2EILE

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eilE00
3AG2E 3AG3E 2OCCE 1OCOE 3ABKE 2Y69E 1OCRE 2ZXWE 3ASOE 1V54E 5B1BE 1OCCE 2DYSE 3ASNE 1V55E 5B1AE 2EIME 3ABLE 2EIKE 3WG7E 3X2QE 2EINE 2DYRE 3AG1E 3AG4E 1OCZE 2EIJE 5B3SE 2EILE 3ABME 5IY5E
chains in the Genus database with same CATH superfamily
1WG0A 2EQXA 4JXTA 4F53A 3SNXA 4YVOA 4HVBA 1OT8A 3DPYA 1HX8A 3OAWA 1O1RA 3ONKA 4UQYA 4HNAD 4GAAA 2RFAA 1TNZA 4Q96A 4O6FA 2FO7A 2GGFA 4EBAA 4XZ4A 1NA3A 1HFAA 4BFRA 2R02A 5D0OD 1SA5A 1E8XA 4AY5A 2WM9A 2B6CA 3HXFA 5EIDA 2R2LA 2YINA 3AG2E 4B94A 1TN8A 4LCTA 2VJ8A 3HRAA 4BSZB 2DYSE 5CECB 2XZTG 4CGWA 4ABNA 2DWZA 3DWLG 4FADA 2QZAA 3BEEA 2VSOE 1WDYA 4KZCA 5T8IA 1B89A 3UKUG 3LCAA 1MHQA 4YDOA 1MX2A 2XS1A 3ZEFA 3QWWA 1YCSB 5JA4D 4URKA 3G2TA 5FIOA 5JJTA 2DVWA 3CLJA 5EX0A 3Q78A 4G1TA 2FI7A 2NC9A 2V5FA 4M3OA 3LEWA 2DZNA 2LAIA 4NQ0A 3DSTA 2IQCA 2WMOA 3D9KA 4FC8A 4ACKA 3MJWA 3JXJA 5FZRA 3MGBA 3TAXA 3DPDA 4M7CA 4U07A 5EILA 4ILHB 2V8SE 5IY5E 3BUAA 2XRYA 2GRPB 3DRAA 3QKYA 1PY1A 4RVBA 3C3QA 5B1AE 1WM5A 3L16A 4GMJA 1LTXA 2WXJA 5ITZF 5KJKA 5JJ6A 3NZUA 3ABME 3ONLA 4XKBA 2WXOA 5EIBE 3ESLA 2BUGA 2E2EA 2PZIA 4I6EA 4JD2G 2OV8A 4CEMA 2FF4A 3CHQA 4GA2A 3ZKJA 2R5SA 3U9WA 3O48A 4U8HA 3MKQB 3Q15A 3OXGA 1OWPA 4BEPA 4DX2A 1JCQA 2Y4TA 2PM6A 1WAO1 5D2MC 2AWIA 3IHVA 4HORA 2VGYA 5FQ8A 3AS8A 4HFGA 3D9JA 2WQ6A 2WXPA 1U3DA 5FQ7A 4KZ0A 5T4YA 4L2YA 3LYAA 4Q94A 4I6JA 3UT4A 5D0QD 3NOGD 4IULA 4ILGA 3ZPJA 4FULA 2CG3A 4A1SA 3LVRE 4OAVB 4GTMA 2KCKA 4GA1A 5BPPA 4LG6A 4WWOA 1L5JA 3SY2A 4APOA 3TWUA 4GZCA 4UUCA 2J4DA 2I9CA 5AIJA 3CK8A 3TWTA 1H6OA 5JHAA 2Y1LE 3BU8A 2H6HA 4A63B 1NP7A 4I43A 2RFMA 1A5EA 3UX4A 3T9KA 3ISMC 3QWPA 3L54A 3NBNB 3G2UA 3S7FA 4JPSA 4ZHBA 2AW6A 3S7BA 2VGXB 2KXPC 4TUUA 3CEQA 3OXFA 2ETCA 2MYOA 3EUVA 3R9AB 3CVLA 3RO3A 4ANXA 1EDUA 3W9GA 1O1TA 4F1PA 1TJFA 3U4TA 1O1SA 1MJ0A 3SO8A 1H6KA 3FFLA 2J49A 1JPLA 3B7SA 4CDMA 3LKUA 4BT8A 3CSTA 1HG5A 3S2AA 4LNBA 3TWQA 4HXIA 1P5QA 5B1BE 1JCSA 2YHCA 4RSYA 3CSFA 5ENSD 3NF1A 2UY1B 2BTDA 2KCVA 2BEDA 3Q47B 2R05A 3EU9A 2XGOA 3IKOB 5DBKA 5ARGA 3MV3B 3ZN3A 2ZGGA 1VDYA 1SA4A 2ONDA 4GMRA 1HS6A 2FULA 4BTBA 2LXLA 2RD0A 3LJNA 4C48B 4IYPA 3CQGB 3OTNA 4I1OB 1TYQG 2OOEA 3FUKA 3QJZA 5CMYA 4J0UA 1V55E 3ZYLA 5CEDB 1W3BA 1TR4A 4GZDA 3EIQC 5AQ7A 4GPKA 1E96B 2DIWA 2XCBA 4L1BA 4KMOA 3V2OA 4G25A 4U95D 1KLXA 2PM7A 3PVLA 1V54E 3ZYKA 3SZ7A 4GZ3A 1BPOA 1D9SA 3Q7FA 5KCMA 3V79K 3TWRA 3QK0A 4JEHA 3TWXA 3Q7AA 4HOTA 1DCQA 2IOLA 2KZTA 3T8MA 2JEKA 3TXMA 2IO2C 2WMNA 3CVVA 4EBAG 2IEJA 5BT1A 1KZOA 1TEZA 2WXLA 3RU0A 4C9BB 3CVQA 3AS4A 3ASHA 3C98A 3HVEA 2FEZA 2CHXA 4G8KA 3FU0A 4G23A 4GB9A 4N3CA 4DLOA 3ML8A 3FTYA 4UWKA 4GMLA 2KC7A 4ACLA 2LUHA 2HR2A 3DEPA 3ESKA 5CHEE 2UWJG 4CGVA 4AM9A 3LVQE 5KNGA 3Q4AB 5AYWD 2WVIA 2I6HA 3ENEA 3UINC 1HF8A 4B8CB 2B0OE 4GU5A 2L6JA 4TXPA 1H2TC 4AOFA 1N4SA 2V4LA 1TNBA 3C5RA 4GTQA 2WB2A 1KT0A 3PRZA 5LOZA 5G2NA 4XE0A 4EHMA 1N0RA 4XI9A 4I9CA 1IHGA 4KYOB 4JB8P 1K3ZD 3ABKE 2ZXWE 2CHWA 4CRWA 3IEGA 4DPRA 2C0MA 4HBDA 4HOSA 3SI5A 1H0AA 1N94A 3CK7A 2BF0X 2V5QC 2A5EA 3O4ZA 3TJPA 3APCA 3MCXA 3ULQA 3QARA 1ELKA 4J8YA 1SZAA 5CCLA 5CRUA 1BLXB 3IV0A 1OWMA 1JWFA 2WXHA 3JCKC 3S7JA 2JABA 1S63A 3HDXA 4GCOA 5AARA 3KEZA 4K5BA 2ILRA 1YA0A 3UKRG 4K5AB 2Y0BG 1BI7B 1D8DA 4DLQA 4FU3A 4WWNA 3MX3A 1OXJA 2FO1E 3C72A 1FCHA 3SBTB 3ZIMA 3PNTB 1OCRE 1ELRA 5HI7A 3UI2A 4NACA 3FUNA 3RRMB 4YDYA 3ZUVB 5M72A 1QNFA 4GTOA 4HOQA 3IXEA 1YMPA 4AXHA 3AJIA 3FY4A 3U66A 4F3VA 3HIZA 3Q79A 3HXCA 2XEEA 4DX1A 2IONA 3CVYA 4UQZA 4L2LA 4U0ZA 1Y8MA 4JA7A 3SBSA 2L0IA 3Q49B 1O5MA 3BQOA 4FP7A 3PNLB 4F6RD 1TJCA 4KT6B 3UPVA 1IQRA 2XPYA 3KS2A 5EYPF 3UTMA 2YQ8A 2X6JA 3OXLA 4W9RA 3CQCB 5G05C 5AQAA 1S70B 2AXZA 2C0LA 2Q7FA 4HRLA 3HXDA 1Z6TA 2WXIA 4GTRA 3FTZA 3QOUA 4XIFA 3U64A 5AENA 3CVWA 4L23A 4I1AA 3LY7A 4PS8A 1OWNA 4Y6WA 4U0SA 4X8QA 3LY8A 1IXVA 3FTXA 3VLDA 4QQIA 3Q9NC 3FWVA 2FBNA 4U7EB 5G05J 3FTWA 5BV1A 1LD7A 4U0UA 3DEOA 2VTBA 1DVPA 1UW4B 5AN8A 3CK9A 3ASNE 3FUHA 4BETA 4CT0A 1E8ZA 2ETAA 4E85A 3D3MA 3RO2A 3FUMA 2XEVA 1S0PA 3QDNA 2J8SD 4CDRA 4UWGA 3UMVA 3ZHEA 1NFIE 3GZ1A 2AXVA 3C3OA 3SHFA 1QBQA 2IFUA 2XEHA 4HOUA 4XKCA 4HLEA 5LFAA 2XENA 3D9LA 4G11A 2L9BA 3KAEA 3TWVA 4PH4B 4G26A 3S7DA 1Y6IA 3MYVA 4FA6A 2MRIA 5CRVA 3GZSA 3E30A 4XEIG 1SVXA 4DI4A 3LS8A 5E75A 4JEUA 4TRQA 3D9OA 3RAUA 4MS6A 3R7QA 3JUEA 3FDHA 5FZSA 4G2VA 2DCPA 2WPVA 4R7LA 4BESA 2QYUA 3KEAA 1HO8A 2XCCA 1A17A 5B3SE 4F1SA 2P9IG 3LJ3A 4KVMA 3V2XA 4WNGA 3Q9UC 1UOHA 3ABLE 3P1UA 4J8EA 3CHOA 1EPUA 3L22A 3EHMA 1IKND 3FH8A 2OEVA 5BV0A 1Q2ZA 3N71A 4O1OA 3QB2A 3I5PA 4MKTA 2DZOA 4U63A 4JC8A 1HXIA 3QNKA 1HU3A 4MBGA 5AQ9A 3D9NA 2I1KA 4K03A 4U8YD 5EYLA 4CZ2D 4JHRA 3PZ4A 3R9MA 3CIAA 4DI3A 2CHZA 4HLLA 4AVXA 3CVNA 3DXKG 2EIME 2KM4A 5ARFA 3TGOA 4O60A 4TXQA 5A23A 4JL0A 2J4BA 1RW2A 2NSZA 3AG1E 4BX9A 3TXNA 4ME2A 3K9IA 4F7AA 3SGHA 1TNYA 2XHEA 3RRNB 4G8LA 3ZYMA 4BY6A 1ZU2A 4WAFA 4G24A 3NZSA 4GTVA 5KNHD 4ILIA 2P9SG 4HI8A 4N2QA 4WNFA 4CCAA 1E8WA 5CBOA 1N54A 4UI9K 3G2SA 3PZDA 1KPSB 5ENNA 4BERA 4ANWA 3V30A 3FU6A 4YNDA 2KATA 4KVOA 4L7TA 2Y4UA 3GYZA 3ZFWA 2P9PG 3FEXA 2I1JA 4EZJA 2ZGDA 4LSZE 2IU1A 1BU9A 3PE3A 5FJYA 4RG9A 3SF4A 1WY6A 4AY6A 4U96D 3EU5A 2P9LG 2VYIA 5C1DA 2Y3AA 4PS3A 4A3TA 3IHYA 1X81A 1H2VC 1N4RA 2CG2A 5C2YA 5FQ6A 2LO6A 2GW1A 3EHQA 3DSSA 1IHBA 4LNGA 4UWLA 4PDXA 2M63A 3KSLA 2AXUA 4QFVA 3APFA 3DSWA 4PUCA 3FH5A 5CEAA 1E90A 2EINE 4GPMA 4WNEA 2E0IA 3PEUB 4JZYA 4KXKB 3V31A 3QWVA 5E76A 3DXMG 3UM2A 1OY3D 2P2CP 4U8VD 3WXXA 1BD8A 4EPZA 3ZW3A 3B95A 2HM8A 1TNOA 3G2WA 1EF1C 3PUJA 3EHRA 5BXUA 4WUYA 2DYRE 3PH0C 3ZVVA 2P9NG 2H6IA 3FH7A 4ZFHA 3CHSA 4FJYA 5J08A 3VLFA 4FHKA 3FTVA 5ENRD 2WXKA 4DX7D 1HE8A 4BX8A 1UJJA 3ZXPA 4ATZD 1YYHA 4C0MA 2HYZA 2XGSA 3PE4A 4UQXA 5HQ8A 4CDNA 4DX6D 2RKKA 2WQHA 4JVSA 3F6QA 3E32A 5FINA 1GW6A 2NXPA 5BUZA 3EJNA 1UN8A 1E7VA 4IN3B 3BG1B 5FZQA 2WXQA 3ULYA 2OVFA 5KJMA 1HG2A 4Q69A 5HKPA 5ENTD 5CMWA 3ASDA 3TG5A 1NA0A 3VTYA 3J5PA 3FUFA 2F0YA 4FJZA 3J5QB 5H7PA 4OAUC 4UWHA 1U2VG 1H2UA 3SD5A 3AU5A 1IYGA 4V3IA 2LNIA 4MLPA 4J8FA 3E37A 1OCCE 1ELWA 3RSEG 4J8DA 4NURA 4MRUA 1MX6A 4IRUA 4BWRA 3Q75A 1IQUA 2CFZA 4RG6A 4I2WA 1HH8A 4ANUA 5JMND 5T3RA 2XPZA 1N0QA 5CBNA 4HS2A 3MKQA 4O1PA 3EHNA 1SZ9A 4I2ZA 3DBSA 2ZIRA 2IOSA 2X6HA 3R7RA 3NB2A 2IY0C 2EILE 3PZ1A 4JA9A 2ZU6B 4DK5A 4H7XA 5A6CA 4GTPA 1FPPA 3UT8A 5ENOD 3L9TA 5AAOA 3PZ2A 1G3NB 2V4HC 3L6AA 3TG4A 3DSVA 2A4ZA 2HE0A 1N4QA 5JJ7A 4N39A 2GRNB 4GCNA 3WG7E 3RRUA 4GTTA 3QAQA 4GYOA 1QYMA 3LPZA 5BW8C 2GROB 3D9IA 3SFYA 4UI9C 2GRQB 1TN7A 1K1AA 1NL4A 2OVBA 4A1GA 3VTXA 4LERA 4DX5D 1MYOA 1KZPA 4N3AA 2X3MA 3LDZA 1DC2A 2J08A 2CFUA 2IF4A 4LNUD 5FTPA 1D8EA 3FU3A 3P2BA 4OVUA 3UXGA 3PZ3A 2PQNA 2X38A 4HRMB 3UM0A 2LSUA 4U04A 3RKVA 3JYSA 2VGXA 1DCEA 3FULA 2H6GA 3JQ0A 4UI9J 4B93B 3UT7A 3MV2B 2YHEA 2WQ7A 4LRZA 3B13A 1KT1A 1SQMA 2F8YA 2PQRA 4ANVA 5DIZA 3UQ3A 4K0RA 3ZU7B 3JUIA 4DJAA 1XGWA 3MA5A 3I3NA 2X6KA 2QY7A 2KZTB 4N5QA 4YVQC 5CCMA 2PL2A 4DRXE 3UIOC 3L13A 5KJLA 1OWOA 5KJNA 3EIJA 4OYSA 1N52A 5LX8A 1PC2A 2F8XK 5HS0A 3B7RL 2AVPA 2LXMA 4AJWA 3HVEB 3AAAC 2UY1A 1S64A 1AP7A 3QC1A 4L9PA 3AG3E 2X6IA 4FLBA 1MZCA 3SQVA 2L0TB 1MX4A 2XRZA 3GZ2A 4E6HA 2L6BA 3FUIA 1DNPA 4J7WA 4KBQA 4XI0A 4K5CA 4NRHB 5KWDA 4XX5A 2GRRB 3ML9A 1N95A 1FVHA 3FUEA 3RJVA 2WXRA 4WNDA 1JCRA 3NAWA 3PS6A 3FTSA 1N9AA 3L17A 3MEKA 2J9QA 5ANLA 4AP2A 3C3RA 5ANRA 2YNQA 3NOCD 3B7UX 5EX3A 1H6PA 2VSNA 3MZLB 2EIKE 3DSXA 5KBAA 3CHRA 3KSQA 1ZB1A 5LCWC 4NIKA 3RIBA 1AWCB 2H6FA 2J09A 2QYJA 1JWGA 3TWWA 2P9KG 1XNFA 3ZGQA 4P29A 2AJAA 3KD7A 3LY9A 3ULEG 3ASFA 3E33A 3HHMA 4I1MA 5EN5D 3PUKA 3VLEA 3ZRHA 2C2LA 4I6GA 1U3CA 1FVFA 3U3WA 1N11A 2OCCE 3HXEA 2IO3C 1FT1A 1NZNA 3CVXA 4N2SA 3CV0A 1NI1A 5G55A 4N3BA 3D9MA 4BT9A 2RG8A 5LCWJ 4OVVA 4WWPA 2X6FA 3UM1A 2BKGA 1UJKA 1OCOE 3SFXA 3ASOE 3ZNGA 4I9EA 3G2VA 1OUVA 3PREA 4GA0A 1RZ4A 5LP0A 4B0ZA 5AQBA 4UWFA 3BG0B 2VQ2A 3B7TA 4C0EA 2KBXA 2XQ0A 2MOWA 4YDEA 4CYMD 4N5CA 5FWQA 2A5UA 4JHKA 2OEWA 3E4BA 2XS8A 3URZA 2WXNA 3CGHA 4TV3A 4J6IA 2ZISA 4LUNU 2WXGA 3PEVB 3FUDA 1HZ4A 2MHKA 4GYWA 5CERB 4APFA 4I17A 1TNUA 2BKKB 3T5XA 3JQ1A 3AS5A 2V0PA 1LD8A 2VTBB 2KCLA 1MQSA 3FU5A 3HG0D 1H19A 4HI9A 5FT9A 3FUJA 4BSXA 2Y69E 4TUMA 5J90A 1N4PA 2ETBA 4RLYA 5HRYA 3ZYQA 1FT2A 3L08A 5AJDA 3T5VA 2VSXE 2QFCA 2VSYA 4ATGA 3AU4A 3EDTB 3IBEA 3ZHEB 3CHPA 4B89A 3UIPC 4EECA 2LAHA 3NQPA 3I4GA 3B7BA 4RQIA 4HRNA 1E7UA 2J07A 2WXFA 1X5BA 2QC9A 3ASGA 2IJGX 4EZKA 5ENQD 1BI8B 5FQ4A 3D9PA 3ZXSA 3FTUA 2R59A 4AV7A 3L82A 4CT4A 1Z5SC 1K1BA 3RK6A 4J8SA 4JHJA 4JW1A 4HQDA 2PNNA 4FLHA 2XGMA 3HXBA 3E34A 3CVPA 3UUXA 1PAQA 5BXOA 1JUQA 5A7DB 4Z68A 3W9FA 4TXRA 1ZBPA 5G04C 1TN6A 4LEUA 4Y6CA 4YDWA 3I4RB 2HO1A 2VGEA 3D9HA 1UG3A 5BNWA 1LF8A 5EKQD 2JLBA 3GW4A 3CVUA 1OWLA 5ENPD 4A55A 3T8KA 5AJLA 2R03A 4GTSA 1E8YA 2XPIA 5JHBA 3UM3A 3X2QE 3FEYA 2GRLA 4HB5A 4GZ5A 1OCZE 2EIJE 5D66A 3Q73A 2LSVA 4H7YA 1Z3XA 2R17C 5EDSA 5G04J 4A3VA 2GRMA 2P58C 1UN9A 3Q5MA 4BTAA 4AEZC 3TL5A 2WXMA 3AG4E 4DUIA 3CKBA 4B8AA 2I2OA 2P9UG 3TWSA 1INZA 1Z3YA 3PDNA 1SW6A 3SFZA 3MKRA 3LXUX 3HYMB 2XZDG 2NYJA 2F37A 3CHMA 1QQEA 3JXIA 3FP3A 3CKCA 3FHEA 1EYHA 4EZLA 3DSUA 4FHJA 4EQFA 4GYYA 4PS7A 4GZ6A 2DBAA 3APDA 3CR3A 4AIFA 1K8KG 1QZ2A 4D10C
chains in the Genus database with same CATH topology
3AG2E 3AG3E 2OCCE 1OCOE 3ABKE 2Y69E 1OCRE 2ZXWE 3ASOE 1V54E 5B1BE 1OCCE 2DYSE 3ASNE 1V55E 5B1AE 2EIME 3ABLE 2EIKE 3WG7E 3X2QE 2EINE 2DYRE 3AG1E 3AG4E 1OCZE 2EIJE 5B3SE 2EILE 3ABME 5IY5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG2 E;  3AG3 E;  2OCC E;  1OCO E;  3ABK E;  2Y69 E;  1OCR E;  2ZXW E;  3ASO E;  1V54 E;  5B1B E;  1OCC E;  2DYS E;  3ASN E;  1V55 E;  5B1A E;  2EIM E;  3ABL E;  2EIK E;  3WG7 E;  3X2Q E;  2EIN E;  2DYR E;  3AG1 E;  3AG4 E;  1OCZ E;  2EIJ E;  5B3S E;  2EIL E;  3ABM E;  5IY5 E; 
#chains in the Genus database with same CATH topology
 1WG0 A;  2EQX A;  4JXT A;  4F53 A;  3SNX A;  4YVO A;  4HVB A;  1OT8 A;  3DPY A;  1HX8 A;  3OAW A;  1O1R A;  3ONK A;  4UQY A;  4HNA D;  4GAA A;  2RFA A;  1TNZ A;  4Q96 A;  4O6F A;  2FO7 A;  2GGF A;  4EBA A;  4XZ4 A;  1NA3 A;  1HFA A;  4BFR A;  2R02 A;  5D0O D;  1SA5 A;  1E8X A;  4AY5 A;  2WM9 A;  2B6C A;  3HXF A;  5EID A;  2R2L A;  2YIN A;  3AG2 E;  4B94 A;  1TN8 A;  4LCT A;  2VJ8 A;  3HRA A;  4BSZ B;  2DYS E;  5CEC B;  2XZT G;  4CGW A;  4ABN A;  2DWZ A;  3DWL G;  4FAD A;  2QZA A;  3BEE A;  2VSO E;  1WDY A;  4KZC A;  5T8I A;  1B89 A;  3UKU G;  3LCA A;  1MHQ A;  4YDO A;  1MX2 A;  2XS1 A;  3ZEF A;  3QWW A;  1YCS B;  5JA4 D;  4URK A;  3G2T A;  5FIO A;  5JJT A;  2DVW A;  3CLJ A;  5EX0 A;  3Q78 A;  4G1T A;  2FI7 A;  2NC9 A;  2V5F A;  4M3O A;  3LEW A;  2DZN A;  2LAI A;  4NQ0 A;  3DST A;  2IQC A;  2WMO A;  3D9K A;  4FC8 A;  4ACK A;  3MJW A;  3JXJ A;  5FZR A;  3MGB A;  3TAX A;  3DPD A;  4M7C A;  4U07 A;  5EIL A;  4ILH B;  2V8S E;  5IY5 E;  3BUA A;  2XRY A;  2GRP B;  3DRA A;  3QKY A;  1PY1 A;  4RVB A;  3C3Q A;  5B1A E;  1WM5 A;  3L16 A;  4GMJ A;  1LTX A;  2WXJ A;  5ITZ F;  5KJK A;  5JJ6 A;  3NZU A;  3ABM E;  3ONL A;  4XKB A;  2WXO A;  5EIB E;  3ESL A;  2BUG A;  2E2E A;  2PZI A;  4I6E A;  4JD2 G;  2OV8 A;  4CEM A;  2FF4 A;  3CHQ A;  4GA2 A;  3ZKJ A;  2R5S A;  3U9W A;  3O48 A;  4U8H A;  3MKQ B;  3Q15 A;  3OXG A;  1OWP A;  4BEP A;  4DX2 A;  1JCQ A;  2Y4T A;  2PM6 A;  1WAO 1;  5D2M C;  2AWI A;  3IHV A;  4HOR A;  2VGY A;  5FQ8 A;  3AS8 A;  4HFG A;  3D9J A;  2WQ6 A;  2WXP A;  1U3D A;  5FQ7 A;  4KZ0 A;  5T4Y A;  4L2Y A;  3LYA A;  4Q94 A;  4I6J A;  3UT4 A;  5D0Q D;  3NOG D;  4IUL A;  4ILG A;  3ZPJ A;  4FUL A;  2CG3 A;  4A1S A;  3LVR E;  4OAV B;  4GTM A;  2KCK A;  4GA1 A;  5BPP A;  4LG6 A;  4WWO A;  1L5J A;  3SY2 A;  4APO A;  3TWU A;  4GZC A;  4UUC A;  2J4D A;  2I9C A;  5AIJ A;  3CK8 A;  3TWT A;  1H6O A;  5JHA A;  2Y1L E;  3BU8 A;  2H6H A;  4A63 B;  1NP7 A;  4I43 A;  2RFM A;  1A5E A;  3UX4 A;  3T9K A;  3ISM C;  3QWP A;  3L54 A;  3NBN B;  3G2U A;  3S7F A;  4JPS A;  4ZHB A;  2AW6 A;  3S7B A;  2VGX B;  2KXP C;  4TUU A;  3CEQ A;  3OXF A;  2ETC A;  2MYO A;  3EUV A;  3R9A B;  3CVL A;  3RO3 A;  4ANX A;  1EDU A;  3W9G A;  1O1T A;  4F1P A;  1TJF A;  3U4T A;  1O1S A;  1MJ0 A;  3SO8 A;  1H6K A;  3FFL A;  2J49 A;  1JPL A;  3B7S A;  4CDM A;  3LKU A;  4BT8 A;  3CST A;  1HG5 A;  3S2A A;  4LNB A;  3TWQ A;  4HXI A;  1P5Q A;  5B1B E;  1JCS A;  2YHC A;  4RSY A;  3CSF A;  5ENS D;  3NF1 A;  2UY1 B;  2BTD A;  2KCV A;  2BED A;  3Q47 B;  2R05 A;  3EU9 A;  2XGO A;  3IKO B;  5DBK A;  5ARG A;  3MV3 B;  3ZN3 A;  2ZGG A;  1VDY A;  1SA4 A;  2OND A;  4GMR A;  1HS6 A;  2FUL A;  4BTB A;  2LXL A;  2RD0 A;  3LJN A;  4C48 B;  4IYP A;  3CQG B;  3OTN A;  4I1O B;  1TYQ G;  2OOE A;  3FUK A;  3QJZ A;  5CMY A;  4J0U A;  1V55 E;  3ZYL A;  5CED B;  1W3B A;  1TR4 A;  4GZD A;  3EIQ C;  5AQ7 A;  4GPK A;  1E96 B;  2DIW A;  2XCB A;  4L1B A;  4KMO A;  3V2O A;  4G25 A;  4U95 D;  1KLX A;  2PM7 A;  3PVL A;  1V54 E;  3ZYK A;  3SZ7 A;  4GZ3 A;  1BPO A;  1D9S A;  3Q7F A;  5KCM A;  3V79 K;  3TWR A;  3QK0 A;  4JEH A;  3TWX A;  3Q7A A;  4HOT A;  1DCQ A;  2IOL A;  2KZT A;  3T8M A;  2JEK A;  3TXM A;  2IO2 C;  2WMN A;  3CVV A;  4EBA G;  2IEJ A;  5BT1 A;  1KZO A;  1TEZ A;  2WXL A;  3RU0 A;  4C9B B;  3CVQ A;  3AS4 A;  3ASH A;  3C98 A;  3HVE A;  2FEZ A;  2CHX A;  4G8K A;  3FU0 A;  4G23 A;  4GB9 A;  4N3C A;  4DLO A;  3ML8 A;  3FTY A;  4UWK A;  4GML A;  2KC7 A;  4ACL A;  2LUH A;  2HR2 A;  3DEP A;  3ESK A;  5CHE E;  2UWJ G;  4CGV A;  4AM9 A;  3LVQ E;  5KNG A;  3Q4A B;  5AYW D;  2WVI A;  2I6H A;  3ENE A;  3UIN C;  1HF8 A;  4B8C B;  2B0O E;  4GU5 A;  2L6J A;  4TXP A;  1H2T C;  4AOF A;  1N4S A;  2V4L A;  1TNB A;  3C5R A;  4GTQ A;  2WB2 A;  1KT0 A;  3PRZ A;  5LOZ A;  5G2N A;  4XE0 A;  4EHM A;  1N0R A;  4XI9 A;  4I9C A;  1IHG A;  4KYO B;  4JB8 P;  1K3Z D;  3ABK E;  2ZXW E;  2CHW A;  4CRW A;  3IEG A;  4DPR A;  2C0M A;  4HBD A;  4HOS A;  3SI5 A;  1H0A A;  1N94 A;  3CK7 A;  2BF0 X;  2V5Q C;  2A5E A;  3O4Z A;  3TJP A;  3APC A;  3MCX A;  3ULQ A;  3QAR A;  1ELK A;  4J8Y A;  1SZA A;  5CCL A;  5CRU A;  1BLX B;  3IV0 A;  1OWM A;  1JWF A;  2WXH A;  3JCK C;  3S7J A;  2JAB A;  1S63 A;  3HDX A;  4GCO A;  5AAR A;  3KEZ A;  4K5B A;  2ILR A;  1YA0 A;  3UKR G;  4K5A B;  2Y0B G;  1BI7 B;  1D8D A;  4DLQ A;  4FU3 A;  4WWN A;  3MX3 A;  1OXJ A;  2FO1 E;  3C72 A;  1FCH A;  3SBT B;  3ZIM A;  3PNT B;  1OCR E;  1ELR A;  5HI7 A;  3UI2 A;  4NAC A;  3FUN A;  3RRM B;  4YDY A;  3ZUV B;  5M72 A;  1QNF A;  4GTO A;  4HOQ A;  3IXE A;  1YMP A;  4AXH A;  3AJI A;  3FY4 A;  3U66 A;  4F3V A;  3HIZ A;  3Q79 A;  3HXC A;  2XEE A;  4DX1 A;  2ION A;  3CVY A;  4UQZ A;  4L2L A;  4U0Z A;  1Y8M A;  4JA7 A;  3SBS A;  2L0I A;  3Q49 B;  1O5M A;  3BQO A;  4FP7 A;  3PNL B;  4F6R D;  1TJC A;  4KT6 B;  3UPV A;  1IQR A;  2XPY A;  3KS2 A;  5EYP F;  3UTM A;  2YQ8 A;  2X6J A;  3OXL A;  4W9R A;  3CQC B;  5G05 C;  5AQA A;  1S70 B;  2AXZ A;  2C0L A;  2Q7F A;  4HRL A;  3HXD A;  1Z6T A;  2WXI A;  4GTR A;  3FTZ A;  3QOU A;  4XIF A;  3U64 A;  5AEN A;  3CVW A;  4L23 A;  4I1A A;  3LY7 A;  4PS8 A;  1OWN A;  4Y6W A;  4U0S A;  4X8Q A;  3LY8 A;  1IXV A;  3FTX A;  3VLD A;  4QQI A;  3Q9N C;  3FWV A;  2FBN A;  4U7E B;  5G05 J;  3FTW A;  5BV1 A;  1LD7 A;  4U0U A;  3DEO A;  2VTB A;  1DVP A;  1UW4 B;  5AN8 A;  3CK9 A;  3ASN E;  3FUH A;  4BET A;  4CT0 A;  1E8Z A;  2ETA A;  4E85 A;  3D3M A;  3RO2 A;  3FUM A;  2XEV A;  1S0P A;  3QDN A;  2J8S D;  4CDR A;  4UWG A;  3UMV A;  3ZHE A;  1NFI E;  3GZ1 A;  2AXV A;  3C3O A;  3SHF A;  1QBQ A;  2IFU A;  2XEH A;  4HOU A;  4XKC A;  4HLE A;  5LFA A;  2XEN A;  3D9L A;  4G11 A;  2L9B A;  3KAE A;  3TWV A;  4PH4 B;  4G26 A;  3S7D A;  1Y6I A;  3MYV A;  4FA6 A;  2MRI A;  5CRV A;  3GZS A;  3E30 A;  4XEI G;  1SVX A;  4DI4 A;  3LS8 A;  5E75 A;  4JEU A;  4TRQ A;  3D9O A;  3RAU A;  4MS6 A;  3R7Q A;  3JUE A;  3FDH A;  5FZS A;  4G2V A;  2DCP A;  2WPV A;  4R7L A;  4BES A;  2QYU A;  3KEA A;  1HO8 A;  2XCC A;  1A17 A;  5B3S E;  4F1S A;  2P9I G;  3LJ3 A;  4KVM A;  3V2X A;  4WNG A;  3Q9U C;  1UOH A;  3ABL E;  3P1U A;  4J8E A;  3CHO A;  1EPU A;  3L22 A;  3EHM A;  1IKN D;  3FH8 A;  2OEV A;  5BV0 A;  1Q2Z A;  3N71 A;  4O1O A;  3QB2 A;  3I5P A;  4MKT A;  2DZO A;  4U63 A;  4JC8 A;  1HXI A;  3QNK A;  1HU3 A;  4MBG A;  5AQ9 A;  3D9N A;  2I1K A;  4K03 A;  4U8Y D;  5EYL A;  4CZ2 D;  4JHR A;  3PZ4 A;  3R9M A;  3CIA A;  4DI3 A;  2CHZ A;  4HLL A;  4AVX A;  3CVN A;  3DXK G;  2EIM E;  2KM4 A;  5ARF A;  3TGO A;  4O60 A;  4TXQ A;  5A23 A;  4JL0 A;  2J4B A;  1RW2 A;  2NSZ A;  3AG1 E;  4BX9 A;  3TXN A;  4ME2 A;  3K9I A;  4F7A A;  3SGH A;  1TNY A;  2XHE A;  3RRN B;  4G8L A;  3ZYM A;  4BY6 A;  1ZU2 A;  4WAF A;  4G24 A;  3NZS A;  4GTV A;  5KNH D;  4ILI A;  2P9S G;  4HI8 A;  4N2Q A;  4WNF A;  4CCA A;  1E8W A;  5CBO A;  1N54 A;  4UI9 K;  3G2S A;  3PZD A;  1KPS B;  5ENN A;  4BER A;  4ANW A;  3V30 A;  3FU6 A;  4YND A;  2KAT A;  4KVO A;  4L7T A;  2Y4U A;  3GYZ A;  3ZFW A;  2P9P G;  3FEX A;  2I1J A;  4EZJ A;  2ZGD A;  4LSZ E;  2IU1 A;  1BU9 A;  3PE3 A;  5FJY A;  4RG9 A;  3SF4 A;  1WY6 A;  4AY6 A;  4U96 D;  3EU5 A;  2P9L G;  2VYI A;  5C1D A;  2Y3A A;  4PS3 A;  4A3T A;  3IHY A;  1X81 A;  1H2V C;  1N4R A;  2CG2 A;  5C2Y A;  5FQ6 A;  2LO6 A;  2GW1 A;  3EHQ A;  3DSS A;  1IHB A;  4LNG A;  4UWL A;  4PDX A;  2M63 A;  3KSL A;  2AXU A;  4QFV A;  3APF A;  3DSW A;  4PUC A;  3FH5 A;  5CEA A;  1E90 A;  2EIN E;  4GPM A;  4WNE A;  2E0I A;  3PEU B;  4JZY A;  4KXK B;  3V31 A;  3QWV A;  5E76 A;  3DXM G;  3UM2 A;  1OY3 D;  2P2C P;  4U8V D;  3WXX A;  1BD8 A;  4EPZ A;  3ZW3 A;  3B95 A;  2HM8 A;  1TNO A;  3G2W A;  1EF1 C;  3PUJ A;  3EHR A;  5BXU A;  4WUY A;  2DYR E;  3PH0 C;  3ZVV A;  2P9N G;  2H6I A;  3FH7 A;  4ZFH A;  3CHS A;  4FJY A;  5J08 A;  3VLF A;  4FHK A;  3FTV A;  5ENR D;  2WXK A;  4DX7 D;  1HE8 A;  4BX8 A;  1UJJ A;  3ZXP A;  4ATZ D;  1YYH A;  4C0M A;  2HYZ A;  2XGS A;  3PE4 A;  4UQX A;  5HQ8 A;  4CDN A;  4DX6 D;  2RKK A;  2WQH A;  4JVS A;  3F6Q A;  3E32 A;  5FIN A;  1GW6 A;  2NXP A;  5BUZ A;  3EJN A;  1UN8 A;  1E7V A;  4IN3 B;  3BG1 B;  5FZQ A;  2WXQ A;  3ULY A;  2OVF A;  5KJM A;  1HG2 A;  4Q69 A;  5HKP A;  5ENT D;  5CMW A;  3ASD A;  3TG5 A;  1NA0 A;  3VTY A;  3J5P A;  3FUF A;  2F0Y A;  4FJZ A;  3J5Q B;  5H7P A;  4OAU C;  4UWH A;  1U2V G;  1H2U A;  3SD5 A;  3AU5 A;  1IYG A;  4V3I A;  2LNI A;  4MLP A;  4J8F A;  3E37 A;  1OCC E;  1ELW A;  3RSE G;  4J8D A;  4NUR A;  4MRU A;  1MX6 A;  4IRU A;  4BWR A;  3Q75 A;  1IQU A;  2CFZ A;  4RG6 A;  4I2W A;  1HH8 A;  4ANU A;  5JMN D;  5T3R A;  2XPZ A;  1N0Q A;  5CBN A;  4HS2 A;  3MKQ A;  4O1P A;  3EHN A;  1SZ9 A;  4I2Z A;  3DBS A;  2ZIR A;  2IOS A;  2X6H A;  3R7R A;  3NB2 A;  2IY0 C;  2EIL E;  3PZ1 A;  4JA9 A;  2ZU6 B;  4DK5 A;  4H7X A;  5A6C A;  4GTP A;  1FPP A;  3UT8 A;  5ENO D;  3L9T A;  5AAO A;  3PZ2 A;  1G3N B;  2V4H C;  3L6A A;  3TG4 A;  3DSV A;  2A4Z A;  2HE0 A;  1N4Q A;  5JJ7 A;  4N39 A;  2GRN B;  4GCN A;  3WG7 E;  3RRU A;  4GTT A;  3QAQ A;  4GYO A;  1QYM A;  3LPZ A;  5BW8 C;  2GRO B;  3D9I A;  3SFY A;  4UI9 C;  2GRQ B;  1TN7 A;  1K1A A;  1NL4 A;  2OVB A;  4A1G A;  3VTX A;  4LER A;  4DX5 D;  1MYO A;  1KZP A;  4N3A A;  2X3M A;  3LDZ A;  1DC2 A;  2J08 A;  2CFU A;  2IF4 A;  4LNU D;  5FTP A;  1D8E A;  3FU3 A;  3P2B A;  4OVU A;  3UXG A;  3PZ3 A;  2PQN A;  2X38 A;  4HRM B;  3UM0 A;  2LSU A;  4U04 A;  3RKV A;  3JYS A;  2VGX A;  1DCE A;  3FUL A;  2H6G A;  3JQ0 A;  4UI9 J;  4B93 B;  3UT7 A;  3MV2 B;  2YHE A;  2WQ7 A;  4LRZ A;  3B13 A;  1KT1 A;  1SQM A;  2F8Y A;  2PQR A;  4ANV A;  5DIZ A;  3UQ3 A;  4K0R A;  3ZU7 B;  3JUI A;  4DJA A;  1XGW A;  3MA5 A;  3I3N A;  2X6K A;  2QY7 A;  2KZT B;  4N5Q A;  4YVQ C;  5CCM A;  2PL2 A;  4DRX E;  3UIO C;  3L13 A;  5KJL A;  1OWO A;  5KJN A;  3EIJ A;  4OYS A;  1N52 A;  5LX8 A;  1PC2 A;  2F8X K;  5HS0 A;  3B7R L;  2AVP A;  2LXM A;  4AJW A;  3HVE B;  3AAA C;  2UY1 A;  1S64 A;  1AP7 A;  3QC1 A;  4L9P A;  3AG3 E;  2X6I A;  4FLB A;  1MZC A;  3SQV A;  2L0T B;  1MX4 A;  2XRZ A;  3GZ2 A;  4E6H A;  2L6B A;  3FUI A;  1DNP A;  4J7W A;  4KBQ A;  4XI0 A;  4K5C A;  4NRH B;  5KWD A;  4XX5 A;  2GRR B;  3ML9 A;  1N95 A;  1FVH A;  3FUE A;  3RJV A;  2WXR A;  4WND A;  1JCR A;  3NAW A;  3PS6 A;  3FTS A;  1N9A A;  3L17 A;  3MEK A;  2J9Q A;  5ANL A;  4AP2 A;  3C3R A;  5ANR A;  2YNQ A;  3NOC D;  3B7U X;  5EX3 A;  1H6P A;  2VSN A;  3MZL B;  2EIK E;  3DSX A;  5KBA A;  3CHR A;  3KSQ A;  1ZB1 A;  5LCW C;  4NIK A;  3RIB A;  1AWC B;  2H6F A;  2J09 A;  2QYJ A;  1JWG A;  3TWW A;  2P9K G;  1XNF A;  3ZGQ A;  4P29 A;  2AJA A;  3KD7 A;  3LY9 A;  3ULE G;  3ASF A;  3E33 A;  3HHM A;  4I1M A;  5EN5 D;  3PUK A;  3VLE A;  3ZRH A;  2C2L A;  4I6G A;  1U3C A;  1FVF A;  3U3W A;  1N11 A;  2OCC E;  3HXE A;  2IO3 C;  1FT1 A;  1NZN A;  3CVX A;  4N2S A;  3CV0 A;  1NI1 A;  5G55 A;  4N3B A;  3D9M A;  4BT9 A;  2RG8 A;  5LCW J;  4OVV A;  4WWP A;  2X6F A;  3UM1 A;  2BKG A;  1UJK A;  1OCO E;  3SFX A;  3ASO E;  3ZNG A;  4I9E A;  3G2V A;  1OUV A;  3PRE A;  4GA0 A;  1RZ4 A;  5LP0 A;  4B0Z A;  5AQB A;  4UWF A;  3BG0 B;  2VQ2 A;  3B7T A;  4C0E A;  2KBX A;  2XQ0 A;  2MOW A;  4YDE A;  4CYM D;  4N5C A;  5FWQ A;  2A5U A;  4JHK A;  2OEW A;  3E4B A;  2XS8 A;  3URZ A;  2WXN A;  3CGH A;  4TV3 A;  4J6I A;  2ZIS A;  4LUN U;  2WXG A;  3PEV B;  3FUD A;  1HZ4 A;  2MHK A;  4GYW A;  5CER B;  4APF A;  4I17 A;  1TNU A;  2BKK B;  3T5X A;  3JQ1 A;  3AS5 A;  2V0P A;  1LD8 A;  2VTB B;  2KCL A;  1MQS A;  3FU5 A;  3HG0 D;  1H19 A;  4HI9 A;  5FT9 A;  3FUJ A;  4BSX A;  2Y69 E;  4TUM A;  5J90 A;  1N4P A;  2ETB A;  4RLY A;  5HRY A;  3ZYQ A;  1FT2 A;  3L08 A;  5AJD A;  3T5V A;  2VSX E;  2QFC A;  2VSY A;  4ATG A;  3AU4 A;  3EDT B;  3IBE A;  3ZHE B;  3CHP A;  4B89 A;  3UIP C;  4EEC A;  2LAH A;  3NQP A;  3I4G A;  3B7B A;  4RQI A;  4HRN A;  1E7U A;  2J07 A;  2WXF A;  1X5B A;  2QC9 A;  3ASG A;  2IJG X;  4EZK A;  5ENQ D;  1BI8 B;  5FQ4 A;  3D9P A;  3ZXS A;  3FTU A;  2R59 A;  4AV7 A;  3L82 A;  4CT4 A;  1Z5S C;  1K1B A;  3RK6 A;  4J8S A;  4JHJ A;  4JW1 A;  4HQD A;  2PNN A;  4FLH A;  2XGM A;  3HXB A;  3E34 A;  3CVP A;  3UUX A;  1PAQ A;  5BXO A;  1JUQ A;  5A7D B;  4Z68 A;  3W9F A;  4TXR A;  1ZBP A;  5G04 C;  1TN6 A;  4LEU A;  4Y6C A;  4YDW A;  3I4R B;  2HO1 A;  2VGE A;  3D9H A;  1UG3 A;  5BNW A;  1LF8 A;  5EKQ D;  2JLB A;  3GW4 A;  3CVU A;  1OWL A;  5ENP D;  4A55 A;  3T8K A;  5AJL A;  2R03 A;  4GTS A;  1E8Y A;  2XPI A;  5JHB A;  3UM3 A;  3X2Q E;  3FEY A;  2GRL A;  4HB5 A;  4GZ5 A;  1OCZ E;  2EIJ E;  5D66 A;  3Q73 A;  2LSV A;  4H7Y A;  1Z3X A;  2R17 C;  5EDS A;  5G04 J;  4A3V A;  2GRM A;  2P58 C;  1UN9 A;  3Q5M A;  4BTA A;  4AEZ C;  3TL5 A;  2WXM A;  3AG4 E;  4DUI A;  3CKB A;  4B8A A;  2I2O A;  2P9U G;  3TWS A;  1INZ A;  1Z3Y A;  3PDN A;  1SW6 A;  3SFZ A;  3MKR A;  3LXU X;  3HYM B;  2XZD G;  2NYJ A;  2F37 A;  3CHM A;  1QQE A;  3JXI A;  3FP3 A;  3CKC A;  3FHE A;  1EYH A;  4EZL A;  3DSU A;  4FHJ A;  4EQF A;  4GYY A;  4PS7 A;  4GZ6 A;  2DBA A;  3APD A;  3CR3 A;  4AIF A;  1K8K G;  1QZ2 A;  4D10 C; 
#chains in the Genus database with same CATH homology
 3AG2 E;  3AG3 E;  2OCC E;  1OCO E;  3ABK E;  2Y69 E;  1OCR E;  2ZXW E;  3ASO E;  1V54 E;  5B1B E;  1OCC E;  2DYS E;  3ASN E;  1V55 E;  5B1A E;  2EIM E;  3ABL E;  2EIK E;  3WG7 E;  3X2Q E;  2EIN E;  2DYR E;  3AG1 E;  3AG4 E;  1OCZ E;  2EIJ E;  5B3S E;  2EIL E;  3ABM E;  5IY5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...