4ZFHA

Crystal structure of artificial ankyrin repeat protein_ank(gag)1d4 mutant -y56a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
ADLGKKLLEAARAGQDDEVRLLLEHGADVNARDSIGSTPLHLAAAYGHLEIVRLLLEHGADVNARDSTGTTPLHYAARLGHLEIVRLLLEHGADVNARDAMGWTPLHLAAKKGHLEIVRLLLKHGADVNANDHFGKTAFDISIDNGNEDLAEILQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Artificial ankyrin repeat protein_Ank(GAG)1D4 mutant- Y56A
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Artificial ankyrin repeat protein_Ank(GAG)1D4 mutant -Y56A
total genus 55
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4zfhA00
5ENPD 1A5EA 1SVXA 2HE0A 5ITZF 4LSZE 5KBAA 3C5RA 3UTMA 1DCQA 2QC9A 3KEAA 4U8VD 1BU9A 3T8KA 1AWCB 3V2OA 4J7WA 4C48B 4Z68A 4K5BA 1NFIE 4G8LA 3F6QA 2DVWA 2DZNA 2NYJA 4HNAD 4J8YA 5HRYA 4HI8A 4LG6A 4DX2A 1BI7B 4ZHBA 3NOCD 1BD8A 5CBNA 5EYPF 1AP7A 4UUCA 5FINA 2MYOA 5ENTD 5ENSD 2VGEA 5EYLA 4A63B 4BEPA 1IKND 4HBDA 3TWUA 4OAVB 4O1PA 4RLYA 3TWXA 2J8SD 3TWVA 1MYOA 4BETA 4DX5D 2RFAA 2V5QC 4HRMB 4QQIA 1MX6A 2F37A 2XZTG 4K5CA 4K5AB 4QFVA 4YDWA 3UI2A 4B93B 4O60A 4BERA 2B0OE 1IXVA 1BI8B 4HRNA 1MX2A 4DX6D 2XEEA 3V30A 4HQDA 4CZ2D 2BKGA 1N0RA 5CECB 5KNHD 3NOGD 2BKKB 4DRXE 5CEDB 2DZOA 3Q9UC 3HRAA 5AQ7A 4DX7D 4HLLA 3W9GA 3EU9A 4O1OA 3B95A 5JMND 4GPMA 2ETAA 4F6RD 2ZGGA 5KWDA 4U8YD 2KXPC 5JA4D 4GMRA 5HS0A 2V4HC 3NBNB 4ZFHA 3V31A 4JB8P 4N5QA 1WDYA 3AAAC 5AARA 3IXEA 2Y1LE 5EILA 5ENQD 4HRLA 1DC2A 3Q9NC 1BLXB 3T9KA 3ZKJA 1SW6A 5FIOA 3V79K 4OAUC 3JUEA 1WG0A 2Y0BG 2FO1E 5CBOA 5EIDA 5EIBE 2RFMA 3SO8A 3UXGA 1YMPA 2XENA 4YDYA 5CEAA 3TWSA 5CERB 1K3ZD 1MX4A 4TUMA 3ZUVB 4CYMD 2P2CP 3DEPA 2F8XK 3DEOA 5AQBA 2L6BA 4HI9A 5ENOD 3V2XA 1K1BA 4DUIA 4ATZD 1OT8A 1YCSB 3ZU7B 2JABA 1YYHA 2F8YA 4U96D 3ZNGA 3EHQA 3EHRA 4G8KA 4NIKA 5BXUA 1N11A 3AJIA 1N0QA 3TWQA 3HG0D 2ETBA 1IHBA 5AN8A 5ENRD 2A5EA 1D9SA 3W9FA 1S70B 3J5QB 2XEHA 3TWWA 4HB5A 4LNUD 2PNNA 3J5PA 3JXJA 3JXIA 5AQAA 5KNGA 5HKPA 3TWTA 3D9HA 2DWZA 2XZDG 1QYMA 5BXOA 2ETCA 1G3NB 3TWRA 4BSZB 2ZGDA 5EN5D 5AQ9A 3LJNA 1UOHA 1TR4A 1MJ0A 5D66A 1OY3D 2AJAA 1K1AA 5AAOA 4DX1A 4U95D 4BESA 4F1PA 2KBXA 3B7BA 2QYJA
chains in the Genus database with same CATH superfamily
3D9KA 2FBNA 2KZTA 2WM9A 2WMOA 3KEAA 4N2SA 4G8LA 3UPVA 4KMOA 2I2OA 3AS5A 1TN8A 4B8CB 4KYOB 3TL5A 2VSNA 1BI8B 3APDA 3CHQA 2J07A 3APCA 3CHPA 1FVHA 4RSYA 5BV0A 3R7RA 1KZPA 3QAQA 4I17A 4FC8A 1LD7A 3UIOC 4Y6CA 4DK5A 3MV3B 4A3VA 2HR2A 4UWFA 4ACLA 5FJYA 3PUJA 2QYUA 3AG3E 1N4SA 3PNTB 3Q15A 2NC9A 3Q4AB 5FIOA 3EDTB 3VLEA 1OWOA 1WG0A 1N4QA 2EQXA 3RIBA 1A17A 2ZIRA 2V5FA 3KSQA 3FP3A 1O1TA 1LTXA 4FP7A 4OVUA 2L6BA 5JJTA 4KVMA 2GW1A 3R9AB 3EHQA 3CKBA 3FUEA 3D9MA 4WAFA 3CGHA 2PNNA 2XS8A 1PY1A 3E34A 4WUYA 1Y8MA 3MEKA 3D9LA 5D66A 1MJ0A 2KCKA 3FU0A 4F1PA 2KBXA 1X81A 2WQ6A 3DSSA 3V2OA 3FU6A 4JEUA 3HVEB 2KATA 3FTXA 4ZHBA 1QBQA 2WXJA 4I9EA 4RLYA 4CT0A 4B89A 4YDWA 3KS2A 3ULQA 3JYSA 4YDEA 3UM0A 3Q49B 3FDHA 3LEWA 4K03A 1XNFA 3Q9UC 5FT9A 2VYIA 3CQGB 3Q79A 5LP0A 4R7LA 4O1OA 3SBTB 4GPMA 1NI1A 2DCPA 4U8YD 2KXPC 5JA4D 3E32A 3QOUA 4J8FA 3EHMA 4L23A 2Y0BG 2R5SA 4Q96A 3TG4A 1UN8A 5CERB 1N94A 4JC8A 2P9NG 1TNOA 3FFLA 3NB2A 5C1DA 2VGYA 3D9NA 3TWQA 1Q2ZA 4U63A 1TYQG 2R05A 5A23A 1NZNA 3PNLB 1UJKA 1BPOA 1RZ4A 1V55E 5KJLA 2LAHA 5FZSA 4RVBA 3LCAA 3FTSA 3X2QE 3ONLA 4GTTA 3HHMA 4M7CA 4XI0A 5T3RA 5J90A 4BTAA 4U7EB 1N4PA 4JW1A 4UUCA 4A63B 2J09A 4O1PA 4TRQA 5BPPA 4QQIA 4GPKA 1MX6A 2XEVA 4PDXA 1HO8A 2IU1A 2CG2A 3CEQA 1IQUA 4MLPA 4KVOA 2F0YA 3AG2E 3ZVVA 3ULYA 4YVQC 4F1SA 2AXZA 3CKCA 3BQOA 2MOWA 2XCCA 1UG3A 4GTRA 4UI9J 3MCXA 3E33A 3SZ7A 4FHKA 4EZJA 4A55A 3NAWA 3ZEFA 3CVQA 3TWSA 1K3ZD 3ML8A 3SD5A 4N2QA 4I9CA 4GA1A 4IN3B 3G2SA 3CHOA 4U8HA 5KJKA 3RRNB 3WXXA 4CCAA 4G8KA 1DCEA 5BXUA 1S63A 2XGMA 4IULA 5LX8A 3FY4A 1E96B 2DWZA 3KAEA 3FH7A 3RSEG 1LD8A 2ONDA 4RG9A 2J49A 1O1RA 1MZCA 3BUAA 3CR3A 4BX9A 5AIJA 2CHXA 3PRZA 1UN9A 3FEXA 1BU9A 4GYOA 3T8KA 4TXQA 2P9PG 2WQHA 2LSVA 4HRMB 3S7BA 2DIWA 1MX2A 2Y69E 4BX8A 4B0ZA 4HQDA 4UI9K 2H6FA 2PQNA 4ANWA 4WNGA 3ZIMA 3AS4A 2ETAA 3UIPC 3Q78A 2VGXA 3D9IA 3LJ3A 3ZHEA 3P1UA 3I3NA 3V31A 3R9MA 2Y1LE 5ANRA 3L16A 2XQ0A 4J8EA 4YVOA 4U0UA 3EJNA 2DYSE 3PS6A 3ZNGA 5ARFA 5FQ4A 4MRUA 1E7UA 1D9SA 2CHZA 5B1BE 2L6JA 1EF1C 3D9HA 1W3BA 1IYGA 2ZGDA 3FH5A 3DBSA 3ZYKA 4GMLA 2I1JA 3TAXA 5CMWA 1AWCB 4C48B 4CDRA 1NFIE 4IYPA 1JPLA 4N3BA 4XE0A 2VGEA 5EYLA 2ILRA 2XGSA 1EYHA 1E8ZA 4JZYA 4UWHA 3FHEA 4GU5A 1OCOE 2BUGA 3IEGA 4FJYA 1KT1A 3MX3A 1MQSA 3IHVA 4UQXA 1E90A 3QDNA 3Q9NC 5E75A 4J8DA 3SO8A 3FTVA 1YMPA 3QB2A 1NP7A 3R7QA 1H6PA 2WXHA 1OWNA 2HO1A 4WWPA 4EECA 5JJ6A 4GZ6A 4WNFA 3U3WA 4GMJA 4YDOA 2UY1B 3CHSA 3PZ4A 2ETBA 2P9LG 5HI7A 2XEHA 3ASOE 4CGVA 5AQAA 4G25A 2XZDG 3ABKE 4ILGA 1L5JA 3IBEA 5EKQD 4FULA 2P9SG 3I5PA 2AJAA 1FCHA 3RK6A 4JPSA 1YA0A 4U95D 4TXPA 3OXFA 1OCZE 2HM8A 2OEWA 3T5VA 2IO2C 2C0MA 4J7WA 4Z68A 4DI4A 4V3IA 3BG0B 4UWKA 5KCMA 4BETA 2P9UG 2F37A 2J9QA 3Q5MA 4EBAG 2B0OE 3SY2A 4L9PA 4LCTA 5D2MC 2XEEA 3V30A 4G2VA 3RRUA 3LVQE 4GA2A 4DX7D 1OUVA 5JMND 4MBGA 4DLQA 3SHFA 3GZ1A 1WAO1 1OWPA 5HS0A 4LRZA 4GAAA 4ZFHA 3CVNA 2X6IA 5T4YA 3ULEG 1TNBA 3Q75A 2H6GA 3PE4A 3U4TA 3UM3A 4HVBA 3UKRG 3V79K 1JCSA 3QNKA 1MX4A 4G23A 5FWQA 1E8YA 4UI9C 3SI5A 4ABNA 3ASDA 3BG1B 2JABA 4N5CA 4C9BB 1TNUA 2GROB 3AU4A 3UINC 1N0QA 3FU5A 1IHBA 1OWMA 4EHMA 2WXRA 3DXMG 4HOTA 1TJCA 1TN6A 2IQCA 1U2VG 1OXJA 3GZ2A 3ZYLA 3B7BA 2F8XK 3EHNA 2QC9A 2X6KA 4F7AA 2NYJA 4HI8A 1BI7B 1UW4B 4OYSA 2R03A 5FINA 4OAVB 3PE3A 1U3CA 4APOA 3FUFA 2MHKA 4K5CA 3UI2A 4CRWA 4B93B 1TNYA 1HF8A 2RG8A 3OAWA 3UKUG 1JWGA 4HXIA 4CDNA 5AQ7A 3UT8A 1SA4A 3PEVB 3CK9A 2ZGGA 2PQRA 4L1BA 2Y3AA 4J6IA 2RD0A 3CK8A 3PZ1A 4N5QA 5EDSA 2PL2A 5A6CA 4UWLA 4IRUA 4I1AA 1X5BA 2GGFA 2V0PA 5AQBA 3Q7AA 1FT2A 2AXUA 5ENOD 3B7SA 1QZ2A 4GTPA 4GZCA 3ISMC 3VLFA 5AYWD 4AM9A 1DVPA 5AN8A 5ENRD 4LUNU 2BTDA 2WXPA 2XPIA 1D8DA 3JXIA 5KNGA 3L6AA 5BW8C 1NA0A 3DPYA 2XS1A 1G3NB 1KLXA 2J4DA 2VSXE 2VTBB 2DBAA 4B8AA 3QARA 3FTYA 3L13A 3LKUA 1OY3D 4CEMA 2EIJE 4PUCA 4DUIA 3TG5A 1IHGA 3DSWA 5C2YA 4GB9A 4H7XA 2WXOA 2PM6A 3AS8A 1U3DA 5ENTD 1SQMA 3CHRA 4BEPA 3DSVA 4HFGA 2UWJG 4NQ0A 4ANVA 3JUIA 2WVIA 2YINA 5AJLA 4I6JA 1HFAA 3QWWA 2CHWA 1IXVA 4HRNA 3QWVA 4LERA 2EILE 2GRPB 3L17A 3RO2A 3RKVA 4Q69A 4DI3A 4FLBA 3FUIA 4ILHB 1UJJA 3ZW3A 5B1AE 4AV7A 2GRRB 3P2BA 1OWLA 2UY1A 3SFZA 5CCLA 3DSUA 3PVLA 2X38A 5EIDA 3MYVA 3ASHA 2NXPA 2XENA 1E7VA 2IF4A 3ZUVB 2XCBA 1NL4A 2X3MA 2QFCA 4BTBA 2B6CA 4U96D 1FT1A 1KPSB 4JD2G 2YQ8A 3J5PA 3NZUA 1QYMA 3O48A 3Q73A 4C0EA 3I4GA 3HXFA 3UT7A 3HVEA 5T8IA 5G04J 2EIME 2H6HA 3LY8A 1A5EA 3BEEA 4CGWA 4DJAA 2HYZA 4U8VD 4B94A 5EX3A 2A5UA 4U07A 1BD8A 2FO7A 4G26A 1E8XA 1HZ4A 3NQPA 2RKKA 2GRNB 5LFAA 4Y6WA 3NZSA 1KZOA 4PS7A 1H19A 4AIFA 4DRXE 2DZOA 2A4ZA 3W9GA 2FI7A 4L2LA 2WXGA 3L22A 1EPUA 1RW2A 4URKA 3CSTA 3DRAA 4A1SA 4BFRA 3U9WA 2MRIA 3T5XA 4GTVA 3C3OA 3ZKJA 3QK0A 4RG6A 4JEHA 2WPVA 2FO1E 4I43A 3C3QA 3IV0A 4OVVA 2VJ8A 5LCWC 5G04C 3G2WA 3DSTA 3ZHEB 3CVWA 2DYRE 3FUNA 3U66A 1YCSB 5LOZA 1YYHA 4I6EA 2YNQA 3EHRA 3HG0D 5KJNA 3PUKA 2LNIA 3G2UA 3W9FA 3HYMB 3TWWA 1O1SA 5J08A 5BXOA 2ETCA 3TXMA 4BT9A 3L08A 5AQ9A 3CHMA 4G11A 5AAOA 2E0IA 4W9RA 4ACKA 2HE0A 3C5RA 3ENEA 4WWNA 4CDMA 2VQ2A 3F6QA 2DVWA 5H7PA 2VSOE 3LY9A 5JJ7A 5KWDA 2MYOA 4G24A 2GRLA 3TWUA 3MKQB 3ZPJA 2J8SD 3TWVA 1MYOA 3K9IA 5AENA 1PAQA 4I1OB 2OVBA 4J0UA 5CCMA 4PH4B 3OXGA 3QWPA 5G55A 1HS6A 4XEIG 4BT8A 5CECB 5KNHD 2BKKB 3ONKA 4PS3A 4N39A 2Q7FA 3Q47B 4DPRA 5LCWJ 2Y4TA 4LNGA 3PZDA 1H2TC 2M63A 1QNFA 3UM1A 3IXEA 4EZKA 1SW6A 4EZLA 4K0RA 3JUEA 2IONA 3MJWA 4TUMA 3KSLA 4HOSA 3V2XA 3FWVA 3N71A 2IY0C 4NIKA 1N11A 2IOSA 3RAUA 3CIAA 3ABME 4U0SA 4LNUD 2L0IA 5G05J 4AXHA 1VDYA 2R59A 2ZISA 2J08A 2WXLA 2R02A 4CT4A 4BESA 4JL0A 4XX5A 3S2AA 3DXKG 3S7JA 5ENPD 1SVXA 1H6KA 4NACA 2WXMA 1HG5A 1TN7A 2H6IA 4J8YA 4HNAD 2DZNA 2XRYA 4NRHB 2AXVA 3SNXA 1AP7A 4I2WA 2ZXWE 5BT1A 1D8EA 1SA5A 1Z3XA 2GRMA 4HS2A 4CZ2D 4JHRA 5JHAA 4L7TA 2IO3C 3UX4A 5CEDB 2WMNA 2BEDA 4FLHA 1TJFA 3E37A 5D0OD 3DWLG 4FA6A 3ZXPA 4GMRA 4KT6B 2V4HC 4AEZC 4E85A 5IY5E 3ZGQA 2I9CA 4GYWA 2PM7A 3GW4A 3E30A 4HRLA 4M3OA 1BLXB 3UT4A 5ANLA 3HXBA 5CMYA 5CBOA 1NA3A 3JQ1A 4HOUA 5CHEE 2JEKA 4N3AA 2IJGX 3LXUX 3ZU7B 2F8YA 2OOEA 3DPDA 3AJIA 4C0MA 4A3TA 3JXJA 2LXLA 2LAIA 3QJZA 5FZQA 2LO6A 5EN5D 4A1GA 4TV3A 1K1AA 3ASGA 3IHYA 4FHJA 2KZTB 2WQ7A 3B13A 2WXKA 3QKYA 5FZRA 3ASFA 5HRYA 3ASNE 3NOCD 3CVUA 2AW6A 3MZLB 5ARGA 3TWXA 4MKTA 3MKQA 2P58C 2RFAA 4GA0A 3LVRE 4O60A 4BERA 1IQRA 3T8MA 3U64A 1QQEA 5DIZA 1N0RA 3CVYA 2ZU6B 3NOGD 1JCRA 3MKRA 3FUMA 3HRAA 3UUXA 3B95A 4I2ZA 2VTBA 3FTWA 1N9AA 4X8QA 3NF1A 3URZA 1Y6IA 3PH0C 3EIQC 3CQCB 4AP2A 2OV8A 1HXIA 2KC7A 3WG7E 3PEUB 3CV0A 4GZ5A 2CFZA 2RFMA 4EQFA 1HE8A 5CEAA 5BNWA 3I4RB 3MA5A 3UM2A 1TEZA 3PZ3A 2XGOA 1K1BA 1N54A 1OT8A 5BUZA 4I1MA 4GCOA 2I6HA 3J5QB 1Z6TA 5A7DB 3QC1A 1SZAA 2KCVA 4BSZB 3VTXA 3ML9A 3ESLA 2VSYA 5FQ6A 4LSZE 4EBAA 3GYZA 1MHQA 4WNEA 2C0LA 1JUQA 4DX2A 4I6GA 5ENSD 2R2LA 4GTMA 4HBDA 2FF4A 3SFYA 4APFA 1H2UA 4DX5D 4AY5A 3CLJA 2Y4UA 4UWGA 4QFVA 4HOQA 1Z3YA 4EPZA 2AWIA 4J8SA 4HORA 1INZA 4DX6D 3HIZA 2KM4A 3SFXA 3ZN3A 5JHBA 4Q94A 3L82A 3FUJA 5CRUA 4GTSA 2FEZA 3MV2B 2XPZA 3OTNA 4U04A 2J4BA 4MS6A 2IEJA 3FTUA 3C72A 3OXLA 3ZYQA 3LYAA 4GCNA 3LDZA 4AJWA 3SGHA 5FQ8A 3ZXSA 3UXGA 3SQVA 4XI9A 5AJDA 1EDUA 3JCKC 4XKBA 3KEZA 4GZDA 2IOLA 3FUHA 2QZAA 4RQIA 3UMVA 2L9BA 1Z5SC 4HB5A 4UQYA 4N3CA 2WXNA 1OCCE 1P5QA 3G2VA 3C3RA 2YHCA 1E8WA 1TR4A 1O5MA 1HG2A 3D9PA 5ITZF 3Q7FA 3PREA 3RO3A 1LF8A 4D10C 2E2EA 4LG6A 3FULA 4KZ0A 2FULA 2X6FA 3EUVA 5M72A 4GYYA 5D0QD 4BWRA 1N52A 4K5AB 3RU0A 4JHKA 3TGOA 3ZYMA 5E76A 1WY6A 1DNPA 1S64A 2XHEA 1V54E 2LSUA 3BU8A 5BV1A 3HXDA 3FTZA 4JVSA 4GTQA 2YHEA 4JB8P 3PZ2A 3B7UX 3TJPA 1JWFA 3AAAC 2PZIA 5ENQD 4PS8A 3CSFA 3T9KA 2LUHA 4FJZA 3ZFWA 2VGXB 5EIBE 1ZU2A 2R17C 3DEPA 3ZRHA 2X6JA 2OEVA 4HI9A 3LS8A 2WXIA 4FU3A 4FADA 3AG4E 3L54A 1K8KG 5KJMA 2A5EA 5FQ7A 1S70B 3G2TA 3SBSA 1HH8A 3TWTA 1JCQA 3ESKA 3VLDA 2WB2A 4UQZA 2EIKE 3DSXA 2JLBA 3TWRA 3EU5A 3LJNA 4F53A 4LEUA 2OCCE 4DX1A 2XPYA 4NURA 4DLOA 3D9OA 1N95A 2V4LA 2C2LA 4K5BA 1TNZA 5EYPF 1HX8A 3KD7A 5HQ8A 2LXMA 4H7YA 2XZTG 4TXRA 4WNDA 2XRZA 1GW6A 3FUDA 4ILIA 4KZCA 3B7TA 4G1TA 4F3VA 3APFA 2IFUA 1H0AA 4HLLA 3FH8A 4BSXA 4ME2A 4HLEA 4F6RD 2WXFA 4E6HA 3PDNA 1WDYA 4XIFA 4LNBA 5EILA 1DC2A 4P29A 4JA7A 3GZSA 3VTYA 4OAUC 4O6FA 1SZ9A 2P2CP 1KT0A 2EINE 2X6HA 3DEOA 4JXTA 4ATZD 2P9KG 1PC2A 4AVXA 4JHJA 3FEYA 5G2NA 3S7DA 4XKCA 4BY6A 3E4BA 3CVVA 3S7FA 5HKPA 4ANUA 2GRQB 2KCLA 3FUKA 4YNDA 3HXCA 4GZ3A 1UOHA 4KXKB 3TXNA 1S0PA 1ELKA 5KBAA 3UTMA 1DCQA 1WM5A 4AY6A 1H6OA 3AU5A 1ELWA 5ENNA 3LPZA 4U0ZA 3HXEA 5CBNA 1IKND 3CVXA 4JA9A 3MGBA 2V5QC 3RRMB 3SF4A 3B7RL 4WWOA 5G05C 3FU3A 1XGWA 1H2VC 4L2YA 1OCRE 2L0TB 3CK7A 2BKGA 2NSZA 2I1KA 3RJVA 3EU9A 1FPPA 4AOFA 2V8SE 4KBQA 3JQ0A 1ZB1A 3NBNB 3L9TA 5FTPA 3AG1E 3CVPA 3C98A 3D9JA 5CRVA 5AARA 1N4RA 1B89A 2BF0X 5EX0A 4TUUA 3CVLA 3O4ZA 4YDYA 1FVFA 4ATGA 4CYMD 3IKOB 1ZBPA 2AVPA 3ABLE 5B3SE 4ANXA 3D3MA 5DBKA 2WXQA 2P9IG 2OVFA 4GTOA 2CG3A 4XZ4A 3HDXA 2CFUA 1HU3A 3UQ3A 1ELRA 3LY7A 2QY7A 3EIJA 2QYJA
chains in the Genus database with same CATH topology
5ENPD 1A5EA 1SVXA 2HE0A 5ITZF 4LSZE 5KBAA 3C5RA 3UTMA 1DCQA 2QC9A 3KEAA 4U8VD 1BU9A 3T8KA 1AWCB 3V2OA 4J7WA 4C48B 4Z68A 4K5BA 1NFIE 4G8LA 3F6QA 2DVWA 2DZNA 2NYJA 4HNAD 4J8YA 5HRYA 4HI8A 4LG6A 4DX2A 1BI7B 4ZHBA 3NOCD 1BD8A 5CBNA 5EYPF 1AP7A 4UUCA 5FINA 2MYOA 5ENTD 5ENSD 2VGEA 5EYLA 4A63B 4BEPA 1IKND 4HBDA 3TWUA 4OAVB 4O1PA 4RLYA 3TWXA 2J8SD 3TWVA 1MYOA 4BETA 4DX5D 2RFAA 2V5QC 4HRMB 4QQIA 1MX6A 2F37A 2XZTG 4K5CA 4K5AB 4QFVA 4YDWA 3UI2A 4B93B 4O60A 4BERA 2B0OE 1IXVA 1BI8B 4HRNA 1MX2A 4DX6D 2XEEA 3V30A 4HQDA 4CZ2D 2BKGA 1N0RA 5CECB 5KNHD 3NOGD 2BKKB 4DRXE 5CEDB 2DZOA 3Q9UC 3HRAA 5AQ7A 4DX7D 4HLLA 3W9GA 3EU9A 4O1OA 3B95A 5JMND 4GPMA 2ETAA 4F6RD 2ZGGA 5KWDA 4U8YD 2KXPC 5JA4D 4GMRA 5HS0A 2V4HC 3NBNB 4ZFHA 3V31A 4JB8P 4N5QA 1WDYA 3AAAC 5AARA 3IXEA 2Y1LE 5EILA 5ENQD 4HRLA 1DC2A 3Q9NC 1BLXB 3T9KA 3ZKJA 1SW6A 5FIOA 3V79K 4OAUC 3JUEA 1WG0A 2Y0BG 2FO1E 5CBOA 5EIDA 5EIBE 2RFMA 3SO8A 3UXGA 1YMPA 2XENA 4YDYA 5CEAA 3TWSA 5CERB 1K3ZD 1MX4A 4TUMA 3ZUVB 4CYMD 2P2CP 3DEPA 2F8XK 3DEOA 5AQBA 2L6BA 4HI9A 5ENOD 3V2XA 1K1BA 4DUIA 4ATZD 1OT8A 1YCSB 3ZU7B 2JABA 1YYHA 2F8YA 4U96D 3ZNGA 3EHQA 3EHRA 4G8KA 4NIKA 5BXUA 1N11A 3AJIA 1N0QA 3TWQA 3HG0D 2ETBA 1IHBA 5AN8A 5ENRD 2A5EA 1D9SA 3W9FA 1S70B 3J5QB 2XEHA 3TWWA 4HB5A 4LNUD 2PNNA 3J5PA 3JXJA 3JXIA 5AQAA 5KNGA 5HKPA 3TWTA 3D9HA 2DWZA 2XZDG 1QYMA 5BXOA 2ETCA 1G3NB 3TWRA 4BSZB 2ZGDA 5EN5D 5AQ9A 3LJNA 1UOHA 1TR4A 1MJ0A 5D66A 1OY3D 2AJAA 1K1AA 5AAOA 4DX1A 4U95D 4BESA 4F1PA 2KBXA 3B7BA 2QYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENP D;  1A5E A;  1SVX A;  2HE0 A;  5ITZ F;  4LSZ E;  5KBA A;  3C5R A;  3UTM A;  1DCQ A;  2QC9 A;  3KEA A;  4U8V D;  1BU9 A;  3T8K A;  1AWC B;  3V2O A;  4J7W A;  4C48 B;  4Z68 A;  4K5B A;  1NFI E;  4G8L A;  3F6Q A;  2DVW A;  2DZN A;  2NYJ A;  4HNA D;  4J8Y A;  5HRY A;  4HI8 A;  4LG6 A;  4DX2 A;  1BI7 B;  4ZHB A;  3NOC D;  1BD8 A;  5CBN A;  5EYP F;  1AP7 A;  4UUC A;  5FIN A;  2MYO A;  5ENT D;  5ENS D;  2VGE A;  5EYL A;  4A63 B;  4BEP A;  1IKN D;  4HBD A;  3TWU A;  4OAV B;  4O1P A;  4RLY A;  3TWX A;  2J8S D;  3TWV A;  1MYO A;  4BET A;  4DX5 D;  2RFA A;  2V5Q C;  4HRM B;  4QQI A;  1MX6 A;  2F37 A;  2XZT G;  4K5C A;  4K5A B;  4QFV A;  4YDW A;  3UI2 A;  4B93 B;  4O60 A;  4BER A;  2B0O E;  1IXV A;  1BI8 B;  4HRN A;  1MX2 A;  4DX6 D;  2XEE A;  3V30 A;  4HQD A;  4CZ2 D;  2BKG A;  1N0R A;  5CEC B;  5KNH D;  3NOG D;  2BKK B;  4DRX E;  5CED B;  2DZO A;  3Q9U C;  3HRA A;  5AQ7 A;  4DX7 D;  4HLL A;  3W9G A;  3EU9 A;  4O1O A;  3B95 A;  5JMN D;  4GPM A;  2ETA A;  4F6R D;  2ZGG A;  5KWD A;  4U8Y D;  2KXP C;  5JA4 D;  4GMR A;  5HS0 A;  2V4H C;  3NBN B;  4ZFH A;  3V31 A;  4JB8 P;  4N5Q A;  1WDY A;  3AAA C;  5AAR A;  3IXE A;  2Y1L E;  5EIL A;  5ENQ D;  4HRL A;  1DC2 A;  3Q9N C;  1BLX B;  3T9K A;  3ZKJ A;  1SW6 A;  5FIO A;  3V79 K;  4OAU C;  3JUE A;  1WG0 A;  2Y0B G;  2FO1 E;  5CBO A;  5EID A;  5EIB E;  2RFM A;  3SO8 A;  3UXG A;  1YMP A;  2XEN A;  4YDY A;  5CEA A;  3TWS A;  5CER B;  1K3Z D;  1MX4 A;  4TUM A;  3ZUV B;  4CYM D;  2P2C P;  3DEP A;  2F8X K;  3DEO A;  5AQB A;  2L6B A;  4HI9 A;  5ENO D;  3V2X A;  1K1B A;  4DUI A;  4ATZ D;  1OT8 A;  1YCS B;  3ZU7 B;  2JAB A;  1YYH A;  2F8Y A;  4U96 D;  3ZNG A;  3EHQ A;  3EHR A;  4G8K A;  4NIK A;  5BXU A;  1N11 A;  3AJI A;  1N0Q A;  3TWQ A;  3HG0 D;  2ETB A;  1IHB A;  5AN8 A;  5ENR D;  2A5E A;  1D9S A;  3W9F A;  1S70 B;  3J5Q B;  2XEH A;  3TWW A;  4HB5 A;  4LNU D;  2PNN A;  3J5P A;  3JXJ A;  3JXI A;  5AQA A;  5KNG A;  5HKP A;  3TWT A;  3D9H A;  2DWZ A;  2XZD G;  1QYM A;  5BXO A;  2ETC A;  1G3N B;  3TWR A;  4BSZ B;  2ZGD A;  5EN5 D;  5AQ9 A;  3LJN A;  1UOH A;  1TR4 A;  1MJ0 A;  5D66 A;  1OY3 D;  2AJA A;  1K1A A;  5AAO A;  4DX1 A;  4U95 D;  4BES A;  4F1P A;  2KBX A;  3B7B A;  2QYJ A; 
#chains in the Genus database with same CATH topology
 3D9K A;  2FBN A;  2KZT A;  2WM9 A;  2WMO A;  3KEA A;  4N2S A;  4G8L A;  3UPV A;  4KMO A;  2I2O A;  3AS5 A;  1TN8 A;  4B8C B;  4KYO B;  3TL5 A;  2VSN A;  1BI8 B;  3APD A;  3CHQ A;  2J07 A;  3APC A;  3CHP A;  1FVH A;  4RSY A;  5BV0 A;  3R7R A;  1KZP A;  3QAQ A;  4I17 A;  4FC8 A;  1LD7 A;  3UIO C;  4Y6C A;  4DK5 A;  3MV3 B;  4A3V A;  2HR2 A;  4UWF A;  4ACL A;  5FJY A;  3PUJ A;  2QYU A;  3AG3 E;  1N4S A;  3PNT B;  3Q15 A;  2NC9 A;  3Q4A B;  5FIO A;  3EDT B;  3VLE A;  1OWO A;  1WG0 A;  1N4Q A;  2EQX A;  3RIB A;  1A17 A;  2ZIR A;  2V5F A;  3KSQ A;  3FP3 A;  1O1T A;  1LTX A;  4FP7 A;  4OVU A;  2L6B A;  5JJT A;  4KVM A;  2GW1 A;  3R9A B;  3EHQ A;  3CKB A;  3FUE A;  3D9M A;  4WAF A;  3CGH A;  2PNN A;  2XS8 A;  1PY1 A;  3E34 A;  4WUY A;  1Y8M A;  3MEK A;  3D9L A;  5D66 A;  1MJ0 A;  2KCK A;  3FU0 A;  4F1P A;  2KBX A;  1X81 A;  2WQ6 A;  3DSS A;  3V2O A;  3FU6 A;  4JEU A;  3HVE B;  2KAT A;  3FTX A;  4ZHB A;  1QBQ A;  2WXJ A;  4I9E A;  4RLY A;  4CT0 A;  4B89 A;  4YDW A;  3KS2 A;  3ULQ A;  3JYS A;  4YDE A;  3UM0 A;  3Q49 B;  3FDH A;  3LEW A;  4K03 A;  1XNF A;  3Q9U C;  5FT9 A;  2VYI A;  3CQG B;  3Q79 A;  5LP0 A;  4R7L A;  4O1O A;  3SBT B;  4GPM A;  1NI1 A;  2DCP A;  4U8Y D;  2KXP C;  5JA4 D;  3E32 A;  3QOU A;  4J8F A;  3EHM A;  4L23 A;  2Y0B G;  2R5S A;  4Q96 A;  3TG4 A;  1UN8 A;  5CER B;  1N94 A;  4JC8 A;  2P9N G;  1TNO A;  3FFL A;  3NB2 A;  5C1D A;  2VGY A;  3D9N A;  3TWQ A;  1Q2Z A;  4U63 A;  1TYQ G;  2R05 A;  5A23 A;  1NZN A;  3PNL B;  1UJK A;  1BPO A;  1RZ4 A;  1V55 E;  5KJL A;  2LAH A;  5FZS A;  4RVB A;  3LCA A;  3FTS A;  3X2Q E;  3ONL A;  4GTT A;  3HHM A;  4M7C A;  4XI0 A;  5T3R A;  5J90 A;  4BTA A;  4U7E B;  1N4P A;  4JW1 A;  4UUC A;  4A63 B;  2J09 A;  4O1P A;  4TRQ A;  5BPP A;  4QQI A;  4GPK A;  1MX6 A;  2XEV A;  4PDX A;  1HO8 A;  2IU1 A;  2CG2 A;  3CEQ A;  1IQU A;  4MLP A;  4KVO A;  2F0Y A;  3AG2 E;  3ZVV A;  3ULY A;  4YVQ C;  4F1S A;  2AXZ A;  3CKC A;  3BQO A;  2MOW A;  2XCC A;  1UG3 A;  4GTR A;  4UI9 J;  3MCX A;  3E33 A;  3SZ7 A;  4FHK A;  4EZJ A;  4A55 A;  3NAW A;  3ZEF A;  3CVQ A;  3TWS A;  1K3Z D;  3ML8 A;  3SD5 A;  4N2Q A;  4I9C A;  4GA1 A;  4IN3 B;  3G2S A;  3CHO A;  4U8H A;  5KJK A;  3RRN B;  3WXX A;  4CCA A;  4G8K A;  1DCE A;  5BXU A;  1S63 A;  2XGM A;  4IUL A;  5LX8 A;  3FY4 A;  1E96 B;  2DWZ A;  3KAE A;  3FH7 A;  3RSE G;  1LD8 A;  2OND A;  4RG9 A;  2J49 A;  1O1R A;  1MZC A;  3BUA A;  3CR3 A;  4BX9 A;  5AIJ A;  2CHX A;  3PRZ A;  1UN9 A;  3FEX A;  1BU9 A;  4GYO A;  3T8K A;  4TXQ A;  2P9P G;  2WQH A;  2LSV A;  4HRM B;  3S7B A;  2DIW A;  1MX2 A;  2Y69 E;  4BX8 A;  4B0Z A;  4HQD A;  4UI9 K;  2H6F A;  2PQN A;  4ANW A;  4WNG A;  3ZIM A;  3AS4 A;  2ETA A;  3UIP C;  3Q78 A;  2VGX A;  3D9I A;  3LJ3 A;  3ZHE A;  3P1U A;  3I3N A;  3V31 A;  3R9M A;  2Y1L E;  5ANR A;  3L16 A;  2XQ0 A;  4J8E A;  4YVO A;  4U0U A;  3EJN A;  2DYS E;  3PS6 A;  3ZNG A;  5ARF A;  5FQ4 A;  4MRU A;  1E7U A;  1D9S A;  2CHZ A;  5B1B E;  2L6J A;  1EF1 C;  3D9H A;  1W3B A;  1IYG A;  2ZGD A;  3FH5 A;  3DBS A;  3ZYK A;  4GML A;  2I1J A;  3TAX A;  5CMW A;  1AWC B;  4C48 B;  4CDR A;  1NFI E;  4IYP A;  1JPL A;  4N3B A;  4XE0 A;  2VGE A;  5EYL A;  2ILR A;  2XGS A;  1EYH A;  1E8Z A;  4JZY A;  4UWH A;  3FHE A;  4GU5 A;  1OCO E;  2BUG A;  3IEG A;  4FJY A;  1KT1 A;  3MX3 A;  1MQS A;  3IHV A;  4UQX A;  1E90 A;  3QDN A;  3Q9N C;  5E75 A;  4J8D A;  3SO8 A;  3FTV A;  1YMP A;  3QB2 A;  1NP7 A;  3R7Q A;  1H6P A;  2WXH A;  1OWN A;  2HO1 A;  4WWP A;  4EEC A;  5JJ6 A;  4GZ6 A;  4WNF A;  3U3W A;  4GMJ A;  4YDO A;  2UY1 B;  3CHS A;  3PZ4 A;  2ETB A;  2P9L G;  5HI7 A;  2XEH A;  3ASO E;  4CGV A;  5AQA A;  4G25 A;  2XZD G;  3ABK E;  4ILG A;  1L5J A;  3IBE A;  5EKQ D;  4FUL A;  2P9S G;  3I5P A;  2AJA A;  1FCH A;  3RK6 A;  4JPS A;  1YA0 A;  4U95 D;  4TXP A;  3OXF A;  1OCZ E;  2HM8 A;  2OEW A;  3T5V A;  2IO2 C;  2C0M A;  4J7W A;  4Z68 A;  4DI4 A;  4V3I A;  3BG0 B;  4UWK A;  5KCM A;  4BET A;  2P9U G;  2F37 A;  2J9Q A;  3Q5M A;  4EBA G;  2B0O E;  3SY2 A;  4L9P A;  4LCT A;  5D2M C;  2XEE A;  3V30 A;  4G2V A;  3RRU A;  3LVQ E;  4GA2 A;  4DX7 D;  1OUV A;  5JMN D;  4MBG A;  4DLQ A;  3SHF A;  3GZ1 A;  1WAO 1;  1OWP A;  5HS0 A;  4LRZ A;  4GAA A;  4ZFH A;  3CVN A;  2X6I A;  5T4Y A;  3ULE G;  1TNB A;  3Q75 A;  2H6G A;  3PE4 A;  3U4T A;  3UM3 A;  4HVB A;  3UKR G;  3V79 K;  1JCS A;  3QNK A;  1MX4 A;  4G23 A;  5FWQ A;  1E8Y A;  4UI9 C;  3SI5 A;  4ABN A;  3ASD A;  3BG1 B;  2JAB A;  4N5C A;  4C9B B;  1TNU A;  2GRO B;  3AU4 A;  3UIN C;  1N0Q A;  3FU5 A;  1IHB A;  1OWM A;  4EHM A;  2WXR A;  3DXM G;  4HOT A;  1TJC A;  1TN6 A;  2IQC A;  1U2V G;  1OXJ A;  3GZ2 A;  3ZYL A;  3B7B A;  2F8X K;  3EHN A;  2QC9 A;  2X6K A;  4F7A A;  2NYJ A;  4HI8 A;  1BI7 B;  1UW4 B;  4OYS A;  2R03 A;  5FIN A;  4OAV B;  3PE3 A;  1U3C A;  4APO A;  3FUF A;  2MHK A;  4K5C A;  3UI2 A;  4CRW A;  4B93 B;  1TNY A;  1HF8 A;  2RG8 A;  3OAW A;  3UKU G;  1JWG A;  4HXI A;  4CDN A;  5AQ7 A;  3UT8 A;  1SA4 A;  3PEV B;  3CK9 A;  2ZGG A;  2PQR A;  4L1B A;  2Y3A A;  4J6I A;  2RD0 A;  3CK8 A;  3PZ1 A;  4N5Q A;  5EDS A;  2PL2 A;  5A6C A;  4UWL A;  4IRU A;  4I1A A;  1X5B A;  2GGF A;  2V0P A;  5AQB A;  3Q7A A;  1FT2 A;  2AXU A;  5ENO D;  3B7S A;  1QZ2 A;  4GTP A;  4GZC A;  3ISM C;  3VLF A;  5AYW D;  4AM9 A;  1DVP A;  5AN8 A;  5ENR D;  4LUN U;  2BTD A;  2WXP A;  2XPI A;  1D8D A;  3JXI A;  5KNG A;  3L6A A;  5BW8 C;  1NA0 A;  3DPY A;  2XS1 A;  1G3N B;  1KLX A;  2J4D A;  2VSX E;  2VTB B;  2DBA A;  4B8A A;  3QAR A;  3FTY A;  3L13 A;  3LKU A;  1OY3 D;  4CEM A;  2EIJ E;  4PUC A;  4DUI A;  3TG5 A;  1IHG A;  3DSW A;  5C2Y A;  4GB9 A;  4H7X A;  2WXO A;  2PM6 A;  3AS8 A;  1U3D A;  5ENT D;  1SQM A;  3CHR A;  4BEP A;  3DSV A;  4HFG A;  2UWJ G;  4NQ0 A;  4ANV A;  3JUI A;  2WVI A;  2YIN A;  5AJL A;  4I6J A;  1HFA A;  3QWW A;  2CHW A;  1IXV A;  4HRN A;  3QWV A;  4LER A;  2EIL E;  2GRP B;  3L17 A;  3RO2 A;  3RKV A;  4Q69 A;  4DI3 A;  4FLB A;  3FUI A;  4ILH B;  1UJJ A;  3ZW3 A;  5B1A E;  4AV7 A;  2GRR B;  3P2B A;  1OWL A;  2UY1 A;  3SFZ A;  5CCL A;  3DSU A;  3PVL A;  2X38 A;  5EID A;  3MYV A;  3ASH A;  2NXP A;  2XEN A;  1E7V A;  2IF4 A;  3ZUV B;  2XCB A;  1NL4 A;  2X3M A;  2QFC A;  4BTB A;  2B6C A;  4U96 D;  1FT1 A;  1KPS B;  4JD2 G;  2YQ8 A;  3J5P A;  3NZU A;  1QYM A;  3O48 A;  3Q73 A;  4C0E A;  3I4G A;  3HXF A;  3UT7 A;  3HVE A;  5T8I A;  5G04 J;  2EIM E;  2H6H A;  3LY8 A;  1A5E A;  3BEE A;  4CGW A;  4DJA A;  2HYZ A;  4U8V D;  4B94 A;  5EX3 A;  2A5U A;  4U07 A;  1BD8 A;  2FO7 A;  4G26 A;  1E8X A;  1HZ4 A;  3NQP A;  2RKK A;  2GRN B;  5LFA A;  4Y6W A;  3NZS A;  1KZO A;  4PS7 A;  1H19 A;  4AIF A;  4DRX E;  2DZO A;  2A4Z A;  3W9G A;  2FI7 A;  4L2L A;  2WXG A;  3L22 A;  1EPU A;  1RW2 A;  4URK A;  3CST A;  3DRA A;  4A1S A;  4BFR A;  3U9W A;  2MRI A;  3T5X A;  4GTV A;  3C3O A;  3ZKJ A;  3QK0 A;  4RG6 A;  4JEH A;  2WPV A;  2FO1 E;  4I43 A;  3C3Q A;  3IV0 A;  4OVV A;  2VJ8 A;  5LCW C;  5G04 C;  3G2W A;  3DST A;  3ZHE B;  3CVW A;  2DYR E;  3FUN A;  3U66 A;  1YCS B;  5LOZ A;  1YYH A;  4I6E A;  2YNQ A;  3EHR A;  3HG0 D;  5KJN A;  3PUK A;  2LNI A;  3G2U A;  3W9F A;  3HYM B;  3TWW A;  1O1S A;  5J08 A;  5BXO A;  2ETC A;  3TXM A;  4BT9 A;  3L08 A;  5AQ9 A;  3CHM A;  4G11 A;  5AAO A;  2E0I A;  4W9R A;  4ACK A;  2HE0 A;  3C5R A;  3ENE A;  4WWN A;  4CDM A;  2VQ2 A;  3F6Q A;  2DVW A;  5H7P A;  2VSO E;  3LY9 A;  5JJ7 A;  5KWD A;  2MYO A;  4G24 A;  2GRL A;  3TWU A;  3MKQ B;  3ZPJ A;  2J8S D;  3TWV A;  1MYO A;  3K9I A;  5AEN A;  1PAQ A;  4I1O B;  2OVB A;  4J0U A;  5CCM A;  4PH4 B;  3OXG A;  3QWP A;  5G55 A;  1HS6 A;  4XEI G;  4BT8 A;  5CEC B;  5KNH D;  2BKK B;  3ONK A;  4PS3 A;  4N39 A;  2Q7F A;  3Q47 B;  4DPR A;  5LCW J;  2Y4T A;  4LNG A;  3PZD A;  1H2T C;  2M63 A;  1QNF A;  3UM1 A;  3IXE A;  4EZK A;  1SW6 A;  4EZL A;  4K0R A;  3JUE A;  2ION A;  3MJW A;  4TUM A;  3KSL A;  4HOS A;  3V2X A;  3FWV A;  3N71 A;  2IY0 C;  4NIK A;  1N11 A;  2IOS A;  3RAU A;  3CIA A;  3ABM E;  4U0S A;  4LNU D;  2L0I A;  5G05 J;  4AXH A;  1VDY A;  2R59 A;  2ZIS A;  2J08 A;  2WXL A;  2R02 A;  4CT4 A;  4BES A;  4JL0 A;  4XX5 A;  3S2A A;  3DXK G;  3S7J A;  5ENP D;  1SVX A;  1H6K A;  4NAC A;  2WXM A;  1HG5 A;  1TN7 A;  2H6I A;  4J8Y A;  4HNA D;  2DZN A;  2XRY A;  4NRH B;  2AXV A;  3SNX A;  1AP7 A;  4I2W A;  2ZXW E;  5BT1 A;  1D8E A;  1SA5 A;  1Z3X A;  2GRM A;  4HS2 A;  4CZ2 D;  4JHR A;  5JHA A;  4L7T A;  2IO3 C;  3UX4 A;  5CED B;  2WMN A;  2BED A;  4FLH A;  1TJF A;  3E37 A;  5D0O D;  3DWL G;  4FA6 A;  3ZXP A;  4GMR A;  4KT6 B;  2V4H C;  4AEZ C;  4E85 A;  5IY5 E;  3ZGQ A;  2I9C A;  4GYW A;  2PM7 A;  3GW4 A;  3E30 A;  4HRL A;  4M3O A;  1BLX B;  3UT4 A;  5ANL A;  3HXB A;  5CMY A;  5CBO A;  1NA3 A;  3JQ1 A;  4HOU A;  5CHE E;  2JEK A;  4N3A A;  2IJG X;  3LXU X;  3ZU7 B;  2F8Y A;  2OOE A;  3DPD A;  3AJI A;  4C0M A;  4A3T A;  3JXJ A;  2LXL A;  2LAI A;  3QJZ A;  5FZQ A;  2LO6 A;  5EN5 D;  4A1G A;  4TV3 A;  1K1A A;  3ASG A;  3IHY A;  4FHJ A;  2KZT B;  2WQ7 A;  3B13 A;  2WXK A;  3QKY A;  5FZR A;  3ASF A;  5HRY A;  3ASN E;  3NOC D;  3CVU A;  2AW6 A;  3MZL B;  5ARG A;  3TWX A;  4MKT A;  3MKQ A;  2P58 C;  2RFA A;  4GA0 A;  3LVR E;  4O60 A;  4BER A;  1IQR A;  3T8M A;  3U64 A;  1QQE A;  5DIZ A;  1N0R A;  3CVY A;  2ZU6 B;  3NOG D;  1JCR A;  3MKR A;  3FUM A;  3HRA A;  3UUX A;  3B95 A;  4I2Z A;  2VTB A;  3FTW A;  1N9A A;  4X8Q A;  3NF1 A;  3URZ A;  1Y6I A;  3PH0 C;  3EIQ C;  3CQC B;  4AP2 A;  2OV8 A;  1HXI A;  2KC7 A;  3WG7 E;  3PEU B;  3CV0 A;  4GZ5 A;  2CFZ A;  2RFM A;  4EQF A;  1HE8 A;  5CEA A;  5BNW A;  3I4R B;  3MA5 A;  3UM2 A;  1TEZ A;  3PZ3 A;  2XGO A;  1K1B A;  1N54 A;  1OT8 A;  5BUZ A;  4I1M A;  4GCO A;  2I6H A;  3J5Q B;  1Z6T A;  5A7D B;  3QC1 A;  1SZA A;  2KCV A;  4BSZ B;  3VTX A;  3ML9 A;  3ESL A;  2VSY A;  5FQ6 A;  4LSZ E;  4EBA A;  3GYZ A;  1MHQ A;  4WNE A;  2C0L A;  1JUQ A;  4DX2 A;  4I6G A;  5ENS D;  2R2L A;  4GTM A;  4HBD A;  2FF4 A;  3SFY A;  4APF A;  1H2U A;  4DX5 D;  4AY5 A;  3CLJ A;  2Y4U A;  4UWG A;  4QFV A;  4HOQ A;  1Z3Y A;  4EPZ A;  2AWI A;  4J8S A;  4HOR A;  1INZ A;  4DX6 D;  3HIZ A;  2KM4 A;  3SFX A;  3ZN3 A;  5JHB A;  4Q94 A;  3L82 A;  3FUJ A;  5CRU A;  4GTS A;  2FEZ A;  3MV2 B;  2XPZ A;  3OTN A;  4U04 A;  2J4B A;  4MS6 A;  2IEJ A;  3FTU A;  3C72 A;  3OXL A;  3ZYQ A;  3LYA A;  4GCN A;  3LDZ A;  4AJW A;  3SGH A;  5FQ8 A;  3ZXS A;  3UXG A;  3SQV A;  4XI9 A;  5AJD A;  1EDU A;  3JCK C;  4XKB A;  3KEZ A;  4GZD A;  2IOL A;  3FUH A;  2QZA A;  4RQI A;  3UMV A;  2L9B A;  1Z5S C;  4HB5 A;  4UQY A;  4N3C A;  2WXN A;  1OCC E;  1P5Q A;  3G2V A;  3C3R A;  2YHC A;  1E8W A;  1TR4 A;  1O5M A;  1HG2 A;  3D9P A;  5ITZ F;  3Q7F A;  3PRE A;  3RO3 A;  1LF8 A;  4D10 C;  2E2E A;  4LG6 A;  3FUL A;  4KZ0 A;  2FUL A;  2X6F A;  3EUV A;  5M72 A;  4GYY A;  5D0Q D;  4BWR A;  1N52 A;  4K5A B;  3RU0 A;  4JHK A;  3TGO A;  3ZYM A;  5E76 A;  1WY6 A;  1DNP A;  1S64 A;  2XHE A;  1V54 E;  2LSU A;  3BU8 A;  5BV1 A;  3HXD A;  3FTZ A;  4JVS A;  4GTQ A;  2YHE A;  4JB8 P;  3PZ2 A;  3B7U X;  3TJP A;  1JWF A;  3AAA C;  2PZI A;  5ENQ D;  4PS8 A;  3CSF A;  3T9K A;  2LUH A;  4FJZ A;  3ZFW A;  2VGX B;  5EIB E;  1ZU2 A;  2R17 C;  3DEP A;  3ZRH A;  2X6J A;  2OEV A;  4HI9 A;  3LS8 A;  2WXI A;  4FU3 A;  4FAD A;  3AG4 E;  3L54 A;  1K8K G;  5KJM A;  2A5E A;  5FQ7 A;  1S70 B;  3G2T A;  3SBS A;  1HH8 A;  3TWT A;  1JCQ A;  3ESK A;  3VLD A;  2WB2 A;  4UQZ A;  2EIK E;  3DSX A;  2JLB A;  3TWR A;  3EU5 A;  3LJN A;  4F53 A;  4LEU A;  2OCC E;  4DX1 A;  2XPY A;  4NUR A;  4DLO A;  3D9O A;  1N95 A;  2V4L A;  2C2L A;  4K5B A;  1TNZ A;  5EYP F;  1HX8 A;  3KD7 A;  5HQ8 A;  2LXM A;  4H7Y A;  2XZT G;  4TXR A;  4WND A;  2XRZ A;  1GW6 A;  3FUD A;  4ILI A;  4KZC A;  3B7T A;  4G1T A;  4F3V A;  3APF A;  2IFU A;  1H0A A;  4HLL A;  3FH8 A;  4BSX A;  4ME2 A;  4HLE A;  4F6R D;  2WXF A;  4E6H A;  3PDN A;  1WDY A;  4XIF A;  4LNB A;  5EIL A;  1DC2 A;  4P29 A;  4JA7 A;  3GZS A;  3VTY A;  4OAU C;  4O6F A;  1SZ9 A;  2P2C P;  1KT0 A;  2EIN E;  2X6H A;  3DEO A;  4JXT A;  4ATZ D;  2P9K G;  1PC2 A;  4AVX A;  4JHJ A;  3FEY A;  5G2N A;  3S7D A;  4XKC A;  4BY6 A;  3E4B A;  3CVV A;  3S7F A;  5HKP A;  4ANU A;  2GRQ B;  2KCL A;  3FUK A;  4YND A;  3HXC A;  4GZ3 A;  1UOH A;  4KXK B;  3TXN A;  1S0P A;  1ELK A;  5KBA A;  3UTM A;  1DCQ A;  1WM5 A;  4AY6 A;  1H6O A;  3AU5 A;  1ELW A;  5ENN A;  3LPZ A;  4U0Z A;  3HXE A;  5CBN A;  1IKN D;  3CVX A;  4JA9 A;  3MGB A;  2V5Q C;  3RRM B;  3SF4 A;  3B7R L;  4WWO A;  5G05 C;  3FU3 A;  1XGW A;  1H2V C;  4L2Y A;  1OCR E;  2L0T B;  3CK7 A;  2BKG A;  2NSZ A;  2I1K A;  3RJV A;  3EU9 A;  1FPP A;  4AOF A;  2V8S E;  4KBQ A;  3JQ0 A;  1ZB1 A;  3NBN B;  3L9T A;  5FTP A;  3AG1 E;  3CVP A;  3C98 A;  3D9J A;  5CRV A;  5AAR A;  1N4R A;  1B89 A;  2BF0 X;  5EX0 A;  4TUU A;  3CVL A;  3O4Z A;  4YDY A;  1FVF A;  4ATG A;  4CYM D;  3IKO B;  1ZBP A;  2AVP A;  3ABL E;  5B3S E;  4ANX A;  3D3M A;  5DBK A;  2WXQ A;  2P9I G;  2OVF A;  4GTO A;  2CG3 A;  4XZ4 A;  3HDX A;  2CFU A;  1HU3 A;  3UQ3 A;  1ELR A;  3LY7 A;  2QY7 A;  3EIJ A;  2QYJ A; 
#chains in the Genus database with same CATH homology
 5ENP D;  1A5E A;  1SVX A;  2HE0 A;  5ITZ F;  4LSZ E;  5KBA A;  3C5R A;  3UTM A;  1DCQ A;  2QC9 A;  3KEA A;  4U8V D;  1BU9 A;  3T8K A;  1AWC B;  3V2O A;  4J7W A;  4C48 B;  4Z68 A;  4K5B A;  1NFI E;  4G8L A;  3F6Q A;  2DVW A;  2DZN A;  2NYJ A;  4HNA D;  4J8Y A;  5HRY A;  4HI8 A;  4LG6 A;  4DX2 A;  1BI7 B;  4ZHB A;  3NOC D;  1BD8 A;  5CBN A;  5EYP F;  1AP7 A;  4UUC A;  5FIN A;  2MYO A;  5ENT D;  5ENS D;  2VGE A;  5EYL A;  4A63 B;  4BEP A;  1IKN D;  4HBD A;  3TWU A;  4OAV B;  4O1P A;  4RLY A;  3TWX A;  2J8S D;  3TWV A;  1MYO A;  4BET A;  4DX5 D;  2RFA A;  2V5Q C;  4HRM B;  4QQI A;  1MX6 A;  2F37 A;  2XZT G;  4K5C A;  4K5A B;  4QFV A;  4YDW A;  3UI2 A;  4B93 B;  4O60 A;  4BER A;  2B0O E;  1IXV A;  1BI8 B;  4HRN A;  1MX2 A;  4DX6 D;  2XEE A;  3V30 A;  4HQD A;  4CZ2 D;  2BKG A;  1N0R A;  5CEC B;  5KNH D;  3NOG D;  2BKK B;  4DRX E;  5CED B;  2DZO A;  3Q9U C;  3HRA A;  5AQ7 A;  4DX7 D;  4HLL A;  3W9G A;  3EU9 A;  4O1O A;  3B95 A;  5JMN D;  4GPM A;  2ETA A;  4F6R D;  2ZGG A;  5KWD A;  4U8Y D;  2KXP C;  5JA4 D;  4GMR A;  5HS0 A;  2V4H C;  3NBN B;  4ZFH A;  3V31 A;  4JB8 P;  4N5Q A;  1WDY A;  3AAA C;  5AAR A;  3IXE A;  2Y1L E;  5EIL A;  5ENQ D;  4HRL A;  1DC2 A;  3Q9N C;  1BLX B;  3T9K A;  3ZKJ A;  1SW6 A;  5FIO A;  3V79 K;  4OAU C;  3JUE A;  1WG0 A;  2Y0B G;  2FO1 E;  5CBO A;  5EID A;  5EIB E;  2RFM A;  3SO8 A;  3UXG A;  1YMP A;  2XEN A;  4YDY A;  5CEA A;  3TWS A;  5CER B;  1K3Z D;  1MX4 A;  4TUM A;  3ZUV B;  4CYM D;  2P2C P;  3DEP A;  2F8X K;  3DEO A;  5AQB A;  2L6B A;  4HI9 A;  5ENO D;  3V2X A;  1K1B A;  4DUI A;  4ATZ D;  1OT8 A;  1YCS B;  3ZU7 B;  2JAB A;  1YYH A;  2F8Y A;  4U96 D;  3ZNG A;  3EHQ A;  3EHR A;  4G8K A;  4NIK A;  5BXU A;  1N11 A;  3AJI A;  1N0Q A;  3TWQ A;  3HG0 D;  2ETB A;  1IHB A;  5AN8 A;  5ENR D;  2A5E A;  1D9S A;  3W9F A;  1S70 B;  3J5Q B;  2XEH A;  3TWW A;  4HB5 A;  4LNU D;  2PNN A;  3J5P A;  3JXJ A;  3JXI A;  5AQA A;  5KNG A;  5HKP A;  3TWT A;  3D9H A;  2DWZ A;  2XZD G;  1QYM A;  5BXO A;  2ETC A;  1G3N B;  3TWR A;  4BSZ B;  2ZGD A;  5EN5 D;  5AQ9 A;  3LJN A;  1UOH A;  1TR4 A;  1MJ0 A;  5D66 A;  1OY3 D;  2AJA A;  1K1A A;  5AAO A;  4DX1 A;  4U95 D;  4BES A;  4F1P A;  2KBX A;  3B7B A;  2QYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...