4K03A

Crystal structure of drosophila cryprochrome
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
534
structure length
529
Chain Sequence
RGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-1
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
total genus 163
structure length 529
sequence length 534
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4k03A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4k03A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4k03A01
2C5SA 2J07A 2CUZA 2PZ8A 2XRZA 1KP2A 4RUKA 1H3EA 3KT0A 1XJQA 1XNGA 3OTWA 1M8FA 1N2BA 3K9WA 3UC5A 2VTBA 5H16A 3IDFA 4R0NA 3IH5A 2CT8A 2PZBA 4DDKA 3DV2A 1EFVB 1GN8A 1T6ZA 1N2JA 1ZJWA 1O97C 1IH8A 3COZA 5F23A 4K03A 1KKUA 4ZT4A 4EG4A 1H1TA 1F7UA 1YIDA 4ZT7A 2V0CA 1Q19A 1RQGA 3TZLA 2OV4A 3CVWA 3GUZA 1I6MA 5DEOA 3A4IA 1K4KA 1NP7A 1ZH6A 2H29A 1M8JA 4HJRA 1WXGA 1EE1A 3SEQA 1N3LA 3A04A 1O5TA 2AG6A 2QJTA 3ZXIA 1JZQA 1YUMA 3FI0A 1J1UA 1FFYA 1XNJA 3QTBA 3IUBA 2CSXA 4MUGA 1I6KA 1KQPA 3MUEA 2A88A 2DPLA 3FWKA 3IOBA 2Z09A 4GU5A 3K32A 1OWPA 1JILA 1MAWA 3I05A 2CV0A 2A1TS 4NX2A 1TYDE 1KH1A 5K0SA 4JZYA 4J76A 1S4MA 5K0TA 2NZ2A 4MUFA 3X1MA 3SYTA 3COWA 4PY2A 1GZUA 1N75A 1QU2A 1JHDA 1BS2A 3HV0A 1NUUA 2O5RA 3RBAA 2Z08A 1QRUA 1T9GS 1EFPB 3TQIA 3IODA 1J70A 5LM3A 1I2DA 1T6YA 4H3SA 5KHAA 2HMAA 4EG1A 3INNA 1O96A 4BWVA 3IVCA 3NV7A 4ZCSA 1YULA 2G36A 4PBSA 1ZUNA 2E21A 3H97A 1F9AA 4ZT6A 3UY4A 1J09A 1U3DA 1VL2A 1NI5A 5IJXA 3G59A 2JAXA 4DJAA 1EXDA 4UZEA 4YMIA 2DUMA 4S1OA 3GMIA 4DNXA 1OWMA 1KAQA 2PZAA 4MW7A 2DERA 4EG7A 4YP6A 1GPMA 3X1KA 3KT3A 1NUSA 3KT8A 4EF6A 1EUQA 1NSYA 2IJGX 3A05A 1YUNA 5BNZA 1G8HA 2DR2A 3D6UA 3F3MA 1JIIA 4NATA 3TS1A 4ZCRA 1MOPA 2DLCX 3VGJA 1JIKA 4FZJA 1J21A 4ARCA 5TEVA 4P2BA 2DEUA 1O94C 2TS1A 1WXEA 3L92A 4QREA 1VBMA 3IOCA 4K0RA 2E18A 1N1DA 3ND5A 4KPUA 3ISJA 4EG5A 3HL4A 1PFYA 3IMEA 2A7XA 1R6UA 2CYBA 2A1UA 3IUEA 2A4MA 2RD2A 2QTRA 3Q10A 1XNHA 3IMCA 3IVXA 3M5WA 3P0HA 5TEWA 1IQUA 3U1VA 4DDMA 3DO8A 4JXZA 1WXFA 4TS1A 5JBNA 1FYDA 4HPWA 4MULA 2AZXA 1KAMA 1VBKA 2D5BA 3CLTC 3D6VA 3LOQA 1TYAE 1T6XA 3A2KA 1MB9A 1U3CA 3IVGA 4KR6A 3PNBA 3TZEA 1GLNA 3SDBA 2X0KA 1QNFA 4MVWA 1NUPA 3HZRA 2GM3A 3CLTD 4MVCA 1KH3A 2CFOA 3QTTA 3RK1A 1WOYA 3FOCA 2WSIA 2QTMA 2PG3A 2J08A 2CYAA 4DE5A 4NAUA 1H3FA 5KWVA 1N2GA 1PFVA 2O8VA 4ZT2A 4OUDA 3UMVA 4XFJA 1DNPA 2A86A 2ZP1A 1V8FA 2JA2A 4G6ZA 4NAHA 1GAXA 3ZXSA 4Q93A 4MW2A 1H3NA 4MUEA 1F7VA 3X1JA 3ELBA 3H9CA 1JIJA 3P52A 3HMQA 1CT9A 3RFFA 3N05A 1IQRA 2YWBA 3CLSC 3FDXA 4PBTA 4MLPA 5J5AA 2GKSA 1T9GR 1U7DA 2VXOA 4CDMA 1M8PA 1PFUA 1O0CA 2A84A 3ZUGA 1N2HA 4XFDA 4KPUB 4KR9A 5EKDA 4ZCQA 1G8FA 3CLSD 3CVXA 4MWDA 3SZ3A 4KR7A 1U0BB 3TNJA 3QE4A 3ZIUA 4F4HA 1JMVA 4YBRA 4Q16A 1V47A 4MW4A 4CT0A 4G5YA 1EJ2A 4CQNA 1N2OA 4MUKA 4R2LA 2E89A 3AL0C 1NYLA 4ARIA 3UOWA 4DLPA 1P7PA 2VTBB 4YP5A 3UK2A 4WSOA 3ZJUA 1EUYA 1WXHA 5HUJA 4HK4A 1TQ8A 5DASA 4JXXA 4MW5A 2J09A 1KQOA 1IFXA 4E1AA 3P0JA 1G59A 1X8XA 5KCMA 4EG8A 5LLTA 3JXEA 2QUJA 4KKVA 3CR8A 2DETA 1JECA 2EL7A 4F3RA 2WQ7A 1KP3A 5HUHA 3BL5A 4JYZA 1YI8A 3FIUA 4L2IA 1KQNA 2IP1A 4MW1A 2XRYA 3PRHA 1M83A 2J5BA 1JGTA 3E27A 1GTSA 3AKZA 3MLAA 4I6JA 1B6TA 1QTQA 2WQ6A 2PFSA 1QJCA 5DB4A 3N2YA 3AFHA 3RK0A 2NSYA 1OWLA 3Q4GA 3KT6A 1D2RA 4MWCA 4R2MA 2IELA 5HG0A 2I1LA 2GOYA 5LFAA 2D13A 1QRTA 4ZT3A 3AG5A 4XSVA 2YXNA 4MVYA 1JZSA 2DXIA 2RE8A 1SURA 1N78A 2H2AA 4ND6A 1KR2A 1OBHA 3CA8A 4NZPA 1WJGA 5TGTA 3RHSA 4MVXA 4G5FA 4MW6A 4J75A 1PFWA 1QU3A 1N2IA 2CYCA 1O0BA 2YWCA 4MW9A 1KORA 4AS1A 1I6LA 4GRIA 1O96B 4YP7A 1ZH0A 3AIIA 4HJXA 1TEZA 1O95D 3VU8A 2AKEA 3PNYA 2CV2A 5TS2A 5DK4A 1NURA 1WXIA 3COVA 1QQTA 2X1LA 4RPIA 1R6XA 3ILVA 1K4MA 4ND7A 4EG6A 1OD6A 2A1TR 3DLAA 3Q12A 5AHWA 1MJHA 4CDNA 3SP1A 1GTRA 4QRDA 1TFUA 4A91A 3NBAA 3FETA 3CLRC 1MAUA 2E0IA 1EFPA 1U7XA 2X1MA 3IOEA 2QUKA 4JFAA 1WY5A 2QUIA 3ZGZA 1J20A 1WQ4A 3CLRD 3N9IA 3RJZA 4MUJA 3CVUA 1PG0A 1Q77A 1MC1A 2X3FA 1N2EA 1OWNA 4U63A 3ZJVA 2A1UB 4AQ7A 1O97D 1IVSA 1Y42X 2J4DA 1X6VA 2V0GA 5IHXA 4MAFA 5FNZA 3N8HA 2CV1A 2QJFA 3NBKA 1YIAA 2Z3VA 1J1ZA 1VLHA 2JANA 1M1ZA 5FO0A 3PXUA 1VBNA 1PG2A 5J59A 4MUNA 5J58A 3CVYA 4I6EA 3FY4A 1UFVA 2YY5A 2B7LA 2HGZA 2HZ7A 3ND6A 3FG9A 1ULHA 4PBRA 2ZUFA 3LCJA 1COZA 1M8GA 1MBZA 1Q11A 2EJCA 4EGAA 5FO1A 3L93A 4OUDB 1N77A 1K97A 4QBTA 1LI5A 2BTEA 1F4LA 3H99A 1HYBA 1TYCA 1Q15A 3HGMA 3MXTA 3ND7A 3AG6A 1IQ0A 3PNVA 1R6TA 4MW0A 1LW7A 1NZJA 3SEZA 3ZJTA 4U7JA 4EG3A 1ILEA 1MRZA 3OP1A 4ZCPA 4MUIA 4UZFA 1WQ3A 2D54A 3H05A 2PIDA 3MMXA 3P0IA 3SZGA 1QRSA 1EFVA 1OBCA 3FNRA 4X0EA 3HFJA 2QUHA 3GLVA 3G6KA 2BYTA 2QTNA 2PXHA 1G8GA 3FHJA 4WNYA 4NDAA 1JEDA 1K92A 2ZUEA 1JEEA 3CVVA 1NUQA 1WKBA 1O95C 4DDHA 1LI7A 4MQ6A 3CLUC 3S3TA 3TQOA 4MUHA 5H7XA 3G5AA 3IMGA 4ZT5A 1KH2A 4OJMX 3VRHA 1WZ2A 3FH0A 1O6BA 3MLBA 1A8HA 2QJOA 4U8HA 1IRXA 3DPIA 3H9BA 1MB2A 4I6GA 3CLUD 1OWOA 4MWEA 1O94D 2R5WA 4MWBA 3COYA 2OQ2A 1NUTA 3C8ZA 1M8KA 4EFKA 1TYBE 3KFLA 1IHOA 4ZCTA 2WB2A 4L2IB 3LE8A
chains in the Genus database with same CATH superfamily
3JX9A 2ODBA 3JD2A 3T7JA 3GB9A 1NVBA 2Y68A 4R0VA 2EGUA 5KSOA 3E9MA 2YWRA 4UCFA 3WS7A 2AOTB 4JVMA 3MTQA 3S8EA 1RAIA 3A3KA 3MKQA 1BJRE 1SA5A 4Y9DA 4IJ5A 1JFSA 3AV0B 3I39X 4Y2VA 3PDHA 5KMGA 3REOA 3C3OA 3WRYC 5AIAA 4UAJA 2R48A 1XNJA 3ZNPA 1YE3A 4LI3X 1N1MA 2AUTA 2DPYA 3E7WA 2M63A 1QZXA 3AZOA 5FTKA 4C0LA 1Q0ZA 3OOEA 1RAGA 3JQAD 2XB2A 2J0UA 3L7AA 4QBIA 3GHHA 2EJTA 4NR0A 4EUEA 1GL7A 1DAGA 5KJNA 5FJYA 1SKUA 4YV1A 3F5QA 5H70A 1RYDA 1T8UA 1STOA 3R9IA 2E85A 4OU4A 4ZIRA 3OEEA 1CRQA 4AVXA 2YJZA 2CXSA 4CL2A 1NGSA 3IOCA 1A9RA 2D5LA 4IDHA 4AMBA 4Z4FA 4WY2A 3E1KA 3DPUA 5SZKB 3EE6A 3ZS8A 1ZD5A 3V4SA 5G0VA 1U3CA 3PNBA 2GRLA 5F7OA 1DJNA 2AUMA 2GO1A 2BF0X 5TQ2B 1DWQA 5D3MB 3MJWA 3RJMA 4DARA 3QOUA 3I04M 5G02A 3K92A 4YEDA 1XGWA 4N47A 3GMTA 4YRNA 1Y8RA 4ZI2A 3QFSA 2BH9A 5IC4A 2PRJA 4ONEA 2EWWA 1H8EA 2R0QC 5ENDA 3QELB 3LFUA 5EVJA 5EJMA 2DBVO 2C9MA 4YY3B 4D9HA 3TZ6A 3ZHTA 4KQJA 2BTQB 2PS3A 3T7SA 2IZ0A 2DWPA 4RHCA 3UOAB 1YS7A 4QQIA 3FTUA 2NSJA 1OLOA 1H1LA 2XZPA 3MCZA 3QEBZ 2BKVA 2EW2A 2Q2WA 3L7NA 3SJ7A 1ZBDA 2P7HA 5GTDA 3GGOA 3A3NA 2IXFA 2QW1A 3PR1A 4U9UA 4IRXA 4L9SA 1QV9A 4HLDA 4UBJA 2O8EA 5ILQA 4O25A 1M2OA 4WFJA 3WRVA 3D0RA 4CMEA 4EFLA 2QZ9A 4ZZ0A 5K2MA 4ZVMA 2WF7A 5IMBA 3TXNA 2HSDA 3FVRA 3SPXA 2HHLA 4BIMA 2A57A 4R9UC 4QRIA 4HD8A 3PEVB 4AMGA 2G06A 5BVGB 1OILA 2C92A 3ANXA 3RYFA 1GILA 3LWZA 3CWCA 4NZOA 4DXHA 3RYTC 2OESA 3F4BA 3N39C 2R59A 3IOEA 1ZRMA 1ZK4A 2IGTA 1VOTA 1CZRA 1LK0A 3SQLA 1NE7A 4WADA 4AK9A 3G8CA 5ITSA 1J1IA 1W1WA 1UJKA 1P3DA 1RMYA 4OP1A 1SC1A 3W8EA 3GRAA 3F71A 4KE8A 3LQFA 4WI1A 3U49A 4N7RA 2J4BA 4XARA 1LEHA 1NBAA 3U61B 3MFYA 5CFRA 1G1MA 1EUCA 1CUUA 3IIJA 4QYIA 4HNQA 1V7ZA 4HQFA 2DULA 5TQ0A 1K88A 1MJGM 5ED0A 4OYSA 3DW3X 3NVDA 3Q9NA 4WKCA 4I55B 1W9MA 1GAWA 1LF0A 4PSUA 2FX3A 4H7PA 3EZGA 1DCFA 5ISMA 2GEKA 2B5VA 2IYFA 2C5AA 2ZSFA 1NAIA 3LGAA 2ZISA 5KDOA 4CEHA 4NACA 3BXGA 1DT5A 3WMGA 3G0IA 3IAM6 1LI7A 5CBNA 3GOHA 3OFJA 3T5MA 3JQFA 1ESZA 5AUQA 3FH0A 4XEIG 4AV7A 4IGEA 2QZPA 4A03A 2OHXA 3R7DA 3B9PA 2R5WA 4QDKA 3C8ZA 3QY9A 1M8KA 3G88A 1EMDA 4OQPA 3OUUA 5IKPA 4QOSA 4HFMA 2UDPA 5F5NA 4GNKA 4L4UA 1XVTA 5ENRD 5FBLB 3HU1A 2L18A 3W5IA 3BH6A 5ARFA 1JQJC 2IL1A 4I1RA 1HZJA 1N8SA 2I2DA 4GM1A 3RM3A 4B3BA 1YR9A 2P5TB 1CJCA 4UREA 4A8JB 3U44A 2MWMA 2I87A 5IH3A 4H7FA 4ANWA 3DO5A 2ZIFA 1S2IA 1HXHA 2Q5FA 5CEEA 3KZNA 1UK9A 2L6BA 1FQOA 4ZOLA 1NQ5A 4BLWA 2QENA 1ADCA 1AKRA 3C2QA 1KY3A 3C5WP 2Q5LA 4H15A 1J09A 1MZVA 2F3TA 2IYWA 1I0LA 3G59A 1M0TA 4BNVA 3OQOA 2VDJA 1ZY2A 3LBIA 3SZLA 1N0UA 3ABZA 1XDGA 1FZQA 2RG1A 3DMNA 4ZCRA 1MOPA 3OJLA 1BCRA 3VH1A 8LDHA 5AQ7A 3T1VA 5LPNA 3MMSA 1EK0A 1O94C 2TS1A 2B1IA 3QBJA 4NMLA 4V3CA 3JZIA 1CR2A 3ZWCA 3PX3A 2GK6A 2BMVA 5E9AA 2QRNA 4OHKA 4X7MA 2XZLA 5A4DA 4KW7A 1KAMA 2AEMA 4BO5A 3CH7A 3G2JA 1R2QA 5F3DA 4B40A 2ZGDA 1ONBA 4Q4AB 3AKCA 1S3IA 1ST3A 4DE5A 2FR1A 2QBYB 2O8VA 1MX3A 4K6HA 2IY9A 3DZ8A 1G3MA 3W90A 4HKTA 1WUYA 2ZBQA 1BDIA 1RRKA 3FDXA 2R8RA 4H1HA 4RVHA 1VI5A 2R05A 4MRSA 2AFIB 2R8OA 5EOVA 1ORIA 3FZQA 4MWDA 4B3JA 2PUHA 1XQ1A 1FNBA 2HK6A 3SHOA 2Q4EA 3WTCA 2Q3LA 5JQGA 3MF4A 3PBKA 4ZAFA 1G64A 2O2CA 2WFLA 2O3JA 3W3ZB 3K0BA 4PX3A 1C3JA 2WT9A 2V7UA 2AR9A 1HI9A 2E4UA 5ELXA 1OWLA 3WY9A 1YOBA 3IEXA 2AH5A 4E09A 1CIVA 1N94A 2TSYB 3VR3A 5I4IA 2I7TA 4MJ3A 5CDTA 5FI5A 2Q5QA 4UBNA 5FQOA 1TCVA 5DBEX 2PSFA 3PITA 5IM5A 4D82A 1QHYA 4WZAA 1ZK0A 2PX2A 4K0KB 5JEEA 1DPFA 3DEZA 1GLVA 1Z35A 3QVKA 2IUSA 4G2VA 2GD2A 1P4RA 4EY3A 2QN9A 3D7MA 3ABSB 1I0ZA 4S35A 1U0EA 1G291 1L3CA 2ZPTX 3VNUA 3B1WA 3BG5A 1YQWA 3TCXB 3IPYA 1MO3A 3D4OA 5DM0A 4MB6A 1Z47A 4L73A 5G04J 1DJLA 1COWA 1SKBA 2QOEA 1T0PA 4MYDA 3RW9A 2HBZA 4IQFA 2OO3A 2IQ5A 2C42A 3EGWA 5D5QA 4S24A 3WKAA 1YDEA 3CB2A 4LTMA 2VKTA 1BKYA 4BMSA 5GV8A 3ICCA 2DHEA 3BWEA 4Y8VA 1GZ5A 3IDOA 1GPH1 2QE7D 4RV5A 4PGFA 4OH1A 3H2BA 4YBZA 3AJDA 3HVEA 1Q1ZA 1UPFA 2DSNA 2YFHA 5CEAA 4H35A 4B45A 1LD3A 1YA6A 5FBRB 4N7BA 2IONA 1J2UA 3UMGA 3UIOC 1I3NA 2DLNA 3UTDA 5M29A 1TJ5A 3FTVA 2Q1YA 4JMPA 3LWDA 3AU5A 3FWYA 3UMJA 3HWSA 1E1RA 1GAEO 1EGAA 2R96A 3FUNA 1XTQA 2OEPA 4Q12A 5A62A 4Y3UA 4U07A 3EEYA 4UFNA 1VHTA 1R7RA 2WV9A 2QPAA 2DGDA 3LP8A 3QPUA 1N2JA 5K8TA 4IH9A 3TWUA 1DAMA 3CEAA 4KE7A 1U0RA 3ZDCA 3GLFA 3WGUA 1Y7LA 2ZRQA 1K5PA 2QTFA 1JZQA 5M2QA 4LGVA 3ZK7A 5EPEA 2R3SA 5FV4A 4BFRA 3JWPA 2PL2A 2J3KA 1MRNA 2XQGA 1PQUA 3QOXA 3P9RA 5K0TA 2CXHA 2W43A 1YZQA 3GUVA 3JVUA 3FUXA 4LMAA 1T6YA 1Z18A 4ZVNA 3D9NA 3HKEB 4QGGA 2QW8A 5AJZA 3MSCA 3QKYA 4PO8A 3A1EA 2FZCA 3SVZA 2WWTA 3ZV7A 2HQ1A 3ENNA 1TM1E 1TJFA 3JD3A 3VNVA 3LCRA 1NSYA 5JANA 4GA1A 3TS1A 3HDVA 3TTVA 1L8QA 3A3PA 2Q3MA 1DIAA 2HXYA 1T4MA 3MQFA 3AY3A 3NWEA 2VPQA 5CVJA 3WDKA 3VSEA 4B3RB 2C0CA 2R1TB 5AJTA 3LK6A 1VBFA 4PG5A 3R6DA 4KN5A 5ALLA 2QD4A 2NXNA 2AOUB 3R20A 3RRBA 1PR9A 3OX4A 3FWNA 4LBVA 3ZYKA 1TTPB 2R8BA 4US1R 4IDGA 1M2EA 5JSQA 3MOSA 2SBTA 3V2HA 2Y1EA 5DNCA 3MEKA 3RFFA 3LO5A 1JR2A 2CMHA 3CCFA 4KPUB 5JQWA 1FFXB 4IMIB 3B1KA 5LQMA 1OYWA 1CUAA 5AQAA 4WLVA 4B46A 4K5AB 1Y4DE 2EHDA 1NULA 4JUBA 3WKBA 2VHEA 1HSZA 4XKJA 1ZOLA 3ULKA 1Q22A 3ZYCA 2IXAA 3PS9A 3C5VA 3S27A 4B6GA 5BOSB 3GRZA 3JWHA 4CQLA 2ID4A 1TZBA 5SZHB 1BSVA 2Z8YA 3FKSA 5EZ6B 3ORHA 4XCXA 2I6TA 3SQXA 1QAQA 5LP6A 5FUWA 1Q0TA 4I6JA 1VYVA 3WIBA 2ACKA 4YRLA 1R3UA 2FFRA 5JD3A 2G9ZA 4G1EB 2PGAA 3GH3A 5IYZF 2MYPA 1XQVA 5KJ6A 3ZBQA 1TEHA 4E2FA 1XDBA 3PDWA 3OA2A 1HNZB 2EX0A 2P3OA 2GVZC 3I6MA 4LI0A 1UKYA 4LWQA 4RFLA 4B79A 1WWKA 1JLHA 1MIOA 4C3UA 1SRQA 4TLBA 1XXLA 1KO7A 3JYPA 821PA 3FETA 3W79A 4P7BA 3P2BA 4ZTZB 3B60A 3EVFA 3T34A 3ZTWA 2FWMX 3HXPA 4S2EA 3L02A 2IRWA 3C3KA 1D4ZA 2Y1CA 3R3VA 4B7UA 1WCWA 4Y0NA 1ZMXA 2VDRB 5D00A 2PYIA 3HBJA 2Z5VA 1TVKB 4WGFA 2Z5LA 2G72A 1QVWA 1WHTB 3H6GA 3WWCA 4C0KA 3Q8XB 2HGZA 2B1QA 5ARGA 1ZXXA 2OXTA 2ODQA 1MFZA 1HSOA 2AMVA 1L5WA 1QHSA 4HPJB 1XDUA 3DMGA 2C1EA 2A1IA 3IEUA 2V96A 4EGCB 3BSYA 1N2SA 2XEXA 1Y63A 5CYPA 4FVTA 3AR7A 4BQSA 4W1SA 3D43A 4HMQA 4RTJA 4DIMA 5CDFE 2Q0XA 4B6SA 4FGLA 1VKNA 2APJA 1CXZA 4IIJA 1E1CB 2UVQA 2OV1A 2Q49A 1JSZA 4KC0A 1SUEA 5L4SA 2I65A 3SBOA 3CRMA 4HNUA 3EDCA 3A1WA 1JU3A 4PLTA 1JA0A 3NT5A 4OHCA 4LZJA 2OZPA 1DTWA 3D64A 2PS9A 2VZLA 5FOQA 5HXAA 3HBAA 3DS8A 2ETVA 3E7PA 4XZ4A 3RB8A 2C2YA 2CL6X 4BRWA 1HFWA 1V3TA 4WXRA 3KXLA 3EOBI 3E37A 1TKAA 4GEGA 1PWHA 1OIXA 3KDPA 3N2LA 1MG0A 2PT5A 2ZRFA 4TT8A 4XLTA 1XELA 3Q7EA 1C4OA 4D4GA 4ZMRA 3F6PA 1XN1A 3WGVA 3WWZA 1L5QA 4AP9A 1JCQA 2WUEA 2B9VA 3PDCA 2ZYUX 1N92A 2Q3FA 4AMZA 3UM1A 2XW6A 3RTCA 1PKEA 2HU8A 2NZ2A 1PV4A 5JT1A 3QKTA 1N3BA 2GAJA 4M3NA 4TRJA 3F6YA 5C4IA 4YAJA 2EX1A 1CDOA 2B4AA 3IDQA 1PW7A 1A8QA 2QGFA 3KXDA 1WXXA 3DXFA 1MGOA 3L9TA 2E21A 4D9CA 2C20A 2JCBA 3GJRA 3KPUA 1Y6ZA 5LKRA 1CRLA 4ZAYA 1GQRA 1QAOA 2VPTA 2LCQA 1E7VA 1SZPA 4GM4A 3ZDFA 4J2TA 5JS8A 3H9UA 4GGPA 4XPIA 1WZCA 3A9SA 1IEQA 3U5ZB 1Z5OA 1C8BA 1T4DA 4X90A 1TB4A 3I9FA 2FQQA 1H2RS 2A9QA 2LVBA 5HWSA 3R09A 3PD0A 1OA0A 3OZEA 3PNQA 1R0YA 1VIYA 3DQQA 2QS9A 1UXOA 3R5JA 3LQ2A 2IU6A 1MPTA 3TQHA 4PNEA 1PLKA 1L4FA 5I7OA 1XLTC 4QIHA 1U3TA 1U31A 3QG5A 3VU9B 1DCQA 1OAOC 4L5JA 5E6UB 1Q74A 3NM4A 4JVSB 1CHDA 3EGDB 1SIWA 4B82A 2VK2A 3QJYA 5CDGA 4JJAA 3QQ5A 2H65A 4N54A 4MQEB 3HU3A 2JVJA 2GZ2A 4IOMA 3VR2A 4S1WA 1B93A 1AY0A 7REQB 5L45A 4QELA 2FW1A 1H2XA 2ATXA 2Q4DA 5D85A 3HWWA 5JFOA 1XKQA 1ONNA 4C0WA 3B38A 2DBZA 4PLPA 4MAAA 3QV1A 4GWGA 1S2DA 1HX7A 3L08A 2ZJ0A 5ARBA 5CNKA 5L40A 5BSRA 4HAOA 5ALFA 3I2YX 4ZAZA 5JO9A 4JA2A 1FUEA 2I29A 3Q4AB 4C1NA 1KDYA 3UJAA 3Q0TA 5AW6A 1PEAA 4ANVA 2AC4A 2GHRA 4KNVA 1N7JA 3DL4A 2QVYX 4HNHA 4M9QA 1PJSA 2CV2A 5DNVA 4UQXA 4IINA 2VS1A 2C07A 4ZWNA 5COAA 1HZZC 3OETA 4XIIA 1DCMA 4GSKA 1ONPA 5E9JA 4J6IA 3RJZA 1QVVA 1KYTA 4V0SA 4RF3A 4GTTA 1Z7BA 3UK0A 4V0NA 3AHFA 4LHZA 1YVEI 4J7WA 4E4RA 5DSTA 2J4CA 2V9PA 1YDWA 2WYHA 3EVGA 5IKMA 1QMGA 4XOIA 3LO8A 1FSZA 2AQHA 3BXZA 4CNQA 2WF9A 4GL2A 5DM4A 4JBGA 2XOXA 2XADA 4UTOA 3O21A 4IUYA 5IBQA 3OESA 5GVRA 3EQ2A 3EGVA 4EHDA 5CNMA 1ADJA 2WYIA 2A5UA 2F1IA 1DXOA 4IMJB 3C85A 1XD9A 3F7MA 1QOPB 4DLYA 4JKOA 2GAOA 1UQRA 1NPTO 4KAFA 4IO0A 4JL6A 3IBYA 3QE0A 1Q57A 3KXIA 2GDJA 5BOVA 1PQPA 1TTTA 1ZGCA 2CLIB 3MT0A 4LZNA 2WFMA 3FTSA 4D3FA 2ZJ3A 4CKWB 4PCVA 1ELKA 4U4AA 1NVKA 3RV4A 5TE9A 3VR3D 1W85B 4PG4A 1N3LA 1Y9JA 4R6XA 4X41A 4R71A 1PR0A 3PRJA 3W9GA 2ENUA 3RNLA 2I4MA 2DY1A 2Z0MA 2WM3A 2HE0A 2KMLA 2PXAA 3KQSA 2ACVA 3PV0A 3B89A 1XV5A 3WYNA 4LOIA 4JPSA 4UQZA 2VDWB 3O0DA 2BW0A 3SYTA 1BS2A 3VZRA 5I7SA 2Z08A 4ZFHA 1SXQA 4FJ2A 2A0YA 4ZVRA 4QEZA 4AKIA 3P9IA 2R11A 3TWVA 4J3FA 1MEOA 2NU7A 1U81A 2FUG1 3MINB 4M60A 3G0OA 3KYIB 1NX9A 4K26A 3FAZA 4IDDA 2NXCA 5JWHA 3KSDO 3JRXA 1L7XA 4HN2A 1Y6JA 4HVTA 2WTNA 3KKLA 1HE5A 5HJ7A 1U2EA 5BW8C 1BG6A 2JGDB 1XGKA 1I4OA 2AB0A 3SF4A 4MI6A 3ZQUA 5BO5A 2FJUA 4H60A 4RDIA 1NBEA 5FBQB 4BAZA 4MWTA 3NBFA 3BEOA 2G08A 4B6FA 4LGCA 3JQAA 1BPOA 2FPKA 1Q7GA 1MOQA 4G5OA 4DXAA 2ST1A 1DJQA 3H9CA 1CJUC 2CC2A 1YCDA 3ZEIA 1PX2A 1BXGA 3U7QB 3UJBA 3AONB 2JPDA 4DYDA 4ZV7A 1SVIA 2AK2A 4I9UA 3ZWYA 2RKWA 3F7NA 4BGEA 4QVIA 3Q79A 3RRMA 1EUYA 1ZG3A 4PX5A 3GLTA 1BQ3A 1G18A 5TF4A 3F6RA 2Q5JA 3QM1A 4ZXPA 1LJ8A 3HDYA 2XQFA 3ECSA 1Z4PX 2GTPA 4C2UA 4M8NE 1O08A 1RBZA 3PJRA 3IV0A 1UKZA 4JI2B 5IM4F 1RRMA 4RENA 5DPMA 4HS9A 4NECA 1T9CA 3Q6IA 3BSFA 3P4XA 3NKFA 4P92A 4LY3A 4WRRA 3R3XA 3CF4A 1ZD3A 3ADOA 5A3QA 4MW6A 4C1BA 3EZ6A 1KFEB 1JRLA 1P17A 1ZM9A 4EJ6A 4O4IA 3K0SA 1EM8A 4GMLA 2EIME 4KIJA 3KAKA 3LPNA 1X7XA 5KQMA 4OHMA 3NJRA 3VVBA 3GJ6A 3HJTA 5L9AA 3FHLA 1RPNA 3CZPA 4URXR 1EHYA 1TN8A 2WXPA 3JQQA 1YFLA 3DOEA 3FIJA 4II7A 1RYHA 3PZRA 1YVPA 5BV0A 1SJ9A 5TR9A 2KZTA 3CNHA 1GQYA 2FZ4A 1XL0A 4BFZA 3HXLA 4OKSA 1FX0A 5CG2A 1VBNA 2W37A 4MS1B 5J2TF 4Z1MA 2JFWA 1OLUA 4RD6A 1RADA 1KPSB 2D4AA 5JJTA 1ZEJA 3FYSA 2H4YA 1RRGA 2D1YA 3WWPA 2KSQA 1XZMA 1TYZA 5L6MB 3QUCA 3MXTA 2VXCA 1H9BA 1FDWA 1XK7A 3CTMA 3RU2A 3HXEA 1MRZA 3CKYA 2ORWA 3C0KA 3QWPA 3CBQA 4RADA 4YDRA 2IOLA 3IV6A 3RVJA 3SM3A 4BB0A 4QVKA 4DHEA 1Z3IX 2I76A 1CZNA 2NXWA 3EH2A 1XD2A 1TM3E 2AFHA 4URHA 3FKSD 2Z9DA 4B6QA 2LAIA 5HKLA 5CA0B 4HUTA 1G5PA 2P67A 1BW9A 1NTRA 2W6IA 3ZHBA 2DIWA 1IG0A 1T5IA 2ZYDA 1PFGA 1XMQB 1AK2A 1ICIA 2JJ1A 2YHEA 3I1YA 1MG5A 4ZC8A 5JSZB 3WK4A 4KACA 1DXHA 3DV2A 3NHAA 3L6BA 4YC7A 1N1EA 2RH9B 1VKZA 1PX0A 2JGEA 3C15C 3ZCRA 1K06A 3OJXA 1SG6A 1JHUA 3U62A 3GZ1A 3ZKWA 2R79A 5AHXA 1TD9A 4OPMA 1R0XA 3JVEA 1ZOIA 2ZJ7A 2AJ8A 4MPTA 4BJ6A 1ZU5A 3H16A 4HNSA 4MPRA 1Y6GA 3ZUVB 4P0TA 2PZJA 3D6TB 2QN6A 2Y92A 1XXHE 5CECB 3KQTA 3KR9A 1HQCA 2P5SA 3G82C 4B3HA 1V41E 2OKGA 4S1OA 2P9QA 1KAQA 3AUXA 1G8AA 5EIHA 3IPAA 3F9IA 3MTEA 5BNZA 1GA1A 3IUSA 4B7AA 4WE3A 4XWWA 4OHVA 1SY7A 4HI8A 3UPTA 3A4VA 3AY0A 5K7SA 1H2YA 2DRIA 4YJHB 3IV7A 1FFSA 3N6RA 1NVTA 5JNTA 1JE1A 3LKUA 2G0AA 2WM9A 3E6AA 4TS1A 1CUEA 4LOKA 4R9VA 4K8OA 4X6LA 4PCAA 2OG2A 4UEWA 3P9NA 4CTKA 4EHLA 1ZU2A 2OUKA 4YI5A 5J4YA 2O8NA 2CLMB 4DBLE 2PD4A 2BHLA 4JP1A 4WVLA 5E8JA 5LA6A 4AI6A 4G6ZA 3CURA 4FU3A 4RKEA 1LPOA 4B31A 3OBBA 1CETA 2XQIA 3P96A 3ETNA 3P52A 3WP0A 1I94B 3H2ZA 3DMRA 3WAJA 4I1AA 2WPVA 3TKLA 3QKIA 4GYJA 3AJRA 3TNJA 5CURA 4RSMA 5FOVA 4DJFC 1NQXA 3TLGB 4ZJYA 4KFSA 3C6YA 4HQLA 1J7JA 5KHOC 1P3JA 2MRIA 4PLWA 4AJEA 1Z5PA 3LL7A 3U16A 4CTOA 2YQ5A 4G01B 5KCMA 5KNBD 1NW5A 3N8KA 3B1ZA 5BYKA 3BH7A 4LE1A 5FADA 3AF3A 1VSVA 3TAXA 4XGKA 4FHCA 4IPTA 4UM7A 3PWTA 4UQYA 3K1AA 4MBGA 1GTVA 1EAMA 4DSNA 3L6EA 1SZJG 3C8MA 3RRZA 3PR2B 3KYDA 1T1SA 2D2VA 3UJNA 2B36A 3FEXA 4O2BA 2B34A 3V3KA 4IUCS 2NO5A 4BRZA 2V6BA 5ECGC 4TXPA 1XDDA 5BNTA 1E9DA 1U7ZA 1IHPA 2OAGA 3N0XA 2VWGA 1N5DA 5AHWA 4RL6A 1IB0A 3O4FA 4DMLA 3AH8A 3VR4A 2CNDA 1RLTA 2L9BA 1WW2A 3BKXA 1XK6A 2C4UA 3N8HA 4BZXA 3NEYA 3GXOA 3MWEA 1RQXA 3D5EA 4AF8A 2Y9MB 2MSLA 1THGA 4NONA 3PXXA 2AW5A 2BKEA 4A1GA 3BTOA 3GRCA 2G25A 3N6XA 3H1PA 3HQ4O 2EIXA 3N5CA 1TLTA 2ORYA 5EJ9A 2H1VA 2IEZA 1JAYA 5I7WA 4Y9SA 3UIEA 1LTXA 2ERXA 1N34B 4Z6KA 3MMZA 4MA4A 1Q2XA 1B0ZA 2ZM6B 2RMKA 1XWIA 1YVUA 5AM2A 4GT1A 4GPKA 3L6RA 1I4EB 1OYOA 4WNYA 1O5IA 3VR2D 4IHQA 3HXOA 3DOOA 2PVCA 3ZI4A 4IH4A 3KOXA 3P0EA 2OYCA 1XKXA 3D3NA 3RFXA 3U26A 2W2VA 3D2CA 3I32A 4LFCB 1TUGA 4IHAA 5EIFA 2J9XB 3PVCA 4B4UA 3I2GA 1SXPA 3EIUA 4XJSA 4G8JA 1KBZA 2QJWA 3GLGB 1JDZA 4L7VA 1NTOA 3F5DA 3IEVA 3M3HA 2PL9A 4RVUA 4J1NA 1V43A 5F21A 2IEDA 1WUIS 3PC4A 1SQ6A 4BX9A 5A7FA 1HUQA 1BROA 3HR4A 1KR5A 3FZEA 3W2IA 4IV0A 1US8A 4ALKA 2NNLD 1XCBA 4FP9A 4R2KA 1DKQA 4RFSA 3KPVA 1K6MA 4ROSA 4QU5A 2WWFA 3C3JA 3IJRA 4MJ7A 3HFGA 3L49A 4YR7A 3D9KA 1GPJA 1J70A 5ADWA 4CV1A 4FHDA 2EILE 2FR0A 3G6WA 1KZ1A 5CXSA 1AIPA 5J4LA 4QU8A 3EJNA 2B4YA 2RKOA 1MV8A 3D5QA 1CRPA 1BE1A 5C34B 3X1KA 3MYVA 1W2HA 3SX0A 3I62A 3LLUA 1XRRA 1PAQA 3VSCA 1XP8A 3JCZA 3W9YA 3A2MA 4DLSA 4KV9A 3IMFA 1MA0A 2GUGA 3QUBA 3TWOA 3Q2KA 4MGKR 4PZEA 1LY1A 3GLSA 1F2VA 3TOXA 1K7CA 1ZAYA 1E2LA 1V3QE 5DX8A 2WIKA 1N4PA 4J16A 2I1KA 4DT1A 4UDOA 3R9KA 1DNPA 3JR7A 4HB4A 4JI7B 4X1YA 2PVSA 3X1JA 3V1TC 4EHJA 1XCLA 1GFZA 4TZKA 3INGA 4X1IB 1WKVA 4J9UE 3B6MA 4BAGA 3MOGA 3T5DA 3LF1A 4I50F 1E94E 2FE4A 2ODAA 2ZRMA 3QY0A 3OMWA 1Q7TA 1T0BA 3PGA1 1JTVA 5DO9A 4GA2A 3EGIA 5G04C 1WXHA 4K6GA 4D8TA 4HK4A 1M5RA 1K0FA 1AX9A 4YX9A 4DA4A 3M6MD 4GXNA 2IO2C 3E15A 5LLTA 2R1UA 3GEDA 5A4IS 2WQ7A 1RPAA 2H11A 4FINA 3CCCA 4FYKA 1MMFB 4L9PA 3FIUA 4NOLA 2A9FA 2F1RA 1ZBQA 5U4XA 1AKTA 2IBMA 3CEPB 4XIJA 2X8JB 2H85A 1KSGA 2WXJA 3LCCA 3TOVA 4V03A 4ZO4A 1U8XX 2X0DA 5IFLA 5JFTA 4R5MA 4AUEA 1N9ZA 1UC9A 5DVZA 4UHJA 4GPAA 3W3AH 4QAJA 2GBFA 2B69A 3TG4A 1F2TB 4P80A 3S70A 4QASA 5E2IA 3KEOA 1F0KA 4YCNA 4G37A 5FLYA 3QNMA 2AT1A 1QONA 4ARZB 1DBWA 2A9VA 4FWTA 1ARZA 4XAQA 3SXPA 5HNKA 1I8TA 2I3AA 2W6OA 4P83A 4HMOA 3R76A 2W4QA 5GM1A 2DR3A 2HF7A 1K3FA 2ZE8A 2ZRJA 5B1EA 3R9MA 2VQ6A 3HEBA 4US0R 3OD1A 1TK3A 3HB4X 3H5NA 3FI9A 4WEQA 3V8VA 2EJCA 1P2TA 1G3QA 2QN8A 1FZTA 4UXJA 2XGOA 4Z51A 1IQ0A 4HVCA 2UYGA 1R6TA 4GR5A 1LW7A 3SS9X 3C6BA 3UFXA 4FKBA 4YCAA 1CC1S 3AIKA 4K9OA 2AKAB 4GSLA 2NPOA 3B2QA 1W581 4D9NA 1N95A 2DUJA 2ILVA 2LSUA 1UXHA 1AZLA 1G60A 1TOAA 4CM8B 2CXQA 2QRVB 2WWIA 4P3NA 3NYRA 2H4ZA 1E8WA 3MLBA 3MRTA 3TRJA 3QUAA 3O31A 2EQ5A 4B3DA 1TF5A 3CLVA 3ONLA 1PUXA 2P75A 4BVHA 2HFKA 1KTVA 4TUYF 3GQBA 4JK3A 1CQXA 1OGIA 5F1PA 2EFCB 1FMFA 3SSNA 1G7CA 1OX6A 3RT9A 1HF3A 1NI1A 3LQ1A 2OBYA 5K8IA 2AMJA 3OCYA 3DZGA 3O84A 2OMEA 1VHLA 2LBPA 2QLMA 3I1JA 3UWOA 4C4SA 5KYKA 4DI3A 4TMKA 3FBGA 2OB2A 3TSCA 5A02A 1QYDA 4FEAA 2C1XA 3IBSA 1JE0A 4Z8XA 1K7XB 2PS1A 4TV8B 1ENYA 1QAMA 1N75A 4N5NA 4HWKA 5A4KA 5EMMA 5ALMA 2I8AA 4G0UA 2QVCA 4R1TA 4OD0A 1E6CA 1ABFA 1NJ6A 3CNNA 3EXFB 3AI2A 1XO1A 3SQOA 3GW4A 2CJFA 4RZSA 2AOXA 4WKPA 4FN4A 4TSKA 5CLIA 2IGBA 4EARA 3KT8A 2L6JA 3P9PA 2YDYA 1J56A 4Z1MD 4LZWA 4MQUA 2WHEA 2YV2A 4ND4A 2WG2A 4HWGA 2VL7A 1NQWA 4Z99A 3LUAA 3E18A 4M83A 4CRWA 3ASGA 2XKJE 2VQ3A 2XMGA 5LZ8A 4L28A 4B48A 3OT1A 2QIOA 3RRNA 5H80A 2IYZA 3EDOA 4MEBA 4WFKA 3OHPA 3BA6A 2IW1A 3DJFA 3EAGA 3A6PC 5AHRA 2PKRA 5I7HA 4NAUA 5HILA 2W2LD 4MVJE 1NHGA 3AFNA 1HT1E 4RXUA 5AM5A 3Q41A 4KT6B 3LXRA 4IEIA 1VLLA 1E9VA 2C3UA 2K87A 4R1MA 1XZFA 4QQ8A 4D3YA 4NCJA 1B8UA 4UW9A 4JASB 1E5VA 4RVDA 2QRZA 1BXRA 4GMHA 2XEVA 3K20A 4DWJA 4WLNA 2W6ID 1VC2A 5B6IA 1BE6A 1SXJE 4L7TA 2JJ1D 5DTMA 3DAPA 1DQYA 1O8BA 3B12A 3BMQA 4X1OA 4LYDA 2XLBA 2M6LA 4LG1A 4OHPA 4K2AA 4LTNA 4L3OA 4LHXA 4GX1A 2DPMA 4JLVA 3E3AA 3JQ7B 4I81A 3RC9A 3NWJA 5TX7A 4EUKA 3NQ41 1TX4B 1JLLB 1HXIA 3ZOZA 3ZLJA 2V4HC 1ZJ5A 3W5HA 3UWMA 1J8YF 4UQPA 3L7IA 2JL1A 1IXZA 2A7QA 1Z7EA 1BQEA 4H77A 2ZIGA 3DMPA 1RM0A 4MB0A 4HQOA 4D44A 1B00A 2NSDA 3OAAA 1R5BA 2AFRA 5KTPA 4CZ2A 4REQB 2VDOB 1ODIA 5IX8A 3KJFA 4I4LA 4DNQA 2W90A 5AW4A 1TF2A 1XZQA 1XJCA 4POAA 4URUR 2Y1DA 4MRUA 2BR5A 1PG0A 1DIOB 2W6QA 4AZVA 3AVWA 3QK0A 4W9MC 5EYPB 2J8SD 3AOEC 3CSTA 4LK2A 4AJ2A 4C3OB 2V0GA 1KMIY 2QJFA 3SIPA 2FFHA 2ZKLA 1W5BA 1XTTA 4R8LA 1CJBA 4ARVA 2RFMA 1XTVA 3UYLA 2XCLA 3DH0A 4EGJA 1YFZA 3RT7A 4M2LA 3RS0A 4QL3A 4RVOA 3E9CA 4PZCA 4G0NA 4DG5A 3SU8A 5FPHA 1QH8A 2GH1A 3N2GA 1H2ZA 4QOEA 3T4UA 3WBJA 1ZP6A 4P31A 1UDWA 2CUNA 2JKZA 5FPTA 3HEMA 3OD5A 4DM3A 4DV6B 4C4TA 1VPDA 3CZ5A 1ODLA 1LBTA 3WV5A 4ZMBA 4KZPA 3C3WA 4RA6A 5KX5B 2QL6A 3AEYA 3L1JA 5C7YA 5LXTB 3EFOA 2EQXA 4YT2A 4JIMA 5K0EA 4AC9A 4PRKA 1RCTE 2PPLA 3AFMA 2F67A 4PAOA 3TG8A 1GVNB 2PMWB 4TVOA 1G6Q1 4AO6A 4BATA 1IPEA 4COKA 4ZYLA 3NTUA 2W2MA 1ZUD1 4KH1A 1Y1PA 3W06A 3U81A 3UKOA 1LNQA 5JJCA 1SIUA 2FK7A 5K3SA 4EYKA 2WK1A 1XZLA 3G8YA 2KM1A 2E4XA 2RH8A 3WOVA 2FO1E 4ND2A 2QYOA 3GCXA 3WHPA 5ETJA 2COKA 3H42B 1QQ6A 4B47A 4UULA 3GIDA 1SU8A 1M2VA 1QU2A 4ESVA 4P36A 4N48A 3ETDA 1I01A 1XT6A 5AI0A 2CDAA 4DVGA 3VR4D 1V1RA 2P9ZA 1Z8FA 3IV9A 3GA0A 3I30X 2DUMA 3CBGA 3HN2A 1SCQA 3I4GA 4EGFA 2XJ9A 2YQ8A 1G8HA 1DUVG 1H4QA 4GOND 3PP8A 2PCLA 4HNRA 4XJTA 2QD5A 3U3JA 2BDEA 2ZSBA 5IF9A 5BSVA 1EVQA 5BT8A 3MMNA 1H2UA 5LQDA 4ND1A 1CQZA 3NTQA 1E3LA 2Z6VA 2DWQA 1VBKA 1KFBB 3VKGA 5LKAA 1IPFA 3GDOA 3ROQA 4QJIA 3MJFA 2GRPB 3M81A 1E2GA 1GTG1 3H5LA 2WKPA 3S5UA 5JPIA 5KWVA 1N2GA 5B53A 1E4OA 3L82B 3KNZA 5B6JA 3ED5A 1BX3A 2J5KA 1A2QA 1W88B 4X5OA 4MLPA 1SC9A 3B5IA 1W9HA 2FZ5A 2LKCA 4FMBB 1Z6XA 3IYLW 1SA0B 3OEWA 3GGDA 2QDXA 7AT1A 3WLSA 3F9RA 3SHWA 1I32A 3BJMA 3O82A 1T8RA 2O50A 2PSDA 3FUKA 2QR2A 2AYYA 4YJ3A 3ZZMA 4OQMA 1QV7A 4E32A 2OORA 3A3YA 1TN7A 1XLVA 3K96A 4A36A 4KI7A 4UD6A 3QMPA 2O2JA 3DBHB 2X6JA 3R5TA 2HQBA 4WESB 1T1GA 3TJRA 1X1CA 1U2GC 3RAEC 3H8JA 3HYLA 1PT7A 4FSDA 1WEHA 1XCOA 2WDZA 2OP1A 2WD8A 4I5DA 1DJOA 1KRHA 3O93A 3CPHA 4O5AA 1X1TA 4ZOEA 4KH0A 4MEAA 2UZ0A 1N0WA 3L0ZA 3TO5A 3RIYA 5DK4A 4ILKA 5CBOA 3GH1A 1T5HX 2E4YA 1TFRA 2PL3A 2QG4A 3SP1A 4BU1A 1SKQA 5DBOA 4D3XA 2FSHA 1JWLA 2C7QA 3UMSA 3W7AA 1JT9A 2R1VA 4EUSA 3C3EA 1Y8CA 3KUDA 1PTJA 4RA9A 3TR0A 3WKEA 4MGZR 1OCRE 5K5EA 3VUEA 1PSDA 5HHTA 1S8AA 3NTXA 4M4SA 1XU9A 4G0MA 1BVYF 3FG9A 4E4TA 1B74A 3WGHA 3LXUX 1GEGA 4JCOA 2ZUSA 4ZHQB 2EZ9A 3NIFB 1KNXA 4ITRC 1WMBA 2H18A 3L93A 4Q4LA 1V2HE 4GI3A 4Z4GA 1VI2A 2F2TA 5ITZB 1GGFA 4DWVA 4WY5A 4OFXA 4GB9A 1EF1C 2V7GA 2BUGA 3E81A 4ZHSA 4A82A 1KHTA 1EFVA 4RKFA 1TLLA 3LDAA 4FCCA 3W6PA 2Q2OA 2GN4A 3JZAA 1LGYA 1PNTA 5ABPA 1P80A 1W5TA 1WMFA 4L6IA 1JKFA 3OIFA 3UUXA 2WG1A 3QVXA 5JDIC 1RYFA 3ND9A 4V0RA 4M54A 4YT4A 1CQIA 4Z5XA 2O0MA 4MWBA 2IO3C 3RIHA 4DMUB 1M6EX 4N9WA 4HOTA 1ZS9A 3FZYA 2I55A 1MCZA 3FH8A 1M8FA 3C3MA 1CWUA 2JHGA 3MVEA 2J67A 1GL3A 4BNNA 2H3HA 1OB5A 4NG4A 1HFKA 3A1NA 2Y76A 4DCOA 3GJ7A 1NF2A 1RQGA 3P32A 3OJ0A 1Y8QA 2PAFA 2KCLA 1M1YA 3U9WA 2EFGA 5FWYA 4L16A 3BD8A 4P58A 1NOKA 4ZVLA 3KHTA 1JA1A 3Q2OA 5EC8A 2RGCA 3RUPA 1IZYA 4MRNA 3UJDA 5JE8A 4M0KA 4WBNF 3FU0A 1LVGA 3GJXC 3MUOA 2P4HX 1Y3AA 2OO5A 4MQBA 1E7UA 2F90A 3KQHA 4QHTA 4OI1A 5M5BA 3M4NA 5BMVF 1HDOA 5IMSA 2PUDA 2MYUA 3H6KA 1U3DA 5IJXA 3EW7A 4JBXA 4PW0A 3CT4A 5I4BA 4ACAA 3TCNA 1Y48E 5GONB 3CVOA 3AQ4A 3V55A 2DJ5A 4PG8A 3A2NA 3FTCA 2GD6A 3L0DA 3HXCA 1HNWB 3CR7A 3N0WA 5E0OA 3RTDA 4OXRA 1JSCA 1FK8A 2QTVB 2F8LA 4KNYA 3O6VA 4JVLA 3EOZA 1XPUA 4BASA 4GBGA 2CHWA 3NT2A 3UJ6A 1QG0A 5DM60 5FINA 3MS2A 2VJMB 5JY1A 4A4DA 1RLUA 1ZSVA 1AU9A 2VDKB 3ZCPA 2AHRA 4ROTA 1LDBA 1W2GA 2DKOA 2G5CA 1GGKA 1GQQA 1JLSA 5CEJA 2BEWB 2CNOA 3Q3EA 4DX5D 4FMCB 3AQIA 2X0NA 5CHEA 1N2CE 2ZCVA 3ZQKA 5GZ1A 1HFEL 4WCVA 4U2GA 1B0PA 2Y1XA 4BAUA 2HADA 4ETMA 5E6SB 2GZRA 4EW2A 2FNAA 3NDIA 3AGQA 1OFUA 1F8FA 3EQ6A 2VO1A 4CEIA 3WG9A 1JECA 1CY1A 3ABOB 3OEYA 3W2EA 1K6XA 4IM7A 3B3JA 3BHIA 4L2IA 3WL4A 2QD3A 2WQHA 2J30A 3HKDB 1WOMA 3U3KA 1A5AB 2XXBA 1VSTA 3KD3A 3R8CA 2O8BA 3DE4X 1NW3A 3H3FA 3RHSA 1AHNA 1EWRA 3L6AA 3A27A 4KPYA 1WM5A 4OYRA 2I67A 3R0ZA 2YBDA 2GYVA 4GLLA 3I2JA 3EA5A 5C53B 4UUMA 3F4KA 2JFFA 1VLZA 2XWJI 2OLKA 4KR2A 4JYCA 1Z4NA 2VQ2A 1BGVA 3MJTA 5K99A 1J42A 2Q6TA 4FBLA 2FR8C 4LJ4A 1ZOOA 1XEWX 3RBXA 1V9SA 3BS4A 3DWGA 5HTOA 1KK2A 2JGJA 4EJSA 3IOMA 4YALA 3JZMA 2V9ZA 5KNBA 1Q16A 4U63A 3H4IA 4OB7A 3TGLA 2G83A 3K9QO 3LUGA 3CVLA 3LHFA 1QOZA 3PB3A 2PH5A 3NBXX 4LQLA 4E5PA 5D86A 2YVUA 2E37A 1Y4ZA 4HEQA 2WM2A 3R3HA 5I5GA 4PBRA 2P9UG 1PK7A 1LLFA 3EG5A 2IP4A 1E61A 2CSUA 3JAKB 4WXEA 1L7QA 3KWFA 2Q0HA 3UNXA 3ESQA 2HMTA 6LDHA 5IZ4A 3SEZA 3M34A 5KQRA 2Q5IA 2YJGA 2VSXE 1RQPA 3KOOA 2C96A 1BHSA 4B81A 4MS4A 2DYRE 2P69A 4Y1RA 2QHXA 4CT4B 1A9OA 3SBSA 4O08A 4JLUA 4MI9A 5H3CA 3RAUA 2HSGA 3BUAA 4E46A 4TMZA 1WV0A 4JJ7A 5F77A 5AW5A 5KQGA 5A3JA 3EZFA 1EFRA 1U0NA 4YUXA 2ZBVA 1KY5A 1SCNE 1OH5A 3LOUA 3I9MA 1NM5C 1EK5A 3FNEA 3BJRA 1U2DC 4EF5A 4G86A 4E5NA 3E7DA 3ZS9A 1YQTA 4N40A 5KOYA 3TL5A 1Z74A 2X6IA 2HYZA 2V0CA 5KAPA 4OJNA 5G3YA 5LBIA 5A7DB 1F0PA 2IYUA 5KWJA 4PXAA 1MAVA 4CF7A 1RWNA 3OAAD 4CZ2D 5JLAA 3RS2A 1NFIE 3FTWA 2Z9CA 1ZGHA 2BV3A 1ZJYA 4FHFA 4FLHA 1XXHB 4ARBA 1I7SB 2FVYA 1CVLA 4LG6A 1FS5A 3LLCA 1O95A 5BSGA 5MF6A 4C6RA 1GPUA 1ESCA 5JPDA 3ZDAA 1QZ3A 2ZULA 2H5JA 5EE3A 1M33A 4AQYB 1Z75A 4CLEA 3L6CA 2ZU0C 3PWSA 2ID7A 4MTLA 1DSSG 3ZC3A 1XLWA 3OM1A 2A1UA 5BN5B 5K8CA 3Q85A 2HRRA 4ZREA 3T3HA 2QMOA 4BMDA 1Y6QA 4HDRB 1IN8A 1C9KA 2ZDHA 4RHYA 1YA0A 3OZGA 4CXMA 1V37A 3ZQ6A 1O03A 3H83A 2QN3A 4LK3A 2F4VB 2HREA 5F5LA 3DE5X 5EMKA 2XKBA 4FCWA 2P9PG 3CLSC 4P81A 4DR2B 4CDMA 4PFQA 2Z5FA 4V1CB 4OLHA 4R8KA 5A03A 4BLTA 1IBCA 1P4AA 4EYQA 3JQDA 2PVPA 1J33A 3DEOA 4JD5A 4YLYA 1VG0B 3CSUA 4M9XA 1H05A 2P2NA 4J1QA 4DUPA 1JAZA 4MQMA 4E1AA 1ODJA 4NCHA 2WILA 1DCEA 3HN6A 4C7OA 2H7YA 3TOZA 3GVXA 1OFTA 2DCMA 4B8ZA 2H52A 3I01A 5FDFA 2WU1A 3FPBA 1AQLA 1SUIA 3G9XA 5KNLA 1GV0A 3VM6A 2GHIA 5CUQA 2X6QA 2C31A 3WB0A 3V5NA 2A5FA 1HDRA 4AP6A 2BWJA 2HJVA 2A3NA 2QR3A 1PD1A 2X40A 1NF9A 3ULYA 2JEKA 1K3TA 1Z3YA 1IC6A 5CFOA 4U9IS 1A0OA 1IQPA 1N2IA 3ANNA 1NXVA 4JDPA 3AERA 4MQLA 4JP8A 2AG8A 3BXPA 1T10A 1PT8A 2X1LA 3NWBA 2FEMA 3G0CA 2G9QA 4MR8A 3QVVA 1FOEB 5AXAA 1BJKA 3DKKA 3RG8A 2RIPA 1XYYA 3CW2A 2WAAA 4F4DA 5BYAA 4BHTA 4NLLA 1KZPA 3P5BA 2RGNC 5ESWA 1KO1A 3RJ5A 3MA0A 1WXDA 5CT4A 5CB4B 3T9KA 2JF0A 4IS2A 1UMKA 4BWGA 1ZNQO 2P2CP 2WSMA 3KOUA 1REQA 3RSQA 1A77A 1VE6A 3CWQA 3AKEA 5BWCA 2QY9A 3EXEB 1TJ4A 2NUAB 3BGOS 1DBIA 3IALA 3I58A 4PZAA 4F60A 3FLAA 3MCWA 3Q1KA 1XVUA 3W6ZA 2EGHA 1R00A 4RLFA 3BDIA 3F6SA 1CYEA 3JZFA 2CFSA 3MJDA 3CHOA 2I9CA 3TR5A 4G1UC 1YMPA 1KOFA 1ZL2A 2DE0X 3D9LA 1QGYA 4G41A 1WDWB 3PICA 2NGRA 2AMYA 2E4ZA 1YS9A 5I7EA 4DRXA 1H2BA 2C2HA 1KMQA 4QBGB 2GRUA 4DHWA 4QG3A 3GUHA 3H7IA 3VMMA 4NK5A 1LZLA 2XD9A 3QXGA 3QU9A 2PKQP 4BFSA 1W4CA 1OYYA 2G80A 3RYIA 4NBSA 4W4TA 2NT3A 3UC5A 2B0CA 1ECBA 3BCHA 1HF8A 4KK3A 3BMCB 4MKZA 2CT8A 1HEUA 2XMPA 2ZCJA 3ZYLA 4MHOA 5MN6A 3E05A 4FR0A 4P3PA 2G9VA 2L82A 1EBFA 1Q5PA 5CR9A 1JEYA 3FMIA 2X8AA 3OZRA 4WL0A 2BELA 1GRNA 4KITB 4D6XA 5B4UA 1RAHA 2RHTA 1AXEA 3F97A 1ZONA 3LT1A 2WYVA 2P2CA 3NOGD 1SVKA 1RHMA 1TADA 4D4KA 1J7KA 1L4YA 1FP1D 1G5HA 1FYFA 1KVTA 3AF0A 1E9AA 2XAAA 4F9TA 1E1NA 2WVIA 1X7ZA 1YBMA 4P7FA 1BIFA 5FBHA 3CH5A 5FQ6A 1GFSA 1A27A 1KJNA 1BWSA 4FFBB 2WLSA 3PHJA 5AW3A 1W0CA 4NATA 1QB8A 2WFAA 2NN3C 3DLCA 5EXSA 4EHIA 3I76A 4M76B 5CBPB 4DMGA 2G1KA 5ER6A 3QI2A 1ZMTA 3EGEA 3R7BA 4ZI7B 3ZQJA 4RGYA 3VJMA 3H8SA 2GZSA 3HP1A 1WBJB 1SZCA 3CT6A 3VDXA 2VRCD 2WT4A 2XUFA 2C2LA 3WRYA 3GLIA 1KH3A 1O0SA 2QRQA 2HF2A 5D7NA 4DA0A 4YYEA 3EK2A 2JEYA 4ZT2A 4OSOA 4TKUB 2FV8A 4U9HS 4Q3LA 5TC4A 3LT2A 4WY8A 3A31A 3E5HA 3N58A 4ZD6A 2B99A 1JFVA 3VFDA 4OP2A 4M0LA 1FVHA 1V4NA 1WF6A 1UJ5A 3IO3A 4FDTA 3JWGA 4U96D 4KR7A 4OXYA 2GESA 2OLJA 1YUBA 3INRA 3F90A 5JZ9A 1XHLA 1GR1A 3I5YA 1RYBA 2XBUA 2PX8A 4PN3A 1XE3A 3SD7A 1TQ8A 4BV8A 2BGNA 4BEWA 4B3IA 4TTAA 3SZRA 1U1CA 4ZALA 4BB9A 3DD5A 2CHQA 1CHNA 1ECJA 1N8TA 4CG0A 1ZH4A 3L0CA 2AXEA 1W6RA 1QHNA 4JHRA 2I80A 5FUMA 4Y2JA 3NAGA 2HJHA 2XUHA 1WTAA 2B5WA 3O38A 3GEGA 2W2LA 2RGDA 3ZXXA 4DLQA 4NCKA 5EESA 4GPD1 4AG5A 4G5FA 5JAOA 4B93B 4BY6A 2ZJ6A 3TI7A 5FTNA 1Y6FA 2WOJA 3ZVVA 3CSDA 4AAYA 2DKFA 3FTEA 4Q21A 1QDLB 4Y2SA 4D2IA 2HAEA 4DY4A 5JNSA 3OWOA 4QG7A 1CULC 2X1MA 3NASA 4Q9AA 2GJSA 4WQMA 3N8NA 1PS9A 5FIOA 1TUEA 3DG9A 1ZISA 1T2FA 4UM8B 3AP3A 4RANA 4XQCA 3HG7A 2AR7A 1XAJA 4HGQA 5ARCA 5IHXA 1XCPA 4BJ3A 4JB0A 1GSHA 2AN1A 1CVRA 3VJKA 4BLSA 5JXGA 3RVRA 2XCIA 1GTMA 2VGXA 4PFJA 1ULHA 1RQLA 3H8VA 1B8VA 3IA2A 1FUKA 1HDCA 2FLVA 4IIHA 3GIWA 2M2IA 2IYPA 5HQ3A 2D1RA 5E1MA 4XVCA 5FI0B 2QZ4A 4R0MA 2ZSEA 3NTLA 4WVFA 2V6JA 3AS8A 3PENA 4UM5A 2B4QA 1OLSB 3OU2A 3UT6A 3RO2A 2CEKA 3QUQA 4YHBA 5LQUA 4KWCA 4FMDF 1QGAA 4JHJA 2Q9UA 3KVVA 1WB9A 4ZP1A 2ATEA 4JUDX 4I8IA 1YQQA 2Q3EA 5ALXA 3HL0A 5KNGA 1RLIA 1HGXA 4K9QA 4HDAA 4B94A 1G7RA 3GROA 5AUNB 8OHMA 3PIDA 3OECA 1SUAA 2ZOSA 3LK7A 1QUEA 3ZV3A 4KXWA 3R6GA 4NPHA 5JA4D 1XNGA 2HB6A 2I1VB 3T61A 4WA8A 5BXYA 4DY6A 1HOTA 3U19A 4BC1A 4IVRA 4LVCA 3NVKI 1MLDA 4K81B 2R86A 1G8MA 4HJRA 4P3YA 3EEOA 2QJTA 2DWUA 1CY8A 3V2XA 4OSEA 5REQB 4ZV4A 1PT6A 3DDWA 5ER9A 1SC3A 4BRSA 4Z7NB 1QZUA 3IE2A 2BD0A 1M76A 1NXSA 2VC2B 1SBQA 5I8PA 4DMFA 4RXTA 4DM7A 4JWKA 3S0JA 1YR3A 2ONZA 4Q6BA 4HRAA 4BWVA 1W0KD 1LFDB 2A5DA 3LBFA 5BV7A 4YMIA 2CKDA 2NAFA 5ADHA 2XENA 5BR7A 3KT3A 4PHTA 4QGBA 4F5ZA 2DR2A 4A73A 3BAFA 2P6PA 2H7XA 1J21A 2Y1OA 4CMIA 2BFCA 2C5HA 1G3RA 5GMOA 1N1DA 4KN8A 2F9LA 3HBFA 4O1OA 2H7CA 3IL2A 3NDRA 4ER6A 5IUKC 5DHAA 1C3EA 5HIKA 4EEXA 3GY0A 2VCHA 3PL5A 2EBUA 2R84A 4Q1FA 3CK9A 1AMOA 1OAKA 4LMRA 2JGIA 3DKPA 3FOCA 3BFXA 5T4EA 1NG9A 4F2HA 5LJIA 4F84A 4XFJA 5EWJA 3HLTA 1T6BY 3DVAB 3FPJA 5KSZA 2SCUB 2WWGA 3HXBA 1R27A 2ZANA 4RH0A 3CONA 4KTVE 1NASA 1U7DA 1X9GA 3OG9A 4KK4A 2VG8A 5J90A 4IDNA 4XFDA 3QWBA 4UMEA 4N1AA 4DSTA 2I7VA 3E2IA 4O29A 1EFRD 5A9TA 2QLBA 3KQMA 1EJ2A 3MNFA 4MYCA 4EHBA 4PHFA 2XODA 1QPGA 2H0QA 3KSZO 4AXXA 5DBKA 3A58B 3D1LA 1C9NA 3GR6A 1O94A 3HRKA 2R60A 4BE7B 2Y0EA 5FXMA 1JDSA 1MB3A 1E2IA 3H0EA 4XFKA 1HG1A 3QFFA 2DT8A 1Q50A 1U8FO 1J8DA 1XRPA 3L6UA 1IXSB 1PGNA 2MYOA 1P8JA 4B6PA 5KVAA 3L1KA 3BWMA 4REOA 3P9CA 4YRAA 3F8SA 2F8MA 1L5VA 3CA8A 4J75A 3K3PA 4JENA 1UKBA 1ZIXA 4JJIA 4C3ZA 1O95D 1U1EA 4FNMA 2X4GA 2J9FB 4UDXX 3SYRA 1EZ1A 1DWUA 1PVVA 1L5KA 5HF9A 5IAOA 2P2ZA 3IP9A 1SAYA 5F7JA 2Q29A 1Z13A 4WNFA 4MH0R 4I2WA 3E1GA 2NU6A 1TL7C 4BV9A 3AUSA 4RQTA 1DC6A 3DE3X 2CV1A 5JAMA 3V1MA 5ESDA 3KQKA 5ELLA 1F0NA 5IT5A 1TNDA 4DLNA 4I2NA 1BCSA 5BPFA 4MITA 1A5TA 2J9GA 1PL8A 4Y0VA 2IBTA 4EHHA 4N8SA 4PX2A 3EWSA 2WJZB 2WUFA 1WZUA 3SZ7A 4A6PA 2BHNA 1YJXA 3VMFA 4MW0A 1NU6A 3OZWA 4ENWA 2XMSA 1C7EA 3ZE2B 1GQOA 2PKYX 1JKMA 1QRSA 4AJOA 4TYNA 1M6VB 1MEEA 3ZJ5A 2LO6A 3CQCB 5GVSA 4GDMA 4KFTA 2PU7A 4XKCA 4UBKA 3ROGA 1WZ2A 4BVEA 3MELA 3UM3A 3ER8A 1GCUA 5JALA 3FPLA 1J9ZA 2OVFA 4EFKA 4KVGA 4ZZ2A 4EPVA 5FPYA 1JKXA 1K7FB 4QXMA 2FEWB 3OF3A 1EE9A 1VLJA 1K7EB 1U8ZA 5DX0A 4EQFA 1X1DA 1AHIA 1KKUA 3KS9A 2OPHA 3S2ZA 3CVNA 3OKCA 3WRWA 4L75A 3ZKAA 2ZPUA 2Q5EA 2GI4A 4OIMA 4NMMA 2B2CA 3HXDA 2PMEA 2IYOA 2RAVA 2IF0A 5AQ9A 4QPZA 1OWPA 4O4LF 1F2UA 4IGAA 5MHTA 3JQGA 3M4ZA 5FTPA 1GG8A 1LPPA 4UFPA 3A1TA 3PQ4A 4KR3A 1JALA 2AXVA 1BFKA 5LM3A 1F14A 1L8LA 1N5LA 5KHAA 4YO8A 3REQA 3MJHA 2P9CA 3NV7A 2V55B 4GFDA 4MPDA 5BN4A 4RQBA 2BEJA 4BSXA 1U9YA 5K6TA 3H65A 5J4HA 4WN9B 1KI2A 2JAUA 1XF9A 3DKRA 4HAUA 3UM2A 1D6JA 5IBPA 2HCBA 4DCMA 1HNXB 2RC6A 4KYUA 4Q3BA 4RPLA 4IOJA 1WMAA 3NC4A 1G2PA 3TTWA 2WKWA 2GBIA 2PQRA 5CYOA 2OFWA 4RX1A 4NARA 3QMWA 4YP0A 2F55A 3M4YA 4C0EA 5F3WB 2GZHA 2JGKA 1XZIA 1TCUA 3IRVA 3R4CA 5DP1A 1M2NA 2WUGA 2JIBA 1Q44A 3KQYA 3H0KA 2FJ0A 1QNFA 2IE0A 1NVFA 3HNPA 4CF3A 2JASA 1IN5A 1P1IA 1NRIA 1YH3A 3QSGA 1WOYA 4X65B 1DJPA 3PDIB 3A36A 2HWKA 1E2KA 5K6AC 3GDHA 1M0SA 3U7EB 3LA6A 3L0SA 3MWDA 3I6QA 1RQ2A 4Q7MB 2BMFA 1E8MA 1JWBB 4TS4A 2E1PA 2K6GA 2C9CA 2CVOA 3FRIA 2YTZA 4YROA 3JQRA 4YT5A 5FPPA 2ZS8A 3Q72A 3CPEA 3QUSA 3BWXA 2Z56A 1WPGA 2Z8YM 2ZAGA 4U02A 1PJZA 2AX4A 3EHNA 4LC9A 2NU9A 4PN7A 1V2GA 2OCYC 3IB6A 4JLWA 3PPXA 5AICA 1DB3A 4LJYA 2OQVA 4OJTA 4RJIA 3ISMC 1JSRA 1LV8A 1KMHA 5I4KA 5DB4A 1G4HA 4Z9AA 3ZGVA 1IG3A 2O1SA 3KYCB 3R7WB 4F3CA 2A8YA 1FTQA 1F3LA 4MVYA 3D0OA 1J5EB 1S9HA 4P2GA 2F48A 1R6VA 1O0BA 4N5IX 2J3QA 2NTEA 1T91A 3V48A 2NUBA 1T0UA 2UU9B 3RC7A 2W8BA 4GIBA 3PKIA 1WAMA 4NE7A 4ZVUA 2BE9A 3DEAA 4UPDA 4B7ZA 4MNTA 1EU1A 2O0LA 1O5OA 3WL5A 2MR6A 5LBTA 3IGFA 5E7QA 4NULA 1QANA 2HT6A 1LDMA 4TLAA 3L1UA 2IHVA 2EL9A 1HLPA 3M9WA 2UYQA 1TEXA 4XRRA 5IFKA 1YF3A 3T7AA 1RKQA 4EKIA 2BSQA 2ZUFA 4K5QA 1SCIA 3A6GA 4IZHA 4KLZA 3KHSA 3EG9B 5TMPA 2H2FA 1E2HA 5CFQA 5AHOA 3ST7A 3PUVA 1XTIA 5H83A 2HN9A 3AHJA 3SOZA 4LW8A 4WEOA 5E3IA 5LZ7A 3T7EA 3OO1A 1S8NA 5IEBA 4WJZA 3FGOA 4BLVA 4BNKA 1O4WA 1F17A 3TBFA 1WB4A 1FNDA 4ZT5A 3QPDA 3HYMB 1N9GA 2QXTA 4MKTA 4Q7KA 3CNBA 2HF8A 2ZE5A 2OXIA 1GQFA 2Z1MA 2P79A 1X7HA 5J4VA 4EABA 1X14A 1QR2A 4B4VA 1K86A 3C45A 4ZYXA 3VLDA 1GTL1 5H16A 4RIIA 2ZBUA 1KFCB 4IJ6A 5JMND 3IT2A 2BH2A 4GGOA 1EX1A 1H2HA 4CKCA 2OAEA 4J1TC 4G8LA 5DLQC 4IILA 1VRCA 3AINA 3CJQA 1KE1A 3PGKA 4YQYA 2Z3ZA 3MWLA 4EMSA 2C7VA 3OBIA 1QIKA 1SKMA 1V25A 4CMKA 2II6A 1X19A 3Q6NA 1JEAA 4V0OA 3HWX1 4OAUC 2C4HA 5HCIA 2X6FA 4J9VA 3CFYA 4KHPB 4UOQA 3D3EA 4HEA1 3QVWA 1FFHA 3NUGA 2IFTA 5AI8A 2RFLA 2XZDA 1Z7WA 3M1YA 1V7CA 1G3IA 2VZ9A 4E7OA 4NNJA 4BXOB 4FDMA 2VNKA 5LYJB 1KTIA 2Q7DA 3FHEA 1E3IA 1Y8ZA 2C2XA 2G4VA 4HBGA 2UYCA 3R0QA 1I4LD 1SELA 5LU9A 4K88A 1U3WA 3A1FA 4Y6CA 1W94A 2EFDB 4GSYA 4AS3A 1U11A 2WIJA 2OZLA 1E4VA 1SQ5A 1QDEA 2RJOA 3UXGA 1G9SA 2BM1A 3IUQA 3A3OA 1RXYA 2I7XA 1YNOA 1Z4QA 1DVRA 1TRHA 3KE8A 4PC3A 4G4JA 3V7WA 2GTIA 4I1OB 2P8SA 3TWWA 3VC7A 4AB1A 3DOUA 4N03A 4ME6A 2EC5A 3TZBA 3OWHA 1N2CB 4PLFA 3DOCA 3KTDA 4W63A 2OOSA 1Q20A 1K6IA 3GD5A 5TV2A 2LDXA 4BUCA 4J07A 4XZ3A 3KEFA 2NVWA 1E1YA 1FF9A 3DDHA 1U9CA 1USVA 5BQFA 2ETCA 5IW8A 1JFFB 3PT9A 3C97A 2WW8A 4WNIA 2WIDA 4IIDA 5CHYA 1PSZA 5AVJA 1E69A 2AXNA 4M9UA 5B1HA 4NRHB 1DXYA 5DCLA 3ULEG 1NR1A 4UHHA 3LC2O 1EYZA 3M2TA 4F4FA 3TW6A 1A9XB 1UOHA 3FYUB 5EJGA 1B0UA 2R8EA 1HQYE 3B1YA 2LZ0A 4C21A 2BMEA 2VYCA 3ANYB 1X86B 4KU4A 3UUFA 3TL2A 1LRLA 4ODIA 3ROKA 5JVDB 1PV2A 1U7PA 1MO5A 2A0XA 3ZIDA 3U9SA 1XLTA 4BNFA 2X0RA 3CUVA 1OAOA 3NS7A 3FBWA 1ODFA 3D02A 1XZCA 3WL6A 2QSYA 3JUEA 4ZCIA 5ALYA 5TPZA 4XX0B 2CMKA 3VPAA 5FEUA 1W1UA 1ZQ9A 2GFHA 1HE8A 2PLRA 4LV8B 2Q4OA 4L02A 1XEAA 5IJWA 4L6CA 3PI6A 4EBFA 1U2TA 2K4MA 3ABME 4UJ3A 1SBNE 4JKIA 4KIGA 4O3MA 2E6KA 3PXUA 1S3FA 1N4DA 1UM8A 4WXMA 1QG4A 1Y5MA 4KUGA 1UPAA 1E3QA 1FC0A 2RHDA 3ZWQA 3GVIA 1N11A 3NW9A 5JATA 3B9QA 4EA6A 2ZE7A 4YV0A 4M86A 1UMBB 3KAPA 4WNAB 3ETHA 4KLAA 2OV8A 4MS3B 4WJLA 2P9IG 3VO8A 5J5VA 1WCXA 4C48B 2WMNB 4PC2A 2D54A 4QUIA 5E3JA 5LB4A 3AG3E 4LJKA 1RI1A 1Y3IA 4F46A 3MJCA 4BVBA 3GLVA 3LFHA 3T3IA 2VT6A 2P11A 5KJCA 2MIIA 3K8ZA 1B8PA 4HUQB 2H63A 4JLMA 4RACA 1UKAA 1V16B 4PGGA 2ZUWA 1RVV1 2E4WA 1G20E 3ZY3A 1FT1A 1WKBA 1HZZA 1YBHA 5H9WA 5CT8A 3EYWA 4BBZA 3N2EA 1CRZA 1V5WA 2R6DA 1O94D 1ZMOA 3HB5X 2ONKA 2HI0A 3PE4A 3AM1A 5EA2A 4QO8A 4HDMA 1ONSA 3I8OA 3DZHA 2J07A 3WIOA 4Q18A 3PC6A 4OCZA 1RC1A 2RI0A 4M9CA 2J85A 3K9GA 4DEYA 1H85A 4IHJB 1XF1A 2ATCA 3KB2A 4GYWA 3VHLB 4EJ2A 1KJYA 2BKXA 2CHEA 5CNIA 1KQPA 1K3ZD 4MV7A 4J7XA 1BQ4A 2NV2B 3LV8A 5J3JA 3DE1X 5K0SA 3UICA 4J76A 4NZYA 3S1LA 2J6IA 4LJ7A 4UM9B 2FPGA 2WY2D 1GYPA 3VYTB 4TN1A 5DM1A 1E2UA 5FV7A 1UJMA 2VJNA 2I2FA 2HW8A 1OCEA 4QTXA 3DF9A 1Y4SA 5IAGA 5AFSA 3LUKA 4RF2A 1TZ2A 4YNBA 3N2NA 4QYXA 4ZVSA 1FUIA 3N53A 4ABTA 4GECA 3CGHA 1KVUA 4GXRA 4XE0A 1WSWA 2QPTA 3JPWA 2O7VA 5KSPA 3IULA 3MTIA 3ET4A 3CGWA 3ZWBA 3M6IA 4DCGA 2QRMA 3IEMA 5FOUA 4JBLA 2E5LB 1HH8A 4XRGA 5CT5A 4TKLA 3U1VA 1QH9A 4MULA 3MUFA 2D5BA 1WKCA 2F9MA 4DNPA 3IVGA 4B3CA 5IEJA 1SZAA 2VP9A 3AR9A 5PNTA 4CKBB 2VF2A 1LLQA 3ZWPA 1FFWA 4HDKA 3BEEA 5DYTA 1J9EA 1E2QA 3NO4A 4HP8A 3T95A 5IM4A 1JEQB 1FFEA 4NNPA 2G1UA 3DEYX 4X8MA 1K8KG 2XF2A 2O2DA 4F96A 1GY8A 3F6QA 3ZUGA 5I7FA 1MOZA 3LYHA 5BR8B 4BN0A 1DEHA 2QTHA 6ADHA 1J99A 5MGBA 2QGNA 5CERB 3W5DA 2PE5A 1FQJA 3R3UA 3M5PA 2PZLA 4IDAA 4NFSA 5KYVA 4YONB 4RY0A 5DASA 3WNQA 3ZEFA 4MP8A 2Q0SA 4M98A 2I3DA 1NRJB 3FUEA 3NATA 1WXWA 4TMVA 3WK8A 2IHUA 4YV2A 3BL8A 4BMXA 1ZGGA 3IRUA 2WTMA 3V32A 1Y1SA 2VRCA 4PZ0A 1UBUS 2XCOA 2HA6A 2VHZA 5CLHA 4BFWA 4RK1A 4MRMA 5BW8A 5CYGA 3LKZA 4QARA 1YRBA 1J07A 1KI6B 4JN6B 4ZT3A 2HQRA 2CNNA 2C4NA 5J2TA 3DQPA 3D3QA 3NR2A 3DMYA 1RFGE 1L9KA 1ISIA 4Q9DA 4UTXA 3LPDA 5KQSA 5FP0A 3OOJA 5TPWB 2OEVA 3O74A 3Q73A 1T3SA 4O2AA 4I9NA 3D31A 2ORVA 1LDEA 5COBA 4JQYA 3AB7A 4ZRMA 2XEDA 3QEJA 1PWZA 3V2IA 4XX5A 4F3VA 3PFFA 3BVPA 4BPBA 4TTTS 2H1OA 3GLHE 3DBLA 2PGNA 4QT4A 1QMPA 4RF5A 3MJRA 2KB0A 2YN4A 3HRHA 3UG6A 3HJAA 3MBKA 4YMGA 2CNKA 2JLVA 5DFAA 2ZJZA 4ZEXA 1QRAA 4UAUA 1YASA 5HX7A 4W9NC 5JCXA 2BGJA 5EMNA 2AWOA 1MO2A 1R8JA 4TV9F 1YR7A 2ZREA 2VOEA 3VHRA 3FSGD 4KOAA 4FIDA 4IYJA 4D6YA 2VSNA 4JLNA 1CKEA 2WMYA 2IEYA 3UHPA 2KCKA 3EFHA 2EP8A 3CG0A 3G5UA 1YJCA 3LRPA 4G1CA 3SC3A 4HVBA 5AENA 3I9V6 3EHRA 1RU3A 4GA0A 4LF4B 4AT1A 5K45A 5K6RA 1A96A 2O8DA 3ZCUA 2F6RA 4TKVA 3ENEA 3GAMA 1X38A 1H69A 1R0ZA 1K9SA 1IHOA 5JMOA 1TMGE 2GETA 1BA2A 1DINA 3IT0A 2NO9A 4PO1A 2AVPA 2L0XA 1TIPA 1DKOA 2P90A 3K9WA 3U13A 1L5OA 4F7WA 5BQXA 1QIFA 2XDQA 1I7PA 2BUBA 4QUEA 3X2SA 4OAQA 1M1NA 3PUXA 2H29A 3ZYQA 3CNQS 5IDWA 1SCUA 5HFJA 2B4KA 3VPDA 4HGYA 3K4PA 3TD9A 2PUBA 5NULA 3OWXA 1JIVA 1JBQA 2WIGA 5TF0A 2Q41A 3UI2A 3LJNA 3B13B 3DD1A 3U0VA 4Q05A 1QIEA 4HL6A 4V0ME 2YMLA 5AUPB 2C3MA 1Y1TA 4X8OA 1C9EA 3TQIA 4LPSA 1QHGA 4IMPA 1ZM7A 2NLOA 4NAVA 5HW0A 1U0HC 5AKLA 2QM3A 2EZ4A 1HEYA 1RHQA 3PHCA 5AQ1A 1Z9BA 1ML4A 2GRQB 1QYWA 4RTNA 3TSYA 2DEUA 2KM4A 2F43B 3VKUA 5BQ3A 3DZCA 1T8WA 4KNWA 3QNKA 5AD1A 4NZNA 2ZYIA 3NM5A 2IDMA 1DEKA 5F4BA 3LBHA 2CJWB 1B73A 2FKNA 3QW2A 3CZ4A 1SHLA 1BH2A 3Q11A 2FWAA 2PT6A 3W5CA 2J46A 2QGZA 2R66A 3BRWD 5FJJA 5KYXA 1VYUA 2AQIA 5ANRB 4YPFA 1RLMA 1O2DA 1RJWA 4R51A 4JT9A 3QWFA 4D9EA 4LXGA 3ZZUA 1W0KA 3VZDA 2JCYA 3QC1A 5J5CA 1KBOA 4BFYA 1RLJA 2R7AA 1LQ2A 5EKDA 1OXVA 3KTAB 5H4GA 4Q03A 5ESXA 2NX2A 3DT8A 4DYVA 5FD8A 5ALEA 4F1PA 2QTZA 2I5PO 4R7LA 2O2ZA 1ZCFA 2ZBGA 2X8BA 3DBRA 1PWYE 2OFOA 3K05A 3U3WA 4AWAA 3EGXA 2ZRKA 4LNUD 4M21A 1KZ9A 3H2HA 1UBSB 5KOHB 3E3MA 2WRZA 2YZ7A 2HMUA 2HWUA 2HWWA 3NCTA 3KKPA 1WX1A 5MN5A 3RJVA 3TSZA 1H22A 5BW4A 1VL6A 2QMUA 3QFHA 4HDNB 2NADA 1U7HA 2I4IA 2OC9A 5F51A 1P2DA 2AVDA 2OQRA 3TECE 1A8UA 4EPTA 4PS8A 4KKXB 5HDQA 4FZ5A 4G5SA 4A91A 2V7PA 4FTWA 3VAYA 2PEZA 3TRKA 4FN5A 4ZHBA 4IIYA 4U00A 5FNVB 3WADA 5YASA 1D1QA 4PNPA 3ZY5A 4MAFA 1ZINA 2X7XA 3S7BA 1Y9DA 3K0FB 4ENQA 2WD7A 1DBRA 3IHLA 1NJFA 3EGOA 2DH5A 2V4ZA 3WK5A 3L4BC 3CIAA 4FNAA 2HDWA 3ZI0A 3GPCA 3HGMA 1AZWA 5C8VA 2YOGA 1ORDA 3CMCO 4N76A 3UT8A 2W2KA 4K6CA 2C83A 3J81A 4HXEB 1AKUA 4I9EA 3AUKA 1R5OA 4QDOA 4PCUA 1RWQA 4GVLA 3BFVA 4JHLA 4J8YA 4ZJUA 3GCDA 3GUYA 1XA4A 3RTBA 1G7SA 1DO8A 2P9NG 3ABQB 1SHZA 5LZ2A 1JV2B 4I5EA 5MGNA 4WX2B 1E0KA 2QLNA 2WKQA 3R7SA 2JI7A 2Q3DA 1UCFA 4Z49A 4HX5A 2FLWA 2FEPA 2X4IA 2V5QC 3U48A 5K3OA 2XI4A 2GNPA 3L43A 4JBWA 4LY6A 4O60A 1U5BB 2JAWA 3CZAA 1PCXA 4PS3A 1CY6A 2RGWA 4NFHA 5F23A 3STYA 3ECCA 4GEKA 5SY9A 1IWBB 2FBNA 1VI6A 4B0ZA 2ADMA 1TO1E 1AXGA 4UJ5A 3TD6A 4KXFB 2HMSA 3V8EA 3NEAA 1MNQA 2EVWX 5TPZD 4F1KA 3ESRA 4E3WA 3OC6A 1EE2A 3FU5A 3RBAA 1RCFA 1S2OA 2NYVA 5J63A 4NG5A 4AM9A 5BWNA 5IANA 1Q3KA 2GARA 1KI3A 4R83A 2JBHA 3WQSB 1QIHA 1X0XA 2ZUBA 3VU1A 2Q9BA 4BBAA 2P35A 1T1EA 4FJ0A 1N5JA 2WXRA 1RJDA 4LHWA 4LF9B 4GWLA 1ND5A 3UT0A 3QOYA 1W0JD 3VA7A 4HVAA 3JS5A 2ECPA 2QQEA 1W75A 4O6VA 1S7GA 4BQIA 3C5EA 5CX1A 1W5AA 4FONA 1O89A 4TMFA 5A2QA 4NF2A 1SQFA 3DAFA 5AVVA 1GKKA 3EWIA 4NV3A 2PX6A 4YH1A 4XDGA 4RKRA 3AIOA 5AP9A 2FCAA 2W93A 3QKSA 4QTUB 3BD7A 4DQXA 3PZ3A 3O2SB 4LC0A 4D92A 3CH6A 3VISA 4RTKA 5I8ZA 2QWXA 2LNDA 1OGJA 1IWPB 2B9EA 3CLSD 3V8MA 1U0SY 4OXIA 4AJ4A 2AZMA 4C6SA 2OG1A 5IN5A 2HJGA 2OK7A 4JA9A 2I8CA 4F0JA 3UAZA 3BTUA 3L1HA 4N0DA 1JJ7A 5FF9A 2BSXA 4QXOA 4EMBA 4ARUA 1BAPA 1ZYUA 5AXBA 2MSCB 4D5GA 1KGSA 2V8SE 3LNCA 2YOFA 2WLTA 5C1PA 3D8HA 4DL9A 3W77A 1L7DA 3JD4A 2JI6A 1OJ7A 4NS1A 3B1VA 3ZHYA 16PKA 3TAUA 1QTNA 4YK7A 2NYUA 2XRYA 1WUTA 1G6OA 2AK3A 1NDUA 1ECGA 1Z0ZA 5EY5B 2C3YA 3JSXA 2Z9BA 2AEEA 1YQEA 3EXG2 2FAXA 1WVIA 2ZR0A 3ZWWA 3AG5A 5GJWC 1A04A 4BYMA 5JPCA 3SMVA 2H9YA 3FR8A 1Q17A 5DRTA 4O1HA 2QSUA 2IYNA 5EZYF 1ZUNB 2BM8A 1J06A 2EFJA 1ZJZA 2LD4A 2X5XA 4QC2A 3AW8A 3TRIA 4PX9A 1NP3A 2A0KA 1MX1A 4F9FA 2XQ0A 3UBTA 1J97A 3FTZA 5TJHA 2Y66A 3I1FA 2V54A 1DJMA 3BB4A 4KREA 2NOAA 3AJ9A 3H2JA 4U7GA 4Q19A 5G3ZA 5G4KA 3IS3A 4PAQA 3OXFA