2EILE

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eilE00
2ZXWE 5B1BE 2EIKE 1OCOE 3ABKE 2OCCE 1OCRE 2EIJE 3ASOE 2EILE 2EINE 1OCCE 5B3SE 3ABME 3ABLE 3WG7E 5B1AE 3AG4E 3X2QE 2DYRE 3ASNE 5IY5E 2DYSE 3AG1E 3AG2E 2Y69E 2EIME 1V54E 3AG3E 1V55E 1OCZE
chains in the Genus database with same CATH superfamily
1DCQA 4AM9A 2WQ6A 3VLDA 5A6CA 4O6FA 2X3MA 2V4LA 4O1PA 3ZRHA 3ESKA 3EHQA 2WXGA 3FTVA 3TWXA 4EECA 3U66A 3UMVA 1DNPA 4RQIA 1H2TC 3CIAA 3FULA 3RO3A 1S70B 2IOLA 3FHEA 5B3SE 2VGXA 3E33A 2V5FA 3FTXA 2IOSA 2PNNA 2FO1E 2GRLA 5J90A 4ILHB 3Q7AA 1U3DA 3CSTA 5CEAA 1BPOA 2MHKA 3HXDA 5ARGA 2IQCA 5KJLA 4BEPA 2ZU6B 3B7RL 3HYMB 5JHAA 3EU5A 1Z5SC 3LVRE 3TXNA 5AQ7A 5CERB 2J4DA 3JXJA 2VGEA 3AU4A 2UWJG 1TYQG 3C72A 5T3RA 2WXMA 3DSSA 2JLBA 4EQFA 3W9FA 4Y6WA 4AY5A 1HFAA 4PUCA 1E8YA 3C98A 3ASHA 3PZ1A 2WXKA 5DIZA 3HXEA 4FJZA 2OOEA 4YVQC 4BFRA 2VTBB 2YNQA 4J8SA 3QWVA 3Q73A 2WVIA 2YHCA 3QNKA 5EYLA 1TNYA 4HRNA 4CEMA 3P2BA 4L9PA 1L5JA 4GTMA 4UWKA 2X6JA 3V30A 3PZDA 4EBAG 5G55A 3CHOA 3FUHA 4EBAA 2XPZA 4WUYA 2CFZA 3EHNA 3Q79A 2HO1A 3VLFA 4G8LA 3QOUA 1D8DA 3QWPA 4FLHA 1YCSB 5T8IA 4B93B 5B1BE 1BU9A 1W3BA 3SNXA 4JHKA 5ENRD 1E8ZA 4APOA 5EIDA 3RO2A 2VGYA 3I3NA 4GZ3A 4U96D 2C0LA 3ZU7B 1H0AA 4TXRA 3MKQB 1E90A 1OWLA 5IY5E 3FTWA 4TUMA 4KZ0A 1EYHA 3U3WA 2XQ0A 5HKPA 4F1PA 3TGOA 4J8YA 3SBSA 3N71A 2QC9A 3R7RA 3ESLA 1OT8A 2WQHA 2X38A 4K5BA 1UN9A 2VSXE 1H6OA 5CHEE 2PZIA 2PQNA 3FTZA 1LD8A 5AENA 2BKGA 2CHXA 1KT0A 2VYIA 2KZTB 1BLXB 3Q9NC 3UXGA 4DLOA 4U04A 3AAAC 3JUIA 3D9NA 2C2LA 3PNTB 4E6HA 3Q75A 3TG5A 2L9BA 3DSWA 4B0ZA 1IHGA 3PUKA 3SF4A 4TXPA 1BD8A 1OY3D 5BPPA 5H7PA 4IYPA 3B7UX 3PREA 3ZIMA 2X6KA 4DI3A 2RKKA 3B13A 4I17A 1D9SA 4GTVA 1N95A 4U8VD 2R5SA 3IHYA 3JQ1A 4BX9A 1ZB1A 5JHBA 2AXZA 5KJMA 4YVOA 3QAQA 4AEZC 3AG1E 5HRYA 3K9IA 1TR4A 2EQXA 4O60A 2RG8A 3NB2A 3ASGA 3LCAA 3GYZA 2FO7A 4G2VA 3MV3B 3EIJA 4J7WA 1TNBA 3MZLB 3KAEA 1X5BA 4N3CA 4WNEA 3C3RA 3DSXA 1INZA 1V54E 2XGSA 2KBXA 3SQVA 4V3IA 1MJ0A 1SA4A 3ASOE 2VSNA 2OV8A 4K5AB 3FY4A 3VTYA 4RG6A 3KEZA 1PC2A 2DYRE 4U8HA 2F37A 3V2OA 4H7YA 2LXLA 5JJ7A 1OUVA 2UY1B 4JXTA 2FI7A 2IFUA 3R7QA 1E96B 2IONA 4XIFA 3OXGA 2XS8A 4ACLA 4EPZA 3ML9A 4JPSA 4CDRA 3CHQA 4FADA 2NSZA 3LY7A 1H2UA 1TN7A 3QJZA 4BESA 4FHJA 4KZCA 1VDYA 5FQ6A 3KS2A 1EPUA 3TL5A 3G2VA 4TV3A 2LAHA 2ONDA 1LTXA 4N3BA 3HIZA 4DUIA 4XEIG 4CRWA 4LNGA 3Q4AB 5BV1A 4UQXA 2B6CA 4WWOA 2XGMA 4G11A 1OCOE 4LSZE 2EIJE 5EDSA 1WG0A 2EINE 4LRZA 4A1GA 3OAWA 5FQ4A 2FBNA 3CVQA 5CBNA 4MRUA 5EX3A 4DRXE 3DSUA 5M72A 3V2XA 3AJIA 3L9TA 1RZ4A 3RSEG 1HZ4A 2LSVA 4EHMA 5CCLA 3Q7FA 2GRNB 4PDXA 5FZSA 3ABLE 3UPVA 3HRAA 2QFCA 3TWQA 4DX5D 2KCVA 4G1TA 4L1BA 3VTXA 5C1DA 1SQMA 4TUUA 4YNDA 5JJ6A 4F6RD 4HI9A 4U63A 3SO8A 2XEEA 5KJKA 1K1AA 1U2VG 4N3AA 4U07A 2XRYA 1FT1A 4I1OB 4G26A 2LNIA 4IRUA 2R02A 1MHQA 2L6BA 3LS8A 3QB2A 4E85A 4OVVA 4XI0A 1KPSB 1H6PA 4HS2A 3V79K 4UWFA 4EZLA 2WXJA 2YQ8A 2P9LG 5EN5D 2ZXWE 3ONLA 3ENEA 2ETCA 3F6QA 3TAXA 4HBDA 5BXOA 3UKUG 5B1AE 3Q15A 4LG6A 3LY9A 2IJGX 3EUVA 3NOCD 4GAAA 3ULYA 4XKCA 1S63A 5EYPF 3FDHA 3ZN3A 1MQSA 2PL2A 4KBQA 1UJJA 1A5EA 4N2QA 4BSZB 1PAQA 4YDYA 4HLEA 4P29A 2IF4A 1SW6A 3CVNA 5LCWJ 3FU5A 4B8CB 2CG3A 4GTQA 4LUNU 3LEWA 5D66A 4BERA 2J09A 1IYGA 3L13A 2GRRB 3ZUVB 2QYJA 4GZ6A 3EHMA 4JD2G 5FZQA 4J6IA 5ENTD 4HRMB 4D10C 3D9KA 1N4SA 1WAO1 2Y4UA 4A55A 4C9BB 4DK5A 5D2MC 3EDTB 3FUKA 1Y8MA 4ABNA 4R7LA 2FULA 5D0OD 1TJFA 3D9HA 1WM5A 4MS6A 3EHRA 2LAIA 2J4BA 2A4ZA 4I9EA 4EZJA 3ZHEB 2Y3AA 4F7AA 1OCCE 2WXLA 3G2TA 3IV0A 5D0QD 2V5QC 2F8XK 4ANVA 2WXPA 1H6KA 4GPKA 3FU6A 5CRVA 4HQDA 3C3OA 4N39A 4CGWA 2Q7FA 3UM0A 4ANXA 4I9CA 2L0IA 4GTTA 3C5RA 3CKBA 3MKRA 3PEUB 3T5XA 4OAVB 5ENNA 4HVBA 1SA5A 4JVSA 4CYMD 4GZ5A 2XZDG 4J8FA 4NRHB 5AJDA 2VTBA 3HVEB 3D9MA 2OEWA 4XZ4A 4AV7A 3TWVA 3RK6A 3SI5A 3ZXPA 4FU3A 3TWTA 1NI1A 4GMRA 3L54A 5BW8C 4BY6A 2EILE 4WNGA 4CDNA 3DEPA 5ANRA 3IHVA 3SFZA 4NURA 4ZFHA 1JPLA 2VQ2A 4M3OA 3RKVA 2I2OA 4FJYA 1O1RA 2KM4A 2KC7A 4UUCA 2WXFA 2HE0A 2WMOA 2GW1A 2V8SE 3RRUA 1NZNA 3R9AB 4HOQA 3JQ0A 3U4TA 4JEUA 3D9OA 3LY8A 3CEQA 4ANUA 2XS1A 4QFVA 1UJKA 2E2EA 3LVQE 3ZNGA 3MX3A 3Q5MA 4F53A 3Q47B 3B7TA 2VGXB 4HXIA 3TWSA 3CVXA 1XGWA 4I6EA 3J5QB 2J07A 4GMJA 1UG3A 4AOFA 5A7DB 4YDEA 2P58C 3UTMA 2DZOA 2R05A 3JXIA 3DPDA 4DX7D 4GCNA 2XPIA 4AXHA 4Q69A 1N4PA 3AG4E 3S7BA 2A5UA 5LFAA 3IBEA 3LKUA 4C48B 2HM8A 3E34A 1HS6A 1NFIE 1HH8A 1DVPA 3ZEFA 3AU5A 3CVYA 1XNFA 4G8KA 2L6JA 2B0OE 5CECB 1A17A 2KZTA 4GU5A 2WXNA 3DPYA 4NIKA 2LO6A 5BV0A 2JEKA 4CT0A 4I1AA 3RRNB 5BUZA 2RFAA 4TRQA 3B95A 1EF1C 1OWNA 4CGVA 3PUJA 1HXIA 2CHWA 1O1SA 2DBAA 3SBTB 5AYWD 3WG7E 4GA2A 5DBKA 4CT4A 5G05C 1HF8A 2H6GA 3NZSA 3ASDA 2P2CP 3CQGB 4NQ0A 2FEZA 3OXFA 4XX5A 2GGFA 4G24A 3RIBA 1OXJA 4GTRA 2WXRA 5AARA 5CBOA 5FJYA 4A1SA 4FC8A 4U0ZA 4UI9J 4HNAD 4F3VA 4OAUC 2F0YA 3GZSA 4J8DA 5AQAA 5CMYA 3T8MA 3ML8A 4C0MA 5CEDB 3CQCB 2J9QA 3U9WA 1E7VA 1K8KG 3I5PA 4ATGA 1TJCA 3LPZA 4PH4B 1MZCA 2AXVA 3GZ1A 2DCPA 2BUGA 3JCKC 1TNUA 4UQYA 3UIPC 2LUHA 4KT6B 3W9GA 1H19A 1UN8A 4CZ2D 3UI2A 1IXVA 4GMLA 4AP2A 1O5MA 3PE4A 3T5VA 1TEZA 2UY1A 5FQ8A 4CDMA 4HLLA 1N54A 2NYJA 3PNLB 3L16A 5KJNA 1BI8B 3B7SA 3HHMA 3DXMG 1SZAA 2M63A 4JHJA 5HI7A 5LX8A 3BUAA 2WXOA 3OXLA 2LSUA 3DSTA 4N5CA 4GPMA 1QNFA 4J0UA 3CV0A 4FA6A 5FT9A 2WXIA 1ELWA 3ASFA 4B8AA 4JA7A 2WPVA 1P5QA 3HXCA 3SHFA 3IKOB 3FTUA 2BTDA 2J08A 2ZGDA 5HQ8A 4L7TA 3MV2B 4N5QA 4A63B 4PS8A 2IO2C 1N94A 1NL4A 3MJWA 1LD7A 3ZPJA 3CSFA 2DYSE 3UT7A 4GYYA 3RAUA 2XRZA 1IKND 1PY1A 3OTNA 3L82A 4KYOB 2PM7A 1QZ2A 3CKCA 3S7JA 1NA0A 2X6HA 3T8KA 2XGOA 4OYSA 4BT9A 2P9PG 1WY6A 2ZGGA 3GZ2A 2WMNA 4MBGA 2H6IA 5LOZA 4DI4A 1D8EA 5E75A 1MX4A 3FTSA 3EU9A 3FUMA 1DC2A 4UWLA 1YYHA 3KSQA 1B89A 1Y6IA 4K5CA 5G04J 4BT8A 2P9UG 4ANWA 1UOHA 4PS7A 1JWGA 2GRMA 3FUNA 4UQZA 5FWQA 5JA4D 1JWFA 3E4BA 4L23A 3S7DA 1HG5A 1N4RA 2IO3C 4H7XA 3QC1A 2C0MA 2X6FA 4HORA 1MYOA 2AW6A 3BG1B 1IQRA 4AY6A 2KATA 5CRUA 3NAWA 3HXBA 2H6FA 3SFYA 4GB9A 4I6JA 3E30A 3P1UA 4LCTA 4U0UA 3PE3A 3ZYMA 5T4YA 1S64A 3CK7A 4UI9K 4UWGA 2VSYA 2MRIA 3MGBA 2DVWA 3SGHA 3QDNA 4JC8A 3CLJA 3CVPA 3ABKE 3J5PA 3RRMB 3TG4A 2WQ7A 3ABME 3L08A 3UT4A 4DX2A 3E37A 4RG9A 1TNOA 1N11A 4L2YA 3BQOA 2XCCA 3FUIA 3FUDA 3KEAA 2AJAA 2AXUA 4U8YD 3ZHEA 3QKYA 4ILGA 4PS3A 4RLYA 3NQPA 3DBSA 4ZHBA 4GZDA 5AQ9A 3ZYLA 4W9RA 4J8EA 3WXXA 3FTYA 2DIWA 2EIME 3AG3E 3LXUX 1V55E 5JJTA 3IXEA 1N0RA 5AQBA 1FVFA 2ZISA 2R2LA 1OWPA 3U64A 5FQ7A 2WXHA 1LF8A 4DX6D 4GA0A 2A5EA 2ILRA 1E8WA 1K3ZD 1E7UA 5AAOA 4B94A 2XEHA 3CHSA 4M7CA 3SFXA 4TXQA 3DSVA 3QK0A 3SY2A 3RU0A 4WNFA 5FINA 3GW4A 2WB2A 3AG2E 2QY7A 4JEHA 3CVLA 3E32A 1TNZA 3FU3A 4JZYA 4JB8P 4U0SA 3O4ZA 3JUEA 3ZYQA 1NP7A 3UM1A 2EIKE 2VSOE 1OWOA 4UI9C 3EIQC 2WM9A 4JA9A 5EIBE 3FWVA 3L22A 4AJWA 1O1TA 4GA1A 1H2VC 2P9SG 4QQIA 1X81A 3ZVVA 4CCAA 3UQ3A 4DLQA 3I4RB 1FPPA 3PVLA 4Q96A 4GTPA 4YDWA 5KCMA 1E8XA 3V31A 4U7EB 4LERA 2I1JA 4DX1A 3G2UA 1OWMA 4X8QA 3ZW3A 4FLBA 1QBQA 4XE0A 3TWWA 3ZXSA 3ZGQA 3ZKJA 4I1MA 1GW6A 3BEEA 4URKA 3UM2A 4BX8A 3FH7A 2JABA 5BXUA 3NZUA 2Y4TA 3PH0C 3PRZA 3DXKG 4KMOA 3PDNA 2OCCE 1G3NB 4G25A 4K03A 3MKQA 5ENPD 4WWPA 4BTBA 3S7FA 2MOWA 3CVUA 2QYUA 3T9KA 4KXKB 3D9IA 2NXPA 5EILA 4Q94A 2I6HA 3QARA 1Z3XA 1WDYA 3CHRA 3ASNE 5FTPA 1KLXA 1JCSA 5ENQD 4GTSA 5BT1A 5JMND 1NA3A 5CMWA 2OEVA 1BI7B 4HB5A 2ETAA 3D9LA 2XENA 2XCBA 2AVPA 3BU8A 5CCMA 3AS8A 1Z3YA 4F1SA 3PZ2A 2KCLA 3ULQA 1IQUA 3RJVA 1ELKA 3UUXA 3ZYKA 1Z6TA 5ITZF 3DEOA 4HI8A 1HO8A 3FEYA 3G2WA 3KD7A 2IY0C 5AJLA 3UM3A 3MYVA 4WNDA 3L6AA 1DCEA 4XI9A 1Q2ZA 3EJNA 2KXPC 2X6IA 3S2AA 4K0RA 2PM6A 3LJ3A 4U95D 2LXMA 3Q49B 1RW2A 1AWCB 4MLPA 5G04C 3CK9A 1SVXA 3ONKA 5J08A 3AS4A 5KWDA 3VLEA 4ILIA 3APDA 4AVXA 2XZTG 3FUEA 2Y69E 5AIJA 1FT2A 4O1OA 3TJPA 1OCZE 4OVUA 4DJAA 3AS5A 2R03A 3UKRG 4JHRA 3PZ4A 4I2ZA 3FH5A 2RFMA 2YINA 2H6HA 4IN3B 2GRPB 3ULEG 4I43A 2DWZA 4BTAA 4AIFA 4JL0A 3D9JA 5AN8A 4WAFA 4N2SA 3G2SA 3APCA 2ETBA 3SZ7A 1S0PA 3APFA 4APFA 2BF0X 4HRLA 4HOUA 2P9NG 2Y1LE 2V0PA 2MYOA 5LCWC 3HDXA 3IEGA 5KNGA 2Y0BG 3NOGD 2V4HC 3FH8A 3MCXA 2XHEA 2XPYA 2DZNA 1SZ9A 4LEUA 3CHMA 2BEDA 4IULA 4FP7A 3PEVB 1UW4B 1FCHA 4BETA 3LYAA 3UX4A 4GTOA 3UT8A 3Q9UC 2FF4A 1KT1A 3CR3A 4GYWA 2J8SD 4KVMA 2IEJA 3FU0A 3L17A 4ATZD 2PQRA 1FVHA 3Q78A 4Z68A 2QZAA 3TWRA 4A3VA 4XKBA 5FZRA 3DWLG 2BKKB 3C3QA 3R9MA 2P9IG 4ACKA 3FEXA 4HFGA 5KBAA 1TN6A 1QYMA 4L2LA 1AP7A 4WWNA 2AWIA 5E76A 1N4QA 5EX0A 1IHBA 5ANLA 3FUFA 1N52A 3NBNB 1YA0A 4JW1A 3QWWA 1ELRA 5BNWA 1HG2A 2L0TB 5G05J 4GZCA 3LJNA 1KZOA 2E0IA 3UIOC 2XEVA 1MX2A 4Y6CA 1HX8A 3PS6A 1HE8A 3DRAA 5ARFA 2CHZA 2CFUA 3KSLA 1QQEA 4RSYA 3FUJA 5FIOA 2GRQB 3I4GA 2I1KA 3CGHA 1JCQA 3NF1A 3JYSA 3PZ3A 2R59A 3X2QE 4HOTA 4I6GA 2HYZA 3SD5A 4ME2A 2HR2A 3ISMC 2OVFA 1EDUA 5EKQD 4A3TA 5ENOD 4C0EA 4MKTA 2P9KG 4FULA 4B89A 1JCRA 3ZFWA 2WXQA 1ZU2A 3TWUA 3TXMA 2KCKA 3FFLA 4I2WA 4G23A 3HG0D 5C2YA 2YHEA 2OVBA 4LNUD 1ZBPA 3CVWA 5G2NA 4KVOA 3D3MA 4RVBA 3BG0B 2R17C 4BWRA 4LNBA 3HXFA 2J49A 3CK8A 4GYOA 2RD0A 2GROB 1MX6A 4DPRA 2IU1A 5KNHD 4NACA 5ENSD 3CVVA 1K1BA 1N0QA 1N9AA 3CHPA 1U3CA 3MEKA 2I9CA 4BSXA 4EZKA 4HOSA 4GCOA 3HVEA 3MA5A 2CG2A 4UWHA 2F8YA 3FP3A 1YMPA 4FHKA 1OCRE 1HU3A 3D9PA 3O48A 3B7BA 3UINC 1KZPA 5A23A 3LDZA 4YDOA 5LP0A 1TN8A 5HS0A 2ZIRA 2VJ8A 2NC9A 3URZA 1JUQA
chains in the Genus database with same CATH topology
2ZXWE 5B1BE 2EIKE 1OCOE 3ABKE 2OCCE 1OCRE 2EIJE 3ASOE 2EILE 2EINE 1OCCE 5B3SE 3ABME 3ABLE 3WG7E 5B1AE 3AG4E 3X2QE 2DYRE 3ASNE 5IY5E 2DYSE 3AG1E 3AG2E 2Y69E 2EIME 1V54E 3AG3E 1V55E 1OCZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXW E;  5B1B E;  2EIK E;  1OCO E;  3ABK E;  2OCC E;  1OCR E;  2EIJ E;  3ASO E;  2EIL E;  2EIN E;  1OCC E;  5B3S E;  3ABM E;  3ABL E;  3WG7 E;  5B1A E;  3AG4 E;  3X2Q E;  2DYR E;  3ASN E;  5IY5 E;  2DYS E;  3AG1 E;  3AG2 E;  2Y69 E;  2EIM E;  1V54 E;  3AG3 E;  1V55 E;  1OCZ E; 
#chains in the Genus database with same CATH topology
 1DCQ A;  4AM9 A;  2WQ6 A;  3VLD A;  5A6C A;  4O6F A;  2X3M A;  2V4L A;  4O1P A;  3ZRH A;  3ESK A;  3EHQ A;  2WXG A;  3FTV A;  3TWX A;  4EEC A;  3U66 A;  3UMV A;  1DNP A;  4RQI A;  1H2T C;  3CIA A;  3FUL A;  3RO3 A;  1S70 B;  2IOL A;  3FHE A;  5B3S E;  2VGX A;  3E33 A;  2V5F A;  3FTX A;  2IOS A;  2PNN A;  2FO1 E;  2GRL A;  5J90 A;  4ILH B;  3Q7A A;  1U3D A;  3CST A;  5CEA A;  1BPO A;  2MHK A;  3HXD A;  5ARG A;  2IQC A;  5KJL A;  4BEP A;  2ZU6 B;  3B7R L;  3HYM B;  5JHA A;  3EU5 A;  1Z5S C;  3LVR E;  3TXN A;  5AQ7 A;  5CER B;  2J4D A;  3JXJ A;  2VGE A;  3AU4 A;  2UWJ G;  1TYQ G;  3C72 A;  5T3R A;  2WXM A;  3DSS A;  2JLB A;  4EQF A;  3W9F A;  4Y6W A;  4AY5 A;  1HFA A;  4PUC A;  1E8Y A;  3C98 A;  3ASH A;  3PZ1 A;  2WXK A;  5DIZ A;  3HXE A;  4FJZ A;  2OOE A;  4YVQ C;  4BFR A;  2VTB B;  2YNQ A;  4J8S A;  3QWV A;  3Q73 A;  2WVI A;  2YHC A;  3QNK A;  5EYL A;  1TNY A;  4HRN A;  4CEM A;  3P2B A;  4L9P A;  1L5J A;  4GTM A;  4UWK A;  2X6J A;  3V30 A;  3PZD A;  4EBA G;  5G55 A;  3CHO A;  3FUH A;  4EBA A;  2XPZ A;  4WUY A;  2CFZ A;  3EHN A;  3Q79 A;  2HO1 A;  3VLF A;  4G8L A;  3QOU A;  1D8D A;  3QWP A;  4FLH A;  1YCS B;  5T8I A;  4B93 B;  5B1B E;  1BU9 A;  1W3B A;  3SNX A;  4JHK A;  5ENR D;  1E8Z A;  4APO A;  5EID A;  3RO2 A;  2VGY A;  3I3N A;  4GZ3 A;  4U96 D;  2C0L A;  3ZU7 B;  1H0A A;  4TXR A;  3MKQ B;  1E90 A;  1OWL A;  5IY5 E;  3FTW A;  4TUM A;  4KZ0 A;  1EYH A;  3U3W A;  2XQ0 A;  5HKP A;  4F1P A;  3TGO A;  4J8Y A;  3SBS A;  3N71 A;  2QC9 A;  3R7R A;  3ESL A;  1OT8 A;  2WQH A;  2X38 A;  4K5B A;  1UN9 A;  2VSX E;  1H6O A;  5CHE E;  2PZI A;  2PQN A;  3FTZ A;  1LD8 A;  5AEN A;  2BKG A;  2CHX A;  1KT0 A;  2VYI A;  2KZT B;  1BLX B;  3Q9N C;  3UXG A;  4DLO A;  4U04 A;  3AAA C;  3JUI A;  3D9N A;  2C2L A;  3PNT B;  4E6H A;  3Q75 A;  3TG5 A;  2L9B A;  3DSW A;  4B0Z A;  1IHG A;  3PUK A;  3SF4 A;  4TXP A;  1BD8 A;  1OY3 D;  5BPP A;  5H7P A;  4IYP A;  3B7U X;  3PRE A;  3ZIM A;  2X6K A;  4DI3 A;  2RKK A;  3B13 A;  4I17 A;  1D9S A;  4GTV A;  1N95 A;  4U8V D;  2R5S A;  3IHY A;  3JQ1 A;  4BX9 A;  1ZB1 A;  5JHB A;  2AXZ A;  5KJM A;  4YVO A;  3QAQ A;  4AEZ C;  3AG1 E;  5HRY A;  3K9I A;  1TR4 A;  2EQX A;  4O60 A;  2RG8 A;  3NB2 A;  3ASG A;  3LCA A;  3GYZ A;  2FO7 A;  4G2V A;  3MV3 B;  3EIJ A;  4J7W A;  1TNB A;  3MZL B;  3KAE A;  1X5B A;  4N3C A;  4WNE A;  3C3R A;  3DSX A;  1INZ A;  1V54 E;  2XGS A;  2KBX A;  3SQV A;  4V3I A;  1MJ0 A;  1SA4 A;  3ASO E;  2VSN A;  2OV8 A;  4K5A B;  3FY4 A;  3VTY A;  4RG6 A;  3KEZ A;  1PC2 A;  2DYR E;  4U8H A;  2F37 A;  3V2O A;  4H7Y A;  2LXL A;  5JJ7 A;  1OUV A;  2UY1 B;  4JXT A;  2FI7 A;  2IFU A;  3R7Q A;  1E96 B;  2ION A;  4XIF A;  3OXG A;  2XS8 A;  4ACL A;  4EPZ A;  3ML9 A;  4JPS A;  4CDR A;  3CHQ A;  4FAD A;  2NSZ A;  3LY7 A;  1H2U A;  1TN7 A;  3QJZ A;  4BES A;  4FHJ A;  4KZC A;  1VDY A;  5FQ6 A;  3KS2 A;  1EPU A;  3TL5 A;  3G2V A;  4TV3 A;  2LAH A;  2OND A;  1LTX A;  4N3B A;  3HIZ A;  4DUI A;  4XEI G;  4CRW A;  4LNG A;  3Q4A B;  5BV1 A;  4UQX A;  2B6C A;  4WWO A;  2XGM A;  4G11 A;  1OCO E;  4LSZ E;  2EIJ E;  5EDS A;  1WG0 A;  2EIN E;  4LRZ A;  4A1G A;  3OAW A;  5FQ4 A;  2FBN A;  3CVQ A;  5CBN A;  4MRU A;  5EX3 A;  4DRX E;  3DSU A;  5M72 A;  3V2X A;  3AJI A;  3L9T A;  1RZ4 A;  3RSE G;  1HZ4 A;  2LSV A;  4EHM A;  5CCL A;  3Q7F A;  2GRN B;  4PDX A;  5FZS A;  3ABL E;  3UPV A;  3HRA A;  2QFC A;  3TWQ A;  4DX5 D;  2KCV A;  4G1T A;  4L1B A;  3VTX A;  5C1D A;  1SQM A;  4TUU A;  4YND A;  5JJ6 A;  4F6R D;  4HI9 A;  4U63 A;  3SO8 A;  2XEE A;  5KJK A;  1K1A A;  1U2V G;  4N3A A;  4U07 A;  2XRY A;  1FT1 A;  4I1O B;  4G26 A;  2LNI A;  4IRU A;  2R02 A;  1MHQ A;  2L6B A;  3LS8 A;  3QB2 A;  4E85 A;  4OVV A;  4XI0 A;  1KPS B;  1H6P A;  4HS2 A;  3V79 K;  4UWF A;  4EZL A;  2WXJ A;  2YQ8 A;  2P9L G;  5EN5 D;  2ZXW E;  3ONL A;  3ENE A;  2ETC A;  3F6Q A;  3TAX A;  4HBD A;  5BXO A;  3UKU G;  5B1A E;  3Q15 A;  4LG6 A;  3LY9 A;  2IJG X;  3EUV A;  3NOC D;  4GAA A;  3ULY A;  4XKC A;  1S63 A;  5EYP F;  3FDH A;  3ZN3 A;  1MQS A;  2PL2 A;  4KBQ A;  1UJJ A;  1A5E A;  4N2Q A;  4BSZ B;  1PAQ A;  4YDY A;  4HLE A;  4P29 A;  2IF4 A;  1SW6 A;  3CVN A;  5LCW J;  3FU5 A;  4B8C B;  2CG3 A;  4GTQ A;  4LUN U;  3LEW A;  5D66 A;  4BER A;  2J09 A;  1IYG A;  3L13 A;  2GRR B;  3ZUV B;  2QYJ A;  4GZ6 A;  3EHM A;  4JD2 G;  5FZQ A;  4J6I A;  5ENT D;  4HRM B;  4D10 C;  3D9K A;  1N4S A;  1WAO 1;  2Y4U A;  4A55 A;  4C9B B;  4DK5 A;  5D2M C;  3EDT B;  3FUK A;  1Y8M A;  4ABN A;  4R7L A;  2FUL A;  5D0O D;  1TJF A;  3D9H A;  1WM5 A;  4MS6 A;  3EHR A;  2LAI A;  2J4B A;  2A4Z A;  4I9E A;  4EZJ A;  3ZHE B;  2Y3A A;  4F7A A;  1OCC E;  2WXL A;  3G2T A;  3IV0 A;  5D0Q D;  2V5Q C;  2F8X K;  4ANV A;  2WXP A;  1H6K A;  4GPK A;  3FU6 A;  5CRV A;  4HQD A;  3C3O A;  4N39 A;  4CGW A;  2Q7F A;  3UM0 A;  4ANX A;  4I9C A;  2L0I A;  4GTT A;  3C5R A;  3CKB A;  3MKR A;  3PEU B;  3T5X A;  4OAV B;  5ENN A;  4HVB A;  1SA5 A;  4JVS A;  4CYM D;  4GZ5 A;  2XZD G;  4J8F A;  4NRH B;  5AJD A;  2VTB A;  3HVE B;  3D9M A;  2OEW A;  4XZ4 A;  4AV7 A;  3TWV A;  3RK6 A;  3SI5 A;  3ZXP A;  4FU3 A;  3TWT A;  1NI1 A;  4GMR A;  3L54 A;  5BW8 C;  4BY6 A;  2EIL E;  4WNG A;  4CDN A;  3DEP A;  5ANR A;  3IHV A;  3SFZ A;  4NUR A;  4ZFH A;  1JPL A;  2VQ2 A;  4M3O A;  3RKV A;  2I2O A;  4FJY A;  1O1R A;  2KM4 A;  2KC7 A;  4UUC A;  2WXF A;  2HE0 A;  2WMO A;  2GW1 A;  2V8S E;  3RRU A;  1NZN A;  3R9A B;  4HOQ A;  3JQ0 A;  3U4T A;  4JEU A;  3D9O A;  3LY8 A;  3CEQ A;  4ANU A;  2XS1 A;  4QFV A;  1UJK A;  2E2E A;  3LVQ E;  3ZNG A;  3MX3 A;  3Q5M A;  4F53 A;  3Q47 B;  3B7T A;  2VGX B;  4HXI A;  3TWS A;  3CVX A;  1XGW A;  4I6E A;  3J5Q B;  2J07 A;  4GMJ A;  1UG3 A;  4AOF A;  5A7D B;  4YDE A;  2P58 C;  3UTM A;  2DZO A;  2R05 A;  3JXI A;  3DPD A;  4DX7 D;  4GCN A;  2XPI A;  4AXH A;  4Q69 A;  1N4P A;  3AG4 E;  3S7B A;  2A5U A;  5LFA A;  3IBE A;  3LKU A;  4C48 B;  2HM8 A;  3E34 A;  1HS6 A;  1NFI E;  1HH8 A;  1DVP A;  3ZEF A;  3AU5 A;  3CVY A;  1XNF A;  4G8K A;  2L6J A;  2B0O E;  5CEC B;  1A17 A;  2KZT A;  4GU5 A;  2WXN A;  3DPY A;  4NIK A;  2LO6 A;  5BV0 A;  2JEK A;  4CT0 A;  4I1A A;  3RRN B;  5BUZ A;  2RFA A;  4TRQ A;  3B95 A;  1EF1 C;  1OWN A;  4CGV A;  3PUJ A;  1HXI A;  2CHW A;  1O1S A;  2DBA A;  3SBT B;  5AYW D;  3WG7 E;  4GA2 A;  5DBK A;  4CT4 A;  5G05 C;  1HF8 A;  2H6G A;  3NZS A;  3ASD A;  2P2C P;  3CQG B;  4NQ0 A;  2FEZ A;  3OXF A;  4XX5 A;  2GGF A;  4G24 A;  3RIB A;  1OXJ A;  4GTR A;  2WXR A;  5AAR A;  5CBO A;  5FJY A;  4A1S A;  4FC8 A;  4U0Z A;  4UI9 J;  4HNA D;  4F3V A;  4OAU C;  2F0Y A;  3GZS A;  4J8D A;  5AQA A;  5CMY A;  3T8M A;  3ML8 A;  4C0M A;  5CED B;  3CQC B;  2J9Q A;  3U9W A;  1E7V A;  1K8K G;  3I5P A;  4ATG A;  1TJC A;  3LPZ A;  4PH4 B;  1MZC A;  2AXV A;  3GZ1 A;  2DCP A;  2BUG A;  3JCK C;  1TNU A;  4UQY A;  3UIP C;  2LUH A;  4KT6 B;  3W9G A;  1H19 A;  1UN8 A;  4CZ2 D;  3UI2 A;  1IXV A;  4GML A;  4AP2 A;  1O5M A;  3PE4 A;  3T5V A;  1TEZ A;  2UY1 A;  5FQ8 A;  4CDM A;  4HLL A;  1N54 A;  2NYJ A;  3PNL B;  3L16 A;  5KJN A;  1BI8 B;  3B7S A;  3HHM A;  3DXM G;  1SZA A;  2M63 A;  4JHJ A;  5HI7 A;  5LX8 A;  3BUA A;  2WXO A;  3OXL A;  2LSU A;  3DST A;  4N5C A;  4GPM A;  1QNF A;  4J0U A;  3CV0 A;  4FA6 A;  5FT9 A;  2WXI A;  1ELW A;  3ASF A;  4B8A A;  4JA7 A;  2WPV A;  1P5Q A;  3HXC A;  3SHF A;  3IKO B;  3FTU A;  2BTD A;  2J08 A;  2ZGD A;  5HQ8 A;  4L7T A;  3MV2 B;  4N5Q A;  4A63 B;  4PS8 A;  2IO2 C;  1N94 A;  1NL4 A;  3MJW A;  1LD7 A;  3ZPJ A;  3CSF A;  2DYS E;  3UT7 A;  4GYY A;  3RAU A;  2XRZ A;  1IKN D;  1PY1 A;  3OTN A;  3L82 A;  4KYO B;  2PM7 A;  1QZ2 A;  3CKC A;  3S7J A;  1NA0 A;  2X6H A;  3T8K A;  2XGO A;  4OYS A;  4BT9 A;  2P9P G;  1WY6 A;  2ZGG A;  3GZ2 A;  2WMN A;  4MBG A;  2H6I A;  5LOZ A;  4DI4 A;  1D8E A;  5E75 A;  1MX4 A;  3FTS A;  3EU9 A;  3FUM A;  1DC2 A;  4UWL A;  1YYH A;  3KSQ A;  1B89 A;  1Y6I A;  4K5C A;  5G04 J;  4BT8 A;  2P9U G;  4ANW A;  1UOH A;  4PS7 A;  1JWG A;  2GRM A;  3FUN A;  4UQZ A;  5FWQ A;  5JA4 D;  1JWF A;  3E4B A;  4L23 A;  3S7D A;  1HG5 A;  1N4R A;  2IO3 C;  4H7X A;  3QC1 A;  2C0M A;  2X6F A;  4HOR A;  1MYO A;  2AW6 A;  3BG1 B;  1IQR A;  4AY6 A;  2KAT A;  5CRU A;  3NAW A;  3HXB A;  2H6F A;  3SFY A;  4GB9 A;  4I6J A;  3E30 A;  3P1U A;  4LCT A;  4U0U A;  3PE3 A;  3ZYM A;  5T4Y A;  1S64 A;  3CK7 A;  4UI9 K;  4UWG A;  2VSY A;  2MRI A;  3MGB A;  2DVW A;  3SGH A;  3QDN A;  4JC8 A;  3CLJ A;  3CVP A;  3ABK E;  3J5P A;  3RRM B;  3TG4 A;  2WQ7 A;  3ABM E;  3L08 A;  3UT4 A;  4DX2 A;  3E37 A;  4RG9 A;  1TNO A;  1N11 A;  4L2Y A;  3BQO A;  2XCC A;  3FUI A;  3FUD A;  3KEA A;  2AJA A;  2AXU A;  4U8Y D;  3ZHE A;  3QKY A;  4ILG A;  4PS3 A;  4RLY A;  3NQP A;  3DBS A;  4ZHB A;  4GZD A;  5AQ9 A;  3ZYL A;  4W9R A;  4J8E A;  3WXX A;  3FTY A;  2DIW A;  2EIM E;  3AG3 E;  3LXU X;  1V55 E;  5JJT A;  3IXE A;  1N0R A;  5AQB A;  1FVF A;  2ZIS A;  2R2L A;  1OWP A;  3U64 A;  5FQ7 A;  2WXH A;  1LF8 A;  4DX6 D;  4GA0 A;  2A5E A;  2ILR A;  1E8W A;  1K3Z D;  1E7U A;  5AAO A;  4B94 A;  2XEH A;  3CHS A;  4M7C A;  3SFX A;  4TXQ A;  3DSV A;  3QK0 A;  3SY2 A;  3RU0 A;  4WNF A;  5FIN A;  3GW4 A;  2WB2 A;  3AG2 E;  2QY7 A;  4JEH A;  3CVL A;  3E32 A;  1TNZ A;  3FU3 A;  4JZY A;  4JB8 P;  4U0S A;  3O4Z A;  3JUE A;  3ZYQ A;  1NP7 A;  3UM1 A;  2EIK E;  2VSO E;  1OWO A;  4UI9 C;  3EIQ C;  2WM9 A;  4JA9 A;  5EIB E;  3FWV A;  3L22 A;  4AJW A;  1O1T A;  4GA1 A;  1H2V C;  2P9S G;  4QQI A;  1X81 A;  3ZVV A;  4CCA A;  3UQ3 A;  4DLQ A;  3I4R B;  1FPP A;  3PVL A;  4Q96 A;  4GTP A;  4YDW A;  5KCM A;  1E8X A;  3V31 A;  4U7E B;  4LER A;  2I1J A;  4DX1 A;  3G2U A;  1OWM A;  4X8Q A;  3ZW3 A;  4FLB A;  1QBQ A;  4XE0 A;  3TWW A;  3ZXS A;  3ZGQ A;  3ZKJ A;  4I1M A;  1GW6 A;  3BEE A;  4URK A;  3UM2 A;  4BX8 A;  3FH7 A;  2JAB A;  5BXU A;  3NZU A;  2Y4T A;  3PH0 C;  3PRZ A;  3DXK G;  4KMO A;  3PDN A;  2OCC E;  1G3N B;  4G25 A;  4K03 A;  3MKQ A;  5ENP D;  4WWP A;  4BTB A;  3S7F A;  2MOW A;  3CVU A;  2QYU A;  3T9K A;  4KXK B;  3D9I A;  2NXP A;  5EIL A;  4Q94 A;  2I6H A;  3QAR A;  1Z3X A;  1WDY A;  3CHR A;  3ASN E;  5FTP A;  1KLX A;  1JCS A;  5ENQ D;  4GTS A;  5BT1 A;  5JMN D;  1NA3 A;  5CMW A;  2OEV A;  1BI7 B;  4HB5 A;  2ETA A;  3D9L A;  2XEN A;  2XCB A;  2AVP A;  3BU8 A;  5CCM A;  3AS8 A;  1Z3Y A;  4F1S A;  3PZ2 A;  2KCL A;  3ULQ A;  1IQU A;  3RJV A;  1ELK A;  3UUX A;  3ZYK A;  1Z6T A;  5ITZ F;  3DEO A;  4HI8 A;  1HO8 A;  3FEY A;  3G2W A;  3KD7 A;  2IY0 C;  5AJL A;  3UM3 A;  3MYV A;  4WND A;  3L6A A;  1DCE A;  4XI9 A;  1Q2Z A;  3EJN A;  2KXP C;  2X6I A;  3S2A A;  4K0R A;  2PM6 A;  3LJ3 A;  4U95 D;  2LXM A;  3Q49 B;  1RW2 A;  1AWC B;  4MLP A;  5G04 C;  3CK9 A;  1SVX A;  3ONK A;  5J08 A;  3AS4 A;  5KWD A;  3VLE A;  4ILI A;  3APD A;  4AVX A;  2XZT G;  3FUE A;  2Y69 E;  5AIJ A;  1FT2 A;  4O1O A;  3TJP A;  1OCZ E;  4OVU A;  4DJA A;  3AS5 A;  2R03 A;  3UKR G;  4JHR A;  3PZ4 A;  4I2Z A;  3FH5 A;  2RFM A;  2YIN A;  2H6H A;  4IN3 B;  2GRP B;  3ULE G;  4I43 A;  2DWZ A;  4BTA A;  4AIF A;  4JL0 A;  3D9J A;  5AN8 A;  4WAF A;  4N2S A;  3G2S A;  3APC A;  2ETB A;  3SZ7 A;  1S0P A;  3APF A;  4APF A;  2BF0 X;  4HRL A;  4HOU A;  2P9N G;  2Y1L E;  2V0P A;  2MYO A;  5LCW C;  3HDX A;  3IEG A;  5KNG A;  2Y0B G;  3NOG D;  2V4H C;  3FH8 A;  3MCX A;  2XHE A;  2XPY A;  2DZN A;  1SZ9 A;  4LEU A;  3CHM A;  2BED A;  4IUL A;  4FP7 A;  3PEV B;  1UW4 B;  1FCH A;  4BET A;  3LYA A;  3UX4 A;  4GTO A;  3UT8 A;  3Q9U C;  2FF4 A;  1KT1 A;  3CR3 A;  4GYW A;  2J8S D;  4KVM A;  2IEJ A;  3FU0 A;  3L17 A;  4ATZ D;  2PQR A;  1FVH A;  3Q78 A;  4Z68 A;  2QZA A;  3TWR A;  4A3V A;  4XKB A;  5FZR A;  3DWL G;  2BKK B;  3C3Q A;  3R9M A;  2P9I G;  4ACK A;  3FEX A;  4HFG A;  5KBA A;  1TN6 A;  1QYM A;  4L2L A;  1AP7 A;  4WWN A;  2AWI A;  5E76 A;  1N4Q A;  5EX0 A;  1IHB A;  5ANL A;  3FUF A;  1N52 A;  3NBN B;  1YA0 A;  4JW1 A;  3QWW A;  1ELR A;  5BNW A;  1HG2 A;  2L0T B;  5G05 J;  4GZC A;  3LJN A;  1KZO A;  2E0I A;  3UIO C;  2XEV A;  1MX2 A;  4Y6C A;  1HX8 A;  3PS6 A;  1HE8 A;  3DRA A;  5ARF A;  2CHZ A;  2CFU A;  3KSL A;  1QQE A;  4RSY A;  3FUJ A;  5FIO A;  2GRQ B;  3I4G A;  2I1K A;  3CGH A;  1JCQ A;  3NF1 A;  3JYS A;  3PZ3 A;  2R59 A;  3X2Q E;  4HOT A;  4I6G A;  2HYZ A;  3SD5 A;  4ME2 A;  2HR2 A;  3ISM C;  2OVF A;  1EDU A;  5EKQ D;  4A3T A;  5ENO D;  4C0E A;  4MKT A;  2P9K G;  4FUL A;  4B89 A;  1JCR A;  3ZFW A;  2WXQ A;  1ZU2 A;  3TWU A;  3TXM A;  2KCK A;  3FFL A;  4I2W A;  4G23 A;  3HG0 D;  5C2Y A;  2YHE A;  2OVB A;  4LNU D;  1ZBP A;  3CVW A;  5G2N A;  4KVO A;  3D3M A;  4RVB A;  3BG0 B;  2R17 C;  4BWR A;  4LNB A;  3HXF A;  2J49 A;  3CK8 A;  4GYO A;  2RD0 A;  2GRO B;  1MX6 A;  4DPR A;  2IU1 A;  5KNH D;  4NAC A;  5ENS D;  3CVV A;  1K1B A;  1N0Q A;  1N9A A;  3CHP A;  1U3C A;  3MEK A;  2I9C A;  4BSX A;  4EZK A;  4HOS A;  4GCO A;  3HVE A;  3MA5 A;  2CG2 A;  4UWH A;  2F8Y A;  3FP3 A;  1YMP A;  4FHK A;  1OCR E;  1HU3 A;  3D9P A;  3O48 A;  3B7B A;  3UIN C;  1KZP A;  5A23 A;  3LDZ A;  4YDO A;  5LP0 A;  1TN8 A;  5HS0 A;  2ZIR A;  2VJ8 A;  2NC9 A;  3URZ A;  1JUQ A; 
#chains in the Genus database with same CATH homology
 2ZXW E;  5B1B E;  2EIK E;  1OCO E;  3ABK E;  2OCC E;  1OCR E;  2EIJ E;  3ASO E;  2EIL E;  2EIN E;  1OCC E;  5B3S E;  3ABM E;  3ABL E;  3WG7 E;  5B1A E;  3AG4 E;  3X2Q E;  2DYR E;  3ASN E;  5IY5 E;  2DYS E;  3AG1 E;  3AG2 E;  2Y69 E;  2EIM E;  1V54 E;  3AG3 E;  1V55 E;  1OCZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...