4ZFHA

Crystal structure of artificial ankyrin repeat protein_ank(gag)1d4 mutant -y56a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
ADLGKKLLEAARAGQDDEVRLLLEHGADVNARDSIGSTPLHLAAAYGHLEIVRLLLEHGADVNARDSTGTTPLHYAARLGHLEIVRLLLEHGADVNARDAMGWTPLHLAAKKGHLEIVRLLLKHGADVNANDHFGKTAFDISIDNGNEDLAEILQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Artificial ankyrin repeat protein_Ank(GAG)1D4 mutant- Y56A
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Artificial ankyrin repeat protein_Ank(GAG)1D4 mutant -Y56A
total genus 55
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4zfhA00
2B0OE 4HLLA 4OAUC 2DZNA 5HKPA 1DCQA 4G8LA 1G3NB 3TWRA 1K1AA 1MJ0A 2QYJA 3ZNGA 4DUIA 5JMND 2BKKB 5AQBA 3W9GA 2DZOA 4DX2A 2QC9A 2V5QC 5ENPD 3J5QB 3TWQA 4K5AB 3JXIA 4J7WA 1BI8B 3V2OA 3LJNA 1MX6A 3UTMA 3ZKJA 4LG6A 2A5EA 1OY3D 5AQ9A 2XZDG 3HRAA 1OT8A 2ETBA 2Y0BG 1SW6A 4JB8P 3AAAC 4GPMA 4O60A 3F6QA 5EIBE 4NIKA 5BXOA 4G8KA 5AQ7A 2ZGDA 4U8VD 4N5QA 5CEDB 3ZU7B 3V79K 4O1OA 4DX1A 1WG0A 1AP7A 3B95A 2L6BA 2XEEA 5CEAA 1K3ZD 1SVXA 4U8YD 4GMRA 1N0RA 1D9SA 2NYJA 2F8XK 1IXVA 1QYMA 4CZ2D 2FO1E 2F8YA 3KEAA 5EYLA 1TR4A 4F1PA 2MYOA 5D66A 1AWCB 1YCSB 3UXGA 3ZUVB 4HRMB 1BU9A 2J8SD 4TUMA 4LNUD 3TWTA 5JA4D 3T9KA 4YDYA 1YMPA 1BI7B 4DX5D 3V30A 1BLXB 2DVWA 5BXUA 2F37A 4QQIA 4DX7D 4HI9A 4UUCA 5CECB 5ENQD 2KXPC 1IHBA 1N0QA 2RFAA 3JUEA 2VGEA 4LSZE 4QFVA 3AJIA 2BKGA 4A63B 3NOGD 5ENOD 3Q9NC 5KNGA 2RFMA 4BERA 1UOHA 3TWVA 5AAOA 2DWZA 4CYMD 3EHRA 3JXJA 1BD8A 1NFIE 5KBAA 1N11A 4K5CA 3DEPA 3TWSA 5CERB 1MX2A 1DC2A 5CBOA 4BETA 4ZHBA 4HBDA 3DEOA 1K1BA 5ENSD 4ZFHA 3EHQA 3TWWA 3UI2A 4O1PA 3IXEA 5FIOA 2HE0A 4HNAD 4Z68A 4C48B 1MYOA 4YDWA 3HG0D 3B7BA 3TWUA 1MX4A 2XZTG 1YYHA 2ZGGA 3V2XA 4F6RD 1WDYA 2ETAA 2V4HC 2XEHA 2AJAA 3C5RA 5KWDA 2PNNA 4HB5A 5EIDA 5EYPF 3TWXA 4B93B 2P2CP 4U96D 4RLYA 4DRXE 1A5EA 5EN5D 5ITZF 3NBNB 5EILA 2ETCA 5ENTD 4HRNA 3D9HA 3J5PA 5AARA 4OAVB 5ENRD 5FINA 3NOCD 5CBNA 4HQDA 4K5BA 1IKND 3EU9A 2JABA 2KBXA 4HRLA 3T8KA 3V31A 2XENA 3W9FA 4BEPA 3Q9UC 4DX6D 4BSZB 5AN8A 5KNHD 4BESA 5HRYA 2Y1LE 4U95D 4J8YA 5AQAA 5HS0A 4ATZD 4HI8A 1S70B 3SO8A
chains in the Genus database with same CATH superfamily
3FU0A 4IN3B 4XI0A 3UT4A 4G8LA 3ZGQA 3W9GA 3T5VA 4FP7A 2FEZA 3LCAA 1Y6IA 4ANXA 1KZOA 4DLOA 2KC7A 3PUKA 4C9BB 5JJTA 1HU3A 2J9QA 2I9CA 1OCZE 2VGYA 3L6AA 3TWTA 3ESKA 1YMPA 3AS5A 5FQ7A 3SI5A 2I6HA 2AXVA 4KT6B 5FZSA 4U0SA 4JVSA 4X8QA 4F3VA 4GA1A 2LXLA 2UWJG 5ANLA 3QJZA 4PUCA 2XZTG 1UN9A 2ZGGA 4CGVA 2X3MA 4GMLA 4GZ6A 4UWGA 2WXLA 1Z6TA 2XHEA 2DYRE 4GTOA 2EIME 2YNQA 3KEZA 1TNYA 2FBNA 1IKND 3D9NA 4HRLA 1UJKA 3C98A 3CKBA 4L9PA 3IHYA 3IBEA 3L13A 4N2QA 2QYJA 4FHJA 3FU5A 4JZYA 3JXIA 3HRAA 1TJFA 4I6GA 4JB8P 2RG8A 3UM1A 3DSTA 3V79K 3ZW3A 1HO8A 2Y69E 4L23A 3JYSA 4MS6A 4CCAA 3HXDA 2LSUA 3TL5A 1YCSB 4I17A 3UKRG 2X6IA 2EILE 2L0TB 4UWHA 4TXQA 2F37A 1HG5A 2WXJA 3FULA 1OWMA 3OTNA 3Q9NC 4RG6A 4G25A 5AAOA 2DWZA 3DPDA 1QBQA 2WQHA 4NURA 4YDEA 3O4ZA 1TJCA 2EQXA 5FIOA 3CEQA 1N4QA 3QWWA 2WXMA 3B7SA 2WQ7A 1W3BA 2ETAA 2AJAA 3G2UA 4J0UA 4DRXE 3D9PA 5CCMA 3IHVA 5CMWA 4F7AA 3L22A 5E75A 4JEUA 3NOCD 3HVEB 1U3CA 2J09A 4BESA 3CR3A 2YINA 1NL4A 5EX0A 1S63A 2Y4UA 2CHWA 1UW4B 1V54E 3MYVA 4XIFA 3UUXA 1OY3D 5C2YA 4CDMA 3CVYA 2ZGDA 3FTXA 3T8MA 1Z3XA 1WG0A 3G2TA 4ACKA 1A17A 2F8YA 4KVMA 3DSVA 3L9TA 4ILIA 5FQ6A 2MYOA 2R02A 3VLFA 2IFUA 4NQ0A 1BI7B 4EECA 2WXQA 3CVXA 3TGOA 4JA9A 4B8AA 2VGEA 2ZIRA 2IQCA 3RRMB 2PZIA 2BKGA 4A63B 2VTBB 4AEZC 3KS2A 3GZ1A 4L2LA 5FZQA 4JD2G 4G1TA 5ENSD 2J07A 4XEIG 2GRRB 1E7UA 2KCVA 3BEEA 2EIJE 2A4ZA 3G2VA 3AG3E 4GYYA 4DI4A 4K0RA 4U96D 4U0ZA 3BQOA 3MEKA 3EHMA 4U7EB 4N5CA 3CSTA 3VTXA 2VQ2A 2VTBA 4HQDA 2H6GA 2ZU6B 3V31A 1TNBA 3I4GA 5AQAA 3E37A 2B0OE 5HKPA 2RD0A 3ML8A 2V0PA 4HLEA 5KJKA 1H2UA 2CHXA 2WMNA 3PUJA 2A5EA 3CVUA 3FDHA 5BV1A 4JHJA 5EIBE 3MX3A 4G8KA 4RSYA 2X6FA 4PS8A 3ZYMA 4GMRA 2F8XK 2P9IG 2BEDA 1H6PA 1RZ4A 3RAUA 4U8HA 3FU6A 3EJNA 4EBAA 5BPPA 1H0AA 2FI7A 5D0QD 3I3NA 3DXMG 4HI9A 1LD7A 2ONDA 1LTXA 3IV0A 3HVEA 1XGWA 3TWVA 1OWLA 4CYMD 4IULA 1N11A 2XPIA 1OXJA 2XGMA 2WXKA 4O1PA 2V4LA 1SZAA 1N52A 3B7BA 2X6JA 5ANRA 3GZSA 1O5MA 3I5PA 3CVWA 5CRVA 5EYPF 4A1GA 5B1BE 2M63A 3NBNB 3AU5A 3U64A 4KYOB 3Q47B 2KCLA 2WXOA 2R05A 3S7BA 4U0UA 3Q15A 3FTWA 4KVOA 4MBGA 3DSWA 5B3SE 3PE4A 5J08A 3J5QB 3SO8A 4NACA 5JHAA 2LSVA 4GTRA 4EQFA 5AQBA 3R9AB 1PC2A 3CK7A 3RO3A 1Z5SC 3EU5A 3TWQA 5BNWA 1MX6A 5B1AE 2Y0BG 3DSXA 4GCNA 4GPMA 3E33A 2OEWA 4BX9A 4HOQA 4HVBA 2QZAA 1JWGA 2XEVA 4XKBA 3B95A 3PZDA 2MHKA 5ENNA 4R7LA 2LAIA 4WWOA 4F1PA 2QFCA 3KAEA 4U04A 2LAHA 3FP3A 1JWFA 2J8SD 4G2VA 3CKCA 4DX7D 2IJGX 4H7XA 4GZDA 3ASGA 3SZ7A 3E34A 3AJIA 3CVLA 4JA7A 3APFA 2IF4A 3AG4E 3BG0B 4FADA 4FA6A 3EHNA 3JQ1A 4WAFA 5CRUA 1H2TC 5HI7A 5EX3A 3QNKA 2P9LG 3L82A 3L17A 3L54A 4UQXA 1N4SA 4GTQA 4G23A 3S7JA 4HRNA 3ULEG 3J5PA 1D8DA 3LS8A 4K5BA 4Q69A 2DIWA 5KJNA 1KT0A 3RJVA 3CVQA 5AN8A 3FUEA 2JEKA 4UWLA 3L16A 4WNEA 3ULYA 3PZ4A 2L6JA 3JQ0A 3NQPA 3CVVA 3R7RA 3LPZA 3T5XA 4WNDA 1BI8B 1TNZA 3AAAC 4NIKA 2LNIA 4YVOA 1HX8A 4W9RA 3KSQA 3SFXA 1TEZA 4XE0A 1QYMA 1SA4A 4I6EA 4FULA 5LCWC 4DK5A 3UPVA 5T8IA 3V30A 2KXPC 1SA5A 5LOZA 4I9CA 3E30A 2XPZA 1JCRA 1O1RA 4TV3A 4GTSA 3CLJA 2AVPA 4PS7A 3DEPA 5CERB 4A3VA 5J90A 2OVBA 4BETA 4AVXA 4ZHBA 3CIAA 4XKCA 4HNAD 4Z68A 3MKQB 4YDWA 4G24A 1QQEA 3Q78A 4JL0A 3DBSA 5FQ4A 4A55A 2XEHA 4GTMA 5ENTD 3PZ1A 2XRYA 3SF4A 3FUFA 3VLDA 1QZ2A 2XENA 4B94A 2VYIA 3LY8A 3R9MA 3QKYA 3LVQE 1G3NB 2PQNA 2V5QC 3ENEA 1B89A 4MRUA 2HR2A 2C0MA 3P1UA 3PRZA 1GW6A 2XEEA 2GW1A 1N0RA 1HH8A 1D9SA 3LY7A 1X81A 5AYWD 3CV0A 3JCKC 5BT1A 4CZ2D 3ZHEB 1HE8A 4HRMB 4N39A 1EPUA 4N3BA 1U2VG 3N71A 1ZBPA 4LRZA 5CECB 1ELKA 3FUMA 2RFAA 1INZA 5FQ8A 3HXBA 1HG2A 3Q49B 3ASFA 4LCTA 3UM2A 4AOFA 1IHGA 3TWSA 3UI2A 4GU5A 2HE0A 5FZRA 1TN6A 4EZLA 4C48B 1MYOA 3SQVA 2VJ8A 2ZISA 4LUNU 4TXRA 4I1AA 3QC1A 4N2SA 2R5SA 4JHRA 2V4HC 4JPSA 3HDXA 2XGSA 3PEVB 4ABNA 3U66A 4FJZA 4WUYA 4EHMA 3FUDA 4WWNA 4V3IA 5JJ7A 3LEWA 4U95D 1MHQA 1S70B 2WM9A 1E8XA 4BSXA 5H7PA 3FTYA 5JMND 2BKKB 2QC9A 2J49A 1KT1A 4K5AB 1DCEA 1U3DA 3U4TA 3UM0A 4LG6A 4J6IA 2EINE 2ETBA 3CHPA 4I2WA 5AQ7A 5EKQD 1AP7A 1OUVA 2XPYA 4GTVA 4AY5A 4CDNA 4FLHA 3RIBA 3UKUG 3EIJA 3CGHA 3HYMB 3UM3A 3QOUA 4BT9A 4FC8A 4UI9C 3PNTB 1HS6A 4LNUD 4GZ3A 3T9KA 2I2OA 5ARFA 3TG4A 1BLXB 3QARA 5BXUA 1YA0A 3HIZA 3B7RL 4HFGA 1E8ZA 3UINC 1E90A 4EZJA 1FT1A 1NFIE 3ZYQA 1TYQG 4HBDA 3UX4A 3QWVA 3DXKG 2VSOE 5G04J 4KMOA 1WAO1 2H6HA 2E2EA 3CK9A 3E4BA 1WDYA 2VGXB 2GRPB 3RKVA 2B6CA 4I43A 4MKTA 5LX8A 3WXXA 2PM6A 3L08A 4PS3A 3QDNA 5BW8C 5DIZA 2Y1LE 3ISMC 3EUVA 4HLLA 2GGFA 3TXMA 3TWRA 1MJ0A 4DUIA 3C3OA 4L7TA 4J7WA 5LFAA 2VGXA 2R2LA 2V5FA 2CG3A 3UT8A 4B8CB 5CEAA 4U8YD 2WMOA 1N94A 3FUNA 5AIJA 4MLPA 3FWVA 1TR4A 2IO2C 4Q94A 1BU9A 5D2MC 4CDRA 2MRIA 3KD7A 2Y4TA 3CK8A 5D0OD 4DX5D 4HXIA 2F0YA 1TNOA 4BTBA 1P5QA 5M72A 4GTPA 2CHZA 4UI9K 3IXEA 3RRNB 1IYGA 2OCCE 1H19A 5FWQA 3ZPJA 5A23A 3V2XA 1TN7A 4F6RD 4AP2A 4HS2A 4OYSA 2VSNA 4HOSA 2ETCA 4OAVB 3QWPA 4JW1A 5KJMA 1OCCE 4LEUA 2IU1A 1X5BA 4HI8A 4G11A 3ZXSA 1KPSB 1PY1A 5G05J 5G04C 3X2QE 5AJDA 3SBTB 4Q96A 3UMVA 1O1SA 3ZKJA 5AQ9A 2FULA 1K8KG 3Q73A 4GAAA 3CQCB 3ONLA 4GZCA 1NP7A 2WXRA 3RK6A 1JUQA 3OXGA 2PL2A 5BUZA 2VSYA 3FH8A 1AWCB 5G55A 1EYHA 4WNGA 5JA4D 1N54A 1JCSA 3FH7A 4LSZE 4QFVA 4CT4A 3MGBA 3NZUA 1JCQA 2UY1A 4RVBA 1BD8A 3RO2A 3FFLA 3D9KA 3DEOA 3NF1A 1E8WA 4EBAG 3DSUA 4M7CA 1H2VC 3TWUA 3BUAA 4U63A 1OCRE 4UQYA 2Q7FA 3R7QA 3LYAA 1TN8A 2KATA 2P2CP 4RLYA 1A5EA 2CG2A 5EILA 1BPOA 3QAQA 3B13A 5AARA 2V8SE 4JC8A 1H6KA 4URKA 2LO6A 1KZPA 2KBXA 3T8KA 4ATGA 3OAWA 2AW6A 3QK0A 1Z3YA 2HM8A 1OWPA 2QY7A 3K9IA 1PAQA 3ONKA 4E6HA 2X6HA 3DPYA 5ENPD 4E85A 1ELRA 4UQZA 3MZLB 4P29A 3APDA 1OCOE 2PM7A 2DBAA 3PDNA 3MA5A 3ZIMA 2YHEA 3SBSA 2C2LA 2L6BA 3FTZA 2VSXE 4J8SA 3C3QA 2WVIA 3MKRA 1FVHA 2FO1E 2H6FA 3GYZA 2E0IA 4JHKA 3PS6A 3ZUVB 4BFRA 3CHQA 4J8EA 2XQ0A 4B89A 3D9JA 2WB2A 3SD5A 4UUCA 5ENQD 1IHBA 3FTUA 5LP0A 5ENOD 1UOHA 4TUUA 1XNFA 3ZYKA 5KBAA 4UWFA 4NRHB 3B7TA 3FUIA 3EHQA 3PEUB 4DLQA 4ZFHA 4N3AA 3HG0D 4F53A 1MX4A 2R59A 1YYHA 2GRQB 4ANWA 4G26A 2KZTA 1N95A 3QB2A 3C5RA 5KWDA 4HB5A 3ASDA 1EDUA 4CGWA 2J4BA 5ITZF 5BV0A 3MKQA 3D9HA 4L1BA 2H6IA 4HOTA 3GW4A 5CHEE 3LDZA 4HORA 3FTVA 1UN8A 3UIOC 3IKOB 4BEPA 2JABA 1MZCA 3CSFA 3D9MA 4DX6D 4H7YA 2IO3C 4J8YA 4ATZD 1E7VA 4KXKB 4K03A 2PQRA 4APOA 4OAUC 4J8FA 1SQMA 1E8YA 1K1AA 3ZRHA 3MJWA 2P9KG 3FHEA 2JLBA 3V2OA 3UTMA 3SFZA 4I2ZA 3TXNA 4O60A 3RRUA 1H6OA 2IEJA 2GRMA 4U8VD 4N5QA 3OXLA 4B0ZA 1SVXA 2GRNB 4CT0A 3LJ3A 2IOSA 3SNXA 2LUHA 4GYWA 1IXVA 3Q5MA 4LNGA 2NC9A 2XS1A 3PNLB 5LCWJ 3LVRE 2BUGA 4LERA 2OEVA 3TG5A 4ANUA 2IONA 5G05C 5DBKA 1FT2A 3MCXA 3SY2A 4FU3A 4BERA 1IQUA 3AG2E 3MV3B 4U07A 3EHRA 4AIFA 1MX2A 2P9PG 5FT9A 3TWWA 5E76A 4AY6A 3FTSA 3TAXA 1N4RA 3DSSA 4BT8A 4TXPA 4DPRA 5EN5D 4GZ5A 1QNFA 3DWLG 4A1SA 3AU4A 2DYSE 5JJ6A 3G2SA 1FVFA 3TJPA 4ACLA 4ANVA 2J4DA 2WXGA 1DNPA 4GCOA 3D3MA 4JEHA 4I1OB 4EPZA 4FJYA 3CVNA 1S64A 3C3RA 2WXFA 3F6QA 5C1DA 1N4PA 4O1OA 4APFA 2WXHA 2OOEA 3LKUA 2XRZA 3U3WA 5A6CA 2CFUA 2R03A 2XS8A 4WWPA 2OVFA 3S7FA 2ILRA 3Q7FA 2I1KA 4Y6CA 2WXPA 5FTPA 1OWNA 3RU0A 1RW2A 3WG7E 3EDTB 4L2YA 3ABLE 3JUEA 4N3CA 3VTYA 2RFMA 1DVPA 2GROB 4HOUA 3JUIA 1N9AA 3CHRA 3LY9A 1NA3A 2NSZA 2X38A 3ZXPA 1Y8MA 3ZN3A 5G2NA 4XZ4A 3I4RB 3ML9A 2XCCA 4IRUA 4I1MA 4YDOA 3VLEA 4RQIA 4UWKA 3FUJA 4EZKA 5ENRD 4M3OA 3ABKE 4XX5A 3W9FA 3SFYA 4UI9J 3HHMA 3CVPA 3ZNGA 3ASHA 3HXFA 2DZOA 1NA0A 3D9OA 1HF8A 4I6JA 2EIKE 3LJNA 2XZDG 2HYZA 2CFZA 5BXOA 3PVLA 5FJYA 4DX1A 2Y3AA 2XCBA 2DCPA 1K3ZD 3AS4A 2GRLA 4Y6WA 3FEXA 3LXUX 3FEYA 2L0IA 3HXEA 5EYLA 4GTTA 3FUHA 1UG3A 3D9LA 4WNFA 5D66A 3UXGA 3SHFA 4TUMA 5KCMA 4DJAA 4PDXA 4YDYA 4IYPA 4YVQC 4AM9A 3AS8A 4PH4B 3OXFA 3URZA 1N0QA 1OWOA 3NOGD 4I9EA 1FPPA 2AWIA 4C0MA 3NZSA 2WQ6A 3PZ2A 1MQSA 5HQ8A 2KM4A 1NZNA 5CMYA 2P9SG 3NB2A 2AXZA 3PREA 3ULQA 2X6KA 1SZ9A 3APCA 4AV7A 4KZCA 4GA0A 4OVVA 5EIDA 4B93B 1S0PA 4AJWA 1UJJA 1LD8A 2YHCA 5AENA 5AJLA 5JHBA 1KLXA 5FINA 4OVUA 3EU9A 1JPLA 3O48A 4BTAA 4BX8A 4GYOA 5KNHD 5HRYA 1IQRA 2HO1A 2IY0C 3DRAA 2DZNA 1DCQA 5ARGA 3D9IA 4DX2A 4FHKA 1NI1A 4YNDA 2AXUA 2IOLA 3G2WA 3HXCA 1ZB1A 3ZHEA 4KZ0A 3Q4AB 5T4YA 2A5UA 1SW6A 4CRWA 5CEDB 4FLBA 1V55E 3ZEFA 1ZU2A 2FF4A 3KEAA 1O1TA 4KBQA 3ASOE 4A3TA 3Q7AA 1EF1C 1HXIA 1L5JA 3B7UX 4CEMA 3SGHA 3ESLA 4GA2A 3FY4A 3MV2B 3S2AA 5KNGA 3UQ3A 3PZ3A 2P9NG 5A7DB 3JXJA 3AG1E 4K5CA 1DC2A 3ZVVA 1K1BA 1FCHA 2KZTB 3NAWA 4J8DA 2LXMA 4BY6A 2R17C 3CHSA 1TNUA 4DI3A 3BU8A 2FO7A 4D10C 3CQGB 2YQ8A 2I1JA 5IY5E 2KCKA 5CCLA 1HFAA 3Q9UC 5HS0A 2OV8A 3GZ2A 3UIPC 1ELWA 3FH5A 3C72A 2L9BA 4ILHB 3EIQC 3FU3A 5KJLA 3CHOA 4GPKA 3ASNE 4RG9A 4C0EA 1HZ4A 1OT8A 3E32A 2XGOA 3ZU7B 5EDSA 3PE3A 3ABME 2NYJA 4O6FA 3U9WA 4TRQA 3KSLA 2P9UG 4ILGA 3RSEG 1VDYA 3Q79A 3S7DA 3ZYLA 1E96B 4JXTA 2DVWA 4F1SA 4QQIA 3PH0C 1Q2ZA 3Q75A 2J08A 4LNBA 3BG1B 2RKKA 2WXNA 1WY6A 1WM5A 2ZXWE 3CHMA 4XI9A 5T3RA 4ME2A 2P58C 5CBOA 3ZFWA 4BWRA 3P2BA 2WXIA 3IEGA 2QYUA 2WPVA 4AXHA 2PNNA 3TWXA 2C0LA 3FUKA 2UY1B 3UT7A 2MOWA 4GB9A 2BTDA 5CBNA 1LF8A 4BSZB 2BF0X 4GMJA 2NXPA 1D8EA
chains in the Genus database with same CATH topology
2B0OE 4HLLA 4OAUC 2DZNA 5HKPA 1DCQA 4G8LA 1G3NB 3TWRA 1K1AA 1MJ0A 2QYJA 3ZNGA 4DUIA 5JMND 2BKKB 5AQBA 3W9GA 2DZOA 4DX2A 2QC9A 2V5QC 5ENPD 3J5QB 3TWQA 4K5AB 3JXIA 4J7WA 1BI8B 3V2OA 3LJNA 1MX6A 3UTMA 3ZKJA 4LG6A 2A5EA 1OY3D 5AQ9A 2XZDG 3HRAA 1OT8A 2ETBA 2Y0BG 1SW6A 4JB8P 3AAAC 4GPMA 4O60A 3F6QA 5EIBE 4NIKA 5BXOA 4G8KA 5AQ7A 2ZGDA 4U8VD 4N5QA 5CEDB 3ZU7B 3V79K 4O1OA 4DX1A 1WG0A 1AP7A 3B95A 2L6BA 2XEEA 5CEAA 1K3ZD 1SVXA 4U8YD 4GMRA 1N0RA 1D9SA 2NYJA 2F8XK 1IXVA 1QYMA 4CZ2D 2FO1E 2F8YA 3KEAA 5EYLA 1TR4A 4F1PA 2MYOA 5D66A 1AWCB 1YCSB 3UXGA 3ZUVB 4HRMB 1BU9A 2J8SD 4TUMA 4LNUD 3TWTA 5JA4D 3T9KA 4YDYA 1YMPA 1BI7B 4DX5D 3V30A 1BLXB 2DVWA 5BXUA 2F37A 4QQIA 4DX7D 4HI9A 4UUCA 5CECB 5ENQD 2KXPC 1IHBA 1N0QA 2RFAA 3JUEA 2VGEA 4LSZE 4QFVA 3AJIA 2BKGA 4A63B 3NOGD 5ENOD 3Q9NC 5KNGA 2RFMA 4BERA 1UOHA 3TWVA 5AAOA 2DWZA 4CYMD 3EHRA 3JXJA 1BD8A 1NFIE 5KBAA 1N11A 4K5CA 3DEPA 3TWSA 5CERB 1MX2A 1DC2A 5CBOA 4BETA 4ZHBA 4HBDA 3DEOA 1K1BA 5ENSD 4ZFHA 3EHQA 3TWWA 3UI2A 4O1PA 3IXEA 5FIOA 2HE0A 4HNAD 4Z68A 4C48B 1MYOA 4YDWA 3HG0D 3B7BA 3TWUA 1MX4A 2XZTG 1YYHA 2ZGGA 3V2XA 4F6RD 1WDYA 2ETAA 2V4HC 2XEHA 2AJAA 3C5RA 5KWDA 2PNNA 4HB5A 5EIDA 5EYPF 3TWXA 4B93B 2P2CP 4U96D 4RLYA 4DRXE 1A5EA 5EN5D 5ITZF 3NBNB 5EILA 2ETCA 5ENTD 4HRNA 3D9HA 3J5PA 5AARA 4OAVB 5ENRD 5FINA 3NOCD 5CBNA 4HQDA 4K5BA 1IKND 3EU9A 2JABA 2KBXA 4HRLA 3T8KA 3V31A 2XENA 3W9FA 4BEPA 3Q9UC 4DX6D 4BSZB 5AN8A 5KNHD 4BESA 5HRYA 2Y1LE 4U95D 4J8YA 5AQAA 5HS0A 4ATZD 4HI8A 1S70B 3SO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0O E;  4HLL A;  4OAU C;  2DZN A;  5HKP A;  1DCQ A;  4G8L A;  1G3N B;  3TWR A;  1K1A A;  1MJ0 A;  2QYJ A;  3ZNG A;  4DUI A;  5JMN D;  2BKK B;  5AQB A;  3W9G A;  2DZO A;  4DX2 A;  2QC9 A;  2V5Q C;  5ENP D;  3J5Q B;  3TWQ A;  4K5A B;  3JXI A;  4J7W A;  1BI8 B;  3V2O A;  3LJN A;  1MX6 A;  3UTM A;  3ZKJ A;  4LG6 A;  2A5E A;  1OY3 D;  5AQ9 A;  2XZD G;  3HRA A;  1OT8 A;  2ETB A;  2Y0B G;  1SW6 A;  4JB8 P;  3AAA C;  4GPM A;  4O60 A;  3F6Q A;  5EIB E;  4NIK A;  5BXO A;  4G8K A;  5AQ7 A;  2ZGD A;  4U8V D;  4N5Q A;  5CED B;  3ZU7 B;  3V79 K;  4O1O A;  4DX1 A;  1WG0 A;  1AP7 A;  3B95 A;  2L6B A;  2XEE A;  5CEA A;  1K3Z D;  1SVX A;  4U8Y D;  4GMR A;  1N0R A;  1D9S A;  2NYJ A;  2F8X K;  1IXV A;  1QYM A;  4CZ2 D;  2FO1 E;  2F8Y A;  3KEA A;  5EYL A;  1TR4 A;  4F1P A;  2MYO A;  5D66 A;  1AWC B;  1YCS B;  3UXG A;  3ZUV B;  4HRM B;  1BU9 A;  2J8S D;  4TUM A;  4LNU D;  3TWT A;  5JA4 D;  3T9K A;  4YDY A;  1YMP A;  1BI7 B;  4DX5 D;  3V30 A;  1BLX B;  2DVW A;  5BXU A;  2F37 A;  4QQI A;  4DX7 D;  4HI9 A;  4UUC A;  5CEC B;  5ENQ D;  2KXP C;  1IHB A;  1N0Q A;  2RFA A;  3JUE A;  2VGE A;  4LSZ E;  4QFV A;  3AJI A;  2BKG A;  4A63 B;  3NOG D;  5ENO D;  3Q9N C;  5KNG A;  2RFM A;  4BER A;  1UOH A;  3TWV A;  5AAO A;  2DWZ A;  4CYM D;  3EHR A;  3JXJ A;  1BD8 A;  1NFI E;  5KBA A;  1N11 A;  4K5C A;  3DEP A;  3TWS A;  5CER B;  1MX2 A;  1DC2 A;  5CBO A;  4BET A;  4ZHB A;  4HBD A;  3DEO A;  1K1B A;  5ENS D;  4ZFH A;  3EHQ A;  3TWW A;  3UI2 A;  4O1P A;  3IXE A;  5FIO A;  2HE0 A;  4HNA D;  4Z68 A;  4C48 B;  1MYO A;  4YDW A;  3HG0 D;  3B7B A;  3TWU A;  1MX4 A;  2XZT G;  1YYH A;  2ZGG A;  3V2X A;  4F6R D;  1WDY A;  2ETA A;  2V4H C;  2XEH A;  2AJA A;  3C5R A;  5KWD A;  2PNN A;  4HB5 A;  5EID A;  5EYP F;  3TWX A;  4B93 B;  2P2C P;  4U96 D;  4RLY A;  4DRX E;  1A5E A;  5EN5 D;  5ITZ F;  3NBN B;  5EIL A;  2ETC A;  5ENT D;  4HRN A;  3D9H A;  3J5P A;  5AAR A;  4OAV B;  5ENR D;  5FIN A;  3NOC D;  5CBN A;  4HQD A;  4K5B A;  1IKN D;  3EU9 A;  2JAB A;  2KBX A;  4HRL A;  3T8K A;  3V31 A;  2XEN A;  3W9F A;  4BEP A;  3Q9U C;  4DX6 D;  4BSZ B;  5AN8 A;  5KNH D;  4BES A;  5HRY A;  2Y1L E;  4U95 D;  4J8Y A;  5AQA A;  5HS0 A;  4ATZ D;  4HI8 A;  1S70 B;  3SO8 A; 
#chains in the Genus database with same CATH topology
 3FU0 A;  4IN3 B;  4XI0 A;  3UT4 A;  4G8L A;  3ZGQ A;  3W9G A;  3T5V A;  4FP7 A;  2FEZ A;  3LCA A;  1Y6I A;  4ANX A;  1KZO A;  4DLO A;  2KC7 A;  3PUK A;  4C9B B;  5JJT A;  1HU3 A;  2J9Q A;  2I9C A;  1OCZ E;  2VGY A;  3L6A A;  3TWT A;  3ESK A;  1YMP A;  3AS5 A;  5FQ7 A;  3SI5 A;  2I6H A;  2AXV A;  4KT6 B;  5FZS A;  4U0S A;  4JVS A;  4X8Q A;  4F3V A;  4GA1 A;  2LXL A;  2UWJ G;  5ANL A;  3QJZ A;  4PUC A;  2XZT G;  1UN9 A;  2ZGG A;  4CGV A;  2X3M A;  4GML A;  4GZ6 A;  4UWG A;  2WXL A;  1Z6T A;  2XHE A;  2DYR E;  4GTO A;  2EIM E;  2YNQ A;  3KEZ A;  1TNY A;  2FBN A;  1IKN D;  3D9N A;  4HRL A;  1UJK A;  3C98 A;  3CKB A;  4L9P A;  3IHY A;  3IBE A;  3L13 A;  4N2Q A;  2QYJ A;  4FHJ A;  3FU5 A;  4JZY A;  3JXI A;  3HRA A;  1TJF A;  4I6G A;  4JB8 P;  2RG8 A;  3UM1 A;  3DST A;  3V79 K;  3ZW3 A;  1HO8 A;  2Y69 E;  4L23 A;  3JYS A;  4MS6 A;  4CCA A;  3HXD A;  2LSU A;  3TL5 A;  1YCS B;  4I17 A;  3UKR G;  2X6I A;  2EIL E;  2L0T B;  4UWH A;  4TXQ A;  2F37 A;  1HG5 A;  2WXJ A;  3FUL A;  1OWM A;  3OTN A;  3Q9N C;  4RG6 A;  4G25 A;  5AAO A;  2DWZ A;  3DPD A;  1QBQ A;  2WQH A;  4NUR A;  4YDE A;  3O4Z A;  1TJC A;  2EQX A;  5FIO A;  3CEQ A;  1N4Q A;  3QWW A;  2WXM A;  3B7S A;  2WQ7 A;  1W3B A;  2ETA A;  2AJA A;  3G2U A;  4J0U A;  4DRX E;  3D9P A;  5CCM A;  3IHV A;  5CMW A;  4F7A A;  3L22 A;  5E75 A;  4JEU A;  3NOC D;  3HVE B;  1U3C A;  2J09 A;  4BES A;  3CR3 A;  2YIN A;  1NL4 A;  5EX0 A;  1S63 A;  2Y4U A;  2CHW A;  1UW4 B;  1V54 E;  3MYV A;  4XIF A;  3UUX A;  1OY3 D;  5C2Y A;  4CDM A;  3CVY A;  2ZGD A;  3FTX A;  3T8M A;  1Z3X A;  1WG0 A;  3G2T A;  4ACK A;  1A17 A;  2F8Y A;  4KVM A;  3DSV A;  3L9T A;  4ILI A;  5FQ6 A;  2MYO A;  2R02 A;  3VLF A;  2IFU A;  4NQ0 A;  1BI7 B;  4EEC A;  2WXQ A;  3CVX A;  3TGO A;  4JA9 A;  4B8A A;  2VGE A;  2ZIR A;  2IQC A;  3RRM B;  2PZI A;  2BKG A;  4A63 B;  2VTB B;  4AEZ C;  3KS2 A;  3GZ1 A;  4L2L A;  5FZQ A;  4JD2 G;  4G1T A;  5ENS D;  2J07 A;  4XEI G;  2GRR B;  1E7U A;  2KCV A;  3BEE A;  2EIJ E;  2A4Z A;  3G2V A;  3AG3 E;  4GYY A;  4DI4 A;  4K0R A;  4U96 D;  4U0Z A;  3BQO A;  3MEK A;  3EHM A;  4U7E B;  4N5C A;  3CST A;  3VTX A;  2VQ2 A;  2VTB A;  4HQD A;  2H6G A;  2ZU6 B;  3V31 A;  1TNB A;  3I4G A;  5AQA A;  3E37 A;  2B0O E;  5HKP A;  2RD0 A;  3ML8 A;  2V0P A;  4HLE A;  5KJK A;  1H2U A;  2CHX A;  2WMN A;  3PUJ A;  2A5E A;  3CVU A;  3FDH A;  5BV1 A;  4JHJ A;  5EIB E;  3MX3 A;  4G8K A;  4RSY A;  2X6F A;  4PS8 A;  3ZYM A;  4GMR A;  2F8X K;  2P9I G;  2BED A;  1H6P A;  1RZ4 A;  3RAU A;  4U8H A;  3FU6 A;  3EJN A;  4EBA A;  5BPP A;  1H0A A;  2FI7 A;  5D0Q D;  3I3N A;  3DXM G;  4HI9 A;  1LD7 A;  2OND A;  1LTX A;  3IV0 A;  3HVE A;  1XGW A;  3TWV A;  1OWL A;  4CYM D;  4IUL A;  1N11 A;  2XPI A;  1OXJ A;  2XGM A;  2WXK A;  4O1P A;  2V4L A;  1SZA A;  1N52 A;  3B7B A;  2X6J A;  5ANR A;  3GZS A;  1O5M A;  3I5P A;  3CVW A;  5CRV A;  5EYP F;  4A1G A;  5B1B E;  2M63 A;  3NBN B;  3AU5 A;  3U64 A;  4KYO B;  3Q47 B;  2KCL A;  2WXO A;  2R05 A;  3S7B A;  4U0U A;  3Q15 A;  3FTW A;  4KVO A;  4MBG A;  3DSW A;  5B3S E;  3PE4 A;  5J08 A;  3J5Q B;  3SO8 A;  4NAC A;  5JHA A;  2LSV A;  4GTR A;  4EQF A;  5AQB A;  3R9A B;  1PC2 A;  3CK7 A;  3RO3 A;  1Z5S C;  3EU5 A;  3TWQ A;  5BNW A;  1MX6 A;  5B1A E;  2Y0B G;  3DSX A;  4GCN A;  4GPM A;  3E33 A;  2OEW A;  4BX9 A;  4HOQ A;  4HVB A;  2QZA A;  1JWG A;  2XEV A;  4XKB A;  3B95 A;  3PZD A;  2MHK A;  5ENN A;  4R7L A;  2LAI A;  4WWO A;  4F1P A;  2QFC A;  3KAE A;  4U04 A;  2LAH A;  3FP3 A;  1JWF A;  2J8S D;  4G2V A;  3CKC A;  4DX7 D;  2IJG X;  4H7X A;  4GZD A;  3ASG A;  3SZ7 A;  3E34 A;  3AJI A;  3CVL A;  4JA7 A;  3APF A;  2IF4 A;  3AG4 E;  3BG0 B;  4FAD A;  4FA6 A;  3EHN A;  3JQ1 A;  4WAF A;  5CRU A;  1H2T C;  5HI7 A;  5EX3 A;  3QNK A;  2P9L G;  3L82 A;  3L17 A;  3L54 A;  4UQX A;  1N4S A;  4GTQ A;  4G23 A;  3S7J A;  4HRN A;  3ULE G;  3J5P A;  1D8D A;  3LS8 A;  4K5B A;  4Q69 A;  2DIW A;  5KJN A;  1KT0 A;  3RJV A;  3CVQ A;  5AN8 A;  3FUE A;  2JEK A;  4UWL A;  3L16 A;  4WNE A;  3ULY A;  3PZ4 A;  2L6J A;  3JQ0 A;  3NQP A;  3CVV A;  3R7R A;  3LPZ A;  3T5X A;  4WND A;  1BI8 B;  1TNZ A;  3AAA C;  4NIK A;  2LNI A;  4YVO A;  1HX8 A;  4W9R A;  3KSQ A;  3SFX A;  1TEZ A;  4XE0 A;  1QYM A;  1SA4 A;  4I6E A;  4FUL A;  5LCW C;  4DK5 A;  3UPV A;  5T8I A;  3V30 A;  2KXP C;  1SA5 A;  5LOZ A;  4I9C A;  3E30 A;  2XPZ A;  1JCR A;  1O1R A;  4TV3 A;  4GTS A;  3CLJ A;  2AVP A;  4PS7 A;  3DEP A;  5CER B;  4A3V A;  5J90 A;  2OVB A;  4BET A;  4AVX A;  4ZHB A;  3CIA A;  4XKC A;  4HNA D;  4Z68 A;  3MKQ B;  4YDW A;  4G24 A;  1QQE A;  3Q78 A;  4JL0 A;  3DBS A;  5FQ4 A;  4A55 A;  2XEH A;  4GTM A;  5ENT D;  3PZ1 A;  2XRY A;  3SF4 A;  3FUF A;  3VLD A;  1QZ2 A;  2XEN A;  4B94 A;  2VYI A;  3LY8 A;  3R9M A;  3QKY A;  3LVQ E;  1G3N B;  2PQN A;  2V5Q C;  3ENE A;  1B89 A;  4MRU A;  2HR2 A;  2C0M A;  3P1U A;  3PRZ A;  1GW6 A;  2XEE A;  2GW1 A;  1N0R A;  1HH8 A;  1D9S A;  3LY7 A;  1X81 A;  5AYW D;  3CV0 A;  3JCK C;  5BT1 A;  4CZ2 D;  3ZHE B;  1HE8 A;  4HRM B;  4N39 A;  1EPU A;  4N3B A;  1U2V G;  3N71 A;  1ZBP A;  4LRZ A;  5CEC B;  1ELK A;  3FUM A;  2RFA A;  1INZ A;  5FQ8 A;  3HXB A;  1HG2 A;  3Q49 B;  3ASF A;  4LCT A;  3UM2 A;  4AOF A;  1IHG A;  3TWS A;  3UI2 A;  4GU5 A;  2HE0 A;  5FZR A;  1TN6 A;  4EZL A;  4C48 B;  1MYO A;  3SQV A;  2VJ8 A;  2ZIS A;  4LUN U;  4TXR A;  4I1A A;  3QC1 A;  4N2S A;  2R5S A;  4JHR A;  2V4H C;  4JPS A;  3HDX A;  2XGS A;  3PEV B;  4ABN A;  3U66 A;  4FJZ A;  4WUY A;  4EHM A;  3FUD A;  4WWN A;  4V3I A;  5JJ7 A;  3LEW A;  4U95 D;  1MHQ A;  1S70 B;  2WM9 A;  1E8X A;  4BSX A;  5H7P A;  3FTY A;  5JMN D;  2BKK B;  2QC9 A;  2J49 A;  1KT1 A;  4K5A B;  1DCE A;  1U3D A;  3U4T A;  3UM0 A;  4LG6 A;  4J6I A;  2EIN E;  2ETB A;  3CHP A;  4I2W A;  5AQ7 A;  5EKQ D;  1AP7 A;  1OUV A;  2XPY A;  4GTV A;  4AY5 A;  4CDN A;  4FLH A;  3RIB A;  3UKU G;  3EIJ A;  3CGH A;  3HYM B;  3UM3 A;  3QOU A;  4BT9 A;  4FC8 A;  4UI9 C;  3PNT B;  1HS6 A;  4LNU D;  4GZ3 A;  3T9K A;  2I2O A;  5ARF A;  3TG4 A;  1BLX B;  3QAR A;  5BXU A;  1YA0 A;  3HIZ A;  3B7R L;  4HFG A;  1E8Z A;  3UIN C;  1E90 A;  4EZJ A;  1FT1 A;  1NFI E;  3ZYQ A;  1TYQ G;  4HBD A;  3UX4 A;  3QWV A;  3DXK G;  2VSO E;  5G04 J;  4KMO A;  1WAO 1;  2H6H A;  2E2E A;  3CK9 A;  3E4B A;  1WDY A;  2VGX B;  2GRP B;  3RKV A;  2B6C A;  4I43 A;  4MKT A;  5LX8 A;  3WXX A;  2PM6 A;  3L08 A;  4PS3 A;  3QDN A;  5BW8 C;  5DIZ A;  2Y1L E;  3ISM C;  3EUV A;  4HLL A;  2GGF A;  3TXM A;  3TWR A;  1MJ0 A;  4DUI A;  3C3O A;  4L7T A;  4J7W A;  5LFA A;  2VGX A;  2R2L A;  2V5F A;  2CG3 A;  3UT8 A;  4B8C B;  5CEA A;  4U8Y D;  2WMO A;  1N94 A;  3FUN A;  5AIJ A;  4MLP A;  3FWV A;  1TR4 A;  2IO2 C;  4Q94 A;  1BU9 A;  5D2M C;  4CDR A;  2MRI A;  3KD7 A;  2Y4T A;  3CK8 A;  5D0O D;  4DX5 D;  4HXI A;  2F0Y A;  1TNO A;  4BTB A;  1P5Q A;  5M72 A;  4GTP A;  2CHZ A;  4UI9 K;  3IXE A;  3RRN B;  1IYG A;  2OCC E;  1H19 A;  5FWQ A;  3ZPJ A;  5A23 A;  3V2X A;  1TN7 A;  4F6R D;  4AP2 A;  4HS2 A;  4OYS A;  2VSN A;  4HOS A;  2ETC A;  4OAV B;  3QWP A;  4JW1 A;  5KJM A;  1OCC E;  4LEU A;  2IU1 A;  1X5B A;  4HI8 A;  4G11 A;  3ZXS A;  1KPS B;  1PY1 A;  5G05 J;  5G04 C;  3X2Q E;  5AJD A;  3SBT B;  4Q96 A;  3UMV A;  1O1S A;  3ZKJ A;  5AQ9 A;  2FUL A;  1K8K G;  3Q73 A;  4GAA A;  3CQC B;  3ONL A;  4GZC A;  1NP7 A;  2WXR A;  3RK6 A;  1JUQ A;  3OXG A;  2PL2 A;  5BUZ A;  2VSY A;  3FH8 A;  1AWC B;  5G55 A;  1EYH A;  4WNG A;  5JA4 D;  1N54 A;  1JCS A;  3FH7 A;  4LSZ E;  4QFV A;  4CT4 A;  3MGB A;  3NZU A;  1JCQ A;  2UY1 A;  4RVB A;  1BD8 A;  3RO2 A;  3FFL A;  3D9K A;  3DEO A;  3NF1 A;  1E8W A;  4EBA G;  3DSU A;  4M7C A;  1H2V C;  3TWU A;  3BUA A;  4U63 A;  1OCR E;  4UQY A;  2Q7F A;  3R7Q A;  3LYA A;  1TN8 A;  2KAT A;  2P2C P;  4RLY A;  1A5E A;  2CG2 A;  5EIL A;  1BPO A;  3QAQ A;  3B13 A;  5AAR A;  2V8S E;  4JC8 A;  1H6K A;  4URK A;  2LO6 A;  1KZP A;  2KBX A;  3T8K A;  4ATG A;  3OAW A;  2AW6 A;  3QK0 A;  1Z3Y A;  2HM8 A;  1OWP A;  2QY7 A;  3K9I A;  1PAQ A;  3ONK A;  4E6H A;  2X6H A;  3DPY A;  5ENP D;  4E85 A;  1ELR A;  4UQZ A;  3MZL B;  4P29 A;  3APD A;  1OCO E;  2PM7 A;  2DBA A;  3PDN A;  3MA5 A;  3ZIM A;  2YHE A;  3SBS A;  2C2L A;  2L6B A;  3FTZ A;  2VSX E;  4J8S A;  3C3Q A;  2WVI A;  3MKR A;  1FVH A;  2FO1 E;  2H6F A;  3GYZ A;  2E0I A;  4JHK A;  3PS6 A;  3ZUV B;  4BFR A;  3CHQ A;  4J8E A;  2XQ0 A;  4B89 A;  3D9J A;  2WB2 A;  3SD5 A;  4UUC A;  5ENQ D;  1IHB A;  3FTU A;  5LP0 A;  5ENO D;  1UOH A;  4TUU A;  1XNF A;  3ZYK A;  5KBA A;  4UWF A;  4NRH B;  3B7T A;  3FUI A;  3EHQ A;  3PEU B;  4DLQ A;  4ZFH A;  4N3A A;  3HG0 D;  4F53 A;  1MX4 A;  2R59 A;  1YYH A;  2GRQ B;  4ANW A;  4G26 A;  2KZT A;  1N95 A;  3QB2 A;  3C5R A;  5KWD A;  4HB5 A;  3ASD A;  1EDU A;  4CGW A;  2J4B A;  5ITZ F;  5BV0 A;  3MKQ A;  3D9H A;  4L1B A;  2H6I A;  4HOT A;  3GW4 A;  5CHE E;  3LDZ A;  4HOR A;  3FTV A;  1UN8 A;  3UIO C;  3IKO B;  4BEP A;  2JAB A;  1MZC A;  3CSF A;  3D9M A;  4DX6 D;  4H7Y A;  2IO3 C;  4J8Y A;  4ATZ D;  1E7V A;  4KXK B;  4K03 A;  2PQR A;  4APO A;  4OAU C;  4J8F A;  1SQM A;  1E8Y A;  1K1A A;  3ZRH A;  3MJW A;  2P9K G;  3FHE A;  2JLB A;  3V2O A;  3UTM A;  3SFZ A;  4I2Z A;  3TXN A;  4O60 A;  3RRU A;  1H6O A;  2IEJ A;  2GRM A;  4U8V D;  4N5Q A;  3OXL A;  4B0Z A;  1SVX A;  2GRN B;  4CT0 A;  3LJ3 A;  2IOS A;  3SNX A;  2LUH A;  4GYW A;  1IXV A;  3Q5M A;  4LNG A;  2NC9 A;  2XS1 A;  3PNL B;  5LCW J;  3LVR E;  2BUG A;  4LER A;  2OEV A;  3TG5 A;  4ANU A;  2ION A;  5G05 C;  5DBK A;  1FT2 A;  3MCX A;  3SY2 A;  4FU3 A;  4BER A;  1IQU A;  3AG2 E;  3MV3 B;  4U07 A;  3EHR A;  4AIF A;  1MX2 A;  2P9P G;  5FT9 A;  3TWW A;  5E76 A;  4AY6 A;  3FTS A;  3TAX A;  1N4R A;  3DSS A;  4BT8 A;  4TXP A;  4DPR A;  5EN5 D;  4GZ5 A;  1QNF A;  3DWL G;  4A1S A;  3AU4 A;  2DYS E;  5JJ6 A;  3G2S A;  1FVF A;  3TJP A;  4ACL A;  4ANV A;  2J4D A;  2WXG A;  1DNP A;  4GCO A;  3D3M A;  4JEH A;  4I1O B;  4EPZ A;  4FJY A;  3CVN A;  1S64 A;  3C3R A;  2WXF A;  3F6Q A;  5C1D A;  1N4P A;  4O1O A;  4APF A;  2WXH A;  2OOE A;  3LKU A;  2XRZ A;  3U3W A;  5A6C A;  2CFU A;  2R03 A;  2XS8 A;  4WWP A;  2OVF A;  3S7F A;  2ILR A;  3Q7F A;  2I1K A;  4Y6C A;  2WXP A;  5FTP A;  1OWN A;  3RU0 A;  1RW2 A;  3WG7 E;  3EDT B;  4L2Y A;  3ABL E;  3JUE A;  4N3C A;  3VTY A;  2RFM A;  1DVP A;  2GRO B;  4HOU A;  3JUI A;  1N9A A;  3CHR A;  3LY9 A;  1NA3 A;  2NSZ A;  2X38 A;  3ZXP A;  1Y8M A;  3ZN3 A;  5G2N A;  4XZ4 A;  3I4R B;  3ML9 A;  2XCC A;  4IRU A;  4I1M A;  4YDO A;  3VLE A;  4RQI A;  4UWK A;  3FUJ A;  4EZK A;  5ENR D;  4M3O A;  3ABK E;  4XX5 A;  3W9F A;  3SFY A;  4UI9 J;  3HHM A;  3CVP A;  3ZNG A;  3ASH A;  3HXF A;  2DZO A;  1NA0 A;  3D9O A;  1HF8 A;  4I6J A;  2EIK E;  3LJN A;  2XZD G;  2HYZ A;  2CFZ A;  5BXO A;  3PVL A;  5FJY A;  4DX1 A;  2Y3A A;  2XCB A;  2DCP A;  1K3Z D;  3AS4 A;  2GRL A;  4Y6W A;  3FEX A;  3LXU X;  3FEY A;  2L0I A;  3HXE A;  5EYL A;  4GTT A;  3FUH A;  1UG3 A;  3D9L A;  4WNF A;  5D66 A;  3UXG A;  3SHF A;  4TUM A;  5KCM A;  4DJA A;  4PDX A;  4YDY A;  4IYP A;  4YVQ C;  4AM9 A;  3AS8 A;  4PH4 B;  3OXF A;  3URZ A;  1N0Q A;  1OWO A;  3NOG D;  4I9E A;  1FPP A;  2AWI A;  4C0M A;  3NZS A;  2WQ6 A;  3PZ2 A;  1MQS A;  5HQ8 A;  2KM4 A;  1NZN A;  5CMY A;  2P9S G;  3NB2 A;  2AXZ A;  3PRE A;  3ULQ A;  2X6K A;  1SZ9 A;  3APC A;  4AV7 A;  4KZC A;  4GA0 A;  4OVV A;  5EID A;  4B93 B;  1S0P A;  4AJW A;  1UJJ A;  1LD8 A;  2YHC A;  5AEN A;  5AJL A;  5JHB A;  1KLX A;  5FIN A;  4OVU A;  3EU9 A;  1JPL A;  3O48 A;  4BTA A;  4BX8 A;  4GYO A;  5KNH D;  5HRY A;  1IQR A;  2HO1 A;  2IY0 C;  3DRA A;  2DZN A;  1DCQ A;  5ARG A;  3D9I A;  4DX2 A;  4FHK A;  1NI1 A;  4YND A;  2AXU A;  2IOL A;  3G2W A;  3HXC A;  1ZB1 A;  3ZHE A;  4KZ0 A;  3Q4A B;  5T4Y A;  2A5U A;  1SW6 A;  4CRW A;  5CED B;  4FLB A;  1V55 E;  3ZEF A;  1ZU2 A;  2FF4 A;  3KEA A;  1O1T A;  4KBQ A;  3ASO E;  4A3T A;  3Q7A A;  1EF1 C;  1HXI A;  1L5J A;  3B7U X;  4CEM A;  3SGH A;  3ESL A;  4GA2 A;  3FY4 A;  3MV2 B;  3S2A A;  5KNG A;  3UQ3 A;  3PZ3 A;  2P9N G;  5A7D B;  3JXJ A;  3AG1 E;  4K5C A;  1DC2 A;  3ZVV A;  1K1B A;  1FCH A;  2KZT B;  3NAW A;  4J8D A;  2LXM A;  4BY6 A;  2R17 C;  3CHS A;  1TNU A;  4DI3 A;  3BU8 A;  2FO7 A;  4D10 C;  3CQG B;  2YQ8 A;  2I1J A;  5IY5 E;  2KCK A;  5CCL A;  1HFA A;  3Q9U C;  5HS0 A;  2OV8 A;  3GZ2 A;  3UIP C;  1ELW A;  3FH5 A;  3C72 A;  2L9B A;  4ILH B;  3EIQ C;  3FU3 A;  5KJL A;  3CHO A;  4GPK A;  3ASN E;  4RG9 A;  4C0E A;  1HZ4 A;  1OT8 A;  3E32 A;  2XGO A;  3ZU7 B;  5EDS A;  3PE3 A;  3ABM E;  2NYJ A;  4O6F A;  3U9W A;  4TRQ A;  3KSL A;  2P9U G;  4ILG A;  3RSE G;  1VDY A;  3Q79 A;  3S7D A;  3ZYL A;  1E96 B;  4JXT A;  2DVW A;  4F1S A;  4QQI A;  3PH0 C;  1Q2Z A;  3Q75 A;  2J08 A;  4LNB A;  3BG1 B;  2RKK A;  2WXN A;  1WY6 A;  1WM5 A;  2ZXW E;  3CHM A;  4XI9 A;  5T3R A;  4ME2 A;  2P58 C;  5CBO A;  3ZFW A;  4BWR A;  3P2B A;  2WXI A;  3IEG A;  2QYU A;  2WPV A;  4AXH A;  2PNN A;  3TWX A;  2C0L A;  3FUK A;  2UY1 B;  3UT7 A;  2MOW A;  4GB9 A;  2BTD A;  5CBN A;  1LF8 A;  4BSZ B;  2BF0 X;  4GMJ A;  2NXP A;  1D8E A; 
#chains in the Genus database with same CATH homology
 2B0O E;  4HLL A;  4OAU C;  2DZN A;  5HKP A;  1DCQ A;  4G8L A;  1G3N B;  3TWR A;  1K1A A;  1MJ0 A;  2QYJ A;  3ZNG A;  4DUI A;  5JMN D;  2BKK B;  5AQB A;  3W9G A;  2DZO A;  4DX2 A;  2QC9 A;  2V5Q C;  5ENP D;  3J5Q B;  3TWQ A;  4K5A B;  3JXI A;  4J7W A;  1BI8 B;  3V2O A;  3LJN A;  1MX6 A;  3UTM A;  3ZKJ A;  4LG6 A;  2A5E A;  1OY3 D;  5AQ9 A;  2XZD G;  3HRA A;  1OT8 A;  2ETB A;  2Y0B G;  1SW6 A;  4JB8 P;  3AAA C;  4GPM A;  4O60 A;  3F6Q A;  5EIB E;  4NIK A;  5BXO A;  4G8K A;  5AQ7 A;  2ZGD A;  4U8V D;  4N5Q A;  5CED B;  3ZU7 B;  3V79 K;  4O1O A;  4DX1 A;  1WG0 A;  1AP7 A;  3B95 A;  2L6B A;  2XEE A;  5CEA A;  1K3Z D;  1SVX A;  4U8Y D;  4GMR A;  1N0R A;  1D9S A;  2NYJ A;  2F8X K;  1IXV A;  1QYM A;  4CZ2 D;  2FO1 E;  2F8Y A;  3KEA A;  5EYL A;  1TR4 A;  4F1P A;  2MYO A;  5D66 A;  1AWC B;  1YCS B;  3UXG A;  3ZUV B;  4HRM B;  1BU9 A;  2J8S D;  4TUM A;  4LNU D;  3TWT A;  5JA4 D;  3T9K A;  4YDY A;  1YMP A;  1BI7 B;  4DX5 D;  3V30 A;  1BLX B;  2DVW A;  5BXU A;  2F37 A;  4QQI A;  4DX7 D;  4HI9 A;  4UUC A;  5CEC B;  5ENQ D;  2KXP C;  1IHB A;  1N0Q A;  2RFA A;  3JUE A;  2VGE A;  4LSZ E;  4QFV A;  3AJI A;  2BKG A;  4A63 B;  3NOG D;  5ENO D;  3Q9N C;  5KNG A;  2RFM A;  4BER A;  1UOH A;  3TWV A;  5AAO A;  2DWZ A;  4CYM D;  3EHR A;  3JXJ A;  1BD8 A;  1NFI E;  5KBA A;  1N11 A;  4K5C A;  3DEP A;  3TWS A;  5CER B;  1MX2 A;  1DC2 A;  5CBO A;  4BET A;  4ZHB A;  4HBD A;  3DEO A;  1K1B A;  5ENS D;  4ZFH A;  3EHQ A;  3TWW A;  3UI2 A;  4O1P A;  3IXE A;  5FIO A;  2HE0 A;  4HNA D;  4Z68 A;  4C48 B;  1MYO A;  4YDW A;  3HG0 D;  3B7B A;  3TWU A;  1MX4 A;  2XZT G;  1YYH A;  2ZGG A;  3V2X A;  4F6R D;  1WDY A;  2ETA A;  2V4H C;  2XEH A;  2AJA A;  3C5R A;  5KWD A;  2PNN A;  4HB5 A;  5EID A;  5EYP F;  3TWX A;  4B93 B;  2P2C P;  4U96 D;  4RLY A;  4DRX E;  1A5E A;  5EN5 D;  5ITZ F;  3NBN B;  5EIL A;  2ETC A;  5ENT D;  4HRN A;  3D9H A;  3J5P A;  5AAR A;  4OAV B;  5ENR D;  5FIN A;  3NOC D;  5CBN A;  4HQD A;  4K5B A;  1IKN D;  3EU9 A;  2JAB A;  2KBX A;  4HRL A;  3T8K A;  3V31 A;  2XEN A;  3W9F A;  4BEP A;  3Q9U C;  4DX6 D;  4BSZ B;  5AN8 A;  5KNH D;  4BES A;  5HRY A;  2Y1L E;  4U95 D;  4J8Y A;  5AQA A;  5HS0 A;  4ATZ D;  4HI8 A;  1S70 B;  3SO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...