4K03A

Crystal structure of drosophila cryprochrome
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
534
structure length
529
Chain Sequence
RGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
molecule keywords Cryptochrome-1
total genus 163
structure length 529
sequence length 534
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4k03A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4k03A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4k03A01
3VGJA 4ZT3A 2CV1A 1LI7A 4F3RA 2J4DA 1COZA 1M8FA 2NSYA 4EG1A 2WQ6A 4DDMA 1BS2A 1N2IA 4EG7A 1J21A 3HFJA 1NUSA 3RFFA 4EG8A 4KKVA 3E27A 2CSXA 1SURA 4R2MA 3X1MA 3TZEA 4PBSA 4CDNA 4JZYA 3DO8A 2X1LA 1M1ZA 1N2BA 5TS2A 2WB2A 1VBKA 2GKSA 2HZ7A 3DV2A 1F7UA 1Q11A 4MVYA 4MW2A 1OWMA 3G59A 2DXIA 2QTNA 4ZCRA 3CLSC 1R6UA 1EFVA 3GLVA 1Q77A 2PFSA 1J1UA 4ZCQA 5H7XA 1QNFA 3COVA 3TZLA 4K0RA 2B7LA 4JYZA 3COYA 3TS1A 1GN8A 3IOCA 2EL7A 4EGAA 3AKZA 1TEZA 1U0BB 4KR7A 3HZRA 1O96B 3Q12A 3MLAA 2AG6A 1JIIA 2A84A 3K9WA 1T6XA 2PZBA 2PZ8A 4P2BA 3C8ZA 3D6VA 1I2DA 3TNJA 1MAWA 3IDFA 1QRSA 4QREA 2ZP1A 4DLPA 4I6EA 3LCJA 4ZT7A 4MUNA 4I6GA 1H3EA 4MWBA 3CVYA 3ZJUA 3ND6A 1IQUA 3COZA 5J59A 1ZH0A 1G8HA 2A1TR 4EFKA 2VTBA 1N2GA 4TS1A 1JEEA 1MC1A 4NATA 3UOWA 2PXHA 5LLTA 1N78A 1HYBA 3ZXSA 1MOPA 3NBKA 1KQNA 3M5WA 1NUPA 3CLTD 1ULHA 4G5FA 4ZCPA 1XJQA 1LI5A 5EKDA 1KH2A 3UC5A 3KT0A 4MW6A 2WSIA 1O0CA 3ZGZA 3UY4A 4DNXA 4MUGA 4MUHA 2OV4A 2CYAA 1EUYA 3QTBA 2AKEA 3AG6A 3MLBA 1QU2A 1G8FA 3QTTA 2Z3VA 4MUFA 5HUHA 3LE8A 1RQGA 1O97D 1VLHA 1OWNA 1XNHA 4EF6A 1T6ZA 4NZPA 4KPUB 1TYBE 2A4MA 4YP7A 5HUJA 1O96A 1EFPA 4MW5A 1IRXA 3CLUD 1YIDA 4NAUA 3FG9A 2V0CA 3FH0A 3ND7A 3F3MA 3SEQA 2CFOA 4DDKA 1TYAE 5KCMA 3KT8A 3IOBA 4MUIA 3SP1A 2V0GA 4MW1A 2PIDA 3PXUA 3P52A 5K0SA 3ILVA 4RUKA 2NZ2A 1ILEA 2YWCA 4MVCA 5F23A 2E89A 1N77A 4AS1A 4MUKA 1GAXA 3D6UA 3IMCA 2D5BA 1O95C 2AZXA 4PBTA 4XFJA 5DB4A 3UMVA 3K32A 1KH1A 5JBNA 1IQRA 3ZUGA 4YMIA 2X1MA 3PNVA 3ELBA 3P0JA 3KFLA 2A88A 3FI0A 3FY4A 1U7XA 2WQ7A 1IH8A 1LW7A 3A04A 1YULA 3DPIA 1O94D 3ZXIA 3N9IA 3L93A 1J1ZA 3MMXA 4QRDA 1JIKA 3FIUA 2RD2A 3CR8A 4WNYA 3IUEA 4ZT5A 1T6YA 1JMVA 1NYLA 2J08A 2CYCA 5J5AA 4MUEA 1K92A 3GUZA 5DK4A 3G5AA 4ZCTA 2H2AA 3ZIUA 1GTRA 4JFAA 2QUIA 2VXOA 1NUUA 1M8JA 1CT9A 4FZJA 1QQTA 3PRHA 2J5BA 4ARCA 2CV2A 1O97C 1IQ0A 1OWLA 1OWOA 4ND7A 4EG4A 1JECA 1O0BA 1N1DA 2A1UA 5H16A 4MVWA 1I6LA 1GZUA 1T9GR 3N05A 3AL0C 4AQ7A 1MB2A 3FETA 4YBRA 4OUDB 1MBZA 5AHWA 1VBMA 2QTMA 1JGTA 3FHJA 3VU8A 1J20A 2PZAA 3AFHA 1X8XA 3BL5A 2I1LA 1XNGA 1WOYA 2PG3A 2QUHA 1KAQA 2J09A 4U7JA 4K03A 4DJAA 3U1VA 1U7DA 5DEOA 1ZJWA 5IHXA 1MB9A 3HV0A 3SYTA 5LFAA 1M8GA 1F4LA 2HGZA 3FDXA 2DR2A 3H9BA 1R6TA 1TFUA 2GOYA 3X1KA 3N8HA 4UZEA 2BTEA 1N2HA 4Q16A 1IHOA 4GU5A 3OTWA 1WY5A 2R5WA 1M8KA 4J75A 4PY2A 4U63A 1NUTA 2QUKA 2E21A 3IMEA 2X3FA 3TQIA 1F7VA 4GRIA 5FO0A 3FOCA 3NBAA 4NAHA 5FO1A 3ZJTA 3H9CA 5KWVA 1TQ8A 1V47A 1UFVA 4L2IB 1O94C 4A91A 1PFYA 3HMQA 2O5RA 4R0NA 2C5SA 2IELA 3IVGA 3ISJA 3Q10A 4BWVA 1J70A 1EE1A 1NSYA 1OBCA 4ZT6A 1YUNA 2A1UB 3FWKA 1Q19A 1MJHA 1TYCA 1H3FA 4DDHA 1G8GA 1O5TA 3IVXA 1Q15A 5TEWA 3MUEA 2O8VA 1O6BA 1WXGA 2D13A 1KR2A 1V8FA 1XNJA 3H99A 3ND5A 1PFVA 1P7PA 1ZUNA 4H3SA 2CV0A 1R6XA 1IVSA 4MW9A 2RE8A 4I6JA 1NI5A 4HJRA 4MWCA 4YP6A 4MQ6A 3CLRD 4EG5A 1GTSA 2XRZA 4F4HA 1KORA 1QRUA 4WSOA 1K4KA 4Q93A 2Z09A 5LM3A 3A05A 1MRZA 2HMAA 4MLPA 3CLRC 4HK4A 3SZ3A 3VRHA 4G6ZA 1KQOA 3AIIA 2DETA 1A8HA 3RJZA 3CVVA 2A1TS 5TGTA 5BNZA 1PG0A 1NURA 2D54A 1JZQA 4KPUA 1K4MA 2TS1A 4OJMX 1YUMA 4ND6A 3A2KA 3OP1A 3NV7A 4HJXA 1WQ4A 3MXTA 4NDAA 1JZSA 1KAMA 1WQ3A 4MWDA 1OD6A 1WXIA 2JANA 1VL2A 1QU3A 1M8PA 3IH5A 3TQOA 2E0IA 1U3CA 3CVWA 1WJGA 4MVXA 5HG0A 1I6KA 1U3DA 1YIAA 4ZCSA 2JAXA 2A7XA 4KR6A 3DLAA 2A86A 1EFVB 3SEZA 3CVXA 4CT0A 4R2LA 1WZ2A 4HPWA 1QJCA 4L2IA 1T9GS 2QUJA 1QTQA 4MULA 4MW4A 3X1JA 4QBTA 3KT6A 3SZGA 4MW0A 1WXHA 2DERA 1FYDA 1GLNA 2DUMA 1B6TA 3S3TA 3SDBA 2YWBA 3RHSA 3L92A 1KP2A 1KKUA 4PBRA 1WKBA 3RK1A 1KH3A 2X0KA 1I6MA 1JHDA 3IMGA 3GMIA 4J76A 5IJXA 1G59A 4RPIA 4OUDA 3RBAA 2ZUEA 1JIJA 3HGMA 3H05A 2E18A 5TEVA 1NZJA 1TYDE 1S4MA 5DASA 1M83A 1VBNA 4MUJA 4CQNA 3INNA 3G6KA 1N75A 2CYBA 3N2YA 3CA8A 4S1OA 2JA2A 5J58A 1WXEA 2CUZA 2DEUA 3IUBA 1N2JA 1FFYA 4G5YA 1MAUA 3IVCA 4EG6A 1NP7A 3PNYA 3AG5A 3KT3A 4KR9A 3HL4A 2IJGX 3P0IA 2J07A 2DLCX 4MWEA 1X6VA 4NX2A 4E1AA 3I05A 4MAFA 3H97A 1EXDA 1N2OA 2H29A 4CDMA 4EG3A 1EFPB 3Q4GA 2EJCA 4JXXA 1J09A 4ZT2A 5K0TA 1KP3A 3COWA 3PNBA 4XSVA 4X0EA 2ZUFA 3RK0A 2G36A 1YI8A 2QJFA 1PG2A 1K97A 1N2EA 2BYTA 1F9AA 3CVUA 1OBHA 1PFUA 4ARIA 3A4IA 1Y42X 1WXFA 2QJOA 2GM3A 2QTRA 3ZJVA 4XFDA 4U8HA 1KQPA 2CT8A 2OQ2A 1DNPA 2YXNA 2QJTA 1GPMA 3P0HA 3UK2A 1N3LA 2IP1A 2DPLA 2YY5A 1EJ2A 4ZT4A 3CLUC 1EUQA 3LOQA 1JILA 5KHAA 1QRTA 4JXZA 4YP5A 3FNRA 1H3NA 1D2RA 1IFXA 2XRYA 2VTBB 1JEDA 2Z08A 1O95D 3IODA 1ZH6A 1H1TA 4MW7A 1OWPA 1PFWA 4DE5A 3QE4A 3CLTC 5FNZA 3CLSD 1NUQA 3JXEA 4UZFA 3IOEA
chains in the Genus database with same CATH superfamily
3BSWA 1OIVA 5IN5A 2ZT8A 1X1SA 2AYYA 4YYZA 2ACKA 3DCYA 5DBEX 4A7PA 5IH7A 1V26A 3GVHA 4HNAA 5D7NA 3M3HA 4ZVVA 5AQ9A 4LERA 4L6IA 4YHHB 5G55A 2D5LA 2R8EA 5IJ0A 1QP4A 4EG8A 4R2XA 2C3PA 4EZLA 1VJRA 3DCJA 2PR2A 5HILA 1O77A 4QQKA 3UYKA 1OXJA 2I03A 3GX1A 4FN5A 3ETCA 1U2VG 2GTIA 1EP3B 4HXEB 4QUKA 4C2BA 5JFGA 1ELWA 3RIXA 4CQJA 4EO9A 1Y4ZA 4CDNA 4QE3A 3RVKA 1UMBB 1OZFA 4YQZA 2G4CA 5BMVA 1A7AA 1NI1A 3G9UA 3HRKA 2AEFA 1NOKA 4YROA 4FQ7A 3W6PA 2NUTB 5JXGA 2ZWVA 3G59A 1P1IA 1RMTA 5FHQA 1D2HA 2WR8A 2PFSA 4OXKA 4M9CA 4H7EA 1J1UA 1HNXB 4FJ1A 2ZRPA 3MCTA 3A1SA 1CVRA 2WHQA 3MRSA 4BMOB 2A9JA 5AESA 5AVSA 3ESLA 2JFFA 3KOOA 1J8MF 1KBQA 4A1GA 2AG1A 3B3AA 3COYA 4GMKA 3PXGA 4UTPA 1KOLA 5JPIA 2WTBA 2OECA 2HA2A 1HDYA 3ZLUA 4HNAD 2XCRB 1Z5WA 3HJTA 3K8QA 3SR3A 3IXQA 5KOYA 3DBIA 1G8SA 2YS7A 2PLFA 2X15A 2AG6A 4AXBA 1OOEA 2LXNA 1WG0A 4LRSB 4LY9A 4PO1A 2E55A 4JP3A 5FJYA 5G04C 4KN8A 4HGZA 2X4GA 3PQ7A 4TOIA 3UCEA 3JQ8A 1G5RA 3QPUA 5GAJA 3AI3A 4R7ZA 2PMEA 4TWIA 4YEDA 4YVFA 3TLYA 3VH1A 2IYUA 1GAJA 4GYOA 1BMTA 4C4AA 3DE3X 3C4VA 3PZRA 3Q2OA 1E4OA 3QEOA 2A1TR 3V3KA 3U80A 5D3KA 3JQDA 3RIEA 9LDBA 1FQJA 1ECPA 3K5PA 4Z0HO 2RK6A 4QD3A 2ILVA 1ZNQO 3G2VA 1VCMA 3U7IA 1RJGA 3F6BX 1ZUHA 1LJ8A 4A3VA 5BURA 2W7TA 3EVZA 3QAQA 4BV8A 3QU7A 4OI2A 4CYMD 2I65A 2YZ2A 3QVKA 4G5GA 5F52A 3W8EA 4JB8A 5ALXA 3KYBA 4JELA 5EN5D 3UQYS 1DXQA 1SHLA 1W2GA 2C98A 4RQTA 2MYUA 3A6JA 3VNVA 5AJWA 1LF0A 1U7PA 3OE7D 2Q6OA 4HF7A 1N9ZA 4TT3A 4ZVLA 4B3SB 3LHDA 1ZNWA 3BFKA 2O9JA 4I4TB 4QIHA 1U0LA 3VAZA 1U9YA 2QZSA 5KAMA 3AFIA 1BCRA 3KR0A 3TB4A 3WAJA 5GPBA 1G3NB 1SZPA 3JQQA 3ISVA 4X3OA 5T57A 2X0NA 1V6CA 1IWBB 3L0IB 5M04A 1RQGA 2PQ0A 3GAFA 3Q49B 2IVFA 3PUXA 3ZK9A 1QVZA 4E4YA 3OEYA 5FEUA 5LQKA 4N49A 2C4MA 2GLUA 3T4XA 3FVQA 3HK2A 4UUCA 1L1EA 3EJWA 2XPZA 3KV3O 4M0FA 5AIAA 3PR2B 3RAJA 2FR8A 3BMXA 4RKWA 1RWXA 1S6YA 4XIJA 4U2DA 3S28A 4XKBA 3H0KA 1A77A 5ENOD 1UPAA 1QFZA 1YIDA 2HV8A 4NAUA 3P0RA 4QO7A 1CZLA 5ALOA 5LBIA 5EQJB 2CN1A 3SJCA 5CDYA 1Y8AA 1GTMA 1JLLA 2A5UA 1PE0A 3DDSA 5CD9A 1Z3XA 1ZU2A 2VZEA 3O3NB 2XI4A 5ECDA 1Z4OA 2HK6A 3OHPA 4G3XA 2OA0A 3SEQA 3T3MB 1ADJA 5IZ4A 1R9JA 1QNLA 1S2GA 3O31A 4L5CA 5I9MA 1HOTA 5K3CA 3WDKA 1IONA 4EPZA 1ZZEA 2OOSA 1TD9A 4TMTA 3SP1A 2J5KA 3W1VA 4DN6A 4F3RA 3ODPA 5JFTA 2BM0A 4IWXA 3EYAA 3EMVA 4MS3B 2W6PA 2K4MA 4RJLA 2C82A 3VR2D 3D54D 4AZTA 3ONWA 4B09A 1C1XB 3UTCA 2WVHA 3C6QA 1YCHA 5K3AA 1V37A 1NVAA 3L9WA 4I55A 1AKEA 4LZOA 3H2HA 5CT5A 4K9KA 3VYWA 2A0UA 2ZETA 4DDTA 3ZUPA 2WUVA 3W3AA 1KH1A 1IBSA 5JBNA 1Q1NA 4J16A 4DS3A 4HEJA 4IHJB 2CLEB 1B0PA 1OXXK 2GXUA 5FADA 3PNVA 5K3FB 3P0JA 1IN8A 2QG4A 3DVQX 1LNSA 3IVMA 3FI0A 2VSXA 1L8QA 1JLLB 2R59A 3EIEA 3IUJA 5FIUA 3VZDA 2WDZA 4PV7A 1Z0ZA 3A04A 1YE8A 2SICE 1E5LA 1XC7A 4WK4B 2O2CA 3B12A 3PXDA 3F3YA 3UENA 4A03A 3DEYX 3L93A 4XPIA 5F1KA 1N77A 3IOMA 2PX8A 1X7XA 3AIOA 5FV4A 2OHVA 3C3JA 4MIEA 1XTQA 3LBAA 2YIDA 3UA3A 3CZMA 4F11A 2IUEA 3HXLA 3O8NA 5AM2A 2XWQA 2J08A 5JYBA 3OJWA 4D25A 3UPDA 4D44A 4XX0B 4KDEA 2WWYA 1BVYF 5LB4A 1JYEA 4F45A 4XYLA 1TLFA 2D2XA 4F3YA 2HW8A 3GOQA 2VK4A 2AXVA 4FPXA 4P4NA 3S1AA 2O50A 1M7BA 2HA3A 2IHKA 1XEWY 3B3JA 4M1MA 4KGXA 3OT4A 3EWIA 4ZDKA 1M8JA 2F3SA 3S44A 3L8CA 5JQGF 2F7SA 1VLQA 4TL8A 4WKPA 2CNWD 4Y67A 3VU3A 1EK6A 1DO2A 3LKUA 1U8EA 3JQFA 1W5EA 4IRMA 3TLAA 4BC0A 2C7QA 1NP6A 1BXKA 1TOAA 2VK8A 3LLMA 3NPMA 4R16A 3NVKI 1OWOA 3ESCA 3IHLA 1PS0A 1YS2X 1D6NA 4JU8A 4W5HA 1FXWF 4FFVA 3A6FA 3SYMA 5IT9A 4ETNA 2BHTA 4GI3A 5BXOA 3SIXA 2BOVA 2Q5FA 3CG0A 4NYJR 1D9SA 5HS0A 2PX3A 1KPIA 4H6WA 4YWJA 4AP9A 3SE0A 1TU3A 3JARB 4YP9A 4JAVC 4DR2B 5HVNA 1VKOA 3WMEA 2RGCA 1JXQA 1E3JA 4EAAA 2WJ4A 1RLJA 3WG9A 1QBQA 1QQ7A 2HDHA 1K8ZB 5IBCA 3TBHA 3G1TA 2CD7A 1X42A 3W5SA 4KNWA 2ILRA 3QKYA 2X9GA 3HV0A 4BT8A 2HH9A 3MMNA 4GIBA 3SYTA 4AT1A 5DNUA 1SELA 2ZBRA 2XWSA 1BQ3A 1SXPA 2GRLA 1RXVA 1XD9A 3F46A 3WZLA 3BREA 1S96A 3ZWYA 1KZGB 4J16C 1NJ2A 3BOSA 3WL3A 4Q16A 3IYLW 6AT1A 2BFPA 4DIUA 2APJA 1VJCA 3DE5X 2ZVPX 2XTAA 2FHSA 1TZMA 4U63A 3HHPA 3NOQA 2EF1A 4NCJA 3TQIA 5AOAA 1ULZA 2QU8A 3NOXA 4GI1A 5J23A 2QFCA 4P4LA 2CHZA 2XENA 1OCZE 3UWPA 4CT4A 2ZJ3A 1Y7HA 2PUFA 4XWGA 4KZCA 3L4JA 1D4AA 1RAAA 2UZIR 1R0BA 4HRXA 4PWZA 4ZOCA 3VKVA 4AWXA 4QECA 3T3HA 1S7GA 2R62A 2C8JA 1E1NA 2V3CC 1D09A 4YMGA 3WKBA 4N47A 3RHZA 1PJ3A 2QYUA 3OQOA 2QY7A 5SZHB 1SHTX 1J70A 5C8YA 4D9KA 4S05A 3MYYA 1CR0A 1NNI1 2GN4A 4CWAA 4CKWA 3U61B 1J0AA 4IHJF 2NYAA 3QWAA 1CY0A 5TQ2A 4NBUA 5DGHA 1M73E 3HGTA 3DGFC 1G9XA 4RACA 1CZUA 3MJEA 2B5OA 3HY4A 1XD8A 1P75A 3FVWA 1J97A 1XG5A 3KR9A 2F9FA 5C37A 1EVKA 2HIMA 4LYHA 4B7CA 5INTA 2XMGA 1PFVA 3AU4A 3ROTA 5CXQA 2AJ8A 4LJ6A 2MSDB 1P7PA 4DQVA 4DR6B 4J9UE 1XWFA 1G59A 2W8ZA 3EB9A 2O2JA 3KZVA 4TV8A 3VAAA 5KYKA 1A5ZA 3EDOA 4I6JA 3PWZA 4NENB 3B1VA 2OQRA 1E2IA 5HKOA 3QYAA 1RAEA 5A03A 2ZYRA 3CLRD 3N8NA 3OOHA 3U3MA 4ZTUB 4FYMA 3HUEA 3PUWA 3FTSA 2YZMA 3K1AA 4IXWA 3C45A 1FFAA 3OIDA 4NYMR 2CNKA 2I4IA 1JF8A 2KI5A 3P4YA 4FNGA 4IJWA 4RV9A 2XXAB 1D8DA 4W7SA 1KE2A 1LFAA 2LP4Y 3PFWO 4ZO8A 3OTNA 4I9CA 3DEZA 3F5DA 1HE2A 3DMHA 3IQGX 3KRTA 4JU9A 2G04A 3CEHA 4M1QA 5AI9A 1PUXA 1VL1A 1VL8A 1JR3A 4KU4A 3MJHA 2A1TS 1PDVA 1ZC4A 4GMHA 3K73O 2CNDA 1WSAA 3U4GA 4O4HB 2HMSA 3ZE1B 3EXG1 1NE7A 1HE3A 5FQ4A 4W1PA 1Y8ZA 3T4PA 2IS6A 3QEKA 1H8HA 3EXFB 2XHEA 2Q62A 3G88A 4BX2A 2VUSA 3V9PA 1G17A 4YV0A 3I2KA 1SU6A 2PBLA 4RTQA 3KB6A 1E3QA 3NV7A 2QTFA 2J67A 1BMQA 2I6SA 4BZPA 3JUEA 2IDMA 3KEFA 2EX0A 2JANA 2EFDB 1NJGA 1MABA 1QMPA 3IBSA 1N9GA 5ANRB 4ML3A 4C9BB 3KHUA 3STYA 5ADVA 2VNAA 2Y27A 4DV4B 4OO3A 2XTJA 5CCXA 4HAVA 2HI0A 4R0VA 2PZIA 4MVXA 3P9SA 2IZ7A 3L8HA 1WMFA 2BCJQ 1VJTA 2I22A 2JD0A 2A0WA 2PSFA 3BFPA 2P4SA 3LLUA 4IJQA 1KYIA 1RLMA 2XCUA 4FLHA 1SBZA 2OPHA 4ANFA 3TFOA 2GSWA 2FPIB 2IZ6A 1R5BA 4P80A 2IPLA 5ESWA 3PX2A 1JA1A 4LJYA 4DJEC 3C8HA 2W4MA 4V1CA 4PYLA 2P3LA 3CU5A 2JABA 1HR0B 2C4TA 5IJZA 2R2AA 3ZDYB 4JVLA 3VR3D 3QVXA 2YJGA 1LSUA 1AP7A 1MAHA 1YKFA 2I6QA 2ZSKA 3IV9A 3L0OA 4ITUA 4QBTA 4TXPA 3DBHA 3HLTA 1DV2A 3MPUA 1A9XA 4FGKA 1NJ1A 1XEFA 2WTNA 3BMQB 1FYDA 2PUWA 4GS5A 4Z3OA 5E1BA 4O2BB 1D5CA 1Q14A 4JT2A 4CETA 3VNUA 1YHZA 2JNWA 1VQ1A 4I19A 2RH5A 4H0NA 3TVYA 1IOZA 1JNYA 3HLYA 1I6MA 1EJ0A 4A63B 4JBYA 3MSXA 5KIAA 1Y5LA 2J4FA 3BB4A 4J76A 4DIOA 4FX2A 2VA8A 4UTXA 2C2MA 3BH6A 2JZCA 4OHCA 4C78A 2EX1A 3FH7A 3GZ1A 1KO5A 3AOGA 3H05A 4I9EA 3KS9A 5ANLA 2O6HA 4QDJA 5TQ0B 3VVCA 2GO1A 2R85A 1VKHA 2EEZA 3K7EA 1MX2A 5CCLA 4OQEA 1M0SA 1VPVA 2DPHA 4Q05A 2XUOA 4UUPA 1XMPA 4X1KB 4YRPA 4A0FA 1WM1A 4OHZA 1XCLA 3A58B 3JQEA 3OZUA 4XDZA 3AVXA 4KAAA 4C5BA 1S3FA 1SC6A 4W7IA 5EIHA 4YJDA 6GPBA 2C77A 1E7WA 3DE0X 3OBIA 4LF4B 1X7WA 4UXIA 3HVJA 2CE2X 4JR1A 1U02A 5CBOA 1YT5A 1FFYA 4XIFA 3OO1A 4ATGA 4B2LA 4BMSA 3O94A 3N5KA 3C6KA 4B89A 1N4DA 4TXQA 1HYEA 2AMYA 3MTDA 3I30X 3T3EA 2HREA 4KLAA 1SUWA 3ZI4A 5IUNC 1AIPA 2WWIA 4NMLA 4F91B 1QZ2A 3UPVA 3D8UA 4M21A 4UNIA 4F6CA 1YQXA 4NULA 2I2BA 2PFKA 2XRMA 3ZC3A 4W5OA 2IBMA 5EE9A 1X6VA 1KGDA 4BP9A 4N3AA 2H1LA 1PDWA 5CB8A 4H7KA 4HDNB 1TM3E 2MYOA 4JKIA 5DI9A 4Q9JA 2NXWA 5D1HA 5FZQA 4PANA 4E22A 1N2OA 1B0AA 2EKDA 1NQTA 3EZGA 4YALA 5DFAA 121PA 4YT5A 2EJCA 2VPIA 4S1WA 1W36B 2Q9AA 1K9VF 1I10A 3LUHA 5FYQA 3KAEA 3JVVA 3MFQA 2D1TA 2JI4A 1E60A 3DFZA 3QE3A 1H2EA 2D1FA 4D0RA 4D46A 3PRZA 1PRYA 2HPZA 3WA6A 4X62B 4E6PA 4JB3A 4UI9J 3FZNA 4TLDA 4XWKA 1F1BA 2BYTA 3TWTA 4C48B 3UVEA 4TRJA 4TZ6A 2AZ4A 4DLYA 3ZLVA 1KZ7B 2ETVA 2HIGA 5TC4A 3KXPA 5IKPA 3BDIA 4O2AB 4U2CA 1LX6A 1GRQA 3I2HA 3OWXA 3ZWKA 3PPVA 4JGIA 1LTKA 1L5GB 5C9ZA 1BFUA 2QRVB 3FMFA 3MZ0A 4B73A 4OP1A 1CD5A 3VR1A 4CKCA 3EHMA 2QI9F 2XHZA 3HFRA 1GSHA 2XQIA 3FYUA 4N8EA 4WV3A 5SY9A 5FUYA 3DRAA 4UHJA 5E6UA 5EE1A 3JU3A 3PJRA 2CFRA 4RH1A 1PW5A 3VX4A 4EYSA 2CUNA 3GHYA 3NANA 5BSHA 1QV7A 1KEZA 4E5SA 2AX3A 2LGJA 1E1KA 2WZBA 4UBOA 1HG5A 3H17A 2DF8A 3FU3A 2INGX 3SSNA 2XEDA 4EVSA 5FAKA 1KU0A 2OLEA 3KYCB 1NMXA 4R9UC 4WXRA 4ZO7A 3BWYA 1RPAA 1UL1X 1A9TA 3A1WA 2B83A 3JALB 3ETEA 2ZYDA 1ZOIA 3KXLA 4KMMA 5ARCA 1ZJJA 1UFKA 2XRYA 4CEMA 1A98A 1YD7A 3WL4A 2PMFA 2Y2VA 5ILQA 3ZE7A 3W8FA 5JECA 1RYNA 4J0FA 3ES9A 1DHTA 2Z5VA 1O4VA 3OWOA 4BU1A 4IYPA 3LQ2A 3QE4A 3WLAA 1ENZA 1MHQA 3CN9A 3KAPA 3K96A 4D4JA 4F21A 1G6KA 1U4OA 2C88A 3CLTC 1SZAA 3GC6A 5CG2A 1YK0A 2GCOA 4LNUB 3AVOA 2ATCA 2F8TA 2HYZA 4G11A 3TZ6A 4B3MB 3D6HA 3H2GA 3SHFA 3IKJA 1B16A 2PBRA 3L8EA 1YQEA 4HUQB 4DIDA 4GL4A 5HM6A 4BMVA 1RU3A 4ZU3A 3E2MA 3RAFC 1C0PA 3SO8A 1NWHA 3IO3A 4QTTB 2ZSDA 3DUWA 5D85A 2CJXA 3PZBA 4FGWA 3MKRA 1MQSA 3OFSA 3R7WA 1H0HA 3E27A 1PZXA 4HFMA 3FBGA 3RVBA 5IUKC 1QE0A 3FUEA 3HN2A 3WLNA 5KYGA 1DOHA 1L6IA 1OBVA 2HXYA 1T5TA 1E5DA 3F78A 5FULA 2IEZA 5AW7A 3KKQA 3NIBA 3PWKA 1YC2A 3MJTA 3LY7A 2MYPA 4X8QA 3HR8A 1NAHA 3LPAA 3Q1LA 4J1NA 4OHRA 3W6ZA 4F9GA 4HRVA 2L9BA 3O48A 4EECA 1OX5A 4IY1A 4QPDA 5I5GA 4UTOA 5F51A 1VHLA 1KMNA 1GKIA 2V7EA 1XD2B 1T9AA 4TUYA 1NUHA 1XMOB 2AWIA 3AJRA 5DTJA 2GX6A 3PHGA 2OQVA 2O8CA 1Q77A 1HDIA 4JH0A 4OA8A 3FGOA 4AUNA 3EWNA 3VZSA 1T10A 2GA9A 2JC3A 2Q3CA 3RDPA 4GRDA 4JYZA 1VKJA 2XB4A 2YQZA 3C2QA 3CZQA 1VA4A 4DVJA 4M1WA 2W42A 4DLXA 4FGZA 3WNQA 4BP1A 1OGYA 2Q5JA 3WIUA 1XU4A 4CR8A 4EPTA 3GLKA 2C2BA 2Q3DA 3GCGA 2PUBA 3DVLA 3ZCUA 5CB4B 2H63A 1B00A 1I4WA 1TN8A 3BJEA 2A9QA 3IQHX 5E0KB 4BNYA 3JWPA 3R7WB 2F8MA 2BMVA 2H5JA 4BJ3A 2LAIA 5BVGB 4DV0B 1QRSA 3K09A 2X38A 4HBZA 2F8XK 1ZO8A 1ZBQA 3VTXA 2QA5A 3F9RA 5BW6B 4BY6A 3AETA 4TS9A 3HYNA 4AZ0A 4DAEA 1RJ9A 4PLWA 4DR5B 4MHSA 4QGFA 4YC7A 3SLKA 5JJCA 2ZI7A 1JQBA 4A8JB 2C00A 3S40A 3L07A 1XRRA 2B36A 2XCLA 2ZI6A 1JEEA 3DEKA 3D2CA 2RHDA 4X3CA 3WHKA 3NHPA 3FFLA 4YUYA 3ZNGA 2YXBA 3ZXSA 1G41A 1XHFA 2OM2A 2YFHA 3PIRA 4GWKA 3NATA 3ORQA 4MP8A 4B74A 5KCZA 4F84A 1N4AA 3TM5A 2FW7A 1WHSB 3HZZA 1ZMTA 3TTSA 1GG9A 2HF2A 3GLUA 4RVSA 2RARA 4QFVA 2G4VA 3DW3X 4M7OA 4DDWA 1GPKA 4C4OA 3OZBA 1QX3A 2RHMA 3DOUA 4MB2A 4AU1A 4DCSA 2WQZA 4NONA 3WDSA 4FHZA 1FX0B 1BRTA 4W5JA 4DCMA 4HXGA 1F6DA 1BEEA 3PD1A 1ZCZA 3DBLA 1RADA 3G9QA 1H23A 4OXNA 2O4UX 2Q6IA 1DP4A 5CH8A 4EX7A 1E0DA 5LDHA 4HDSB 1ODCA 2GTPA 3G2KA 5JASA 4MR7A 4FQ8A 2VSYA 2GYVA 1G5FA 2TYSB 3DKPA 4R9SA 4N03A 4DI4A 4TYNA 5F2OA 1X92A 3Q5MA 1U9IA 2Q4BA 4EUFA 3RSQA 2I55A 3QLUA 1Z0SA 2HD4A 3ZQUA 4FDAA 4Y2SA 4ZMBA 4JBWA 3B52X 3GU3A 2PBZA 2YWXA 3N1UA 3ACBA 3IQFA 4KRXA 4XD7A 5CIWA 3RYHB 1L9XA 4C0HA 5H3CA 3OCUA 2IZZA 4MRVA 5T4HA 2H7YA 1ORWA 1BIFA 3QLTA 3E3MA 1CK4A 2WABA 3FH0A 1X39A 2JFNA 1KFCB 3HYCA 2DMRA 2EERA 4G9GA 1C30A 4UVEA 1TYAE 3WOHA 4N5NA 1L4HA 1P9OA 5AKYA 4F86A 5KCMA 1XAGA 1E7SA 2P4EA 2VJNA 2W6ID 2V0GA 4UM5A 1PQYA 4TTRA 3WLKX 5LP6F 3IEPA 4QARA 1Q1QA 3DEHA 1SUEA 1WUIS 2V9PA 4TTVA 4WNCA 1OUMA 5K8VA 1TQ6A 5ELLA 1E2PA 2AD5A 1R4AA 3ILVA 5H1YA 5JXJA 1TTPB 3ZN3A 3U7QB 1RXYA 1T6NA 3K0HA 2YWCA 4TS3A 2GMWA 3KEMA 1JU3A 4BNTA 1QO7A 3PRKE 4Q3BA 4AIRA 4MUKA 3EHEA 4YMHA 3ND8A 5TPWA 1G5TA 1RZ4A 1T8RA 3PX7A 5DB4A 1LLUA 1N94A 3Q98A 1Q5PA 3OWHA 4P58A 4QHTA 3VHRA 1P4GA 5L7TA 4M49A 1GY8A 1G0OA 4E4RA 1W6UA 1OAOC 4YV2A 1FRNA 3VDRA 3L6OO 2YL2A 2BKAA 3V33A 3TOSA 1YOBA 3ZXIA 1RI3A 1Q0SA 3DSXA 2G83A 1UBFA 4P1ZA 5EXTA 3UEOA 3I3SR 4I99A 5BSWA 5T6MA 3PKZA 1FP1D 2P0YA 1KXJA 1G3MA 3BPSA 3UAOA 1NI4B 3Q9LA 3VU8A 1R0LA 3SFZA 1L7RA 1GDHA 2Z1DA 4PFSA 3OSZA 4F4UA 3VMFA 3HBLA 3PEYA 2YICA 4GZMA 3ACDA 4HR7A 4QYSA 4WAFA 3OPYB 2BKLA 4V0MA 3FUXA 1K98A 5DISB 4EY3A 4ZI7F 5F64A 3CK9A 3X2EA 1QSGA 3IEVA 3MERA 1OCCE 2NC9A 2QAGB 4OP2A 3SBXA 2I99A 2O2ZA 2OESA 3C7AA 3RIMA 3ZQKA 4ASUA 4JI8B 2XA2A 2FW0A 2RG1A 2V8BA 3MWGA 5F1YA 3PGVA 5HJ5A 3R23A 2VRBA 3TGLA 4QOIA 2VDQB 1QOQB 4PUCA 3MYVA 1TVKA 3GUYA 4NNPA 2O59A 1KU6A 2V59A 3JWHA 2AIRA 4J7XA 1XQVA 1ZK4A 4YRNA 4NZMA 2HDOA 3Q79A 2AG8A 2BUBA 3QEBZ 2QVGA 2LKDA 3LBIA 1YS4A 1JFLA 3UJBA 2X9LA 4E51A 5I51A 4AQ7A 4ZCMA 1JQLB 3AKYA 4LDNA 3OT1B 1OX6A 2XVZA 4CMIA 1KKMA 4E2ZA 3GGCA 1C3EA 1B7GO 3G0BA 4WACA 1KMHB 1CX9B 2YJ6A 3G7NA 3HL0A 3VU1A 2ODNA 1MW9X 1R3DA 1P4HA 3FAZA 3EXHC 4DEYA 4ZYTA 3DOFA 3G2WA 1P44A 2QUHA 4HWTA 1T2UA 4HFRA 5DEOA 2BTDA 4YONB 4WAUA 4O1HA 4JBNA 2GK3A 4Q12A 3FUFA 4FSHA 3MWYW 2HGZA 2TECE 3VR4D 4X6UA 4Q03A 3HMKA 4MYUA 1LC0A 5T8IA 3UXYA 4HX5A 4QQRA 4B6RA 4GVXA 4ZRMA 3NBMA 2VJQA 1QCYA 2EWVA 2YVKA 4K3UA 4LRQA 4RZXA 2HCJB 4BNUA 3V1UA 4JP5A 2DQKA 4L74A 4QEZA 2HHAA 1YF3A 4D3SA 4CFZA 5CTJA 2E21A 4A1SA 2BMFA 3LPNA 5LP6B 5C1DA 5MDHA 4QVIA 3AJ9A 3CLJA 1GYPA 4NV0A 5H4HA 3ITNA 1AZSC 3GRZA 4WK6A 4M1SA 3QWPA 1GLGA 3ASYA 4TPKA 3IR7A 1Y4AE 4DV1B 5KWVA 1U6JA 1ABFA 2ZJ4A 1OROA 1V47A 2O48X 2Q99A 2XMPA 2Q0SA 4P3OA 4D3DA 2HCBA 4L2IB 3AVYA 2FQYA 1HDEA 4X94A 2ZSHA 4MVJM 1E9FA 3PSHA 3RQIA 4W4TA 2WPDD 1E5XA 1N6IA 3M6XA 4J03A 3LOUA 3CMCO 1BXZA 3NR2A 3DTYA 5HKLA 2GYWA 3Q3IA 4D9EA 1FDUA 4IW3B 3TWRA 1J24A 4OK5A 2WXHA 2FV8A 2E5FA 4OOEA 4TMWA 2W6QA 4TTJA 2AEMA 1PJ4A 1IBMB 4CM5A 4X7PA 3AESB 2FN7A 2Q9CA 2JLQA 3UXEA 3V31A 1WF3A 5BUSA 1VHJA 4XFKA 2P9UG 3GZNB 3TF5A 2MMCA 2XDYA 1VSTA 1P5ZB 2AT1A 3BORA 4LRYA 4MAAA 4N5IX 4EJSC 1MZCA 1XZ8A 5DBHX 5KYXA 2PUTA 4J7WA 3PXCX 3TW6A 2VQEB 3FDIA 3MWLA 1CW2B 3LP6A 3T54A 3CKMA 5AVKA 1NC1A 2YINC 2QJRA 1X2BA 5FUXA 5I7RA 1GTSA 1A9PA 1KORA 4PFQA 5IC5A 3FOWA 5FL7D 4ZI7B 3TJPA 4CKEB 4R9NA 1EHYA 4TYQA 3ZHSA 4WT7A 1EDZA 3VRHA 4OU5A 1Z07A 2CXOA 1REQA 4NZYA 4QBKA 4F92B 3BWEA 1ZM7A 1SZ9A 5BV7A 2D54A 2NZYA 4PYOA 3EMDA 4JFRA 4KMRA 2P30A 2ETCA 3EZ6A 4ZQEA 3RD5A 4ZFNA 3GPLA 4UTNA 2UXBB 4UI9K 5FI0B 3WIEA 3ZW3A 4O60A 4FFPA 4N7MA 4IRUB 3WSWA 2NXCA 1CQZA 1JPUA 4RGYA 1JLSA 1II8B 2WY2D 4AY6A 4U3JA 1A7KA 3HCEA 2OPBA 2V7TA 2D0PB 1UDCA 3ENQA 4DWWA 5FQNA 1U2DA 2RKWA 3MTIA 2A0XA 5AI4A 4GZLA 1E8NA 1G20E 1JWLA 3EARA 3IH5A 5B2ZA 3I72A 4UE6A 4BIIA 2CDBA 1LZLA 4ENRA 4GA1A 5H3HA 3U3OA 5HWSA 3MWFA 1WJGA 5DH9A 2PRSA 3ASUA 4M1ZA 4A3TA 2I9KA 5FOSA 3OP4A 3QV2A 2YNMD 3KOZA 1W46A 4GGPA 2ZU0C 4UMVA 5A6SB 2J3EA 5TPZD 4R3NA 3HBMA 1OLOA 3CJQA 4K88A 2OD7A 1A9SA 1IZYA 3KPJA 6ADHA 2YVUA 1NVBA 2YHUA 2FOIA 4HPWA 4Y6OA 1FJ2A 4FJ2A 3ECCA 2KLBA 2PV7A 3ROEA 3HO8A 1Q6YA 1RKVA 5EJ4A 1TK3A 4G0VA 2F43A 4ARVA 3KT6A 1UXKA 1D0SA 1BFKA 2NVWA 4P5EA 2O2GA 2Q29A 2DERA 2BMAA 4HUQA 1KO8A 4LHYA 5HBRA 3ZY4A 2GD1O 3N6RA 2H08A 4ENSA 1XEWX 3UIPC 4FHCA 3KOUA 4V0RA 5E4JA 1L4EA 3RYIA 4DMHA 4QX6A 1N0WA 1DMRA 4KV9A 2DFDA 1XZNA 1R0CA 2VQ2A 2A9FA 3L9TA 2W71A 5KNHD 3TX6A 1PTJC 3I61A 4Z4FA 2CKDA 4HD8A 3HGMA 5FBWB 5KB3A 4EMTA 3E37A 4MRNA 5KBYA 4Y30A 2IDZA 3ZE0B 4HNTA 3EOZA 3DONA 2PLRA 3SPXA 3TIXB 4CMBA 1I1HA 3ZXPA 4TKVB 4PLTA 5JJTA 1I24A 1WP4A 2B6NA 2I7CA 1Z6AA 2WU0A 3AEUA 3KHTA 3NDJA 4KJZA 4LEIA 5CHYA 3SSAA 4DHWA 1H2FA 5BYJA 4TUYB 2Z2IA 4CODB 2P6PA 3A7EA 3TSYA 3HI4A 5G1PA 5FD8A 2R7AA 3A28A 5CPBA 3KJNA 4GF5A 3TQCA 5E7MA 1P0MA 2BKXA 2G6TA 2G4LA 4KXFB 1RHUA 4URUR 2DEUA 4Q02A 4L0QA 1I7DA 3VH3A 3BXFA 4G01B 4AJWA 3HB5X 5F73A 2PYIA 2CZCA 1YDWA 4U7DA 2JBHA 3QV1A 1LNQA 1YFJA 1GV1A 1DG9A 2JGFA 3BHJA 1FTQA 2GHTA 3EULA 1DV1A 2VR1A 2XUKA 3ONKA 3HL4A 4LOLA 2ZXWE 1GPDG 4XUCA 5DV9A 4CNQA 4CQMB 4YUWA 5JROA 2QVLA 1MRNA 3JQ9C 2DLCX 2ZLBA 3ZLBA 1I2BA 3BEOA 4NFSA 3MBKA 3I05A 3MM4A 1OXUA 4LTMA 1CRZA 3DNMA 5A02A 4D6XA 2X2PA 3I9LA 2XITA 3P5SA 1PX2A 3RSLA 3RC3A 2H29A 4RBNA 1HDXA 3SZ7A 4A8JA 2FQ1A 4K46A 2Y4OA 3ANXA 5FDFA 2JGKA 3I4FA 4HEHA 3QE2A 5HKBA 1IY9A 2V9CA 3JAWA 5K5EA 1CXZA 1YACA 1CC1S 2BTQB 2QE6A 4KQ6A 5EWLA 1EQAA 2I71A 2AMJA 5B36A 5LXTB 3KPYA 3KQKA 1Y4UA 4XE0A 2ZUFA 4GTSA 1BVRA 4JOSA 5AVJA 3RK0A 2J7PA 1F6WA 1F5NA 2V5FA 4HLUA 3PIIA 4C0EA 4WBSA 1GZ6A 4JA2A 3S7BA 2RGUA 3ENZA 3FM9A 5IYZB 1PAUA 3D8SA 4M6WB 1PR4A 4TLEA 5ELXA 1T0JB 1YFKA 4FXPA 3QELB 4WECA 3A4IA 5IC4A 5KU7A 3WGIA 5ENNA 2EBWA 2QTRA 3JYLA 3CT6A 2A67A 3B60A 1A5SB 4NEQA 4ZKDA 4J4HA 3DMPA 5AP9A 2IS1A 4K9SA 5A2QA 1KJWA 5AVXA 2DY1A 4E94A 1SBYA 2IT1A 2JFGA 4ZIRA 1YA8A 1STOA 2PRZA 5JQGA 1GFIA 1ZU5A 4U7WA 3ENNA 4UAGA 1TD1A 5EXXA 3D9MA 1H65A 5LDDC 3V4RA 2GRAA 2Q50A 4HGPA 4N5MA 3RASA 3C39A 4Q24A 1WAMA 1CWUA 1ZITA 2IY8A 2JD1A 5CR9A 3PTZA 4NH0A 4B0ZA 1LBIA 1RKXA 3H11A 4X8LA 1KVSA 4GGOA 4LNBA 4E13A 5HYVA 5K09A 3IUSA 3TTXA 4IMRA 1ZH6A 3SDSA 2HV9A 2BBSA 4BN0A 2NZUG 3U4HA 1ECGA 4KQGA 3I83A 3W7BA 2B4TO 3ET4A 1EWRA 3KSMA 4KN5A 2VHUA 3DUFB 3EFBA 4ER5A 3QWFA 3T95A 1XP8A 1Q50A 1MG0A 1N5DA 3EZYA 3PZ2A 2OCLA 3D6TB 4MX8A 5A3JA 4TN5A 3DOCA 2NUAA 4FONA 1BWPA 3BIJA 4OHOA 1ECCA 2OFPA 1F38A 4L4RA 1YZLA 5FFNA 3WJ7A 2BFEA 3AUTA 3VI3B 2A9VA 3U49A 1BS2A 5EKQD 4B44A 5A2GA 4KI0A 2PGJA 3H8SA 4J8PA 4K86A 4TL6A 4YJ3F 2NUPB 1YDGA 3FSGA 1XUOA 1L1FA 2Z6QA 2XH8A 1NQOA 3RUIA 3EIOA 4FCWA 4OQDA 1TE2A 3E53A 3QU4A 3SKXA 4W5QA 1ZL0A 4PLPA 1KAGA 1OLSB 2YW2A 4P22A 4R81A 3FYCA 1VTKA 1PNQA 4R0MA 4DV7B 3SSMA 3BEDA 5K6TA 4G0UA 2DCUA 2I1KA 1H19A 2X6KA 3T9AA 4URZR 3VO2A 1P18A 2JHAA 1XEXB 2Q6LA 4P81A 3U40A 4FFSA 4V0SA 2JLZA 1FBNA 3E2PA 3Q3CA 1Z5GA 2ZB2A 4OLHA 1T8YA 4UWLA 1T8PA 4Q39A 2E6UX 4R1OA 2Q21A 3I76A 3QM1A 5TY0A 5AVOA 3WK5A 3CVPA 2PZGA 3L8ZA 3ZD9A 2B8WA 1R0ZA 3CUVA 2B30A 3WWDA 3VHXB 3M70A 1ZVKA 1EB8A 1FP2A 2BFEB 1XF1A 1QE3A 1GNVA 2PYZA 2SHKA 3GQVA 4UDNA 3RU3A 4BCDA 4EYOA 3ZX5A 5C8YB 3D4NA 1RW2A 3FHTA 3KQMA 1P1CA 5FFFA 5FWNA 4MIOA 4X1IB 3UMYA 2BEVA 1Z0KA 4N7RA 2FF7A 2MSCB 3WWOA 5FX2A 1USWA 3C8ZA 3N0XA 3TPFA 3TNJA 4ER0A 5F9FA 2XB9A 4Q82A 2FSIA 4GICA 2IUUA 1SW6A 3DPDA 3ONFA 5JSKA 4OY3A 1JCQA 2NVOA 4LXGA 3HR4A 4QXOA 2W9XA 5EXEA 5U4XA 2R6HA 5L3QA 4AF6A 3SD5A 1P3DA 2ON6A 3FOBA 3ITDA 2PGXA 5IYZF 5A9SA 1THZA 1RZRA 4QYIB 2C99A 1W9HA 1U90A 1RM4A 3K9BA 3LG2A 5FTNA 4EUHA 2WYUA 1A3CA 2J9RA 1UBMS 3BCSA 3K4PA 3FDFA 2IX3A 1W88B 3CTPA 4ZPXA 3UKRG 1FE8A 2WOOA 4YAJA 5LSAA 4WFKA 5LLTA 3JQ9A 4B3DA 1W49A 4CG0A 5DWQA 4GSYA 3DL0A 3IQWA 1B76A 1L4UA 1SCJA 1TM1E 2C3YA 3A0UA 3OOWA 4EF4A 2W93A 4BNNA 2GXQA 1NR5A 3NT5A 3C15C 4HNUA 4NENA 5BT9A 1MN6A 4B3JA 1SCDA 3OIVA 3RAUA 2G5PA 1OA0A 2GASA 4OMFG 1UXOA 2DQZA 3UUGA 4C3UA 4MQEB 2O8BA 2WLSA 3D7SA 3N70A 5HZMA 1BDJA 2VEOA 3G8YA 4MUHA 4BQPA 4DMFA 4KACA 5GIPE 5C0OE 2COEA 4QDTA 1IN4A 4HAWA 1SRQA 1NBWB 2ID7A 3A2NA 4TVOA 5FUQA 1G291 3OAWA 1GPLA 1NVDA 1ZD1A 4JQOA 1V43A 4XJTA 1JPLA 1V5GA 1IM2A 2H8GA 4Z7JA 1XRJA 3LUFA 3ZQ6A 1OWNA 1HT1E 1T1RA 4OM8A 4DBZA 2PCJA 1FJGB 1SNYA 2FFJA 3NDRA 4G8KA 1VB5A 1QO0A 3AG3E 3BM5A 3LUBA 4LJ5A 2ONCA 2ZQ5A 3M2PA 4AMUA 2SECE 3ACCA 2NYRA 1D0IA 3HKCB 3RSFA 2GZ2A 2J8SD 3R24A 1QS0B 1B74A 3NLLA 3ZJUA 1B89A 1ES9A 1DPGA 1EWTA 1U6IA 4EENA 5ARFA 2R96A 3W5UA 3CMMA 4UU1A 1K5PA 3UANA 2ISCA 2P4QA 1L8OA 3PHIA 4N0MA 3DOOA 4CL8A 2VT7A 4IJVA 4YJ3B 4OMUA 4HWGA 4E15A 3L4EA 4X6LA 1EGVB 2FE4A 2WP8J 1TCUA 1DAFA 4N01A 3PGA1 4DAOA 1VGVA 5A04A 1NASA 2DHQA 4J90A 2G25A 3AB3A 3ZN2A 5C4IA 1Y6FA 3UUEA 2VGXB 2QIOA 2PRYA 4Q7KA 2I4NA 4UM8B 4R7LA 4HEA1 3CQGB 4RPKA 4MVCA 2FP3A 3P32A 5FWYB 1W85A 1EFUA 5LA6F 3CO0S 4S2UA 4D41A 3VNAA 2IUTA 4D4IA 2FVYA 1T29A 1R88A 2DVMA 1ID8A 4AJNA 4B3XA 2XD4A 2R00C 3TIFA 3GLIA 4G1MB 5ENZA 1PK9A 2FN9A 4O2BA 5KTTA 1KBZA 2C29D 3VO9A 3QI2A 1KMHA 1M7HA 3C8UA 1EP9A 4NABA 3IUMA 4INZA 1R8JA 4LVNA 4M1TA 3ZGVA 2PUEA 1F12A 1S8NA 1ZM4A 1CDDA 2G5TA 1NFIE 3ANMA 3MD9A 4OBEA 4D0SA 4BLOA 4HAZA 3M6WA 5AI6A 2WQ7A 4CKEA 4D8TA 1A5TA 1U4SA 1HG0A 3OCWA 2RHBA 2HWWA 3QVUA 1JKIA 1N0HA 3FUNA 1NVUQ 1CE8B 3VDQA 1Z7GA 2FZLA 4FOOA 4Q4AB 1F2DA 2B4YA 3BEEA 2J3DA 3HEAA 5EMHA 3NHRA 3SFXA 5I48A 2WAMA 2YYSA 3DEJA 4IDBA 3WV5A 1KT0A 3PYLA 1U2ZA 2I54A 2RBEA 1PJSA 3KSZO 2WJGA 2VH5R 3WZMA 3M9XA 4EBFA 5JEDA 3ZGLA 3T7JA 2JI8A 3N76A 3VZCA 3GRUA 4AS2A 4QEKA 4JJIA 4RKYA 4ZAWA 4FUTA 4CIBA 4ZCTA 2R84A 4YH1A 4UXHA 3TCNA 3K0CA 4Z6KA 1EVYA 2HM7A 4C0KA 8OHMA 3R3SA 3TR5A 2C94A 4MVJA 3HWWA 1ZBPA 2J31A 4I2ZA 2J32A 3G02A 4RK0A 2GZSA 9GPBA 5AM1A 1WLYA 5SYAA 4WZAE 1J9EA 1GU1A 1U4NA 5AKIA 4JC4A 2AK2A 1NATA 4BNMA 5HGXA 4AIIA 5KYWB 4XD7D 1INLA 1WMEA 1ZY2A 1N25A 2HRQA 4ZMRA 5CK4A 2DH5A 1G5PA 1GTG1 4L08A 5DIZA 1IN7A 1UBOS 3FR8A 1QQ6A 1GPBA 4NU8X 3BZWA 1KEWA 5C80A 1VCHA 3DSVA 3DSTA 1A9YA 1EM8B 2I29A 3L8GA 3EPPA 4QLOA 1T9GR 2ZDGA 5IK2A 5CM8B 4IUCS 2VDMB 5EYPB 3F8TA 3AOEA 5T67A 1Z83A 4Q4AA 2W2PA 1FRFS 1D6MA 1Y82A 1XDSA 2Y4NA 4WLVA 2TSYB 2UY1B 3F6EX 3SZLA 5KSWB 2QTMA 1W36C 3NM5A 5DM4A 3RSZA 3CJRA 1N2CA 3IEIA 5B3JA 2GAAA 3RVOA 5C5IA 2XVMA 2G09A 3RUPA 1AG9A 2PG3A 2B8NA 4ETMA 2A7QA 5E6RB 1JEJA 4GRAA 4CM9D 3IA2A 1P2VA 1DI0A 1G1AA 1NMZA 2C2WA 2QR3A 4NJEB 5DE3A 4F2PA 1DEHA 1FNDA 3RKSA 4YAUA 5KPJA 1WP9A 1S0UA 1U1IA 4B4VA 7ADHA 4DWVA 1J99A 2WPNA 1X7GA 2ZAOA 4C43A 1EDDA 3BS4A 1TFUA 1D1TA 2V4UA 3HVEB 4ZOLA 3D1VA 4V1CI 5KVSA 3KQUA 3EPHA 3TN7A 5BUZA 4U7TB 1HWYA 1ABEA 1QBGA 5BR1A 3T1VA 4AY5A 4N7JA 4PY2A 2NU7A 3WBKA 2QHXA 3KUUA 4E09A 4DCGA 2BW0A 1ANKA 1YS9A 1ESCA 4MHOA 4X6YA 5EYPA 5KU1A 3ELUA 1LLDA 3CPHA 1FRZA 4ZCLA 1XTJA 2ZYUX 3D3WA 5LMCA 1OH7A 3ZJTA 3G8BA 4KFTA 1QR6A 3MC1A 1X1BA 1O1TA 3KJHA 4YIKA 1DO0A 1O94C 1JKJA 3JWIA 1OZHA 1UBKS 3QOFA 2GN6A 4UOQA 1F2TB 5IBPA 1ZA2A 3WRVA 2O5RA 3ZGYA 1Z22A 2B8JA 2GZRA 2B3TA 1P29A 4WZBA 3RVMA 1G2IA 3BXXA 3PPYA 3W8NA 2C0PA 2Q5OA 4BO8A 3KELA 4MVJG 1SCUB 1IZ8A 4PAOA 1O5TA 1NJ8A 1RRGA 1SUAA 3M9LA 4GYKA 3SQWA 5LWHA 4Z4GA 2V9ZA 3ZFWA 1ETHA 1WHTB 3VR6D 3C1UA 1M2JA 4GX1A 4HNRA 4B35A 1ODTC 3G8AA 3ND5A 2GPAA 3HB1A 5AW0A 1KR5A 3OAAA 1QANA 1R5OA 1Q0TA 4CVNA 1LCIA 2ZWMA 3G2SA 3AR6A 4KH0A 3JR7A 1U2TA 3DCNA 4XX0A 2J6CA 3KG2A 2P9PG 1FFXB 5CRUA 1ZM2A 3BRSA 2QW8A 3I39X 3NUZA 4DMGA 1UBTS 4H6PA 4UAJA 3TMKA 1ONOA 3UQ3A 3CEAA 1AKYA 2FXVA 1WUYA 5SV2A 5LQAA 2RKKA 3UMRA 3FYUC 3HWSA 1RWVA 3NOCD 2BSXA 1P4SA 3IP6A 1QGUA 3TLEA 1GGJA 2ZJ2A 1S89A 4F4DA 4HVCA 5HPYB 4CEJB 4W1RA 4MIKA 2ZYWX 3O2NA 1ELKA 3IQXA 2YIMA 1H2XA 3L7JA 4QDUA 1U6KA 4OCZA 4QATA 4R54A 3T38A 4Z7OB 2IODA 3TNLA 5DM60 2W58A 3L79A 1SCUA 3CH5A 4CCSA 7REQA 4KVMA 1C7FA 4MHTA 1VXRA 3RW9A 3ZHUA 4JUAA 1Y8RA 4OSPA 5EHQA 2NW6A 4D9GA 4R68A 1SO8A 2ADMA 4N2SA 5E0OA 4UXJA 4EHHA 5CG1A 7MDHA 2WJZB 4KBYA 3ZHQA 5I7SA 5LQSA 5LCWJ 4K6OA 2VP3A 3INGA 1JQ5A 2WVAA 3B1WA 3MS4A 3VHLB 3EGEA 4CIYA 2DTXA 1DFHA 2W2KA 4MKZA 4C5CA 4KE8A 1W52X 2O3RA 4J0CA 1SCAA 3VOSA 2GN1A 4Y0AA 3U7FB 1AHPA 3A4TA 2DCPA 1NLUA 1Z3YA 1F4VA 2HC9A 3T7RA 5AIBA 1P5QA 4DLBA 1M3SA 1UPUA 3CW2A 3WDMA 4YV1A 4CM4B 1PV2A 3A11A 3V2XA 4UM7A 2UVDA 1UPFA 3GEIA 2GGSA 3O1LA 5GJVC 3SZRA 4QO8A 1IY8A 1GZ5A 2VN8A 3ETDA 3MB8A 3NWBA 2C7PA 1WZ2A 1I30A 3H9QA 2IXGA 1T9GS 2QUJA 2QLLA 4A2CA 3ZV3A 5I9BA 4LNHA 5KMGA 3IP3A 2XE7A 3EQ9A 1QIFA 3WQRA 3R8XA 3SZGA 1B8VA 1R6BX 3T94A 3M1LA 4EJ2A 2EZ8A 4Q7MB 2WSMA 4J2HA 3U7GA 2CFSA 2ETXA 5HZKA 3CK7A 2ALJA 1NBMD 2HF8A 2P1RA 3IA7A 3HYTA 1PGOA 4RLQA 5A0FA 1YDFA 3SX4A 4HLNA 3JAKA 2BF0X 3AU8A 5PGMA 3HM9A 3ZGQA 4BX8A 4CEHA 3C5EA 4ZYZA 2OV6A 4PAWA 1J5EB 3CF2A 2HUPA 3SAJA 2E5LB 1MO5A 3I4LA 4UUAA 1ZX1A 1JIJA 2Q7XA 3B6IA 4BX0A 3SOPA 3G0HA 1EXNA 1GEGA 2F3TA 3GPDG 4OEHA 4P4GA 5DVZA 5LQRA 4EGJA 4ER3A 2Q4EA 3DV0B 4IG9A 1C3JA 1GITA 1PWHA 1Q7RA 3DFIA 3EQ7A 3DDWA 5EL0A 1MJ0A 1PNTA 5DASA 3MJRA 3ZLTA 3CWZA 3BN3A 3WYAA 1MU0A 1V8PA 5JADA 3U9SA 4Q6BA 3IDZA 4OXRA 3RSGA 4BNJA 1E32A 5JVDF 4M88A 1GGMA 2CBGA 2CXQA 3EDQA 3LPLA 4EI8A 4KWIA 4OD0A 1U3WA 3A8TA 1EUCB 4YRBA 2CXSA 2CUZA 3HJHA 2W43A 1JFFA 1U04A 4LG6A 2EWWA 2FRDA 2J30A 3QK7A 4PAQA 5GV7A 4Z1MA 3EU5A 4EEKA 5BXUA 5AH0A 2JKVA 1PV4A 1SWWA 1PT9A 1TK9A 1YSCA 4UNPA 4W8HA 3PFKA 2HX1A 4FD3A 2I5PO 2IDKA 2IJGX 5D2CA 5JZSA 4APFA 1GKYA 4AC9A 1VI5A 3B7BA 3HJGA 3WMRA 4TYMA 5JA4D 2CW5A 2HA6A 1SUBA 3WICA 2ORVA 3ABIA 4LI0A 4UE3S 3H4VA 5ER9A 2IOSA 3I6ZA 3FFWA 1C30B 4O1PA 3JVEA 3H5VA 4II3A 4NQZA 3RVRA 1OREA 1VI2A 1B0ZA 3THXA 3JQPA 2W6ZA 4TTQA 1HL3A 1WB5A 3IE0A 2ADOA 5JSUA 5KOIA 1MJGA 1T2NA 1UOPA 3PFNA 5ER6A 1XKQA 3P9CA 3MFYA 3RRMB 3B82A 1EFPB 4JLUA 4EHJA 2KCLA 5KNGA 3EPRA 1YJBA 2YIVX 4QYIA 4EYGA 3KHSA 2XAAA 3WG7E 1KP3A 3RUDA 2WKPA 4BVAA 4MQFB 3LFUA 1HLGA 4EQ6A 3FJ1A 4JI2B 2JH8A 4H16A 2I2FA 1C3LA 2M6LA 2G36A 1YI8A 1HRKA 1DKPA 2HM8A 1E0SA 3ZDXB 5HTOA 4JI5B 1K97A 1N2EA 2Q5CA 5ESXA 1GUFA 4YUXA 2WVIA 1IPEA 1JALA 2F1JA 2KWIA 2XSZA 4YNDA 3JYOA 1CU1A 3BWMA 3C7DB 4KLZA 1HORA 1HNWB 5DWVA 3U9LA 1W6RA 2DFLA 2AXNA 3WQBA 3H5AA 4Q3CA 4A6EA 1ICEA 1Z08A 3C7CB 4C88A 5JRJA 2VKTA 1Q7TA 3ENKA 4Q4HB 3ZWDA 2EZ9A 2FZWA 4WNAA 4HG2A 1HG2A 3S7JA 1XZKA 1IOVA 2XR1A 3UUXA 3EZFA 5GZ6A 3U1TA 4AWAA 5L95A 4WUTA 1WB9A 4HS2A 3G49A 2BGUA 2QN3A 1Z37A 1QH1B 2D5AA 1TF2A 1Y81A 3M2TA 4LRXA 4JLVA 4NCHA 3PUVA 1E1YA 3LOQA 3LQFA 3RAGA 1W44A 2HIAA 4DSOA 1TCCA 2GCIA 3HA2A 3P71T 1KAOA 1JTEA 5C2JB 2FXIA 4NIMA 2O0JA 3K0KA 4O4JB 4WL0A 3D9IA 1LJLA 5C3MA 4P54A 4JMLA 4FGLA 1NU6A 3FKSD 4R2JA 2VXBA 3HRIA 3R20A 2FSPA 3EHNA 4QPPA 2OEVA 1GXSA 5DK6A 2F8LA 1N0IA 4RTLA 1FYEA 1IAQA 3JXIA 5IKMA 2J49A 5C8VA 1FFDA 1I80A 3CINA 1TVKB 1SKYB 2PX2A 2UVPA 5EEHA 2J0QA 1YL6A 3A3OA 3OOYA 4CGYA 4FD2A 3V2HA 3VJRA 4PVCA 3UM3A 1S2NA 2BEWB 2MSWA 1BE6A 1F8XA 3I1YA 5D0QD 1N2XA 3C8MA 5CDUA 1QYVA 2EILE 3V9AA 1NOJA 1CSEE 2OYCA 5GTDA 4CF3A 3PV0A 2KM4A 2UZ1A 3I5PA 4DPRA 2Z8XA 3L0BA 3SQVA 3DVAA 3NEJA 4M98A 4JK3A 1RWOA 4US2R 4FGJA 5K05A 3UT5B 2ZYGA 3LJ3A 2OXIA 2FW9A 2OGTA 3MAJA 4OHVA 4RFSB 3CHOA 3BX1A 1L4MA 1EEHA 1AOXA 1XMXA 3QFFA 4YYEA 1VRWA 3Q7SA 1SKYE 2E1RA 1UDXA 2OEPA 5FOVA 3BMNB 3A9SA 4RVBA 2FK7A 3LJNA 1PWEA 5K0JA 1LX7A 2R9VA 5LYJB 2HT1A 1WABA 1ZD5A 2FYTA 4OAPA 1PSZA 4GAEA 5IDQA 16PKA 3V7WA 4LDQA 4LHEA 1GLVA 2FN3A 2JCYA 5CIYA 5AUPB 1BW9A 4EPYA 3ICEA 1NPDA 1P19A 2G67A 3IIMA 4ZYUA 2WSBA 5DGTA 1ULAA 4BFVA 1W4RA 3FPAA 5H83A 4QBIA 1EH5A 4TSFD 4IHAA 2MOWA 3ZR4B 2C7GA 2BEUB 3STUA 1VE6A 4RY8A 4HLDA 5K3BA 1GADO 2X8WA 2CY0A 4PTYA 4X24A 1TEZA 4BQIA 4AO7A 5C1BA 3HXCA 4LY3A 1HL7A 1YRAA 1T4DA 2V74B 2QTAA 3O8LA 2P68A 3A31A 5GONF 3NORA 4RABA 4XGNA 3ZVNA 4JHLA 2AN1A 4BMDA 3QGMA 5EMNA 2PZBA 1SQMA 1I2DA 1UN8A 2BI8A 2PWAA 2XDAA 3HDHA 3VR6H 4D3ZA 3G0IA 3FLEA 2D7JA 2B34A 2P2GA 3FA2A 1UXGA 2XKJE 3D5TA 3FCAA 1BN6A 3OTOB 4DMRA 1QZZA 1DFGA 1RWQA 1SUFA 4MWBA 4O5AA 1AD2A 3D3QA 4C7OA 1E8MA 4ZJZA 5IFKA 2VTBA 3HKBB 1VXOA 4QQNA 4CTKA 2NTVA 2XLBA 2J0SA 1U1EA 4NATA 4OGLA 1VE1A 4BJ6A 2ZAMA 2XLCA 2UYGA 2W4IA 3QX9A 4FMDB 3JSXA 2CE7A 3MG9A 4XLLA 3H3XA 1DAPA 1QKKA 3DT8A 2GQ0A 1X8KA 4AP5A 3VQTA 4E0BA 5CA0B 5KYXB 3WGUA 2ZIGA 2XCOA 1N57A 4LVUA 1B3BA 2LCQA 1J0BA 5JOQA 1K3TA 3H13A 1WMBA 1ND5A 2JVJA 2WE8A 3UV6A 4F6LA 3P1UA 2FX2A 1I9GA 1E6MA 1UKYA 2NSLA 4JDUA 2IIPA 2VAMA 4UBNA 2OZLB 3FXAA 2GA8A 1RAIA 4DEVA 1JAHA 2VPQA 4F8EA 4FCVA 3DT6A 1EUYA 3LF1A 2WMNA 1KI6B 1XYGA 2IX9A 2OHXA 2WWHA 3AG6A 3HJUA 4IGIA 1TUGA 2Z3VA 4KZKA 1JDTA 2QY9A 3SZOA 1VLHA 2XB6A 2OY0A 1R3UA 3OIUA 3QUCA 3R40A 4IX9A 4W9NA 4MVJD 5E95A 3ADOA 3V1KA 5DYYA 1P73A 1QVVA 1R0RE 2C3MA 2JGDB 3SS9X 4JLMA 1RWWA 2P11A 3Q88A 4KIGA 4UNRA 3F73A 1PZEA 5KJNA 4E14A 3OZWA 1Y5RA 3QKRA 3NIFB 5FBKA 4FWBA 2AN3A 3PPIA 4WKOA 4DSNA 1WW3A 3E9RA 1V9CA 1AKMA 1UEIA 1Y1KE 2V0CA 3DQPA 1KMCA 1FTSA 1WPRA 1ZVJA 3U3ZA 2PGDA 1GVNB 4QODA 3Q6IA 3CUSA 3TMYA 4DV2B 2GCGA 1GUYA 4RTNA 4FT2A 5CT9A 3JQ6A 2BBTA 1MH1A 1CUBA 3P97A 5LQMA 2Q5EA 2B0JA 1JH9A 2WJHA 1FU8A 5IT4A 3ZGNA 4ZTZB 1PKEA 2AJCA 3CRZA 4JCOA 3UM0A 2RGYA 3DMTA 5KQMA 4P98A 2HEGA 3SJZA 2YJ5A 4WA8A 5F23A 1ZLYA 3PFGA 3CKBA 2M9MA 4P38A 1JHRA 2LBPA 3KVRA 1KI7A 3VTAA 5JJIA 4K1XA 2EKLA 1K2VN 2GJ9A 1U0EA 3EZ2A 2PH1A 3EUEA 2D5BA 3QLVA 5EI5A 3R7SA 3NP7A 4DBLC 1O4WA 4PBTA 5LIRA 2AZXA 3UMVA 2JEOA 2RHOA 2BKKB 3H5IA 1EEXB 621PA 2RH8A 1R64A 4BBAA 4UM9B 4WKGA 4I4LA 3V4OA 1AK1A 4MQ5A 1KEEB 4OFXA 3VFDA 5ALQA 4A1OA 5IVKA 1NPTO 2BGMA 2QPTA 3GLFB 3W7VA 3M0EA 4Y18A 1U7XA 3Q11A 4D9IA 2NMVA 1TTTA 4X41A 3ZG6A 2XNJA 5B64A 3T1HB 4U9UA 5LXTF 3SYNA 2Y4TA 2BF4A 2WHPA 4KQCA 3S2IA 3QEMA 4C22A 1ZS9A 1MIHA 5ETJA 3ZV5A 5HFNA 3WWCA 2GRUA 4IEFB 2QE7A 2FP4B 1XNFA 5J4HA 4KDFA 2CCGA 3EVEA 3G0OA 4I8IA 1ZXBA 2CLDX 1Y48E 4K5AB 3BGDA 5E6UB 3W05A 3HHEA 3E5NA 4Q4CA 4BQNA 3DFKA 4ZVTA 4NDNE 1ZNZA 2WUFA 5JNVA 2IF2A 4W5RA 2R6JA 4DA9A 3ZIUA 5K99A 2MR6A 2QUIA 2VXOA 1N3BA 3E03A 5KYVA 3WLLA 1ZI8A 3D2AA 4NRHB 3L7LA 1E1QD 1ZN8A 4WUYA 1US8B 2IIQA 2Y1EA 2XQFA 1S5PA 1F2UA 1H5NA 4KIFA 4S1VA 4TWRA 4GOXA 4GECA 4TV9F 5KYYB 4YRTA 1XMQB 2F48A 4RQUA 3R6TA 3TL5A 4DUPA 4E1VA 3L8FA 3C4QA 2O1XA 1GCIA 4E08A 5IF3A 3G2UA 2MMGA 1IEXA 1FX0A 3FOAA 4Q7LA 1V41E 1Z6GA 1JECA 1QC5A 1N1DA 3QY0A 1KXZA 3GCZA 3GOHA 2XS1A 2Z30A 4L8WB 2D7CA 2WHPB 2X4DA 4DADA 4FYHA 4Z4HA 5ADUS 2R1VB 4A6PA 1HLFA 1QXSA 3TTYA 4EPRA 3AERB 1X8LA 2FZ5A 2P9TA 2WTMA 4FX5A 3AM5A 4GPAA 4P86A 1MBZA 1ISIA 4NS1A 3UO8B 2OCPA 2CVZA 3U6BA 1V1MA 2YZ7A 3PRYA 2PZFA 2ZJAA 3DDZX 2MYTA 3TK1A 4Z9FA 5I7OA 2QK4A 2Y6UA 5TVKA 2D0OB 3SJBA 4HLQB 2V7VA 5DXAA 4INOA 4J8FA 1Z5PA 2DM6A 1L0BA 5JTUA 3RTAA 1E8XA 2KHZA 3A4VA 4NZOA 2OOEA 5JY1A 4H7DA 4TSKA 2R3SA 3G0GA 1PX0A 1P1KA 4IQFA 2C5EA 4CT5A 5YASA 3ZCVA 3LX5A 5K3SA 1ONSA 2YY6A 1THGA 3G5MA 2EBUA 2WYWA 3Q3EA 4RVFA 3CVNA 3S2ZA 5LFAA 1QHGA 4ODIA 5CB4A 4EYEA 5CDFA 3D9KA 1DT3A 1FP4B 1GYQA 1LSJA 1VPTA 3WBJA 1UZMA 1H4SA 4M6WA 2HMUA 3K3PA 4Q1EA 3VKGA 4K7JA 4XWTA 4N6GA 4CGZA 4WWPA 4RVNA 1K86A 1Y7LA 1DX9A 1WY5A 2J3MA 1ULUA 4GEKA 4MUAA 1E58A 5JSYA 1ORIA 3NP9A 1U3UA 5JD4A 2ACEA 2IUYA 3H65A 4I9HA 1IUKA 3R3ZA 1JLMA 3FOCA 3NBAA 4B3CA 5LBTA 3UK7A 2PM7A 2E48A 2X6RA 4B34A 3KQHA 1I1NA 4I4TA 4IIJF 1QG4A 2FRXA 3FTNA 5TGDA 3B7TA 1BCRB 3H9CA 5LOVF 2GEDA 1PR2A 4G5OA 3S1LA 4B3RB 4FC7A 5DHQA 3V4SA 5FH9A 4J0QA 9MHTA 2O7VA 4IZ6A 5BSVA 3CV0A 1P2TA 1WHSA 4NU0A 1P74A 4WLUA 4XSHA 3DVSX 3Q10A 1ULTA 3DZKA 3WTCA 3AUFA 4DJTA 4C7VA 5JYEA 1QH8B 3LGXA 3MUNA 5FOWA 3TKAA 4O08A 3ZU4A 1RM3A 1C7JA 1H3FA 3ZIMA 3A2MA 4XYEA 3IVXA 1WXXA 5LP6C 4DDHA 3GP8A 3KJXA 4E33A 1BJKA 1EF1C 1O6BA 1QZUA 1GIAA 1U7TA 2ABWA 2R8XA 1DCFA 3AEKA 3MF4A 1W1WA 1GNLA 2Q0HA 4R98A 5EUCA 3ZWPA 4D9FA 1Q7GA 1MFZA 5EIFA 5BSFA 5KNCD 3HU2A 1G6Q1 4WWHA 4X95A 2XYQA 4KE7A 4DNFA 3FULA 2XF2A 2QX7A 3PDJA 4WXPA 4MW9A 1EVIA 2MT9A 3EH1A 1Q22A 2H16A 3CPEA 4RCZA 1WR8A 3BIXA 4LDAA 4MRMA 4DNOA 5L4LA 1KQGA 4X71A 3L77A 2GBGA 3R5FA 3ASGA 2NQ8A 2P4UA 2Z04A 3AILA 4NRDA 2NV6A 5EXPA 4BLVA 2AOVA 4WSOA 3S70A 1W7AA 1C9JA 1LZKA 2IOLA 3FUCA 3T0GA 1D1SA 2HMYB 5LM3A 1P5JA 1MRZA 2DWOA 2HMAA 2RCNA 4HK4A 1XTBA 2PMDA 5AI8A 3AJIA 1KQOA 3RWMB 4AN0A 2KS6A 3RJZA 3QVGB 2X3YA 2QLNA 1SUDA 4MINA 2XODA 5A4KA 3IKMB 4IH9A 4RM2A 3RUAA 4JEUA 4EJSB 2QLMA 4JOCA 4Y3UA 4IOJA 3COJA 2P9KG 2JS7A 2XUHA 3FF4A 3HSYA 5K3FA 1FSFA 1O6FA 1A4IA 4EK9A 1XVLA 1OYYA 3KQYA 2OAEA 4QFBA 1NF9A 1P4JA 1VJ1A 1L5MA 1XX6A 2ESRA 3BXHA 3LBNA 5EX3A 1Q12A 3OE7A 4G8DA 2FPLA 1PL8A 1WXIA 3QC1A 2ZDQA 3OT1A 4KQ2A 4XPZA 4BC1A 2E0IA 1JG2A 1JX6A 1CUEA 2YV1A 1FFWA 4ZHBA 5HP4A 2X1VA 3CNLA 1XPUA 2QRKA 1GRCA 3GJYA 3NIWA 1N4PA 2YHSA 4HDMA 4EB6B 3AW9A 3CNBA 4ZCSA 3EVGA 4V0OA 4HOTA 1X70A 3E3LA 3ZWAA 5KWSA 2XYRA 1Z6QA 2AEJA 4BP8A 1GDTA 2PRJA 3IAHA 2ZYTX 2Y0BA 3M89A 3GXOA 1V4NA 3CVXA 1RJFA 4FLBA 1T1EA 3KSUA 2FW8A 3AXSA 4GKAA 4AF7A 3ICCA 1CZHA 2GUGA 1OTHA 2G9VA 3OZXA 4U8VD 3LPCA 1Q0QA 4P8RA 3ZY3A 4IGAA 3CZ5A 3Q6MA 4M0KA 1YGYA 4PXYA 2CMFA 3OA0A 2B6HA 4HXIA 4Z49A 4PRLA 3WLEA 1HFEL 1WDLA 2OHOA 3IPYA 1JHZA 4YMUA 1BNCA 5KOHA 3RHSA 2OORC 2XSZD 4K28A 3R6LA 3TI7A 1Z25A 2ZBDA 4QFMA 3JQCA 3TEJA 4M37A 4AN1A 1OCOE 3GAAA 4BB0A 3L01A 1UDAA 2I3ZA 2RAFA 3NNNA 3RS7A 4WZZA 4DA0A 721PA 2QGZA 5EXSA 1TR4A 5C1OA 3TXMA 4TTAA 1IN1A 3DZFA 4RPIA 1DVRA 1ZD8A 4COKA 1DS6A 4MIYA 3DR5A 3NGMA 2IPMA 1VL6A 1J8VA 3QOXA 1IDN1 5EC8A 3V2OA 3OFJA 3W5BA 4Y6GB 3PEEA 4BFSA 4I81A 1QCZA 2Q2OA 2L18A 3E9QA 1QIGA 2XGJA 3MJCA 3RYCB 1NZJA 4JVSB 3R8CA 3CTMA 3PFCA 4IIEA 2EHJA 3SBEA 2H1OA 4YDOA 4C0LA 3NDPA 2IP4A 2KYRA 2QU7A 2ZYAA 3LQYA 2GF2A 1UBUS 5ICGA 3ESYA 4UULA 5DRTA 1F2VA 1RM5A 2DLNA 5COAA 4B6OA 1M2NA 3DE4X 1DAEA 2XF8A 3H1EA 1E6CA 1WXEA 4IVNA 4BNGA 1NKSA 2BFCB 4WI1A 2IUSA 1K08A 3RSHA 2B7CA 4BV9A 1B1CA 4D8YA 1LKZA 3BH7A 3PENA 1KDZA 3SMQA 3PNQA 3F5MA 4ZZIA 5C51B 5DXFA 4OLBA 1YI0A 1NBEA 3L82A 4JOQA 2GW1A 3IVCA 4XWAA 1P1BA 1GNTA 1UBNA 2EGGA 2IZOA 2XX3A 3AG5A 3IC5A 3K2EA 3A1VA 2R6FA 1VMIA 2AC7A 4IM7A 1APBA 1XCPA 3C1AA 4RPJA 3IT1A 3ZDEA 4BRUA 1FZTA 3OPYI 3RIBA 2R86A 4NZNA 1NY6A 4HVLA 1HMPA 2G8LA 1VSUA 3BB1A 3Q5GA 4YJHA 2RAPA 3WSTA 5BUQA 3I4GA 1OI4A 1FRQA 3O26A 1KVQA 1U28C 3CNOA 1DX4A 1Y33E 2NM0A 2P9QA 1EXDA 2NO0A 2NPIA 3Q3GE 3DLIA 3CSFA 1GWNA 5FI1B 2W2QA 1QDUA 1JSRA 2CNWA 4WJLA 1RXEA 1BVUA 2YDXA 2VJYA 3BWCA 3D4IA 3EY9A 3VV3A 4V1CB 2WB4A 1RABA 3BMCB 1SXIA 1O95A 2C9BA 1IBRA 1SUCA 4HTFB 2ZBFA 2RDMA 1BI7B 3TL6A 1TT5B 2AH5A 3K8OE 2PZJA 3D4OA 1DC2A 4UUNA 5KWJA 5BWLA 4E5MA 1M1NA 1EFDN 5EYLA 1GR0A 4BTLA 3OCYA 3N5CA 1J39A 1ZIOA 4AG5A 7GPBA 2QN1A 4GOMD 4RZUA 3TAHA 2F00A 3NTXA 1SJ9A 1N3IA 3ZYZA 3ZJVA 1KFKB 1R4ZA 4IZOA 4LZWA 4U8HA 3PG5A 4ZOEA 3PUJA 4GBMA 1HT2E 4HRNA 4FN4A 4OYHA 4YMTA 1QIDA 3LDFA 1PU2A 3F67A 2KBFA 1MMFB 5M34A 4MO9A 2W11A 1H2VC 3SF0A 3FI9A 3CLUC 4MARA 4D9JA 3VKHA 3FCSB 1QFXA 2C9ZA 3PGJA 4KIJA 4PRZA 3RJ9A 4J1TC 2BWJA 4MKRA 3AEXA 4QYMA 3V8MA 2GEUA 3GRVA 2WFMA 4IFIA 5CA1B 5JSQA 4W1SA 4CM6A 2QTBA 1FDWA 4LF9B 5JYCA 3H4MA 1O95D 4ZP1A 2GT1A 1Z4JA 1L5HB 1IM8A 5GIOE 4LCTA 2BAGA 5HRAA 3JQAD 2AX4A 2G9NA 1KJQA 2RI1A 3M4JA 2RGXA 3PLRA 4TTIA 3EVNA 4DSTA 1KJYA 1Y5IA 1E2HA 3GRRA 2JEZA 3DC2A 3UCFA 1VE7A 5ICMA 4MPPA 5FNZA 2D59A 1ESMA 3S99A 1HE4A 3T7AA 1D07A 1KIFA 3DXMG 1CUVA 4B82A 1AHHA 1XTIA 4ZICA 5JEEA 3N7UA 5KAPA 3R9WA 1UC4B 2Z2YA 4WH0A 3WGLA 3M1YA 3WKEA 2CLLB 2JRLA 2ZBQA 3FPGA 2QN7A 3BWVA 3HKBA 1ID1A 2GBCA 2XQ0A 3OE1A 1WG8A 2WSSD 3VU9B 1UBHS 4DDMA 5BXQC 5ICCA 2R79A 2A3RA 3U9TA 2OXCA 5F2NA 2C31A 1RP7A 3O1IC 3M4YA 2WF8A 1H6PA 4KKVA 4BE4A 1Y6IA 1E9DA 3T0FA 3USCS 1RYYA 4GKBA 1FSSA 3FUJA 2Z1MA 2CSXA 3LS8A 3QG5A 3MRTA 1FLVA 1FYVA 5HIJA 4AO8A 3OX4A 4EATA 5CYGA 3CH7A 1MVLA 2ZTMA 3EK2A 3JQGA 2EHDA 2W4QA 3CF4G 3K0AB 3SQOA 2DR3A 5F78A 2WB2A 2X77A 4HHEA 1E3IA 3DV2A 4PO8A 1HT3A 3HXKA 3V2IA 5B53A 3WGKA 3BA6A 1OWMA 1GU7A 4LUCA 4HQNA 5LKRA 4LBYA 3HXQA 1ZG3A 3IT0A 1E94E 2BGJA 2CL6X 2FP4A 1XJCA 2HHJA 1JQEA 1U0HC 3D1LA 1R6AA 1W9MA 3IFSA 4O2AA 4PHTA 4Y98A 3H1TA 1X86B 1YH3A 4X7RA 2ZB4A 3R7BA 3W9BA 3NU1A 3CHYA 4EGAA 2OK8A 5DM70 3HB9A 4FGSA 1GZVA 3LXUX 4FE7A 1A04A 3D3WB 1XQYA 3HZRA 4LCBA 1XPOA 2PMWB 4KR7A 3HDXA 4NDZA 2ZWAA 3WNZA 4AJLA 3BD9A 4RHEA 5IKOA 2JPDA 3H7AA 1RCTE 2D00A 2HNAA 3D6VA 2UYCA 1C4XA 1NPYA 4QUGA 1DIGA 1YB2A 2XWPA 5L9AA 4V2UA 3F6YA 4AG3A 1K3FA 4UQZA 1YOVA 2FF5A 2GHIA 3DAPA 3Q8XB 3E5MA 1R15A 2GRQB 1FMJA 1WWKA 4GUDA 3VR0A 4C1BA 3FTEA 2ZRQA 3ND6A 3EFHA 5G4LA 2H65A 5CBPB 2ZJ1A 4PPNA 2GEFA 3NBFA 3R0IA 4NYIR 4YI5A 3I73A 4BFUA 4D56A 1TAUA 4D8UA 2FGJA 2GVNA 2NZJA 3O8QB 2X58A 2H2IA 2R1VA 1JE1A 3GEMA 1OAAA 1K66A 5A4MS 5CBKA 2PUGA 4RD1A 2XQKA 4N5DA 2EJTA 1E89A 4M86A 4KX5A 3NBKA 3ZS8A 5B2EA 2E4YA 2GVDC 1H2WA 2EATA 1B43A 2ZWOA 3VTYA 5C5EA 1XP5A 4LV6A 1X7YB 1QIEA 2VHWA 4B3FX 1Z0IA 3EIQC 2PH5A 2BLNA 5ALWA 1KY4A 1LI5A 3FBWA 3KT0A 3P0FA 2V6JA 3O4RA 3R7RA 1V3TA 5ALDA 4S04A 2ZI4A 5AJLA 4MI6A 2OV4A 3T7IA 1G4AE 3RU2A 1DADA 1UQUA 3IRUA 5CMWA 1ZDMA 2FEWB 2LUOA 5T7BA 2EW1A 3WA7A 1EX6A 2EQXA 4FMCF 2GEVA 5BN1A 2ZVDA 3MJWA 2D5IA 3W3ZB 1YASA 2ZJ8A 1WCIA 5AQBA 1SPBS 4MR8B 4BEVA 3S4YA 2OSVA 1L6RA 3BMOB 3O8QA 3GCDA 4Q9DA 4BHTA 3D8BA 4G1BA 3T1TA 5A4DA 3DDOA 2ZE8A 3UJ6A 1GCAA 4RZ2A 2AUTA 3TGOA 1SKAA 2NN3C 2YXEA 4J4TA 4MVJF 4TSFA 1TNUA 4I08A 4WXYB 1EWVA 2HNBA 3MEKA 1JWGA 1I2AA 4KW7A 3P9YA 4R7GA 3WZ2A 5DLYA 1AB5A 4M8LA 3SE7A 3T7CA 3PQ6A 4YUVA 3IOBA 3GT3A 1RBMA 1FYWA 1TK2A 3JASA 4D9HA 1CG6A 5CM2Z 3K9HA 1HOXA 2A8YA 2PX6A 2PMCA 3HEBA 3QELA 3GJTA 4B2IA 1XA4A 4U2EA 1SM4A 3OLZA 4KO4S 5K0SA 1YTUA 1QC5B 5FTJA 4CRWB 3RO7A 1PJRA 1YZGA 2XQGA 4KVGA 4K6GA 4YCLA 3G3EA 4DSZA 2FG7C 1Q1AA 3D6UA 5L3SB 1WVMA 4R01A 3ZYKA 2JGMA 3GPIA 4QOHA 1B14A 4TV9A 2NXNA 1KTVA 4MRUA 1QHSA 3FVTA 3IILA 4GA0A 3IAM6 4HPXB 3ZCQA 5AW3A 2XMQA 4LOJA 3C3MA 1NA5A 5J1TB 3LBHA 4QBFA 1P2SA 4L3VA 4U6NA 5LNK1 3B53X 5EGSA 3KXKA 1TU4A 3SJAA 2IFTA 2NQTA 1YR3A 2ZXUA 4Z54A 4FNMA 3DL4A 1FW6A 1RKQA 2XUIA 4CLRB 2RCYA 1GPNA 4R69A 5HQ3B 4E88A 2FCRA 3QQ5A 3I9KA 3R7NA 4AKTA 4MA0A 2VT6A 1T2AA 1UK6A 2PSJA 2YBDA 4I66A 4ZQIA 4KYTA 3V97A 3QXHA 1RBQA 5F7JA 1KA9H 1JMVA 1O6GA 4TUUA 3VJLA 3Q0TA 3R7AA 3DUFA 4YV7A 1D03A 4FUQA 3L7BA 2ZT7A 3O21A 4TRRA 4B17A 1V96A 3DBLB 4QT4A 1R12A 4UD2A 2F1IA 1AO0A 5FQ7A 1UKCA 2CLCX 2JLSA 3D0RA 4MGEA 4TSRA 5EIOA 1QR2A 3B9RA 4FM9A 1CJVC 1GL3A 2Y67A 4JCCA 2C92A 3AW8A 4HWSA 2Y1KA 4BX3A 4AAYA 1MRSA 2ORED 2VK2A 3LVQE 2NZ8A 5BNTA 4X66B 1HE8B 4ALKA 3RT1A 3E8MA