4K03A

Crystal structure of drosophila cryprochrome
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
534
structure length
529
Chain Sequence
b'RGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-1
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
total genus 163
structure length 529
sequence length 534
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4k03A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4k03A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4k03A01
1U0BB 1JECA 3CLSC 1N2BA 2DPLA 4L2IA 4ND6A 4K03A 3TS1A 1VBKA 4HK4A 1WY5A 4EFKA 2GKSA 1D2RA 3L93A 3AG5A 5TGTA 2Z08A 4BWVA 1MRZA 1XNJA 4E1AA 1IVSA 1TYBE 4QBTA 2CYAA 3LOQA 1O94D 2RD2A 3ZIUA 4Q93A 1H1TA 1V8FA 1O6BA 4ZT3A 4I6EA 1IH8A 1O96A 1NSYA 3IDFA 1PFUA 4ZCPA 3FHJA 1JGTA 2V0GA 1GZUA 1O97D 3UOWA 1N78A 1R6UA 5KHAA 3P0HA 4EG8A 4ZCRA 1H3EA 1F7UA 3CLRC 4MULA 1GLNA 3FOCA 5LM3A 1WQ4A 2J4DA 3IUEA 4EGAA 3Q10A 2CYBA 2JANA 2A4MA 1I6LA 3ISJA 2A1UB 1X6VA 1Q19A 3U1VA 4A91A 4ZCSA 1JILA 3ND6A 1LI7A 1NUTA 2QUJA 1Q15A 1KR2A 3ZUGA 1LI5A 3FI0A 3CLUD 4ND7A 1N2OA 4MW4A 3MLAA 1TFUA 3PNBA 2D5BA 3CVVA 1EFPA 4CDMA 1IRXA 4DDKA 2QJTA 4FZJA 1R6XA 1PG0A 1JIIA 1Q11A 3MMXA 3CLTD 2O5RA 1O0CA 2XRYA 4CDNA 1VBMA 4J75A 3MUEA 1NUQA 2QJFA 1LW7A 2DETA 2HGZA 4PBSA 1JZSA 4P2BA 4PBRA 2QTRA 1J1UA 4ZT6A 3SP1A 1M8FA 3H99A 3DO8A 1NUSA 4DDHA 1M8KA 1N3LA 4MWCA 3MXTA 2CT8A 1VBNA 3CVYA 1O95D 4MUJA 3K32A 3G6KA 3SYTA 2ZUEA 1YIDA 1WJGA 1WQ3A 1Q77A 1N75A 1FYDA 3A2KA 3PRHA 1O94C 4H3SA 5HG0A 1EUQA 4CQNA 4ZT5A 1QRUA 2XRZA 4HJXA 2Z3VA 1JHDA 3IMCA 1O97C 4MW2A 4MWBA 1VL2A 3I05A 4EG7A 2QTNA 1U3DA 3IVCA 3TQIA 1MC1A 2PFSA 3K9WA 3AL0C 4YP6A 3HV0A 3SZGA 3UC5A 3P0IA 3CVWA 4JFAA 1OD6A 5TEWA 3FG9A 4DLPA 2VXOA 1KH3A 4R2MA 3A4IA 1OBCA 4OUDA 1F7VA 4R2LA 1I2DA 4KR9A 2E89A 3H9BA 4X0EA 1N2IA 3IODA 4ZCQA 3TZEA 2HZ7A 1YIAA 5F23A 1ZJWA 3NV7A 3IUBA 2AKEA 3Q4GA 3CLTC 3CR8A 1ULHA 1S4MA 2WQ7A 4TS1A 4ZT7A 2CV2A 4KR7A 2V0CA 4GU5A 2YY5A 3C8ZA 1KQOA 1COZA 1WXFA 5DK4A 2NSYA 2H2AA 4K0RA 1IQUA 1H3NA 3IMEA 2QJOA 1BS2A 4EG3A 1YULA 3UY4A 4U63A 1WXHA 1O95C 2DLCX 2PG3A 1KORA 1J21A 1P7PA 2G36A 2HMAA 4ARIA 4NX2A 3BL5A 1GPMA 1NUUA 1T6XA 1NYLA 2CV0A 5AHWA 3AG6A 3N8HA 2ZUFA 5DB4A 1UFVA 4KPUB 3RBAA 2PXHA 3COYA 3COWA 3ND7A 1KAMA 1GN8A 5K0TA 3NBKA 3KT6A 2J5BA 5DASA 3X1MA 2E21A 3D6UA 5HUJA 3FDXA 1M8JA 2YWCA 1O0BA 3GMIA 4EG5A 3M5WA 4KR6A 2IELA 3OP1A 1KAQA 3X1KA 2J08A 2PZAA 2A1UA 3IVGA 3P52A 4S1OA 4OJMX 4KKVA 4MW9A 4EG4A 2ZP1A 3N9IA 3VGJA 4NDAA 1JIKA 2BYTA 3F3MA 1M83A 4NAHA 2C5SA 2QUKA 4G5FA 4AS1A 4WNYA 1VLHA 1XNHA 3D6VA 3H05A 4MUKA 3IOEA 4MVWA 2X3FA 1U3CA 3ELBA 4UZEA 3LCJA 5J5AA 4HJRA 1O5TA 2OQ2A 3SEZA 1OWNA 3HGMA 3FH0A 5TS2A 3L92A 5FO1A 2A84A 1N1DA 2A86A 3KT8A 4R0NA 1WXIA 2X0KA 1QQTA 2CUZA 3KT3A 1YI8A 1GAXA 2QUHA 4JXXA 2J07A 1G8GA 2WB2A 2Z09A 3OTWA 4MWDA 2I1LA 2PIDA 2O8VA 3GUZA 1NZJA 1MB9A 4XSVA 5LFAA 2PZBA 4ZT2A 3IMGA 4WSOA 1KP2A 2R5WA 1N2GA 3ZJVA 3CA8A 1Y42X 3FY4A 4MW7A 4DE5A 2OV4A 3HZRA 2X1LA 1KQPA 1IQRA 1U7DA 4MUGA 1TYAE 1MBZA 1PFVA 1WXEA 5JBNA 1DNPA 1K92A 1N2JA 3JXEA 3GLVA 3AIIA 3RHSA 3CLUC 1XJQA 2A1TR 2E18A 4UZFA 1R6TA 1J09A 1V47A 4PBTA 2QUIA 1IQ0A 2VTBB 3H9CA 3NBAA 1HYBA 2D13A 5TEVA 4XFDA 1QU2A 1G8FA 4MVXA 4MVCA 1KKUA 1QU3A 3DV2A 4DJAA 3IOBA 1RQGA 3QTBA 1FFYA 1ZUNA 1OWPA 1N2EA 2JA2A 1G8HA 1ZH6A 2DEUA 1OBHA 1OWLA 4YBRA 1NUPA 3N2YA 4QREA 3FNRA 2X1MA 2GOYA 2YXNA 3G59A 1EFVB 2CFOA 1I6MA 2A88A 4JXZA 4MUHA 2JAXA 5EKDA 4EG6A 1MB2A 1PG2A 2H29A 1XNGA 3MLBA 4NAUA 5FO0A 1I6KA 1GTSA 1T9GS 1PFWA 5J58A 4L2IB 1WXGA 3P0JA 2E0IA 3HFJA 3IOCA 4KPUA 2QTMA 5LLTA 2WSIA 4MUEA 2D54A 4I6GA 4NATA 1KQNA 3RK0A 4MUIA 5H7XA 1PFYA 3H97A 1T6YA 4PY2A 5K0SA 2CV1A 1K97A 3QTTA 1QNFA 4XFJA 4DDMA 3CVXA 1QRTA 1O96B 2GM3A 2IJGX 1ZH0A 4F4HA 1OWMA 1KH2A 1F4LA 2CSXA 4MVYA 2AZXA 2A7XA 1J1ZA 4MQ6A 5HUHA 2AG6A 1JZQA 4ZT4A 1JMVA 4F3RA 4AQ7A 5DEOA 1NURA 4MLPA 4EG1A 3RJZA 2DR2A 2A1TS 4U7JA 4YP5A 3ZJTA 1T9GR 3ILVA 5KWVA 3IH5A 4MAFA 4MW1A 3PNVA 1EFPB 1U7XA 1K4KA 1EE1A 1K4MA 1IFXA 2NZ2A 3E27A 1WKBA 4MW5A 1B6TA 3FWKA 5IHXA 1N2HA 4QRDA 1N77A 4RPIA 3TNJA 3A04A 3Q12A 4ARCA 1OWOA 3SZ3A 2B7LA 5IJXA 3UK2A 5FNZA 3FIUA 3A05A 3ND5A 4J76A 3VU8A 1T6ZA 1TYDE 2PZ8A 3UMVA 2DUMA 1JIJA 1QTQA 1CT9A 3CLSD 1KP3A 2IP1A 3HL4A 1TYCA 1KH1A 4RUKA 4YP7A 1TEZA 1JEDA 3INNA 4U8HA 2YWBA 2RE8A 1WZ2A 2J09A 3X1JA 2TS1A 1A8HA 3RK1A 3CVUA 3ZXSA 3HMQA 3LE8A 3ZXIA 3QE4A 3N05A 4Q16A 4GRIA 3ZGZA 3G5AA 1M8GA 4MWEA 2BTEA 3SEQA 1YUMA 1MAUA 4JZYA 1GTRA 4YMIA 1EXDA 1MJHA 1H3FA 3ZJUA 3DLAA 1IHOA 1X8XA 3AFHA 4MW6A 3RFFA 3S3TA 2VTBA 3TZLA 2DXIA 3CLRD 2EL7A 1M8PA 3SDBA 1YUNA 2CYCA 1M1ZA 3KT0A 4OUDB 3TQOA 4EF6A 1MOPA 3FETA 1TQ8A 4MUFA 1QRSA 4JYZA 5KCMA 3PXUA 1G59A 1J20A 5J59A 2DERA 4NZPA 1F9AA 3COVA 1WOYA 4ZCTA 1SURA 3KFLA 1ILEA 4MUNA 5H16A 4I6JA 4G6ZA 5BNZA 2WQ6A 2EJCA 1QJCA 4G5YA 1JEEA 3VRHA 1J70A 4DNXA 4CT0A 1NI5A 3AKZA 1NP7A 1EFVA 3DPIA 3COZA 3PNYA 4MW0A 3IVXA 1MAWA 1EUYA 1EJ2A 4HPWA
chains in the Genus database with same CATH superfamily
2BFDB 4YYZA 3GMDA 1A9QA 4D4LA 3LC2O 4TKUA 4UBLA 2OCYC 1L5ZA 3TD6A 2V6GA 3DC7A 5C8YB 4TV9F 4OV6B 1G9SA 5HP4A 2JFPA 5FJIA 3SXUB 2COKA 3O5AA 1FCJA 4Y7DA 1HE3A 4NPCA 2BH9A 1RI4A 3SOZA 3TRHA 2QR5A 3IKVA 4RKQA 2AFRA 1Z18A 3VMMA 4F2HA 5B5SA 4R51A 5B12A 2BHTA 4MV1A 2I8LA 4LZAA 1FBNA 1LTKA 2IZ5A 4ARBA 3O8OA 1A82A 2JIPA 3ETEA 4LPKA 4CUZA 2BE7A 4H08A 1X0VA 4AP6A 4BLRA 4KPFC 5G02A 5AJHA 1RWXA 4FUTA 4YJ2A 4WNFA 4I81A 3TWRA 3L54A 2VHTA 2B6HA 4YDHB 2WJWA 2QSYA 1E96A 4ESOA 1U0JA 1YB5A 1PKXA 4TVKA 4BNZA 4GEKA 2QY7A 1Q0TA 1TNZA 1SVMA 1COZA 5EDSA 3MTAA 3A4MA 3HWSA 1TPYA 4BB9A 5DI9A 4PLWA 2OXTA 1SKBA 4HAUA 1NHGA 2C4VA 1FSPA 2BPOA 1OJLA 4MO2A 5IAJA 2O6HA 2IEIA 2P41A 3C8DA 4RQTA 3PZ2A 4ZVNA 4W5JA 2WT4A 4DJJA 4UI9C 2G1KA 4OHMA 3TKLA 4YPFA 4YMLA 4Y2UA 4NMHA 1TXGA 1DLJA 1N4AA 3MS4A 4X1KA 3UG6A 2CLSA 1I0ZA 2WU3A 1RI3A 2AK3A 1L7DA 1FFBA 1GUAA 3M70A 2QGFA 4TUYF 1K7EB 4XUCA 4G81A 4QULA 2PAFA 4WFQA 2G06A 2RBEA 2EJBA 1U3CA 3SFVA 1XZNA 4XB1A 1PGJA 5FPKA 4IQ0A 2ECKA 4YR9A 2MYOA 1L9XA 1U5CA 1M1NA 2J0UB 3R5XA 1OUVA 1WMDA 1DIHA 2OGZA 2CLEB 4RY8A 1QYRA 4WERA 3CMMA 5HE9A 4ZJPA 1P5JA 1U4NA 5JNTA 3OO1A 4UCWA 4ZDWA 2HSDA 3R9KA 1V47A 5CUQA 2CXRA 3PEVA 3UKDA 1S8AA 3UJ7A 3DZHA 1ZB1A 2C4MA 1EQ2A 1QFXA 4RVOA 3TQQA 4CQMB 1DTWB 1M1YE 3QKYA 1WCIA 2BEWA 4QYWA 3PFFA 4UBIA 2CWWA 5AQ1A 3H86A 2EV9A 1YJBA 5J58A 3U2QA 3WZMA 3FUMA 2EYUA 1FP6A 3K6SA 1X7WA 3BVPA 3F0TA 2EKPA 2AZ4A 2Q4EA 3DAYA 1L4GA 5JWOA 4FVTA 1Y8RA 3Q79A 1E5TA 3EC2A 1DINA 3BK7A 5KTKA 4AMZA 3IYLW 3ORHA 1OZFA 3DZBA 4P22A 3WYCA 2XCCA 4MTCA 3ND5A 4RDCA 1I94B 1H94A 3LL4A 3EFOA 3F46A 3W7VA 1ZGAA 1TLFA 4XGIA 4B43A 4BO3A 2WINI 4XI9A 3TJPA 4ETWA 3E84A 4ZV4A 2D5IA 2L42A 1YZNA 3PCTA 1NONA 1RYFA 2BMJA 4GTVA 2DWCA 2NG1A 5CB4B 3JZDA 1XX6A 2XYVA 5LPNA 4WOJA 3WGGA 2ZU6A 5HCIA 1UDWA 3EYWA 3OFKA 3Q5GA 1GL3A 1YDMA 3L7JA 1YE5A 3JARA 3AJIA 3HCCA 1U80A 1F06A 3D0OA 2I5PO 3Q0EA 2PGOA 2IUSA 3W34A 1V4NA 4JJKA 1G1AA 2PUWA 3ECSA 1V7PC 4LYAA 3OXLA 1D5WA 4ATNA 1W49A 3V2OA 3KJGA 5ABPA 1P5FA 2OBYA 5TQ0A 1J07A 1THTA 3A1NA 5PNTA 4EB0A 2BMFA 3KWFA 5FWYA 4J0DA 3Q7IA 4AS3A 4R84A 4ZZIA 5C81A 4RG9A 5E2BA 4QAQA 1SXJC 1C2YA 3DA8A 5DHAA 1XQWA 3AGQA 2VL7A 3IO3A 4M8SA 1XCMA 4ESEA 3LL7A 1E2FA 2CE2X 5B3LA 1XFDA 1NE2A 2OTCA 2ZAIA 4QXQA 1JUQA 3GN2A 1HX8A 5LQNA 5FI0B 1WMFA 4BYGA 4CQLB 1HG0A 1PX2A 4ZVLA 4IV0A 1SQ0A 1P0PA 2OWEA 2O8EA 1HH8A 2ZWMA 1DAMA 3UQZA 3DS8A 3E4CA 1JDUA 3LK6A 2O1WA 1TM7E 3NV7A 2GJKA 3G0DA 5KDDA 4QJBA 3K9HA 2FUCA 1CY8A 2Q4BA 1NY5A 1UJKA 2OQRA 1YULA 2D62A 3IXEA 4IVPA 5IYZB 1L5HB 3MTBA 3IA7A 4E30A 3VAZA 1BJTA 3TBFA 3FU3A 4CDGA 3L7BA 1CNEA 2VT2A 4PYJA 3K1TA 3WIVA 4DVJA 3RC8A 3TG5A 4HXGA 1FUIA 2XUAA 4KI7A 3ULKA 1SIWA 3WAKA 2QTGA 5G0SA 1W0KD 2GBPA 4OU4A 3LZ6A 1KEEA 4OFBA 2BOVA 1E3MA 3HP7A 1V0JA 4QO7A 4OVUA 1W85B 3I73A 2HW8A 3T4EA 3H83A 1D4ZA 4EB6A 3KAQA 1GGFA 5BSKA 5KSPA 1MC4A 1GLGA 4J9UE 1AQIA 5FOSA 3LKVA 3PVSA 1XTRA 3UK6A 1Q91A 1G21E 3BQ9A 3N3AC 2Z09A 4XSVA 2WZDA 5LP6B 3B5JA 2H2WA 1F4VA 5F52A 2XBMA 1U31A 1MBZA 1X74A 2WHYA 4BNDB 3GJXC 3H9UA 3N8KA 3NFRA 4L57A 3I0ZA 5GOTA 3UMBA 2J3KA 3EPKA 1K3ZD 4I1UA 3UO8B 4BFLA 2H3EA 1YL5A 4LOLA 4RFLA 4J16C 5K0NA 2RAFA 4CYMA 4FJYA 2AWIA 3QAQA 1BH2A 4KUHA 1EK2A 3DTVB 3FMFA 1QANA 1IBSA 5CA1A 5JS2A 3C3RA 5HRAA 3K92A 1XGKA 3H6GA 4YCBA 4NXMB 1O54A 3MT8A 3CKBA 4REMA 1IC6A 3JAWB 5DXFA 3I0MA 3WGHA 3RV4A 3G2LA 3PIRA 1ESZA 1Y4DE 1WPRA 1F6BA 3AAAC 1G60A 3IBSA 4L85A 4YX9A 5TGZA 2EWWA 1O58A 2RGWA 2IS1A 1ZM7A 1OBFO 1I51A 2VJQA 2DR2A 1Q3KA 1M67A 2GETA 3E23A 4DV5B 4YJ3A 2PH5A 1EFPB 2ZYRA 5A03A 1WB5A 4LA4A 3UTMA 1W52X 3UA4A 1FFGA 5UKDA 4N9QA 1OY3D 3FIUA 4WQMA 5P8WA 3CLSD 4UDYX 5C5CA 3JATA 1SXHA 1IULA 1O5IA 5LQCA 1E2EA 4KQ1A 4ERNA 1NXPA 3JYOA 5I7HA 5IC4A 1DAPA 1ADBA 1E8MA 2M6RA 2Z2ZA 1XO1A 3FYDA 1U8FO 2Q07A 1AZTA 4HTFA 2BEDA 2LWIA 3DBRA 4LF7B 5A7FA 4U8VD 5CEDB 4DYDA 1FSGA 5AI6A 3U7JA 1ZIYA 3AOEA 1EP3B 1Z0SA 3UAOA 5BV8A 1JSXA 5GVRA 3B70A 4PFQA 1VYVA 1TM3E 1RLTA 3BJIC 3G2MA 3HWWA 4XWWA 3TAUA 3FSGD 1CC1S 2ATXA 5FZRA 1MF7A 1DAHA 3QXCA 1USWA 1R8SA 4QNNA 1BWQA 2ODBA 2QQEA 3DTVD 3IT0A 5JNRA 1G66A 3AVTA 2PX4A 3D5TA 1GFZA 2WP0A 3U1VA 1JV2B 4KAFA 3L6OO 4MVJA 4TYMA 5JC1A 2CMKA 1AZSC 3L7CA 1MO5A 1TD9A 1IRXA 2DKNA 4FTWA 3VH2A 3CLTD 1K89A 1XU9A 2GAIA 4U4AA 4DMMA 1VRCA 1WEHA 4BL5A 1T2AA 4H4DA 1IB6A 3WZLA 4ACAA 3RROA 2CT8A 2OEVA 4GO1A 4ES6A 1QAOA 5KTSA 4F1JA 1Q7BA 3D54D 2B2NA 2ORED 1MHQA 4PGGA 4PV7A 4M7WA 1NVDA 3DE4X 2NM0A 3A6GA 4J8EA 3P0IA 5D01A 1HLDA 4FHDA 3H42B 1GZ3A 3ZLTA 1ZI6A 5KYNA 5LD2B 3A4IA 4ZICA 3KSUA 2YMLA 1M2KA 3KQKA 5L40A 3UFXB 4GC9A 4B2PA 2O50A 3VPXA 1NBOA 2J85A 4F4DA 4DLUA 3BZUA 3IOMA 1Y8QA 4KR7A 4R1OA 1NL3A 4DLWA 2XGGA 3C8ZA 3KHUA 4YRGA 4ZCMA 1C1DB 1M6HA 3CZ9A 4EY4A 4JSYA 3JWPA 4NZ9A 2GAAA 3JALB 2R44A 1OREA 4JJ6A 3Q78A 3Q2OA 4MRPA 1DX9A 3LJNA 2YKGA 3GJ0A 4FNGA 4N4AA 1TZBA 1XZMA 2XUQA 1IJEA 4M9SA 4CF4A 3HWRA 5HX7A 2AIRA 4IEEA 2VSYA 4EJFA 4S2EA 1Y3IA 3GJ6A 2C31A 2CHQA 1RIIA 1FDIA 1GR0A 3ZKWA 2XGOA 1NLZA 5B1IA 4WJKB 4ZZ1A 1FFCA 2VDRB 4JLAA 4GQAA 1S3SA 5AESA 1N7IA 3AFGA 3KJZA 3VNUA 3PDJA 4FSHA 3M6UA 4K88A 3F7NA 2XZTG 1FXWA 3FWPA 5U4QA 3VU1A 4DLYA 1WXEA 3EPRA 5FLYA 2ONDA 1Z0DA 3BQMB 4H7PA 5FV7A 4FGSA 1AQJA 4MAMA 4AM8A 4Q1BA 2C8KA 1RQGA 1CUVA 2X6JA 2I7VA 5DGDA 3G68A 1PVDA 1G8HA 4A1GA 2Q99A 3F1LA 2WF7A 1BWPA 3GZNB 3M3HA 1Y4SA 4NNJA 2GH1A 4MP6A 3ZNOA 3DE7X 2ZAOA 4OB7A 2P8SA 1NN5A 1CX9B 3BD9A 1V7CA 3AEYA 2B35A 5KX5B 3ULYA 3EVAA 3LV8A 2R84A 3SF8A 4WESA 1T9CA 2V6MA 1Z0IA 1KFCB 4Z49A 2NOAA 4BPRA 2ZE6A 3DSXA 3A9TA 5CT4A 1QPGA 1V8ZA 3U26A 5IJ0B 2QXYA 3U31A 2NO6A 1WSWA 3ROZA 2VCEA 3GZ1A 3E5HA 1JDBB 4ZXPA 4GE0A 4JXTA 3AY6A 5AVQA 4PZAA 2RHJA 3VR5D 2AR7A 2JEOA 4OG2A 3EMDA 2ERXA 1SOVA 1FMLA 2B8TA 4YT5A 4JD5A 2M6KA 2UZ1B 5FEMA 3GL9A 2NP6A 3DLPX 3ES9A 1VIVA 1VCMA 5DLPA 2CDBA 1ZR2A 5DCYA 3LBHA 1TB4A 3N2GA 1REQA 3S4YA 4MW6A 4EHAA 5DNYB 4D1YA 1E0JA 1OFVA 3ZDYB 1KZ4A 4OXQA 4XCQA 4IPTA 3R09A 1SIUA 4OYLA 3SF4A 3N2ZB 5AUPB 3ED1A 3A28A 3C1UA 2R17C 1NI5A 2CDAA 4LRTB 5JROA 4DMUB 2BHLA 1AGNA 4IIEA 3IT3A 2AVDA 4V0KA 4PZ0A 5DGIA 2JB9A 1WY6A 3J5QB 4F96A 2O6LA 2C3OA 2F4NA 1M10A 3ZYKA 3TL5A 1X86B 3QKRB 2IODA 1YRWA 5C4MA 2VOEA 4MV4A 4W9NC 5IEJA 2NLOA 1JJVA 5E9AA 1Y82A 4M49A 3RF7A 3OLXA 1DZIA 3WLMA 2WVIA 4EDHA 1PJQA 4NYMQ 4O02B 4WW0A 3CR7A 5BRJA 1C3EA 1KZGB 3JQFA 3EZ6A 2OYSA 4JDUA 4LNHA 4Q6BA 1LW7A 3KZMA 4J90A 1TYEB 5EPOA 3A1UA 4C89A 4AY6A 3HJNA 1ZK3A 2MDTA 3P4XA 4X95A 2CD9A 3KQPA 3E3LA 1W73A 1JWGA 4RMIA 2FTKE 1ZGGA 2Z3VA 2R2AA 1YNOA 5CX1A 5FRDA 3JUIA 2C3MA 2VTDA 1CUYA 4Q48A 2I55A 3WXMA 3GLHA 1HETA 5DH9A 2ZREA 2ASEA 2QTZA 4RG6A 4AROA 3QEJA 1E4EB 4APOA 2JGNA 5KNCA 2GHQA 4QUIA 1B3RA 4LUNU 4ZOLA 1WBDA 4TTIA 1AX9A 4DK5A 1GEGA 3IKOB 4FE7A 3UY4A 1J21A 2WJPA 3BL5A 1TO1E 2QZJA 1AP7A 4MMYB 3PZ3A 4EA6A 5AD1A 1U0SY 4RD4A 4IIUA 5GONF 2XYQA 1BW9B 1L7XA 2VJMA 3COYA 4JBYA 2QTWB 3QW2A 4BO7A 4DEVA 1E2BA 2IXAA 5KNDD 5C4IA 1ZG3A 1EM8B 1FTNA 2D00A 1CUJA 3L6UA 5MN6A 2FR8C 1H5NA 1D6SA 3AR2A 1JP7A 3FHCB 4BTAA 3Q5EA 5CD1A 2JJ2D 3V4ZA 5BSFA 2HSJA 1GXSA 4JA7A 1Y80A 4HMOA 1ML3A 1ZGHA 2IFTA 3F4KA 4EJSC 1KP2A 3RTCA 2FWJA 2OR3A 1Y4UA 3TRKA 2G71A 4A8TA 3BXOA 3WLTA 3FJ1A 2XUDA 2V8BA 4M60A 2V65A 4UEJA 3NGXA 3RHSA 2GRRB 1WDLA 1K9VF 3ASVA 1LD8A 3LVRE 1FX1A 4MVCA 1N2CE 1B0AA 1Z28A 4UFNA 5JYDA 3NTUA 4FNMA 3CPJB 2YYAA 2DPGA 4D97A 5C37A 1E4OA 3IILA 4ZV9A 1N0HA 4QQNA 4MPRA 3SQWA 4GTPA 1U1GA 1FFXB 2QTMA 4QUHA 1HLFA 2UDPA 5CVVA 4LSWA 3TSAA 2Q2VA 3QA3E 3LUDA 1OXSC 2VSFA 1O96B 3NP7A 3K8YA 1A1SA 3EASA 3F2VA 1ZVJA 2CSXA 3SQLA 1ZSVA 2ABWA 3EEFA 2W6JD 3REOA 3ETLA 3Q8WA 1GPNA 3ZU5A 1T4DA 2QPAA 1X38A 4M8NE 4GMDA 5LP6C 1B26A 4FYXA 5I7EA 5ECWA 5K0LA 1IJKA 3K0BA 4KO8A 4J76A 3LY8A 2GCEA 1CK4A 1IZ0A 2CLIB 5JCOC 4HUQA 1HZZC 5ESWA 1OSNA 4BX9A 4GYJA 3WYDA 1SVNA 2XCBA 2WFZA 2BFFA 4WPGA 1ADCA 3UT0A 3NYIA 4AL4A 3DLAA 3AP2A 3I4GA 4P0PB 1XZCA 1W4CA 3MJWA 4EPXA 4OJYA 3M82A 2XKJE 2D59A 1DV2A 3T9FA 1UT8A 1H2FA 5C18A 3BD8A 3FOFC 3DP9A 1M34B 1CUIA 1R5NA 3KTAA 3JQ1A 1VKOA 4YAGA 2O2GA 2AS0A 2VXBA 4UTVA 4HPWA 4I9HA 2VXYA 3SF0A 3OKFA 3ZN2A 1YT5A 5C8VA 3FUDA 3CB2A 5IC6A 4I9NA 3CKKA 3SCZA 3RNLA 4L3VA 3EFEA 1NW3A 3JX9A 4PYLA 1Y6JA 2F4VB 1QUFA 1GZUA 5HW0A 1JR6A 5ICSA 4C0QC 5DNDA 4UBNA 1E32A 5EY5B 5IUKC 4KODA 3CRQA 4ZVSA 2QDXA 2I4OA 5F3DA 1WPQA 3IAXA 4OQFA 1UJNA 3OOHA 3S2IA 4US0R 4FOLA 5EX3A 1G5IA 2NO0A 3EZLA 4UNQA 3AI7A 1HU3A 3AETB 2ONYA 1T4CB 2QZ4A 1R0XA 3JQ9C 4D8YA 1GL7A 1IZZA 3PHCA 5FNVA 2X38A 4ZEXA 3MT7A 4IUDS 1FY2A 4OHKA 5C8ZA 3NOXA 1T1RA 3FHEA 3OETA 3FOEC 1LPBB 1Y4AE 1PZNA 1HDCA 2C98A 4X91A 5EIAA 4HAOA 5JSZA 3NWEA 2R6ZA 4G1EB 1ZBDA 2SKDA 1MEEA 4FP9A 4A26A 2JLCA 3C39A 5BSRA 4JJ4A 3QDNA 5LZ2A 5TF0A 1VHLA 1ZOSA 5JS8A 1CE8A 1T9DA 4QOJA 1HPLA 2FG5A 3CF4G 3IVRA 4OBXA 4QXOA 4U2BA 5EYPA 1NX9A 4U2EA 3OBBA 2DFTA 3GFGA 1YF3A 3LS8A 5LX8A 1U9JA 3OM1A 3E30A 2D1RA 1XTZA 5I9BA 4JS0A 2Z04A 4XGQA 1YZFA 1CZUA 4CM9D 5JJTA 3VUEA 4R8MA 4EA9A 2TECE 1BCRB 2JFVA 1C9JA 4CLOA 2QW0X 1YRLA 2WHPA 5JVDF 5IH7A 4DSOA 4ZI7A 2RHWA 4ENUA 4BFYA 4MMXB 3ESYA 1GUYA 3QWPA 4L0DA 1E8WA 2DF8A 2A5FA 4TSKA 2QGNA 1QYMA 2IEGA 2WIGA 4HLCA 5BVGA 3MSXA 4OKIA 4YONB 4HLLA 3B3AA 1SELA 3H05A 3SIPA 1ADFA 4MI1A 3EX7C 2PO5A 3SC4A 1H2YA 2ISSD 4LV8B 4WK2B 2P9IG 1CY1A 4TMVA 3T7JA 5FI5A 2X8WA 2VQEB 4L6IA 6PFKA 5LD2C 1A4RA 1YV9A 2HX1A 3OQIA 3RIEA 1KK1A 5EE0A 4DQDA 2ZRQA 2C83A 3FTUA 5CEJA 4MUGA 4QDUA 3U64A 4TKZA 2NTJA 3JXEA 1ABFA 4KT6B 4PO1A 3QOYA 4WZAA 3O21A 3CEMA 4KXLA 3DWLG 3L9TA 1XN4A 1Z6TA 4A0HA 1ZCFA 4OX9B 1BHO1 3G13A 1GQYA 2V6FA 1OWPA 3BDAA 3PQ6A 2R6R1 1CR2A 721PA 4HX9A 3MOIA 4EI2A 1T0PA 4O2AF 4J1TA 1NBMD 2QM7A 1L4KA 1JAHA 4LSMA 5E6RB 3F8TA 4U6SA 3DKPA 1G7TA 5BNTA 2WA2A 4OSPA 4DA4A 1EWTA 3KR1A 1MQ8B 1DU4A 2BY4A 2ZYVX 3S27A 2P2CA 3OF5A 4CLDA 1MO2A 4HUTA 3IVMA 1XCGB 3GOQA 2JF0A 4B44A 5DEOA 5IY5E 2IUFA 2AQIA 2V7VA 3I6YA 2XY4A 1X19A 3F6RA 3F9CA 3ZJTA 3ILVA 2OHOA 5I9LA 5IAAA 3KK0A 1YQGA 1MENA 4UXHA 1N4PA 3ACCA 3O2QB 3N8IA 2GZHA 2EW8A 4O29A 1KI4A 4OA5A 3Q49B 4CBVA 3INNA 3T5VA 1QE0A 2E48A 3B9QA 5IT4A 2IU3A 1GFWA 1MDFA 1VJGA 3VYWA 1V39A 5ER6A 2ZRIA 2LR0A 4MARA 3ODGA 4JHLA 3EVTA 1H0AA 3E37A 4OQYA 4A5OA 5FT9A 2H11A 3TWSA 1T26A 1VDYA 4C43A 4BEVA 3COPA 2BFEB 1UZLA 3K8OE 3OZWA 1KBOA 2CHUA 3STUA 5CB0A 3BRWA 1AS0A 1EUYA 4IR7A 1Y8ZA 3VV3A 4N3NA 1SUPA 5KU7A 2PS9A 3DCYA 3U0BA 2HQBA 1NBAA 2IF2A 2QLJA 1OLSA 3TR6A 4K9LA 1TN7A 1UK7A 5DI3A 3W3AA 2ZR0A 1JDBC 4W7SA 1JPVA 2HXYA 3ZR4B 4RHXA 2G08A 2PGIA 4MULA 4BWRA 3I2IA 1PJLA 3I04M 3MRTA 1ZS9A 3F3SA 4LFCB 3WL4A 3JQRA 4BMDA 1ZJ5A 4FJ0A 1QIEA 3FEYA 3IP3A 2P4HX 3WWYA 5GJWC 1XQ1A 1VKJA 2BGUA 2VGYA 2WSSA 3MXTA 4QOFA 1GN9A 3TCXB 4RDHA 2ENWA 2NZUG 4B7UA 5CT6A 2JD1A 1EFUA 2NSJA 4QQIA 1ZVQA 2FPGB 2Z3WA 2XAUA 3A25A 3VSBA 1TJCA 4YTEA 5KO2A 3PZ4A 4BE9A 5KJNA 1ZJWA 4YRQA 4I14A 4O3FA 1P29A 1X87A 3DVSX 2OG2A 3DZDA 3A14A 3ANNA 3T9BA 5BV1A 2QRGA 2MR5A 1W44A 4HLUC 4DM4A 4BC0A 2O7RA 4B81A 1A77A 1NKSA 3AM1A 3GEHA 3AEUA 4QVGA 4PIPA 3N8HA 2ES4A 3K20A 4JITA 3C6YA 3NUZA 3T3HA 3D9KA 4EHHA 3ROKA 1UEJA 1TEXA 2IYEA 2QYOA 3C6QA 2VJCA 1J5PA 2CG3A 2BKVA 2XR1A 4MV6A 3DB1A 4RAQA 4UAVA 2HMTA 2PVCA 4LUCA 4AWAA 1FJGB 1PJTA 5IKOA 2FWNA 3F3MA 4UWHA 2IDJA 5CFNA 2GW1A 3FHLA 4G37A 2PL1A 2YOGA 2QTLA 5JZBA 1BWRA 4RNCA 3UT4A 4PO3X 1PR4A 1SXJB 3ZOKA 1ZEJA 1RU3A 4R0NA 1LS6A 3ZWXA 3CHMA 1HE5A 1KFEB 4TMYA 4OI2A 4ZQBA 4Y2SA 5JXWA 2PBRA 3MUNA 3LQ4A 4M4SA 2AXNA 1OV6A 2RGXA 1GDDA 2I80A 3EPJA 4L02A 1ZITA 4TTQA 1MAVA 3TLJA 4DNFA 2ZGDA 2XUGA 2QVXX 1EZ1A 3QFRA 1U7OA 4N8DA 2NTYC 1YVUA 4HNAD 5ARFA 1H2BA 4YBRA 5AIJA 1S96A 3JASA 2CJWA 4JYCA 1F8YA 1BA2A 4HS2A 3PE4A 3OTQA 3Q5MA 1SD5A 1XNGA 3RYFA 4H3VA 1XXHE 4GTRA 1N0QA 1EM6A 4UNSA 2VT6A 3IALA 4MDHA 2HV8A 3BL6A 3G0CA 2XTJA 5DX8A 2C4UA 3L1HA 3A9SA 1E8ZA 3EJ6A 2G9QA 1A0OA 1T3GA 3V1MA 2E4XA 4ZMSA 3F5MA 4BTEA 4L27A 2DQSA 5REQB 1EA7A 1U3UA 4ITUA 2DE0X 5CERB 2BJWA 3LFUA 3CZCA 4DX5D 1TYDE 4QGSA 1N7JA 1TL7C 5DYIA 1AXRA 4MS3A 1Z3CA 1EMDA 4GWGA 3O38A 2AFIE 5JTTA 2EW1A 1TEZA 1JEDA 3WLIA 4GIBA 3NV9A 4EHDA 2VUUA 1G5PA 5JSFA 3P5BA 2GF2A 3NEPX 4ZCLA 4TL9A 4HH3C 5H5JA 4HZUB 4FILA 3A6DA 4Q96A 1JHQA 1E2IA 4F0JA 1FUUA 3P71T 4DY6A 2YJ3A 9MHTA 2Y4UA 4HN9A 1EESA 4RZIA 1SXJD 3LVBA 4ACKA 1NBIA 2I1KA 1M2OA 1ZL2A 2E5WA 1ZFNA 4R1LA 4DI4A 1EFLA 1GQQA 4P38A 3VI3B 1ISJA 4MUNA 4I6JA 4GQIA 1I7SB 1QFMA 4NFLA 3X2FA 1Q1ZA 1V96A 2IOLA 4OGKA 4XQGA 2ZB3A 1SQGA 4Q9KA 1ULZA 2R8PA 3OE1A 3QFTA 1E3EA 5J2UF 2ZE7A 4PIMA 1BOFA 1U99A 4MYCA 2QQGA 2VJPA 4C7OB 2ZI9A 3EVEA 3T3OA 3HE3A 1GGNA 4WDRA 4HLDA 4DNOA 2HA3A 3T9DA 3DJFA 2JIBA 3MZ0A 4BT8A 5E8RA 3RRZA 4RPJA 4YMHA 1TJ3A 3EC1A 2QJTA 2OL4A 3QWIA 3I92A 4QUAA 3QOUA 2ZZKA 4KQ6A 1M1YA 1Y9DA 5LMZA 3NHMA 4BV3A 4Z9AA 4BMVA 5T8IA 4Q66C 3F7MA 1EKXA 1PLKA 1V41E 1N3LA 4QXPA 3P0FA 3D0QA 1EZ4A 4BOYA 3GAMA 2MWMA 1XVAA 4ICIA 5DM60 4JUBA 3NQPA 4JY7A 2ILVA 3TGPA 5DK6A 3Q3VA 3LT0A 3AB3A 2R1VA 1MN6A 4XQCA 3SYLA 1E69A 1MX1A 4Z54A 1WDYA 2WXFA 3OEED 1ZCBA 3BJZA 2UVQA 5IARA 5KEIA 4ENSA 3MLEA 2YC4C 4PX2A 1GTL1 1XYVA 5CAEB 1IOWA 4LF4B 3A6FA 1NQUA 1LPNA 1RQ7A 4RS3A 3SAJA 1DPFA 5JECA 4BKOA 4LDNA 2OC9A 3NBZC 3V46A 5AJVB 3NI2A 3RSQA 3SJZA 1AN0A 3IL2A 1LFAA 4XI0A 3R20A 2JRCA 5KI6A 2C4HA 1MX3A 2WF5A 1DMRA 4NAHA 4WECA 5JFTA 4QM7A 4RAOA 1JHZA 1MB0A 1KQ3A 2C2BA 4YJFB 1XRNA 1RLIA 4HH1A 4J7UA 5J5AA 4O4LB 4LI0A 3KB2A 4FMDF 3KT8A 4UAUA 2GAJA 4Y30A 5TT1A 2ETBA 4QOHA 4OGGA 3K6JA 3ZCTA 2XV1A 2ZR7A 2FW0A 3H0KA 5B3AA 3AILA 1MR3F 5AI8A 5JBNA 2VHVA 5JH7F 1MTOA 3D9QX 3THOA 4PZPA 1MJ0A 1M6YA 3LF2A 4KXNA 4OHFA 3BQOA 2I7CA 1UANA 1Y7IA 3PEUA 3HFGA 2VJ8A 2GJSA 2XQVA 5AQ7A 2O8CA 2YYSA 2I62A 4MQ4A 3WA7A 5HNKA 3TQCA 1FFSA 3TCNA 1WUIS 4KPUA 5AVKA 3EDRA 4OH7A 2KBFA 3FRHA 3P9XA 4ANXA 2R2GA 3L41A 1KPSB 4BT9A 1Q21A 4IRXA 1TADA 4HQOA 1STOA 1ACLA 1T34A 4UEQA 2AZXA 2YHUA 3L6BA 2V4UA 2E49A 4LC0A 1QVRA 5AHKA 2GD2A 3C7DB 5DGTA 2NXPA 2E1RA 1WIWA 1LEHA 5F7ZA 3B6MA 2XB2A 3ZWNA 1XD2A 2C9DA 4D9HA 3QVOA 2Q0SA 4I1VA 1HEIA 2GJAA 2EP5A 4D0NA 1TECE 2QG6A 4KREA 4JVMA 2EQBA 4I8DA 3QE4A 3UW1A 3MTDA 3SEQA 1WXWA 1N6NA 5JTUA 3DOHA 4NNPA 3V7YA 1UMKA 4JLUA 4RFSA 1RAIA 4S0ZA 2P1RA 1N3IA 5DM2A 3TJRA 4LBVA 1GZSA 3PXGA 4MUFA 1Z08A 3HXLA 3TG4A 4IMJB 5AENA 3ZHVA 2CUNA 4A3TA 5KYXB 2CMDA 3T7AA 2JLBA 4EMBA 3GEIA 1E8YA 3DLHA 1G21A 2LDXA 3RVNA 1FW6A 1E4YA 4WOBA 3H65A 1POXA 3R6LA 4BNMA 3DC2A 5LCXA 4EX6A 4FWIB 4EYOA 2HJGA 4WFIA 5TVGA 4QSMA 3QYFA 3SHTA 2Q4TA 3B6EA 5TT0A 5L45A 4Y8VA 2J8SD 4OO3A 3R5KA 4BS9A 1UKYA 4QRIA 4IDGA 4LJ5A 3N8DA 4WKGA 4GNKA 4D9IA 3URZA 2V1XA 4CCYA 5C35A 4BVBA 1TQ2A 3IUJA 3LHFA 1UEIA 3D43A 2VQSA 4FZJA 3TFWA 1H2AS 1Q6YA 1NFFA 3KQQA 4MIOA 2WD9A 3ASYA 4Z4HA 4HDRA 4NMMA 1SUDA 4YR7A 4RVGA 3MWDA 3PR2B 1TQ6A 3FA2A 3OZIA 1P0IA 3R9XB 2EGUA 3P2BA 3SVLA 2GCNA 1FUEA 2P6OA 4L5CA 1Z3YA 1QP0A 3VVBA 1UAYA 3R7WA 5EQTA 2PFSA 1T4GA 1C9YA 1M2VB 4KWEA 1J8YF 5IBCA 3RRMB 1U7HA 2G04A 1QFYA 3QKTA 2IXTA 1ZXXA 3F2IA 1QO0A 2X0IA 2OZLA 2VYVA 2AKEA 4PLPA 3B12A 1XOIA 1RRVA 1DQYA 4RGYA 2ZVDA 3QVUA 2DSNA 3MINB 4X8MA 2Q9BA 3CPHA 4MRUA 5K0ZA 5IUNC 1G19A 4MRNA 4G1BA 5FFMA 3TGWA 4JQYA 1BO6A 1JKXA 2JHFA 2CV0A 1GUZA 3LOUA 3N76A 4G8LA 3JVIA 1EX9A 1EG2A 4NK5A 4DLXA 3KSZO 1R5OA 3NJ4A 4KBGA 1MEJA 4L4RA 4MCIA 1KMNA 1II8A 2RHCA 4BFUA 2DUUA 5C1BA 3MMNA 3AIOA 5JLJA 3FJOA 4JASB 2GRUA 5JA4D 3B8HA 2GILA 2JIOA 3OQOA 2JIQA 1XEXA 2MT9A 4CG1A 4HVAA 4M0MA 3DRAA 2H4JA 1WP9A 1E61A 2CL7X 3ZXXA 1ONPA 3L0CA 3SYNA 3DDSA 4G86A 4OQDA 1D4OA 4GOJA 1ZD1A 4ADSG 4F1PA 4QUGA 5IAEA 3GGOA 3FMPB 2C9BA 4MI3A 2DQYA 5KTTA 2E6UX 2LO6A 4AICA 3LA6A 1DJNA 1DBIA 2DPHA 1KHTA 1L7EA 4Y6WA 1L1EA 1GKYA 3VR3D 4N54A 3D7SA 2FSUA 5CBPA 2A0XA 1U6JA 3CO0S 3M0EA 3M2TA 4IILA 5H3LA 2DX7A 4JYMA 3O2JA 2I76A 1NMQA 3HB5X 4KB5A 2JAQA 4QTYA 2A92A 2WUEA 2A33A 3O8QB 3RRNA 3VLFA 3QBEA 2VNHA 4IUCS 1YRYE 3RRJA 2BGLA 4JP8A 2VYFA 2WFLA 4M9RA 3NZUA 4CQMD 1SZDA 2WNHA 5LDGA 1I4TD 4DG9A 5D7NA 3RFVA 3U3XA 3AC0A 2B0OE 4UCXA 1RXCA 5HF8A 3B38A 5EIXA 2C8JA 1KPHA 3UANA 5F5LA 5DRTA 5B1AE 1B74A 2GD6A 1F2UA 4N5CA 3D5EA 3AM5A 2AFHB 2J41A 3TBKA 2V0PA 2ERCA 3EIFA 4E88A 3R0ZA 2WJVA 1MX5A 3WFJA 3D9PA 4EJSB 3BD6A 3NM6B 1GO2A 5AJZA 3ZHRA 3VAYA 3WKBA 5EZYA 2K7ZA 3P2JA 4FEAA 4DCNA 5CHYA 1G2IA 1P3JA 2XTAA 3RC9A 4LXQA 2M2IA 1O9HA 2FXVA 1LD3A 2WXMA 1SRQA 1H93A 3NZSA 2C7VA 4BSZB 2HNKA 4MKHA 4E2FA 4FI3F 3R0JA 5KTMA 1HR0B 3KV3O 1U2GA 3ROQA 1I24A 1ACJA 1RQ2A 3OAAD 5E6SB 1QV7A 1SBIA 2VPWA 1ZGZA 2LPMA 2XVYA 5E6UB 2X5OA 4ZKEA 1YA0A 1Q0UA 4DLOA 4ND7A 1E1QD 4ARUA 5DX1A 4Q3NA 1C4XA 1MRSA 4YRLA 2WUVA 1R6XA 5C1OA 5GPBA 3V8PA 1XE3A 1OX4B 4KQHA 2DIWA 1BCSB 3GVPA 4KXVA 4JV5B 1PUJA 1RSZA 2HK9A 4YV0A 3GY0A 5D5HA 3B1VA 2FLWA 1IBLB 1L3BA 4G5SA 3OA0A 2XA9A 1XHEA 1RXEA 1MP0A 3DCJA 4G85A 1GY8A 4HLQB 3QEMA 3UCXA 4JHXA 1R0YA 2IRWA 1JMYA 3B3JA 3DMYA 2D2VA 1MXHA 3T1TA 2CXOA 3ETGA 4DX7D 2OLJA 2FMHA 1BDBA 1CRPA 3C15C 1BX0A 2YHCA 1G8PA 3PLRA 4C01A 1NM5A 2PUCA 5CXQA 3QFHA 4NQ0A 4DNQA 3P2MA 1BHJA 3NP9A 3KQWA 3CF2A 4E21A 4BNVA 2J08A 3QFSA 3CX3A 4OYYA 2A1UA 2ZVQX 1BXRA 4EKYA 5JD5A 1G42A 4FYIA 4GBGA 2J9XB 1ELOA 3M3DA 1NMSA 3E5RA 2BKGA 2FF7A 3EK2A 1WBBA 2GF0A 4RTQA 4QG7A 3VKGA 4RDIA 5ICFA 4GLBA 3H6KA 1BI8B 4CLRA 4E5KA 2FPLA 2YXPX 3D8HA 4C0SA 3JR7A 4GL4A 4CQJA 3OCZA 5IK2A 3MHPA 4OI1A 5EHZA 2HRZA 1YKSA 3AUSA 4LV5B 5KYTA 3L02A 4CKXA 3OE4A 2CEKA 1Z2NX 4BHTA 3LWBA 1HF3A 2WKWA 3NHSA 4XQ9A 4MR8A 1V8PA 1R0LA 1WG8A 3ZVNA 4TKVB 1KWKA 2VJDA 3F71A 3K5HA 4B80A 4AXBA 3KUDA 1AWCB 3MWGA 4X64B 5J40A 3CIOA 2B5VA 4DMFA 4M1OA 1IPHA 2Z1MA 3REQA 1XP5A 4E85A 4BJHB 2MHKA 1W5AA 1VMAA 4M1QA 3DDOA 3URKA 4ANWA 3ISMC 1A88A 4HDNA 4KAXA 4I1AA 3AHHA 1PNOA 2RFMA 2R62A 1B6TA 2O1SA 4PNEA 1S8NA 1DEAA 5EIBC 5LC1A 2FFJA 2H4XA 4AV7A 2NU6B 3C1OA 1VYTA 2V96A 4G1UC 1TYZA 2DWQA 2HM7A 5AM3A 3I5AA 4NS1A 1NDHA 3ICQB 1Q83A 3EG9B 1J2JA 4DRYA 5JQGA 3EIHA 4UUQA 2EJWA 4X7MA 2OV6A 4WUTA 4KRYA 2ZUVA 5COQA 2Z9BA 4EF6A 4UDNA 4RSYA 3EXEB 4UWFA 1LF5A 5GZ3A 1PCXA 1SBNE 3Q3IA 3ROPA 1N4RA 5FUVA 3ZWWA 4C6RA 4C0MA 4DCOA 4YVQC 2W4MA 2R7NA 2W83A 5IFLA 4F2DA 4HVCA 1VCIA 2V6BA 4V0QA 1Y7TA 2YWGA 4H7JA 5FQ4A 1N92A 1P9RA 2XEDA 5JY1A 4HB0A 2WXNA 2ADFA 3N0VA 5HM8A 4XIFA 4RF4A 3LOQA 4HGOA 4P81A 2OZVA 4GGPA 3WIEA 4TZ0A 3BB3A 5G0WA 3SVTA 1BDIA 2VZEA 1N2XA 4YT8A 3VHRA 1RYEA 1YHNA 4ZYZA 1BXKA 1X6VA 1SXPA 4HN4B 5LWHA 5AOVA 1VGRA 1RVDA 1N2CA 2ORWA 1DEKA 5ENTD 1Z0AA 1PNTA 3TWWA 2RG1A 4NG5A 2XPIA 3FTWA 2KI5A 4X92A 3UM2A 2IE8A 4UVGA 3E34A 5CHEE 3AMVA 4C21A 4KVMA 5TPZD 2D1YA 3A3KA 3A2LA 3AL0C 3TPCA 4COKA 2XMCA 1FMCA 1F17A 5DNEA 4GXRA 4EO4A 4L8YA 2ECOA 2R4UA 3CW2A 1PK8A 1DDIA 4GICA 4GI1A 3RM3A 4DCGA 3LBNA 2YW9A 2NUAA 4R98A 2JLXA 4NQZA 1QF9A 3F78A 5TARA 3HJFA 3E9MA 3RKRA 2HWXA 5ERGB 2ZIGA 1E9AA 3Q9NC 3W5VA 1UFVA 4AP2A 1X0XA 3U4QA 4W6ZA 4WNDA 5CH8A 4N3BA 5FWDA 4EBAA 1GPH1 2NXWA 5KNBD 3ROMA 1ZKDA 3PSAA 4LRXA 1K7CA 4C08A 3FVQA 4RMNA 2Y93A 2TRSB 5EERA 3V31A 5CDSA 3GRKA 1AZLA 3ZQ4A 1QYXA 3FTDA 5L3QB 3TLZA 1VG0B 1UZNA 3EIEA 4XVCA 3ECCA 2ZJZA 3FH0A 2I8AA 5AVUA 5E1DA 1NQOA 1TD1A 2D5CA 5E7IA 4QA9A 2QEQA 1TFRA 4P54A 1OYOA 3EYAA 2KSQA 3QJZA 3ZQUA 4DE5A 3VYUB 5JWRA 1NMZA 5LXTB 2XA1A 2CE7A 3IA2A 5J90A 4CKCA 2PRIA 4FFVA 4N9WA 3FBTA 3D1VA 4I4TA 3H16A 4MEJA 3R3YA 4ND8A 3EG5A 2G5CA 3ELDA 1Y8AA 1EHCA 2YWHA 5D3MB 1P5HA 1M2EA 4RF5A 5BNWA 1TU4A 1OTHA 3DDCA 4URYR 4GCNA 3QI7A 2V74B 3LKUA 2NZJA 1IWPB 4C07A 2ZJFA 2H00A 4I50F 3G88A 3V8VA 3DEJA 3IAFA 3EVDA 1PE0A 2I22A 4JVNA 5KOHA 5CRIA 4H27A 4A5SA 3OKCA 3HB0A 1QNFA 3D6FA 3EZGA 4TLBA 4PPNA 2BDTA 2NYAA 1IBKB 2IF0A 5JEEA 3UJBA 4M2LA 4JOBA 4RU1A 4EPZA 5C8YF 2AG6A 1AS3A 2A6PA 3F5DA 2VZ8A 3O7MA 3KLOA 1YC2A 5JRJA 4V3BA 1S02A 4TRRA 1BYIA 5BN5A 3HVRA 4P31A 5B30A 2X0DA 3DVQX 4PRZA 1MG0A 3KZOA 1IZ8A 1WWKA 2TS1A 1NOIA 1KERA 3CXRA 4BCBA 2CFUA 2CXSA 1PGOA 3B2NA 1U2ZA 3R3VA 1PEKE 4CT5A 3FVVA 5HTKA 5ERXA 2AKYA 1RW2A 3IHVA 4MROA 4BLSA 1YS2X 2HDHA 2VTBA 1FEZA 4G5HA 2PSDA 3BA1A 1LNZA 1G3RA 1QRSA 3PGLA 6LDHA 2J7KA 1GGKA 1S3IA 4B3BA 3D3JA 3NHLA 1BDJA 3FOWA 3COJA 5HRUA 1HQDA 3PEFA 1Z0ZA 2DCPA 7REQB 3ZEAA 4IIFA 4TRNA 3S1AB 3SDSA 1CIVA 3QXXA 3U7QB 4KIJA 2V7PA 3OESA 2H1CA 3A9VA 4M86A 4QM6A 1NJ6A 1O08A 2IHZA 1F8GA 2ADMA 1L4BA 4FR5A 3SEAA 1ZXBA 5T64A 5BUCA 1PS9A 3SX2A 3B1FA 1CDZA 2FH5B 3VPDA 1Z88A 4Y6GB 5DTRA 4CIYA 3L4BC 2A30A 3EXFA 2P5UA 4IXTA 5ES4B 4QJ3A 3PQFA 2P3SA 4PBRA 1YS9A 3ZQKA 5HPYB 3E7XA 3OJXA 2QTAA 4H0FA 4CM6A 3ZK7A 4D3YA 3KD7A 1ZSYA 5F73A 4HWKA 3Q75A 3T9AA 1ZA1A 1OC4A 3EW7A 1PP4A 5TC4A 4Y1RA 5TEWA 5K3OA 2CBXA 5JCPA 1C1XA 1MW8X 2IO2C 5TB5A 1Q7RA 2BFWA 1P60A 2EP8A 2J3EA 3C4VA 4BVJA 4BQEA 1JB9A 1WNFA 2Z0MA 3DF9A 1XZGA 3H1AA 3HCEA 2PJUA 1ZUNB 3AG2E 1NAIA 4KIUA 4ENRA 4I0WB 2ZXFA 4GLFA 4JWTA 2Z8YA 3U19A 3ERCA 4CTMA 4IJ6A 2ORVA 4D46A 3ST7A 3IP8A 3N0XA 1KYXA 2IYWA 5KWIA 1HOXA 1PTKA 3SR4A 1QS0A 4YUAA 3H1BA 2QTVA 1ENPA 2X0RA 2IIPA 2EIXA 2P3OA 3FROA 4HDMB 4DEYA 1NC3A 2NYRA 5JLAA 2XNDD 3W7AA 3WBFA 2GPNA 4JC5A 2HJWA 3HBAA 4ARZB 4D0LB 2RCYA 4E08A 3NIGB 3I34X 2Z1NA 4D9BA 1Z5GA 4UATA 1JXMA 5A5EA 3G8CA 2O2JA 2CJXA 4W7IA 3A1VA 4JB0A 5ARDA 1M7BA 3T1VA 4J0FA 3GFQA 5I4KA 1YS1X 4CMKA 1KQGA 1UBFA 2F37A 4YBZA 1P9LA 3KZNA 1ABBA 1ZDMA 4LNGA 1OZHA 4JKOA 4R7TA 4R9RA 1APBA 3SM9A 1GL9B 1DKOA 4ERXA 4YUZA 5CB4F 2Z83A 1EBUA 3FBWA 2FWPA 4UM8B 2FK7A 4QGGA 2HK8A 4KAAA 3ZHTA 1Q95A 4BVAA 1R10A 4EPYA 1JTEA 5BUQA 3S7BA 1L5GB 2IWRA 1IK6A 4JGIA 1UKCA 3F74A 2A5UA 1I1OA 3WGMA 3OM8A 3S8YA 3RBZA 2GEJA 2QDKA 1DMSA 2QLNA 4MEAA 2G67A 4LAFA 5H59A 4H1VA 2Y0BG 4BO4A 1Z7WA 1TLLA 1KC1A 2IYQA 2C04A 4XLTA 2XUFA 4N03A 4X7BA 3K9BA 4CPDA 2VQDA 1J22A 1JHMA 4HWSA 3GHYA 3BHIA 1UJCA 2OHIA 5LWQA 1XMXA 3CV3A 1ZPDA 4ENPA 5AOAA 2OAP1 2JI8A 4ZO9A 2GPSA 5D1NA 5EP1A 4O2RA 4E94A 4HWGA 1V3UA 3R6GA 3TLGB 3D9OA 5THKA 5SYNA 4RJKA 2XBLA 2HY7A 4EK9A 1QONA 2Q5FA 1HGXA 3ZLJA 3LQRA 5CJJA 2ST1A 3EVNA 4X85A 2W22A 3D0KA 2AW5A 3S1LA 4A55A 3IP9A 1I13A 3K09A 2Q5QA 4R01A 1ZISA 4YCJA 1ILEA 4D80A 3HDGA 4Y6SA 4G2TA 1KRWA 4G5YA 1UOEA 1JAYA 4X20B 3J80A 3NHRA 1D1QA 4PLFA 1VKRA 3JRWA 5TGTA 2OHVA 4RVDA 3EMKA 2W8BB 4ODIA 2P9SG 2W2TA 1HG2A 3BXEA 1AQLA 4KWTA 3RRYA 2ZI6A 4HKTA 2NO1A 5IYZF 4C5BA 3IBFA 4GR4A 2J4DA 3KPWA 4PAQA 1VA5A 5JO9A 3ISJA 3EHRA 4GOND 3OZXA 1RZVA 3VR6A 5KSWB 2GO7A 3D8TA 5B7NA 1M7HA 2AN1A 1RQLA 1KMHA 3T4PA 2BGKA 5TMEA 4L51A 3M4YA 2VSOE 3SYRA 1YB2A 1ZUHA 1ILWA 1RWQA 5JD3A 1G55A 4BNHA 4ZOEA 1XXHA 2X9NA 4GUDA 4J1NA 3AQIA 3N5KA 1ZI8A 2IIVA 4WZZA 1EBBA 1K5PA 2W2NA 2YFQA 5CNIA 4FXPA 2F43B 3TTUA 2P2ZA 2VBFA 2C7BA 4TWBA 2GQ0A 1A27A 3W9FA 4K2HA 1T10A 1H1DA 2V9ZA 2ZJ1A 3RQIA 4A6DA 3PDCA 4L5BA 3QEKA 3N0RA 4RVBA 5G4LA 4LHEA 3SC2A 1SBCA 3OO0A 4Y2HA 2DY1A 3Q6IA 3HRAA 4KKXB 5GJBA 1WVMA 3AF0A 3KJNA 1O95C 1FPQA 4MGKR 1P7PA 3ZDEA 5HA5A 2AFIA 4JVLA 3CU5A 3MCUA 3R5JA 2WHXA 4OAUC 2XVXA 3ZKAA 2B8NA 4BVLA 2NPIA 1B3BA 5A5DA 3MWJA 1T0JB 5DX0A 2C94A 3MWYW 3LK7A 5ENQD 2FDCA 4HX2A 2XMQA 3E0QA 4WNAB 3L13A 3QVGB 4NEHB 3D4PA 4A2CA 1J7JA 3MJTA 5K4GA 2ZU0C 5IABA 1JT9A 5FH9A 4LKOA 2PLNA 4K87A 1O6ZA 1RJEA 5FA5A 2GPTA 1X1CA 1UKBA 1KSHA 2WKSA 2F1JA 1KK0A 1NI1A 1O7JA 2I6HA 1G8GA 3E18A 4R1QA 3WIDA 1PAQA 4P58A 2NTNA 3DT8A 2QNIA 5LP0A 4K0KB 2R5WA 4GQBA 1GIAA 2IDKA 3SS8A 3SEFA 3ZVKA 4U0ZA 4K40A 1ISIA 3KKNA 2NVUB 2IYNA 4Q4DA 1UOHA 1TTHA 4DC0A 4ZJYA 3GLGB 5D0QD 2ZJ4A 4X62B 3CNLA 4O4JA 1M54A 1N32B 5G55A 2P0EA 4BBPA 1PR5A 4V1CB 1R6VA 2YHBA 3MJRA 2LAIA 3EISA 3QE9Y 3KQHA 1CDOA 4L0CA 1GZ7A 1ECPA 4B7ZA 3E3MA 2NTEA 2PNJA 1XMQB 3D6JA 2LBPA 2A9PA 4BXOA 3UK1A 2XKKA 1L8LA 3EAGA 4U3JA 4GR5A 3IJPA 4E2WA 1US8B 2EZ9A 3QU2A 1XYYA 2AKAB 4L8VA 5T3RA 2C3YA 3JQAB 4IRUB 3U61B 4BEJA 5FEUA 1ZH0A 4OHBA 2D5AA 2KLHA 2O5EA 5EWJA 2HM8A 2FHSA 3PT9A 3QLJA 3GFVA 1DAIA 3H11B 4L75A 3VQTA 3ICVA 2UYHA 4L8GA 4EAAA 3QARA 4QBFA 1T25A 1E90A 4FFDA 2ZW9A 4IJVA 3GCGA 5FKJA 1JE0A 1Z38A 3E03A 4PWYA 1RPNA 5JE8A 5CFPA 4FHKA 1TLTA 3OH8A 4X24A 1T3SA 3GLFB 3RRUA 4CV3A 4YIKA 2HWWA 4G1FA 3QLTA 2WDZA 3OLCX 2ZJOA 2ZT7A 2XUOA 2P6RA 3BAZA 3CPEA 1G63A 1PNVA 3KVYA 2FV8A 2CCKA 4HT3B 2GK3A 2HOQA 3B13A 5CT8A 5CXXA 4AS2A 4BP3A 4CF7A 5IVKA 4JA0A 4E2ZA 2IY9A 2XZTA 5GV8A 2Q8NA 3LLCA 3BMCA 4D7AA 1VL8A 3DOIA 4G0YA 2BRUC 4KZ0A 3RLFA 2QT1A 1C14A 3MGCA 1ONSA 1INZA 2RIPA 1UMDA 3V34A 1JKFA 1EXVA 2QTFA 4BMXA 2QLMA 2VR1A 2AMJA 2GAOA 1DG9A 4QDXA 5FBWB 2YYZA 2AUNA 4JL6A 1L5FA 5JD6A 1I30A 2BD0A 3NBNB 4NULA 3TQSA 5JSYA 2Q49A 5C53B 2WUWE 4NE9A 2LUOA 1Q15A 3DL0A 4DQ0A 4L9RA 2CXUA 3FUXA 4HGQA 4WBNB 1GM5A 5ECYA 2GBFA 3BGWA 3JQAD 5KUTA 3GRUA 1CUEA 4I1PA 1E7MA 1NFQA 1J1UA 1P2VA 4LCEA 2P58C 1KL7A 4HADA 1FNDA 1TM2A 3T5DA 3GEGA 3JSAA 1B14A 1GFSA 1IOLA 4BKRA 4ZOBA 3BXFA 3THYB 3N6XA 1EWRA 4RZQA 4KXYA 2XYPA 4DIBA 1UK9A 3IV7A 3ZV7A 3PC8A 1R6AA 1U0OC 3E4BA 2J4FA 3BRSA 3HWX1 3TZQA 4DSTA 4FHJA 3E81A 4M83A 1MC5A 5AOBA 1EGMB 1SR8A 1FMFA 1V5EA 3DOCA 3VM6A 3ZZNA 1SD2A 3QPVA 4FJ2A 2R05A 2XSZD 3ZGNA 3GLIB 1LCIA 1MQSA 2FUG1 3V9AA 3F97A 2RONA 3GA5A 1O8BA 4TX1A 4QC2A 1ORTA 1JE1A 1YC5A 2R751 5E3IA 3RBAA 4MV3A 3FVWA 2EFCB 3RTDA 2QG9A 4A3SA 3T8MA 1KR5A 2YWCA 2Y76A 2J5RA 4BU1A 3LGSA 4DBVO 4KVAA 3JZFA 3O3CA 1Z3IX 1QVZA 1GNSA 4UBOA 4JLPA 2C5SA 1N34B 2YFHA 3I83A 1A9XB 1HNWB 2JGAA 2R6JA 4WEQA 4CUJA 5D51S 3DKIA 3W5HA 2R03A 5CDFE 2VNAA 2QZPA 3IQXA 3KCNA 4IWNA 3ANMA 2QE7A 3VPAA 4F3KA 4ZEWA 2W43A 3P9QA 3MS7A 1JJIA 3EY4A 3LKBA 1I3NA 2DT5A 3JQBA 2IA5A 4LISA 3L0DA 2EARA 3KEFA 3N6RA 1NNSA 5DLYA 4MQEB 3WL8A 3HZRA 1JHUA 5KWEA 4R2KA 4F4JA 4PU0A 2GD0A 5CDUA 5CFLA 2HU7A 2GLTA 2H9IA 5E4TA 4PYKA 1R6TA 1E0KA 3C43A 3R7RA 3GR6A 5G3ZA 3V1UA 1XU7A 2B83A 3W78A 4W8OA 5B37A 4P3NA 1CJCA 3UMSA 1JPJA 1A9RA 1H6OA 5EXTA 3EA4A 1F60A 3Q15A 2VRWA 5AI0A 4NENA 3GRRA 2W0SA 3MLBA 2R8XA 1M74A 2BWJA 4Z3OA 2NGRA 4GVXA 1KKMA 1E3SA 2C8LA 5JCJD 1HE8A 1WSAA 1KQNA 2JDIA 4PY2A 2CV1A 3OIWA 3HVIA 4IHJB 3KD2A 2GJ4A 2O3JA 1K8XB 3OT1B 2W2XA 2PQ6A 3U3MA 3GJ5A 1BS1A 2XNJA 2FG7C 1YCGA 1VYUA 2W2PA 4DQVA 3SZ7A 4MLPA 2AG8A 1U04A 1ZD9A 4P4SB 2FWMX 5EOVA 1R4MB 3FGPA 4YXWA 5CW1A 2RKBA 3PK0A 3G9XA 3OU2A 3LNCA 2JH9A 2W6PA 1T2VA 4ZFHA 1ZNQO 4JUIA 4KXUA 4YJGA 2R7AA 4ILKA 1O87A 2I9PA 5AW1A 1G9XA 5K3BA 4AJ9A 3PICA 3ZV4A 3KOZA 3CVUA 4Q4JA 2H6EA 4LZPA 3K96A 4PO8A 1TK3A 2G77B 1QHHA 2B21A 2J9GA 4NESA 5BV2P 5FLKA 4B76A 3WGOA 3IP7A 5AVYA 3E7PA 2VDPB 3G5TA 1B0ZA 3R3UA 4QQRA 2Y1EA 4RYDA 2XPYA 3VO9A 4JP1A 1DB3A 2Y1FA 2BW0A 3T1OA 5HDQA 3UJ9A 1EHIA 4L4UA 1W93A 1QIDA 3FF1A 2YUTA 4PC3A 1Z83A 4U96D 4HI8A 3AEXA 1QHGA 2G8LA 1X7DA 2EFEB 2DCMA 5BN1A 5C5IA 1IMOA 1LPOA 2QN3A 4I9GA 1ANKA 3ACBA 3QVTA 2OBNA 5ELLA 5IG2A 3IS3A 3J7TA 5KDOA 2QFCA 2IPLA 1JILA 1MKYA 3ZUGA 2B0CA 3BS4A 3KOWA 1RAHA 4FFOA 3WBKA 4GMXA 1G8YA 3NXSA 2XA2A 1XRRA 3TW6A 4RTPA 3E15A 3FUCA 5EHNA 2ATEA 1EXMA 5HIKA 3H19A 4LHWA 4MUJA 1H6PA 3U3KA 5AVJA 5JDIC 2R8OA 2QYJA 1XV5A 2CLKB 3UJDA 3VHLB 2WSLA 2VP3A 2WHEA 1J56A 1KAOA 3C3BA 3GCDA 3G7SA 1B42A 1OROA 1CETA 4RQIA 5DCUA 3INRA 5AM0A 3R7AA 2XDAA 4KDRA 1JA9A 3AUFA 3O9ZA 4M99A 2UV8A 4LHXA 5AK4A 3RWMB 4KJXA 2Z6UA 1VBFA 4B4DA 4LXIA 1NVEA 1J99A 3PRJA 2Q3HA 3M34A 3AI1A 1OX6A 1X92A 2VNJA 3PUYA 1CP3A 4Q9HA 2YBDA 4FLFA 3F5FA 2QW1A 3FNBA 3VNAA 1ZIDA 1USUA 3B3FA 3GBVA 3L8YA 1ZN9A 2FMTA 3NAZA 2O19A 3TRFA 4E12A 3IHKA 1HE1C 4PIVA 2WXHA 1M83A 1P73A 4LYJA 4LSZE 1XNHA 4WJZA 2C1ZA 3GXOA 2FUEA 3L92A 3ELWA 5FB3A 2GLXA 2O3UA 4B7CA 3EW9A 5A9SA 1XTIA 4IDFA 3JQPA 5M5BA 2ZJ2A 1KVRA 1NZJA 1RM5A 4YROA 3L8FA 3SHQA 2JJ1D 4RHUA 1I3KA 4LZWA 3SGLA 5ALTA 3USZA 4IDCA 4N5IX 2OZPA 2F8YA 4D57A 3AGPA 5EWMA 2Y0EA 3G82C 4MI6A 2B4RO 4F21A 4DMHA 1X9GA 2JJYA 3FFBA 4E6HA 4WACA 4JT2A 4YDSA 1RI5A 2ASVA 5EIBD 4RIIA 2HO5A 3CF4A 5G1NA 5GM1A 4KWHA 2K87A 3ANLA 4GYOA 3LECA 3DHWC 2VH5R 2REXB 1UCFA 3SNHA 2HUNA 4P7GA 1X7XA 1T0HB 3D6NB 4FOSA 2BLLA 3LGXA 5E1BA 4UTXA 2GGFA 4HORA 2C8VA 1XVIA 2Q45A 5ITZF 3QH4A 3ELYA 2XQKA 3DOFA 4QD3A 3AUTA 5KWVA 5NLLA 1A9ZA 3PNVA 3TGOA 1B1AA 3FDJA 4FGJA 5DLEA 3NHYA 4Z4CA 1DC7A 2EU8A 3IULA 1YDGA 1WBJB 1Y98A 3KXKA 3UMVA 3RWBA 4NIMA 1IHYA 3KV1A 4EF4A 5FTJA 1T5LA 2WVGA 5JW6A 1LXCA 3ZDZB 5KKNB 2Z2JA 3PPYA 4ZVVA 5IT0A 5CURA 3OJFA 3PC3A 4C2TA 1RLOA 4Z9BA 4MRMA 1WUKS 5KVSA 4HNQA 1JDNA 5BT8A 4AMYA 3PF8A 3NUGA 2DFDA 4HBZA 4H7HA 2DPMA 1NDUA 3AHCA 3VHXA 3U66A 1XRPA 3TB4A 4CF6A 4X1YB 1JDTA 3FGZA 3IBGA 1LDNA 1Z25A 3QE3A 4XUEA 3L18A 4OP1A 1I7NA 4XB2A 1JJBA 3LP8A 3P2KA 4BQQA 3H3XA 1LDMA 5DP2A 4Q4AB 4L2IA 2C2LA 2XVMA 4EOGA 3M4NA 1H2RS 3W5BA 3DEHA 1CUSA 2HZBA 2RD2A 3A1TA 3AUKA 3FAKA 1HT1E 3ZPXA 2ESRA 3H1EA 3HA3A 4O4HB 2RARA 5AM2A 4GRDA 3NEAA 3UT7A 4CKEB 4A91A 1EWKA 4WAUA 3HJRA 2FWBA 2XMRA 2L0TB 4HSEA 1DP4A 1NTRA 3IDOA 2P35A 4RD3A 5CB6A 1F0NA 1XTBA 2B4TO 1YRBA 5E95A 1ECCA 4QTZA 2NUPB 4MWTA 3LUJA 1EQUA 3EA5A 2LRHA 3TUZC 1D0IA 2WWRA 2PGLA 3IMKA 4KX5A 2LNIA 1G6OA 3OPNA 4E5NA 1YR2A 9ATCA 1E5VA 5IT5A 1NP3A 3VDMA 1NVXQ 1O1TA 5P21A 1OD6A 5FTPA 4D9EA 3FTSA 2E6KA 4G1MB 1HFEL 2ZSJA 4G0XA 2BEVA 4OREX 1I2BA 2EJUA 3DWFA 1S4MA 4MITA 1H0KA 4XASA 2RIRA 2B8WA 2CSUA 1W4ZA 3ZUVB 2NSYA 4MGZR 1H4TA 2BFMA 4V0ME 3F7OA 5A1TA 1E1CA 4OP3A 4XA8A 3FSJX 4HRMB 1CUUA 1HSOA 2C95A 2IVZA 5C51B 1F5SA 1T4MA 1ZD8A 3H6HA 3BF7A 1C9EA 3C6MA 3WA6A 3MIIA 4H17A 4C2BA 4BFXA 3BWVA 1UP6A 4KACA 1U8UA 2IKQA 3P52A 2DY0A 2BYTA 3WR5A 4W9MC 3I4CA 3NKFA 5AK0A 2GT1A 4EFMA 1GG2A 2XODA 1XVVA 4AF8A 4H31A 1YFZA 1LSSA 3O75A 3CQ9A 5AW8A 3BHJA 2P67A 3NOOA 1WW3A 1BD4A 4B85A 2RGEA 4FIDA 1UBEA 2O0LA 3VR5H 2ZSDA 1PQUA 1KEUA 3R77A 4FGKA 1QLJA 4L78A 4BKMA 5LFAA 1U8CB 3EGDA 4RM2A 1UBCA 1Z56C 2J5KA 3DTYA 1A9SA 4DUZB 3VKHA 3W8DA 4K1XA 3C8UA 1CJUC 1KY3A 1AF7A 5KWJA 1KS2A 1CF9A 1NR1A 1NOKA 1KO7A 4ABTA 2CZGA 1XZQA 1ZIXA 3WNDA 2UZIR 3HO1A 4H1HA 4BNFA 4PLHA 1KARA 4MRAA 5HZHA 1L6RA 2LKDA 1G98A 2WD7B 3GD7A 5LOVA 4Y6CA 2VSXA 5E75A 3V3KA 5CHEA 4F45A 3ZVMA 4PC7A 5FBKA 5BQFA 3KPVA 4PVCA 1MZCA 3B3QA 1V6CA 1TAGA 3II6X 2Q3MA 3HRKA 2DTXA 3K5PA 1SWWA 3L0SA 3BSWA 2JI6A 4MZXA 4RTKA 3ADCA 2H6HA 3LC7O 3N70A 4R8LA 3Q1KA 1KRHA 1VLZA 5IEBA 4OMUA 1CUCA 3K4HA 2GWHA 2KCKA 4QRDA 2ZR8A 4XUGB 5KU1A 2NO9A 4B3SB 3DW3X 1RXIA 3DMTA 5JAIA 4WX2B 4DC9A 1KMMA 2WG0A 2WPNA 4JLDA 1P39A 2H1HA 3ZXSA 1E9DA 3M33A 1Z2OX 3HJGA 5CU7A 3NTRA 3HCRA 4GRIA 4WINA 4YPOA 5KMGB 3WP1B 2PWBA 3WB1A 3WOHA 3KHSA 2B92A 4XX0B 4DV4B 4PPFA 1ZLYA 4DCTA 5J2UA 3PQ2A 5C46F 1VLQA 3KT0A 3TINA 1A9OA 1J20A 1Q2XA 2F3PA 4YMUA 1WETA 1NMEA 3DBVO 5EJAA 2J9FA 4H9GA 3N2KA 3EPHA 3OQVA 4Y18A 5IJAA 5AW5A 4Z1OA 1G8AA 2KCVA 3FMIA 3ZWDA 5M04A 4XEUA 4BLWA 2BMDA 1ZM9A 2J9QA 1H2VC 3NJRA 3EDTB 4LG6A 3S7FA 2YRXA 1JG3A 3LT4A 1UOQA 2NV6A 4UPEA 1UPTA 3GRZA 4JSTA 1I5OA 4N7MA 4NY1A 3PUWA 5HFNA 3DMPA 3FNFA 3A1WA 1SCQA 3LUPA 3BL8A 2I9CA 2FI1A 2JZNA 4LNAA 5DULA 2UXCB 3TM4A 2BMAA 5KNDH 4RIGA 1YZVA 1T1JA 4KOEC 1EUDB 1CKEA 5A4FS 5CDGA 1BJRE 3LXMA 1PC2A 3WGKA 1H8EA 3I12A 5FQ6A 2JLZA 4WI1A 1KAEA 121PA 3I39X 3O90A 5IXSA 2DLDA 2GVDC 4JB2A 2NU8B 1W96A 5LP1A 4CM4A 1DO2A 3BE8A 2B7BA 3QJYA 3MN1A 1H2TC 1RWPA 3C87A 1QRUA 3VJRA 3DDNA 4UWGA 4TKMA 2ZPTX 1RAAA 1J0XO 2GK7A 3OPYA 3BYZA 3HACA 3LLMA 4PHGA 4D0RA 1WHTA 2FFBA 4NBTA 5A6SA 1GRNA 5CG1A 4LWQA 4FC8A 1CG6A 4NU8X 3L0IB 3PFWO 1ZJJA 5HYVA 4G89A 4AJ2A 4I4NA 1OPRA 1FFDA 2OGSA 3OVMA 2F3QA 3AXTA 2C84A 2BGNA 1U90A 5FTMA 2VTEA 1FS5A 3A6JA 3L8DA 2AC2A 2E2WA 2HRBA 2RG8A 4YRRA 1QOPB 4KRXA 2Q7DA 3CFYA 4Q4HA 1X5BA 1QC5A 3ND7A 3KB8A 5K0TA 1YL6A 3PQ7A 5AJWA 3FMOB 2AI1A 3D6UA 3OQMA 2ZBVA 1X7ZB 4F6CA 4RELA 3OP1A 2F8TA 2JGKA 3OF2A 2I4TA 4GXNA 3ZBUA 4U2GA 2CL6X 3F8WA 2IPXA 3MA5A 3K30A 1Q7TA 2XWBF 2VJBA 4L74A 2C61A 2UAGA 3QKSA 3A0RB 3G0IA 1B6SA 2HSGA 2QPOA 2BTQA 2XMDA 1SCBA 1L4EA 3L5OA 2W98A 3LCMA 3OX3A 3C3JA 3TI7A 4DPKA 4KI0A 2FEXA 2X0KA 4D74A 3GPDG 1T13A 3JQ7A 1S7GA 4ETMA 4MZDA 1G16A 4ZT2A 4BMPB 3QPWA 1IM8A 1AS2A 4TV8B 1R37A 2P0YA 1K75A 1PHRA 3JQ8A 4RY9A 4CWAA 3RKSA 4DW8A 3WIBA 3L7KA 3RAUA 2BFCB 2GHIA 2V4LA 1HYBA 4ABYA 3DT9A 4E2YA 1G8FA 3SR0A 3NCHA 1FC0A 2Y9MB 2GCGA 5H68A 2LE0A 3IV9A 1I2MA 4TV9A 1OBHA 2XNHA 1I9CA 2F59A 2V1UA 5IJWA 3IR5A 2O2HA 4YRPA 5KC8A 1Y1SA 1RC0A 1Q1QA 2HREA 4CIAA 2G0NA 4UXJA 4QZVA 4Q12A 2CLOB 4DA0A 2V7XA 1G1MA 4NLLA 2PUTA 4M6WA 1XU4A 1Q22A 1R0WA 4RVCA 2A78A 2AT1A 2Z57A 2GPAA 3VBCA 3FX2A 4Q7JB 2Z6AA 2B1QA 4IHAA 1SVXA 2Q3EA 1SOAA 1XQVA 4BNNA 3JVVA 3JY6A 5JAHA 2Z3ZA 2AQ8A 4IVNA 1QRAA 3JWGA 2QTBA 3IBYA 1ODKA 3RFXA 1TEVA 5TPWB 4BMZA 2VSXE 3IHWA 3KTOA 5CYPA 4WNCA 3C7TA 4C0AC 2AG1A 3CUYA 2BBSA 3FDZA 4O0MA 1QX3A 2X13A 4MKTA 4J1SA 4DIKA 1P72A 4EMTA 3D1LA 2CKMA 2C2OA 2L2QA 3UJAA 5IKPA 2VA8A 4TLLB 4XARA 2WWWA 1V16A 1FRZA 2ALJA 5C0OE 4ME2A 5LZ4A 3AP1A 3AVVA 4G6ZA 4BJ5A 2O0JA 4J3JA 2ZSKA 4IDBA 1MPXA 4CL2A 3BPSA 3ID6C 1U8YA 4K03A 2XX3A 3I9V6 2YIVX 4LBYA 3Q2KA 3ULQA 1U1IA 4IDQA 4TUYA 1VA4A 5HI7A 4YUXA 3QC1A 2RHGB 1YGYA 2PS3A 3VC7A 4UQYA 2C5FA 3EQ8A 4E09A 4P84A 1OCZE 3ENVA 4XH9B 4G5OA 1XP8A 1NUTA 1BAPA 5DTIA 5I7FA 3FPKA 1V5WA 4LJ6A 1UBUS 2O8BA 1IG0A 2AOVA 3KWLA 1SQMA 4LWZA 3BFVA 4EHLA 3EZXA 2NNLD 3FD8A 3IR6A 2CNNA 3F8SA 2HE0A 2IHKA 4BFVA 2JAWA 2OGWA 3C3KA 1O95D 4GTTA 2R7MA 1FNMA 2WM8A 3PDIA 3JQ0A 4RK5A 1TKAA 2Z4RA 2RDMA 3DDWA 4O4LF 3HR7A 3HHPA 5AYWD 3UC5A 5EKQD 3T52A 1IBRA 3WX0A 1ECGA 4YP9A 3SQMA 1K2WA 2GNOA 3V33A 4ENTA 2FPKA 3MKQB 4ZPJA 5EXPA 3KTDA 1Z0FA 4W5WA 4AJKA 2NVWA 3CXUA 1IWOA 1MOSA 3LCCA 1OILA 4TWAA 1ZRHA 2ANCA 2WQ7A 3ESZA 4WLVA 4ZGGA 1EHYA 1OGIA 4OX9Y 1WCYA 2HQOA 4A8HA 2QC9A 3TI9A 1KJYA 2P62A 3CNEA 3PQCA 1HFKA 1YBMA 1T6BY 2QQ0A 1NC1A 1BEZA 3DF7A 2FUG6 1AD2A 5IDVA 1K08A 2G80A 3ZW7A 1XCJA 1TAUA 2Q8PA 3U81A 3T5XA 5KTRA 4QHSA 1TCBA 4EYKA 4FS3A 1ZK1A 1QE5A 1V1MA 4JA9A 3WAGA 3RO2A 3H2SA 1RWMA 5ILQA 3EY9A 3IE1A 4UKDA 1ZM2A 3OQPA 3ZDDA 4PSCA 4Q0MA 3NVAA 3I52A 5FORA 3KBBA 4ZEOA 1KQFA 4OFWA 1KVUA 5KTYA 1YZUA 4HXIA 1TC1A 3FU5A 4PINA 3ZE7A 5A0VA 3RLIA 2JD2A 3VVCA 4BZZA 4M1YA 5I5GA 5HFAA 1NI3A 4JI3B 3FVTA 3Q9LA 2OEWA 2C00A 2ZVPX 4UTZA 3VNVA 4DFDA 3STWA 1WF6A 5AI9A 4C4ZA 1FP2A 1E20A 1M0TA 4WZ6A 1A98A 3QPAA 4KYUA 2F1OA 4E31A 4MVXA 2VEDA 3DH0A 4BNGA 1MABB 4HDAA 4PG5A 4F11A 3L9XA 4HYQA 2DEUA 4OI0A 5BQPA 1HDZA 2POQX 3H9EO 2VSOA 3DMDA 4Y67A 3W5IA 4Q3EA 1S9DA 5DM4A 3Q47B 4RMJA 2NACA 3BK1A 5KAMA 2H5JA 1ULAA 3CRW1 1LH0A 3MPUA 3RYTC 5DOZA 2HYDA 5AW0A 2NSZA 2BF7A 3A1SA 1J1ZA 5DHUA 2E4YA 1JW9B 3PGA1 1DAEA 1N0RA 4KJZA 3CPSA 4X90A 1SBZA 4CMIB 3N2NA 2JGFA 1WDWB 4X65B 4RLYA 1NJSA 3KR2A 1IY1A 4WLEA 1ZOIA 2I0FA 4DB2A 5AN8A 1JR4A 5MFPA 1M6EX 3HXEA 4ID9A 3E1SA 4DXAA 1FIUA 1D04A 3K1JA 5I47A 3IERA 1TCUA 2J67A 3AFHA 2OGTA 1II0A 4C0JA 5FV4A 1O94A 4OUDB 3G2TA 2DERA 3ZXPA 1ZRNA 3FTCA 4ZHBA 4IJKA 3CSSA 3PGMA 3O9VA 3T5PA 1YJAA 1VE5A 3L4EA 4B73A 1M72A 3ANYB 5DW3A 2GUWA 1CLEA 3VI4B 2OG1A 5A3SA 1MYOA 2GF9A 4XOUA 8AT1A 2ZTVA 1WHSA 3LW7A 3ZIUA 4Q9AA 2ZBEA 1TNYA 4GUAA 3VGPA 1FDTA 3QVWA 2HLHA 1E3WB 3KYDA 3RU7A 3LX4A 1Z26A 3PVLA 3RS8A 1Q19A 4OQPA 1TQDA 5K20A 1SQ5A 2CNOA 1E1RA 1UXHA 4J7XA 2ROQA 2H65A 2M32A 2RBGA 3O4RA 3RREA 1U1DA 1RMTA 5K8VA 4RFVA 3I4LA 4NBLA 3SYKA 2CBGA 3G6KA 3SYTA 2GPJA 1QGYA 1X80A 4PYIA 3WMWA 4CLHA 2XDQA 4TVOA 5AKYA 3HYCA 1RAFA 3E1GA 3KJQA 2AF3C 4ZMRA 1ZBPA 2JGMA 2Z5GA 3UGQA 2VCYA 1EG7A 3N59A 5T41A 1HZJA 1QTRA 1V9LA 4JVSA 2C07A 5CFQA 3LDZA 3TGLA 3BGDA 4ZEVA 3EIQA 1AUXA 4S24A 3OJWA 2RJNA 2M63A 3F47A 3D5QA 1KY5A 1XVTA 3OOYA 2B5OA 3U6KA 1HF8A 4OSEA 4MKRA 1NBME 3W5DA 1PYOA 1HE4A 4Q9IA 1WV1A 4LDQA 4A6EA 3FIJA 1XMIA 3ABOB 2DQKA 3GUCA 4RV5A 3UJHA 1IG3A 3VR4D 4KRGA 2ZRPA 1AIPA 5SY9A 1KJ9A 1EQAA 4RORA 4LZJA 1U7PA 3WTBA 3QG1A 5B7QA 5EPEA 4YP1A 4B4WA 3U49A 1VLHA 1JHRA 5JRZA 2PL3A 1VSTA 4IWXA 1X1EA 3UKRG 2DKOA 4LNBA 2X4IA 4G24A 1JR3D 4RIEA 5K6AC 2Y05A 3C7CB 3LNTA 1PFKA 4ZXFA 3TXYA 4BCDA 5AQAA 1AY0A 2WAYA 4J0CA 3KHKA 4PX5A 4BO2A 3C7KA 1YKFA 3BICA 1NVGA 3KPJA 1RFLA 3U7EB 1Y89A 2ZI5A 5DCWA 4PYQA 3WKAA 2K4MA 2X3YA 1TI7A 4XWAA 1C4WA 4AZ0A 4TLDA 3GQVA 3NHUA 1V3VA 1Z4MA 1QTIA 1ODJA 1DKNA 5BT1A 1FNSA 3NTVA 2YR0A 4FONA 2KM1A 1GKLA 1EVZA 4AKGA 2RH5A 4UWLA 1YOBA 3F67A 3OD5A 2FLVA 4RSGA 5ALMA 1I6MA 5DJ5A 2CK3A 3EIWA 4MS4A 3AZQA 1V9CA 4JXKA 3HB4X 1N7HA 3CN9A 4OQMA 5ECDA 5JI2E 3ZFWA 3PT5A 3U37A 3I28A 2D5LA 4PTYA 5JDCA 4B6JA 3IHYA 3CVOA 5CRUA 2WY2D 3CVXA 2RFAA 1H19A 4WN9A 4W63A 1ECBA 1N0IA 1SC3A 2OBXA 4OKSA 2DWUA 2OV8A 1OUMA 5IKXA 2E3JA 3NRBA 5JHAA 4AY2A