2EILE

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
total genus 43
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eilE00
1OCZE 2EINE 2Y69E 3ABME 5B1BE 5IY5E 2DYRE 2EIME 3AG1E 3AG3E 1V54E 5B3SE 1OCCE 2OCCE 3X2QE 2ZXWE 3ASOE 3ASNE 2EILE 2DYSE 3ABLE 1V55E 2EIKE 2EIJE 3AG4E 1OCRE 3ABKE 3WG7E 1OCOE 5B1AE 3AG2E
chains in the Genus database with same CATH superfamily
3CVUA 3ZVVA 4HRLA 2VQ2A 5LP0A 2OVFA 5FQ4A 1EPUA 2GGFA 4ACLA 3ZNGA 4ANVA 4HFGA 2RKKA 4A3TA 1DCEA 1N52A 1Y8MA 2WQ7A 2WXKA 3FP3A 2J49A 4N3BA 3EHMA 1IHGA 2QYJA 1FPPA 3Q4AB 3NAWA 2WMNA 5A7DB 2KBXA 3EU5A 4ANUA 3CHRA 2B0OE 1N9AA 3Q75A 3CVVA 4N39A 3B13A 4GTPA 5KJKA 3ZIMA 1SW6A 3F6QA 2QC9A 4D10C 2DYRE 4OYSA 3L54A 4AY5A 2A4ZA 5J08A 3TGOA 3N71A 2L6BA 3C98A 5A23A 4N2SA 3QC1A 3ZHEA 2Q7FA 2GRQB 4G8KA 3ABKE 4K03A 5LCWJ 4B8AA 1ZU2A 1NL4A 4N3CA 2PM6A 2AVPA 3E37A 4U8VD 3PUKA 2NC9A 4BTBA 4CZ2D 4FJYA 3FTUA 2ETAA 1K3ZD 4BT9A 2EIME 4XI9A 2CG2A 3B7TA 3TWRA 2CFUA 4BT8A 1K1AA 1TN7A 3SQVA 4RQIA 4PUCA 2ETBA 3ASGA 3SNXA 1XNFA 2WXLA 2PL2A 2V0PA 2AJAA 1HG5A 1MZCA 3UT8A 4LEUA 1JUQA 4BESA 3SO8A 2BKGA 4ATZD 2L0IA 3DSWA 3QDNA 4GTTA 4UI9C 1TN6A 2LXMA 3QARA 5AIJA 2EIKE 2GRNB 3FDHA 2HE0A 2P9SG 1HH8A 3D9JA 3OAWA 4P29A 3LYAA 2F8YA 5JA4D 3SD5A 3DEPA 1WAO1 3EIQC 4NACA 2RFMA 2AXZA 4AXHA 3Q49B 2VGXB 3FULA 1N11A 2J8SD 1K1BA 4NURA 5EX3A 3KEAA 3MJWA 1H6PA 3SGHA 3ZEFA 5T3RA 5DIZA 3R7QA 3JUEA 3Q7AA 4YNDA 4DX1A 3Q9NC 2YNQA 4BSZB 4K5CA 5EDSA 1Q2ZA 2DCPA 4APFA 3D3MA 4Z68A 2J09A 1N54A 1OY3D 4DRXE 4KZ0A 3FFLA 3QAQA 4BEPA 1N94A 3FU5A 4JHKA 3L22A 3Q79A 5J90A 3JXJA 1E8YA 4C0EA 2FULA 1TYQG 5BV0A 2WXQA 2QY7A 4DUIA 3BG0B 3ZFWA 1BI7B 3FU0A 4TXRA 4JHJA 3ZGQA 2Y3AA 1S0PA 3FHEA 3FWVA 1AP7A 1PC2A 1H2VC 3DSVA 2X6IA 2UY1A 5T4YA 2HYZA 1UOHA 4U0SA 1X81A 3RIBA 3ZYLA 3UUXA 4G26A 4G23A 3HVEB 5ARGA 4X8QA 3D9NA 1NI1A 2XQ0A 4HS2A 5JHAA 4HLEA 3UIPC 2IONA 1DCQA 4G25A 5AJLA 4H7XA 2J9QA 3AS5A 5CERB 3TWQA 5BUZA 1MJ0A 4OAUC 2R05A 2R5SA 2XCCA 5CBOA 3MYVA 2FEZA 5BNWA 3Q47B 3NOCD 3UM2A 1N0QA 4J8FA 3Q15A 3RRMB 5D66A 1HX8A 1NFIE 2YQ8A 4XI0A 2WQHA 5HQ8A 3DWLG 1MQSA 2EIJE 3MCXA 3UX4A 3BUAA 4JA7A 2YHEA 2WXJA 2C0MA 1WG0A 3S7BA 2BF0X 3TWSA 4CRWA 2WXRA 2IFUA 5CMYA 2X38A 5DBKA 1H2UA 2AXVA 4LCTA 1U3DA 2KM4A 4I43A 4UI9K 3G2WA 3R9AB 3U4TA 5B3SE 2E2EA 4UQZA 3JUIA 2PNNA 3FUIA 1IKND 3CVWA 4J6IA 2IF4A 1OCRE 2VGYA 5E75A 3V79K 3MEKA 4I2WA 3FH8A 3O4ZA 3QOUA 2VSXE 1BPOA 3APDA 2QFCA 3T8KA 3KSLA 1UW4B 4M7CA 4HVBA 2V4LA 3FU3A 4GYWA 4XEIG 4Q69A 4I2ZA 3ASDA 3UXGA 4OVUA 5LFAA 4MLPA 4F6RD 2WMOA 3ZKJA 3UKRG 4ANXA 5LOZA 3EDTB 4EECA 2HR2A 1DC2A 3MX3A 1JCSA 3Q73A 4A63B 3CK8A 2I1JA 1YMPA 1N0RA 1HZ4A 3ABLE 1U2VG 3CVNA 4KT6B 3GYZA 2ETCA 3HXCA 1OWLA 5BXUA 4I6JA 3ZYQA 4AEZC 3EJNA 3CHMA 4IN3B 4LG6A 3UM3A 2GRMA 2WXPA 3URZA 3GW4A 4KXKB 3ISMC 4PH4B 2JLBA 4IULA 3IEGA 1EYHA 2VGEA 4KMOA 2XENA 4JVSA 1GW6A 3RRNB 3UI2A 4JEHA 4FLBA 4U0UA 3ESLA 3UIOC 2GRRB 1KT0A 4NRHB 2VSYA 5HKPA 4WWPA 3OXLA 4RSYA 5CMWA 3CQCB 4GMRA 3T9KA 1E8XA 2CFZA 3LKUA 3LDZA 5IY5E 3MKQB 5FZQA 3L16A 4CDNA 4PS3A 3RKVA 4N5QA 3L13A 4JEUA 4CGVA 1G3NB 4EBAG 2WVIA 4CYMD 4RLYA 1IXVA 3AG2E 5G04C 2P9LG 3KAEA 1PY1A 1MX6A 4AP2A 3HIZA 4AV7A 3QK0A 5FWQA 1IQRA 3C5RA 1E8WA 4XE0A 1HU3A 2KCLA 1N95A 5EILA 3RAUA 3E4BA 4FJZA 1H2TC 2LAHA 4UQYA 3MV2B 3CHQA 4GZ3A 2I9CA 3SBSA 3FU6A 2CHZA 3G2UA 2X6KA 3UTMA 5FQ6A 4NIKA 3WG7E 4U8HA 4HI9A 4J8DA 3MGBA 4J8YA 5BT1A 1KT1A 2MYOA 3DXMG 3K9IA 4DPRA 1ZBPA 3C3RA 3E32A 3AG3E 3KSQA 3RJVA 3ZU7B 4U0ZA 4Y6CA 4GA0A 3CK7A 1EDUA 5ENTD 4B89A 3UT4A 3VTXA 3IV0A 4I6EA 2F8XK 3PZ1A 4GZCA 3DSUA 4L23A 5ENRD 5AAOA 3CK9A 1QZ2A 1JCQA 4K5AB 5CEDB 3QJZA 1HF8A 3CQGB 4YVQC 4CT0A 2P9KG 3FY4A 3CR3A 2IU1A 3SFXA 4GCOA 4PS7A 1WM5A 3E30A 1NA3A 1UG3A 1SQMA 2L9BA 3C3OA 2FO1E 1FVFA 2JEKA 4C0MA 4AY6A 4I1OB 2R2LA 4L2YA 1P5QA 2VSOE 1UJKA 1KPSB 1LTXA 4FHJA 3LXUX 3SFZA 3FTXA 3T8MA 2AW6A 3HG0D 2L0TB 1WDYA 4XX5A 4JPSA 1S70B 4JC8A 2VTBB 2PQNA 4DLQA 4B8CB 3LS8A 3L9TA 4UWLA 3S2AA 4WUYA 5CHEE 4F53A 1LD8A 2KC7A 4LSZE 2X6FA 3CVLA 3SHFA 3PEUB 2GW1A 3ZXSA 4IRUA 4F3VA 3RO2A 2XEHA 3QWWA 1X5BA 1HFAA 5FQ8A 4G11A 1TNOA 4FHKA 3TXNA 1D8DA 4EZKA 3ZN3A 1K8KG 1TNZA 3OXFA 1HXIA 2DZOA 1B89A 4EHMA 4ANWA 4LNBA 1IYGA 1QQEA 3FTVA 1N4PA 2VSNA 3JCKC 2Y1LE 3RK6A 4WAFA 4EZJA 2ZXWE 3C72A 3EU9A 4M3OA 2E0IA 2LSUA 3GZSA 3MZLB 2AWIA 4CDRA 2ILRA 4JHRA 1E8ZA 5FJYA 4U8YD 3RSEG 1N4QA 5EX0A 3PS6A 3Q5MA 2OVBA 5JJ6A 4L9PA 3U3WA 3DRAA 4DI4A 1OT8A 4LUNU 5G04J 3TXMA 5D0OD 4HOQA 4A55A 2BEDA 4YDYA 5ENOD 3ULYA 1QYMA 2IOSA 3APFA 2ONDA 5FIOA 4I9EA 3G2VA 4GYOA 4KBQA 1D8EA 2VJ8A 3LCAA 2KZTA 4E6HA 2XEEA 2ZGGA 5EIDA 4FADA 5FZSA 4R7LA 1BU9A 2AXUA 2IO2C 3R9MA 2R59A 3P1UA 4PDXA 4LERA 4AIFA 5AYWD 5ITZF 1BI8B 5AQBA 3AJIA 2RG8A 3CSTA 4HXIA 2LO6A 3AAAC 4HNAD 2WXMA 3SBTB 2WPVA 3BG1B 4E85A 3FTZA 4IYPA 1OCOE 5EYPF 5G55A 5CRUA 3L6AA 2RD0A 4WNFA 1FT1A 5EIBE 3W9FA 3I4GA 4EZLA 3HXFA 3B7SA 2IEJA 1AWCB 3UINC 5FINA 4UWGA 2XPYA 4DLOA 1U3CA 4TUMA 1OXJA 3QWVA 4I1AA 4OAVB 3ZPJA 2DVWA 5G05J 3CEQA 4G8LA 5CRVA 3AU4A 3KEZA 4AOFA 4YDWA 4MRUA 2BTDA 4GA1A 3SF4A 2XGOA 3ASHA 1YCSB 3TWTA 1NZNA 1DNPA 4U07A 4CCAA 1TNUA 4CT4A 4GPMA 1SZ9A 1W3BA 3ULQA 4DI3A 2XGSA 3VLDA 3O48A 4APOA 3ASFA 4GZ6A 3G2TA 4MS6A 4Q94A 4O60A 5FTPA 4J0UA 3CIAA 4O1OA 4J8EA 1Z3XA 3V31A 4KZCA 1SA4A 2DYSE 4L2LA 4KVMA 5AJDA 3ML9A 1A5EA 2F37A 4CEMA 2RFAA 2X6JA 2UWJG 4G24A 4N3AA 2YINA 3R7RA 3U66A 3V30A 3FH7A 1O1RA 2EILE 1TR4A 3NF1A 1OWOA 4JD2G 5D0QD 2V4HC 2A5EA 2X3MA 1TNYA 4BWRA 3J5QB 3EIJA 3PNLB 3LJNA 3PE3A 3FH5A 4A1SA 4XKBA 3AG1E 3Q7FA 3U64A 3OTNA 2XS1A 2V5FA 3EHNA 4GZDA 4V3IA 4BX9A 5KJNA 3AG4E 5AN8A 2IJGX 3FUDA 2NXPA 2XCBA 4URKA 3PVLA 3W9GA 3PH0C 4YDEA 5KNHD 3PREA 4GTQA 5CBNA 5C2YA 1JWFA 3EHRA 3JYSA 1VDYA 4FLHA 2NSZA 3C3QA 4ILIA 4UQXA 1E90A 3IBEA 4WNDA 2OEVA 4GCNA 4AM9A 3IHVA 3FUJA 1JWGA 5D2MC 2VGXA 2FO7A 2JABA 3D9IA 3D9PA 3ONKA 5KCMA 3TWVA 4ME2A 3B7BA 4F1SA 1IQUA 2WXFA 3JXIA 3OXGA 5AARA 5B1AE 3FTYA 4KVOA 3PRZA 3UPVA 2XZTG 4BERA 3ZYKA 1TN8A 4GMJA 3LY7A 3HDXA 2OOEA 2DBAA 2BKKB 2XPIA 1ZB1A 5KJLA 4I1MA 3HXEA 4EQFA 3CVXA 1E7UA 4GPKA 3PZ4A 3LEWA 1FVHA 4C48B 5CCLA 1OWNA 2FF4A 1Z3YA 4I17A 2KCVA 1V54E 4HLLA 1QBQA 2OCCE 4U04A 3T5XA 1N4RA 5LX8A 3B7UX 2Y4TA 4U95D 2B6CA 1E7VA 3D9LA 2XHEA 5B1BE 3CHSA 2LAIA 2QYUA 3LVQE 3UM0A 3ONLA 2R02A 4F7AA 3UMVA 3CSFA 2LSVA 3PNTB 4JL0A 3DXKG 3ULEG 4A3VA 2YHCA 4AVXA 2V5QC 2HO1A 3HVEA 3B95A 3NZUA 3SY2A 5BPPA 4N5CA 3S7JA 4HB5A 3FUNA 4I9CA 2WB2A 1HO8A 1HS6A 4TUUA 3P2BA 2KXPC 4AJWA 3PE4A 4HOUA 1S63A 2QZAA 2EINE 2Y69E 3FEYA 5ENQD 3ENEA 4MBGA 2WQ6A 2FI7A 1WY6A 3QWPA 4GTRA 4JA9A 3E33A 1RZ4A 3LJ3A 5FQ7A 3T5VA 4JW1A 1TJCA 2KATA 2CHXA 3DBSA 1UJJA 3LY8A 3APCA 4MKTA 4GU5A 4G2VA 2CG3A 1Y6IA 2X6HA 4HI8A 2IQCA 1LD7A 3CVPA 1FT2A 3PZ3A 3D9HA 1KZOA 3Q78A 5G05C 4QQIA 2L6JA 1MX2A 5ENPD 1UN9A 2CHWA 5BV1A 4H7YA 3TG4A 4B93B 3CVYA 3RRUA 3FUEA 3D9KA 4GB9A 5EN5D 3S7DA 4O6FA 4ACKA 1XGWA 5ANLA 4XKCA 4BTAA 4L1BA 4WNGA 1O1SA 2Y0BG 4I6GA 3IKOB 4QFVA 5ENNA 2I1KA 2V8SE 3MKRA 4RVBA 2P9NG 3ZYMA 3LVRE 2WXOA 5C1DA 3SI5A 2P9IG 5HRYA 4UWKA 3ABME 1S64A 3I3NA 3V2OA 1UN8A 3GZ2A 2XPZA 5FT9A 3CKBA 3I4RB 3KD7A 2DZNA 2DIWA 4TXPA 3TWXA 1RW2A 3ASNE 3J5PA 3DEOA 3JQ1A 1YYHA 2FBNA 4Y6WA 2I6HA 4GA2A 2LUHA 4BY6A 2KCKA 2WM9A 3IHYA 3CV0A 2GRPB 2R17C 3L82A 4XIFA 2F0YA 3ML8A 5KBAA 2XRZA 3UQ3A 2P58C 1BLXB 3FUFA 4DX6D 1OUVA 2J4DA 2MRIA 4FP7A 3UM1A 5BXOA 4JZYA 3AS4A 3HYMB 2H6FA 2J07A 3BEEA 3X2QE 3PDNA 3Q9UC 3EHQA 2PQRA 2GROB 3FUMA 4UWHA 5E76A 3FEXA 3EUVA 3CGHA 5HS0A 5CECB 3BQOA 1MX4A 3PEVB 2A5UA 3B7RL 3VTYA 5KNGA 4HRMB 4O1PA 3MKQA 2Y4UA 4B0ZA 1FCHA 4TRQA 4LRZA 1EF1C 2WXHA 2LXLA 1H19A 1HG2A 1SZAA 5JJTA 4RG6A 3MV3B 4DJAA 4CDMA 1D9SA 5KWDA 3AS8A 4Q96A 2OV8A 3NZSA 3VLFA 4ILHB 2H6GA 1ELKA 1H0AA 4GTOA 5BW8C 1IHBA 1H6KA 4U63A 4DK5A 2PZIA 4G1TA 1SVXA 2PM7A 2J08A 3IXEA 5ANRA 2IY0C 4BETA 4YDOA 3PZ2A 5ENSD 2XEVA 3ESKA 2H6HA 4HRNA 1MHQA 3RO3A 2XGMA 1MYOA 1HE8A 3CVQA 4TXQA 3UKUG 5H7PA 5EKQD 3QB2A 5HI7A 3SFYA 1H6OA 2OEWA 2ZIRA 1BD8A 1V55E 2R03A 3TG5A 4K0RA 3JQ0A 2DWZA 4RG9A 4NQ0A 4GZ5A 3D9OA 2XS8A 5CCMA 3ZHEB 3CKCA 3L08A 3WXXA 1OCCE 2VYIA 4WNEA 4F1PA 3FUHA 1LF8A 2MOWA 1NP7A 3ZXPA 3FTWA 3MA5A 5JMND 4HBDA 1O5MA 3G2SA 3BU8A 2XZDG 3PUJA 4EPZA 4UUCA 1N4SA 2HM8A 2XRYA 3L17A 4DX2A 3QKYA 1A17A 1QNFA 3VLEA 2ZGDA 5AQ9A 4WWNA 2ZU6B 1DVPA 3TWUA 3LY9A 3I5PA 1OWPA 3ZRHA 4U7EB 2WXIA 4UI9J 4ZFHA 2WXNA 4B94A 4UWFA 4TV3A 4LNUD 4PS8A 3V2XA 4FA6A 3FUKA 4GYYA 3PZDA 4J7WA 1OCZE 2VTBA 4FULA 2MHKA 3LPZA 1E96B 3S7FA 5LCWC 3HXBA 1SA5A 5AQ7A 5JJ7A 5M72A 4GMLA 5ARFA 3CLJA 4K5BA 1INZA 3ASOE 3DPYA 3ZUVB 5CEAA 4JXTA 3ZW3A 4ATGA 4CGWA 1KZPA 5AQAA 3HHMA 2NYJA 3QNKA 2ZISA 4A1GA 3NB2A 3AU5A 3KS2A 3TWWA 2P2CP 1NA0A 2BUGA 4OVVA 3TJPA 5JHBA 4HORA 1ELRA 3DSTA 1ELWA 1OWMA 3NOGD 1KLXA 3CHOA 4N2QA 4BSXA 4YVOA 5EYLA 1TEZA 4ZHBA 1JCRA 3RU0A 2LNIA 4U96D 3TL5A 1PAQA 4JB8P 5AENA 5T8IA 2IO3C 4ABNA 4HOSA 4LNGA 3E34A 4ILGA 1YA0A 3HXDA 3TAXA 2WXGA 2J4BA 4C9BB 2M63A 4FU3A 4WWOA 2KZTB 4HQDA 4EBAA 4GAAA 4HOTA 4XZ4A 2C0LA 3GZ1A 4GTVA 3SZ7A 4L7TA 5A6CA 2P9UG 4J8SA 3D9MA 3UT7A 1TJFA 2H6IA 4GTMA 3FTSA 3U9WA 1L5JA 4BFRA 1JPLA 1O1TA 3CHPA 4DX7D 3HRAA 2UY1B 4BX8A 4KYOB 5FZRA 3DSSA 1Z6TA 5KJMA 2I2OA 1TNBA 2P9PG 2GRLA 3DSXA 2EQXA 2C2LA 2IOLA 5G2NA 3NBNB 1Z5SC 3NQPA 4FC8A 4GTSA 4DX5D 4W9RA 3DPDA
chains in the Genus database with same CATH topology
1OCZE 2EINE 2Y69E 3ABME 5B1BE 5IY5E 2DYRE 2EIME 3AG1E 3AG3E 1V54E 5B3SE 1OCCE 2OCCE 3X2QE 2ZXWE 3ASOE 3ASNE 2EILE 2DYSE 3ABLE 1V55E 2EIKE 2EIJE 3AG4E 1OCRE 3ABKE 3WG7E 1OCOE 5B1AE 3AG2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCZ E;  2EIN E;  2Y69 E;  3ABM E;  5B1B E;  5IY5 E;  2DYR E;  2EIM E;  3AG1 E;  3AG3 E;  1V54 E;  5B3S E;  1OCC E;  2OCC E;  3X2Q E;  2ZXW E;  3ASO E;  3ASN E;  2EIL E;  2DYS E;  3ABL E;  1V55 E;  2EIK E;  2EIJ E;  3AG4 E;  1OCR E;  3ABK E;  3WG7 E;  1OCO E;  5B1A E;  3AG2 E; 
#chains in the Genus database with same CATH topology
 3CVU A;  3ZVV A;  4HRL A;  2VQ2 A;  5LP0 A;  2OVF A;  5FQ4 A;  1EPU A;  2GGF A;  4ACL A;  3ZNG A;  4ANV A;  4HFG A;  2RKK A;  4A3T A;  1DCE A;  1N52 A;  1Y8M A;  2WQ7 A;  2WXK A;  3FP3 A;  2J49 A;  4N3B A;  3EHM A;  1IHG A;  2QYJ A;  1FPP A;  3Q4A B;  3NAW A;  2WMN A;  5A7D B;  2KBX A;  3EU5 A;  4ANU A;  3CHR A;  2B0O E;  1N9A A;  3Q75 A;  3CVV A;  4N39 A;  3B13 A;  4GTP A;  5KJK A;  3ZIM A;  1SW6 A;  3F6Q A;  2QC9 A;  4D10 C;  2DYR E;  4OYS A;  3L54 A;  4AY5 A;  2A4Z A;  5J08 A;  3TGO A;  3N71 A;  2L6B A;  3C98 A;  5A23 A;  4N2S A;  3QC1 A;  3ZHE A;  2Q7F A;  2GRQ B;  4G8K A;  3ABK E;  4K03 A;  5LCW J;  4B8A A;  1ZU2 A;  1NL4 A;  4N3C A;  2PM6 A;  2AVP A;  3E37 A;  4U8V D;  3PUK A;  2NC9 A;  4BTB A;  4CZ2 D;  4FJY A;  3FTU A;  2ETA A;  1K3Z D;  4BT9 A;  2EIM E;  4XI9 A;  2CG2 A;  3B7T A;  3TWR A;  2CFU A;  4BT8 A;  1K1A A;  1TN7 A;  3SQV A;  4RQI A;  4PUC A;  2ETB A;  3ASG A;  3SNX A;  1XNF A;  2WXL A;  2PL2 A;  2V0P A;  2AJA A;  1HG5 A;  1MZC A;  3UT8 A;  4LEU A;  1JUQ A;  4BES A;  3SO8 A;  2BKG A;  4ATZ D;  2L0I A;  3DSW A;  3QDN A;  4GTT A;  4UI9 C;  1TN6 A;  2LXM A;  3QAR A;  5AIJ A;  2EIK E;  2GRN B;  3FDH A;  2HE0 A;  2P9S G;  1HH8 A;  3D9J A;  3OAW A;  4P29 A;  3LYA A;  2F8Y A;  5JA4 D;  3SD5 A;  3DEP A;  1WAO 1;  3EIQ C;  4NAC A;  2RFM A;  2AXZ A;  4AXH A;  3Q49 B;  2VGX B;  3FUL A;  1N11 A;  2J8S D;  1K1B A;  4NUR A;  5EX3 A;  3KEA A;  3MJW A;  1H6P A;  3SGH A;  3ZEF A;  5T3R A;  5DIZ A;  3R7Q A;  3JUE A;  3Q7A A;  4YND A;  4DX1 A;  3Q9N C;  2YNQ A;  4BSZ B;  4K5C A;  5EDS A;  1Q2Z A;  2DCP A;  4APF A;  3D3M A;  4Z68 A;  2J09 A;  1N54 A;  1OY3 D;  4DRX E;  4KZ0 A;  3FFL A;  3QAQ A;  4BEP A;  1N94 A;  3FU5 A;  4JHK A;  3L22 A;  3Q79 A;  5J90 A;  3JXJ A;  1E8Y A;  4C0E A;  2FUL A;  1TYQ G;  5BV0 A;  2WXQ A;  2QY7 A;  4DUI A;  3BG0 B;  3ZFW A;  1BI7 B;  3FU0 A;  4TXR A;  4JHJ A;  3ZGQ A;  2Y3A A;  1S0P A;  3FHE A;  3FWV A;  1AP7 A;  1PC2 A;  1H2V C;  3DSV A;  2X6I A;  2UY1 A;  5T4Y A;  2HYZ A;  1UOH A;  4U0S A;  1X81 A;  3RIB A;  3ZYL A;  3UUX A;  4G26 A;  4G23 A;  3HVE B;  5ARG A;  4X8Q A;  3D9N A;  1NI1 A;  2XQ0 A;  4HS2 A;  5JHA A;  4HLE A;  3UIP C;  2ION A;  1DCQ A;  4G25 A;  5AJL A;  4H7X A;  2J9Q A;  3AS5 A;  5CER B;  3TWQ A;  5BUZ A;  1MJ0 A;  4OAU C;  2R05 A;  2R5S A;  2XCC A;  5CBO A;  3MYV A;  2FEZ A;  5BNW A;  3Q47 B;  3NOC D;  3UM2 A;  1N0Q A;  4J8F A;  3Q15 A;  3RRM B;  5D66 A;  1HX8 A;  1NFI E;  2YQ8 A;  4XI0 A;  2WQH A;  5HQ8 A;  3DWL G;  1MQS A;  2EIJ E;  3MCX A;  3UX4 A;  3BUA A;  4JA7 A;  2YHE A;  2WXJ A;  2C0M A;  1WG0 A;  3S7B A;  2BF0 X;  3TWS A;  4CRW A;  2WXR A;  2IFU A;  5CMY A;  2X38 A;  5DBK A;  1H2U A;  2AXV A;  4LCT A;  1U3D A;  2KM4 A;  4I43 A;  4UI9 K;  3G2W A;  3R9A B;  3U4T A;  5B3S E;  2E2E A;  4UQZ A;  3JUI A;  2PNN A;  3FUI A;  1IKN D;  3CVW A;  4J6I A;  2IF4 A;  1OCR E;  2VGY A;  5E75 A;  3V79 K;  3MEK A;  4I2W A;  3FH8 A;  3O4Z A;  3QOU A;  2VSX E;  1BPO A;  3APD A;  2QFC A;  3T8K A;  3KSL A;  1UW4 B;  4M7C A;  4HVB A;  2V4L A;  3FU3 A;  4GYW A;  4XEI G;  4Q69 A;  4I2Z A;  3ASD A;  3UXG A;  4OVU A;  5LFA A;  4MLP A;  4F6R D;  2WMO A;  3ZKJ A;  3UKR G;  4ANX A;  5LOZ A;  3EDT B;  4EEC A;  2HR2 A;  1DC2 A;  3MX3 A;  1JCS A;  3Q73 A;  4A63 B;  3CK8 A;  2I1J A;  1YMP A;  1N0R A;  1HZ4 A;  3ABL E;  1U2V G;  3CVN A;  4KT6 B;  3GYZ A;  2ETC A;  3HXC A;  1OWL A;  5BXU A;  4I6J A;  3ZYQ A;  4AEZ C;  3EJN A;  3CHM A;  4IN3 B;  4LG6 A;  3UM3 A;  2GRM A;  2WXP A;  3URZ A;  3GW4 A;  4KXK B;  3ISM C;  4PH4 B;  2JLB A;  4IUL A;  3IEG A;  1EYH A;  2VGE A;  4KMO A;  2XEN A;  4JVS A;  1GW6 A;  3RRN B;  3UI2 A;  4JEH A;  4FLB A;  4U0U A;  3ESL A;  3UIO C;  2GRR B;  1KT0 A;  4NRH B;  2VSY A;  5HKP A;  4WWP A;  3OXL A;  4RSY A;  5CMW A;  3CQC B;  4GMR A;  3T9K A;  1E8X A;  2CFZ A;  3LKU A;  3LDZ A;  5IY5 E;  3MKQ B;  5FZQ A;  3L16 A;  4CDN A;  4PS3 A;  3RKV A;  4N5Q A;  3L13 A;  4JEU A;  4CGV A;  1G3N B;  4EBA G;  2WVI A;  4CYM D;  4RLY A;  1IXV A;  3AG2 E;  5G04 C;  2P9L G;  3KAE A;  1PY1 A;  1MX6 A;  4AP2 A;  3HIZ A;  4AV7 A;  3QK0 A;  5FWQ A;  1IQR A;  3C5R A;  1E8W A;  4XE0 A;  1HU3 A;  2KCL A;  1N95 A;  5EIL A;  3RAU A;  3E4B A;  4FJZ A;  1H2T C;  2LAH A;  4UQY A;  3MV2 B;  3CHQ A;  4GZ3 A;  2I9C A;  3SBS A;  3FU6 A;  2CHZ A;  3G2U A;  2X6K A;  3UTM A;  5FQ6 A;  4NIK A;  3WG7 E;  4U8H A;  4HI9 A;  4J8D A;  3MGB A;  4J8Y A;  5BT1 A;  1KT1 A;  2MYO A;  3DXM G;  3K9I A;  4DPR A;  1ZBP A;  3C3R A;  3E32 A;  3AG3 E;  3KSQ A;  3RJV A;  3ZU7 B;  4U0Z A;  4Y6C A;  4GA0 A;  3CK7 A;  1EDU A;  5ENT D;  4B89 A;  3UT4 A;  3VTX A;  3IV0 A;  4I6E A;  2F8X K;  3PZ1 A;  4GZC A;  3DSU A;  4L23 A;  5ENR D;  5AAO A;  3CK9 A;  1QZ2 A;  1JCQ A;  4K5A B;  5CED B;  3QJZ A;  1HF8 A;  3CQG B;  4YVQ C;  4CT0 A;  2P9K G;  3FY4 A;  3CR3 A;  2IU1 A;  3SFX A;  4GCO A;  4PS7 A;  1WM5 A;  3E30 A;  1NA3 A;  1UG3 A;  1SQM A;  2L9B A;  3C3O A;  2FO1 E;  1FVF A;  2JEK A;  4C0M A;  4AY6 A;  4I1O B;  2R2L A;  4L2Y A;  1P5Q A;  2VSO E;  1UJK A;  1KPS B;  1LTX A;  4FHJ A;  3LXU X;  3SFZ A;  3FTX A;  3T8M A;  2AW6 A;  3HG0 D;  2L0T B;  1WDY A;  4XX5 A;  4JPS A;  1S70 B;  4JC8 A;  2VTB B;  2PQN A;  4DLQ A;  4B8C B;  3LS8 A;  3L9T A;  4UWL A;  3S2A A;  4WUY A;  5CHE E;  4F53 A;  1LD8 A;  2KC7 A;  4LSZ E;  2X6F A;  3CVL A;  3SHF A;  3PEU B;  2GW1 A;  3ZXS A;  4IRU A;  4F3V A;  3RO2 A;  2XEH A;  3QWW A;  1X5B A;  1HFA A;  5FQ8 A;  4G11 A;  1TNO A;  4FHK A;  3TXN A;  1D8D A;  4EZK A;  3ZN3 A;  1K8K G;  1TNZ A;  3OXF A;  1HXI A;  2DZO A;  1B89 A;  4EHM A;  4ANW A;  4LNB A;  1IYG A;  1QQE A;  3FTV A;  1N4P A;  2VSN A;  3JCK C;  2Y1L E;  3RK6 A;  4WAF A;  4EZJ A;  2ZXW E;  3C72 A;  3EU9 A;  4M3O A;  2E0I A;  2LSU A;  3GZS A;  3MZL B;  2AWI A;  4CDR A;  2ILR A;  4JHR A;  1E8Z A;  5FJY A;  4U8Y D;  3RSE G;  1N4Q A;  5EX0 A;  3PS6 A;  3Q5M A;  2OVB A;  5JJ6 A;  4L9P A;  3U3W A;  3DRA A;  4DI4 A;  1OT8 A;  4LUN U;  5G04 J;  3TXM A;  5D0O D;  4HOQ A;  4A55 A;  2BED A;  4YDY A;  5ENO D;  3ULY A;  1QYM A;  2IOS A;  3APF A;  2OND A;  5FIO A;  4I9E A;  3G2V A;  4GYO A;  4KBQ A;  1D8E A;  2VJ8 A;  3LCA A;  2KZT A;  4E6H A;  2XEE A;  2ZGG A;  5EID A;  4FAD A;  5FZS A;  4R7L A;  1BU9 A;  2AXU A;  2IO2 C;  3R9M A;  2R59 A;  3P1U A;  4PDX A;  4LER A;  4AIF A;  5AYW D;  5ITZ F;  1BI8 B;  5AQB A;  3AJI A;  2RG8 A;  3CST A;  4HXI A;  2LO6 A;  3AAA C;  4HNA D;  2WXM A;  3SBT B;  2WPV A;  3BG1 B;  4E85 A;  3FTZ A;  4IYP A;  1OCO E;  5EYP F;  5G55 A;  5CRU A;  3L6A A;  2RD0 A;  4WNF A;  1FT1 A;  5EIB E;  3W9F A;  3I4G A;  4EZL A;  3HXF A;  3B7S A;  2IEJ A;  1AWC B;  3UIN C;  5FIN A;  4UWG A;  2XPY A;  4DLO A;  1U3C A;  4TUM A;  1OXJ A;  3QWV A;  4I1A A;  4OAV B;  3ZPJ A;  2DVW A;  5G05 J;  3CEQ A;  4G8L A;  5CRV A;  3AU4 A;  3KEZ A;  4AOF A;  4YDW A;  4MRU A;  2BTD A;  4GA1 A;  3SF4 A;  2XGO A;  3ASH A;  1YCS B;  3TWT A;  1NZN A;  1DNP A;  4U07 A;  4CCA A;  1TNU A;  4CT4 A;  4GPM A;  1SZ9 A;  1W3B A;  3ULQ A;  4DI3 A;  2XGS A;  3VLD A;  3O48 A;  4APO A;  3ASF A;  4GZ6 A;  3G2T A;  4MS6 A;  4Q94 A;  4O60 A;  5FTP A;  4J0U A;  3CIA A;  4O1O A;  4J8E A;  1Z3X A;  3V31 A;  4KZC A;  1SA4 A;  2DYS E;  4L2L A;  4KVM A;  5AJD A;  3ML9 A;  1A5E A;  2F37 A;  4CEM A;  2RFA A;  2X6J A;  2UWJ G;  4G24 A;  4N3A A;  2YIN A;  3R7R A;  3U66 A;  3V30 A;  3FH7 A;  1O1R A;  2EIL E;  1TR4 A;  3NF1 A;  1OWO A;  4JD2 G;  5D0Q D;  2V4H C;  2A5E A;  2X3M A;  1TNY A;  4BWR A;  3J5Q B;  3EIJ A;  3PNL B;  3LJN A;  3PE3 A;  3FH5 A;  4A1S A;  4XKB A;  3AG1 E;  3Q7F A;  3U64 A;  3OTN A;  2XS1 A;  2V5F A;  3EHN A;  4GZD A;  4V3I A;  4BX9 A;  5KJN A;  3AG4 E;  5AN8 A;  2IJG X;  3FUD A;  2NXP A;  2XCB A;  4URK A;  3PVL A;  3W9G A;  3PH0 C;  4YDE A;  5KNH D;  3PRE A;  4GTQ A;  5CBN A;  5C2Y A;  1JWF A;  3EHR A;  3JYS A;  1VDY A;  4FLH A;  2NSZ A;  3C3Q A;  4ILI A;  4UQX A;  1E90 A;  3IBE A;  4WND A;  2OEV A;  4GCN A;  4AM9 A;  3IHV A;  3FUJ A;  1JWG A;  5D2M C;  2VGX A;  2FO7 A;  2JAB A;  3D9I A;  3D9P A;  3ONK A;  5KCM A;  3TWV A;  4ME2 A;  3B7B A;  4F1S A;  1IQU A;  2WXF A;  3JXI A;  3OXG A;  5AAR A;  5B1A E;  3FTY A;  4KVO A;  3PRZ A;  3UPV A;  2XZT G;  4BER A;  3ZYK A;  1TN8 A;  4GMJ A;  3LY7 A;  3HDX A;  2OOE A;  2DBA A;  2BKK B;  2XPI A;  1ZB1 A;  5KJL A;  4I1M A;  3HXE A;  4EQF A;  3CVX A;  1E7U A;  4GPK A;  3PZ4 A;  3LEW A;  1FVH A;  4C48 B;  5CCL A;  1OWN A;  2FF4 A;  1Z3Y A;  4I17 A;  2KCV A;  1V54 E;  4HLL A;  1QBQ A;  2OCC E;  4U04 A;  3T5X A;  1N4R A;  5LX8 A;  3B7U X;  2Y4T A;  4U95 D;  2B6C A;  1E7V A;  3D9L A;  2XHE A;  5B1B E;  3CHS A;  2LAI A;  2QYU A;  3LVQ E;  3UM0 A;  3ONL A;  2R02 A;  4F7A A;  3UMV A;  3CSF A;  2LSV A;  3PNT B;  4JL0 A;  3DXK G;  3ULE G;  4A3V A;  2YHC A;  4AVX A;  2V5Q C;  2HO1 A;  3HVE A;  3B95 A;  3NZU A;  3SY2 A;  5BPP A;  4N5C A;  3S7J A;  4HB5 A;  3FUN A;  4I9C A;  2WB2 A;  1HO8 A;  1HS6 A;  4TUU A;  3P2B A;  2KXP C;  4AJW A;  3PE4 A;  4HOU A;  1S63 A;  2QZA A;  2EIN E;  2Y69 E;  3FEY A;  5ENQ D;  3ENE A;  4MBG A;  2WQ6 A;  2FI7 A;  1WY6 A;  3QWP A;  4GTR A;  4JA9 A;  3E33 A;  1RZ4 A;  3LJ3 A;  5FQ7 A;  3T5V A;  4JW1 A;  1TJC A;  2KAT A;  2CHX A;  3DBS A;  1UJJ A;  3LY8 A;  3APC A;  4MKT A;  4GU5 A;  4G2V A;  2CG3 A;  1Y6I A;  2X6H A;  4HI8 A;  2IQC A;  1LD7 A;  3CVP A;  1FT2 A;  3PZ3 A;  3D9H A;  1KZO A;  3Q78 A;  5G05 C;  4QQI A;  2L6J A;  1MX2 A;  5ENP D;  1UN9 A;  2CHW A;  5BV1 A;  4H7Y A;  3TG4 A;  4B93 B;  3CVY A;  3RRU A;  3FUE A;  3D9K A;  4GB9 A;  5EN5 D;  3S7D A;  4O6F A;  4ACK A;  1XGW A;  5ANL A;  4XKC A;  4BTA A;  4L1B A;  4WNG A;  1O1S A;  2Y0B G;  4I6G A;  3IKO B;  4QFV A;  5ENN A;  2I1K A;  2V8S E;  3MKR A;  4RVB A;  2P9N G;  3ZYM A;  3LVR E;  2WXO A;  5C1D A;  3SI5 A;  2P9I G;  5HRY A;  4UWK A;  3ABM E;  1S64 A;  3I3N A;  3V2O A;  1UN8 A;  3GZ2 A;  2XPZ A;  5FT9 A;  3CKB A;  3I4R B;  3KD7 A;  2DZN A;  2DIW A;  4TXP A;  3TWX A;  1RW2 A;  3ASN E;  3J5P A;  3DEO A;  3JQ1 A;  1YYH A;  2FBN A;  4Y6W A;  2I6H A;  4GA2 A;  2LUH A;  4BY6 A;  2KCK A;  2WM9 A;  3IHY A;  3CV0 A;  2GRP B;  2R17 C;  3L82 A;  4XIF A;  2F0Y A;  3ML8 A;  5KBA A;  2XRZ A;  3UQ3 A;  2P58 C;  1BLX B;  3FUF A;  4DX6 D;  1OUV A;  2J4D A;  2MRI A;  4FP7 A;  3UM1 A;  5BXO A;  4JZY A;  3AS4 A;  3HYM B;  2H6F A;  2J07 A;  3BEE A;  3X2Q E;  3PDN A;  3Q9U C;  3EHQ A;  2PQR A;  2GRO B;  3FUM A;  4UWH A;  5E76 A;  3FEX A;  3EUV A;  3CGH A;  5HS0 A;  5CEC B;  3BQO A;  1MX4 A;  3PEV B;  2A5U A;  3B7R L;  3VTY A;  5KNG A;  4HRM B;  4O1P A;  3MKQ A;  2Y4U A;  4B0Z A;  1FCH A;  4TRQ A;  4LRZ A;  1EF1 C;  2WXH A;  2LXL A;  1H19 A;  1HG2 A;  1SZA A;  5JJT A;  4RG6 A;  3MV3 B;  4DJA A;  4CDM A;  1D9S A;  5KWD A;  3AS8 A;  4Q96 A;  2OV8 A;  3NZS A;  3VLF A;  4ILH B;  2H6G A;  1ELK A;  1H0A A;  4GTO A;  5BW8 C;  1IHB A;  1H6K A;  4U63 A;  4DK5 A;  2PZI A;  4G1T A;  1SVX A;  2PM7 A;  2J08 A;  3IXE A;  5ANR A;  2IY0 C;  4BET A;  4YDO A;  3PZ2 A;  5ENS D;  2XEV A;  3ESK A;  2H6H A;  4HRN A;  1MHQ A;  3RO3 A;  2XGM A;  1MYO A;  1HE8 A;  3CVQ A;  4TXQ A;  3UKU G;  5H7P A;  5EKQ D;  3QB2 A;  5HI7 A;  3SFY A;  1H6O A;  2OEW A;  2ZIR A;  1BD8 A;  1V55 E;  2R03 A;  3TG5 A;  4K0R A;  3JQ0 A;  2DWZ A;  4RG9 A;  4NQ0 A;  4GZ5 A;  3D9O A;  2XS8 A;  5CCM A;  3ZHE B;  3CKC A;  3L08 A;  3WXX A;  1OCC E;  2VYI A;  4WNE A;  4F1P A;  3FUH A;  1LF8 A;  2MOW A;  1NP7 A;  3ZXP A;  3FTW A;  3MA5 A;  5JMN D;  4HBD A;  1O5M A;  3G2S A;  3BU8 A;  2XZD G;  3PUJ A;  4EPZ A;  4UUC A;  1N4S A;  2HM8 A;  2XRY A;  3L17 A;  4DX2 A;  3QKY A;  1A17 A;  1QNF A;  3VLE A;  2ZGD A;  5AQ9 A;  4WWN A;  2ZU6 B;  1DVP A;  3TWU A;  3LY9 A;  3I5P A;  1OWP A;  3ZRH A;  4U7E B;  2WXI A;  4UI9 J;  4ZFH A;  2WXN A;  4B94 A;  4UWF A;  4TV3 A;  4LNU D;  4PS8 A;  3V2X A;  4FA6 A;  3FUK A;  4GYY A;  3PZD A;  4J7W A;  1OCZ E;  2VTB A;  4FUL A;  2MHK A;  3LPZ A;  1E96 B;  3S7F A;  5LCW C;  3HXB A;  1SA5 A;  5AQ7 A;  5JJ7 A;  5M72 A;  4GML A;  5ARF A;  3CLJ A;  4K5B A;  1INZ A;  3ASO E;  3DPY A;  3ZUV B;  5CEA A;  4JXT A;  3ZW3 A;  4ATG A;  4CGW A;  1KZP A;  5AQA A;  3HHM A;  2NYJ A;  3QNK A;  2ZIS A;  4A1G A;  3NB2 A;  3AU5 A;  3KS2 A;  3TWW A;  2P2C P;  1NA0 A;  2BUG A;  4OVV A;  3TJP A;  5JHB A;  4HOR A;  1ELR A;  3DST A;  1ELW A;  1OWM A;  3NOG D;  1KLX A;  3CHO A;  4N2Q A;  4BSX A;  4YVO A;  5EYL A;  1TEZ A;  4ZHB A;  1JCR A;  3RU0 A;  2LNI A;  4U96 D;  3TL5 A;  1PAQ A;  4JB8 P;  5AEN A;  5T8I A;  2IO3 C;  4ABN A;  4HOS A;  4LNG A;  3E34 A;  4ILG A;  1YA0 A;  3HXD A;  3TAX A;  2WXG A;  2J4B A;  4C9B B;  2M63 A;  4FU3 A;  4WWO A;  2KZT B;  4HQD A;  4EBA A;  4GAA A;  4HOT A;  4XZ4 A;  2C0L A;  3GZ1 A;  4GTV A;  3SZ7 A;  4L7T A;  5A6C A;  2P9U G;  4J8S A;  3D9M A;  3UT7 A;  1TJF A;  2H6I A;  4GTM A;  3FTS A;  3U9W A;  1L5J A;  4BFR A;  1JPL A;  1O1T A;  3CHP A;  4DX7 D;  3HRA A;  2UY1 B;  4BX8 A;  4KYO B;  5FZR A;  3DSS A;  1Z6T A;  5KJM A;  2I2O A;  1TNB A;  2P9P G;  2GRL A;  3DSX A;  2EQX A;  2C2L A;  2IOL A;  5G2N A;  3NBN B;  1Z5S C;  3NQP A;  4FC8 A;  4GTS A;  4DX5 D;  4W9R A;  3DPD A; 
#chains in the Genus database with same CATH homology
 1OCZ E;  2EIN E;  2Y69 E;  3ABM E;  5B1B E;  5IY5 E;  2DYR E;  2EIM E;  3AG1 E;  3AG3 E;  1V54 E;  5B3S E;  1OCC E;  2OCC E;  3X2Q E;  2ZXW E;  3ASO E;  3ASN E;  2EIL E;  2DYS E;  3ABL E;  1V55 E;  2EIK E;  2EIJ E;  3AG4 E;  1OCR E;  3ABK E;  3WG7 E;  1OCO E;  5B1A E;  3AG2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...