL A;  4OVV A;  4J8D A;  4DLQ A;  2HR2 A;  5AEN A;  4CEM A;  3T5V A;  4AY5 A;  4L23 A;  1PY1 A;  1UN9 A;  4PS3 A;  3CHQ A;  2WXF A;  1OWP A;  2V8S E;  4HFG A;  3ONL A;  4I43 A;  3APD A;  1E8Y A;  1N52 A;  3RKV A;  3B7U X;  3CVQ A;  2VGX A;  5G05 C;  4MS6 A;  1HFA A;  2YHE A;  1NP7 A;  2CFU A;  5HQ8 A;  3FTS A;  2GRL A;  2KCV A;  2Q7F A;  1QZ2 A;  2XCB A;  4ILH B;  1IQR A;  2RG8 A;  3HVE A;  3VTY A;  5AJL A;  4RG6 A;  3EDT B;  3PEU B;  3TG4 A;  3BG1 B;  4CGW A;  3PNL B;  1Z3X A;  5ANR A;  4L2Y A;  1U3C A;  1WM5 A;  3L08 A;  3CQC B;  2LO6 A;  3PUJ A;  4AM9 A;  1QNF A;  2OOE A;  3K9I A;  2FUL A;  5BV0 A;  2IFU A;  3GW4 A;  4G1T A;  4IUL A;  3ESL A;  1HF8 A;  4HXI A;  4AEZ C;  5HI7 A;  4HOS A;  2J9Q A;  4U63 A;  4GZ5 A;  4EBA A;  3D9M A;  4I6E A;  4CDM A;  4JW1 A;  4CCA A;  4WWP A;  4FJY A;  4ANW A;  4EZL A;  4JHR A;  2DIW A;  3NQP A;  3HHM A;  5G2N A;  4FU3 A;  4FA6 A;  4F53 A;  4UQY A;  3LVQ E;  2AVP A;  2E2E A;  3KEZ A;  3QDN A;  3ZEF A;  1XGW A;  1HG5 A;  1E90 A;  3MV3 B;  4DPR A;  4Q94 A;  5FQ4 A;  3CKC A;  1E96 B;  4AVX A;  4F3V A;  1VDY A;  1EPU A;  3OXF A;  4LRZ A;  3ML9 A;  5FQ8 A;  3ZYK A;  4AV7 A;  3KD7 A;  3FUL A;  4YVO A;  4ANX A;  5BT1 A;  3TAX A;  4ILI A;  3FU3 A;  4I1A A;  4XKC A;  4I9E A;  1UN8 A;  3MYV A;  4U0Z A;  4XI0 A;  2UY1 B;  4A1G A;  1H2V C;  5FZQ A;  4XIF A;  3FTV A;  1TEZ A;  2OV8 A;  5A6C A;  2LAH A;  4DLO A;  1DNP A;  2P58 C;  3FTW A;  2WXK A;  3GZ2 A;  4J8E A;  5T3R A;  5BNW A;  3ZHE A;  3AS5 A;  3UUX A;  3CK8 A;  2XRZ A;  3RU0 A;  4CDN A;  1HG2 A;  2DCP A;  2V0P A;  3D9N A;  4I6J A;  4XZ4 A;  5FZR A;  2PM7 A;  2ZU6 B;  5CCL A;  2R17 C;  3LCA A;  1KT0 A;  3SFZ A;  1H0A A;  3MGB A;  3S7J A;  5LP0 A;  1HU3 A;  4DI3 A;  2XGO A;  3Q49 B;  3FTY A;  1UG3 A;  2UWJ G;  4URK A;  2KCL A;  3PRE A;  2VSO E;  3QK0 A;  3SBT B;  2GW1 A;  3S7F A;  5CMY A;  2WXP A;  5JHB A;  3CVX A;  2A4Z A;  3I4R B;  4KVM A;  2C0L A;  1INZ A;  1A17 A;  2KAT A;  2X3M A;  4HOT A;  5AIJ A;  2QFC A;  3ZYQ A;  1NA0 A;  4MKT A;  4J6I A;  5DIZ A;  4N3B A;  3UT7 A;  3PDN A;  1FCH A;  4WNF A;  3PZD A;  5E76 A;  3SGH A;  1UJJ A;  4FJZ A;  3LVR E;  3TGO A;  4AIF A;  4IRU A;  2IOS A;  3CHR A;  3D9L A;  4FLH A;  3ULQ A;  5C1D A;  2WXL A;  2CFZ A;  3FEX A;  3OXL A;  5FWQ A;  3CQG B;  3FEY A;  3OAW A;  5ANL A;  1PC2 A;  3JCK C;  4O6F A;  1ELK A;  4Y6W A;  3FUJ A;  3EIQ C;  2L9B A;  2C2L A;  1XNF A;  3NZU A;  5A7D B;  3MEK A;  3ZW3 A;  3CST A;  2VSY A;  3UT8 A;  3JYS A;  3TL5 A;  2C0M A;  2WM9 A;  4J0U A;  3R7R A;  1EF1 C;  4BX9 A;  4H7Y A;  4PDX A;  4TV3 A;  2OVF A;  3IHY A;  5KJN A;  5G05 J;  2MHK A;  3OXG A;  2LSU A;  3SNX A;  3FWV A;  4BT8 A;  3LPZ A;  3CK9 A;  2MRI A;  3QWP A;  3P2B A;  4LCT A;  4CT0 A;  1L5J A;  2WMO A;  1ZBP A;  4ANV A;  5FTP A;  2PL2 A;  3D9P A;  3QAQ A;  3T8M A;  2I1K A;  1HO8 A;  4WAF A;  3ZIM A;  5FQ6 A;  2I9C A;  1MQS A;  2LAI A;  2WXI A;  3O48 A;  2KZT A;  4GZC A;  4IN3 B;  3U3W A;  3BG0 B;  3QC1 A;  4GYW A;  3SZ7 A;  4N2S A;  4GA1 A;  2PM6 A;  2DBA A;  4H7X A;  3LY8 A;  3NF1 A;  4B94 A;  2E0I A;  4FP7 A;  4FHK A;  4RG9 A;  3R9A B;  3ZFW A;  4ACL A;  1HS6 A;  2XHE A;  4XI9 A;  4WUY A;  3L17 A;  3SHF A;  4F7A A;  4OVU A;  3MKQ A;  4PUC A;  3FU5 A;  3U4T A;  2RD0 A;  3MA5 A;  3LDZ A;  3G2T A;  2WMN A;  4NAC A;  4NRH B;  2NXP A;  2OND A;  1UJK A;  2YHC A;  4N3A A;  2CHX A;  3APC A;  5E75 A;  2HO1 A;  2HYZ A;  3JQ1 A;  2QY7 A;  4XE0 A;  3Q5M A;  2PQR A;  4G25 A;  4U0U A;  3TXN A;  3IEG A;  4B89 A;  1HH8 A;  3ESK A;  4PS8 A;  3IKO B;  3OTN A;  3ZN3 A;  2VYI A;  1H6K A;  3B7R L;  1OWO A;  1UW4 B;  2X6J A;  2I6H A;  3VTX A;  2WXQ A;  2FI7 A;  3LS8 A;  3UT4 A;  4GB9 A;  3FP3 A;  3ASG A;  4G11 A;  4K03 A;  1JWG A;  3AU5 A;  1ZU2 A;  3TG5 A;  4JEH A;  5FZS A;  3PH0 C;  1TJF A;  3RIB A;  4B0Z A;  3I3N A;  3KS2 A;  5LOZ A;  3RJV A;  2PZI A;  2Y4U A;  3EIJ A;  4RSY A;  5KJL A;  4JVS A;  3L22 A;  3MCX A;  4AY6 A;  2X38 A;  4U04 A;  4GA0 A;  4ABN A;  3B13 A;  2WXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...