4K03A

Crystal structure of drosophila cryprochrome
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
534
structure length
529
Chain Sequence
RGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
molecule keywords Cryptochrome-1
total genus 163
structure length 529
sequence length 534
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4k03A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4k03A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4k03A01
3FH0A 2H2AA 3MLAA 1JILA 2GOYA 4MW6A 1GLNA 3IOBA 1KP3A 2RD2A 1N78A 2AZXA 3Q4GA 1YIDA 2D54A 1ULHA 2A1UB 1CT9A 5H16A 2QTMA 4KR6A 1O0BA 1OD6A 1KORA 1GN8A 2J5BA 1P7PA 1PFWA 1QU3A 2PXHA 1U3DA 1NUSA 1Y42X 2E89A 3DPIA 3SZGA 1LW7A 1J20A 1EE1A 2IP1A 1D2RA 4E1AA 1IQUA 1IFXA 3IOEA 4MWEA 3ND7A 1G8GA 1X6VA 2A1UA 4YP7A 1WOYA 1VBNA 3VU8A 3AIIA 3IUEA 1O97D 1TYBE 2GKSA 3PNYA 4DLPA 4MW1A 3L93A 1WXHA 4KKVA 1JIJA 1O96B 1NI5A 1WXEA 1LI5A 4MW5A 1U0BB 3X1MA 4PBRA 4EFKA 2YWBA 3IMGA 4HJRA 1QNFA 1TYAE 2WB2A 3S3TA 3N05A 2J09A 1PG0A 1N2BA 1MB2A 4U8HA 2OV4A 2X1LA 4RUKA 2NZ2A 2PIDA 4GU5A 3IDFA 5DB4A 2PZAA 4EG6A 4L2IB 4MUNA 4DJAA 3A04A 2X0KA 1S4MA 1J1UA 4BWVA 4PBTA 1LI7A 1O96A 1EXDA 2QJTA 1OWMA 3X1KA 1K97A 4F3RA 5LM3A 4NDAA 3CVUA 4ZT2A 3IVGA 3DV2A 1H1TA 2G36A 3N2YA 4ARCA 2CFOA 1J21A 1EJ2A 1I2DA 3OP1A 3CLTD 1TQ8A 3G6KA 3LE8A 3M5WA 5TEVA 3TNJA 3DLAA 5K0TA 1K92A 1YIAA 1MOPA 3MMXA 4XSVA 2CV2A 1MAWA 1XNGA 4EF6A 3GLVA 2EJCA 1XJQA 1O97C 4EG8A 3D6VA 3RHSA 2Z09A 5J59A 3TZLA 2JA2A 5IJXA 3Q12A 2DETA 2DXIA 1OWOA 1F9AA 1SURA 1A8HA 4NZPA 4MVCA 1T6XA 3FOCA 2HZ7A 3UK2A 2X3FA 4R2LA 4DE5A 3ZUGA 3ZGZA 2YXNA 1X8XA 3LCJA 5FNZA 4XFJA 2A1TS 1EFVA 1O94D 3HFJA 3IMCA 1O0CA 3CVYA 2O5RA 3N8HA 3RFFA 4ZCTA 1M8KA 3IUBA 2V0GA 1M8GA 4ND7A 3PXUA 2Z3VA 4RPIA 4DDHA 1R6TA 2JANA 2A7XA 3H9BA 1MJHA 1JEEA 2RE8A 1COZA 2QJOA 2YY5A 2AG6A 4JFAA 4MW0A 3P52A 3IODA 1IH8A 4J75A 5J5AA 4PY2A 1K4KA 3CLUD 1JECA 3ILVA 3UC5A 4MW4A 3ND6A 3UMVA 4K03A 3D6UA 2DR2A 1R6XA 1NYLA 4MQ6A 3HV0A 3MXTA 1RQGA 4I6GA 4KR7A 2HGZA 1ZH6A 4KPUB 1KH1A 4MLPA 3GUZA 2EL7A 1T9GR 3IH5A 3RJZA 1Q19A 1ILEA 3FIUA 3G59A 4MUIA 4ZCSA 4MUGA 1WZ2A 1JGTA 4GRIA 1VL2A 4MWCA 3SP1A 1OWLA 5HG0A 3HZRA 4EG4A 5K0SA 5LLTA 4ZT3A 1N2EA 4CT0A 2A84A 3TS1A 1N1DA 4YP6A 3PNVA 1MBZA 3P0JA 1V8FA 3KT0A 1Q15A 3LOQA 4NAUA 5JBNA 1MC1A 2QJFA 4U7JA 3HMQA 3P0HA 4K0RA 2CV1A 2B7LA 1WQ4A 3L92A 2CYBA 1QTQA 3AG6A 1QJCA 1O6BA 4QREA 1JZSA 1WKBA 3KT8A 1ZH0A 1IRXA 1EFPB 4MUKA 4Q16A 1GTRA 5DK4A 2DPLA 3IVXA 5H7XA 1PG2A 1NUQA 4YMIA 1KQPA 2D5BA 1I6KA 1EFVB 2CUZA 3UOWA 4I6EA 2QTRA 2TS1A 5KWVA 1T6ZA 2XRYA 1OBCA 4G5YA 1EUYA 1JMVA 5FO0A 3PRHA 1KP2A 2NSYA 1O95C 3IMEA 4DDKA 2J07A 1WXFA 3F3MA 2C5SA 1M8PA 3CLRC 3NBKA 3RK1A 2JAXA 3HGMA 3MUEA 1KKUA 3COZA 1U7DA 3AKZA 1JIIA 4JXZA 1YUNA 4MAFA 1QRUA 3K32A 3INNA 4YP5A 2A88A 3HL4A 3SEQA 3MLBA 1F7VA 1HYBA 3GMIA 5F23A 3X1JA 1V47A 1ZJWA 3QE4A 3KT3A 5FO1A 1FYDA 3CLUC 4MW2A 1WY5A 1MRZA 1BS2A 1M83A 4WNYA 4EG7A 3A2KA 3SZ3A 2A86A 2OQ2A 1I6LA 1NUTA 1U3CA 1G59A 4ZCQA 1QU2A 3KFLA 3SYTA 1O5TA 1KH3A 2DEUA 1G8FA 1U7XA 1IVSA 1IQRA 2QTNA 3NV7A 1TFUA 2CYCA 4MWDA 2VTBA 1OBHA 1NZJA 3CLSD 1XNHA 3ZXSA 4JXXA 3U1VA 2ZUFA 2QUJA 1JIKA 4QRDA 4MUJA 1TEZA 3DO8A 1O94C 2DERA 4MW7A 2J08A 3CLRD 1QRSA 4F4HA 2ZP1A 2VXOA 4J76A 3SEZA 2DUMA 1N75A 3FETA 5TS2A 5TGTA 2O8VA 1KQOA 4R2MA 2AKEA 4FZJA 4OUDB 2XRZA 3COYA 4S1OA 4XFDA 5AHWA 5HUJA 4MW9A 1J70A 1EFPA 3H05A 3N9IA 4TS1A 3CVVA 4UZFA 4I6JA 4KR9A 3VGJA 3ISJA 4ZT7A 1YI8A 1N2JA 4QBTA 1I6MA 1WQ3A 4MUEA 1JEDA 1NURA 5KCMA 1J1ZA 4HK4A 1VBMA 1OWNA 4MVWA 4CDMA 1ZUNA 4MWBA 3FDXA 1DNPA 4CQNA 3CLSC 4ND6A 4OUDA 3A4IA 2BYTA 2IJGX 1N2GA 4HJXA 3H99A 3JXEA 2QUHA 2CSXA 3CA8A 2IELA 5DEOA 2A1TR 2QUIA 3KT6A 1N3LA 2PG3A 3FHJA 2A4MA 1J09A 1JZQA 1T6YA 4WSOA 1WJGA 2WQ7A 3ND5A 3RK0A 2CT8A 1OWPA 1MAUA 1GTSA 3AL0C 1T9GS 1WXIA 1M8FA 2CYAA 4NX2A 2BTEA 3UY4A 3ZJVA 3PNBA 4MULA 3CR8A 1VBKA 2I1LA 4JYZA 3IVCA 4G5FA 1KR2A 3E27A 4MVYA 1QRTA 4U63A 1N2IA 2Z08A 5IHXA 4NATA 1H3EA 1PFUA 3COVA 5LFAA 1NSYA 4EGAA 1UFVA 1GPMA 4UZEA 1Q11A 1WXGA 1PFYA 1GZUA 1NUUA 2D13A 4NAHA 1XNJA 1N2HA 3QTBA 1VLHA 3Q10A 4KPUA 2V0CA 3K9WA 4CDNA 4ZT4A 3RBAA 4ZT5A 1TYCA 3ELBA 4JZYA 1NUPA 1EUQA 1YULA 5KHAA 3IOCA 4EG3A 3TZEA 1GAXA 4ZCPA 2R5WA 5J58A 2WQ6A 3P0IA 4Q93A 4H3SA 1N77A 1B6TA 3FWKA 4G6ZA 4EG5A 1K4MA 5TEWA 2PZ8A 1IHOA 3H97A 4DNXA 4EG1A 3COWA 3QTTA 2QUKA 2J4DA 4X0EA 1R6UA 3TQIA 4R0NA 3AFHA 3FI0A 1F4LA 2VTBB 1YUMA 1KH2A 2YWCA 3C8ZA 3VRHA 2GM3A 2E21A 4MUFA 1QQTA 1JHDA 3OTWA 4ZCRA 3H9CA 3AG5A 2WSIA 1TYDE 1F7UA 3A05A 3SDBA 3FG9A 4L2IA 2DLCX 4P2BA 4HPWA 1NP7A 3NBAA 3ZJUA 2PZBA 1PFVA 3G5AA 4YBRA 2HMAA 1KQNA 3TQOA 3ZIUA 3CLTC 4A91A 2PFSA 4ZT6A 3FNRA 3ZJTA 1KAMA 4DDMA 3BL5A 2ZUEA 5BNZA 3FY4A 5EKDA 4AS1A 4OJMX 4MUHA 4ARIA 2H29A 4AQ7A 1G8HA 1FFYA 1N2OA 1MB9A 1O95D 1IQ0A 1H3NA 1KAQA 4MVXA 2X1MA 2E18A 2CV0A 2E0IA 3ZXIA 1M1ZA 3CVXA 3I05A 1H3FA 3CVWA 1Q77A 4PBSA 5DASA 5HUHA 1M8JA
chains in the Genus database with same CATH superfamily
4IH1A 4J7WA 1BU5A 2WSYB 2DZNA 2DWZA 1GNTA 2PGXA 3FR7A 1Z39A 3GOQA 3FULA 3O3NB 2RD2A 1H8HA 4M1EA 1HZ4A 1P1KA 4HRNA 1PR0A 4MXDA 1YIDA 3GBVA 3L0IB 3OLXA 2GM5A 4AURA 1EXVA 2J3HA 4KR6A 3H5WA 1WHTB 2FDXA 2QL7A 2B4QA 5T3RA 1R8SA 2BMFA 2FG5A 4IQGA 4PSKA 3RYFB 3IPYA 3X3HA 5A2GA 2PX3A 5A7HA 1ZM7A 4BKUA 1XAHA 5F7XA 5EL0A 4GKVA 4LZJA 5HI7A 4B4DA 4YONB 4A2QA 1IFXA 2A0YA 5AIJA 2LW7A 3WLHA 5EYPA 1JAIA 1QYMA 2WJPA 1R6AA 1O97D 3L0ZA 1WLSA 3PNYA 5KOHA 4MDEA 2P11A 1GTL1 4CYMA 5A5DA 4HQNA 1ZD5A 5AM3A 4KOAA 1RRMA 3R9KA 3GA5A 1Z13A 2VDPB 2IDKA 1SUPA 3UXEA 4YLEA 4MW5A 3OZRA 2IOQA 1LLQA 1U3WA 4WX2B 4EKDA 3L8EA 1HG0A 4O4LF 4B3SB 1AHNA 1ZOIA 5LWQA 3QQ5A 2MSEB 4AY2A 3RANA 1EVIA 4QICA 2OENG 3VO2A 1NL4A 1R00A 1QNFA 1T6BY 3ODPA 5B37A 1J9ZA 4C76A 3FSGA 4BFUA 1NZFA 4WECA 1S2OA 2H59A 2RHCA 2RBKA 4TPKA 2R6FA 4AN1A 3P9QA 4TUYF 3U7RA 4OUKX 5GIPE 5B6PA 2VZ8A 1NJ6A 5CRVA 1Z0DA 3E8XA 3FXAA 3G2OA 3QNUA 1K5PA 3V3KA 1JTVA 4B81A 4NFLA 3FCUB 4JCOA 1Z06A 5B5SA 4L2IB 5I3ZA 5H3LA 3LL4A 1C1DB 1N4RA 4DJAA 3E9CA 3P4UA 3DSRA 2Q8QA 5CNJA 5FR2A 2PUCA 4BLUA 4QM6A 2QUAA 1NVXQ 1FDTA 3HZOA 4LYDA 4TN5A 3UXHA 3KDPA 1E2UA 3HKDB 3ZJYA 4RWEA 1R1DA 2B0CA 2PGJA 3JATB 3R4VA 1FTSA 2AN4A 4JBNA 5KNBA 5LM3A 5IT9A 1PJCA 3CX7A 1F2DA 1H1TA 1XELA 3L7DA 5CG2A 1AH2A 3HABA 2DBYA 2J33A 4IICA 5E0KB 3F4LA 1UK9A 4EMSA 3EDYA 1EF1C 1SC4A 5ULLA 3CLTD 4O4JA 2PPLA 3ON5A 3MB8A 4Q12A 5KUTA 2A9QA 4YHBA 4JI5B 3CR3A 1F8UA 1JRLA 1MOPA 1L5VA 4H27A 4XSVA 5DI3B 4AY4A 4K9LA 4Q48A 2RKWA 4BPRA 3TKAA 5CYOA 4QFDA 3W7VA 4B3GA 1XDBA 2ID7A 4JOCA 1IHYA 5F73A 3RRBA 2HEIA 4JT2A 4Q9DA 2QTZA 1BFDA 4QRIA 2QRVA 2R03A 2AXUA 1ZZEA 1W76A 4C6TA 2UXCB 2GZ1A 2W2LD 2XE4A 3CRNA 3C39A 3FOCA 2ZWAA 4HLDA 1V5WA 4U02A 4JQOA 4BDTA 1WPXA 2P0AA 4RHEA 3L6OO 5TPZD 1SOAA 1Z2NX 2O54A 1ZHHA 1XHEA 2AFHA 2V3WA 5EP1A 4CDGA 2X38A 3GLGE 1E9EA 2NO9A 4EPWA 2DCMA 4F6LA 4WBNB 1S70B 4ILIA 4QOEA 4HY3A 2WIGA 3RIEA 3ED5A 3F3YA 3G2IA 4S0ZA 3S27A 3CUYA 3FPCA 2ZJBA 2EKQA 1G7RA 3QELB 5CIQA 3I0MA 2FEWB 3PI7A 4K1XA 3UT8A 2J3QA 2A0FA 5JH7B 5CA1A 1PDVA 1MJHA 2R1TA 3CTPA 3O74A 4R1OA 4UNRA 2IEGA 2F8TA 1JEEA 2DKNA 4B34A 3ANMA 2PVSA 3TOXA 5BPHA 4A10A 1CR0A 4UHFA 1RCFA 2X7XA 2L6BA 1CVRA 4HRAA 3IODA 5KTYA 3SX4A 2X9LA 5J5AA 2EL9A 2VUIB 2Y4OA 4R2WA 4DV7B 1HSZA 4IEEA 5HOEA 3ULEG 4UM7A 1SBIA 5HIMA 1B3RA 2FRXA 4L28A 4L3WA 4QQNA 5CVTA 3SLRA 4ZV7A 3OT1A 4RTPA 4IO0A 3ELDA 1W2GA 3NQ41 4YDOA 1NP3A 4IL5A 1VKRA 5HZMA 1PVOA 4UOEA 3GF4A 3HXBA 5DI9A 4HZUA 1NVWQ 4MA5A 5H82A 2WA2A 1PF7E 2ZR0A 2EIXA 1OAOA 4PTLA 4ZDKA 3QUBA 2O1EA 4N01A 3ZE1B 1KBZA 2HGZA 1N8KA 1V5IA 2XADA 5I48A 4RZHA 3PF8A 2RFMA 1G0NA 4N48A 1AE1A 2IF4A 2VP4A 3AF1A 4IAOA 3U2QA 4A5OA 3ECSA 4R8LA 4DYVA 4ZCLA 4NVRA 1ND6A 2C3MA 3CXRA 1C4WA 2M98A 4WFQA 3E5NA 1W4ZA 3HWWA 1KJIA 3VO8A 3ZCTA 5IH7A 5K4HA 4LF6B 2Q4RA 3I3NA 3QFHA 4PG7A 4PSAA 1HDGO 2Y77A 4KRGA 4UUAA 2BEDA 1A50B 3OUTA 4KWCA 3FLEA 3K0AA 3QUQA 2AR0A 3UXYA 1N1DA 1PGPA 2CHXA 1ELOA 1GFSA 1SBZA 2H1CA 4XOIA 5EXXA 3TOSA 2XHZA 2L0TB 2XECA 3WGQA 4AMYA 4OJNA 1SY7A 2C7QA 3RO7A 1C0KA 1FU8A 4HUTA 1CVIA 1V5EA 4IXMA 1Q0TA 2XOKA 1WXXA 1NVTA 1RXWA 4R0MA 3IPRA 4QDUA 2V0NA 4ALJA 3HYLA 2PQ6A 3AP2A 3NUGA 4RNDB 5KHOC 2C9DA 3ZZNA 3EOBI 2WAAA 3INTA 1RRKA 4C3VA 2YN4A 3IIJA 1UP7A 2V98A 5EIFA 1P5JA 2I3DA 1FXSA 2FA9A 3AILA 1WQ4A 1IIBA 3MGKA 5KDDA 4ETNA 1CULC 1DX6A 3ML9A 1JZSA 3C3DA 1WVMA 4XQ9A 1A76A 2IYLD 1OY3D 1K6XA 4P54A 5FZSA 4NXNB 1C2TA 3Q7TA 4NH0A 3E05A 4II7A 4I1RA 4MUKA 4NFYA 4LHWA 4HGNA 4QPZA 3EFBA 1Q0ZA 2XVAA 1U8FO 4YJDA 2R8PA 4JBYA 5BNIA 4QARA 2ID4A 4O4HF 1AUVA 4RVOA 2JATA 2WJJA 2C31A 5D5QA 3HXFA 4HOTA 1Z0SA 3GDFA 5GIOE 5IHPA 3OE4A 2DUWA 1M2HA 4G5YA 2RSLA 5EJAA 1UT5A 2QKYA 3T1VA 2LSVA 4NMMA 2YIDA 3FNHA 1H0HA 3O95A 2O0JA 4OHMA 5A62A 2EW1A 4D3XA 3QWWA 4BNLA 4CKBA 3I45A 3NBMA 3V1NA 2ZT7A 1M8PA 3H5RA 1ODKA 1U8UA 2QK4A 3KAPA 4EYSA 1UJ2A 1US8B 3KPWA 3LPAA 4HYQA 3PKZA 4GPTA 4KQKA 3M4YA 4LRQA 2CXOA 2X0RA 4WN9A 2G82A 2Q9AA 5E6UB 1XZDA 4G85A 1HTTA 2YMPA 4UTNA 5ELXA 3B7BA 2PKRA 4C0JA 4KXKB 4AQ7A 3AI2A 4YP5A 4CMCA 2A88A 4FFPA 5G3YA 2PJRA 3PYXA 2TSYB 1RKUA 1ZJWA 4CLXA 2BEUB 2I4NA 3IXEA 4MWTA 1B2RA 3BRSA 5I7WA 5TVGA 5E6UA 3QWPA 3HC7A 2GF2A 3IQXA 3KVNA 1ZONA 3W6NA 4EECA 2Y1XA 1K6MA 1TN8A 3N2LA 2JW5A 4HX5A 4QODA 3ZGOA 3E58A 4MVJF 1I6LA 3EG9B 2VJDA 2HNKA 5AKLA 5CEJA 4E1BA 3OKFA 2FX2A 1OYWA 4OLBA 5HUQA 4C5AA 1FZQA 2O23A 2ZROA 1IQRA 2QTNA 3CW8X 3LY5A 5HMLA 5K20A 3GEGA 3BERA 3PFIA 3UM3A 3A6FA 3SLGA 3C48A 4UOQA 5EMJA 2YZKA 1B00A 3WX0A 1IY1A 3L1KA 1L4BA 3TM4A 1QIKA 1QC5A 2EBFX 5H81A 3AS8A 5HF8A 2LKDA 1YVUA 3CU5A 2X5NA 1CU1A 2BVNA 3OU7A 1R6VA 2LO6A 4GT1A 4Y2XA 5CM9C 2EQBA 4AVYA 3IBEA 4RMGA 4I43A 3LBAA 1E0SA 3ETLA 3IKMB 5CDFE 1KBQA 3U7JA 3X44A 4BLSA 2NMVA 3RSZA 4FD2A 4DWVA 2CUKA 1DAHA 1KXZA 4HNAA 1QRSA 1RAHA 3LHFA 3QFFA 2GYVA 2FG7C 4BVJA 3DL4A 4BFLA 5K3FB 5TT0A 2HE0A 1XOIA 3HI4A 3OIFA 5BNTA 5FA8A 2VAWA 1ODIA 4O59O 3BORA 3U09A 1KL7A 2VHYA 4Q3BA 4HB4A 1V6AA 2HA5A 2JBHA 3D7RA 1VHLA 1KJ8A 2WUEA 4W9NC 3H4MA 4XFDA 2PNJA 4BMXA 4EKEA 4TUYB 2F3TA 2DP4E 4NENB 5F98A 3P9KA 2NVWA 4CMIB 4BFWA 3G8YA 2OFWA 2XZOA 1USKA 3TBFA 3KKOA 5ITVA 4BE7B 1KGDA 1Z3XA 1PFKA 4Q01A 3FSGD 3DZKA 3IPAA 1WQ3A 1XDZA 3OLWA 4JYCA 3UJ8A 4MUEA 3V4OA 4AS3A 4J1QA 5IVKA 5T4BA 3UGTA 1NOIA 3G6WA 5EEHA 3S8YA 3PFHA 2QN2A 2ODNA 1CUVA 3LW8A 2FEPA 1SM4A 2N75A 3OD5A 1PEYA 5CW1A 1PUJA 2V4MA 5AN8A 4DLNA 4QDOA 4EHKA 3QF4B 2I1KA 4W1SA 1UL1X 5FEUA 2FQYA 4CQNA 5MFZA 3M7IA 3NVAA 5DZSA 5EWLB 4N40A 3BIOA 2GCPA 2P9TA 3JV7A 5U4QA 3L77A 2IOHA 4FM9A 3Q0EA 3MTBA 1N2GA 2V4ZA 4MRSA 2WMOA 2GRUA 4RH1A 1YDFA 4WK2B 1WMEA 1GAQA 5TR9A 2VHEA 3G85A 4GL4A 4DUPA 4P3PA 2JAPA 1M1YA 1XU7A 3IAXA 4W63A 4YDWA 2FB9A 1JZQA 3VZBA 3PGXA 2JBAA 3SSOA 3TIFA 4HQ0A 3ZUPA 3V55A 2JJQA 2QRZA 2ZAOA 1XPUA 2IDMA 3CCFA 1KS9A 2R6GA 3L9XA 4LXUA 1A4RA 2C5EA 4JJFA 3O82A 4WCDA 4E5PA 4NCAA 5F1YA 4HLUA 2WK1A 3LWDA 2FUKA 1JMKC 3Q0IA 4HUJA 1RLJA 5D5HA 2WKSA 4TSKA 1BLXB 2LCFA 3RSCA 2Z95A 4TMKA 1VMEA 4I50B 5ALRA 3LYLA 5CM8B 1A8SA 3F7NA 3NFRA 1XVLA 3LP5A 2R6JA 4K9NA 2ADMA 4RGBA 4QE3A 2D8AA 3L7LA 1MA0A 5CPFA 3NBUA 4WBSA 1KDRA 2JHGA 3E3MA 1NRXA 4LJSA 5DM4A 3HTXA 4WZAB 4I7EA 3SQVA 4V2UA 4G1UC 3OFSA 4WOPA 1YOBA 3LZ6A 3EDRA 3LC7O 4WLEA 2VYCA 3DSSA 4PUCA 4IQ8A 3PLRA 3MF4A 4GXTA 2FETA 3VC3A 2G77B 1IXZA 2GA8A 4X90A 5JV5A 2GR9A 3D9IA 4HD8A 1SA5A 4A1OA 2OL4A 1SCUA 3KB6A 4MWOA 4ZT4A 3GVCA 4ZT5A 3TLMA 4JNKA 2OYCA 3AUJB 5DIZA 3KZ1E 3PJFA 2NSZA 2MOKA 3LC0A 5JHBA 2BEWB 4G9EA 2L19A 4ANXA 4F06A 2VT7A 4EG3A 1IMJA 3E6AA 3FTSA 4MYUA 3VYRB 4ENQA 1N0UA 1GG8A 1HK7A 3JARA 5I4CA 2P79A 5CB0A 4L7TA 1ZLYA 1DJMA 3T7TA 1T3HA 4HH1A 3U7HB 3K09A 2HU5A 2ECOA 4JL0A 1E58A 3LVFO 1RRCA 1K4MA 1K7XB 1Z15A 4J91A 1CF4A 2W6JA 3OZSA 4NHOA 4BL5A 1H2HA 3ET5A 1PQ4A 4PFQA 4LWQA 3ESQA 3GEBA 2DYKA 3PFNA 1RZUA 2YQ5A 1W4CA 1HDCA 3GEPA 4JC0A 1NKVA 3IQEA 3NETA 3LS8A 4U3JB 3WLJA 2M1ZA 3ZDRA 5G2NA 2BBWA 3R3SA 2G70A 1EX9A 2BTQA 2D2EA 2FGKA 4NEGA 1HTWA 3G2HA 2HSGA 2HYZA 2QD4A 3DNFA 3NAZA 3ADBA 3NOQA 4KIUA 3Q3VA 1HMYA 1KTVA 2H4XA 4H7JA 4MUFA 1FLNA 1JQ5A 3VUEA 5JMTA 4PQGA 1JJAA 1FQKA 5T57A 4ZCRA 1NZDA 1XD2B 2ECKA 2IPOA 2JIRA 3EA5A 3JQBC 3ZNQA 5B64A 3AG2E 5A5GA 1OI4A 1TK3A 2H4JA 4AJWA 3UWOA 4B82A 1EDDA 3M5CA 4I4TA 2D7CA 2QQ0A 3AR9A 5FWAA 1ZXLA 3ULQA 3QBJA 1TNYA 1OX4B 3BMCB 1N6LA 4B7UA 3H84A 3Q9NC 3WJ7A 1I3KA 3L3BA 4E21A 3KV1A 3WBKA 2OGUA 5GAJA 1CUIA 4FJYA 3RFVA 2W2OA 2BBOA 2PZKA 3KEQA 1L5FA 4RF2A 1I7DA 1FS5A 2H85A 2YX1A 2ODQA 3C6ZA 1YV9A 4N8EA 5AOAA 1H8HD 3IT1A 4QASA 1XVIA 4ZJYA 2LE0A 1NPYA 3BTSA 4JSTA 4AS1A 3GWZA 1ZZGA 4ARBA 2H2GA 1AG9A 1SC9A 1DB3A 2FLKA 3DF9A 2B94A 2J9XB 3K9NA 4YGYA 4YRZA 2P2GA 2XPCA 3HVEB 3MGBA 4Z9XA 3VLFA 1Y9JA 2B4AA 1UF9A 2X86A 4Y18A 3DL2A 2GCOA 4N3GA 3IKOB 1MQSA 1E3QA 1W8IA 4MVXA 3AR2A 4PRLA 1XK6A 1QYXA 2FW9A 4JZKA 2XMPA 3IA7A 1OH6A 3FRHA 4D96A 3AP3A 2ZGVA 3H9JA 5DCYA 3GIWA 1UPFA 1TF7A 2P3SA 3ZYZA 5ALVA 4F86A 5KNCD 3N0RA 4O4IB 4CYMD 1QQEA 1P9OA 2UZIR 2IYUA 1NDHA 1YBMA 2WYHA 4KFTA 2EP8A 5CYFA 3M6VA 1UBKS 1YS7A 4LXTA 3TQTA 3ZR4B 5IZ4A 2IYFA 3CO5A 3L82A 3GNTA 3TPZA 1M34E 1W5EA 1O89A 2RH5A 2VDWA 2NT4A 4L3OA 3TB4A 4AJ1A 5ICCA 1BQEA 1YGPA 5DHTA 5BW6B 4BVAA 1OLSA 1I4TD 5AWFC 3D9PA 4JI1B 3RNOA 7GPBA 4G41A 1ABFA 1EDBA 2WD7A 1EFTA 3WDSA 4DTIA 1JE1A 3DFKA 3BXGA 3E7PA 4PHFA 2A1UB 2CB0A 1CT9A 4NEHB 2P9BA 2C99A 4IIXA 2INGX 4MCIA 4FP7A 2LRHA 3OFJA 1TC1A 5L40A 4DCTA 3L17A 3R23A 4EJMA 4RVBA 1WCXA 2GJAA 3ESDA 2ZB7A 4FGJA 4X20A 4YRJA 5TMPA 1V1RA 1ADCA 1KO5A 4UEJA 3MPUA 1V8PA 3MWEB 4ATNA 1CSEE 2G80A 4HOYA 4E1AA 1YMVA 4IMIB 5IARA 2NSLA 3SZUA 1FFBA 4X1OA 1X6VA 3R8CA 4BZQA 2YQ4A 4ZALA 3IXQA 2WMNA 2HBZA 2YUIA 4M3OA 1LD7A 1LPSA 3IJ5A 3GNSA 4OXKA 4PSUA 2ZYIA 4D9BA 4MW1A 4UDXX 1WXHA 1DGQA 1L5SA 2HNBA 4UE3S 5JNLA 2E4VA 1AN0A 3OQVA 4FFBA 2ORYA 4LY9A 1C9DB 4EABA 2VSXE 1X3LA 4HZGA 5ILQA 3U80A 4ZK2A 1UIRA 5ARGA 3QX3A 4L4YA 1A5BB 1JQLB 2I33A 2VDKB 4QBFA 4V0NA 4YROA 1JA0A 2XYRA 3D7SA 5D5PA 4J0QA 2KYRA 1ZK4A 2QTWB 1QF6A 2O2HA 4AI6A 2PL1A 1YQEA 2V7WA 3KHSA 4G01B 3RYHB 4KACA 3LUBA 2HV8A 2Q28A 2R7AA 4HNAB 8OHMA 3QC1A 1R0YA 2WT4A 4DX6D 3QY0A 5IX8A 4QNMA 3TQFA 4DCVA 5TQ0B 4ZAWA 1XHFA 4RKYA 3HVIA 2ZYDA 3JQGB 2BP7B 4OHOA 1DBPA 1ESMA 2VJQA 3FPEA 5HBGA 5EUBA 1S2NA 3E9NA 3R7SA 2AQKA 4G1TA 4XW2A 1YR1A 1QXSA 5EPOA 2QJTA 1NN1A 3ZU3A 3RT9A 1K97A 4B5KA 1D8AA 4ND5A 3WG9A 5JPCA 3T3NA 4NDAA 5IUKC 5CGQB 3CVUA 2FX3A 3IYLW 5CJJA 3U3ZA 3H9UA 3DEZA 4RANA 3ZHTA 2OV1A 5F2OA 4F21A 5CA0A 2BW0A 3ZHEA 1B1CA 3FNFA 3M1AA 2R8RA 1Z2OX 3P0RA 1MH1A 4C6HA 5DYNA 4YAUA 5DNDA 3DLAA 3LTNC 3G2LA 5KO2A 1YIAA 4Z0PA 3DT6A 4BFVA 3U16A 3T5CA 4Q7EA 4U6QA 4R1MA 3HXOA 3EGDA 3IT3A 1C4KA 4UNNA 4UU0A 4GBJA 2Y1LA 4M76B 4BV2A 2FUG6 4LBVA 5M5BA 3BH7A 2WWTA 1RWNA 4IFBA 5DGTA 5FJIA 4X62B 1MU0A 4UNSA 4NZPA 1PDOA 1S8OA 1T6XA 3ZW7A 2CLCX 2X3FA 2ZIUB 3HKCB 3JZMA 2GCIA 4I55B 4ZZ1A 1XZAA 1B15A 3KLPX 3Q40A 1KFKB 3DPSA 2A1TS 1H93A 1O94D 1O0CA 1HG5A 4EL5A 5K09A 4ZVUA 1Y7LA 1PJ2A 5BQ5A 3TGWA 3DHWC 3T5GA 3THSA 5A71A 4Q9JA 2DQYA 1Z5SC 4ABNA 4PCVA 3ZKWA 4KXUA 4H7EA 5C2YA 2G1UA 3TEFA 3LPLA 4K28A 1D2MA 3PC6A 4C7JA 9ATCA 5EEGA 4LDAA 4FC8A 1QHHB 2K2QB 4GQBA 3P45A 4INZA 3GQVA 3RUHA 4BMCA 4X63A 4HGRA 1KS2A 3WISA 2PRIA 1ADYA 5CXXA 1JHZA 3ZD6A 1K4KA 2IU6A 4B4VA 3HO8A 1SD2A 2L17A 3KQYA 3CH5A 1UFOA 2C8VA 2Z2JA 3N3BC 4JH0A 4MW4A 5HIKA 2FPRA 3WQBA 2ACEA 1YQXA 3KLBA 4HLNA 1P1RA 1TK2A 2AOWA 2EKBA 5JJIA 1I13A 1AQLA 1MO2A 3AYXB 4D4JA 5CCLA 3G5LA 2VNAA 2C20A 4MGHA 2GDJA 4L9PA 2ALJA 4UM9B 2QMYA 4DV6B 1WBJB 2LDBA 4Y7CA 4R3NA 4JLSA 2ANCA 1A5AB 1DT5A 2QYHA 3KSBC 3E4BA 1GDDA 3U5TA 4LF8B 3N58A 2QAIA 2O8FA 2MCFA 4KX3A 2NUBA 3RRMB 1PL6A 2H1LA 1Z2EA 1SELA 4R2IA 2BHLA 2IHYA 4UU7A 2E4WA 4YMSA 3MAJA 4BV3A 1OHHA 2WXKA 2QGFA 1WZEA 3OEHD 3HKEA 2HPHA 4QUDA 3ACCA 4QTTB 1N5OX 3L4JA 3UK0A 3KKEA 3OCUA 1IY0A 1A97A 4FDMA 3TLEA 3I4GA 3L4BA 4GMKA 3LEWA 3DFFA 4C4RA 2XENA 1SC1A 1IDN1 1F9EA 3RJMA 3WK9A 1DLIA 2HJGA 1H4SA 1ZISA 3QG1A 4O1PA 1K1AA 2AXEA 3DLHA 3JYHA 4O02B 4X91A 1UC5B 3GNQA 1NVAA 3A1NA 4OHRA 2XGSA 1EHYA 4JHXA 4S0XA 1U2EA 4IX1A 1GYRA 2XNDD 3K4PA 4KX5A 2RHLA 3OTHA 2VF2A 3A6LA 3F6YA 3HJTA 4TL9A 2Y1FA 1UXIA 2XMGA 2CVPA 2IZ5A 4I9UA 4CTNA 3CKMA 4RA6B 3V4LA 3J81A 4Z4QA 2NUPB 4XRGA 1THMA 3QVOA 2DH5A 3SR0A 1F6BA 4MYRA 3ZX5A 1R9GA 3IBFA 4MUMA 4QBGB 3RS8A 1MV5A 4F5EA 2W22A 4QGAA 8AT1A 2I91A 4DLQA 4Q19A 4X60A 3MOIA 1W93A 3IVXA 1H22A 3UWMA 2P9UG 1QHFA 2Z2XA 4FI3C 4UOZA 2Y3AA 3I2IA 5C53B 1I2BA 1C7JA 2NV0A 3H16A 4NJEB 4KZCA 1D09A 1YT5A 2J9FB 4ZQEA 2V7EA 5FQ4A 3RCBA 1OAOC 3CZRA 2G8LA 3LK6A 3U39A 1MEJA 3ZVVA 3FRIA 1VDYA 2FW0A 2JGDA 4RJIA 4FGLA 3WBJA 1OYOA 4NNJA 1ZD9A 4TT3D 3P1JA 3DEIA 4LIPD 1JMVA 3PPYA 4IJVA 1IOVA 1QCDA 2AI1A 5GOTA 5L8VA 2JH8A 4POAA 1I7QB 4U1RA 4DDKA 1NXPA 3NG1A 1N5LA 1U9CA 2CXTA 3LBFA 2E9SA 5CK5A 3CZ9A 4JJIA 1C7IA 1NJGA 5J2UB 1JLMA 1YBVA 5K6TA 2XUHA 3JXIA 4CV2A 3UT6A 3JW8A 2H6FA 1NVVR 3HJUA 3EMBA 1VCHA 2HSZA 2RI0A 2FPSA 2YOHA 1JHXA 4KODA 2X23A 3RRZA 4JXZA 2OXFA 4S2EA 3HO6A 4K87A 1KO1A 2A5LA 4IFIA 1W85A 1LVGA 4JU9A 3CFYA 3LIPA 4TROA 1NXVA 4IOLA 1M1NA 4PONA 2C2KA 3K8OE 4RKQA 1IL0A 2ZQ5A 3QHPA 3WK7A 3ZLBA 4D9EA 3RVKA 5I7VA 1KEEA 4ZEXA 5SY9A 2FSVC 3KT3A 4U7WA 1IEWA 2KX7A 3W78A 3AB3A 3P9ZA 5A4KA 3PEVA 1MOSA 1E92A 2MMGA 2MYTA 1VA5A 3PIDA 3EISA 5CP8A 1ZG3A 3ORRA 2QDKA 3OOSA 1YJAA 3COPA 1K27A 4IRUB 4PQEA 4BZPA 3THOA 2OCYC 5E95A 5BYAA 2WD7B 1KYYA 1VKNA 2O7VA 1KH3A 1U28C 1Z6ZA 2J3IA 3E22A 1T8YA 4LWOA 5NLLA 3R8XA 4NY1A 4WTOA 1RZ4A 4YCCA 2NACA 4MS4B 2YFHA 3F7MA 2CYCA 2SHKA 3KBBA 2R6CA 1S2MA 3LK7A 5AJDA 3CN9A 3PL5A 4MLDA 1NQTA 4HVCA 1QCCA 2FW1A 1FPMA 1NZJA 2ZIFA 3K1AB 3TMYA 1JF8A 2J3EA 3FDJA 3SVTA 4GMFA 4B7XA 3R6WA 4J6IA 2UKDA 1UK7A 2PANA 1SVUA 2O2DA 1RWVA 2BEUA 2F1RA 2OBMA 3MZ0A 5JHAA 4HOSA 3ACDA 1H8ED 4IJUA 5F64A 4DCPA 2VUTA 2ZUFA 2X76A 1CUBA 2OCBA 4TWIA 4DA0A 3RWBA 5IYZA 3QUSA 1KT0A 4WA7A 4WACA 1FBNA 4E7OA 4ECAA 4HH3C 1YHZA 3EC7A 3U13A 4KMMA 5BQPA 4YHHB 2PL9A 4RD0A 3UFBA 2JLAA 3MJFA 4NU5A 2YC4C 1H0AA 3HY3A 3OTIA 4LY0A 1ENPA 1FXUA 5JFOA 3A25A 3BQ9A 1T0UA 3EZ2A 1T6NA 1L4NA 5SV2A 4D0SA 3S55A 3OIUA 2VJPA 4R2MA 3AGPA 1DDIA 3GFSA 1PY1A 5DX8A 1CY2A 2PX0A 1IKND 4JLAA 2LD4A 4CM9A 1N2ZA 2VC2B 2WAMA 3D7MA 3O21A 5JG7A 3UF0A 1PK8A 4K2HA 1CRZA 1OPRA 4B4KA 3QOUA 2F59A 2OUKA 3NS7A 4UHDA 4YJ3B 2C0LA 1CXZA 3D7LA 3UK1A 1FMFA 1NNEA 2HI0A 3N2ZB 1S0UA 4UZFA 3WIVA 3I32A 2Y0EA 5CTAA 2Y4TA 2OMKA 2D1QA 4L8LA 3KK0A 1UT6A 4LAFA 4ZT7A 1HX8A 4JR2A 1UEXC 1IJEA 2Q5JA 1S9HA 4AJJA 4L76A 2WZQA 3PUYA 4QD3A 1Y48E 3UICA 5KC8A 2WW8A 3S1SA 2QD5A 4MMYB 2AOUA 1OWNA 5LQAA 2PX4A 2FWAA 2QG4A 1MF7A 4RV5A 4F2WA 2XYGA 2GF9A 2GBCA 1N0QA 1SKQA 3B6KA 2JRLA 1XTQA 4YJ3A 2C8LA 2P35A 5JD4A 4A1GA 3GCWA 4KC0A 2AG1A 3T3MB 1VG8A 4GXRA 3WLMA 1C30A 2P9HA 4EGCB 3FMVA 2IJGX 5CFPA 4XYGA 1TDJA 2FSSA 2Q3JA 3UM2A 5HTOA 4BATA 3EU9A 5ENPD 1R12A 1WSAA 3FGNA 1PKEA 4HRYA 4K88A 4C7VA 4QYIA 1XTSA 1OFHA 4DV0B 2X3MA 4A0GA 4D9HA 2I2DA 4L9RA 4UUQA 1RLIA 2BR5A 3VOBA 1VLLA 4R83A 4ER0A 3HFRA 5LXTA 4EJSC 3SVZA 2RGEA 2A4MA 4XXHA 1VSTA 2IYNA 2CFTA 1JFRA 2NW6A 1N9GA 4G23A 2YS7A 3AJDA 3KAKA 4Z4CA 4J16A 5DT9A 4WJLA 1W1IA 2NWQA 3GP3A 4RY2A 3RABA 5KVCA 1PEKE 1W1UA 2CT8A 1DPGA 3CISA 3ZU5A 4RIFA 4FDLA 2HWXA 4TTJA 4UE2A 4NX2A 2CJFA 3O4RA 2XB4A 1YCGA 3L16A 4E2YA 2Q5QA 1P0FA 1UMCB 2R00A 5AKKA 4ZWNA 5TPZA 3A10A 1Q3HA 5IBCA 4UWKA 1A9XB 3NHBA 2GPWA 4DTCA 3NT2A 3EUFA 1E7QA 3P2BA 4BVFA 4ER3A 5B58C 1QAOA 2FRDC 4JYZA 1J2RA 2EWMA 2YMMA 3IAHA 3APDA 4RVDA 5DP2A 1FFCA 1KR2A 3FOBA 4PLTA 4F4UA 2EC5A 3Q41A 1Z7YA 3GAFA 1L4YA 2IT1A 4OFWA 3GLIA 5DJ5A 4EGAA 1FPQA 4RXMA 1G5RA 2W37A 4LZAA 4CR8A 5FPHA 3FHTA 3T99A 2BI8A 2BHRA 4XGQA 1APBA 2E49A 4F71A 1XNJA 2YINA 1N2HA 4HWOA 2VSNA 3OFKA 4RVCA 5E6RA 1UKAA 3UH1A 4KPUA 4PICA 2YJTD 3M3DA 1FPPA 4D25A 4DIDA 3C97A 4IIVA 2VPQA 3B3JA 2DHCA 3TM5A 4CF7A 1TTTA 3PE3A 1U0RA 1UMDB 1KDOA 1SUFA 3HPQA 4KFRA 2W2LA 2EIHA 3NPMA 3BBLA 4BP8A 5JUWA 2FPPA 3STUA 2BFEB 4Q00A 3T3DA 4JIGA 2XT0A 3UN1A 3MMSA 4A03A 2R8OA 1GZHB 3B3QA 2JD0A 5J58A 2WTXA 2OZEA 3VZSA 5BXQC 1N77A 3L6UA 4UKDA 1RACA 4KLRA 3CUVA 4OEHA 4I4NA 5TEWA 4EG5A 3OAAA 4JKOA 5ENVA 4ARZA 1RLOA 3AEQA 1KEPA 1XU4A 2L18A 4DC9A 3N5KA 1E90A 2DZOA 4ACLA 1EK2A 3NH6A 2KM4A 3JWJA 4I5GA 2FBNA 3O8RA 2YXLA 3IQGX 2FMKA 4PPNA 4Q21A 1A5SB 4PWYA 1YHYA 4EA8A 3U44A 3CZMA 4NOLA 3FSJX 3FX2A 3EFOB 3UXMA 4U04A 3WGYA 1T25A 3RVLA 4V0KA 3OIWA 5COBA 2PBZA 2DLDA 2ILVA 4NU0A 1K0FA 1P3JA 2C4MA 3EW9A 2NAPA 3I09A 2IK8A 4YV2A 3ETEA 5B12A 1KJZA 3ZDZB 2WU1A 2WAOA 1GNPA 1OT5A 1P7YA 3AERA 2JDIA 1K8XB 5CB4A 3RKRA 1SQMA 2GPYA 4O4JF 4KQ6A 1JV2B 3HIZA 5F3WB 3U60B 2FSPA 2H54A 3L1VA 3UT5B 4AJKA 1ZAYA 4DCCA 3TR5A 1BRTA 1W5AA 3NHYA 1QH8A 4IG9A 2I4TA 2MWMA 2Z83A 4MYSA 5CR9A 5G2OA 2PBLA 4ERNA 2J87A 1TKAA 2WSLA 3GZNA 3UJ3X 5LOVF 3T0IA 3T52A 3RT7A 4XX0B 4DDMA 4YC7A 4CLRA 1E66A 1Z0JA 5DLDA 1RXYA 4G63A 4LVCA 2J9RA 3VPSA 5ENOD 3KKZA 1DCMA 4NSNA 1JUDA 3W4KA 3JD1A 4GQAA 2QROA 4MUHA 3LL7A 1KZGB 5LCWC 2GYYA 3C6XA 4D3ZA 1HPLA 1U7UA 4X9XA 1P7CA 1MB9A 4YR7A 4JBGA 1UMCA 3RC9A 1PSDA 1RHRA 4LNUD 1JKMA 1PP4A 2Q3HA 5KX5F 1IHBA 1DQYA 4K5AB 4TUMA 3IAEA 4JDPA 4M21A 4P33A 3S1AA 4DA6A 1J8MF 4N82A 1Z47A 2ZS7A 2OWEA 1SIUA 4QU9A 2FJUA 1UFRA 4JYMA 4CR6A 4PLCA 4HQDA 2OLKA 2P91A 4GVXA 1U0FA 1YA0A 3ERCA 1TCCA 5EZ6B 3VJRA 1IQPA 2ZAMA 2X5OA 1NG1A 2DBRA 3OJLA 1W52X 4HQFA 2DIWA 1V3QE 5DNAA 2GARA 4BQQA 4D45A 5LU8A 3MLAA 4A27A 1UBEA 4NQZA 1KI6A 1OSNA 3SOPA 2PT9A 2AX3A 3N2KA 4CLRB 1I4EB 4IHQA 3UKDA 1UBUS 3HE3A 3K94A 4IY1A 3U4GA 2QB5A 3SYNA 1EIWA 1WKVA 4X3CA 2DT8A 4Z7JA 1UDRA 4BAZA 5M2QA 1LSJA 2FPKA 2I80A 2ZZNA 3FUJA 4HG2A 2BKAA 2VDJA 3SZGA 3N70A 4MUYA 3VU9B 3AEUB 2JD1A 5CBNA 1CIPA 1K9VF 1QFMA 1QUFA 1TJCA 1WDWB 1VYTA 2AG0A 1P2FA 1F4VA 3CB2A 3M70A 4M9CA 4RHUA 4YREA 2WMYA 4AG5A 3EXFA 1KYVA 1QHSA 3NMUF 3ABQB 1LW6E 3A26A 2DHQA 2WF6A 1BCRB 1JJIA 3CJRA 3DGEC 3I9V6 3L0BA 4MI9A 4IBOA 5JS1A 4LF9B 1U63A 3EHMA 1CETA 2NZVG 4EW1A 2IS2A 1Y34E 1B8PA 1NW6A 2Q7XA 3AWDA 3KQMA 4E08A 4KHPB 3QE0A 3ZTYA 2LXLA 4BV9A 2OXEA 4RQIA 2WXQA 3ITKA 2C7OA 3N05A 2H57A 2J09A 1W4LA 4LBYA 5DHUA 2HQBA 1P73A 4U8HA 4C0BA 3FUXA 4I9NA 1E7SA 4MVJD 1L4EA 5DOVA 2R62A 2X1LA 1E8NA 4AZ3B 1VSVA 4B9AA 3EVGA 4HBGA 3O03A 3PQ8A 2PD3A 5CB4B 1N32B 2BDTA 2HLDD 1VE3A 5FOSA 1Q0RA 5AM0A 2C5FA 3TMAA 1EG7A 1MX4A 1A7JA 1PS9A 1UBHS 2XEDA 2OEPA 4KGDA 2NZUG 3NZEA 4HH0A 1EXDA 2HMWA 4UBMA 4F3RA 2Z2YA 1YQDA 5K8UA 2P65A 2V1UA 4UQXA 3E2IA 4I50A 4ZT2A 5J2TF 3AEKB 1A27A 2C2XA 3SYRA 5ITZB 2QT9A 3EF3A 4YDSA 1OTHA 1KT1A 1CQJB 1TKCA 2NQ8A 1EJ2A 1I2DA 2O2GA 4M9UA 2ZTHA 2NXWA 3T1NA 4HAVA 2VCEA 3KR9A 5C8YB 1UDXA 1BGVA 1E5XA 1Q3KA 1P0QA 3AY3A 2P58C 5K8VA 3FWHA 1LBEA 1NI4A 3CZPA 3GPBA 4NZNA 1WMSA 5DWDA 3CSUA 5JD5A 3COJA 4JITA 2ID8A 4X85A 1U04A 3E9EA 1BE8A 4G2NA 3MKQB 5JVDF 3WLEA 2UXDB 1IC6A 3ASVA 4ZAFA 5FWXB 4RJTA 2VJBA 3ML8A 1ZUHA 4J4TA 2PUAA 2CLMB 4WWHA 3WTBA 4M8LA 4BTBA 1E1RA 1PWZA 2HDNB 1QG0A 1F1BA 2YWRA 2REOA 4WXEA 5CPBA 4DSNA 4E5SA 2QTVA 1SXQA 2YHUA 3OPYB 3ZJ5A 4YAOA 1QTNA 4CN9A 3ABOB 2J6IA 3I8SA 2BE7A 2HA6A 1QR6A 4ZVQA 1T0IA 5CAEB 2P30A 1G8AA 4E4TA 1PNOA 2PY6A 2XYVA 5EZYA 4OLFA 4KQ2A 1WPRA 3AI1A 1D6MA 2NGRA 3O8QA 1XD9A 4Q24A 5C1PA 3PENA 1DWPA 3ED1A 3R1IA 3ORYA 1YQ9A 2A7XA 3LBNA 5BSUA 3RYIB 3WY9A 2J0SA 4EPRA 2JB9A 1X1RA 1YR2A 1JLKA 3O84A 3WMWA 1ZUNB 1IN7A 3BRWD 3OOYA 2NUAB 3D5TA 4OI4A 4BIIA 4Z4FA 4R7ZA 4B8AA 3UT7A 4UARA 3RFXA 3AUXA 4DPMA 1GHTA 1KVTA 1IH8A 2PGDA 1OFGA 2J3KA 2QM8A 2XQIA 4P8RA 2NU9A 5E1MA 1AGRA 4MV1A 3ROGA 2WD8A 5AVVA 5KJFA 2AEEA 3TFQA 5IAGA 2B4YA 4BNYA 3RYIA 1Z37A 4DIKA 1NJ1A 3C8UA 3V2IA 1DIBA 1KI7A 4KXNA 4N5CA 2P9JA 4AFNA 3HKBB 3X1YA 4RKFA 4D7AA 1E32A 2DR2A 4O4JB 1R6XA 1MC8A 1IRIA 4MA0A 1VC2A 1DKPA 2V59A 5FDFA 1ZJ5A 4I4IA 1DKRA 3WZ2A 1QVVA 2IEDA 4MLPA 4TL8A 3I37X 5FL7D 3FVTA 1ZH8A 3D4PA 2UZ0A 3G59A 3O3OB 3W05A 4Z0NA 3ICEA 5D1HA 1KIMA 5GP1A 3NVDA 1IJFA 1VYHA 4JYBA 4V0LA 5REQB 2XEVA 4BNDA 4QJ3A 3J80A 4C14A 5FWDA 2OQIA 2ERYA 1WA5A 1A04A 3OIDA 4UXIA 3SWWA 1XR3A 3N2KB 3NKLA 3WHPA 4ZN6A 3TG2A 1PC2A 2ZQYA 1Z8NA 4UQLA 5G41A 5KVVA 1VYUA 3T1HB 2A84A 2JK1A 4KQMA 3VZQA 5FLEX 3UZUA 3ZN3A 4HBZA 3Q5GA 3LXRA 4UUNA 7REQB 1TMKA 3CZCA 2VLIA 4PVDA 2PA3A 1OY1A 1T1JA 2RGCA 4DR7B 2DTEA 2BUAA 2HXGA 4DBVO 5EC8A 1K5HA 4ID9A 4CCAA 4FADA 4FMDF 3N71A 2PYIA 4N49A 4O0LA 4EPXA 3N2GA 3OQPA 3PITA 1U2QA 4OFZA 1RRPA 4ZA2A 2WJVA 3EGCA 1DL5A 3TIXB 4YCMA 1XRNA 2FI1A 3X1XA 2QMHA 3DDUA 2JJ1A 4RHYA 4B3HA 3RQIA 1RI5A 1BXRA 3L82B 1GPDG 4EEXA 1N5DA 1QJCA 2EWWA 2P9SG 1OE0A 2PQ0A 3BRCA 2PA0A 4J8SA 5IC6A 5IKMA 1J2JA 1T35A 3WYFA 3GMSA 3L7CA 3QG5A 5KSYA 5FPSA 1N9KA 2ZRLA 1FE8A 1HWYA 4H1WA 5DO9A 2AQIA 5D3MB 5TPWB 1GTRA 2J8SD 3VDXA 4F53A 4WN9B 5DNEA 4GI2A 1IHGA 3CEPB 3F74A 5FF9A 1T0JB 5H7XA 4DG8A 1E4VA 2TMKA 4H7YA 3H17A 4YQYA 3F96A 1REQB 3SIRA 3EYAA 1QH8B 2FK7A 1IBRA 2NC9A 4I9GA 4L6CA 3PFBA 2RHWA 1PGNA 2CWWA 3D4IA 1B8UA 2H52A 3HA5A 3M6AA 4IIEA 1H66A 2XQ0A 3TZHA 3GLSA 4D6YA 4F3CA 3SPXA 3UKUG 1IOLA 1MG5A 1MRSA 2B4TO 2ZSEA 3ODGA 4MO9A 3G2NA 1E3MA 4OGLA 3RTGA 1OPXA 4BB6A 3BULA 5T3UA 3H5IA 3BL6A 2VAPA 1EFRD 1XGWA 1WXFA 1LSOA 3DMNA 1YRHA 4OMFG 4BO6A 1Y1LA 3NP7A 5CXQA 5CLQA 4BKOA 3JCKC 1JL3A 3IO5A 4CG3A 3S1AB 5MFPA 1RI1A 1NV9A 2QJRA 5AHOA 5DSTA 4R2KA 1KO7A 4YDYA 1RFLA 2ON6A 3S8MA 4COKA 3BE4A 4MWSA 3DMYA 1CQIA 1M5TA 4TQGA 3SEQA 2XT9A 1D7OA 4MPRA 2GK4A 3DAGA 2JGDB 5CIYA 5IRCD 2VH2A 5JSKA 2QTFA 3FBGA 2PKCA 4R3WA 5A6VA 3PNKA 2OT3B 5AW4A 5HFAA 5KJLA 2VP0A 3IUMA 1A8IA 1DKMA 4KQEA 4X54A 1N4PA 2G7MC 4O25A 5F7ZA 2VP9A 1FNCA 1X70A 2ZYAA 4C06A 5IFKA 3UI2A 4R16A 2V5AA 5IW8A 1V7PC 1HNZB 2C3UA 2IX3A 3VH3A 4DNPA 2X2FA 1XAGA 4P4NA 2DEUA 3FNGA 3TJRA 4B79A 1IVSA 2Q27A 4LI0A 1QO0A 3A32A 4YUVA 1AZSC 3MD9A 3HB7A 3WP1B 3DO6A 4NV3A 3G7UA 5EXDA 4DF3A 5KQSA 3V31A 1GL7A 2XZDA 4TTSA 2IYWA 2VEOA 5FI5A 4G36A 3O31A 4RFSB 2H9YA 5DK6A 4G8BA 3I73A 4NU6A 4PYQA 4AWAA 4TV9B 3TZCA 5F9HA 3KJQA 5AW0A 3ZVRA 1QB8A 1WUHS 4YYEA 1DQNA 4XE0A 4TRNA 4LWZA 2F55A 2SNIE 1JIKA 1MP0A 3DQQA 2UUAB 2GPAA 1TEZA 3WYBA 3OQNA 4JIMA 2WJAA 3OIVA 3ASHA 2QRQA 1Y81A 2IV7A 1EP9A 1SBTA 3CUEF 4Q7LA 3A3PA 4R9SA 4F04A 2ZAIA 1FIUA 5BOSA 1W2HA 4B93B 1DKOA 1WKCA 3IXMA 5I7FA 4TZ0A 1PEDA 4G2VA 4HFRA 5FQOA 1ZUWA 5CVUA 1IONA 1SD1A 2CXPA 4FZJA 3QYPA 3I2GA 3VYVA 4DZTA 4QDJA 1J00A 4W82A 1YS2X 2A3NA 2PH3A 2QYOA 1T2FA 3R5FA 1EI9A 1VBFA 4B3FX 4MW9A 4OBWA 1S6YA 5CBPB 3CVVA 1ADFA 1CNFA 4I17A 4J03A 4NZOA 4EJ6A 4P6VF 1QTIA 4MKHA 4W4TA 1NLMA 1YCHA 3EDMA 5KCMA 1NXQA 1FFXB 1FXWF 1JHMA 2RGYA 3G02A 4QJ5A 1H6BA 4MRRA 3IALA 3M1LA 1O1RA 2F2TA 4RH0A 2X0DA 1KQ3A 3BXHA 2WNHA 3B9QA 3PDJA 1WMBA 1X77A 3VR0A 4PRYA 3C1AA 4NJMB 3DEYX 2AV6A 4EIWA 1CQJA 4ZVOA 1FRZA 3G2UA 3DBRA 3W6ZA 3NKFA 4BNZA 1Y3CE 6YASA 2QRVB 2X1VA 4WLFA 5TMBA 3I1IA 2C78A 1JG7A 1KZPA 3Q7RA 4YAWA 3VR5H 1ZC3A 2QZJA 3HU5A 4N8SA 4OH1A 1TZMA 3B7GA 3CH6A 3U4TA 3RU7A 5KSWB 4ROTA 1NQUA 3W5SA 3VHRA 4CQJA 3G9ZA 4DWWA 4ZANA 3DB2A 4Y0VA 5HFJA 3RUEA 4EAAA 4WBNA 2DGDA 1WBBA 1SU4A 1J09A 1P4AA 1E2JA 1XTIA 3OZVA 2PH5A 3EQ7A 3DSVA 4LSWA 3S7TA 3UAGA 3T7EA 4PO3X 4AJEA 2CE7A 2HGSA 1BWRA 4K9OA 3ZNOA 1X8KA 2ZATA 4YCSA 4AKGA 4TXRA 1NJ8A 1PL7A 3D6MA 3VR4H 5KVAA 1TO6A 2Z5LA 3EU5A 2AR9A 4BRSA 2G4LA 2RHBA 3BMNA 3KR2A 2CYAA 4XM0A 5BQXA 1ZH2A 4MS6A 2FGJA 2OHVA 3DE4X 1B43A 4L08A 5B7QA 1BX0A 2GASA 2JIQA 5J4LA 4CXMA 5M3BA 4FOOA 1ES9A 1O94A 3OZEA 1V45E 1FNDA 1OXTA 3CT4A 4YX9A 1SZDA 3RSSA 1Y8ZA 4BFSA 1HE1C 2QLFA 2R4TA 3GFGA 3IVCA 2FU5C 3JS5A 2VTEA 2P0EA 2NU6A 3B9BA 2FXVA 3VKFA 4HMOA 5BXUA 4KXMA 4XWYA 4AL4A 1DINA 1MAVA 2EYUA 1JLLB 2Q21A 2VJYA 1NIJA 3CGWA 3II6X 3ZHYA 2OV2A 2RAVA 1UIMA 2X0FA 4WDRA 2GJKA 2IFTA 1GG9A 1Q7BA 3EXG2 3ASFA 2CJXA 2OCKA 1HNNA 3D6TB 1HLFA 3HHPA 1B4DA 1H2WA 3WDLA 1P7ZA 2F62A 2W8BB 2GSWA 4G1CA 2C0QA 4ZJUA 4ZOLA 3THRA 3RBAA 3F6EX 3U48A 1YJBA 4N5QA 5K0NA 4PH4B 4HDOB 1GVNB 5ICMA 1XLTA 4UDYX 1XWFA 4GMJA 2AE2A 1Z0ZA 3MOSA 4QNRA 2JLYA 4J16C 1RWWA 2XVZA 4QOJA 2HJRA 4UQYA 3KSQA 2XNKA 3IQZA 5JXWA 5L4LA 1RW4A 1Z8FA 2GNAA 4F7DA 5EYPB 3BQOA 2DKOA 5B3LA 1N9ZA 4KAAA 4EG1A 2WUVA 1BEUB 2JVIA 4EHLA 4WNCA 1AJEA 3R77A 1AQYA 2KCVA 2XPYA 2Q46A 2QTBA 4TM7A 1NW4A 5CRIA 1BXZA 3C24A 2OO7A 1R6UA 2O5CA 1OVMA 1JDVA 2ASEA 2Q9BA 3FI0A 1EKXA 1ULZA 4M8SA 3HADA 2H2WA 1UC8A 1WAO1 4ICIA 3OX1A 3Q98A 4KN8A 1KNQA 1HE4A 5AM5A 5B1DA 5B3JA 4DBLE 1XDDA 5DHSA 5LQMA 4FWTA 1OFVA 3K70D 1FDOA 3KSDO 1CYDA 1X13A 1OUVA 2BC9A 2VFAA 1Y8QA 3CPJB 2WHRA 3H9CA 4LOAA 3IO3A 3A05A 4QQFA 3SDBA 4BKMA 1DCTA 4LX8A 1A1VA 1ZCJA 3G82C 2CLFB 2FDRA 3F98A 2YC2C 4X8MA 4D98A 3CK9A 3UJ6A 5A4FS 1P0IA 1GL6A 3PRKE 2ZJ0A 1QB7A 4FLFA 4NYJQ 4C4XA 1U02A 1ND5A 3Q2KA 4CZ2A 3FTWA 1N4DA 3LLSA 4F2DA 4LISA 1R0CA 1JG4A 1PX2A 4GA1A 1CUXA 4P80A 2O3RA 3UT4A 1HOTA 1ZBDA 3D2BA 5TIIA 4UWFA 3D3JA 2O50A 4D46A 5TARA 1D8DA 2WIJA 3K35A 1KDTA 1GZVA 1AV7A 2J31A 4JD2G 4AOFA 3OPXA 1BE6A 2JLCA 3TXAA 4PM4A 2HJSA 2IXEA 2JS7A 3O1HB 4TQ9A 4C29A 1NC3A 1QHYA 3EGIA 3M1IA 5MGNA 2PKQO 2YHEA 1C50A 4L50A 3SMQA 4YV0A 2KC7A 2XODA 1LTKA 1YD7A 2FR8A 1IXRC 3ZWVA 3LT5A 2A59A 4DSZA 1GAEO 4I1YA 5KQMA 4TKVB 5DEIA 5EZQA 3U19A 2BKKB 4OHCA 4DIFA 4DW8A 1DBVO 3KUUA 3O4HA 5G4LA 3S99A 3TOCA 3BEDA 4YMGA 4V3IA 3MINB 2I9KA 1Z45A 5C31A 2AQ8A 3G7SA 2JFVA 3I9MA 3U7QA 3FPKA 1OTYA 3LS2A 3PVSA 5AW8A 3USCS 4RVNA 3WIDA 2Q07A 2ZJ6A 2PZEA 3L1JA 2RH9B 4HATA 4XUDA 1RVV1 1BVYF 1GEEA 1LF0A 2HMYB 4QFMA 3S29A 4ZYXA 5JSFA 1XRSB 3DONA 3M0EA 4WGFA 4DSUA 4W5RA 1ZNXA 2P62A 3AY6A 3O1IC 3NM4A 4XR9A 1K7EB 4ZAVA 3VPFA 1UWLA 5BSFA 5H16A 1G5IA 2I1WA 5BV7A 1KEWA 3U3RA 5ARBA 1R18A 4E85A 1UK6A 4YJFA 4AN0A 4FNMA 1HDXA 2J5BA 1NF8A 2OD7A 3N6XA 5DGXA 3SZOA 4B71A 3EDOA 2QTAA 3PV0A 2A58A 2WA1A 5LBTA 3UT0A 1MX1A 4HDNA 1UR5A 4H6PA 4NE2A 2WTMA 2O57A 1X7WB 4G84A 3TI7A 1R3UA 2XYPA 1WR8A 4QXAA 5IBPA 2ZRDA 2DQZA 3ZWOA 5AARA 5HQ3A 4HEA1 2V8SE 2A67A 3LP8A 1MVNA 2FPOA 4RKEA 5BRAA 1Q5PA 1NI5A 4IKPA 4GKAA 1LI5A 2HMUA 4ZV9A 3KHKA 3LM8A 4IINA 2P7HA 4IMRA 3UAZA 1U0BB 1P74A 5DT2A 3NR2A 5D00A 2QG6A 4PV7A 4TXQA 3BWXA 3HM2A 4LDZA 1WV1A 3OA2A 4MTLA 4YAIA 1JSLA 4FU3A 4NBNA 4AKTA 2QORA 4OB6A 2WB2A 4WFIA 3RVRA 3WLRA 5M29A 1D1QA 1PTKA 1SHZA 3JQ7A 3PWSA 2Z98A 1MAAA 3W3AH 3CSDA 4BLOA 5A3RA 1RYZA 1KJ9A 1FFSA 1L7VC 1QP8A 3AV0B 4WW0A 2LAHA 3UB2A 2PXXA 4Q9LA 1IXKA 5JFTA 4F4FA 5K6AC 2J0VA 2CXRA 3FUNA 5C8ZA 3Q75A 2VQEB 4RVGA 3QVLA 1R88A 3I28A 1OXKB 1W48A 1J0EA 3BCRA 3O2JA 4NDNE 2IHVA 3QAQA 5CH3A 4GVLA 4U9HS 1AUPA 4Z4GA 5H5JA 3CCBA 4DKJA 3D9MA 3ZQ4A 4KUHA 2Q1UA 3HACA 2Q2WA 3LYHA 1JEYB 4OGKA 1HL7A 2G36A 5IPFA 1E3DA 3F71A 1XTBA 2BGTA 1AS0A 1VXRA 4Y2SA 3HDXA 4GW3A 3KB8A 2Y0DA 3PQ5A 5K0TA 3WYCA 5E4TA 3B7PA 3EXIB 2E5FA 1AKMA 1P33A 2Z5VA 4M1KA 5CCXA 1MAWA 3WNZA 5JNWA 2VT6A 4YRKA 1OLUB 4YJ2A 4FJZA 1R0SA 4UFOA 2H92A 2R02A 1V4BA 3QLJA 3EOAI 4FEAA 1J1IA 4HNVA 3SQNA 3V7NA 4EPVA 3O9VA 3EWAA 1Y8CA 3W2IA 2O19A 5IJXA 3CHMA 1OWOA 4ENUA 2XNSA 4C5BA 2R5SA 1D2GA 2ZRAA 2WPDD 4BXOB 4KHZA 4QBKA 2I6GA 4LDRA 1DCKA 3EIOA 4E6EA 2C9OA 4RMHA 5AW9A 4MZXA 4ZPXA 1KBOA 1SB9A 2UUPA 4F4IA 3LOPA 5ITZA 4DI4A 2AL7A 2VCHA 1E9DA 1OXXK 1L9XA 4OP2A 5DYGA 4DPKA 4GMRA 1M8KA 5AQ1A 4N54A 5B1IA 5JDIA 4AU1A 3WLQA 4OHUA 3GRVA 3LRXA 4ND7A 4RW0A 1XCMA 5TGDA 4C3UA 3WWDA 3ITEA 4DK5A 1DJPA 1L0BA 3PIIA 3N0XA 1TUIA 2JHPA 4Q1VA 5LUBA 2HW8A 4RD2A 1ZNZA 3WV5A 3HSYA 1AXRA 1QIFA 1IAQA 1GRVA 2FH5B 5FP0A 2GD1O 4X1KA 2P9KG 4LMAA 4WDQA 2RE8A 3GPIA 2AVDA 1N52A 4H6WA 1NRJB 4GOJA 3EGOA 3L0YA 4QVGA 4O1OA 4WLVA 1I3MA 4ZAGA 3P1UA 1W5BA 1B14A 1D9SA 2CWDA 3H1GA 3MYVA 1SEPA 3KOXA 4GR9A 1D5WA 4L74A 3SIPA 3TXXA 5HILA 1QNLA 2PWAA 1QGOA 3C3WA 1YR9A 5LSAA 1BMQA 1ZA1A 3MELA 1Z75A 4D0NA 1OZAA 1JJ7A 1S3SA 1HG2A 1QOPB 2AC2A 2FUEA 4B6OA 4DXDA 5FT9A 3CLKA 4FT2A 5CM2Z 4MRMA 3MXTA 5E76A 2D8MA 2YVAA 4EUFA 5C5CA 1R6BX 4JNCA 4F9TA 2YVLA 3VDMA 3I9FA 4I8DA 3P9CA 4P22A 4WNFA 1X9HA 2EF1A 2GPBA 5IK2D 1O4WA 1XMVA 4BGVA 2HO4A 4B6GA 1KFCB 4NXMB 1DEAA 2GK3A 2HPAA 4ZOLB 1R8QA 5CDYA 2FTKE 4IGIA 2A57A 2I54A 2HKIA 2Q7OE 1ZP6A 1WZCA 4EMUA 4G8KA 3C3RA 2CKMA 5AQ9A 1S96A 1Z0IA 1KMIY 2VWGA 4TLMB 4ANWA 3Q8XB 4MV4A 4ZVSA 4JUCA 4X65B 1XEFA 3CF4G 4ZT3A 2DPXA 1O3YA 1G3QA 5KTTA 1P31A 4P08A 1F3LA 4LPSA 2IH4A 1U2TA 1KDVA 1N0WA 1OA0A 1O87A 1C3VA 3LVQE 2JLQA 1Z12A 1M9NA 1P77A 1NBEA 1PD0A 2I22A 4G89A 4B4UA 4EUNA 2NG1A 3U4QA 4RYDA 4Y6QA 4DA8A 2RG1A 4JVMA 4X95A 4J8YA 2QVLA 5E3HA 4XWKA 3UXGA 2O5VA 2ZKLA 5DW3A 1PQYA 3TQSA 5E2IA 1OREA 2PMFA 3STWA 2Y76A 3FPGA 3P9YA 5A5EA 5TQJA 4K0RA 3EF1A 3KCQA 1B8OA 3KE9A 3VNBA 1YVEI 2PJDA 4R5MA 3L92A 4DUGD 2G7ZA 1ST3A 4ASUA 1JH9A 2ZYGA 2BGKA 2R2GA 5ALJA 3WKAA 3OJOA 1PZFA 1HRDA 1Y3HA 1YS9A 1C81A 4FXOA 4J1TC 1DBQA 3H19A 4IRMA 3RVDA 3U66A 3VBEA 1Q1AA 5LWHA 1N57A 4LNBA 4TGLA 5CT6A 2WJ4A 2XQGA 5K0CA 1AMOA 1C14A 1YZHA 4MVJP 5KYNA 3MBKA 3B1JA 3DH0A 3FFXA 4EQ6A 1L4KA 5DCUA 1DJOA 2V65A 2BV3A 2FN7A 2IYQA 1VMAA 1KDYA 4JMPA 2KSQA 4HGPA 3AL3A 1AHPA 2C2LA 1FSFA 2Q3EA 2BKEA 3JSAA 4L78A 4YPVA 3FVRA 1OXBB 3PDIB 1ZINA 5TJHA 4GZ3A 4AZ0B 3AOEC 1N0RA 1RHJA 2BM1A 3AKYA 5E7IA 3LTEA 5JH7A 1WP4A 1GAWA 1RABA 3IEUA 1OH5A 1GARA 4RY9A 3T5VA 2NU7A 1ZWKA 3HGMA 4Q82A 4B8CB 2BOVA 2QR5A 2Z8YA 3DW3X 5K6AA 3MMZA 4RPGA 1G64A 3FUWA 3AKZA 2P4HX 3IVRA 2UZ4A 4NS4A 4G5QA 4OLAA 1YUNA 4H08A 4FFSA 4TLBA 2NVUB 3QMMA 3VKVA 4DCSA 1AXEA 2BKUA 3BRWA 4Z4HA 1Z07A 5LD2B 3TDKA 5FORA 3S7DA 4OL9A 1ML3A 3CRZA 3GFQA 4G4SP 5JXGA 3MBOA 1EH5A 3FE2A 5AOVA 1G5QA 4K9KA 5F23A 4DCJA 1SHUX 1TEXA 3EZFA 2CNLA 3HRHA 3M2PA 5K2MA 2G9UA 1EX1A 3DE6X 2OR3A 1ZL2A 5EMMA 4X94A 2PMKA 4JJEA 1HXIA 1B89A 1BHJA 5ISMA 3W2TA 1QYVA 4CPDA 2CVQA 2GAFA 3Q4AB 3ABZA 3SZ3A 2A86A 4LYFA 4TYQA 4AIFA 3ZE6A 5BR1A 3T1YB 1U3CA 5DTIA 1M6EX 2O5EA 1I51A 1PJSA 3SYTA 3FM9A 2QTTA 3G5TA 4LTDA 1H0RA 5LYJB 4HGYA 2Q2OA 1CUUA 4G0PA 5IDQA 4V0QA 5JNVA 2XBMA 2YJ4A 1LB1B 2NP7A 2ZWMA 3HA2A 5IZCC 3DC7A 4IWXA 4OKSA 1LJUA 2AFIE 3TRKA 4U7EB 3S2GA 3VNQA 1NQOA 3OXLA 5K05A 5KQRA 3U7GA 4NJOA 1XD2A 3GVXA 4B84A 5AW5A 4YDQA 1MIHA 2J3JA 2WWRA 3E3LA 5FFNA 3RBZA 4V1CI 2VKQA 3A9WA 3P9SA 5AK0A 4QGHA 1Y6FA 4JYAB 1U1FA 4X7BA 3SBOA 5KWJA 4ZP1A 1R4MA 3HQ4O 1O94C 3TSOA 4OB8A 4UATA 1RAFA 4XR4A 5EJ5A 3WIUA 4PC6A 1TO2E 1ZFNA 3Q7SA 2C0CA 1J9GA 1Z6GA 1HO8A 4DA4A 1ANKA 1LKZA 3KJIA 3E23A 3QYJA 3BGVA 4NYMR 5JJLA 1C7EA 2PO7A 4EVIA 4YMVA 3REOA 5F2EA 1EWQA 3OEEA 1QANA 2XUIA 3LUAA 4RKRA 4M0LA 1TQ6A 1DQRA 3GW8A 4G1BA 4Q3OA 1U81A 1VJTA 2XMBA 1L4MA 3O5AA 3C74A 4K05A 2RGNA 4OU5A 1OBOA 4UAVA 1T0HB 4QUAA 4TV8A 5AHWA 5CIWA 1SKYB 3JALB 2EBHX 1EZ1A 2FOIA 4B3RB 1FVHA 1SZAA 2DU8A 3CG4A 2FFBA 1D1SA 3IAUA 1KI3A 1SULA 4I1UA 2ZB2A 2OCCE 1C2YA 3G0CA 3OHMA 3VGJA 3GPDG 3TUZC 1SCJA 2QLJA 1S8AA 4ARAA 3GRUA 4AC9A 4DI3A 4IRUA 1ZSNA 4XE5A 4CIXA 3FDIA 3W6PA 4CCWA 4HK4A 3KEGA 1I1OA 2CDAA 2C98A 3DV0B 4E30A 2QV0A 3SE7A 1Z6AA 3F4BA 2B1GA 3FROA 1V48A 4GXNA 5JS2A 1UXHA 2AWIA 1JIVA 3QW4B 2GRAA 3OFVA 5BSMA 1G5HA 2GHTA 1VI2A 1Y4ZA 4YJHA 4RF5A 4X8QA 4CZ2D 2FEOA 2OGSA 4WK0B 1N4QA 3BDIA 1NVEA 3AR5A 3CWCA 3IP3A 2DF8A 4HJXA 4ZTUB 4ZHQA 4GDFA 2QUHA 4D9IA 4UUBA 5HJEA 2XCCA 4TRQA 3PGVA 2QVYX 5DTMA 3TW0A 3BJZA 2PM6A 1FOEB 3GT7A 1OHHD 5L3SB 2RDMA 1W0JA 4R69A 3Q8KA 2B4RO 3A2MA 4LXYA 1J5XA 1SU6A 1EGVB 2CF5A 1MAUA 3SY8A 2F17A 4A92A 2CXQA 4IZ6A 4GR5A 4MPTA 3NYRA 3RTEA 1G60A 3NT4A 3OJEA 3UW1A 2XMQA 1T1RA 3BD8A 4D57A 2LIPA 2RG7A 2O4UX 4F9GA 1QHXA 4YRLA 1QZTA 3WO1A 5LKAA 3HO1A 2P69A 3X2QE 1ZJ4A 1AHHA 1C1XB 3AJIA 1L3IA 3M49A 3I42A 3Q3CA 4UI9C 2NZJA 3KKKA 4KQIA 4JR1A 2PM8A 3E27A 3KU4A 3UYLA 4BNNA 2X19A 1LK0A 3E7WA 1OYYA 1MT3A 3Q7PA 4OSOA 4BC1A 1G8YA 5A5VA 3UJ7A 4Q4AB 1VL8A 2KWIA 2HNAA 1WXGA 5ALGA 2OCXA 4D4GA 1G38A 4AECA 3OCYA 3IKLA 1VHTA 4HF7A 1XEWX 4BCBA 3FUKA 1MZCA 3E2PA 3QPBA 4DR6B 1DIRA 1SKBA 1X0VA 1IPEA 1RQPA 3L8MA 1G7SA 4QTXA 2ZJ7A 4CDNA 1XNFA 3T06B 3TEJA 2GCEA 3U44B 4JZYA 3W3AD 4TTAA 3RTCA 4YJGA 4KMSA 1VTKA 2FEAA 3E0QA 1BX1A 2GK7A 1CQXA 3SZ7A 1TZCA 3I12A 4KO4S 2FQQA 3DKKA 1GPYA 1PT6A 3R9MA 2VTKA 4UBKA 3Q5EA 1EM8B 3UA3A 2BH2A 4EHNA 4A8PA 1AP7A 1PR9A 3OFNA 4BPBA 1CF2O 4H31A 1K63A 2WTUA 1H2VC 4JROA 1JR2A 1N7JA 3O8QB 4WRRA 3V48A 3E3NA 1QOZA 4AUKA 2FMFA 4QA9A 2C59A 4K6FA 1IHOA 3T61A 5CHEA 4GMLA 4LXQA 3RR2A 3DV9A 5JTTA 3COWA 1BJRE 3AU4A 1Z6PA 3GO4A 4GM4A 1TNBA 2CLIB 2VSOE 3I01M 1E9SA 2O2YA 3B1FA 4JQZA 3AFHA 4JUIA 4RC9A 5BV2P 1KKMA 3DOOA 3EG5A 3U4DA 4UZSA 5A9TA 2JI4A 3LDUA 4M60A 2WZCA 2GM3A 5AP9A 3W9FA 3RJVA 5JS7A 4XARA 2EZ9A 2HSWA 4YEDA 5A0VA 1RRGA 3AG5A 4I2VA 4ZAZA 3T9CA 5J5VA 4JX8A 1GAJA 1B73A 1IK4A 1B0AA 3TCKA 2P9YA 1RI2A 3O4JA 3PWTA 3QKUA 3B7TA 1ZOLA 4IHKA 5KMGA 4EBAA 1WUTA 2F8YA 2AUNA 2O6LA 4JEMA 5EE3A 5BQOA 2CE2X 3CRW1 3PC7A 3ZIUA 4AF7A 4B3JA 4UI9K 1WM1A 2XTMA 1JA9A 4MLCA 1OI3A 1Q2XA 1VGVA 2H4HA 2VHCA 1PV1A 4K6KA 5C4GB 2D3WA 4HGZA 3SS8A 2BFPA 4AYXA 4Q37A 4WOKA 1ZN9A 1DG3A 1UMDA 2G17A 4F3NA 2ZUEA 1EPUA 1KYTA 4GD3Q 3CKLA 2H1VA 3S7BA 3BXXA 4F97A 5FWYA 1HX7A 4BLWA 1S5PA 4LFBB 4OJMX 3ZEFA 3G3EA 2YW2A 1BO6A 3GR6A 1QO9A 3BKWA 5GM2A 5C4MA 1XP5A 2YJ3A 4EELA 1II8B 2VZ0A 3AR4A 3TLCA 2V4LA 1OTXA 5A6CA 2DX7A 1VLZA 3L13A 2F9MA 4EP1A 3K71B 1W4BA 3TVTA 1TJ3A 3IX7A 2I6UA 4ACKA 1QF9A 2Z4TA 3WL6A 3W9GA 3RS3A 2EGUA 1XDWA 2X4GA 5LJIA 3I05A 3CVQA 1E62A 1K8YB 3DV0A 1Q77A 1JR4A 2Q4BA 1PR5A 2I7CA 2YWEA 3LVBA 3OCXA 4QDTA 4TLDA 4FW8A 1FFAA 5DASA 5IT5A 2GI4A 1U1GA 3TKYA 3ER6A 3NHPA 4XM1A 1VGQA 4NBSA 2R7KA 1U1IA 5K0BA 4V1CB 2GOYA 3SAJA 1BMFD 1YXMA 3NWBA 3G8AA 3TH5A 2XRFA 4D80A 5DLPA 2BUBA 1JB1A 1A9PA 1GOTA 2H9IA 1FYXA 4MI3A 4RTLA 4MI1A 1KERA 1T9ZA 1UM8A 3BILA 3EUVA 3CX6A 1Z9BA 4DQXA 1RQNA 4WNIA 1E7VA 2C94A 2GM9A 2XRMA 3TAHA 1X81A 1SVWA 5UKDA 2YCLA 4KO2S 1XTTA 4GF5A 3ZWAA 4U7FA 4V1CA 1PGOA 5K8JB 2NXEA 3HDVA 2A5FA 5ALXA 2CJYA 4LCBA 3B51X 3DBLA 4DAEA 2OCDA 3PGMA 4JVSB 2MHKA 2RBEA 3DA8A 4MEJA 1IUPA 4YP7A 2HJWA 3BD7A 2JAOA 3IUEA 4C7KA 4M1QA 1UH5A 4DJDC 3JQFC 4DLPA 1CJTC 4MRVA 1UFKA 5FUQA 3KQKA 1L7AA 3HXTA 2P90A 1O96B 4A36A 1KVQA 5E3JA 3UJ9A 1XMOB 4U2GA 4TRRA 2O0KA 2OCGA 5IK2A 4EYGA 1SFRA 2ZIXB 3KZMA 2QVCA 3KYJB 4UCXA 2IP4A 5EDSA 5TQ0A 3NZUA 1V54E 3DBLB 3ESBA 1MDFA 3BSSA 4NQRA 2WF8A 1BMFA 4S35A 3EPJA 2RGDA 1TYEB 1RM5A 1CUSA 1SCAA 2DLNA 2PL3A 4IHJF 2VN8A 3VDRA 5KNDD 2I29A 2VDMB 3EDQA 4C5CA 1QF7A 3H2SA 3HY6A 4YDRA 4DMLA 1UMBB 2HDHA 1M7GA 4B3CA 3WI7A 4JEHA 1GGVA 1VQ1A 1NUHA 1YR3A 1QK3A 2Y9PB 2ZRFA 3B8EA 1C4XA 3IV7A 2WVIA 4PLPA 1EBBA 2HF8A 1XO1A 2I8CA 1S4MA 4QIHA 5E7QA 3TOVA 1VIMA 1ZICA 5EXTA 2CEKA 3EPPA 2W2TA 5FBQB 3JUEA 1BFUA 5B7NA 4U0UA 1OXUA 4DLSA 3LC1O 4B2PA 4BLPA 1FU4A 2C2HA 2XY4A 2IX9A 4IKEA 1PRYA 4N03A 1CLEA 5HDBB 1EM8A 1NX6A 4KBQA 1RP1A 4KQ1A 2VYNA 3CW9A 3P2IA 3KOZA 4DDUA 2IIBA 3CVJA 3F4KA 3MRTA 4HZIA 3OP1A 1E0AA 1QG2A 4C48B 2DYSE 2D2XA 5JMPA 1I7PA 1M1NB 1J0AA 2JAHA 2P2LA 4KVZA 3CJTA 4DLUA 1XJQA 2LWIA 2CSUA 3A1VA 4NHEA 4RORA 4INOA 3FYUC 2H31A 4TMTA 1V96A 1WCIA 1A2BA 3MG9A 1XZGA 5J59A 4JLPA 2C2ZA 2DETA 3F7OA 2GEFA 3ZE2B 3NKVA 4DJ5X 3K9GA 1RXSA 1E98A 1T3ZA 2VT2A 4F1SA 5DNCA 4R1PA 3IEGA 3ZGZA 2H7CA 5AQBA 3DYVA 3LUFA 4DL9A 1MC4A 2HU2A 2DPGA 1ONOA 3LKUA 2EX4A 3IT2A 1VCIA 3UUGA 1N36B 1EIZA 2QUZA 2ZG6A 1U2PA 2Q5FA 2ZQZA 3KXPA 3X0DA 4LZZA 5ICGA 1GQSA 4JVLA 3R8FA 2BDUA 4YIKA 1BKDR 2OBYA 3ONNA 2ERXA 4Q1BA 5BN4A 1F0NA 2G06A 2VA8A 2WJWA 3WYAA 3RHFA 5KMGB 1IG0A 4XKJA 4M0DA 4OGFA 1FDWA 3DE1X 3HNRA 3TLKA 1PZMA 3SQDA 3OXGA 4UWGA 4BMNA 4BTLA 1VGRA 2DZDA 4HQKA 4C2BA 3KYDB 2R6AA 3JZDA 4OP1A 4LVNA 5K8LA 1N9AA 1KYXA 1N6NA 2GRLA 1QGZA 5F5LA 5C80A 1D07A 3OSUA 2WM8A 1NLUA 1AQUA 4BECA 4DAOA 3FH5A 4V0RA 5KYYB 1B6GA 4Y2PA 1TAUA 3KALA 5FBRB 2NIPA 3CHRA 3BF7A 5MF6A 1YNSA 4LFAB 2X4LA 4YWHA 5J1TB 3VZDA 4IVNA 1BVRA 1YA6A 2P2YA 3RAUA 3HBJA 3MHPA 1C0PA 1N1MA 2G8NA 3G2KA 2RIRA 4WT7A 2JCGA 3AEKA 5KKAA 3CV0A 5E75A 3PLNA 8ADHA 4FE7A 5AVTA 2FFRA 5FPTA 3IVMA 1KETA 2JFHA 4M7RA 4D4HA 3NAMA 4UI9J 3ZEIA 5K2OA 3AESA 1EBUA 4N5LA 4US1R 4Y9TA 4PG5A 5C18A 4FFBB 4N0PA 1LDBA 5JALA 1YB7A 2XUKA 4MB0A 3CMMA 3AUUA 1NVUQ 5CA1B 3W5BA 3PT9A 5C37A 2DSNA 4JQSA 1L5KA 1W581 4DNXA 3DDWA 3C6KA 3EEFA 5DV9A 3NOCD 2JGFA 1T8UA 3MQ2A 1R0WA 2BMEA 2W43A 2W11A 2PUHA 3DJFA 2WPVA 3E3AA 4YMHA 1D4FA 3G9QA 1X7DA 3QITA 2HBQA 2V7QD 1BE0A 3CT6A 1KMHB 4IEFB 2ZE6A 5FIUA 2GRMA 3RF7A 4M37A 3SXUA 1CLUA 5JROA 3W7BA 1PJ3A 4IJ5A 2QA5A 2QDXA 1IB0A 5EQJB 5G4KA 1P1BA 3WK5A 5IF3A 2PD6A 3RUCA 4ON9A 4CM1A 2PE5A 1DUIA 1E2NA 4XQCA 2NU8A 2HCTA 1QVWA 3EDCA 2O6HA 5BYBA 4DJEC 4E22A 3IBTA 4B31A 3N8IA 4C4YA 3N7TA 3PNQA 1MX9A 1YB4A 3HNOA 5JBNA 1OCRE 2Z8ZA 1RW2A 5KNBH 5J90A 5KYKA 4GM0A 1YMUA 1SMKA 4N0MA 4ZI7A 5B2EA 1SXPA 4A73A 3HDJA 3K70C 1SZCA 1U7WA 4JI2B 3OOHA 1Y1TA 4Z86A 1KAOA 2QLLA 1F17A 2C57A 3D6NB 5BSEA 3B1XA 1O57A 4G0OA 3RRXA 5KOYA 5JSUA 3IKVA 3P8ZA 4US0R 3RC1A 4N3CA 1CY1A 1QPBA 3OQHA 3ZY2A 3EAFA 4X5OA 4EW2A 5BW4A 1QR2A 1RPNA 4JL5A 2VQ6A 1ZH0A 2B6NA 4EKIA 1RKVA 1T9HA 1XMXA 2CBZA 3QBVA 3AB8A 1U8XX 1ZDMA 4QXRA 5TGZA 3D9LA 3HPRA 1U1DA 5LZ4A 1QP7A 2XTNA 4DMCA 1T1EA 4ER6A 3CX4A 4HL6A 1XYYA 3K5PA 4PNPA 5CG1A 1Y7TA 4OHBA 5ALKA 4L51A 1KSGA 5BRNA 3GW4A 1V41E 1Z7EA 3KQWA 4R7GA 3APCA 1Y37A 3UPUA 2TS1A 2JVJA 4NTZA 3AIMA 3EE6A 5KJKA 2R9VA 4KVGA 2IYXA 4LGVA 4YACA 5EE1A 3SJAA 4AJHA 2KPOA 4D9GA 3JRWA 1WD5A 3TSZA 1HOXA 1SZPA 3TBHA