4ZFHA

Crystal structure of artificial ankyrin repeat protein_ank(gag)1d4 mutant -y56a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
ADLGKKLLEAARAGQDDEVRLLLEHGADVNARDSIGSTPLHLAAAYGHLEIVRLLLEHGADVNARDSTGTTPLHYAARLGHLEIVRLLLEHGADVNARDAMGWTPLHLAAKKGHLEIVRLLLKHGADVNANDHFGKTAFDISIDNGNEDLAEILQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Artificial ankyrin repeat protein_Ank(GAG)1D4 mutant -Y56A
publication title Crystal structure of Artificial ankyrin repeat protein_Ank(GAG)1D4 mutant- Y56A
rcsb
source organism Homo sapiens
total genus 55
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4zfhA00
2Y0BG 3DEOA 4GMRA 3TWUA 4QFVA 4BETA 1K3ZD 1BLXB 2FO1E 5FIOA 4QQIA 5AQ7A 5HS0A 1YCSB 4HRLA 4J7WA 3NOGD 3W9GA 3ZU7B 1K1AA 4HRNA 2B0OE 1BD8A 3TWVA 3UTMA 3ZNGA 4BSZB 3EHQA 2XEHA 5ENOD 4HI8A 2F8YA 2MYOA 3HG0D 5EIBE 3V31A 2DVWA 1IXVA 4F6RD 4HQDA 2HE0A 5KNGA 2F8XK 5EN5D 5CBNA 5AQBA 5EYLA 1N0QA 2ETCA 3C5RA 2QYJA 4GPMA 5ENTD 5AARA 4DX5D 4HB5A 3JXIA 2XEEA 1D9SA 4BEPA 1IHBA 2BKKB 4K5BA 5ITZF 3B95A 4NIKA 4DX6D 3Q9NC 5HKPA 4G8LA 3F6QA 3AJIA 2DZOA 2XZTG 3NOCD 3TWTA 3V79K 5EIDA 4JB8P 3NBNB 1DC2A 1WG0A 4CZ2D 1AP7A 2JABA 4DX1A 3TWQA 3EU9A 2V5QC 3V30A 1N0RA 4HLLA 5AQ9A 1NFIE 1BI8B 4YDYA 1YYHA 4U96D 4O60A 3V2XA 5AAOA 3JXJA 4G8KA 4B93B 1QYMA 3UI2A 4ATZD 2V4HC 2ETAA 5KNHD 4DUIA 5KBAA 4DX7D 3TWXA 1UOHA 3EHRA 1MX4A 1N11A 2L6BA 5ENQD 3UXGA 1BI7B 1DCQA 3T8KA 5CEAA 5ENSD 1YMPA 4Z68A 1IKND 3B7BA 5AQAA 1K1BA 3ZUVB 2ZGGA 5BXOA 2A5EA 5KWDA 4OAVB 3TWRA 3AAAC 5AN8A 4F1PA 3TWWA 5BXUA 2KBXA 1WDYA 1A5EA 3IXEA 4U95D 4ZHBA 5D66A 4DX2A 4OAUC 4LNUD 2P2CP 1OY3D 4TUMA 2BKGA 3DEPA 2NYJA 2XENA 4O1PA 3J5QB 2KXPC 4HI9A 4C48B 4DRXE 4BESA 4BERA 4YDWA 1TR4A 1S70B 2RFMA 2F37A 1SVXA 2J8SD 4HRMB 3SO8A 3HRAA 3LJNA 3ZKJA 3KEAA 3JUEA 1SW6A 2PNNA 1MX2A 4UUCA 3TWSA 1AWCB 1BU9A 4RLYA 5EILA 5CEDB 1G3NB 2Y1LE 2DWZA 4N5QA 3J5PA 4HNAD 2DZNA 5FINA 4LSZE 5HRYA 3W9FA 2ETBA 1OT8A 2XZDG 2VGEA 5ENPD 5CERB 4CYMD 2AJAA 5JA4D 5JMND 1MYOA 5ENRD 2QC9A 4K5AB 4U8YD 1MJ0A 5CECB 2RFAA 4J8YA 4K5CA 4A63B 1MX6A 4HBDA 3T9KA 4ZFHA 4LG6A 5CBOA 2ZGDA 4O1OA 5EYPF 3Q9UC 4U8VD 3D9HA 3V2OA
chains in the Genus database with same CATH superfamily
1K8KG 4Q69A 3T8MA 3TWVA 3ZHEA 2IO3C 3MV2B 1X5BA 3DSWA 2V0PA 3UKRG 3ISMC 3GW4A 3LYAA 1D8DA 2HM8A 3C5RA 2VYIA 4PH4B 2GRLA 3C72A 2M63A 4ILGA 5BW8C 4H7YA 3FUIA 3AJIA 3RK6A 2DZOA 2R05A 3B7RL 2EINE 4HOQA 3SHFA 3ML8A 5ANLA 5FQ4A 3U64A 2XPYA 3DXKG 4GTTA 2JLBA 3FTXA 3HXDA 3WXXA 5AJDA 1BI7B 2Q7FA 4L2LA 3CVWA 3T8KA 5FQ7A 3CVLA 4E85A 3L82A 3G2UA 3L6AA 1IHGA 3L13A 4F1PA 1A5EA 1WDYA 2L0TB 3ZXPA 3D9PA 4G26A 3NAWA 3U4TA 4GA1A 1TJFA 4MRUA 2ZIRA 2Y69E 3ZKJA 2X38A 3LY7A 3HXFA 3FTZA 3FP3A 3LVQE 1HU3A 5EX3A 1S64A 1O1SA 2XGSA 3SD5A 1Z3XA 2XQ0A 3IHVA 3UM2A 1N9AA 4JXTA 1OCCE 2ZISA 3BU8A 3EJNA 3JCKC 5D0QD 1TEZA 4X8QA 3C3RA 2L9BA 2P9NG 1YCSB 1KT0A 1U3DA 3ZU7B 2LO6A 2J08A 3CHQA 1TYQG 4I9EA 2IOSA 3GZSA 4C0EA 3QK0A 4DX5D 3C98A 3NOCD 1P5QA 4L7TA 4JB8P 3EU9A 3RRMB 3LS8A 2R02A 3FDHA 4AOFA 4KBQA 1HZ4A 1RW2A 2DYSE 4LERA 5B3SE 5H7PA 4XKBA 1ZU2A 4A3TA 2VGXA 1H19A 3TWRA 3ZW3A 1OY3D 5G04C 3NB2A 4JHRA 2WXFA 1PY1A 2VTBA 3Q7AA 4F53A 3L9TA 3HVEA 3D9JA 2EIKE 2PNNA 4NQ0A 2H6GA 5G04J 4LRZA 2HR2A 4LSZE 1TN8A 5ENPD 1E7VA 3FU5A 3SFZA 4GZCA 4YDOA 4ZFHA 3PUJA 1HE8A 1DCEA 1TNYA 4GMRA 1XNFA 3Q15A 2A4ZA 2OOEA 3I3NA 2V8SE 4DLOA 5ENOD 1UN9A 5BUZA 3I5PA 2WVIA 3ASOE 4ILIA 4U0UA 4WWNA 1O1TA 1N4QA 3CSFA 3CLJA 3TL5A 5AARA 3CIAA 3CVYA 2PQRA 4GTPA 2R03A 3Q9NC 1ELKA 4XE0A 3QAQA 1N4PA 4YVQC 3CK7A 3EUVA 4APOA 4DLQA 1Y6IA 3QKYA 4CDMA 3I4RB 2J07A 2PQNA 1BPOA 4EQFA 1NP7A 4G24A 2WXHA 2DCPA 4JHJA 5D66A 2OCCE 2XENA 4I6JA 2I6HA 2AXUA 4BESA 4GZ6A 1SVXA 4HRMB 3LKUA 5FT9A 2KM4A 3E30A 3AU4A 4FADA 4U0SA 4GTVA 1N4SA 3FUEA 4FA6A 1G3NB 2IONA 4AVXA 1NA0A 2XGMA 5DIZA 5B1AE 2J4DA 5HQ8A 4CT4A 4WNEA 4K5AB 2VGXB 3I4GA 3RSEG 5EYPF 5BV0A 3UM0A 1N95A 2IFUA 2VTBB 1FCHA 4DPRA 5AQ7A 4FULA 1BD8A 1O1RA 5EKQD 4WWPA 1HF8A 2HE0A 3Q5MA 1HXIA 4C0MA 3KS2A 5ENTD 4E6HA 5CMYA 3JXIA 4LNGA 3MEKA 4A3VA 4OVUA 2Y4UA 4K03A 3R9AB 2LNIA 4IN3B 3F6QA 2EQXA 4EZLA 3UT8A 4XI9A 2KCVA 2MRIA 3V30A 4ANVA 1NL4A 4GMJA 2KC7A 1UOHA 3AG1E 1ELWA 4WNGA 1IKND 3D9KA 2LXMA 3QB2A 2ILRA 5KWDA 3U3WA 4A55A 4A1GA 1UJJA 2CHWA 4LNBA 5IY5E 3DEPA 4EBAA 3ABLE 4N3AA 4C48B 4YDWA 2WQ6A 2F37A 3LJNA 3O48A 3CEQA 2J4BA 1AWCB 4RQIA 5EILA 3CVPA 4FJYA 1Y8MA 1FT2A 1O5MA 4KYOB 5JA4D 1WY6A 5CECB 5J08A 3QOUA 1MX6A 5CBOA 2F0YA 2ZGDA 4R7LA 1FVFA 2FO1E 4WUYA 3ZN3A 2XS8A 1N52A 2LSVA 2MYOA 4D10C 3ULYA 4UQZA 4XZ4A 2UY1A 4XIFA 2P9PG 5EN5D 4ME2A 4UWLA 5JHAA 2QYJA 4GPMA 4JHKA 3CVUA 3LXUX 2P9IG 4C9BB 4TUUA 1EPUA 3UPVA 3UQ3A 2H6FA 4GZDA 3Q49B 3SQVA 4AEZC 2QZAA 5JHBA 3L16A 1OWNA 3IBEA 3OAWA 5CMWA 3CKBA 1JCRA 3TWXA 3DSUA 3RRUA 4BT8A 2IEJA 4Z68A 4JEUA 2KCLA 4ZHBA 5BPPA 4PDXA 4GTSA 4CDNA 3RO3A 4UQXA 2J8SD 2CG2A 3G2VA 2XRZA 3TWSA 4AV7A 2EIME 4O6FA 4GTOA 3BG1B 1TN7A 2AXZA 3PZDA 4EECA 3RJVA 2QC9A 2WQHA 4GCOA 4TRQA 4BT9A 4IYPA 3ZGQA 5EIBE 3V31A 3KEZA 4EZJA 3CHRA 1HO8A 3URZA 4LUNU 3NZSA 3Q78A 4HRLA 3Q47B 3PZ2A 4BSZB 4KXKB 3PZ1A 4JL0A 4BSXA 4LEUA 1ZB1A 1D8EA 2CHZA 4Y6WA 2LAHA 3ASNE 1NZNA 1LF8A 2J9QA 3MKQB 4KMOA 3QC1A 1SA5A 2XZTG 3CQGB 4XI0A 3SBTB 3QARA 3TWQA 1N0RA 2XHEA 3BG0B 3SF4A 1FVHA 3G2TA 5EDSA 4ATZD 2V4HC 3CSTA 3ASGA 4ANUA 2Y3AA 1PAQA 3SFXA 2UY1B 2DIWA 4EPZA 4MS6A 2FEZA 3CHOA 2CFUA 3VLEA 3FU3A 5CHEE 4CGVA 2BKGA 5CCMA 1TR4A 1TJCA 5A7DB 1MX2A 5FZSA 3ZFWA 3D9MA 4WNFA 3CK9A 4IULA 5D2MC 3U66A 3PZ3A 1HG2A 4U04A 2J09A 3FHEA 4J8YA 3T9KA 4U8VD 3CVNA 3B7SA 3Q73A 1JCSA 5ANRA 5HS0A 2GRNB 3NOGD 1LD8A 3CVXA 3T5XA 1V54E 3FTVA 1B89A 3FULA 3HYMB 3CV0A 1ELRA 2F8XK 4KT6B 3CKCA 4N3BA 3FTYA 2GROB 3DSXA 3HXCA 3JQ0A 2BKKB 3CHSA 4G8LA 2MOWA 5B1BE 2IQCA 3JYSA 4AIFA 3OXGA 3VTYA 4BWRA 4JVSA 2EILE 3FU0A 4FHKA 4G8KA 1IYGA 1KZOA 2GRRB 4KZCA 3LY9A 2CG3A 1TNBA 1H2TC 3LEWA 3QWWA 2ZGGA 4RG9A 2P9SG 2P2CP 4TXRA 3D9LA 4CCAA 3ONLA 4U0ZA 3T5VA 4I6EA 2WM9A 3ZHEB 1SW6A 3CHMA 2X6FA 3CK8A 1LD7A 5LFAA 2KZTA 2X3MA 2C0MA 4N2SA 3J5PA 4URKA 3EIQC 3QNKA 5FINA 5LX8A 2VGEA 1UJKA 4CEMA 1X81A 4I43A 3UKUG 5D0OD 3TAXA 1E8ZA 4FC8A 1Z3YA 3DPDA 1HH8A 3VTXA 3D9HA 3O4ZA 3V2OA 3R7QA 4G11A 3ZEFA 1JPLA 3S7BA 4U7EB 3UTMA 4HOUA 1GW6A 1IXVA 5CBNA 5CRUA 3S2AA 5EYLA 2I1KA 1S0PA 4RG6A 2EIJE 2I1JA 3K9IA 4HB5A 4N39A 1OWOA 1JUQA 2WXJA 4FP7A 1IHBA 1H6KA 1H6PA 4GCNA 5FQ6A 4CRWA 1E8WA 3TWTA 2WXNA 4I17A 1SZAA 4U63A 4HLLA 3Q79A 1FPPA 4AY5A 3DWLG 5M72A 1OWMA 2WXPA 1N54A 4GAAA 2ETAA 4ANWA 3FTWA 4GA2A 4HVBA 1SZ9A 1MX4A 4TXQA 2GW1A 2CFZA 2WB2A 4WAFA 3UXGA 3FUJA 2VSXE 1FT1A 4I1OB 1DCQA 3UT4A 3EHNA 1OWLA 2GRMA 3FUMA 2IJGX 2PM7A 2KBXA 4W9RA 4LCTA 3DRAA 1E96B 4O1PA 2WXIA 4BERA 1LTXA 1NI1A 4DI4A 3JUEA 4AXHA 3GYZA 3PREA 2LXLA 4GTRA 3ZVVA 3W9FA 4HXIA 4CYMD 4U07A 3MZLB 3NF1A 4BX8A 2VQ2A 4HBDA 4NURA 4RSYA 3MJWA 3RIBA 3ASDA 4B94A 3TWUA 4QFVA 1Z6TA 2X6IA 5BT1A 3ABKE 2VSYA 1KZPA 3EDTB 2VSNA 2R17C 3KD7A 3S7FA 1IQRA 1E90A 1QQEA 4BEPA 3E4BA 3TG5A 3RKVA 5E76A 1XGWA 2ONDA 5EIDA 3DSTA 3HVEB 4HLEA 1BI8B 3FUFA 3FTSA 5T4YA 3D9NA 3V2XA 2AW6A 3ESKA 4KVOA 2ZU6B 3PUKA 4L2YA 3PNTB 3RRNB 2XS1A 3L08A 3JQ1A 5ENSD 4OVVA 4WWOA 1H0AA 4MKTA 4ABNA 2H6IA 5T8IA 1KPSB 4J8DA 4OAUC 4MBGA 4LNUD 3ULQA 5JJTA 4A1SA 4GU5A 2WXRA 3UIOC 1EYHA 4L1BA 3IEGA 3EIJA 4Q94A 4KZ0A 2BF0X 2XRYA 3FWVA 4V3IA 2P9LG 2C2LA 5FQ8A 1HFAA 2P9UG 4HS2A 1YA0A 5JMND 4YNDA 5ENRD 2GGFA 5ITZF 4CGWA 2VGYA 4P29A 2NC9A 5FWQA 4IRUA 3WG7E 5KJNA 3EHMA 3LDZA 1PC2A 3MYVA 3FTUA 1QZ2A 4OYSA 3MCXA 5AQBA 2WXOA 4FJZA 1IQUA 3RAUA 1MQSA 3GZ1A 3AS4A 4M3OA 3B95A 4NACA 5HKPA 4U8HA 1L5JA 4JPSA 4GZ3A 1DNPA 3NBNB 1DC2A 1WG0A 3G2SA 3IHYA 1JWFA 2JABA 4B0ZA 4CZ2D 4DX1A 5KJKA 1HG5A 5E75A 2YINA 4UWHA 1HX8A 4J6IA 3UM1A 5KNHD 3ZIMA 3FH8A 3EHRA 2L6BA 3X2QE 3VLFA 5AQAA 1K1BA 1EF1C 2HO1A 3PZ4A 5AN8A 4K0RA 5BXUA 3CGHA 3TJPA 4DX2A 3CQCB 4ANXA 3AG4E 3P2BA 1U3CA 2DWZA 2WMOA 2ETBA 4PS8A 1SQMA 2RKKA 2A5UA 3AS8A 1KT1A 1MJ0A 2BTDA 3C3OA 3P1UA 4U8YD 3ZRHA 3B7UX 2JEKA 1E8XA 3LCAA 2Y0BG 4BETA 1K3ZD 4QQIA 4J7WA 1UN8A 2P58C 4GYWA 1A17A 3BUAA 4I2ZA 2J49A 2FULA 4GYOA 4UI9C 4JC8A 4I9CA 3FUHA 3KAEA 3ML9A 5AQ9A 2I9CA 4UI9J 2C0LA 3FH5A 3ZYMA 3JXJA 1SA4A 2V5FA 3E34A 3IKOB 2PM6A 5C1DA 3N71A 3UMVA 2WQ7A 2A5EA 5FJYA 3HDXA 1RZ4A 2XGOA 4TUMA 2FI7A 2WMNA 2VJ8A 4TXPA 4FU3A 3LPZA 3SNXA 4GPKA 3AS5A 2RFMA 2L6JA 3SZ7A 4GYYA 2FO7A 4J8SA 4RLYA 2RD0A 3D9OA 2OEWA 3EU5A 4B89A 1TNOA 3AG3E 4TV3A 5AIJA 1INZA 2DYRE 4JA9A 4K5CA 3Q9UC 3UIPC 2AWIA 2WXGA 3SI5A 3FUDA 3APDA 4BY6A 3PVLA 1K1AA 3ZNGA 1QBQA 3HG0D 3CVQA 4N2QA 5AENA 3FEXA 4BX9A 2R2LA 2R5SA 2XEEA 1HS6A 4AP2A 3APCA 1N94A 3PE3A 2OVFA 2UWJG 3SY2A 4HFGA 3DXMG 5AAOA 5T3RA 3UI2A 4JZYA 3E32A 4RVBA 5ENQD 2R59A 1VDYA 2IF4A 2E2EA 4FLHA 5BXOA 1Q2ZA 3AAAC 5LCWC 2KCKA 4J8FA 4G2VA 1OUVA 2YHEA 3FY4A 1S70B 3APFA 3HRAA 4G25A 5LCWJ 2BEDA 5CEDB 5ARGA 5LOZA 1OT8A 1UW4B 2V4LA 1WM5A 5J90A 2AJAA 1H2UA 4UWFA 1MYOA 3R7RA 2RFAA 2AVPA 1TNUA 3GZ2A 1DVPA 4F7AA 2XPZA 2XCCA 2LSUA 5FIOA 5JJ6A 4JA7A 2XEHA 4DK5A 2GRQB 2H6HA 3BQOA 3ZYQA 4F6RD 4HQDA 3UINC 2WPVA 3FUNA 4F1SA 4KVMA 5G55A 4Q96A 5BV1A 3S7DA 4GA0A 4BTBA 4K5BA 3DBSA 4CT0A 2E0IA 3ZPJA 3V79K 4I1AA 4GTQA 3HXEA 2WXQA 2NSZA 4O60A 4B93B 2FF4A 4GZ5A 3MX3A 4DX7D 3DPYA 4AY6A 2WXMA 2FBNA 4FLBA 3FUKA 5CEAA 4UI9K 1YMPA 4GMLA 3B7BA 3QDNA 2B6CA 4OAVB 3C3QA 3ONKA 5BNWA 4DI3A 2XCBA 3QWVA 2KXPC 3JUIA 1H2VC 3D9IA 1W3BA 2AXVA 4UUCA 3PRZA 4XEIG 5FTPA 3LJ3A 2BUGA 4PS7A 4FHJA 2Y1LE 3TG4A 3E33A 3RU0A 4AJWA 1TNZA 3PH0C 4ATGA 2GRPB 1KLXA 4EZKA 3DEOA 1NA3A 4GTMA 1OCZE 1H6OA 2I2OA 2F8YA 3D3MA 3QJZA 3CR3A 2DVWA 2PL2A 4EBAG 4L9PA 4PUCA 4JW1A 2WXKA 1D9SA 2NXPA 5KJMA 3PNLB 2QYUA 1UG3A 2PZIA 3SGHA 1AP7A 5C2YA 3ENEA 3LVRE 1NFIE 2KZTB 3NQPA 5CRVA 1QYMA 3PEVB 3PEUB 5KBAA 4JD2G 2IU1A 1N11A 5A6CA 4M7CA 3Q7FA 4BTAA 2IO2C 4XKCA 5G2NA 3IXEA 2LAIA 3MV3B 3FEYA 4HI9A 3FFLA 3KEAA 4N5CA 5AJLA 1MZCA 3ASFA 2XZDG 1MHQA 3OXFA 1OWPA 3L17A 2X6JA 2X6KA 4ACLA 4LG6A 3MGBA 5CCLA 3FU6A 3SFYA 3CVVA 4UWKA 1N4RA 1BLXB 3KSQA 2XPIA 2XEVA 3UX4A 2B0OE 4I6GA 4WNDA 1JWGA 2QFCA 3R9MA 4HI8A 5A23A 2LUHA 4YVOA 5KNGA 3OXLA 4XX5A 1QNFA 4JEHA 4HOSA 5KJLA 3AG2E 2MHKA 1TN6A 2X6HA 3ZYLA 3PDNA 3TXMA 1YYHA 5LP0A 4MLPA 1OCRE 3ZYKA 4HOTA 4H7XA 3NZUA 3DSSA 3CHPA 1OCOE 3UUXA 2OV8A 2KATA 4YDEA 2L0IA 2NYJA 4GB9A 3ASHA 3MKQA 3ESLA 4DJAA 2RG8A 2Y4TA 3SO8A 3DSVA 3Q4AB 3ABME 1V55E 3S7JA 2OEVA 5FZRA 3PE4A 4N5QA 4G1TA 2HYZA 3MA5A 2DZNA 1Z5SC 1OXJA 5HRYA 1ZBPA 5CERB 4B8AA 5KCMA 1EDUA 4PS3A 3PS6A 3TXNA 4BFRA 4UWGA 4B8CB 1S63A 4I2WA 3L54A 5FZQA 4EHMA 1U2VG 3RO2A 3W9GA 3UM3A 3HHMA 4HORA 4HRNA 5JJ7A 3EHQA 2VSOE 3L22A 3ULEG 4APFA 5ARFA 5AYWD 1N0QA 2ETCA 3VLDA 2CHXA 3AU5A 3UT7A 4AM9A 2YNQA 3G2WA 2P9KG 4J0UA 4NIKA 4DX6D 2OVBA 4F3VA 4ILHB 3HXBA 2YQ8A 3TGOA 3BEEA 2V5QC 3OTNA 4YDYA 4U96D 3HIZA 5G05C 2QY7A 3IV0A 4DUIA 3Q75A 2WXLA 5HI7A 1WAO1 3B7TA 3KSLA 4UQYA 3U9WA 4J8EA 3QWPA 3B13A 3FH7A 3ZUVB 1E8YA 5G05J 2IY0C 5ENNA 3TWWA 5DBKA 4U95D 3J5QB 4DRXE 4Y6CA 3LY8A 3ZXSA 1BU9A 2IOLA 2DBAA 1E7UA 4NRHB 1JCQA 3MKRA 4G23A 4HNAD 4CDRA 4ACKA 2ZXWE 4L23A 5EX0A 4N3CA 3SBSA 2YHCA 4I1MA 4A63B 4O1OA 3E37A
chains in the Genus database with same CATH topology
2Y0BG 3DEOA 4GMRA 3TWUA 4QFVA 4BETA 1K3ZD 1BLXB 2FO1E 5FIOA 4QQIA 5AQ7A 5HS0A 1YCSB 4HRLA 4J7WA 3NOGD 3W9GA 3ZU7B 1K1AA 4HRNA 2B0OE 1BD8A 3TWVA 3UTMA 3ZNGA 4BSZB 3EHQA 2XEHA 5ENOD 4HI8A 2F8YA 2MYOA 3HG0D 5EIBE 3V31A 2DVWA 1IXVA 4F6RD 4HQDA 2HE0A 5KNGA 2F8XK 5EN5D 5CBNA 5AQBA 5EYLA 1N0QA 2ETCA 3C5RA 2QYJA 4GPMA 5ENTD 5AARA 4DX5D 4HB5A 3JXIA 2XEEA 1D9SA 4BEPA 1IHBA 2BKKB 4K5BA 5ITZF 3B95A 4NIKA 4DX6D 3Q9NC 5HKPA 4G8LA 3F6QA 3AJIA 2DZOA 2XZTG 3NOCD 3TWTA 3V79K 5EIDA 4JB8P 3NBNB 1DC2A 1WG0A 4CZ2D 1AP7A 2JABA 4DX1A 3TWQA 3EU9A 2V5QC 3V30A 1N0RA 4HLLA 5AQ9A 1NFIE 1BI8B 4YDYA 1YYHA 4U96D 4O60A 3V2XA 5AAOA 3JXJA 4G8KA 4B93B 1QYMA 3UI2A 4ATZD 2V4HC 2ETAA 5KNHD 4DUIA 5KBAA 4DX7D 3TWXA 1UOHA 3EHRA 1MX4A 1N11A 2L6BA 5ENQD 3UXGA 1BI7B 1DCQA 3T8KA 5CEAA 5ENSD 1YMPA 4Z68A 1IKND 3B7BA 5AQAA 1K1BA 3ZUVB 2ZGGA 5BXOA 2A5EA 5KWDA 4OAVB 3TWRA 3AAAC 5AN8A 4F1PA 3TWWA 5BXUA 2KBXA 1WDYA 1A5EA 3IXEA 4U95D 4ZHBA 5D66A 4DX2A 4OAUC 4LNUD 2P2CP 1OY3D 4TUMA 2BKGA 3DEPA 2NYJA 2XENA 4O1PA 3J5QB 2KXPC 4HI9A 4C48B 4DRXE 4BESA 4BERA 4YDWA 1TR4A 1S70B 2RFMA 2F37A 1SVXA 2J8SD 4HRMB 3SO8A 3HRAA 3LJNA 3ZKJA 3KEAA 3JUEA 1SW6A 2PNNA 1MX2A 4UUCA 3TWSA 1AWCB 1BU9A 4RLYA 5EILA 5CEDB 1G3NB 2Y1LE 2DWZA 4N5QA 3J5PA 4HNAD 2DZNA 5FINA 4LSZE 5HRYA 3W9FA 2ETBA 1OT8A 2XZDG 2VGEA 5ENPD 5CERB 4CYMD 2AJAA 5JA4D 5JMND 1MYOA 5ENRD 2QC9A 4K5AB 4U8YD 1MJ0A 5CECB 2RFAA 4J8YA 4K5CA 4A63B 1MX6A 4HBDA 3T9KA 4ZFHA 4LG6A 5CBOA 2ZGDA 4O1OA 5EYPF 3Q9UC 4U8VD 3D9HA 3V2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0B G;  3DEO A;  4GMR A;  3TWU A;  4QFV A;  4BET A;  1K3Z D;  1BLX B;  2FO1 E;  5FIO A;  4QQI A;  5AQ7 A;  5HS0 A;  1YCS B;  4HRL A;  4J7W A;  3NOG D;  3W9G A;  3ZU7 B;  1K1A A;  4HRN A;  2B0O E;  1BD8 A;  3TWV A;  3UTM A;  3ZNG A;  4BSZ B;  3EHQ A;  2XEH A;  5ENO D;  4HI8 A;  2F8Y A;  2MYO A;  3HG0 D;  5EIB E;  3V31 A;  2DVW A;  1IXV A;  4F6R D;  4HQD A;  2HE0 A;  5KNG A;  2F8X K;  5EN5 D;  5CBN A;  5AQB A;  5EYL A;  1N0Q A;  2ETC A;  3C5R A;  2QYJ A;  4GPM A;  5ENT D;  5AAR A;  4DX5 D;  4HB5 A;  3JXI A;  2XEE A;  1D9S A;  4BEP A;  1IHB A;  2BKK B;  4K5B A;  5ITZ F;  3B95 A;  4NIK A;  4DX6 D;  3Q9N C;  5HKP A;  4G8L A;  3F6Q A;  3AJI A;  2DZO A;  2XZT G;  3NOC D;  3TWT A;  3V79 K;  5EID A;  4JB8 P;  3NBN B;  1DC2 A;  1WG0 A;  4CZ2 D;  1AP7 A;  2JAB A;  4DX1 A;  3TWQ A;  3EU9 A;  2V5Q C;  3V30 A;  1N0R A;  4HLL A;  5AQ9 A;  1NFI E;  1BI8 B;  4YDY A;  1YYH A;  4U96 D;  4O60 A;  3V2X A;  5AAO A;  3JXJ A;  4G8K A;  4B93 B;  1QYM A;  3UI2 A;  4ATZ D;  2V4H C;  2ETA A;  5KNH D;  4DUI A;  5KBA A;  4DX7 D;  3TWX A;  1UOH A;  3EHR A;  1MX4 A;  1N11 A;  2L6B A;  5ENQ D;  3UXG A;  1BI7 B;  1DCQ A;  3T8K A;  5CEA A;  5ENS D;  1YMP A;  4Z68 A;  1IKN D;  3B7B A;  5AQA A;  1K1B A;  3ZUV B;  2ZGG A;  5BXO A;  2A5E A;  5KWD A;  4OAV B;  3TWR A;  3AAA C;  5AN8 A;  4F1P A;  3TWW A;  5BXU A;  2KBX A;  1WDY A;  1A5E A;  3IXE A;  4U95 D;  4ZHB A;  5D66 A;  4DX2 A;  4OAU C;  4LNU D;  2P2C P;  1OY3 D;  4TUM A;  2BKG A;  3DEP A;  2NYJ A;  2XEN A;  4O1P A;  3J5Q B;  2KXP C;  4HI9 A;  4C48 B;  4DRX E;  4BES A;  4BER A;  4YDW A;  1TR4 A;  1S70 B;  2RFM A;  2F37 A;  1SVX A;  2J8S D;  4HRM B;  3SO8 A;  3HRA A;  3LJN A;  3ZKJ A;  3KEA A;  3JUE A;  1SW6 A;  2PNN A;  1MX2 A;  4UUC A;  3TWS A;  1AWC B;  1BU9 A;  4RLY A;  5EIL A;  5CED B;  1G3N B;  2Y1L E;  2DWZ A;  4N5Q A;  3J5P A;  4HNA D;  2DZN A;  5FIN A;  4LSZ E;  5HRY A;  3W9F A;  2ETB A;  1OT8 A;  2XZD G;  2VGE A;  5ENP D;  5CER B;  4CYM D;  2AJA A;  5JA4 D;  5JMN D;  1MYO A;  5ENR D;  2QC9 A;  4K5A B;  4U8Y D;  1MJ0 A;  5CEC B;  2RFA A;  4J8Y A;  4K5C A;  4A63 B;  1MX6 A;  4HBD A;  3T9K A;  4ZFH A;  4LG6 A;  5CBO A;  2ZGD A;  4O1O A;  5EYP F;  3Q9U C;  4U8V D;  3D9H A;  3V2O A; 
#chains in the Genus database with same CATH topology
 1K8K G;  4Q69 A;  3T8M A;  3TWV A;  3ZHE A;  2IO3 C;  3MV2 B;  1X5B A;  3DSW A;  2V0P A;  3UKR G;  3ISM C;  3GW4 A;  3LYA A;  1D8D A;  2HM8 A;  3C5R A;  2VYI A;  4PH4 B;  2GRL A;  3C72 A;  2M63 A;  4ILG A;  5BW8 C;  4H7Y A;  3FUI A;  3AJI A;  3RK6 A;  2DZO A;  2R05 A;  3B7R L;  2EIN E;  4HOQ A;  3SHF A;  3ML8 A;  5ANL A;  5FQ4 A;  3U64 A;  2XPY A;  3DXK G;  4GTT A;  2JLB A;  3FTX A;  3HXD A;  3WXX A;  5AJD A;  1BI7 B;  2Q7F A;  4L2L A;  3CVW A;  3T8K A;  5FQ7 A;  3CVL A;  4E85 A;  3L82 A;  3G2U A;  3L6A A;  1IHG A;  3L13 A;  4F1P A;  1A5E A;  1WDY A;  2L0T B;  3ZXP A;  3D9P A;  4G26 A;  3NAW A;  3U4T A;  4GA1 A;  1TJF A;  4MRU A;  2ZIR A;  2Y69 E;  3ZKJ A;  2X38 A;  3LY7 A;  3HXF A;  3FTZ A;  3FP3 A;  3LVQ E;  1HU3 A;  5EX3 A;  1S64 A;  1O1S A;  2XGS A;  3SD5 A;  1Z3X A;  2XQ0 A;  3IHV A;  3UM2 A;  1N9A A;  4JXT A;  1OCC E;  2ZIS A;  3BU8 A;  3EJN A;  3JCK C;  5D0Q D;  1TEZ A;  4X8Q A;  3C3R A;  2L9B A;  2P9N G;  1YCS B;  1KT0 A;  1U3D A;  3ZU7 B;  2LO6 A;  2J08 A;  3CHQ A;  1TYQ G;  4I9E A;  2IOS A;  3GZS A;  4C0E A;  3QK0 A;  4DX5 D;  3C98 A;  3NOC D;  1P5Q A;  4L7T A;  4JB8 P;  3EU9 A;  3RRM B;  3LS8 A;  2R02 A;  3FDH A;  4AOF A;  4KBQ A;  1HZ4 A;  1RW2 A;  2DYS E;  4LER A;  5B3S E;  5H7P A;  4XKB A;  1ZU2 A;  4A3T A;  2VGX A;  1H19 A;  3TWR A;  3ZW3 A;  1OY3 D;  5G04 C;  3NB2 A;  4JHR A;  2WXF A;  1PY1 A;  2VTB A;  3Q7A A;  4F53 A;  3L9T A;  3HVE A;  3D9J A;  2EIK E;  2PNN A;  4NQ0 A;  2H6G A;  5G04 J;  4LRZ A;  2HR2 A;  4LSZ E;  1TN8 A;  5ENP D;  1E7V A;  3FU5 A;  3SFZ A;  4GZC A;  4YDO A;  4ZFH A;  3PUJ A;  1HE8 A;  1DCE A;  1TNY A;  4GMR A;  1XNF A;  3Q15 A;  2A4Z A;  2OOE A;  3I3N A;  2V8S E;  4DLO A;  5ENO D;  1UN9 A;  5BUZ A;  3I5P A;  2WVI A;  3ASO E;  4ILI A;  4U0U A;  4WWN A;  1O1T A;  1N4Q A;  3CSF A;  3CLJ A;  3TL5 A;  5AAR A;  3CIA A;  3CVY A;  2PQR A;  4GTP A;  2R03 A;  3Q9N C;  1ELK A;  4XE0 A;  3QAQ A;  1N4P A;  4YVQ C;  3CK7 A;  3EUV A;  4APO A;  4DLQ A;  1Y6I A;  3QKY A;  4CDM A;  3I4R B;  2J07 A;  2PQN A;  1BPO A;  4EQF A;  1NP7 A;  4G24 A;  2WXH A;  2DCP A;  4JHJ A;  5D66 A;  2OCC E;  2XEN A;  4I6J A;  2I6H A;  2AXU A;  4BES A;  4GZ6 A;  1SVX A;  4HRM B;  3LKU A;  5FT9 A;  2KM4 A;  3E30 A;  3AU4 A;  4FAD A;  4U0S A;  4GTV A;  1N4S A;  3FUE A;  4FA6 A;  1G3N B;  2ION A;  4AVX A;  1NA0 A;  2XGM A;  5DIZ A;  5B1A E;  2J4D A;  5HQ8 A;  4CT4 A;  4WNE A;  4K5A B;  2VGX B;  3I4G A;  3RSE G;  5EYP F;  5BV0 A;  3UM0 A;  1N95 A;  2IFU A;  2VTB B;  1FCH A;  4DPR A;  5AQ7 A;  4FUL A;  1BD8 A;  1O1R A;  5EKQ D;  4WWP A;  1HF8 A;  2HE0 A;  3Q5M A;  1HXI A;  4C0M A;  3KS2 A;  5ENT D;  4E6H A;  5CMY A;  3JXI A;  4LNG A;  3MEK A;  4A3V A;  4OVU A;  2Y4U A;  4K03 A;  3R9A B;  2LNI A;  4IN3 B;  3F6Q A;  2EQX A;  4EZL A;  3UT8 A;  4XI9 A;  2KCV A;  2MRI A;  3V30 A;  4ANV A;  1NL4 A;  4GMJ A;  2KC7 A;  1UOH A;  3AG1 E;  1ELW A;  4WNG A;  1IKN D;  3D9K A;  2LXM A;  3QB2 A;  2ILR A;  5KWD A;  3U3W A;  4A55 A;  4A1G A;  1UJJ A;  2CHW A;  4LNB A;  5IY5 E;  3DEP A;  4EBA A;  3ABL E;  4N3A A;  4C48 B;  4YDW A;  2WQ6 A;  2F37 A;  3LJN A;  3O48 A;  3CEQ A;  2J4B A;  1AWC B;  4RQI A;  5EIL A;  3CVP A;  4FJY A;  1Y8M A;  1FT2 A;  1O5M A;  4KYO B;  5JA4 D;  1WY6 A;  5CEC B;  5J08 A;  3QOU A;  1MX6 A;  5CBO A;  2F0Y A;  2ZGD A;  4R7L A;  1FVF A;  2FO1 E;  4WUY A;  3ZN3 A;  2XS8 A;  1N52 A;  2LSV A;  2MYO A;  4D10 C;  3ULY A;  4UQZ A;  4XZ4 A;  2UY1 A;  4XIF A;  2P9P G;  5EN5 D;  4ME2 A;  4UWL A;  5JHA A;  2QYJ A;  4GPM A;  4JHK A;  3CVU A;  3LXU X;  2P9I G;  4C9B B;  4TUU A;  1EPU A;  3UPV A;  3UQ3 A;  2H6F A;  4GZD A;  3Q49 B;  3SQV A;  4AEZ C;  2QZA A;  5JHB A;  3L16 A;  1OWN A;  3IBE A;  3OAW A;  5CMW A;  3CKB A;  1JCR A;  3TWX A;  3DSU A;  3RRU A;  4BT8 A;  2IEJ A;  4Z68 A;  4JEU A;  2KCL A;  4ZHB A;  5BPP A;  4PDX A;  4GTS A;  4CDN A;  3RO3 A;  4UQX A;  2J8S D;  2CG2 A;  3G2V A;  2XRZ A;  3TWS A;  4AV7 A;  2EIM E;  4O6F A;  4GTO A;  3BG1 B;  1TN7 A;  2AXZ A;  3PZD A;  4EEC A;  3RJV A;  2QC9 A;  2WQH A;  4GCO A;  4TRQ A;  4BT9 A;  4IYP A;  3ZGQ A;  5EIB E;  3V31 A;  3KEZ A;  4EZJ A;  3CHR A;  1HO8 A;  3URZ A;  4LUN U;  3NZS A;  3Q78 A;  4HRL A;  3Q47 B;  3PZ2 A;  4BSZ B;  4KXK B;  3PZ1 A;  4JL0 A;  4BSX A;  4LEU A;  1ZB1 A;  1D8E A;  2CHZ A;  4Y6W A;  2LAH A;  3ASN E;  1NZN A;  1LF8 A;  2J9Q A;  3MKQ B;  4KMO A;  3QC1 A;  1SA5 A;  2XZT G;  3CQG B;  4XI0 A;  3SBT B;  3QAR A;  3TWQ A;  1N0R A;  2XHE A;  3BG0 B;  3SF4 A;  1FVH A;  3G2T A;  5EDS A;  4ATZ D;  2V4H C;  3CST A;  3ASG A;  4ANU A;  2Y3A A;  1PAQ A;  3SFX A;  2UY1 B;  2DIW A;  4EPZ A;  4MS6 A;  2FEZ A;  3CHO A;  2CFU A;  3VLE A;  3FU3 A;  5CHE E;  4CGV A;  2BKG A;  5CCM A;  1TR4 A;  1TJC A;  5A7D B;  1MX2 A;  5FZS A;  3ZFW A;  3D9M A;  4WNF A;  3CK9 A;  4IUL A;  5D2M C;  3U66 A;  3PZ3 A;  1HG2 A;  4U04 A;  2J09 A;  3FHE A;  4J8Y A;  3T9K A;  4U8V D;  3CVN A;  3B7S A;  3Q73 A;  1JCS A;  5ANR A;  5HS0 A;  2GRN B;  3NOG D;  1LD8 A;  3CVX A;  3T5X A;  1V54 E;  3FTV A;  1B89 A;  3FUL A;  3HYM B;  3CV0 A;  1ELR A;  2F8X K;  4KT6 B;  3CKC A;  4N3B A;  3FTY A;  2GRO B;  3DSX A;  3HXC A;  3JQ0 A;  2BKK B;  3CHS A;  4G8L A;  2MOW A;  5B1B E;  2IQC A;  3JYS A;  4AIF A;  3OXG A;  3VTY A;  4BWR A;  4JVS A;  2EIL E;  3FU0 A;  4FHK A;  4G8K A;  1IYG A;  1KZO A;  2GRR B;  4KZC A;  3LY9 A;  2CG3 A;  1TNB A;  1H2T C;  3LEW A;  3QWW A;  2ZGG A;  4RG9 A;  2P9S G;  2P2C P;  4TXR A;  3D9L A;  4CCA A;  3ONL A;  4U0Z A;  3T5V A;  4I6E A;  2WM9 A;  3ZHE B;  1SW6 A;  3CHM A;  2X6F A;  3CK8 A;  1LD7 A;  5LFA A;  2KZT A;  2X3M A;  2C0M A;  4N2S A;  3J5P A;  4URK A;  3EIQ C;  3QNK A;  5FIN A;  5LX8 A;  2VGE A;  1UJK A;  4CEM A;  1X81 A;  4I43 A;  3UKU G;  5D0O D;  3TAX A;  1E8Z A;  4FC8 A;  1Z3Y A;  3DPD A;  1HH8 A;  3VTX A;  3D9H A;  3O4Z A;  3V2O A;  3R7Q A;  4G11 A;  3ZEF A;  1JPL A;  3S7B A;  4U7E B;  3UTM A;  4HOU A;  1GW6 A;  1IXV A;  5CBN A;  5CRU A;  3S2A A;  5EYL A;  2I1K A;  1S0P A;  4RG6 A;  2EIJ E;  2I1J A;  3K9I A;  4HB5 A;  4N39 A;  1OWO A;  1JUQ A;  2WXJ A;  4FP7 A;  1IHB A;  1H6K A;  1H6P A;  4GCN A;  5FQ6 A;  4CRW A;  1E8W A;  3TWT A;  2WXN A;  4I17 A;  1SZA A;  4U63 A;  4HLL A;  3Q79 A;  1FPP A;  4AY5 A;  3DWL G;  5M72 A;  1OWM A;  2WXP A;  1N54 A;  4GAA A;  2ETA A;  4ANW A;  3FTW A;  4GA2 A;  4HVB A;  1SZ9 A;  1MX4 A;  4TXQ A;  2GW1 A;  2CFZ A;  2WB2 A;  4WAF A;  3UXG A;  3FUJ A;  2VSX E;  1FT1 A;  4I1O B;  1DCQ A;  3UT4 A;  3EHN A;  1OWL A;  2GRM A;  3FUM A;  2IJG X;  2PM7 A;  2KBX A;  4W9R A;  4LCT A;  3DRA A;  1E96 B;  4O1P A;  2WXI A;  4BER A;  1LTX A;  1NI1 A;  4DI4 A;  3JUE A;  4AXH A;  3GYZ A;  3PRE A;  2LXL A;  4GTR A;  3ZVV A;  3W9F A;  4HXI A;  4CYM D;  4U07 A;  3MZL B;  3NF1 A;  4BX8 A;  2VQ2 A;  4HBD A;  4NUR A;  4RSY A;  3MJW A;  3RIB A;  3ASD A;  4B94 A;  3TWU A;  4QFV A;  1Z6T A;  2X6I A;  5BT1 A;  3ABK E;  2VSY A;  1KZP A;  3EDT B;  2VSN A;  2R17 C;  3KD7 A;  3S7F A;  1IQR A;  1E90 A;  1QQE A;  4BEP A;  3E4B A;  3TG5 A;  3RKV A;  5E76 A;  1XGW A;  2OND A;  5EID A;  3DST A;  3HVE B;  4HLE A;  1BI8 B;  3FUF A;  3FTS A;  5T4Y A;  3D9N A;  3V2X A;  2AW6 A;  3ESK A;  4KVO A;  2ZU6 B;  3PUK A;  4L2Y A;  3PNT B;  3RRN B;  2XS1 A;  3L08 A;  3JQ1 A;  5ENS D;  4OVV A;  4WWO A;  1H0A A;  4MKT A;  4ABN A;  2H6I A;  5T8I A;  1KPS B;  4J8D A;  4OAU C;  4MBG A;  4LNU D;  3ULQ A;  5JJT A;  4A1S A;  4GU5 A;  2WXR A;  3UIO C;  1EYH A;  4L1B A;  3IEG A;  3EIJ A;  4Q94 A;  4KZ0 A;  2BF0 X;  2XRY A;  3FWV A;  4V3I A;  2P9L G;  2C2L A;  5FQ8 A;  1HFA A;  2P9U G;  4HS2 A;  1YA0 A;  5JMN D;  4YND A;  5ENR D;  2GGF A;  5ITZ F;  4CGW A;  2VGY A;  4P29 A;  2NC9 A;  5FWQ A;  4IRU A;  3WG7 E;  5KJN A;  3EHM A;  3LDZ A;  1PC2 A;  3MYV A;  3FTU A;  1QZ2 A;  4OYS A;  3MCX A;  5AQB A;  2WXO A;  4FJZ A;  1IQU A;  3RAU A;  1MQS A;  3GZ1 A;  3AS4 A;  4M3O A;  3B95 A;  4NAC A;  5HKP A;  4U8H A;  1L5J A;  4JPS A;  4GZ3 A;  1DNP A;  3NBN B;  1DC2 A;  1WG0 A;  3G2S A;  3IHY A;  1JWF A;  2JAB A;  4B0Z A;  4CZ2 D;  4DX1 A;  5KJK A;  1HG5 A;  5E75 A;  2YIN A;  4UWH A;  1HX8 A;  4J6I A;  3UM1 A;  5KNH D;  3ZIM A;  3FH8 A;  3EHR A;  2L6B A;  3X2Q E;  3VLF A;  5AQA A;  1K1B A;  1EF1 C;  2HO1 A;  3PZ4 A;  5AN8 A;  4K0R A;  5BXU A;  3CGH A;  3TJP A;  4DX2 A;  3CQC B;  4ANX A;  3AG4 E;  3P2B A;  1U3C A;  2DWZ A;  2WMO A;  2ETB A;  4PS8 A;  1SQM A;  2RKK A;  2A5U A;  3AS8 A;  1KT1 A;  1MJ0 A;  2BTD A;  3C3O A;  3P1U A;  4U8Y D;  3ZRH A;  3B7U X;  2JEK A;  1E8X A;  3LCA A;  2Y0B G;  4BET A;  1K3Z D;  4QQI A;  4J7W A;  1UN8 A;  2P58 C;  4GYW A;  1A17 A;  3BUA A;  4I2Z A;  2J49 A;  2FUL A;  4GYO A;  4UI9 C;  4JC8 A;  4I9C A;  3FUH A;  3KAE A;  3ML9 A;  5AQ9 A;  2I9C A;  4UI9 J;  2C0L A;  3FH5 A;  3ZYM A;  3JXJ A;  1SA4 A;  2V5F A;  3E34 A;  3IKO B;  2PM6 A;  5C1D A;  3N71 A;  3UMV A;  2WQ7 A;  2A5E A;  5FJY A;  3HDX A;  1RZ4 A;  2XGO A;  4TUM A;  2FI7 A;  2WMN A;  2VJ8 A;  4TXP A;  4FU3 A;  3LPZ A;  3SNX A;  4GPK A;  3AS5 A;  2RFM A;  2L6J A;  3SZ7 A;  4GYY A;  2FO7 A;  4J8S A;  4RLY A;  2RD0 A;  3D9O A;  2OEW A;  3EU5 A;  4B89 A;  1TNO A;  3AG3 E;  4TV3 A;  5AIJ A;  1INZ A;  2DYR E;  4JA9 A;  4K5C A;  3Q9U C;  3UIP C;  2AWI A;  2WXG A;  3SI5 A;  3FUD A;  3APD A;  4BY6 A;  3PVL A;  1K1A A;  3ZNG A;  1QBQ A;  3HG0 D;  3CVQ A;  4N2Q A;  5AEN A;  3FEX A;  4BX9 A;  2R2L A;  2R5S A;  2XEE A;  1HS6 A;  4AP2 A;  3APC A;  1N94 A;  3PE3 A;  2OVF A;  2UWJ G;  3SY2 A;  4HFG A;  3DXM G;  5AAO A;  5T3R A;  3UI2 A;  4JZY A;  3E32 A;  4RVB A;  5ENQ D;  2R59 A;  1VDY A;  2IF4 A;  2E2E A;  4FLH A;  5BXO A;  1Q2Z A;  3AAA C;  5LCW C;  2KCK A;  4J8F A;  4G2V A;  1OUV A;  2YHE A;  3FY4 A;  1S70 B;  3APF A;  3HRA A;  4G25 A;  5LCW J;  2BED A;  5CED B;  5ARG A;  5LOZ A;  1OT8 A;  1UW4 B;  2V4L A;  1WM5 A;  5J90 A;  2AJA A;  1H2U A;  4UWF A;  1MYO A;  3R7R A;  2RFA A;  2AVP A;  1TNU A;  3GZ2 A;  1DVP A;  4F7A A;  2XPZ A;  2XCC A;  2LSU A;  5FIO A;  5JJ6 A;  4JA7 A;  2XEH A;  4DK5 A;  2GRQ B;  2H6H A;  3BQO A;  3ZYQ A;  4F6R D;  4HQD A;  3UIN C;  2WPV A;  3FUN A;  4F1S A;  4KVM A;  5G55 A;  4Q96 A;  5BV1 A;  3S7D A;  4GA0 A;  4BTB A;  4K5B A;  3DBS A;  4CT0 A;  2E0I A;  3ZPJ A;  3V79 K;  4I1A A;  4GTQ A;  3HXE A;  2WXQ A;  2NSZ A;  4O60 A;  4B93 B;  2FF4 A;  4GZ5 A;  3MX3 A;  4DX7 D;  3DPY A;  4AY6 A;  2WXM A;  2FBN A;  4FLB A;  3FUK A;  5CEA A;  4UI9 K;  1YMP A;  4GML A;  3B7B A;  3QDN A;  2B6C A;  4OAV B;  3C3Q A;  3ONK A;  5BNW A;  4DI3 A;  2XCB A;  3QWV A;  2KXP C;  3JUI A;  1H2V C;  3D9I A;  1W3B A;  2AXV A;  4UUC A;  3PRZ A;  4XEI G;  5FTP A;  3LJ3 A;  2BUG A;  4PS7 A;  4FHJ A;  2Y1L E;  3TG4 A;  3E33 A;  3RU0 A;  4AJW A;  1TNZ A;  3PH0 C;  4ATG A;  2GRP B;  1KLX A;  4EZK A;  3DEO A;  1NA3 A;  4GTM A;  1OCZ E;  1H6O A;  2I2O A;  2F8Y A;  3D3M A;  3QJZ A;  3CR3 A;  2DVW A;  2PL2 A;  4EBA G;  4L9P A;  4PUC A;  4JW1 A;  2WXK A;  1D9S A;  2NXP A;  5KJM A;  3PNL B;  2QYU A;  1UG3 A;  2PZI A;  3SGH A;  1AP7 A;  5C2Y A;  3ENE A;  3LVR E;  1NFI E;  2KZT B;  3NQP A;  5CRV A;  1QYM A;  3PEV B;  3PEU B;  5KBA A;  4JD2 G;  2IU1 A;  1N11 A;  5A6C A;  4M7C A;  3Q7F A;  4BTA A;  2IO2 C;  4XKC A;  5G2N A;  3IXE A;  2LAI A;  3MV3 B;  3FEY A;  4HI9 A;  3FFL A;  3KEA A;  4N5C A;  5AJL A;  1MZC A;  3ASF A;  2XZD G;  1MHQ A;  3OXF A;  1OWP A;  3L17 A;  2X6J A;  2X6K A;  4ACL A;  4LG6 A;  3MGB A;  5CCL A;  3FU6 A;  3SFY A;  3CVV A;  4UWK A;  1N4R A;  1BLX B;  3KSQ A;  2XPI A;  2XEV A;  3UX4 A;  2B0O E;  4I6G A;  4WND A;  1JWG A;  2QFC A;  3R9M A;  4HI8 A;  5A23 A;  2LUH A;  4YVO A;  5KNG A;  3OXL A;  4XX5 A;  1QNF A;  4JEH A;  4HOS A;  5KJL A;  3AG2 E;  2MHK A;  1TN6 A;  2X6H A;  3ZYL A;  3PDN A;  3TXM A;  1YYH A;  5LP0 A;  4MLP A;  1OCR E;  3ZYK A;  4HOT A;  4H7X A;  3NZU A;  3DSS A;  3CHP A;  1OCO E;  3UUX A;  2OV8 A;  2KAT A;  4YDE A;  2L0I A;  2NYJ A;  4GB9 A;  3ASH A;  3MKQ A;  3ESL A;  4DJA A;  2RG8 A;  2Y4T A;  3SO8 A;  3DSV A;  3Q4A B;  3ABM E;  1V55 E;  3S7J A;  2OEV A;  5FZR A;  3PE4 A;  4N5Q A;  4G1T A;  2HYZ A;  3MA5 A;  2DZN A;  1Z5S C;  1OXJ A;  5HRY A;  1ZBP A;  5CER B;  4B8A A;  5KCM A;  1EDU A;  4PS3 A;  3PS6 A;  3TXN A;  4BFR A;  4UWG A;  4B8C B;  1S63 A;  4I2W A;  3L54 A;  5FZQ A;  4EHM A;  1U2V G;  3RO2 A;  3W9G A;  3UM3 A;  3HHM A;  4HOR A;  4HRN A;  5JJ7 A;  3EHQ A;  2VSO E;  3L22 A;  3ULE G;  4APF A;  5ARF A;  5AYW D;  1N0Q A;  2ETC A;  3VLD A;  2CHX A;  3AU5 A;  3UT7 A;  4AM9 A;  2YNQ A;  3G2W A;  2P9K G;  4J0U A;  4NIK A;  4DX6 D;  2OVB A;  4F3V A;  4ILH B;  3HXB A;  2YQ8 A;  3TGO A;  3BEE A;  2V5Q C;  3OTN A;  4YDY A;  4U96 D;  3HIZ A;  5G05 C;  2QY7 A;  3IV0 A;  4DUI A;  3Q75 A;  2WXL A;  5HI7 A;  1WAO 1;  3B7T A;  3KSL A;  4UQY A;  3U9W A;  4J8E A;  3QWP A;  3B13 A;  3FH7 A;  3ZUV B;  1E8Y A;  5G05 J;  2IY0 C;  5ENN A;  3TWW A;  5DBK A;  4U95 D;  3J5Q B;  4DRX E;  4Y6C A;  3LY8 A;  3ZXS A;  1BU9 A;  2IOL A;  2DBA A;  1E7U A;  4NRH B;  1JCQ A;  3MKR A;  4G23 A;  4HNA D;  4CDR A;  4ACK A;  2ZXW E;  4L23 A;  5EX0 A;  4N3C A;  3SBS A;  2YHC A;  4I1M A;  4A63 B;  4O1O A;  3E37 A; 
#chains in the Genus database with same CATH homology
 2Y0B G;  3DEO A;  4GMR A;  3TWU A;  4QFV A;  4BET A;  1K3Z D;  1BLX B;  2FO1 E;  5FIO A;  4QQI A;  5AQ7 A;  5HS0 A;  1YCS B;  4HRL A;  4J7W A;  3NOG D;  3W9G A;  3ZU7 B;  1K1A A;  4HRN A;  2B0O E;  1BD8 A;  3TWV A;  3UTM A;  3ZNG A;  4BSZ B;  3EHQ A;  2XEH A;  5ENO D;  4HI8 A;  2F8Y A;  2MYO A;  3HG0 D;  5EIB E;  3V31 A;  2DVW A;  1IXV A;  4F6R D;  4HQD A;  2HE0 A;  5KNG A;  2F8X K;  5EN5 D;  5CBN A;  5AQB A;  5EYL A;  1N0Q A;  2ETC A;  3C5R A;  2QYJ A;  4GPM A;  5ENT D;  5AAR A;  4DX5 D;  4HB5 A;  3JXI A;  2XEE A;  1D9S A;  4BEP A;  1IHB A;  2BKK B;  4K5B A;  5ITZ F;  3B95 A;  4NIK A;  4DX6 D;  3Q9N C;  5HKP A;  4G8L A;  3F6Q A;  3AJI A;  2DZO A;  2XZT G;  3NOC D;  3TWT A;  3V79 K;  5EID A;  4JB8 P;  3NBN B;  1DC2 A;  1WG0 A;  4CZ2 D;  1AP7 A;  2JAB A;  4DX1 A;  3TWQ A;  3EU9 A;  2V5Q C;  3V30 A;  1N0R A;  4HLL A;  5AQ9 A;  1NFI E;  1BI8 B;  4YDY A;  1YYH A;  4U96 D;  4O60 A;  3V2X A;  5AAO A;  3JXJ A;  4G8K A;  4B93 B;  1QYM A;  3UI2 A;  4ATZ D;  2V4H C;  2ETA A;  5KNH D;  4DUI A;  5KBA A;  4DX7 D;  3TWX A;  1UOH A;  3EHR A;  1MX4 A;  1N11 A;  2L6B A;  5ENQ D;  3UXG A;  1BI7 B;  1DCQ A;  3T8K A;  5CEA A;  5ENS D;  1YMP A;  4Z68 A;  1IKN D;  3B7B A;  5AQA A;  1K1B A;  3ZUV B;  2ZGG A;  5BXO A;  2A5E A;  5KWD A;  4OAV B;  3TWR A;  3AAA C;  5AN8 A;  4F1P A;  3TWW A;  5BXU A;  2KBX A;  1WDY A;  1A5E A;  3IXE A;  4U95 D;  4ZHB A;  5D66 A;  4DX2 A;  4OAU C;  4LNU D;  2P2C P;  1OY3 D;  4TUM A;  2BKG A;  3DEP A;  2NYJ A;  2XEN A;  4O1P A;  3J5Q B;  2KXP C;  4HI9 A;  4C48 B;  4DRX E;  4BES A;  4BER A;  4YDW A;  1TR4 A;  1S70 B;  2RFM A;  2F37 A;  1SVX A;  2J8S D;  4HRM B;  3SO8 A;  3HRA A;  3LJN A;  3ZKJ A;  3KEA A;  3JUE A;  1SW6 A;  2PNN A;  1MX2 A;  4UUC A;  3TWS A;  1AWC B;  1BU9 A;  4RLY A;  5EIL A;  5CED B;  1G3N B;  2Y1L E;  2DWZ A;  4N5Q A;  3J5P A;  4HNA D;  2DZN A;  5FIN A;  4LSZ E;  5HRY A;  3W9F A;  2ETB A;  1OT8 A;  2XZD G;  2VGE A;  5ENP D;  5CER B;  4CYM D;  2AJA A;  5JA4 D;  5JMN D;  1MYO A;  5ENR D;  2QC9 A;  4K5A B;  4U8Y D;  1MJ0 A;  5CEC B;  2RFA A;  4J8Y A;  4K5C A;  4A63 B;  1MX6 A;  4HBD A;  3T9K A;  4ZFH A;  4LG6 A;  5CBO A;  2ZGD A;  4O1O A;  5EYP F;  3Q9U C;  4U8V D;  3D9H A;  3V2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...