4ZFHA

Crystal structure of artificial ankyrin repeat protein_ank(gag)1d4 mutant -y56a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
ADLGKKLLEAARAGQDDEVRLLLEHGADVNARDSIGSTPLHLAAAYGHLEIVRLLLEHGADVNARDSTGTTPLHYAARLGHLEIVRLLLEHGADVNARDAMGWTPLHLAAKKGHLEIVRLLLKHGADVNANDHFGKTAFDISIDNGNEDLAEILQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Artificial ankyrin repeat protein_Ank(GAG)1D4 mutant- Y56A
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Artificial ankyrin repeat protein_Ank(GAG)1D4 mutant -Y56A
total genus 55
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4zfhA00
3C5RA 1YYHA 3TWVA 3TWTA 4HRMB 1UOHA 1IHBA 4B93B 1WDYA 2FO1E 5CBNA 4QQIA 1K1AA 4N5QA 5AQ7A 2BKKB 3TWWA 1D9SA 5ENRD 5AARA 2MYOA 3ZUVB 5AAOA 2XENA 4K5AB 2V5QC 4J7WA 4CZ2D 4BEPA 1AP7A 2HE0A 3T9KA 3J5PA 4LG6A 3HG0D 5HRYA 2QYJA 1BD8A 3JUEA 5FIOA 4A63B 1OY3D 1MX4A 1MX2A 3W9FA 2ETBA 2XEEA 4ATZD 3T8KA 3AJIA 4K5BA 2RFMA 4BESA 2DWZA 3IXEA 3TWSA 1SVXA 2V4HC 5AN8A 4U96D 4HQDA 4J8YA 1DCQA 1K3ZD 3AAAC 2ZGGA 4DRXE 1BI8B 4DX5D 4NIKA 4TUMA 5AQBA 2DZOA 4GMRA 5ENTD 1BU9A 2P2CP 5KNHD 3ZNGA 3UI2A 4ZHBA 5FINA 3KEAA 3JXJA 2JABA 4DUIA 5HKPA 1A5EA 4QFVA 4RLYA 3NOGD 3V2OA 3JXIA 5CECB 3J5QB 3EHRA 3DEOA 5ENSD 5KNGA 1TR4A 5AQAA 1N11A 4DX6D 4DX7D 4DX2A 4OAUC 2BKGA 2VGEA 2ETCA 2KXPC 5ENPD 4LSZE 3UTMA 4G8KA 2DZNA 2AJAA 3TWUA 4HRNA 4YDYA 3TWQA 4O1PA 1BLXB 3LJNA 4HLLA 2DVWA 3V30A 5KBAA 4CYMD 4K5CA 4U8VD 1K1BA 5EIDA 3ZU7B 2J8SD 2ETAA 1S70B 3D9HA 5EILA 5CBOA 4BETA 1YMPA 2RFAA 3UXGA 3NBNB 3NOCD 5D66A 4BERA 4DX1A 4BSZB 5BXUA 4U8YD 4ZFHA 4F1PA 2XZTG 4C48B 4U95D 1N0QA 1NFIE 3Q9UC 3EHQA 3B95A 1N0RA 3V2XA 4F6RD 1DC2A 5BXOA 4HI8A 1IXVA 4G8LA 5EYLA 5HS0A 5EYPF 1QYMA 5CEAA 1MJ0A 5EIBE 2L6BA 2F8YA 5CERB 1IKND 2F37A 5ITZF 5CEDB 2A5EA 3HRAA 2NYJA 2PNNA 4HBDA 4UUCA 3Q9NC 1SW6A 3V31A 5ENQD 5KWDA 4OAVB 4GPMA 4YDWA 3SO8A 1OT8A 3B7BA 2ZGDA 2B0OE 3W9GA 1WG0A 4Z68A 5JA4D 3V79K 4LNUD 4HRLA 1G3NB 1MYOA 2XEHA 5AQ9A 1MX6A 4HB5A 1YCSB 3TWXA 3ZKJA 4JB8P 4O1OA 2XZDG 3DEPA 2Y1LE 3EU9A 5EN5D 2F8XK 4HI9A 5ENOD 2QC9A 3TWRA 1AWCB 4O60A 3F6QA 4HNAD 5JMND 2KBXA 1BI7B 2Y0BG
chains in the Genus database with same CATH superfamily
2MOWA 3LEWA 3DXMG 4AEZC 2UY1B 1D9SA 1NI1A 2WMOA 2WPVA 3FULA 2IO2C 3L22A 3FTYA 2C2LA 1ZU2A 3U64A 3L9TA 2OEVA 4A3VA 3JUEA 3VLEA 4TUUA 3PZ4A 4GZ5A 4URKA 3D9JA 4I6GA 4JVSA 3JXJA 3CK9A 3FTVA 4Y6WA 3ML9A 5AQAA 2MHKA 3HIZA 3SFXA 4XIFA 2CG3A 4APOA 2J49A 3SGHA 4O1PA 1LD8A 2YHCA 2RKKA 4FLHA 2EIME 3EHQA 2WVIA 4HXIA 3PNTB 1O5MA 1QQEA 1FPPA 3CVNA 4NURA 2WQHA 1U3CA 2F8YA 1IKND 3UMVA 1OWMA 3S7BA 4U0UA 3MCXA 4OVUA 4WWPA 3DSWA 5ENQD 5B1AE 4XE0A 3PZ3A 1GW6A 2XQ0A 1HG2A 5AQ9A 2X6JA 1HX8A 4PS7A 1SA5A 4HI9A 3ZW3A 3PZDA 2E2EA 4GMLA 1UN8A 3LXUX 3FUHA 4EZLA 1UOHA 4DI3A 3MKQA 3PE4A 5AENA 3T5XA 4U0ZA 3Q79A 1AP7A 3AU4A 4GAAA 5KJNA 3ZHEA 1A17A 2GRMA 5BNWA 3U3WA 2HYZA 4TUMA 5ENTD 1BU9A 4AOFA 2XPZA 3RRNB 3KSLA 3B7RL 2EQXA 3FU3A 1QBQA 4LSZE 3GZ1A 2DVWA 1N4SA 2J8SD 1MHQA 2R59A 3ULYA 3UIPC 4J8SA 2XRZA 4B89A 3TJPA 5D2MC 5HS0A 5AJLA 4B0ZA 4GCOA 2Y69E 4LEUA 5C1DA 4ANVA 2XRYA 3ASDA 3ZGQA 3Q9NC 4PS3A 1OCOE 3PNLB 5FJYA 3FUDA 4BWRA 1TNZA 4G11A 1Y8MA 4L7TA 2X3MA 3BUAA 1QZ2A 2Y1LE 5EN5D 3AG3E 2KBXA 2AVPA 3JUIA 2PQRA 5AIJA 3DXKG 4TXPA 3GZSA 2YNQA 5AAOA 2XENA 3APCA 4Q96A 2V5QC 2XGMA 3J5PA 2BUGA 3FH7A 3CGHA 5HRYA 5ARGA 5D0QD 2PM7A 3BG1B 3IEGA 3I5PA 4YNDA 1HO8A 3UPVA 2HM8A 1VDYA 2XS1A 4JA7A 4G25A 5CMYA 5JJ7A 4RSYA 3OXLA 4I1OB 4CGWA 4KMOA 3HXEA 5ENSD 3U9WA 4XKBA 2Y4UA 3HXCA 1N4RA 4J8FA 2KXPC 1L5JA 4UI9C 1N95A 1V54E 1IHGA 3VLDA 5BXUA 3QWPA 2L0IA 3Q9UC 3ZYMA 4UWGA 1TN6A 3L82A 1H6OA 3PDNA 5CCMA 3CSTA 1SW6A 3OAWA 2VSNA 3CVUA 5G55A 3B7BA 3LS8A 4GTTA 5FQ8A 5LFAA 3PZ2A 3TWRA 4J8EA 1BI7B 3ABME 1HXIA 1ELRA 1TN7A 1S64A 1UJKA 4HRMB 4AVXA 3NF1A 4APFA 4M3OA 5KCMA 2P9UG 3CVPA 3L17A 4BEPA 4LERA 1JUQA 2ZIRA 3FTUA 3G2TA 4G24A 5A7DB 3HG0D 3IHVA 4MKTA 2WXIA 5FIOA 2ETBA 3E4BA 4YDOA 3D9LA 3AJIA 3SFZA 2V4HC 2I9CA 4JA9A 2CHXA 2ZGGA 3LDZA 2WXMA 2IFUA 3PUKA 1KT0A 3NOGD 2DYSE 1OUVA 4HLEA 5C2YA 2VGEA 1JWFA 3FHEA 2FEZA 3C98A 3FDHA 4O6FA 3MYVA 4K5CA 4U8VD 2RFAA 3FH5A 2XHEA 3ASFA 3CQGB 5ARFA 4C9BB 4HI8A 3SI5A 4G8LA 5EYLA 3IBEA 2J07A 5ANLA 2WXFA 2XCCA 3ESKA 3U4TA 4GPMA 4BY6A 3D9IA 3LY9A 5JA4D 1HG5A 2X6FA 2XEHA 3Q49B 3KEZA 4LNBA 2PM6A 3D9NA 4NRHB 1TJCA 3Q4AB 2JLBA 2Q7FA 2IF4A 3MV3B 1IHBA 4WNFA 5BPPA 2DYRE 3CVQA 4A3TA 5A23A 4I43A 1Q2ZA 4R7LA 1KT1A 2EILE 3CHSA 1V55E 4AIFA 2ZU6B 2RFMA 4BESA 2DWZA 5AN8A 3MKRA 3URZA 4ANUA 3CVLA 1BI8B 1IYGA 4RVBA 2GRLA 4U7EB 5CMWA 3BU8A 3MJWA 4H7XA 4TRQA 3V2OA 2H6HA 4ABNA 3VTXA 3FTSA 4DX6D 4DX2A 3UINC 2P9NG 2AJAA 2LSVA 3CKBA 3HHMA 3PH0C 3QWWA 3PVLA 5CBOA 1HS6A 4BERA 4HOQA 4I2ZA 1DCEA 3DSXA 4U8YD 5G05J 2OVBA 1EYHA 3IHYA 4CRWA 2MRIA 3ML8A 4L2YA 3Q7FA 5CRVA 3JQ1A 1B89A 3G2WA 3V31A 1U3DA 5KWDA 1O1RA 2H6FA 3UM2A 1PC2A 3SBSA 4ME2A 3TXMA 1N94A 2KCVA 5ENNA 5E75A 1JCQA 1UG3A 4MS6A 4E6HA 4I9CA 3WG7E 2VSYA 4PDXA 5CBNA 5AQ7A 3L6AA 4ACLA 1HU3A 4CT0A 4XZ4A 4JW1A 5EKQD 5B3SE 3AU5A 5FQ7A 3LVRE 4GZ6A 2WXGA 4EQFA 5DIZA 3ZPJA 3QWVA 1KZOA 1MQSA 5BW8C 4XX5A 4GTVA 4IRUA 1LD7A 4GZDA 4N5CA 2WXLA 3ZYQA 4GZCA 1H0AA 2KZTB 1HE8A 2VTBB 3R9MA 4CEMA 1JCSA 3I4RB 2V8SE 3FEXA 4TXQA 2BKGA 1RZ4A 3RAUA 4G8KA 3V30A 5HQ8A 4FHJA 5EIDA 1S70B 3L08A 5H7PA 2AXZA 4I6JA 3UT7A 3CK7A 4TV3A 2XZTG 4EZKA 2QFCA 1INZA 4DLOA 2RG8A 3B95A 4G1TA 1TJFA 3FUIA 5BXOA 2OVFA 3HXBA 2L6BA 2A5EA 3X2QE 3RO2A 2CHZA 4F7AA 3I3NA 2L6JA 3QDNA 4GB9A 4JB8P 2I1KA 1SA4A 3FUMA 2GRPB 4J0UA 4YVQC 5FWQA 2WXJA 4Q69A 4ILHB 3MV2B 1H2VC 4OVVA 3LY7A 3QNKA 4L2LA 2X6HA 2P9IG 2WXNA 3EU5A 1KLXA 5BT1A 5KJKA 1JCRA 1BD8A 2OEWA 1OY3D 3D9KA 3ZRHA 1MZCA 3PUJA 4GMRA 2LNIA 2P2CP 3E30A 2QYUA 4V3IA 4PH4B 3TL5A 2FF4A 3CHOA 4HOTA 4X8QA 2IY0C 3BG0B 2X6KA 4A1GA 2KC7A 2ZISA 3OXGA 5KJLA 1IQRA 4F53A 1BLXB 3DRAA 3QARA 3ZU7B 5EILA 2VQ2A 2WMNA 3AS8A 4BSZB 4CDMA 2M63A 3DSSA 1S63A 3CVXA 3UM3A 4UI9K 2GROB 1HH8A 3S2AA 4FU3A 1Y6IA 2J9QA 2R5SA 1Z6TA 1N9AA 3CSFA 2R03A 3CIAA 3PRZA 4MBGA 4HB5A 4HOSA 3C3QA 3SBTB 3ENEA 5ENOD 3ZHEB 1OCZE 1AWCB 4HNAD 5G04J 2LUHA 4XI0A 5J90A 4AXHA 2VSOE 3MGBA 3HVEB 1UN9A 3CLJA 4CZ2D 2HE0A 5EX3A 5FZRA 1X81A 4BTBA 4G23A 5CCLA 1WY6A 3ZIMA 3UKUG 3W9FA 5JHBA 4ATZD 5T8IA 4K5BA 3NAWA 5D0OD 2P9LG 1K3ZD 4HOUA 3CVVA 4N39A 4RLYA 5G04C 3UM1A 2Y4TA 4JHKA 5J08A 1TEZA 2KM4A 5CHEE 4ANXA 1DNPA 5ENPD 3TWUA 2I6HA 3LJNA 4NQ0A 3RSEG 3HXFA 3CVWA 2NSZA 5JJTA 2BF0X 4F1SA 3BEEA 4ZFHA 3TG5A 3DSUA 4F6RD 2R2LA 2E0IA 1O1TA 5EIBE 4YVOA 1QYMA 3WXXA 1WM5A 3FEYA 3ISMC 4BX8A 1E8YA 3SNXA 4Z68A 3SD5A 4LNUD 1G3NB 2GRQB 2ONDA 4WWOA 4KVMA 3D9PA 5A6CA 2YHEA 4F3VA 1PAQA 3HYMB 1XNFA 4ATGA 4CGVA 5EDSA 4FHKA 2Y0BG 4GYWA 4G2VA 1SZ9A 2AXVA 3LJ3A 5IY5E 1WDYA 4GA1A 1RW2A 3IV0A 4K03A 4A55A 3T9KA 1E7VA 3TG4A 3B7UX 2XS8A 2QYJA 2FI7A 4JC8A 1P5QA 3UQ3A 1Z3XA 3ULQA 3CHPA 3TWSA 3NZUA 4J8YA 4YDEA 2PZIA 5KNHD 3UI2A 3KEAA 3JXIA 4DPRA 4HFGA 4JHRA 1TR4A 3VTYA 5B1BE 2HR2A 4EBAG 2OV8A 3JCKC 3EHNA 3UT8A 1OWPA 3D9HA 4OYSA 4D10C 2WXKA 3E34A 2BEDA 4ACKA 4U95D 3ZVVA 2L9BA 4H7YA 4KVOA 3CKCA 1MJ0A 4LNGA 2ZXWE 2WXHA 3SZ7A 4HBDA 3QJZA 2P9PG 4AM9A 1OT8A 5FT9A 3T8MA 3CQCB 4HRLA 3OXFA 1YCSB 3ZKJA 4WWNA 2EIJE 3GW4A 3B7SA 2RD0A 4JD2G 5LOZA 4GU5A 2JEKA 3DWLG 5BV1A 3LPZA 4WUYA 3EJNA 3FUJA 4UQYA 2IOLA 4B8CB 1LF8A 2VSXE 1OXJA 3MX3A 4A63B 3LYAA 3LVQE 3T8KA 2WXOA 2XEVA 4DX5D 4GYOA 4BT8A 3KS2A 2JABA 1A5EA 4C0EA 1IQUA 4EPZA 2CFZA 2GGFA 3HDXA 4CCAA 2LAIA 3P1UA 3UTMA 3FU0A 5ANRA 4YDYA 3E32A 4XI9A 2ETAA 4BETA 3FFLA 4DX1A 4F1PA 3Q75A 5T3RA 4GTRA 2A4ZA 1IXVA 5EYPF 1FT1A 4I1AA 2R17C 5G05C 1N4PA 4P29A 5CEDB 2X6IA 1EF1C 2PNNA 2V5FA 3KAEA 4UUCA 1TNUA 3R9AB 5G2NA 1H19A 2ZGDA 1BPOA 4KZCA 3E33A 3V79K 4N3CA 4W9RA 4BTAA 2QY7A 4IULA 1JWGA 3FP3A 2LAHA 3DSTA 5JHAA 4XEIG 1E90A 3ZUVB 4HORA 4EZJA 3QB2A 1HF8A 2J4BA 3N71A 4UWLA 3ZEFA 1HZ4A 1OCRE 3MZLB 5FQ6A 3ZXPA 4I9EA 2VJ8A 1FCHA 3GYZA 3FUKA 4Y6CA 3CV0A 2VYIA 3R7RA 4DUIA 3LCAA 4L23A 4FJZA 5FZQA 3ASOE 4DX7D 2P9KG 2R02A 1TNYA 1KPSB 2DZNA 2V4LA 4RQIA 1TN8A 3RIBA 2UWJG 1N52A 5KBAA 3ASNE 4CYMD 2AWIA 3EUVA 1NA0A 4EECA 4BFRA 3CEQA 1NA3A 1UW4B 3QOUA 2WQ6A 3ASHA 3CK8A 3S7JA 2VGXB 1FVHA 4ANWA 2CG2A 4J6IA 4BX9A 3EDTB 1X5BA 5DBKA 1TNOA 4I1MA 4AY6A 1MYOA 2I1JA 3AG2E 4N2QA 1KZPA 1FT2A 3K9IA 5JMND 1JPLA 5HI7A 4FA6A 4LUNU 2XPIA 3TWTA 3EIQC 1K1AA 2FULA 1HFAA 4KT6B 2BKKB 3R7QA 4DK5A 3L54A 2WXRA 1ZBPA 3ULEG 2DCPA 4U07A 3Q73A 5CRUA 1WAO1 4I2WA 4RG6A 3PEVB 3CVYA 3RKVA 2YQ8A 3CHQA 3ZFWA 3RU0A 2X38A 4U96D 3PS6A 4GA2A 2BTDA 5EX0A 3IKOB 3LY8A 3T5VA 2R05A 1FVFA 4WNGA 4EHMA 2YINA 1SZAA 2F0YA 4N3BA 5KNGA 3JQ0A 3FUEA 1PY1A 4DI4A 3HXDA 3QKYA 1XGWA 5FQ4A 4WNEA 4AV7A 5T4YA 3UXGA 4WAFA 3NBNB 3G2UA 2GRRB 4JXTA 2IO3C 3B7TA 1H2TC 5KJMA 3S7FA 3RJVA 4CT4A 3Q7AA 2GW1A 4JPSA 2A5UA 2L0TB 4YDWA 2WQ7A 2I2OA 4GYYA 2LXMA 4KZ0A 4KBQA 3TWVA 3ESLA 1YA0A 1TNBA 3CR3A 4U8HA 2P9SG 3Q15A 4QQIA 2IONA 3L13A 3C3RA 2WB2A 2LO6A 1EDUA 2MYOA 3UKRG 4G26A 1O1SA 1Z3YA 4FULA 3SQVA 3G2VA 3Q47B 4FC8A 1UJJA 4FADA 1K8KG 1ELWA 3PZ1A 2FBNA 3O4ZA 5JJ6A 3IXEA 4EBAA 4TXRA 4Q94A 2QZAA 5AQBA 4IN3B 4E85A 4FP7A 2J4DA 4ZHBA 5LCWJ 4AJWA 2C0MA 2WM9A 3FY4A 4UI9J 3D3MA 1EPUA 3PEUB 1LTXA 1E8WA 3O48A 3P2BA 1NP7A 1H6KA 4HLLA 3SY2A 4FJYA 1N54A 3FTXA 3BQOA 2XGSA 1YMPA 4ILGA 3SHFA 2IJGX 5E76A 3ZN3A 1NFIE 4B94A 4M7CA 4I6EA 2VTBA 4AY5A 1E8XA 1OWNA 4MRUA 3QC1A 4BSXA 4GA0A 4U0SA 3HVEA 4ILIA 3W9GA 2LXLA 3CHMA 3FUNA 1MX6A 2F8XK 4XKCA 4HQDA 4AP2A 2CFUA 4B93B 2FO1E 1W3BA 4UQXA 3FTWA 4FLBA 4K5AB 3UM0A 2OOEA 3ZYKA 3ZYLA 4U63A 3VLFA 4GMJA 4JZYA 2AXUA 1U2VG 2XEEA 2EIKE 3ABKE 1DCQA 3AAAC 2UY1A 4PS8A 3TGOA 4GZ3A 1SQMA 3I4GA 3PE3A 2GRNB 5FINA 3DPDA 5HKPA 4K0RA 2H6GA 2LSUA 3J5QB 3EHRA 1E8ZA 4JL0A 4L9PA 3D9OA 3TWQA 5BV0A 2IU1A 4C48B 3ONKA 1N0QA 4B8AA 5LX8A 3V2XA 1E96B 5CEAA 2DBAA 3FWVA 3ONLA 2P58C 2F37A 2OCCE 5ITZF 1ZB1A 2KATA 4UWFA 2KCLA 4N2SA 3ABLE 3E37A 3ASGA 2B0OE 2B6CA 3DSVA 3TWXA 2NC9A 3MA5A 2QC9A 4O60A 3C5RA 4GTMA 5LCWC 4JEHA 3MEKA 2PQNA 3C72A 3AS4A 3TWWA 3NB2A 5AARA 3C3OA 2J09A 3AG4E 4J8DA 4J7WA 2KZTA 1D8DA 1DVPA 3FU6A 4L1BA 2J08A 3APDA 4N3AA 4LRZA 1S0PA 2XCBA 1MX4A 1MX2A 2KCKA 3UT4A 3MKQB 4UWHA 4CDNA 3UX4A 4JEUA 5FTPA 1D8EA 4DRXE 4NIKA 4I17A 3ZNGA 1ELKA 2C0LA 4QFVA 3QK0A 3FTZA 3DEOA 3QAQA 1N11A 2DIWA 2Y3AA 4NACA 2HO1A 3SF4A 4HRNA 4WNDA 1K1BA 4GTSA 2IEJA 3NOCD 5D66A 2EINE 1N0RA 3SFYA 2IOSA 3RO3A 3RRUA 3TAXA 4KXKB 4CDRA 4OAVB 1H2UA 2CHWA 2NXPA 3FU5A 3SO8A 5AYWD 4A1SA 4GCNA 2ILRA 2WXQA 1NZNA 3PREA 3DBSA 5BUZA 4HVBA 2XPYA 1NL4A 3UIOC 4O1OA 2XZDG 3DEPA 3EU9A 3AG1E 4BT9A 4JHJA 2VGXA 1YYHA 2WXPA 2PL2A 3DPYA 2VGYA 4DLQA 3KD7A 4UQZA 4N5QA 3EIJA 4IYPA 4HS2A 5ENRD 3GZ2A 2FO7A 3L16A 4C0MA 3Q5MA 4LG6A 1QNFA 3S7DA 4DJAA 4MLPA 3G2SA 4UWKA 1OWLA 4GTQA 3UUXA 3NZSA 1SVXA 2V0PA 3APFA 3JYSA 2DZOA 3RK6A 3D9MA 3KSQA 4RG9A 4GTOA 5CECB 4GTPA 1N4QA 5LP0A 3FUFA 4OAUC 1H6PA 2ETCA 5AJDA 2IQCA 3Q78A 3RRMB 2H6IA 3LKUA 4LCTA 3ZXSA 1OCCE 4PUCA 4GPKA 1DC2A 1E7UA 1OWOA 3CHRA 4KYOB 5CERB 4U04A 3EHMA 3HRAA 2NYJA 3TXNA 3AS5A 1WG0A 2AW6A 3OTNA 3FH8A 3NQPA 3B13A 5M72A 1Z5SC 2XGOA 3U66A 5FZSA 3F6QA 1TYQG
chains in the Genus database with same CATH topology
3C5RA 1YYHA 3TWVA 3TWTA 4HRMB 1UOHA 1IHBA 4B93B 1WDYA 2FO1E 5CBNA 4QQIA 1K1AA 4N5QA 5AQ7A 2BKKB 3TWWA 1D9SA 5ENRD 5AARA 2MYOA 3ZUVB 5AAOA 2XENA 4K5AB 2V5QC 4J7WA 4CZ2D 4BEPA 1AP7A 2HE0A 3T9KA 3J5PA 4LG6A 3HG0D 5HRYA 2QYJA 1BD8A 3JUEA 5FIOA 4A63B 1OY3D 1MX4A 1MX2A 3W9FA 2ETBA 2XEEA 4ATZD 3T8KA 3AJIA 4K5BA 2RFMA 4BESA 2DWZA 3IXEA 3TWSA 1SVXA 2V4HC 5AN8A 4U96D 4HQDA 4J8YA 1DCQA 1K3ZD 3AAAC 2ZGGA 4DRXE 1BI8B 4DX5D 4NIKA 4TUMA 5AQBA 2DZOA 4GMRA 5ENTD 1BU9A 2P2CP 5KNHD 3ZNGA 3UI2A 4ZHBA 5FINA 3KEAA 3JXJA 2JABA 4DUIA 5HKPA 1A5EA 4QFVA 4RLYA 3NOGD 3V2OA 3JXIA 5CECB 3J5QB 3EHRA 3DEOA 5ENSD 5KNGA 1TR4A 5AQAA 1N11A 4DX6D 4DX7D 4DX2A 4OAUC 2BKGA 2VGEA 2ETCA 2KXPC 5ENPD 4LSZE 3UTMA 4G8KA 2DZNA 2AJAA 3TWUA 4HRNA 4YDYA 3TWQA 4O1PA 1BLXB 3LJNA 4HLLA 2DVWA 3V30A 5KBAA 4CYMD 4K5CA 4U8VD 1K1BA 5EIDA 3ZU7B 2J8SD 2ETAA 1S70B 3D9HA 5EILA 5CBOA 4BETA 1YMPA 2RFAA 3UXGA 3NBNB 3NOCD 5D66A 4BERA 4DX1A 4BSZB 5BXUA 4U8YD 4ZFHA 4F1PA 2XZTG 4C48B 4U95D 1N0QA 1NFIE 3Q9UC 3EHQA 3B95A 1N0RA 3V2XA 4F6RD 1DC2A 5BXOA 4HI8A 1IXVA 4G8LA 5EYLA 5HS0A 5EYPF 1QYMA 5CEAA 1MJ0A 5EIBE 2L6BA 2F8YA 5CERB 1IKND 2F37A 5ITZF 5CEDB 2A5EA 3HRAA 2NYJA 2PNNA 4HBDA 4UUCA 3Q9NC 1SW6A 3V31A 5ENQD 5KWDA 4OAVB 4GPMA 4YDWA 3SO8A 1OT8A 3B7BA 2ZGDA 2B0OE 3W9GA 1WG0A 4Z68A 5JA4D 3V79K 4LNUD 4HRLA 1G3NB 1MYOA 2XEHA 5AQ9A 1MX6A 4HB5A 1YCSB 3TWXA 3ZKJA 4JB8P 4O1OA 2XZDG 3DEPA 2Y1LE 3EU9A 5EN5D 2F8XK 4HI9A 5ENOD 2QC9A 3TWRA 1AWCB 4O60A 3F6QA 4HNAD 5JMND 2KBXA 1BI7B 2Y0BG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5R A;  1YYH A;  3TWV A;  3TWT A;  4HRM B;  1UOH A;  1IHB A;  4B93 B;  1WDY A;  2FO1 E;  5CBN A;  4QQI A;  1K1A A;  4N5Q A;  5AQ7 A;  2BKK B;  3TWW A;  1D9S A;  5ENR D;  5AAR A;  2MYO A;  3ZUV B;  5AAO A;  2XEN A;  4K5A B;  2V5Q C;  4J7W A;  4CZ2 D;  4BEP A;  1AP7 A;  2HE0 A;  3T9K A;  3J5P A;  4LG6 A;  3HG0 D;  5HRY A;  2QYJ A;  1BD8 A;  3JUE A;  5FIO A;  4A63 B;  1OY3 D;  1MX4 A;  1MX2 A;  3W9F A;  2ETB A;  2XEE A;  4ATZ D;  3T8K A;  3AJI A;  4K5B A;  2RFM A;  4BES A;  2DWZ A;  3IXE A;  3TWS A;  1SVX A;  2V4H C;  5AN8 A;  4U96 D;  4HQD A;  4J8Y A;  1DCQ A;  1K3Z D;  3AAA C;  2ZGG A;  4DRX E;  1BI8 B;  4DX5 D;  4NIK A;  4TUM A;  5AQB A;  2DZO A;  4GMR A;  5ENT D;  1BU9 A;  2P2C P;  5KNH D;  3ZNG A;  3UI2 A;  4ZHB A;  5FIN A;  3KEA A;  3JXJ A;  2JAB A;  4DUI A;  5HKP A;  1A5E A;  4QFV A;  4RLY A;  3NOG D;  3V2O A;  3JXI A;  5CEC B;  3J5Q B;  3EHR A;  3DEO A;  5ENS D;  5KNG A;  1TR4 A;  5AQA A;  1N11 A;  4DX6 D;  4DX7 D;  4DX2 A;  4OAU C;  2BKG A;  2VGE A;  2ETC A;  2KXP C;  5ENP D;  4LSZ E;  3UTM A;  4G8K A;  2DZN A;  2AJA A;  3TWU A;  4HRN A;  4YDY A;  3TWQ A;  4O1P A;  1BLX B;  3LJN A;  4HLL A;  2DVW A;  3V30 A;  5KBA A;  4CYM D;  4K5C A;  4U8V D;  1K1B A;  5EID A;  3ZU7 B;  2J8S D;  2ETA A;  1S70 B;  3D9H A;  5EIL A;  5CBO A;  4BET A;  1YMP A;  2RFA A;  3UXG A;  3NBN B;  3NOC D;  5D66 A;  4BER A;  4DX1 A;  4BSZ B;  5BXU A;  4U8Y D;  4ZFH A;  4F1P A;  2XZT G;  4C48 B;  4U95 D;  1N0Q A;  1NFI E;  3Q9U C;  3EHQ A;  3B95 A;  1N0R A;  3V2X A;  4F6R D;  1DC2 A;  5BXO A;  4HI8 A;  1IXV A;  4G8L A;  5EYL A;  5HS0 A;  5EYP F;  1QYM A;  5CEA A;  1MJ0 A;  5EIB E;  2L6B A;  2F8Y A;  5CER B;  1IKN D;  2F37 A;  5ITZ F;  5CED B;  2A5E A;  3HRA A;  2NYJ A;  2PNN A;  4HBD A;  4UUC A;  3Q9N C;  1SW6 A;  3V31 A;  5ENQ D;  5KWD A;  4OAV B;  4GPM A;  4YDW A;  3SO8 A;  1OT8 A;  3B7B A;  2ZGD A;  2B0O E;  3W9G A;  1WG0 A;  4Z68 A;  5JA4 D;  3V79 K;  4LNU D;  4HRL A;  1G3N B;  1MYO A;  2XEH A;  5AQ9 A;  1MX6 A;  4HB5 A;  1YCS B;  3TWX A;  3ZKJ A;  4JB8 P;  4O1O A;  2XZD G;  3DEP A;  2Y1L E;  3EU9 A;  5EN5 D;  2F8X K;  4HI9 A;  5ENO D;  2QC9 A;  3TWR A;  1AWC B;  4O60 A;  3F6Q A;  4HNA D;  5JMN D;  2KBX A;  1BI7 B;  2Y0B G; 
#chains in the Genus database with same CATH topology
 2MOW A;  3LEW A;  3DXM G;  4AEZ C;  2UY1 B;  1D9S A;  1NI1 A;  2WMO A;  2WPV A;  3FUL A;  2IO2 C;  3L22 A;  3FTY A;  2C2L A;  1ZU2 A;  3U64 A;  3L9T A;  2OEV A;  4A3V A;  3JUE A;  3VLE A;  4TUU A;  3PZ4 A;  4GZ5 A;  4URK A;  3D9J A;  4I6G A;  4JVS A;  3JXJ A;  3CK9 A;  3FTV A;  4Y6W A;  3ML9 A;  5AQA A;  2MHK A;  3HIZ A;  3SFX A;  4XIF A;  2CG3 A;  4APO A;  2J49 A;  3SGH A;  4O1P A;  1LD8 A;  2YHC A;  2RKK A;  4FLH A;  2EIM E;  3EHQ A;  2WVI A;  4HXI A;  3PNT B;  1O5M A;  1QQE A;  1FPP A;  3CVN A;  4NUR A;  2WQH A;  1U3C A;  2F8Y A;  1IKN D;  3UMV A;  1OWM A;  3S7B A;  4U0U A;  3MCX A;  4OVU A;  4WWP A;  3DSW A;  5ENQ D;  5B1A E;  4XE0 A;  3PZ3 A;  1GW6 A;  2XQ0 A;  1HG2 A;  5AQ9 A;  2X6J A;  1HX8 A;  4PS7 A;  1SA5 A;  4HI9 A;  3ZW3 A;  3PZD A;  2E2E A;  4GML A;  1UN8 A;  3LXU X;  3FUH A;  4EZL A;  1UOH A;  4DI3 A;  3MKQ A;  3PE4 A;  5AEN A;  3T5X A;  4U0Z A;  3Q79 A;  1AP7 A;  3AU4 A;  4GAA A;  5KJN A;  3ZHE A;  1A17 A;  2GRM A;  5BNW A;  3U3W A;  2HYZ A;  4TUM A;  5ENT D;  1BU9 A;  4AOF A;  2XPZ A;  3RRN B;  3KSL A;  3B7R L;  2EQX A;  3FU3 A;  1QBQ A;  4LSZ E;  3GZ1 A;  2DVW A;  1N4S A;  2J8S D;  1MHQ A;  2R59 A;  3ULY A;  3UIP C;  4J8S A;  2XRZ A;  4B89 A;  3TJP A;  5D2M C;  5HS0 A;  5AJL A;  4B0Z A;  4GCO A;  2Y69 E;  4LEU A;  5C1D A;  4ANV A;  2XRY A;  3ASD A;  3ZGQ A;  3Q9N C;  4PS3 A;  1OCO E;  3PNL B;  5FJY A;  3FUD A;  4BWR A;  1TNZ A;  4G11 A;  1Y8M A;  4L7T A;  2X3M A;  3BUA A;  1QZ2 A;  2Y1L E;  5EN5 D;  3AG3 E;  2KBX A;  2AVP A;  3JUI A;  2PQR A;  5AIJ A;  3DXK G;  4TXP A;  3GZS A;  2YNQ A;  5AAO A;  2XEN A;  3APC A;  4Q96 A;  2V5Q C;  2XGM A;  3J5P A;  2BUG A;  3FH7 A;  3CGH A;  5HRY A;  5ARG A;  5D0Q D;  2PM7 A;  3BG1 B;  3IEG A;  3I5P A;  4YND A;  1HO8 A;  3UPV A;  2HM8 A;  1VDY A;  2XS1 A;  4JA7 A;  4G25 A;  5CMY A;  5JJ7 A;  4RSY A;  3OXL A;  4I1O B;  4CGW A;  4KMO A;  3HXE A;  5ENS D;  3U9W A;  4XKB A;  2Y4U A;  3HXC A;  1N4R A;  4J8F A;  2KXP C;  1L5J A;  4UI9 C;  1N95 A;  1V54 E;  1IHG A;  3VLD A;  5BXU A;  3QWP A;  2L0I A;  3Q9U C;  3ZYM A;  4UWG A;  1TN6 A;  3L82 A;  1H6O A;  3PDN A;  5CCM A;  3CST A;  1SW6 A;  3OAW A;  2VSN A;  3CVU A;  5G55 A;  3B7B A;  3LS8 A;  4GTT A;  5FQ8 A;  5LFA A;  3PZ2 A;  3TWR A;  4J8E A;  1BI7 B;  3ABM E;  1HXI A;  1ELR A;  1TN7 A;  1S64 A;  1UJK A;  4HRM B;  4AVX A;  3NF1 A;  4APF A;  4M3O A;  5KCM A;  2P9U G;  3CVP A;  3L17 A;  4BEP A;  4LER A;  1JUQ A;  2ZIR A;  3FTU A;  3G2T A;  4G24 A;  5A7D B;  3HG0 D;  3IHV A;  4MKT A;  2WXI A;  5FIO A;  2ETB A;  3E4B A;  4YDO A;  3D9L A;  3AJI A;  3SFZ A;  2V4H C;  2I9C A;  4JA9 A;  2CHX A;  2ZGG A;  3LDZ A;  2WXM A;  2IFU A;  3PUK A;  1KT0 A;  3NOG D;  2DYS E;  1OUV A;  4HLE A;  5C2Y A;  2VGE A;  1JWF A;  3FHE A;  2FEZ A;  3C98 A;  3FDH A;  4O6F A;  3MYV A;  4K5C A;  4U8V D;  2RFA A;  3FH5 A;  2XHE A;  3ASF A;  3CQG B;  5ARF A;  4C9B B;  4HI8 A;  3SI5 A;  4G8L A;  5EYL A;  3IBE A;  2J07 A;  5ANL A;  2WXF A;  2XCC A;  3ESK A;  3U4T A;  4GPM A;  4BY6 A;  3D9I A;  3LY9 A;  5JA4 D;  1HG5 A;  2X6F A;  2XEH A;  3Q49 B;  3KEZ A;  4LNB A;  2PM6 A;  3D9N A;  4NRH B;  1TJC A;  3Q4A B;  2JLB A;  2Q7F A;  2IF4 A;  3MV3 B;  1IHB A;  4WNF A;  5BPP A;  2DYR E;  3CVQ A;  4A3T A;  5A23 A;  4I43 A;  1Q2Z A;  4R7L A;  1KT1 A;  2EIL E;  3CHS A;  1V55 E;  4AIF A;  2ZU6 B;  2RFM A;  4BES A;  2DWZ A;  5AN8 A;  3MKR A;  3URZ A;  4ANU A;  3CVL A;  1BI8 B;  1IYG A;  4RVB A;  2GRL A;  4U7E B;  5CMW A;  3BU8 A;  3MJW A;  4H7X A;  4TRQ A;  3V2O A;  2H6H A;  4ABN A;  3VTX A;  3FTS A;  4DX6 D;  4DX2 A;  3UIN C;  2P9N G;  2AJA A;  2LSV A;  3CKB A;  3HHM A;  3PH0 C;  3QWW A;  3PVL A;  5CBO A;  1HS6 A;  4BER A;  4HOQ A;  4I2Z A;  1DCE A;  3DSX A;  4U8Y D;  5G05 J;  2OVB A;  1EYH A;  3IHY A;  4CRW A;  2MRI A;  3ML8 A;  4L2Y A;  3Q7F A;  5CRV A;  3JQ1 A;  1B89 A;  3G2W A;  3V31 A;  1U3D A;  5KWD A;  1O1R A;  2H6F A;  3UM2 A;  1PC2 A;  3SBS A;  4ME2 A;  3TXM A;  1N94 A;  2KCV A;  5ENN A;  5E75 A;  1JCQ A;  1UG3 A;  4MS6 A;  4E6H A;  4I9C A;  3WG7 E;  2VSY A;  4PDX A;  5CBN A;  5AQ7 A;  3L6A A;  4ACL A;  1HU3 A;  4CT0 A;  4XZ4 A;  4JW1 A;  5EKQ D;  5B3S E;  3AU5 A;  5FQ7 A;  3LVR E;  4GZ6 A;  2WXG A;  4EQF A;  5DIZ A;  3ZPJ A;  3QWV A;  1KZO A;  1MQS A;  5BW8 C;  4XX5 A;  4GTV A;  4IRU A;  1LD7 A;  4GZD A;  4N5C A;  2WXL A;  3ZYQ A;  4GZC A;  1H0A A;  2KZT B;  1HE8 A;  2VTB B;  3R9M A;  4CEM A;  1JCS A;  3I4R B;  2V8S E;  3FEX A;  4TXQ A;  2BKG A;  1RZ4 A;  3RAU A;  4G8K A;  3V30 A;  5HQ8 A;  4FHJ A;  5EID A;  1S70 B;  3L08 A;  5H7P A;  2AXZ A;  4I6J A;  3UT7 A;  3CK7 A;  4TV3 A;  2XZT G;  4EZK A;  2QFC A;  1INZ A;  4DLO A;  2RG8 A;  3B95 A;  4G1T A;  1TJF A;  3FUI A;  5BXO A;  2OVF A;  3HXB A;  2L6B A;  2A5E A;  3X2Q E;  3RO2 A;  2CHZ A;  4F7A A;  3I3N A;  2L6J A;  3QDN A;  4GB9 A;  4JB8 P;  2I1K A;  1SA4 A;  3FUM A;  2GRP B;  4J0U A;  4YVQ C;  5FWQ A;  2WXJ A;  4Q69 A;  4ILH B;  3MV2 B;  1H2V C;  4OVV A;  3LY7 A;  3QNK A;  4L2L A;  2X6H A;  2P9I G;  2WXN A;  3EU5 A;  1KLX A;  5BT1 A;  5KJK A;  1JCR A;  1BD8 A;  2OEW A;  1OY3 D;  3D9K A;  3ZRH A;  1MZC A;  3PUJ A;  4GMR A;  2LNI A;  2P2C P;  3E30 A;  2QYU A;  4V3I A;  4PH4 B;  3TL5 A;  2FF4 A;  3CHO A;  4HOT A;  4X8Q A;  2IY0 C;  3BG0 B;  2X6K A;  4A1G A;  2KC7 A;  2ZIS A;  3OXG A;  5KJL A;  1IQR A;  4F53 A;  1BLX B;  3DRA A;  3QAR A;  3ZU7 B;  5EIL A;  2VQ2 A;  2WMN A;  3AS8 A;  4BSZ B;  4CDM A;  2M63 A;  3DSS A;  1S63 A;  3CVX A;  3UM3 A;  4UI9 K;  2GRO B;  1HH8 A;  3S2A A;  4FU3 A;  1Y6I A;  2J9Q A;  2R5S A;  1Z6T A;  1N9A A;  3CSF A;  2R03 A;  3CIA A;  3PRZ A;  4MBG A;  4HB5 A;  4HOS A;  3C3Q A;  3SBT B;  3ENE A;  5ENO D;  3ZHE B;  1OCZ E;  1AWC B;  4HNA D;  5G04 J;  2LUH A;  4XI0 A;  5J90 A;  4AXH A;  2VSO E;  3MGB A;  3HVE B;  1UN9 A;  3CLJ A;  4CZ2 D;  2HE0 A;  5EX3 A;  5FZR A;  1X81 A;  4BTB A;  4G23 A;  5CCL A;  1WY6 A;  3ZIM A;  3UKU G;  3W9F A;  5JHB A;  4ATZ D;  5T8I A;  4K5B A;  3NAW A;  5D0O D;  2P9L G;  1K3Z D;  4HOU A;  3CVV A;  4N39 A;  4RLY A;  5G04 C;  3UM1 A;  2Y4T A;  4JHK A;  5J08 A;  1TEZ A;  2KM4 A;  5CHE E;  4ANX A;  1DNP A;  5ENP D;  3TWU A;  2I6H A;  3LJN A;  4NQ0 A;  3RSE G;  3HXF A;  3CVW A;  2NSZ A;  5JJT A;  2BF0 X;  4F1S A;  3BEE A;  4ZFH A;  3TG5 A;  3DSU A;  4F6R D;  2R2L A;  2E0I A;  1O1T A;  5EIB E;  4YVO A;  1QYM A;  3WXX A;  1WM5 A;  3FEY A;  3ISM C;  4BX8 A;  1E8Y A;  3SNX A;  4Z68 A;  3SD5 A;  4LNU D;  1G3N B;  2GRQ B;  2OND A;  4WWO A;  4KVM A;  3D9P A;  5A6C A;  2YHE A;  4F3V A;  1PAQ A;  3HYM B;  1XNF A;  4ATG A;  4CGV A;  5EDS A;  4FHK A;  2Y0B G;  4GYW A;  4G2V A;  1SZ9 A;  2AXV A;  3LJ3 A;  5IY5 E;  1WDY A;  4GA1 A;  1RW2 A;  3IV0 A;  4K03 A;  4A55 A;  3T9K A;  1E7V A;  3TG4 A;  3B7U X;  2XS8 A;  2QYJ A;  2FI7 A;  4JC8 A;  1P5Q A;  3UQ3 A;  1Z3X A;  3ULQ A;  3CHP A;  3TWS A;  3NZU A;  4J8Y A;  4YDE A;  2PZI A;  5KNH D;  3UI2 A;  3KEA A;  3JXI A;  4DPR A;  4HFG A;  4JHR A;  1TR4 A;  3VTY A;  5B1B E;  2HR2 A;  4EBA G;  2OV8 A;  3JCK C;  3EHN A;  3UT8 A;  1OWP A;  3D9H A;  4OYS A;  4D10 C;  2WXK A;  3E34 A;  2BED A;  4ACK A;  4U95 D;  3ZVV A;  2L9B A;  4H7Y A;  4KVO A;  3CKC A;  1MJ0 A;  4LNG A;  2ZXW E;  2WXH A;  3SZ7 A;  4HBD A;  3QJZ A;  2P9P G;  4AM9 A;  1OT8 A;  5FT9 A;  3T8M A;  3CQC B;  4HRL A;  3OXF A;  1YCS B;  3ZKJ A;  4WWN A;  2EIJ E;  3GW4 A;  3B7S A;  2RD0 A;  4JD2 G;  5LOZ A;  4GU5 A;  2JEK A;  3DWL G;  5BV1 A;  3LPZ A;  4WUY A;  3EJN A;  3FUJ A;  4UQY A;  2IOL A;  4B8C B;  1LF8 A;  2VSX E;  1OXJ A;  3MX3 A;  4A63 B;  3LYA A;  3LVQ E;  3T8K A;  2WXO A;  2XEV A;  4DX5 D;  4GYO A;  4BT8 A;  3KS2 A;  2JAB A;  1A5E A;  4C0E A;  1IQU A;  4EPZ A;  2CFZ A;  2GGF A;  3HDX A;  4CCA A;  2LAI A;  3P1U A;  3UTM A;  3FU0 A;  5ANR A;  4YDY A;  3E32 A;  4XI9 A;  2ETA A;  4BET A;  3FFL A;  4DX1 A;  4F1P A;  3Q75 A;  5T3R A;  4GTR A;  2A4Z A;  1IXV A;  5EYP F;  1FT1 A;  4I1A A;  2R17 C;  5G05 C;  1N4P A;  4P29 A;  5CED B;  2X6I A;  1EF1 C;  2PNN A;  2V5F A;  3KAE A;  4UUC A;  1TNU A;  3R9A B;  5G2N A;  1H19 A;  2ZGD A;  1BPO A;  4KZC A;  3E33 A;  3V79 K;  4N3C A;  4W9R A;  4BTA A;  2QY7 A;  4IUL A;  1JWG A;  3FP3 A;  2LAH A;  3DST A;  5JHA A;  4XEI G;  1E90 A;  3ZUV B;  4HOR A;  4EZJ A;  3QB2 A;  1HF8 A;  2J4B A;  3N71 A;  4UWL A;  3ZEF A;  1HZ4 A;  1OCR E;  3MZL B;  5FQ6 A;  3ZXP A;  4I9E A;  2VJ8 A;  1FCH A;  3GYZ A;  3FUK A;  4Y6C A;  3CV0 A;  2VYI A;  3R7R A;  4DUI A;  3LCA A;  4L23 A;  4FJZ A;  5FZQ A;  3ASO E;  4DX7 D;  2P9K G;  2R02 A;  1TNY A;  1KPS B;  2DZN A;  2V4L A;  4RQI A;  1TN8 A;  3RIB A;  2UWJ G;  1N52 A;  5KBA A;  3ASN E;  4CYM D;  2AWI A;  3EUV A;  1NA0 A;  4EEC A;  4BFR A;  3CEQ A;  1NA3 A;  1UW4 B;  3QOU A;  2WQ6 A;  3ASH A;  3CK8 A;  3S7J A;  2VGX B;  1FVH A;  4ANW A;  2CG2 A;  4J6I A;  4BX9 A;  3EDT B;  1X5B A;  5DBK A;  1TNO A;  4I1M A;  4AY6 A;  1MYO A;  2I1J A;  3AG2 E;  4N2Q A;  1KZP A;  1FT2 A;  3K9I A;  5JMN D;  1JPL A;  5HI7 A;  4FA6 A;  4LUN U;  2XPI A;  3TWT A;  3EIQ C;  1K1A A;  2FUL A;  1HFA A;  4KT6 B;  2BKK B;  3R7Q A;  4DK5 A;  3L54 A;  2WXR A;  1ZBP A;  3ULE G;  2DCP A;  4U07 A;  3Q73 A;  5CRU A;  1WAO 1;  4I2W A;  4RG6 A;  3PEV B;  3CVY A;  3RKV A;  2YQ8 A;  3CHQ A;  3ZFW A;  3RU0 A;  2X38 A;  4U96 D;  3PS6 A;  4GA2 A;  2BTD A;  5EX0 A;  3IKO B;  3LY8 A;  3T5V A;  2R05 A;  1FVF A;  4WNG A;  4EHM A;  2YIN A;  1SZA A;  2F0Y A;  4N3B A;  5KNG A;  3JQ0 A;  3FUE A;  1PY1 A;  4DI4 A;  3HXD A;  3QKY A;  1XGW A;  5FQ4 A;  4WNE A;  4AV7 A;  5T4Y A;  3UXG A;  4WAF A;  3NBN B;  3G2U A;  2GRR B;  4JXT A;  2IO3 C;  3B7T A;  1H2T C;  5KJM A;  3S7F A;  3RJV A;  4CT4 A;  3Q7A A;  2GW1 A;  4JPS A;  2A5U A;  2L0T B;  4YDW A;  2WQ7 A;  2I2O A;  4GYY A;  2LXM A;  4KZ0 A;  4KBQ A;  3TWV A;  3ESL A;  1YA0 A;  1TNB A;  3CR3 A;  4U8H A;  2P9S G;  3Q15 A;  4QQI A;  2ION A;  3L13 A;  3C3R A;  2WB2 A;  2LO6 A;  1EDU A;  2MYO A;  3UKR G;  4G26 A;  1O1S A;  1Z3Y A;  4FUL A;  3SQV A;  3G2V A;  3Q47 B;  4FC8 A;  1UJJ A;  4FAD A;  1K8K G;  1ELW A;  3PZ1 A;  2FBN A;  3O4Z A;  5JJ6 A;  3IXE A;  4EBA A;  4TXR A;  4Q94 A;  2QZA A;  5AQB A;  4IN3 B;  4E85 A;  4FP7 A;  2J4D A;  4ZHB A;  5LCW J;  4AJW A;  2C0M A;  2WM9 A;  3FY4 A;  4UI9 J;  3D3M A;  1EPU A;  3PEU B;  1LTX A;  1E8W A;  3O48 A;  3P2B A;  1NP7 A;  1H6K A;  4HLL A;  3SY2 A;  4FJY A;  1N54 A;  3FTX A;  3BQO A;  2XGS A;  1YMP A;  4ILG A;  3SHF A;  2IJG X;  5E76 A;  3ZN3 A;  1NFI E;  4B94 A;  4M7C A;  4I6E A;  2VTB A;  4AY5 A;  1E8X A;  1OWN A;  4MRU A;  3QC1 A;  4BSX A;  4GA0 A;  4U0S A;  3HVE A;  4ILI A;  3W9G A;  2LXL A;  3CHM A;  3FUN A;  1MX6 A;  2F8X K;  4XKC A;  4HQD A;  4AP2 A;  2CFU A;  4B93 B;  2FO1 E;  1W3B A;  4UQX A;  3FTW A;  4FLB A;  4K5A B;  3UM0 A;  2OOE A;  3ZYK A;  3ZYL A;  4U63 A;  3VLF A;  4GMJ A;  4JZY A;  2AXU A;  1U2V G;  2XEE A;  2EIK E;  3ABK E;  1DCQ A;  3AAA C;  2UY1 A;  4PS8 A;  3TGO A;  4GZ3 A;  1SQM A;  3I4G A;  3PE3 A;  2GRN B;  5FIN A;  3DPD A;  5HKP A;  4K0R A;  2H6G A;  2LSU A;  3J5Q B;  3EHR A;  1E8Z A;  4JL0 A;  4L9P A;  3D9O A;  3TWQ A;  5BV0 A;  2IU1 A;  4C48 B;  3ONK A;  1N0Q A;  4B8A A;  5LX8 A;  3V2X A;  1E96 B;  5CEA A;  2DBA A;  3FWV A;  3ONL A;  2P58 C;  2F37 A;  2OCC E;  5ITZ F;  1ZB1 A;  2KAT A;  4UWF A;  2KCL A;  4N2S A;  3ABL E;  3E37 A;  3ASG A;  2B0O E;  2B6C A;  3DSV A;  3TWX A;  2NC9 A;  3MA5 A;  2QC9 A;  4O60 A;  3C5R A;  4GTM A;  5LCW C;  4JEH A;  3MEK A;  2PQN A;  3C72 A;  3AS4 A;  3TWW A;  3NB2 A;  5AAR A;  3C3O A;  2J09 A;  3AG4 E;  4J8D A;  4J7W A;  2KZT A;  1D8D A;  1DVP A;  3FU6 A;  4L1B A;  2J08 A;  3APD A;  4N3A A;  4LRZ A;  1S0P A;  2XCB A;  1MX4 A;  1MX2 A;  2KCK A;  3UT4 A;  3MKQ B;  4UWH A;  4CDN A;  3UX4 A;  4JEU A;  5FTP A;  1D8E A;  4DRX E;  4NIK A;  4I17 A;  3ZNG A;  1ELK A;  2C0L A;  4QFV A;  3QK0 A;  3FTZ A;  3DEO A;  3QAQ A;  1N11 A;  2DIW A;  2Y3A A;  4NAC A;  2HO1 A;  3SF4 A;  4HRN A;  4WND A;  1K1B A;  4GTS A;  2IEJ A;  3NOC D;  5D66 A;  2EIN E;  1N0R A;  3SFY A;  2IOS A;  3RO3 A;  3RRU A;  3TAX A;  4KXK B;  4CDR A;  4OAV B;  1H2U A;  2CHW A;  2NXP A;  3FU5 A;  3SO8 A;  5AYW D;  4A1S A;  4GCN A;  2ILR A;  2WXQ A;  1NZN A;  3PRE A;  3DBS A;  5BUZ A;  4HVB A;  2XPY A;  1NL4 A;  3UIO C;  4O1O A;  2XZD G;  3DEP A;  3EU9 A;  3AG1 E;  4BT9 A;  4JHJ A;  2VGX A;  1YYH A;  2WXP A;  2PL2 A;  3DPY A;  2VGY A;  4DLQ A;  3KD7 A;  4UQZ A;  4N5Q A;  3EIJ A;  4IYP A;  4HS2 A;  5ENR D;  3GZ2 A;  2FO7 A;  3L16 A;  4C0M A;  3Q5M A;  4LG6 A;  1QNF A;  3S7D A;  4DJA A;  4MLP A;  3G2S A;  4UWK A;  1OWL A;  4GTQ A;  3UUX A;  3NZS A;  1SVX A;  2V0P A;  3APF A;  3JYS A;  2DZO A;  3RK6 A;  3D9M A;  3KSQ A;  4RG9 A;  4GTO A;  5CEC B;  4GTP A;  1N4Q A;  5LP0 A;  3FUF A;  4OAU C;  1H6P A;  2ETC A;  5AJD A;  2IQC A;  3Q78 A;  3RRM B;  2H6I A;  3LKU A;  4LCT A;  3ZXS A;  1OCC E;  4PUC A;  4GPK A;  1DC2 A;  1E7U A;  1OWO A;  3CHR A;  4KYO B;  5CER B;  4U04 A;  3EHM A;  3HRA A;  2NYJ A;  3TXN A;  3AS5 A;  1WG0 A;  2AW6 A;  3OTN A;  3FH8 A;  3NQP A;  3B13 A;  5M72 A;  1Z5S C;  2XGO A;  3U66 A;  5FZS A;  3F6Q A;  1TYQ G; 
#chains in the Genus database with same CATH homology
 3C5R A;  1YYH A;  3TWV A;  3TWT A;  4HRM B;  1UOH A;  1IHB A;  4B93 B;  1WDY A;  2FO1 E;  5CBN A;  4QQI A;  1K1A A;  4N5Q A;  5AQ7 A;  2BKK B;  3TWW A;  1D9S A;  5ENR D;  5AAR A;  2MYO A;  3ZUV B;  5AAO A;  2XEN A;  4K5A B;  2V5Q C;  4J7W A;  4CZ2 D;  4BEP A;  1AP7 A;  2HE0 A;  3T9K A;  3J5P A;  4LG6 A;  3HG0 D;  5HRY A;  2QYJ A;  1BD8 A;  3JUE A;  5FIO A;  4A63 B;  1OY3 D;  1MX4 A;  1MX2 A;  3W9F A;  2ETB A;  2XEE A;  4ATZ D;  3T8K A;  3AJI A;  4K5B A;  2RFM A;  4BES A;  2DWZ A;  3IXE A;  3TWS A;  1SVX A;  2V4H C;  5AN8 A;  4U96 D;  4HQD A;  4J8Y A;  1DCQ A;  1K3Z D;  3AAA C;  2ZGG A;  4DRX E;  1BI8 B;  4DX5 D;  4NIK A;  4TUM A;  5AQB A;  2DZO A;  4GMR A;  5ENT D;  1BU9 A;  2P2C P;  5KNH D;  3ZNG A;  3UI2 A;  4ZHB A;  5FIN A;  3KEA A;  3JXJ A;  2JAB A;  4DUI A;  5HKP A;  1A5E A;  4QFV A;  4RLY A;  3NOG D;  3V2O A;  3JXI A;  5CEC B;  3J5Q B;  3EHR A;  3DEO A;  5ENS D;  5KNG A;  1TR4 A;  5AQA A;  1N11 A;  4DX6 D;  4DX7 D;  4DX2 A;  4OAU C;  2BKG A;  2VGE A;  2ETC A;  2KXP C;  5ENP D;  4LSZ E;  3UTM A;  4G8K A;  2DZN A;  2AJA A;  3TWU A;  4HRN A;  4YDY A;  3TWQ A;  4O1P A;  1BLX B;  3LJN A;  4HLL A;  2DVW A;  3V30 A;  5KBA A;  4CYM D;  4K5C A;  4U8V D;  1K1B A;  5EID A;  3ZU7 B;  2J8S D;  2ETA A;  1S70 B;  3D9H A;  5EIL A;  5CBO A;  4BET A;  1YMP A;  2RFA A;  3UXG A;  3NBN B;  3NOC D;  5D66 A;  4BER A;  4DX1 A;  4BSZ B;  5BXU A;  4U8Y D;  4ZFH A;  4F1P A;  2XZT G;  4C48 B;  4U95 D;  1N0Q A;  1NFI E;  3Q9U C;  3EHQ A;  3B95 A;  1N0R A;  3V2X A;  4F6R D;  1DC2 A;  5BXO A;  4HI8 A;  1IXV A;  4G8L A;  5EYL A;  5HS0 A;  5EYP F;  1QYM A;  5CEA A;  1MJ0 A;  5EIB E;  2L6B A;  2F8Y A;  5CER B;  1IKN D;  2F37 A;  5ITZ F;  5CED B;  2A5E A;  3HRA A;  2NYJ A;  2PNN A;  4HBD A;  4UUC A;  3Q9N C;  1SW6 A;  3V31 A;  5ENQ D;  5KWD A;  4OAV B;  4GPM A;  4YDW A;  3SO8 A;  1OT8 A;  3B7B A;  2ZGD A;  2B0O E;  3W9G A;  1WG0 A;  4Z68 A;  5JA4 D;  3V79 K;  4LNU D;  4HRL A;  1G3N B;  1MYO A;  2XEH A;  5AQ9 A;  1MX6 A;  4HB5 A;  1YCS B;  3TWX A;  3ZKJ A;  4JB8 P;  4O1O A;  2XZD G;  3DEP A;  2Y1L E;  3EU9 A;  5EN5 D;  2F8X K;  4HI9 A;  5ENO D;  2QC9 A;  3TWR A;  1AWC B;  4O60 A;  3F6Q A;  4HNA D;  5JMN D;  2KBX A;  1BI7 B;  2Y0B G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...