4ZFHA

Crystal structure of artificial ankyrin repeat protein_ank(gag)1d4 mutant -y56a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
ADLGKKLLEAARAGQDDEVRLLLEHGADVNARDSIGSTPLHLAAAYGHLEIVRLLLEHGADVNARDSTGTTPLHYAARLGHLEIVRLLLEHGADVNARDAMGWTPLHLAAKKGHLEIVRLLLKHGADVNANDHFGKTAFDISIDNGNEDLAEILQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Artificial ankyrin repeat protein_Ank(GAG)1D4 mutant -Y56A
publication title Crystal structure of Artificial ankyrin repeat protein_Ank(GAG)1D4 mutant- Y56A
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 55
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4zfhA00
5ENSD 1K1AA 4DRXE 2NYJA 2DWZA 4BSZB 3TWVA 1MX2A 2RFMA 2QYJA 3T8KA 5HS0A 3V31A 4DX1A 5CBOA 3C5RA 5KNGA 3V30A 3ZU7B 4BETA 2FO1E 1A5EA 4LG6A 3NOGD 1AWCB 3LJNA 1MX6A 3Q9UC 2BKGA 4HI9A 3TWSA 1QYMA 2HE0A 3D9HA 4J8YA 2BKKB 5CEAA 4HRMB 5ITZF 1DC2A 5ENTD 4J7WA 4YDWA 4GPMA 3B7BA 1SW6A 5AQ7A 4K5AB 3TWTA 3EHRA 3DEPA 2KXPC 1TR4A 1S70B 4GMRA 4K5BA 4U96D 5EN5D 4DX2A 5BXOA 5FINA 3W9GA 2ETCA 3JXJA 5CEDB 4QFVA 2DZOA 4U95D 1N11A 3B95A 3V2XA 5CBNA 2RFAA 1BU9A 1K3ZD 5JMND 1D9SA 4HQDA 1YCSB 5EYPF 3TWUA 5BXUA 3ZNGA 2QC9A 3HG0D 5FIOA 2ETAA 3AAAC 4U8YD 4BERA 1SVXA 2V5QC 1MX4A 2Y0BG 3ZKJA 4HB5A 4NIKA 4A63B 1YMPA 2J8SD 4ATZD 2DZNA 5EYLA 4CZ2D 3KEAA 3TWRA 2ETBA 3AJIA 3IXEA 5EIDA 3J5QB 5AQ9A 4DX6D 1WDYA 4OAUC 2L6BA 5AQBA 4Z68A 1BI8B 3Q9NC 4QQIA 4OAVB 5EILA 1K1BA 1WG0A 2JABA 5AQAA 3EHQA 1DCQA 5KNHD 2XEHA 2XZTG 1OT8A 4HBDA 4G8KA 5HKPA 1MJ0A 2MYOA 2P2CP 4DUIA 1IHBA 3UXGA 2XENA 4CYMD 2DVWA 2F8YA 5ENOD 3T9KA 4UUCA 5KBAA 4F1PA 4B93B 1BD8A 4O1PA 4YDYA 1OY3D 3TWQA 2ZGGA 3ZUVB 5D66A 1BI7B 2VGEA 5AN8A 4F6RD 3EU9A 4ZFHA 3SO8A 4O60A 2ZGDA 1MYOA 1YYHA 4LSZE 5JA4D 4O1OA 3V2OA 1AP7A 3J5PA 1IKND 1IXVA 1NFIE 3NOCD 4HI8A 4RLYA 3W9FA 3NBNB 1G3NB 4HRNA 3DEOA 4ZHBA 3F6QA 5ENPD 4LNUD 4C48B 2Y1LE 4BEPA 2V4HC 1N0QA 5HRYA 5AARA 2B0OE 4HLLA 3UTMA 3HRAA 2XEEA 4U8VD 2F37A 4JB8P 3TWXA 2AJAA 2F8XK 2XZDG 4N5QA 5CERB 2KBXA 1UOHA 3JXIA 4K5CA 4TUMA 5ENQD 5KWDA 4G8LA 4DX5D 5CECB 1N0RA 5AAOA 4HRLA 4DX7D 3V79K 3TWWA 2PNNA 3UI2A 4BESA 4HNAD 5ENRD 2A5EA 5EIBE 3JUEA 1BLXB
chains in the Genus database with same CATH superfamily
1K1AA 4BFRA 2WB2A 3DPDA 4AOFA 1INZA 3GZSA 4MLPA 4CRWA 4L2YA 4AM9A 1S64A 3FY4A 4GU5A 3VTYA 3ZIMA 2CG2A 2WMOA 3B7BA 2VSYA 1KT0A 1VDYA 4GPKA 4K5BA 4DX2A 4IRUA 3B95A 1N9AA 2H6IA 4BY6A 1D8DA 4PUCA 1TNBA 5FWQA 3R9AB 4A63B 3L13A 3ZHEB 3FUHA 3HIZA 3J5QB 4DX6D 1TN7A 4G1TA 4R7LA 2XGOA 3QARA 4ACKA 2MYOA 2P2CP 2DYSE 1E96B 5A7DB 3LEWA 3SFYA 2L6JA 3HXCA 3MGBA 2P9LG 3AG3E 3MCXA 2ZGGA 4FA6A 3CHPA 3D9NA 1YYHA 1HS6A 1TN6A 3PUKA 4UQYA 3U3WA 5D0OD 5HRYA 4FJYA 4LNBA 3L17A 3Q79A 3NZSA 3ABKE 3D9JA 2EIME 2XS8A 1OWNA 1FVFA 2RG8A 3ABLE 3JCKC 4U0SA 3SFZA 3ZYQA 1EYHA 3TWVA 3T8KA 3V31A 1U3DA 1EF1C 3KAEA 5A6CA 2EIJE 3MX3A 5AJLA 1UJJA 2BKGA 3ASDA 4HVBA 4YVQC 3LY7A 3E34A 2ZU6B 5ANLA 5JJTA 4I9CA 1K3ZD 3EJNA 5D2MC 1D9SA 3G2SA 4O6FA 4U8HA 4BERA 3QWVA 4N39A 2DZNA 3GZ2A 3VLDA 3E32A 1N4RA 4TV3A 3D3MA 2XGSA 3UPVA 1K1BA 3EHQA 3RSEG 1NL4A 4A3VA 3AS4A 3FUMA 4CGWA 3MKQA 3PZ4A 2FBNA 3JQ1A 3UXGA 2OV8A 5KBAA 5HQ8A 4B93B 4ACLA 1N4QA 5T8IA 3CHSA 5BT1A 1MQSA 4IN3B 4CCAA 2VGEA 1KPSB 3MA5A 5JJ7A 4JEHA 3VTXA 2HM8A 4XIFA 3APCA 4BEPA 3ASHA 3UTMA 3RAUA 3HRAA 5A23A 5EX3A 5KCMA 5ANRA 2YNQA 3I4RB 4GTMA 3JUEA 3RRUA 4N3CA 2VSNA 3ZXPA 2RKKA 2OOEA 2JEKA 2XS1A 2WQ6A 3D9HA 2MHKA 5T4YA 3UKRG 3JQ0A 4XI9A 4GTPA 3FUDA 4HORA 3DBSA 3LKUA 3CHRA 2QC9A 5FQ6A 4TXRA 1XGWA 4I17A 4J0UA 4XZ4A 2ETBA 2OEVA 4QQIA 5EILA 1UJKA 1WG0A 2GRPB 1DCEA 4FP7A 4DI4A 5LP0A 1IHBA 3UM3A 3U66A 4J8DA 3IKOB 1QQEA 1OUVA 1OCZE 3SNXA 2QZAA 4L1BA 2XCBA 5JA4D 3MKRA 3FU6A 2EIKE 2V4LA 3FEXA 4H7XA 3ASOE 2ILRA 3Q7AA 4G8LA 1N0RA 3V79K 2BTDA 4OVVA 5C2YA 1KZOA 1P5QA 4DRXE 2WXNA 3UT8A 2FEZA 1H2VC 2IO3C 5CBOA 3OXGA 3C5RA 1OWOA 2WQ7A 4LG6A 2IOLA 3SZ7A 3RRMB 1IHGA 2BKKB 5ITZF 4K03A 3ABME 2WXGA 1O1SA 4GZCA 4AY6A 3FP3A 3SHFA 2IQCA 3QOUA 3ZYKA 1JCSA 5G05C 3P1UA 3EHNA 3CQGB 5KJKA 3ZEFA 2A5UA 1UG3A 5B3SE 3UX4A 3I4GA 2EINE 1LTXA 3QWPA 3AG4E 3QJZA 3HHMA 4L9PA 5EYLA 3RK6A 3KEAA 5FZRA 3ASGA 4OAVB 3FTSA 2C0LA 4KVMA 3D9OA 5J90A 4WWOA 4G8KA 1X5BA 2DIWA 4A1SA 1N54A 4WUYA 4JEUA 2E2EA 3FUNA 3DSWA 4JA7A 1HE8A 3NOCD 4HS2A 2VGXA 2IU1A 3CVNA 2X6FA 4U8VD 2F37A 4OVUA 1V54E 2WM9A 4CEMA 4TUMA 1E8XA 2X6JA 1JWGA 3C3RA 2R02A 3HVEB 2HYZA 1V55E 2R2LA 2GROB 3HDXA 3FWVA 3BG1B 2DYRE 2E0IA 1DC2A 1OCCE 1OWLA 5KJMA 3CVQA 2GGFA 2I1JA 3VLFA 2KXPC 1TR4A 4U96D 4BT8A 5EDSA 3N71A 3G2UA 2CG3A 5B1AE 1YCSB 2VSXE 3FUJA 2IY0C 5J08A 3NF1A 4JD2G 3WXXA 4Q69A 4HLEA 3IBEA 4K0RA 5FQ8A 4U8YD 5FZQA 5ENNA 2QFCA 1YMPA 3S2AA 4ANWA 3KSQA 3L54A 2P9SG 3D9LA 4GB9A 4WNDA 2R5SA 3CK9A 1HG2A 4FLBA 5ENOD 5HI7A 1IQRA 3RJVA 4F1PA 4O1PA 2VGYA 2WXLA 1OY3D 2J09A 5G2NA 2R05A 3APDA 5JJ6A 4GA0A 2ZGDA 4RLYA 1EPUA 1U3CA 4A1GA 1NZNA 4C48B 2V4HC 3CHOA 4KT6B 1H6KA 2YINA 5KJNA 2UY1A 3NAWA 4HNAD 4I2WA 3B7UX 1BLXB 4N5CA 3OTNA 3FULA 2RFMA 1LD8A 1E8YA 1W3BA 2BEDA 4UWHA 1HU3A 1FPPA 4F1SA 3ZW3A 3Q75A 2LXMA 3ASFA 2FULA 2ZISA 2HE0A 1GW6A 3S7FA 3UIOC 3RO3A 3SF4A 3CVXA 3L08A 1Z3XA 3JXJA 2DZOA 3ZXSA 5CBNA 3U64A 4HQDA 1N95A 1WY6A 2GRMA 2I1KA 1WAO1 1JCRA 2IJGX 2J8SD 1TNOA 3QDNA 4ATGA 2YHEA 1WDYA 2GRLA 4N2QA 2XPZA 5G05J 1A17A 2LXLA 3PVLA 3FH7A 4G24A 3CEQA 3CVPA 2XENA 3T9KA 3QNKA 4AJWA 2VTBA 4FADA 1BI7B 2PQNA 3LS8A 3FUEA 4JL0A 1IKND 5BUZA 3S7BA 1HZ4A 3C3QA 3UINC 3PNTB 1KT1A 2XQ0A 2C2LA 2C0MA 3L6AA 4N5QA 2KBXA 3CGHA 3FU3A 3JXIA 3PZ2A 4LERA 1KLXA 3UI2A 4GA1A 3KSLA 5CHEE 4Q96A 3FHEA 2RD0A 4UWKA 3LJNA 4CGVA 2WXOA 3KEZA 4I9EA 4EQFA 5FTPA 2AW6A 5BV1A 1B89A 3ZHEA 5CEDB 5FINA 3SQVA 2EQXA 4F53A 4JC8A 2WQHA 5ARFA 1HH8A 2LNIA 4GZ3A 4RG6A 4G26A 3AAAC 1U2VG 1N52A 1HFAA 3IEGA 4AP2A 5EIDA 4B8CB 4GZ5A 4JPSA 2Y4UA 4UQZA 1MJ0A 4EHMA 3PEVB 1Y6IA 4FHKA 4IYPA 2IEJA 4JXTA 4KZ0A 3JUIA 4M7CA 1BD8A 4YDYA 5FQ4A 3FU0A 4NRHB 3EDTB 1TNYA 5T3RA 5CCMA 2P9NG 3TAXA 4PS7A 2NSZA 3S7DA 4O1OA 1TYQG 3E37A 2R17C 3FUIA 4ZHBA 5LCWC 1H19A 4UWGA 1IYGA 2WXRA 1N4SA 3TWXA 3BEEA 4K5CA 4AIFA 3TL5A 4EZKA 4DX7D 3GW4A 4YVOA 2CFUA 4HRMB 4MKTA 1ELWA 4XI0A 3PE3A 2L0TB 4P29A 5G04C 5AENA 3T5VA 4U0ZA 4YDWA 4GPMA 3R7QA 3TWTA 4GMRA 3ZGQA 4UI9C 4KVOA 4OYSA 4GA2A 3D9MA 1SA4A 2WXQA 2PZIA 2Y4TA 4TXPA 5EYPF 4EZJA 3HG0D 4Q94A 4W9RA 4KYOB 3ZKJA 4NIKA 2P58C 1JWFA 4BT9A 2P9IG 3RKVA 2QY7A 4OAUC 3Q9NC 4XX5A 4CDRA 3LCAA 2XZTG 2IOSA 4IULA 4LNGA 3JYSA 3SY2A 3ZYLA 1FT2A 4DK5A 3SBSA 3PDNA 1X81A 4ILGA 4FULA 3FTZA 2VQ2A 4B89A 5JHAA 2R59A 4HOSA 3DPYA 3MEKA 4LNUD 1ZB1A 2B0OE 3E33A 1DVPA 2CFZA 2H6FA 3QC1A 5ARGA 3CQCB 4DX5D 3TWWA 3DSTA 5LOZA 5KNGA 3ZU7B 3T8MA 2XCCA 1MX6A 4HOUA 4GAAA 3TWSA 1D8EA 2WXPA 2GW1A 2PM6A 4DLQA 1QBQA 3I5PA 1SW6A 2CHZA 4LCTA 3CHMA 4PH4B 4RG9A 1JPLA 4M3OA 4BTBA 5DBKA 3KD7A 4JZYA 2FI7A 4EBAG 5CRUA 5BXUA 2I6HA 5FIOA 2GRRB 3FDHA 2XGMA 4BX8A 3TG4A 4RQIA 3CSFA 3EU5A 5AIJA 4NURA 2GRNB 3BUAA 1OT8A 4H7YA 2XHEA 3ESLA 3R7RA 4I6EA 3PE4A 4ZFHA 3SO8A 3MV2B 4GTOA 4U7EB 1OWPA 2PM7A 1Y8MA 3PZ1A 5CCLA 1H0AA 4JHJA 5CRVA 2LAIA 1PY1A 2XPIA 3DXKG 3AU4A 4UQXA 2OEWA 1YA0A 5BNWA 3AU5A 3QKYA 5CMYA 1RW2A 4AXHA 4EECA 4KBQA 4WWNA 4ME2A 4B8AA 5LCWJ 3NOGD 4XEIG 2Q7FA 1NP7A 1IQUA 3GYZA 2J08A 3DEPA 1SZAA 2ETCA 4U95D 4J6IA 3HXFA 3ULYA 3UM2A 4KXKB 1SA5A 5JMND 3RU0A 3L22A 2AXZA 1TN8A 3ZNGA 1O1TA 3AG1E 3L9TA 3ZYMA 5G04J 4HOQA 4YDOA 5AQBA 3CVUA 3LXUX 2JABA 4UI9J 5M72A 3GZ1A 2HR2A 3PUJA 5HKPA 1UN9A 2DBAA 2DVWA 3RIBA 4WNGA 3Q73A 1IXVA 1NFIE 4E85A 3HVEA 1G3NB 1OCRE 3L82A 3DWLG 5B1BE 3B7TA 2Y1LE 2KM4A 4GTVA 4I1MA 1O1RA 2XZDG 5CERB 4G11A 5KWDA 4HRLA 3B7SA 3D9KA 3TJPA 4GYWA 1PAQA 2A5EA 2NXPA 2BF0X 2QYJA 4CT4A 4BETA 2WXIA 4C0MA 5CMWA 1AWCB 2KCLA 2WXHA 1EDUA 4WNFA 3NQPA 1H6PA 4BWRA 4XE0A 3ZRHA 3V2XA 4JHRA 3OXFA 3U4TA 5AYWD 4GMJA 4G2VA 4LRZA 3TWRA 1FVHA 3AG2E 2L6BA 4MRUA 1HX8A 4APFA 3PZDA 3PRZA 1N94A 5E75A 2B6CA 2J4BA 3FUFA 2VJ8A 4WWPA 1SZ9A 3BU8A 2PL2A 3FH5A 5D66A 2XRZA 2X6HA 3CLJA 3EU9A 4MS6A 3TXNA 1HG5A 1MHQA 2NC9A 4CT0A 3ULQA 2I2OA 3CK7A 2KCVA 3PH0C 2AJAA 3ISMC 2LUHA 2I9CA 4GZDA 5CECB 2AXUA 2CHWA 4L2LA 4YDEA 3E4BA 4U04A 3NB2A 1AP7A 3CVYA 3UIPC 4DPRA 4J8FA 3Q47B 5HS0A 4DX1A 2CHXA 3V30A 4N2SA 3ZPJA 1NI1A 4BX9A 4ANUA 3QK0A 5FJYA 1OCOE 3EHMA 3DSVA 3QWWA 3ZN3A 4CDMA 4PS3A 5AQ7A 4E6HA 2YQ8A 3KS2A 2FO1E 2LSUA 3FU5A 2IO2C 4NACA 4DLOA 4GYOA 2QYUA 2H6GA 1LF8A 5FT9A 4FLHA 2DCPA 2ETAA 3UUXA 1MX4A 4DJAA 2V0PA 3Q15A 3MYVA 3CR3A 1BI8B 2KC7A 5H7PA 1JCQA 4HBDA 2V5FA 4DUIA 3CHQA 3CVWA 3UM0A 4GZ6A 2LO6A 1TNUA 3FH8A 1OXJA 1E7VA 3TWQA 1ZU2A 3SD5A 3ZUVB 3ENEA 2R03A 3AS5A 2VYIA 2KZTB 3MKQB 3O48A 3NBNB 3F6QA 1HO8A 3SI5A 3C3OA 4I1OB 1QNFA 3TXMA 4JB8P 5LX8A 2LSVA 5AAOA 1H2UA 4BESA 2FF4A 5EIBE 2IF4A 1FCHA 4BSZB 3T5XA 3PEUB 3Q49B 4G23A 3PNLB 3Q4AB 1RZ4A 4ILIA 4EZLA 4GCOA 4JHKA 3FTUA 1NA0A 1E7UA 1TJFA 1WM5A 4UWLA 4K5AB 4HFGA 4RSYA 4I1AA 2WXMA 1E90A 1N11A 3OXLA 2KZTA 3ULEG 2UWJG 3E30A 4BTAA 3IV0A 2V5QC 3U9WA 3DXMG 3CSTA 4APOA 3APFA 3G2VA 1OWMA 4HOTA 3ML8A 3ESKA 5EKQD 3D9PA 4HXIA 4UUCA 3LY8A 2V8SE 1Z6TA 5AN8A 4EPZA 1PC2A 3FEYA 1MYOA 2AWIA 3LYAA 3WG7E 3DEOA 3FTYA 5ENPD 2KCKA 4L23A 5AJDA 2MRIA 4U0UA 5AARA 2L0IA 3SBTB 2GRQB 3UQ3A 4C0EA 2WPVA 3CV0A 3UKUG 4C9BB 4AY5A 2Y3AA 5ENRD 2IFUA 4PS8A 3MZLB 5KJLA 4TXQA 1BPOA 1UN8A 3BQOA 4JVSA 1E8ZA 4I6GA 2WXFA 2J07A 5D0QD 1ELRA 2P9UG 1QYMA 3HXDA 4A3TA 4J8YA 2OVFA 5ENTD 3TGOA 4J7WA 4GYYA 3NZUA 4KZCA 3EHRA 1S70B 5EN5D 2H6HA 4QFVA 4GTQA 2RFAA 1BU9A 2AVPA 4J8EA 4Y6CA 3B13A 3UT7A 5IY5E 1HXIA 3Q7FA 5C1DA 1SVXA 2PQRA 2Y0BG 2YHCA 3HYMB 4HB5A 4AVXA 2KATA 1ELKA 4XKCA 4D10C 1SQMA 4KMOA 3Q78A 4WAFA 3X2QE 1TJCA 1DCQA 3URZA 5EX0A 4V3IA 3DRAA 2LAHA 4GCNA 2P9PG 1Z5SC 2X3MA 4CYMD 2F8YA 4Y6WA 4ANVA 1K8KG 3HXBA 3CKCA 1S63A 2X38A 4JA9A 3CK8A 4AV7A 3LVQE 4EBAA 3O4ZA 2M63A 3FUKA 3V2OA 3J5PA 3I3NA 4HI8A 3W9FA 3PREA 1Q2ZA 1FT1A 2X6KA 3CVVA 4UI9K 4LEUA 3LJ3A 2F8XK 5ENQD 4X8QA 4B94A 2WXJA 3AS8A 2PNNA 2VGXB 3K9IA 3MJWA 4LUNU 4UWFA 2J49A 2XEVA 1N4PA 3C98A 2J4DA 1A5EA 3LVRE 4HI9A 4DI3A 4BSXA 3ASNE 2X6IA 5FZSA 3C72A 3G2TA 3SGHA 2WVIA 5BXOA 4B0ZA 5G55A 3W9GA 4XKBA 3MV3B 5JHBA 4A55A 4I43A 3FTWA 2P9KG 4GTTA 4WNEA 4FHJA 1DNPA 3ML9A 5AQ9A 3DSXA 3CVLA 3ZFWA 2ZIRA 4Z68A 4JW1A 2OCCE 1Z3YA 2JLBA 5AQAA 5KNHD 3RO2A 2J9QA 4GTSA 3Q5MA 4GMLA 3R9MA 1JUQA 1H2TC 2ONDA 2WXKA 2OVBA 3IHYA 5LFAA 4F6RD 3B7RL 3VLEA 4URKA 3BG0B 4NQ0A 4LSZE 3IHVA 3CKBA 2XPYA 1HF8A 4PDXA 4HLLA 3RRNB 5BPPA 3HXEA 4RVBA 5E76A 3EIQC 1QZ2A 5ENSD 2Y69E 1E8WA 2DWZA 2NYJA 4TUUA 1MX2A 3UMVA 4GTRA 4U07A 1KZPA 1ZBPA 1LD7A 2FO7A 3Q9UC 3DSSA 3QAQA 3TG5A 5CEAA 2UY1B 4FJZA 2VSOE 2MOWA 4F7AA 4CDNA 1UW4B 2WMNA 1NA3A 3L16A 1H6OA 1MZCA 1XNFA 2L9BA 4ILHB 1TEZA 4I2ZA 3SFXA 3TWUA 4U63A 4J8SA 4F3VA 1S0PA 3G2WA 3LY9A 4L7TA 4FC8A 5DIZA 4ATZD 2HO1A 2XRYA 4CZ2D 4YNDA 3AJIA 3IXEA 4I6JA 3P2BA 3DSUA 3S7JA 1TNZA 4N3AA 4FU3A 4MBGA 3UT4A 3EIJA 3ONKA 2XEHA 5FQ7A 3OAWA 4TRQA 3FFLA 2BUGA 5BW8C 4N3BA 2F0YA 3LPZA 3EUVA 1O5MA 4ANXA 2ZXWE 4O60A 3FTXA 3LDZA 2A4ZA 3UM1A 4ABNA 4HRNA 3PZ3A 4AEZC 2IONA 3CIAA 3ZVVA 3PS6A 1N0QA 2VTBB 2XEEA 5BV0A 1L5JA 1UOHA 4G25A 3D9IA 2EILE 2AXVA 3FTVA 3QB2A 3ONLA
chains in the Genus database with same CATH topology
5ENSD 1K1AA 4DRXE 2NYJA 2DWZA 4BSZB 3TWVA 1MX2A 2RFMA 2QYJA 3T8KA 5HS0A 3V31A 4DX1A 5CBOA 3C5RA 5KNGA 3V30A 3ZU7B 4BETA 2FO1E 1A5EA 4LG6A 3NOGD 1AWCB 3LJNA 1MX6A 3Q9UC 2BKGA 4HI9A 3TWSA 1QYMA 2HE0A 3D9HA 4J8YA 2BKKB 5CEAA 4HRMB 5ITZF 1DC2A 5ENTD 4J7WA 4YDWA 4GPMA 3B7BA 1SW6A 5AQ7A 4K5AB 3TWTA 3EHRA 3DEPA 2KXPC 1TR4A 1S70B 4GMRA 4K5BA 4U96D 5EN5D 4DX2A 5BXOA 5FINA 3W9GA 2ETCA 3JXJA 5CEDB 4QFVA 2DZOA 4U95D 1N11A 3B95A 3V2XA 5CBNA 2RFAA 1BU9A 1K3ZD 5JMND 1D9SA 4HQDA 1YCSB 5EYPF 3TWUA 5BXUA 3ZNGA 2QC9A 3HG0D 5FIOA 2ETAA 3AAAC 4U8YD 4BERA 1SVXA 2V5QC 1MX4A 2Y0BG 3ZKJA 4HB5A 4NIKA 4A63B 1YMPA 2J8SD 4ATZD 2DZNA 5EYLA 4CZ2D 3KEAA 3TWRA 2ETBA 3AJIA 3IXEA 5EIDA 3J5QB 5AQ9A 4DX6D 1WDYA 4OAUC 2L6BA 5AQBA 4Z68A 1BI8B 3Q9NC 4QQIA 4OAVB 5EILA 1K1BA 1WG0A 2JABA 5AQAA 3EHQA 1DCQA 5KNHD 2XEHA 2XZTG 1OT8A 4HBDA 4G8KA 5HKPA 1MJ0A 2MYOA 2P2CP 4DUIA 1IHBA 3UXGA 2XENA 4CYMD 2DVWA 2F8YA 5ENOD 3T9KA 4UUCA 5KBAA 4F1PA 4B93B 1BD8A 4O1PA 4YDYA 1OY3D 3TWQA 2ZGGA 3ZUVB 5D66A 1BI7B 2VGEA 5AN8A 4F6RD 3EU9A 4ZFHA 3SO8A 4O60A 2ZGDA 1MYOA 1YYHA 4LSZE 5JA4D 4O1OA 3V2OA 1AP7A 3J5PA 1IKND 1IXVA 1NFIE 3NOCD 4HI8A 4RLYA 3W9FA 3NBNB 1G3NB 4HRNA 3DEOA 4ZHBA 3F6QA 5ENPD 4LNUD 4C48B 2Y1LE 4BEPA 2V4HC 1N0QA 5HRYA 5AARA 2B0OE 4HLLA 3UTMA 3HRAA 2XEEA 4U8VD 2F37A 4JB8P 3TWXA 2AJAA 2F8XK 2XZDG 4N5QA 5CERB 2KBXA 1UOHA 3JXIA 4K5CA 4TUMA 5ENQD 5KWDA 4G8LA 4DX5D 5CECB 1N0RA 5AAOA 4HRLA 4DX7D 3V79K 3TWWA 2PNNA 3UI2A 4BESA 4HNAD 5ENRD 2A5EA 5EIBE 3JUEA 1BLXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENS D;  1K1A A;  4DRX E;  2NYJ A;  2DWZ A;  4BSZ B;  3TWV A;  1MX2 A;  2RFM A;  2QYJ A;  3T8K A;  5HS0 A;  3V31 A;  4DX1 A;  5CBO A;  3C5R A;  5KNG A;  3V30 A;  3ZU7 B;  4BET A;  2FO1 E;  1A5E A;  4LG6 A;  3NOG D;  1AWC B;  3LJN A;  1MX6 A;  3Q9U C;  2BKG A;  4HI9 A;  3TWS A;  1QYM A;  2HE0 A;  3D9H A;  4J8Y A;  2BKK B;  5CEA A;  4HRM B;  5ITZ F;  1DC2 A;  5ENT D;  4J7W A;  4YDW A;  4GPM A;  3B7B A;  1SW6 A;  5AQ7 A;  4K5A B;  3TWT A;  3EHR A;  3DEP A;  2KXP C;  1TR4 A;  1S70 B;  4GMR A;  4K5B A;  4U96 D;  5EN5 D;  4DX2 A;  5BXO A;  5FIN A;  3W9G A;  2ETC A;  3JXJ A;  5CED B;  4QFV A;  2DZO A;  4U95 D;  1N11 A;  3B95 A;  3V2X A;  5CBN A;  2RFA A;  1BU9 A;  1K3Z D;  5JMN D;  1D9S A;  4HQD A;  1YCS B;  5EYP F;  3TWU A;  5BXU A;  3ZNG A;  2QC9 A;  3HG0 D;  5FIO A;  2ETA A;  3AAA C;  4U8Y D;  4BER A;  1SVX A;  2V5Q C;  1MX4 A;  2Y0B G;  3ZKJ A;  4HB5 A;  4NIK A;  4A63 B;  1YMP A;  2J8S D;  4ATZ D;  2DZN A;  5EYL A;  4CZ2 D;  3KEA A;  3TWR A;  2ETB A;  3AJI A;  3IXE A;  5EID A;  3J5Q B;  5AQ9 A;  4DX6 D;  1WDY A;  4OAU C;  2L6B A;  5AQB A;  4Z68 A;  1BI8 B;  3Q9N C;  4QQI A;  4OAV B;  5EIL A;  1K1B A;  1WG0 A;  2JAB A;  5AQA A;  3EHQ A;  1DCQ A;  5KNH D;  2XEH A;  2XZT G;  1OT8 A;  4HBD A;  4G8K A;  5HKP A;  1MJ0 A;  2MYO A;  2P2C P;  4DUI A;  1IHB A;  3UXG A;  2XEN A;  4CYM D;  2DVW A;  2F8Y A;  5ENO D;  3T9K A;  4UUC A;  5KBA A;  4F1P A;  4B93 B;  1BD8 A;  4O1P A;  4YDY A;  1OY3 D;  3TWQ A;  2ZGG A;  3ZUV B;  5D66 A;  1BI7 B;  2VGE A;  5AN8 A;  4F6R D;  3EU9 A;  4ZFH A;  3SO8 A;  4O60 A;  2ZGD A;  1MYO A;  1YYH A;  4LSZ E;  5JA4 D;  4O1O A;  3V2O A;  1AP7 A;  3J5P A;  1IKN D;  1IXV A;  1NFI E;  3NOC D;  4HI8 A;  4RLY A;  3W9F A;  3NBN B;  1G3N B;  4HRN A;  3DEO A;  4ZHB A;  3F6Q A;  5ENP D;  4LNU D;  4C48 B;  2Y1L E;  4BEP A;  2V4H C;  1N0Q A;  5HRY A;  5AAR A;  2B0O E;  4HLL A;  3UTM A;  3HRA A;  2XEE A;  4U8V D;  2F37 A;  4JB8 P;  3TWX A;  2AJA A;  2F8X K;  2XZD G;  4N5Q A;  5CER B;  2KBX A;  1UOH A;  3JXI A;  4K5C A;  4TUM A;  5ENQ D;  5KWD A;  4G8L A;  4DX5 D;  5CEC B;  1N0R A;  5AAO A;  4HRL A;  4DX7 D;  3V79 K;  3TWW A;  2PNN A;  3UI2 A;  4BES A;  4HNA D;  5ENR D;  2A5E A;  5EIB E;  3JUE A;  1BLX B; 
#chains in the Genus database with same CATH topology
 1K1A A;  4BFR A;  2WB2 A;  3DPD A;  4AOF A;  1INZ A;  3GZS A;  4MLP A;  4CRW A;  4L2Y A;  4AM9 A;  1S64 A;  3FY4 A;  4GU5 A;  3VTY A;  3ZIM A;  2CG2 A;  2WMO A;  3B7B A;  2VSY A;  1KT0 A;  1VDY A;  4GPK A;  4K5B A;  4DX2 A;  4IRU A;  3B95 A;  1N9A A;  2H6I A;  4BY6 A;  1D8D A;  4PUC A;  1TNB A;  5FWQ A;  3R9A B;  4A63 B;  3L13 A;  3ZHE B;  3FUH A;  3HIZ A;  3J5Q B;  4DX6 D;  1TN7 A;  4G1T A;  4R7L A;  2XGO A;  3QAR A;  4ACK A;  2MYO A;  2P2C P;  2DYS E;  1E96 B;  5A7D B;  3LEW A;  3SFY A;  2L6J A;  3HXC A;  3MGB A;  2P9L G;  3AG3 E;  3MCX A;  2ZGG A;  4FA6 A;  3CHP A;  3D9N A;  1YYH A;  1HS6 A;  1TN6 A;  3PUK A;  4UQY A;  3U3W A;  5D0O D;  5HRY A;  4FJY A;  4LNB A;  3L17 A;  3Q79 A;  3NZS A;  3ABK E;  3D9J A;  2EIM E;  2XS8 A;  1OWN A;  1FVF A;  2RG8 A;  3ABL E;  3JCK C;  4U0S A;  3SFZ A;  3ZYQ A;  1EYH A;  3TWV A;  3T8K A;  3V31 A;  1U3D A;  1EF1 C;  3KAE A;  5A6C A;  2EIJ E;  3MX3 A;  5AJL A;  1UJJ A;  2BKG A;  3ASD A;  4HVB A;  4YVQ C;  3LY7 A;  3E34 A;  2ZU6 B;  5ANL A;  5JJT A;  4I9C A;  1K3Z D;  3EJN A;  5D2M C;  1D9S A;  3G2S A;  4O6F A;  4U8H A;  4BER A;  3QWV A;  4N39 A;  2DZN A;  3GZ2 A;  3VLD A;  3E32 A;  1N4R A;  4TV3 A;  3D3M A;  2XGS A;  3UPV A;  1K1B A;  3EHQ A;  3RSE G;  1NL4 A;  4A3V A;  3AS4 A;  3FUM A;  4CGW A;  3MKQ A;  3PZ4 A;  2FBN A;  3JQ1 A;  3UXG A;  2OV8 A;  5KBA A;  5HQ8 A;  4B93 B;  4ACL A;  1N4Q A;  5T8I A;  3CHS A;  5BT1 A;  1MQS A;  4IN3 B;  4CCA A;  2VGE A;  1KPS B;  3MA5 A;  5JJ7 A;  4JEH A;  3VTX A;  2HM8 A;  4XIF A;  3APC A;  4BEP A;  3ASH A;  3UTM A;  3RAU A;  3HRA A;  5A23 A;  5EX3 A;  5KCM A;  5ANR A;  2YNQ A;  3I4R B;  4GTM A;  3JUE A;  3RRU A;  4N3C A;  2VSN A;  3ZXP A;  2RKK A;  2OOE A;  2JEK A;  2XS1 A;  2WQ6 A;  3D9H A;  2MHK A;  5T4Y A;  3UKR G;  3JQ0 A;  4XI9 A;  4GTP A;  3FUD A;  4HOR A;  3DBS A;  3LKU A;  3CHR A;  2QC9 A;  5FQ6 A;  4TXR A;  1XGW A;  4I17 A;  4J0U A;  4XZ4 A;  2ETB A;  2OEV A;  4QQI A;  5EIL A;  1UJK A;  1WG0 A;  2GRP B;  1DCE A;  4FP7 A;  4DI4 A;  5LP0 A;  1IHB A;  3UM3 A;  3U66 A;  4J8D A;  3IKO B;  1QQE A;  1OUV A;  1OCZ E;  3SNX A;  2QZA A;  4L1B A;  2XCB A;  5JA4 D;  3MKR A;  3FU6 A;  2EIK E;  2V4L A;  3FEX A;  4H7X A;  3ASO E;  2ILR A;  3Q7A A;  4G8L A;  1N0R A;  3V79 K;  2BTD A;  4OVV A;  5C2Y A;  1KZO A;  1P5Q A;  4DRX E;  2WXN A;  3UT8 A;  2FEZ A;  1H2V C;  2IO3 C;  5CBO A;  3OXG A;  3C5R A;  1OWO A;  2WQ7 A;  4LG6 A;  2IOL A;  3SZ7 A;  3RRM B;  1IHG A;  2BKK B;  5ITZ F;  4K03 A;  3ABM E;  2WXG A;  1O1S A;  4GZC A;  4AY6 A;  3FP3 A;  3SHF A;  2IQC A;  3QOU A;  3ZYK A;  1JCS A;  5G05 C;  3P1U A;  3EHN A;  3CQG B;  5KJK A;  3ZEF A;  2A5U A;  1UG3 A;  5B3S E;  3UX4 A;  3I4G A;  2EIN E;  1LTX A;  3QWP A;  3AG4 E;  3QJZ A;  3HHM A;  4L9P A;  5EYL A;  3RK6 A;  3KEA A;  5FZR A;  3ASG A;  4OAV B;  3FTS A;  2C0L A;  4KVM A;  3D9O A;  5J90 A;  4WWO A;  4G8K A;  1X5B A;  2DIW A;  4A1S A;  1N54 A;  4WUY A;  4JEU A;  2E2E A;  3FUN A;  3DSW A;  4JA7 A;  1HE8 A;  3NOC D;  4HS2 A;  2VGX A;  2IU1 A;  3CVN A;  2X6F A;  4U8V D;  2F37 A;  4OVU A;  1V54 E;  2WM9 A;  4CEM A;  4TUM A;  1E8X A;  2X6J A;  1JWG A;  3C3R A;  2R02 A;  3HVE B;  2HYZ A;  1V55 E;  2R2L A;  2GRO B;  3HDX A;  3FWV A;  3BG1 B;  2DYR E;  2E0I A;  1DC2 A;  1OCC E;  1OWL A;  5KJM A;  3CVQ A;  2GGF A;  2I1J A;  3VLF A;  2KXP C;  1TR4 A;  4U96 D;  4BT8 A;  5EDS A;  3N71 A;  3G2U A;  2CG3 A;  5B1A E;  1YCS B;  2VSX E;  3FUJ A;  2IY0 C;  5J08 A;  3NF1 A;  4JD2 G;  3WXX A;  4Q69 A;  4HLE A;  3IBE A;  4K0R A;  5FQ8 A;  4U8Y D;  5FZQ A;  5ENN A;  2QFC A;  1YMP A;  3S2A A;  4ANW A;  3KSQ A;  3L54 A;  2P9S G;  3D9L A;  4GB9 A;  4WND A;  2R5S A;  3CK9 A;  1HG2 A;  4FLB A;  5ENO D;  5HI7 A;  1IQR A;  3RJV A;  4F1P A;  4O1P A;  2VGY A;  2WXL A;  1OY3 D;  2J09 A;  5G2N A;  2R05 A;  3APD A;  5JJ6 A;  4GA0 A;  2ZGD A;  4RLY A;  1EPU A;  1U3C A;  4A1G A;  1NZN A;  4C48 B;  2V4H C;  3CHO A;  4KT6 B;  1H6K A;  2YIN A;  5KJN A;  2UY1 A;  3NAW A;  4HNA D;  4I2W A;  3B7U X;  1BLX B;  4N5C A;  3OTN A;  3FUL A;  2RFM A;  1LD8 A;  1E8Y A;  1W3B A;  2BED A;  4UWH A;  1HU3 A;  1FPP A;  4F1S A;  3ZW3 A;  3Q75 A;  2LXM A;  3ASF A;  2FUL A;  2ZIS A;  2HE0 A;  1GW6 A;  3S7F A;  3UIO C;  3RO3 A;  3SF4 A;  3CVX A;  3L08 A;  1Z3X A;  3JXJ A;  2DZO A;  3ZXS A;  5CBN A;  3U64 A;  4HQD A;  1N95 A;  1WY6 A;  2GRM A;  2I1K A;  1WAO 1;  1JCR A;  2IJG X;  2J8S D;  1TNO A;  3QDN A;  4ATG A;  2YHE A;  1WDY A;  2GRL A;  4N2Q A;  2XPZ A;  5G05 J;  1A17 A;  2LXL A;  3PVL A;  3FH7 A;  4G24 A;  3CEQ A;  3CVP A;  2XEN A;  3T9K A;  3QNK A;  4AJW A;  2VTB A;  4FAD A;  1BI7 B;  2PQN A;  3LS8 A;  3FUE A;  4JL0 A;  1IKN D;  5BUZ A;  3S7B A;  1HZ4 A;  3C3Q A;  3UIN C;  3PNT B;  1KT1 A;  2XQ0 A;  2C2L A;  2C0M A;  3L6A A;  4N5Q A;  2KBX A;  3CGH A;  3FU3 A;  3JXI A;  3PZ2 A;  4LER A;  1KLX A;  3UI2 A;  4GA1 A;  3KSL A;  5CHE E;  4Q96 A;  3FHE A;  2RD0 A;  4UWK A;  3LJN A;  4CGV A;  2WXO A;  3KEZ A;  4I9E A;  4EQF A;  5FTP A;  2AW6 A;  5BV1 A;  1B89 A;  3ZHE A;  5CED B;  5FIN A;  3SQV A;  2EQX A;  4F53 A;  4JC8 A;  2WQH A;  5ARF A;  1HH8 A;  2LNI A;  4GZ3 A;  4RG6 A;  4G26 A;  3AAA C;  1U2V G;  1N52 A;  1HFA A;  3IEG A;  4AP2 A;  5EID A;  4B8C B;  4GZ5 A;  4JPS A;  2Y4U A;  4UQZ A;  1MJ0 A;  4EHM A;  3PEV B;  1Y6I A;  4FHK A;  4IYP A;  2IEJ A;  4JXT A;  4KZ0 A;  3JUI A;  4M7C A;  1BD8 A;  4YDY A;  5FQ4 A;  3FU0 A;  4NRH B;  3EDT B;  1TNY A;  5T3R A;  5CCM A;  2P9N G;  3TAX A;  4PS7 A;  2NSZ A;  3S7D A;  4O1O A;  1TYQ G;  3E37 A;  2R17 C;  3FUI A;  4ZHB A;  5LCW C;  1H19 A;  4UWG A;  1IYG A;  2WXR A;  1N4S A;  3TWX A;  3BEE A;  4K5C A;  4AIF A;  3TL5 A;  4EZK A;  4DX7 D;  3GW4 A;  4YVO A;  2CFU A;  4HRM B;  4MKT A;  1ELW A;  4XI0 A;  3PE3 A;  2L0T B;  4P29 A;  5G04 C;  5AEN A;  3T5V A;  4U0Z A;  4YDW A;  4GPM A;  3R7Q A;  3TWT A;  4GMR A;  3ZGQ A;  4UI9 C;  4KVO A;  4OYS A;  4GA2 A;  3D9M A;  1SA4 A;  2WXQ A;  2PZI A;  2Y4T A;  4TXP A;  5EYP F;  4EZJ A;  3HG0 D;  4Q94 A;  4W9R A;  4KYO B;  3ZKJ A;  4NIK A;  2P58 C;  1JWF A;  4BT9 A;  2P9I G;  3RKV A;  2QY7 A;  4OAU C;  3Q9N C;  4XX5 A;  4CDR A;  3LCA A;  2XZT G;  2IOS A;  4IUL A;  4LNG A;  3JYS A;  3SY2 A;  3ZYL A;  1FT2 A;  4DK5 A;  3SBS A;  3PDN A;  1X81 A;  4ILG A;  4FUL A;  3FTZ A;  2VQ2 A;  4B89 A;  5JHA A;  2R59 A;  4HOS A;  3DPY A;  3MEK A;  4LNU D;  1ZB1 A;  2B0O E;  3E33 A;  1DVP A;  2CFZ A;  2H6F A;  3QC1 A;  5ARG A;  3CQC B;  4DX5 D;  3TWW A;  3DST A;  5LOZ A;  5KNG A;  3ZU7 B;  3T8M A;  2XCC A;  1MX6 A;  4HOU A;  4GAA A;  3TWS A;  1D8E A;  2WXP A;  2GW1 A;  2PM6 A;  4DLQ A;  1QBQ A;  3I5P A;  1SW6 A;  2CHZ A;  4LCT A;  3CHM A;  4PH4 B;  4RG9 A;  1JPL A;  4M3O A;  4BTB A;  5DBK A;  3KD7 A;  4JZY A;  2FI7 A;  4EBA G;  5CRU A;  5BXU A;  2I6H A;  5FIO A;  2GRR B;  3FDH A;  2XGM A;  4BX8 A;  3TG4 A;  4RQI A;  3CSF A;  3EU5 A;  5AIJ A;  4NUR A;  2GRN B;  3BUA A;  1OT8 A;  4H7Y A;  2XHE A;  3ESL A;  3R7R A;  4I6E A;  3PE4 A;  4ZFH A;  3SO8 A;  3MV2 B;  4GTO A;  4U7E B;  1OWP A;  2PM7 A;  1Y8M A;  3PZ1 A;  5CCL A;  1H0A A;  4JHJ A;  5CRV A;  2LAI A;  1PY1 A;  2XPI A;  3DXK G;  3AU4 A;  4UQX A;  2OEW A;  1YA0 A;  5BNW A;  3AU5 A;  3QKY A;  5CMY A;  1RW2 A;  4AXH A;  4EEC A;  4KBQ A;  4WWN A;  4ME2 A;  4B8A A;  5LCW J;  3NOG D;  4XEI G;  2Q7F A;  1NP7 A;  1IQU A;  3GYZ A;  2J08 A;  3DEP A;  1SZA A;  2ETC A;  4U95 D;  4J6I A;  3HXF A;  3ULY A;  3UM2 A;  4KXK B;  1SA5 A;  5JMN D;  3RU0 A;  3L22 A;  2AXZ A;  1TN8 A;  3ZNG A;  1O1T A;  3AG1 E;  3L9T A;  3ZYM A;  5G04 J;  4HOQ A;  4YDO A;  5AQB A;  3CVU A;  3LXU X;  2JAB A;  4UI9 J;  5M72 A;  3GZ1 A;  2HR2 A;  3PUJ A;  5HKP A;  1UN9 A;  2DBA A;  2DVW A;  3RIB A;  4WNG A;  3Q73 A;  1IXV A;  1NFI E;  4E85 A;  3HVE A;  1G3N B;  1OCR E;  3L82 A;  3DWL G;  5B1B E;  3B7T A;  2Y1L E;  2KM4 A;  4GTV A;  4I1M A;  1O1R A;  2XZD G;  5CER B;  4G11 A;  5KWD A;  4HRL A;  3B7S A;  3D9K A;  3TJP A;  4GYW A;  1PAQ A;  2A5E A;  2NXP A;  2BF0 X;  2QYJ A;  4CT4 A;  4BET A;  2WXI A;  4C0M A;  5CMW A;  1AWC B;  2KCL A;  2WXH A;  1EDU A;  4WNF A;  3NQP A;  1H6P A;  4BWR A;  4XE0 A;  3ZRH A;  3V2X A;  4JHR A;  3OXF A;  3U4T A;  5AYW D;  4GMJ A;  4G2V A;  4LRZ A;  3TWR A;  1FVH A;  3AG2 E;  2L6B A;  4MRU A;  1HX8 A;  4APF A;  3PZD A;  3PRZ A;  1N94 A;  5E75 A;  2B6C A;  2J4B A;  3FUF A;  2VJ8 A;  4WWP A;  1SZ9 A;  3BU8 A;  2PL2 A;  3FH5 A;  5D66 A;  2XRZ A;  2X6H A;  3CLJ A;  3EU9 A;  4MS6 A;  3TXN A;  1HG5 A;  1MHQ A;  2NC9 A;  4CT0 A;  3ULQ A;  2I2O A;  3CK7 A;  2KCV A;  3PH0 C;  2AJA A;  3ISM C;  2LUH A;  2I9C A;  4GZD A;  5CEC B;  2AXU A;  2CHW A;  4L2L A;  4YDE A;  3E4B A;  4U04 A;  3NB2 A;  1AP7 A;  3CVY A;  3UIP C;  4DPR A;  4J8F A;  3Q47 B;  5HS0 A;  4DX1 A;  2CHX A;  3V30 A;  4N2S A;  3ZPJ A;  1NI1 A;  4BX9 A;  4ANU A;  3QK0 A;  5FJY A;  1OCO E;  3EHM A;  3DSV A;  3QWW A;  3ZN3 A;  4CDM A;  4PS3 A;  5AQ7 A;  4E6H A;  2YQ8 A;  3KS2 A;  2FO1 E;  2LSU A;  3FU5 A;  2IO2 C;  4NAC A;  4DLO A;  4GYO A;  2QYU A;  2H6G A;  1LF8 A;  5FT9 A;  4FLH A;  2DCP A;  2ETA A;  3UUX A;  1MX4 A;  4DJA A;  2V0P A;  3Q15 A;  3MYV A;  3CR3 A;  1BI8 B;  2KC7 A;  5H7P A;  1JCQ A;  4HBD A;  2V5F A;  4DUI A;  3CHQ A;  3CVW A;  3UM0 A;  4GZ6 A;  2LO6 A;  1TNU A;  3FH8 A;  1OXJ A;  1E7V A;  3TWQ A;  1ZU2 A;  3SD5 A;  3ZUV B;  3ENE A;  2R03 A;  3AS5 A;  2VYI A;  2KZT B;  3MKQ B;  3O48 A;  3NBN B;  3F6Q A;  1HO8 A;  3SI5 A;  3C3O A;  4I1O B;  1QNF A;  3TXM A;  4JB8 P;  5LX8 A;  2LSV A;  5AAO A;  1H2U A;  4BES A;  2FF4 A;  5EIB E;  2IF4 A;  1FCH A;  4BSZ B;  3T5X A;  3PEU B;  3Q49 B;  4G23 A;  3PNL B;  3Q4A B;  1RZ4 A;  4ILI A;  4EZL A;  4GCO A;  4JHK A;  3FTU A;  1NA0 A;  1E7U A;  1TJF A;  1WM5 A;  4UWL A;  4K5A B;  4HFG A;  4RSY A;  4I1A A;  2WXM A;  1E90 A;  1N11 A;  3OXL A;  2KZT A;  3ULE G;  2UWJ G;  3E30 A;  4BTA A;  3IV0 A;  2V5Q C;  3U9W A;  3DXM G;  3CST A;  4APO A;  3APF A;  3G2V A;  1OWM A;  4HOT A;  3ML8 A;  3ESK A;  5EKQ D;  3D9P A;  4HXI A;  4UUC A;  3LY8 A;  2V8S E;  1Z6T A;  5AN8 A;  4EPZ A;  1PC2 A;  3FEY A;  1MYO A;  2AWI A;  3LYA A;  3WG7 E;  3DEO A;  3FTY A;  5ENP D;  2KCK A;  4L23 A;  5AJD A;  2MRI A;  4U0U A;  5AAR A;  2L0I A;  3SBT B;  2GRQ B;  3UQ3 A;  4C0E A;  2WPV A;  3CV0 A;  3UKU G;  4C9B B;  4AY5 A;  2Y3A A;  5ENR D;  2IFU A;  4PS8 A;  3MZL B;  5KJL A;  4TXQ A;  1BPO A;  1UN8 A;  3BQO A;  4JVS A;  1E8Z A;  4I6G A;  2WXF A;  2J07 A;  5D0Q D;  1ELR A;  2P9U G;  1QYM A;  3HXD A;  4A3T A;  4J8Y A;  2OVF A;  5ENT D;  3TGO A;  4J7W A;  4GYY A;  3NZU A;  4KZC A;  3EHR A;  1S70 B;  5EN5 D;  2H6H A;  4QFV A;  4GTQ A;  2RFA A;  1BU9 A;  2AVP A;  4J8E A;  4Y6C A;  3B13 A;  3UT7 A;  5IY5 E;  1HXI A;  3Q7F A;  5C1D A;  1SVX A;  2PQR A;  2Y0B G;  2YHC A;  3HYM B;  4HB5 A;  4AVX A;  2KAT A;  1ELK A;  4XKC A;  4D10 C;  1SQM A;  4KMO A;  3Q78 A;  4WAF A;  3X2Q E;  1TJC A;  1DCQ A;  3URZ A;  5EX0 A;  4V3I A;  3DRA A;  2LAH A;  4GCN A;  2P9P G;  1Z5S C;  2X3M A;  4CYM D;  2F8Y A;  4Y6W A;  4ANV A;  1K8K G;  3HXB A;  3CKC A;  1S63 A;  2X38 A;  4JA9 A;  3CK8 A;  4AV7 A;  3LVQ E;  4EBA A;  3O4Z A;  2M63 A;  3FUK A;  3V2O A;  3J5P A;  3I3N A;  4HI8 A;  3W9F A;  3PRE A;  1Q2Z A;  1FT1 A;  2X6K A;  3CVV A;  4UI9 K;  4LEU A;  3LJ3 A;  2F8X K;  5ENQ D;  4X8Q A;  4B94 A;  2WXJ A;  3AS8 A;  2PNN A;  2VGX B;  3K9I A;  3MJW A;  4LUN U;  4UWF A;  2J49 A;  2XEV A;  1N4P A;  3C98 A;  2J4D A;  1A5E A;  3LVR E;  4HI9 A;  4DI3 A;  4BSX A;  3ASN E;  2X6I A;  5FZS A;  3C72 A;  3G2T A;  3SGH A;  2WVI A;  5BXO A;  4B0Z A;  5G55 A;  3W9G A;  4XKB A;  3MV3 B;  5JHB A;  4A55 A;  4I43 A;  3FTW A;  2P9K G;  4GTT A;  4WNE A;  4FHJ A;  1DNP A;  3ML9 A;  5AQ9 A;  3DSX A;  3CVL A;  3ZFW A;  2ZIR A;  4Z68 A;  4JW1 A;  2OCC E;  1Z3Y A;  2JLB A;  5AQA A;  5KNH D;  3RO2 A;  2J9Q A;  4GTS A;  3Q5M A;  4GML A;  3R9M A;  1JUQ A;  1H2T C;  2OND A;  2WXK A;  2OVB A;  3IHY A;  5LFA A;  4F6R D;  3B7R L;  3VLE A;  4URK A;  3BG0 B;  4NQ0 A;  4LSZ E;  3IHV A;  3CKB A;  2XPY A;  1HF8 A;  4PDX A;  4HLL A;  3RRN B;  5BPP A;  3HXE A;  4RVB A;  5E76 A;  3EIQ C;  1QZ2 A;  5ENS D;  2Y69 E;  1E8W A;  2DWZ A;  2NYJ A;  4TUU A;  1MX2 A;  3UMV A;  4GTR A;  4U07 A;  1KZP A;  1ZBP A;  1LD7 A;  2FO7 A;  3Q9U C;  3DSS A;  3QAQ A;  3TG5 A;  5CEA A;  2UY1 B;  4FJZ A;  2VSO E;  2MOW A;  4F7A A;  4CDN A;  1UW4 B;  2WMN A;  1NA3 A;  3L16 A;  1H6O A;  1MZC A;  1XNF A;  2L9B A;  4ILH B;  1TEZ A;  4I2Z A;  3SFX A;  3TWU A;  4U63 A;  4J8S A;  4F3V A;  1S0P A;  3G2W A;  3LY9 A;  4L7T A;  4FC8 A;  5DIZ A;  4ATZ D;  2HO1 A;  2XRY A;  4CZ2 D;  4YND A;  3AJI A;  3IXE A;  4I6J A;  3P2B A;  3DSU A;  3S7J A;  1TNZ A;  4N3A A;  4FU3 A;  4MBG A;  3UT4 A;  3EIJ A;  3ONK A;  2XEH A;  5FQ7 A;  3OAW A;  4TRQ A;  3FFL A;  2BUG A;  5BW8 C;  4N3B A;  2F0Y A;  3LPZ A;  3EUV A;  1O5M A;  4ANX A;  2ZXW E;  4O60 A;  3FTX A;  3LDZ A;  2A4Z A;  3UM1 A;  4ABN A;  4HRN A;  3PZ3 A;  4AEZ C;  2ION A;  3CIA A;  3ZVV A;  3PS6 A;  1N0Q A;  2VTB B;  2XEE A;  5BV0 A;  1L5J A;  1UOH A;  4G25 A;  3D9I A;  2EIL E;  2AXV A;  3FTV A;  3QB2 A;  3ONL A; 
#chains in the Genus database with same CATH homology
 5ENS D;  1K1A A;  4DRX E;  2NYJ A;  2DWZ A;  4BSZ B;  3TWV A;  1MX2 A;  2RFM A;  2QYJ A;  3T8K A;  5HS0 A;  3V31 A;  4DX1 A;  5CBO A;  3C5R A;  5KNG A;  3V30 A;  3ZU7 B;  4BET A;  2FO1 E;  1A5E A;  4LG6 A;  3NOG D;  1AWC B;  3LJN A;  1MX6 A;  3Q9U C;  2BKG A;  4HI9 A;  3TWS A;  1QYM A;  2HE0 A;  3D9H A;  4J8Y A;  2BKK B;  5CEA A;  4HRM B;  5ITZ F;  1DC2 A;  5ENT D;  4J7W A;  4YDW A;  4GPM A;  3B7B A;  1SW6 A;  5AQ7 A;  4K5A B;  3TWT A;  3EHR A;  3DEP A;  2KXP C;  1TR4 A;  1S70 B;  4GMR A;  4K5B A;  4U96 D;  5EN5 D;  4DX2 A;  5BXO A;  5FIN A;  3W9G A;  2ETC A;  3JXJ A;  5CED B;  4QFV A;  2DZO A;  4U95 D;  1N11 A;  3B95 A;  3V2X A;  5CBN A;  2RFA A;  1BU9 A;  1K3Z D;  5JMN D;  1D9S A;  4HQD A;  1YCS B;  5EYP F;  3TWU A;  5BXU A;  3ZNG A;  2QC9 A;  3HG0 D;  5FIO A;  2ETA A;  3AAA C;  4U8Y D;  4BER A;  1SVX A;  2V5Q C;  1MX4 A;  2Y0B G;  3ZKJ A;  4HB5 A;  4NIK A;  4A63 B;  1YMP A;  2J8S D;  4ATZ D;  2DZN A;  5EYL A;  4CZ2 D;  3KEA A;  3TWR A;  2ETB A;  3AJI A;  3IXE A;  5EID A;  3J5Q B;  5AQ9 A;  4DX6 D;  1WDY A;  4OAU C;  2L6B A;  5AQB A;  4Z68 A;  1BI8 B;  3Q9N C;  4QQI A;  4OAV B;  5EIL A;  1K1B A;  1WG0 A;  2JAB A;  5AQA A;  3EHQ A;  1DCQ A;  5KNH D;  2XEH A;  2XZT G;  1OT8 A;  4HBD A;  4G8K A;  5HKP A;  1MJ0 A;  2MYO A;  2P2C P;  4DUI A;  1IHB A;  3UXG A;  2XEN A;  4CYM D;  2DVW A;  2F8Y A;  5ENO D;  3T9K A;  4UUC A;  5KBA A;  4F1P A;  4B93 B;  1BD8 A;  4O1P A;  4YDY A;  1OY3 D;  3TWQ A;  2ZGG A;  3ZUV B;  5D66 A;  1BI7 B;  2VGE A;  5AN8 A;  4F6R D;  3EU9 A;  4ZFH A;  3SO8 A;  4O60 A;  2ZGD A;  1MYO A;  1YYH A;  4LSZ E;  5JA4 D;  4O1O A;  3V2O A;  1AP7 A;  3J5P A;  1IKN D;  1IXV A;  1NFI E;  3NOC D;  4HI8 A;  4RLY A;  3W9F A;  3NBN B;  1G3N B;  4HRN A;  3DEO A;  4ZHB A;  3F6Q A;  5ENP D;  4LNU D;  4C48 B;  2Y1L E;  4BEP A;  2V4H C;  1N0Q A;  5HRY A;  5AAR A;  2B0O E;  4HLL A;  3UTM A;  3HRA A;  2XEE A;  4U8V D;  2F37 A;  4JB8 P;  3TWX A;  2AJA A;  2F8X K;  2XZD G;  4N5Q A;  5CER B;  2KBX A;  1UOH A;  3JXI A;  4K5C A;  4TUM A;  5ENQ D;  5KWD A;  4G8L A;  4DX5 D;  5CEC B;  1N0R A;  5AAO A;  4HRL A;  4DX7 D;  3V79 K;  3TWW A;  2PNN A;  3UI2 A;  4BES A;  4HNA D;  5ENR D;  2A5E A;  5EIB E;  3JUE A;  1BLX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...