2EILE

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
105
structure length
105
Chain Sequence
b'HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
total genus 43
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eilE00
3AG3E 3ASOE 3ABME 2DYSE 2EIME 3WG7E 2Y69E 3X2QE 2EILE 5IY5E 1OCZE 2OCCE 2EIJE 3ABKE 3ASNE 5B3SE 3ABLE 1OCRE 2DYRE 1V55E 1OCOE 2EINE 3AG4E 2EIKE 2ZXWE 3AG1E 1V54E 1OCCE 5B1AE 3AG2E 5B1BE
chains in the Genus database with same CATH superfamily
4YDEA 1N4PA 2EIME 3JQ0A 3WG7E 5BNWA 4FULA 2OOEA 1WM5A 3BUAA 4L2LA 2AW6A 4CT4A 3TJPA 1WDYA 2AXVA 3ESLA 1QQEA 3IV0A 1H6OA 4NIKA 3EHRA 1E96B 2BUGA 5A23A 2KZTB 1KT1A 3QWWA 3FU3A 3MCXA 1OXJA 4UQZA 4B93B 2B6CA 2FF4A 3PZDA 3FUDA 2C2LA 4O1OA 5T3RA 2LXMA 3FP3A 4LERA 2WM9A 4AIFA 4GPMA 1NA0A 2WB2A 3BG1B 5FT9A 4APOA 5KJKA 3CEQA 2HO1A 2XCBA 4OAUC 4LNBA 3TWUA 2DZOA 3SFYA 4HI9A 4DX1A 2IQCA 3S7BA 5D0OD 1Q2ZA 4G1TA 2QYJA 4NURA 1OY3D 4UUCA 2KC7A 2RG8A 3UIPC 5G04J 4BX8A 3ZUVB 4TV3A 2L6JA 3HIZA 5G55A 1AWCB 2P9NG 2R02A 1JCQA 4JEUA 3ZW3A 2CHXA 2FBNA 3KSQA 4GA1A 2V0PA 3FTSA 2WMNA 3FU6A 4KZCA 4JC8A 3V79K 1OCZE 3RAUA 4U7EB 4G11A 5FZQA 4XE0A 4D10C 1HE8A 4EPZA 3E34A 3B95A 4L1BA 4JPSA 3LY9A 4DK5A 3TWVA 5HRYA 3C98A 4F53A 4MRUA 4AOFA 1D9SA 4F1PA 3JYSA 3DXKG 2WXFA 4KXKB 2WQ6A 4HRMB 2VSNA 3IHYA 1OCCE 3BEEA 4GTQA 3URZA 5KJLA 2Y3AA 5T4YA 3T5XA 4N5CA 4M7CA 3BG0B 4JW1A 5M72A 2V5QC 5AYWD 3RIBA 2MHKA 3FUMA 2QZAA 4GPKA 1DCEA 5AQ9A 1LD7A 2KXPC 4DLQA 3GZSA 4GTMA 4HI8A 1U3DA 5LCWJ 4GYYA 1OUVA 4I9EA 3HHMA 1KLXA 3ASHA 3CLJA 1TJCA 4FHKA 2I1KA 4HLEA 1Z6TA 2QC9A 3QWPA 3AG3E 1FVHA 4JEHA 3FHEA 4ZFHA 1WG0A 3FWVA 3B7RL 3P1UA 3HXBA 2ETBA 2YQ8A 3ABLE 3UINC 4U95D 2VSOE 2WXIA 3UT7A 5ANLA 3DSTA 3MGBA 4L7TA 2BKKB 3O48A 3GW4A 2OEWA 1MX6A 3MZLB 1KZOA 4ANVA 4Q94A 2AXZA 3NF1A 4I9CA 1XGWA 2KCVA 3GZ1A 2MOWA 5CBOA 2ZGGA 3TGOA 5BV1A 3ULEG 1IYGA 4FJYA 3PNTB 3E32A 1E8WA 5AQBA 1E7VA 2E0IA 4B8CB 5FINA 3P2BA 1A17A 3D9LA 1N54A 2WXNA 5G04C 4UWKA 4N3CA 3IEGA 1FCHA 5CERB 3HXDA 4U0ZA 3CK9A 2VGXA 3X2QE 4JXTA 1EYHA 3FTZA 4GCOA 5KBAA 4L9PA 1NZNA 3ULQA 2VQ2A 1JCRA 4CGWA 4KT6B 4N5QA 3MV3B 4IN3B 3QOUA 2NYJA 2KCKA 2PM6A 4GTVA 1IHGA 4DJAA 5CRVA 5BV0A 1MZCA 2LXLA 5ENSD 3FY4A 1H6PA 4CCAA 4EHMA 4AXHA 3MJWA 4CRWA 1L5JA 5KCMA 3T5VA 3D9IA 3QB2A 4O60A 3Q7FA 3E37A 5EX0A 1TEZA 2J49A 1OWMA 3CGHA 3AU5A 1O1SA 4ACKA 4FC8A 2L6BA 4OVVA 2XEHA 1UJKA 2CFZA 3TG5A 3RSEG 5CEDB 2ETCA 3ML9A 3CK8A 3G2SA 3GYZA 3TXMA 3U4TA 2RKKA 2LSUA 3T8KA 1ZU2A 5B1AE 5CBNA 2A5EA 4I1MA 4EECA 2V5FA 4XX5A 3ENEA 2WXPA 3G2WA 4U04A 1MX2A 3SHFA 3LDZA 1D8DA 3C3OA 3SGHA 5EN5D 5G2NA 1E8ZA 5EIDA 4LRZA 4I6GA 3U66A 3TWSA 1N4QA 4XKCA 4RG9A 3SNXA 4KVMA 3LCAA 4W9RA 1SQMA 5C1DA 4U8HA 1BPOA 3LXUX 5DBKA 3FU5A 2QFCA 3NQPA 5EDSA 2CG3A 1YA0A 3HVEA 3G2TA 3FEXA 3D9OA 1S64A 4UWFA 5ENTD 2P58C 1N52A 3AS4A 4Y6CA 5AQ7A 2JLBA 2XEEA 2E2EA 1JUQA 5JJ7A 3C72A 2VGEA 4NRHB 2GGFA 3FUJA 3EIJA 4FLHA 1EDUA 3HXCA 1H19A 3UIOC 5BUZA 3RRNB 3HG0D 2IFUA 3JUIA 3OAWA 4N3BA 1BD8A 3PEUB 3ZHEA 3OXGA 4J8SA 4DI3A 4B89A 4JB8P 3D9KA 3Q47B 3HDXA 1K8KG 3Q75A 4ANXA 1TNOA 3ZRHA 1SA4A 2DYRE 3Q9NC 2ZGDA 4OVUA 3PUKA 2EIKE 3DSUA 5FQ8A 2M63A 3PZ2A 1B89A 3FUNA 3LYAA 2Y1LE 5KWDA 4RVBA 1U3CA 4GB9A 5T8IA 5CECB 3CKCA 5FZSA 3RJVA 4RG6A 4WWNA 5KJMA 5AJDA 4X8QA 1Z3XA 4HB5A 4EZKA 4Q96A 3FTUA 1DC2A 4H7XA 3PREA 2HE0A 4AY5A 3L16A 3LEWA 2KZTA 4BEPA 3QAQA 3Q4AB 4LNGA 2Y4UA 3FH5A 1ZBPA 3AAAC 3SD5A 1OT8A 3ZYLA 5CMYA 1Z5SC 4M3OA 5AAOA 2CFUA 1EPUA 2BTDA 4O1PA 2XRZA 3CVWA 2OCCE 2RD0A 3D9HA 1RZ4A 2WXRA 2DIWA 1KPSB 1HF8A 1SA5A 3UX4A 2ZISA 4WWOA 4YDYA 4APFA 2WPVA 4U8VD 1KZPA 4A55A 4U96D 2IEJA 3HVEB 3LVRE 4YNDA 5LFAA 1MHQA 2XPYA 1UOHA 3QWVA 4ANWA 3T8MA 3EU9A 4F7AA 2PNNA 2XGMA 5JA4D 1W3BA 2IJGX 1DNPA 2XRYA 1N11A 4WWPA 2VYIA 4GYWA 2KCLA 3RK6A 3R9MA 3UUXA 3TWQA 1OWPA 3TWXA 4HNAD 5EYLA 5ENRD 1KT0A 3UXGA 4G23A 3KD7A 5FJYA 3SZ7A 2P9UG 2IY0C 4B94A 4G24A 2X6HA 1IQRA 2VTBA 3SY2A 3LKUA 3O4ZA 2QY7A 4UI9C 2L9BA 3K9IA 2H6IA 4E6HA 3EHQA 4DUIA 5G05J 3V31A 2CG2A 3F6QA 3FH7A 3ZYKA 4K5CA 2I6HA 1OCOE 2FEZA 2XZTG 5ITZF 3KS2A 1MQSA 5E75A 1IHBA 4ME2A 4NQ0A 2GRNB 1N4SA 3APFA 5J08A 3DEOA 2YHCA 3SI5A 5BT1A 4ILHB 4URKA 4YDWA 1XNFA 2VSYA 4ACLA 4LNUD 2ETAA 5JJ6A 4C9BB 1IQUA 1OWOA 4KZ0A 3UM3A 4GZCA 1MYOA 4DX5D 3SQVA 2P9LG 2WVIA 1Y6IA 2CHWA 1SW6A 1E90A 4JL0A 3DBSA 3TL5A 4GZ6A 5FQ4A 3KEZA 4GMLA 2EIJE 2WQ7A 4G8LA 1SZAA 3UTMA 4OAVB 1S70B 3KAEA 4RQIA 3AG4E 2LAIA 4C48B 2XGSA 4DRXE 1PY1A 3TWWA 2F0YA 3CSTA 1FVFA 1PC2A 2J4DA 1PAQA 2R5SA 3VTXA 3RKVA 4PS7A 3J5QB 2IOLA 4J8EA 4JHRA 4YVQC 2H6FA 3PEVB 5CCMA 3ZGQA 4HLLA 2PQRA 3B7BA 3CHSA 1UN9A 2Y0BG 4BTBA 2RFMA 3DPYA 3DSWA 5CRUA 4BFRA 1K1BA 3ZYMA 2H6GA 4HORA 1TNYA 4MLPA 1HX8A 1JPLA 2R05A 1HU3A 3J5PA 2PL2A 2VJ8A 4GA0A 3ZKJA 3CQCB 4AJWA 3BQOA 3MKQA 2V4HC 2X6JA 3CVPA 4JZYA 5CMWA 2OEVA 2WXOA 1EF1C 5HQ8A 2IO2C 3PZ4A 4HRNA 3E4BA 5EYPF 3R7QA 4XI0A 1YMPA 3PDNA 4Q69A 3Q49B 2J8SD 2XGOA 1UN8A 3RU0A 2P9SG 2BF0X 2I9CA 3PVLA 3W9FA 3ASDA 2BEDA 3PZ3A 2EILE 5A6CA 4EQFA 5BPPA 3TG4A 4ABNA 3NOGD 5KJNA 4WNFA 3HXEA 2V4LA 3FUHA 3UM2A 4PDXA 1SVXA 4KBQA 4GZDA 4JD2G 1SZ9A 2DVWA 4J8YA 1H2VC 4LEUA 3FEYA 1O1RA 2P9PG 1FPPA 3G2VA 4BWRA 2R17C 5AARA 2J09A 1E8XA 4PS3A 1GW6A 3LS8A 5FIOA 4U0SA 5EILA 3DSSA 4GAAA 1X81A 2H6HA 1QNFA 4F6RD 3S7DA 2F8YA 2P9IG 4J8DA 2F8XK 5ENNA 3ISMC 4ATZD 2XEVA 2LUHA 2LSVA 2GRMA 3PNLB 3UT8A 1H2UA 1QZ2A 3CHRA 4JHJA 3T9KA 2HR2A 4MS6A 5FQ6A 4GTPA 5ENQD 3PE3A 4BX9A 4I1AA 3PRZA 3QKYA 3FTWA 1LTXA 4YDOA 4QFVA 2C0LA 1VDYA 2J9QA 4XZ4A 4JHKA 3VLFA 3CR3A 5G05C 4GMJA 4FLBA 5EKQD 4LSZE 3ASOE 2MYOA 4WNEA 4GU5A 1YYHA 2ZIRA 3AS8A 3UPVA 3D3MA 3EDTB 3D9NA 1BI7B 2XZDG 3UKRG 3V2OA 3CHQA 3JCKC 3ASFA 4BT8A 1TN6A 3EJNA 3FH8A 3L54A 1K1AA 2EINE 1QBQA 4IULA 2IU1A 2ZU6B 4BY6A 4XI9A 3Q5MA 4G8KA 3ABME 3FU0A 3L22A 4P29A 2GROB 2XPIA 2Y69E 3ZN3A 4FP7A 3V30A 2RFAA 1DVPA 3FUEA 3LPZA 4H7YA 4HOSA 1N94A 3ZIMA 3C5RA 5HS0A 2IF4A 4PH4B 4HBDA 1UG3A 3FUFA 3FDHA 3B7SA 3LVQE 4B8AA 2Y4TA 3PZ1A 3MEKA 2ILRA 1Z3YA 4CDNA 3CK7A 3U64A 4IYPA 4ANUA 4A3VA 3IBEA 3AG2E 5J90A 4ILIA 1ELKA 3AS5A 3PE4A 3VLEA 1JCSA 2ONDA 5IY5E 5JMND 5LP0A 5D2MC 3C3QA 5DIZA 1NI1A 4WNGA 3UKUG 3D9PA 1OCRE 4K03A 4I2ZA 1O5MA 2X6KA 3KSLA 4WAFA 2X6FA 5KNGA 3LY8A 1TNUA 3HXFA 4K0RA 5EIBE 4B0ZA 3NBNB 3SBSA 4GZ3A 2PQNA 4BSZB 5AQAA 3KEAA 3OXLA 4GCNA 4J0UA 5CHEE 1WY6A 3ZYQA 2YINA 3AG1E 4QQIA 4CDRA 1AP7A 3L08A 3CQGB 4IRUA 4U63A 5ENPD 2J07A 2NXPA 3HYMB 1U2VG 4AP2A 4HQDA 2L0IA 4O6FA 3UM1A 1IXVA 3IKOB 1ZB1A 4DX6D 3CVXA 3Q73A 1UJJA 3E30A 4ZHBA 4TUUA 3IHVA 4GTSA 3U9WA 1HG2A 3QDNA 2JABA 3ZFWA 5D66A 1TR4A 2C0MA 5KNHD 1OWLA 1YCSB 3NOCD 5ENOD 3Q9UC 5HI7A 5JHBA 4JVSA 4DI4A 1V55E 2BKGA 5FWQA 5C2YA 2XQ0A 4ILGA 1LD8A 4I6EA 4A1SA 3N71A 3ZU7B 3EHMA 4K5AB 3CHPA 2I2OA 3TWRA 4AM9A 3IXEA 2J08A 1K3ZD 1N4RA 1OWNA 3MV2B 1WAO1 3W9GA 1UW4B 4F3VA 1ELRA 3QARA 3UI2A 3Q7AA 1P5QA 4RSYA 4R7LA 3B13A 3S2AA 3PS6A 2WMOA 3APCA 4BERA 2X3MA 4KYOB 5LCWC 4UI9K 3MKRA 3FTXA 4HFGA 4YVOA 3B7TA 4Y6WA 2KBXA 4JA7A 5BW8C 4MKTA 4TXPA 1HXIA 1LF8A 1NL4A 3VLDA 2WXLA 3FTYA 5H7PA 1NFIE 4HS2A 2UY1A 5ANRA 1ELWA 5A7DB 1IKND 1E8YA 4UQYA 4AY6A 3CVNA 3NZSA 1TN7A 4ATGA 4FU3A 1DCQA 4GTTA 4PS8A 4C0MA 3AU4A 2J4BA 4G26A 2WXGA 3NB2A 1O1TA 3ASNE 2FULA 3DWLG 3CKBA 3CHMA 2GW1A 5AENA 3R9AB 2IOSA 3JQ1A 4N2QA 4OYSA 2NC9A 5HKPA 2UY1B 4CT0A 2GRLA 4EZLA 2Q7FA 3LJ3A 3CVUA 2R59A 4XKBA 4HXIA 3S7JA 2AWIA 4MBGA 1A5EA 3R7RA 4BTAA 2OVBA 4UI9J 3CSFA 3I5PA 3L9TA 2OVFA 3Q78A 2V8SE 5LOZA 2P9KG 3NAWA 1BLXB 4J7WA 2CHZA 1TNZA 2X38A 4J8FA 4N2SA 4FADA 1FT1A 4CDMA 2WXJA 3SFXA 4TRQA 2XENA 1TNBA 4UWGA 4GTOA 4HRLA 4AVXA 1N0RA 4E85A 5B1BE 2JEKA 3JUEA 4EZJA 2HM8A 3TAXA 1S0PA 1TYQG 5AN8A 4DX2A 1RW2A 3APDA 3QJZA 1FT2A 3FULA 4LUNU 3EHNA 3OXFA 3S7FA 3I4GA 5B3SE 1JWGA 2P2CP 2YNQA 4NACA 1V54E 3EIQC 2UWJG 4CYMD 4I2WA 3FTVA 1HZ4A 4G25A 3RO3A 4I6JA 2GRPB 3ZEFA 1N95A 5ARFA 3ZNGA 2DZNA 3QK0A 4BETA 4A1GA 2HYZA 4N3AA 4HOQA 4DLOA 1MX4A 1S63A 4CZ2D 3CVYA 4A63B 2WXQA 3C3RA 1Y8MA 1QYMA 3DSXA 4GYOA 3L17A 1TJFA 5AJLA 2XCCA 2PM7A 3MA5A 1G3NB 3CVLA 3VTYA 2EQXA 4DX7D 4I1OB 3ML8A 4HOUA 2F37A 3SF4A 4WNDA 2IONA 2VGXB 3G2UA 4U0UA 3CHOA 3Q15A 2LO6A 2LAHA 2AJAA 3B7UX 3OTNA 4A3TA 4TUMA 2B0OE 3DRAA 1X5BA 5FQ7A 4UWLA 3RRMB 1H2TC 3AJIA 4XEIG 4V3IA 3FFLA 1NP7A 2FO7A 3MKQB 2XHEA 3RRUA 3SO8A 1HFAA 4LG6A 4K5BA 4WUYA 2ZXWE 2QYUA 2WQHA 5FTPA 3UM0A 3CIAA 4L2YA 4GMRA 3ONLA 4TXRA 2VGYA 2X6IA 3DPDA 5D0QD 3UT4A 1HO8A 4EBAA 5BXUA 3HRAA 1D8EA 3QC1A 4N39A 3FUIA 2WXHA 3SFZA 3ZPJA 1BU9A 3ULYA 2FO1E 4LCTA 2GRQB 4FJZA 3UQ3A 3CVVA 1TN8A 3BU8A 1JWFA 3LY7A 4GA2A 4EBAG 4GZ5A 3MX3A 3DEPA 2A4ZA 3ASGA 4CEMA 2IO3C 4TXQA 4AV7A 3TWTA 2XS8A 1H0AA 4XIFA 1H6KA 3L82A 5JHAA 2FI7A 3DXMG 4KVOA 3JXIA 3U3WA 3JXJA 2XPZA 5BXOA 4L23A 3UMVA 2NSZA 5JJTA 2LNIA 2R03A 4UWHA 3ONKA 2XS1A 2A5UA 2AXUA 3I4RB 3ZXSA 2YHEA 3FUKA 3TXNA 3EU5A 5CCLA 3PUJA 2DBAA 2DCPA 4HVBA 2KM4A 3RO2A 4PUCA 2WXMA 3EUVA 1E7UA 4BESA 4BT9A 4HOTA 5LX8A 2KATA 4U8YD 3ESKA 3LJNA 2VSXE 1NA3A 4Z68A 3MYVA 4I17A 3CV0A 4FHJA 3ABKE 4I43A 2R2LA 3I3NA 3PH0C 4FA6A 3V2XA 4G2VA 5FZRA 4KMOA 4RLYA 3ZVVA 2PZIA 2DYSE 3DSVA 4UQXA 3Q79A 2OV8A 4JA9A 1HS6A 5E76A 3SBTB 3E33A 2WXKA 3ZHEB 5ARGA 2MRIA 4F1SA 1MJ0A 3ZXPA 4BSXA 2L0TB 1INZA 2I1JA 3GZ2A 3L6AA 4CGVA 4U07A 4GTRA 3D9MA 2DWZA 5CEAA 2GRRB 1HH8A 2AVPA 1N9AA 2VTBB 3NZUA 4DPRA 1N0QA 1BI8B 3QNKA 5AIJA 3CVQA 3L13A 3D9JA 4AEZC 4C0EA 1HG5A 5EX3A 3WXXA 4J6IA
chains in the Genus database with same CATH topology
3AG3E 3ASOE 3ABME 2DYSE 2EIME 3WG7E 2Y69E 3X2QE 2EILE 5IY5E 1OCZE 2OCCE 2EIJE 3ABKE 3ASNE 5B3SE 3ABLE 1OCRE 2DYRE 1V55E 1OCOE 2EINE 3AG4E 2EIKE 2ZXWE 3AG1E 1V54E 1OCCE 5B1AE 3AG2E 5B1BE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG3 E;  3ASO E;  3ABM E;  2DYS E;  2EIM E;  3WG7 E;  2Y69 E;  3X2Q E;  2EIL E;  5IY5 E;  1OCZ E;  2OCC E;  2EIJ E;  3ABK E;  3ASN E;  5B3S E;  3ABL E;  1OCR E;  2DYR E;  1V55 E;  1OCO E;  2EIN E;  3AG4 E;  2EIK E;  2ZXW E;  3AG1 E;  1V54 E;  1OCC E;  5B1A E;  3AG2 E;  5B1B E; 
#chains in the Genus database with same CATH topology
 4YDE A;  1N4P A;  2EIM E;  3JQ0 A;  3WG7 E;  5BNW A;  4FUL A;  2OOE A;  1WM5 A;  3BUA A;  4L2L A;  2AW6 A;  4CT4 A;  3TJP A;  1WDY A;  2AXV A;  3ESL A;  1QQE A;  3IV0 A;  1H6O A;  4NIK A;  3EHR A;  1E96 B;  2BUG A;  5A23 A;  2KZT B;  1KT1 A;  3QWW A;  3FU3 A;  3MCX A;  1OXJ A;  4UQZ A;  4B93 B;  2B6C A;  2FF4 A;  3PZD A;  3FUD A;  2C2L A;  4O1O A;  5T3R A;  2LXM A;  3FP3 A;  4LER A;  2WM9 A;  4AIF A;  4GPM A;  1NA0 A;  2WB2 A;  3BG1 B;  5FT9 A;  4APO A;  5KJK A;  3CEQ A;  2HO1 A;  2XCB A;  4OAU C;  4LNB A;  3TWU A;  2DZO A;  3SFY A;  4HI9 A;  4DX1 A;  2IQC A;  3S7B A;  5D0O D;  1Q2Z A;  4G1T A;  2QYJ A;  4NUR A;  1OY3 D;  4UUC A;  2KC7 A;  2RG8 A;  3UIP C;  5G04 J;  4BX8 A;  3ZUV B;  4TV3 A;  2L6J A;  3HIZ A;  5G55 A;  1AWC B;  2P9N G;  2R02 A;  1JCQ A;  4JEU A;  3ZW3 A;  2CHX A;  2FBN A;  3KSQ A;  4GA1 A;  2V0P A;  3FTS A;  2WMN A;  3FU6 A;  4KZC A;  4JC8 A;  3V79 K;  1OCZ E;  3RAU A;  4U7E B;  4G11 A;  5FZQ A;  4XE0 A;  4D10 C;  1HE8 A;  4EPZ A;  3E34 A;  3B95 A;  4L1B A;  4JPS A;  3LY9 A;  4DK5 A;  3TWV A;  5HRY A;  3C98 A;  4F53 A;  4MRU A;  4AOF A;  1D9S A;  4F1P A;  3JYS A;  3DXK G;  2WXF A;  4KXK B;  2WQ6 A;  4HRM B;  2VSN A;  3IHY A;  1OCC E;  3BEE A;  4GTQ A;  3URZ A;  5KJL A;  2Y3A A;  5T4Y A;  3T5X A;  4N5C A;  4M7C A;  3BG0 B;  4JW1 A;  5M72 A;  2V5Q C;  5AYW D;  3RIB A;  2MHK A;  3FUM A;  2QZA A;  4GPK A;  1DCE A;  5AQ9 A;  1LD7 A;  2KXP C;  4DLQ A;  3GZS A;  4GTM A;  4HI8 A;  1U3D A;  5LCW J;  4GYY A;  1OUV A;  4I9E A;  3HHM A;  1KLX A;  3ASH A;  3CLJ A;  1TJC A;  4FHK A;  2I1K A;  4HLE A;  1Z6T A;  2QC9 A;  3QWP A;  3AG3 E;  1FVH A;  4JEH A;  3FHE A;  4ZFH A;  1WG0 A;  3FWV A;  3B7R L;  3P1U A;  3HXB A;  2ETB A;  2YQ8 A;  3ABL E;  3UIN C;  4U95 D;  2VSO E;  2WXI A;  3UT7 A;  5ANL A;  3DST A;  3MGB A;  4L7T A;  2BKK B;  3O48 A;  3GW4 A;  2OEW A;  1MX6 A;  3MZL B;  1KZO A;  4ANV A;  4Q94 A;  2AXZ A;  3NF1 A;  4I9C A;  1XGW A;  2KCV A;  3GZ1 A;  2MOW A;  5CBO A;  2ZGG A;  3TGO A;  5BV1 A;  3ULE G;  1IYG A;  4FJY A;  3PNT B;  3E32 A;  1E8W A;  5AQB A;  1E7V A;  2E0I A;  4B8C B;  5FIN A;  3P2B A;  1A17 A;  3D9L A;  1N54 A;  2WXN A;  5G04 C;  4UWK A;  4N3C A;  3IEG A;  1FCH A;  5CER B;  3HXD A;  4U0Z A;  3CK9 A;  2VGX A;  3X2Q E;  4JXT A;  1EYH A;  3FTZ A;  4GCO A;  5KBA A;  4L9P A;  1NZN A;  3ULQ A;  2VQ2 A;  1JCR A;  4CGW A;  4KT6 B;  4N5Q A;  3MV3 B;  4IN3 B;  3QOU A;  2NYJ A;  2KCK A;  2PM6 A;  4GTV A;  1IHG A;  4DJA A;  5CRV A;  5BV0 A;  1MZC A;  2LXL A;  5ENS D;  3FY4 A;  1H6P A;  4CCA A;  4EHM A;  4AXH A;  3MJW A;  4CRW A;  1L5J A;  5KCM A;  3T5V A;  3D9I A;  3QB2 A;  4O60 A;  3Q7F A;  3E37 A;  5EX0 A;  1TEZ A;  2J49 A;  1OWM A;  3CGH A;  3AU5 A;  1O1S A;  4ACK A;  4FC8 A;  2L6B A;  4OVV A;  2XEH A;  1UJK A;  2CFZ A;  3TG5 A;  3RSE G;  5CED B;  2ETC A;  3ML9 A;  3CK8 A;  3G2S A;  3GYZ A;  3TXM A;  3U4T A;  2RKK A;  2LSU A;  3T8K A;  1ZU2 A;  5B1A E;  5CBN A;  2A5E A;  4I1M A;  4EEC A;  2V5F A;  4XX5 A;  3ENE A;  2WXP A;  3G2W A;  4U04 A;  1MX2 A;  3SHF A;  3LDZ A;  1D8D A;  3C3O A;  3SGH A;  5EN5 D;  5G2N A;  1E8Z A;  5EID A;  4LRZ A;  4I6G A;  3U66 A;  3TWS A;  1N4Q A;  4XKC A;  4RG9 A;  3SNX A;  4KVM A;  3LCA A;  4W9R A;  1SQM A;  5C1D A;  4U8H A;  1BPO A;  3LXU X;  5DBK A;  3FU5 A;  2QFC A;  3NQP A;  5EDS A;  2CG3 A;  1YA0 A;  3HVE A;  3G2T A;  3FEX A;  3D9O A;  1S64 A;  4UWF A;  5ENT D;  2P58 C;  1N52 A;  3AS4 A;  4Y6C A;  5AQ7 A;  2JLB A;  2XEE A;  2E2E A;  1JUQ A;  5JJ7 A;  3C72 A;  2VGE A;  4NRH B;  2GGF A;  3FUJ A;  3EIJ A;  4FLH A;  1EDU A;  3HXC A;  1H19 A;  3UIO C;  5BUZ A;  3RRN B;  3HG0 D;  2IFU A;  3JUI A;  3OAW A;  4N3B A;  1BD8 A;  3PEU B;  3ZHE A;  3OXG A;  4J8S A;  4DI3 A;  4B89 A;  4JB8 P;  3D9K A;  3Q47 B;  3HDX A;  1K8K G;  3Q75 A;  4ANX A;  1TNO A;  3ZRH A;  1SA4 A;  2DYR E;  3Q9N C;  2ZGD A;  4OVU A;  3PUK A;  2EIK E;  3DSU A;  5FQ8 A;  2M63 A;  3PZ2 A;  1B89 A;  3FUN A;  3LYA A;  2Y1L E;  5KWD A;  4RVB A;  1U3C A;  4GB9 A;  5T8I A;  5CEC B;  3CKC A;  5FZS A;  3RJV A;  4RG6 A;  4WWN A;  5KJM A;  5AJD A;  4X8Q A;  1Z3X A;  4HB5 A;  4EZK A;  4Q96 A;  3FTU A;  1DC2 A;  4H7X A;  3PRE A;  2HE0 A;  4AY5 A;  3L16 A;  3LEW A;  2KZT A;  4BEP A;  3QAQ A;  3Q4A B;  4LNG A;  2Y4U A;  3FH5 A;  1ZBP A;  3AAA C;  3SD5 A;  1OT8 A;  3ZYL A;  5CMY A;  1Z5S C;  4M3O A;  5AAO A;  2CFU A;  1EPU A;  2BTD A;  4O1P A;  2XRZ A;  3CVW A;  2OCC E;  2RD0 A;  3D9H A;  1RZ4 A;  2WXR A;  2DIW A;  1KPS B;  1HF8 A;  1SA5 A;  3UX4 A;  2ZIS A;  4WWO A;  4YDY A;  4APF A;  2WPV A;  4U8V D;  1KZP A;  4A55 A;  4U96 D;  2IEJ A;  3HVE B;  3LVR E;  4YND A;  5LFA A;  1MHQ A;  2XPY A;  1UOH A;  3QWV A;  4ANW A;  3T8M A;  3EU9 A;  4F7A A;  2PNN A;  2XGM A;  5JA4 D;  1W3B A;  2IJG X;  1DNP A;  2XRY A;  1N11 A;  4WWP A;  2VYI A;  4GYW A;  2KCL A;  3RK6 A;  3R9M A;  3UUX A;  3TWQ A;  1OWP A;  3TWX A;  4HNA D;  5EYL A;  5ENR D;  1KT0 A;  3UXG A;  4G23 A;  3KD7 A;  5FJY A;  3SZ7 A;  2P9U G;  2IY0 C;  4B94 A;  4G24 A;  2X6H A;  1IQR A;  2VTB A;  3SY2 A;  3LKU A;  3O4Z A;  2QY7 A;  4UI9 C;  2L9B A;  3K9I A;  2H6I A;  4E6H A;  3EHQ A;  4DUI A;  5G05 J;  3V31 A;  2CG2 A;  3F6Q A;  3FH7 A;  3ZYK A;  4K5C A;  2I6H A;  1OCO E;  2FEZ A;  2XZT G;  5ITZ F;  3KS2 A;  1MQS A;  5E75 A;  1IHB A;  4ME2 A;  4NQ0 A;  2GRN B;  1N4S A;  3APF A;  5J08 A;  3DEO A;  2YHC A;  3SI5 A;  5BT1 A;  4ILH B;  4URK A;  4YDW A;  1XNF A;  2VSY A;  4ACL A;  4LNU D;  2ETA A;  5JJ6 A;  4C9B B;  1IQU A;  1OWO A;  4KZ0 A;  3UM3 A;  4GZC A;  1MYO A;  4DX5 D;  3SQV A;  2P9L G;  2WVI A;  1Y6I A;  2CHW A;  1SW6 A;  1E90 A;  4JL0 A;  3DBS A;  3TL5 A;  4GZ6 A;  5FQ4 A;  3KEZ A;  4GML A;  2EIJ E;  2WQ7 A;  4G8L A;  1SZA A;  3UTM A;  4OAV B;  1S70 B;  3KAE A;  4RQI A;  3AG4 E;  2LAI A;  4C48 B;  2XGS A;  4DRX E;  1PY1 A;  3TWW A;  2F0Y A;  3CST A;  1FVF A;  1PC2 A;  2J4D A;  1PAQ A;  2R5S A;  3VTX A;  3RKV A;  4PS7 A;  3J5Q B;  2IOL A;  4J8E A;  4JHR A;  4YVQ C;  2H6F A;  3PEV B;  5CCM A;  3ZGQ A;  4HLL A;  2PQR A;  3B7B A;  3CHS A;  1UN9 A;  2Y0B G;  4BTB A;  2RFM A;  3DPY A;  3DSW A;  5CRU A;  4BFR A;  1K1B A;  3ZYM A;  2H6G A;  4HOR A;  1TNY A;  4MLP A;  1HX8 A;  1JPL A;  2R05 A;  1HU3 A;  3J5P A;  2PL2 A;  2VJ8 A;  4GA0 A;  3ZKJ A;  3CQC B;  4AJW A;  3BQO A;  3MKQ A;  2V4H C;  2X6J A;  3CVP A;  4JZY A;  5CMW A;  2OEV A;  2WXO A;  1EF1 C;  5HQ8 A;  2IO2 C;  3PZ4 A;  4HRN A;  3E4B A;  5EYP F;  3R7Q A;  4XI0 A;  1YMP A;  3PDN A;  4Q69 A;  3Q49 B;  2J8S D;  2XGO A;  1UN8 A;  3RU0 A;  2P9S G;  2BF0 X;  2I9C A;  3PVL A;  3W9F A;  3ASD A;  2BED A;  3PZ3 A;  2EIL E;  5A6C A;  4EQF A;  5BPP A;  3TG4 A;  4ABN A;  3NOG D;  5KJN A;  4WNF A;  3HXE A;  2V4L A;  3FUH A;  3UM2 A;  4PDX A;  1SVX A;  4KBQ A;  4GZD A;  4JD2 G;  1SZ9 A;  2DVW A;  4J8Y A;  1H2V C;  4LEU A;  3FEY A;  1O1R A;  2P9P G;  1FPP A;  3G2V A;  4BWR A;  2R17 C;  5AAR A;  2J09 A;  1E8X A;  4PS3 A;  1GW6 A;  3LS8 A;  5FIO A;  4U0S A;  5EIL A;  3DSS A;  4GAA A;  1X81 A;  2H6H A;  1QNF A;  4F6R D;  3S7D A;  2F8Y A;  2P9I G;  4J8D A;  2F8X K;  5ENN A;  3ISM C;  4ATZ D;  2XEV A;  2LUH A;  2LSV A;  2GRM A;  3PNL B;  3UT8 A;  1H2U A;  1QZ2 A;  3CHR A;  4JHJ A;  3T9K A;  2HR2 A;  4MS6 A;  5FQ6 A;  4GTP A;  5ENQ D;  3PE3 A;  4BX9 A;  4I1A A;  3PRZ A;  3QKY A;  3FTW A;  1LTX A;  4YDO A;  4QFV A;  2C0L A;  1VDY A;  2J9Q A;  4XZ4 A;  4JHK A;  3VLF A;  3CR3 A;  5G05 C;  4GMJ A;  4FLB A;  5EKQ D;  4LSZ E;  3ASO E;  2MYO A;  4WNE A;  4GU5 A;  1YYH A;  2ZIR A;  3AS8 A;  3UPV A;  3D3M A;  3EDT B;  3D9N A;  1BI7 B;  2XZD G;  3UKR G;  3V2O A;  3CHQ A;  3JCK C;  3ASF A;  4BT8 A;  1TN6 A;  3EJN A;  3FH8 A;  3L54 A;  1K1A A;  2EIN E;  1QBQ A;  4IUL A;  2IU1 A;  2ZU6 B;  4BY6 A;  4XI9 A;  3Q5M A;  4G8K A;  3ABM E;  3FU0 A;  3L22 A;  4P29 A;  2GRO B;  2XPI A;  2Y69 E;  3ZN3 A;  4FP7 A;  3V30 A;  2RFA A;  1DVP A;  3FUE A;  3LPZ A;  4H7Y A;  4HOS A;  1N94 A;  3ZIM A;  3C5R A;  5HS0 A;  2IF4 A;  4PH4 B;  4HBD A;  1UG3 A;  3FUF A;  3FDH A;  3B7S A;  3LVQ E;  4B8A A;  2Y4T A;  3PZ1 A;  3MEK A;  2ILR A;  1Z3Y A;  4CDN A;  3CK7 A;  3U64 A;  4IYP A;  4ANU A;  4A3V A;  3IBE A;  3AG2 E;  5J90 A;  4ILI A;  1ELK A;  3AS5 A;  3PE4 A;  3VLE A;  1JCS A;  2OND A;  5IY5 E;  5JMN D;  5LP0 A;  5D2M C;  3C3Q A;  5DIZ A;  1NI1 A;  4WNG A;  3UKU G;  3D9P A;  1OCR E;  4K03 A;  4I2Z A;  1O5M A;  2X6K A;  3KSL A;  4WAF A;  2X6F A;  5KNG A;  3LY8 A;  1TNU A;  3HXF A;  4K0R A;  5EIB E;  4B0Z A;  3NBN B;  3SBS A;  4GZ3 A;  2PQN A;  4BSZ B;  5AQA A;  3KEA A;  3OXL A;  4GCN A;  4J0U A;  5CHE E;  1WY6 A;  3ZYQ A;  2YIN A;  3AG1 E;  4QQI A;  4CDR A;  1AP7 A;  3L08 A;  3CQG B;  4IRU A;  4U63 A;  5ENP D;  2J07 A;  2NXP A;  3HYM B;  1U2V G;  4AP2 A;  4HQD A;  2L0I A;  4O6F A;  3UM1 A;  1IXV A;  3IKO B;  1ZB1 A;  4DX6 D;  3CVX A;  3Q73 A;  1UJJ A;  3E30 A;  4ZHB A;  4TUU A;  3IHV A;  4GTS A;  3U9W A;  1HG2 A;  3QDN A;  2JAB A;  3ZFW A;  5D66 A;  1TR4 A;  2C0M A;  5KNH D;  1OWL A;  1YCS B;  3NOC D;  5ENO D;  3Q9U C;  5HI7 A;  5JHB A;  4JVS A;  4DI4 A;  1V55 E;  2BKG A;  5FWQ A;  5C2Y A;  2XQ0 A;  4ILG A;  1LD8 A;  4I6E A;  4A1S A;  3N71 A;  3ZU7 B;  3EHM A;  4K5A B;  3CHP A;  2I2O A;  3TWR A;  4AM9 A;  3IXE A;  2J08 A;  1K3Z D;  1N4R A;  1OWN A;  3MV2 B;  1WAO 1;  3W9G A;  1UW4 B;  4F3V A;  1ELR A;  3QAR A;  3UI2 A;  3Q7A A;  1P5Q A;  4RSY A;  4R7L A;  3B13 A;  3S2A A;  3PS6 A;  2WMO A;  3APC A;  4BER A;  2X3M A;  4KYO B;  5LCW C;  4UI9 K;  3MKR A;  3FTX A;  4HFG A;  4YVO A;  3B7T A;  4Y6W A;  2KBX A;  4JA7 A;  5BW8 C;  4MKT A;  4TXP A;  1HXI A;  1LF8 A;  1NL4 A;  3VLD A;  2WXL A;  3FTY A;  5H7P A;  1NFI E;  4HS2 A;  2UY1 A;  5ANR A;  1ELW A;  5A7D B;  1IKN D;  1E8Y A;  4UQY A;  4AY6 A;  3CVN A;  3NZS A;  1TN7 A;  4ATG A;  4FU3 A;  1DCQ A;  4GTT A;  4PS8 A;  4C0M A;  3AU4 A;  2J4B A;  4G26 A;  2WXG A;  3NB2 A;  1O1T A;  3ASN E;  2FUL A;  3DWL G;  3CKB A;  3CHM A;  2GW1 A;  5AEN A;  3R9A B;  2IOS A;  3JQ1 A;  4N2Q A;  4OYS A;  2NC9 A;  5HKP A;  2UY1 B;  4CT0 A;  2GRL A;  4EZL A;  2Q7F A;  3LJ3 A;  3CVU A;  2R59 A;  4XKB A;  4HXI A;  3S7J A;  2AWI A;  4MBG A;  1A5E A;  3R7R A;  4BTA A;  2OVB A;  4UI9 J;  3CSF A;  3I5P A;  3L9T A;  2OVF A;  3Q78 A;  2V8S E;  5LOZ A;  2P9K G;  3NAW A;  1BLX B;  4J7W A;  2CHZ A;  1TNZ A;  2X38 A;  4J8F A;  4N2S A;  4FAD A;  1FT1 A;  4CDM A;  2WXJ A;  3SFX A;  4TRQ A;  2XEN A;  1TNB A;  4UWG A;  4GTO A;  4HRL A;  4AVX A;  1N0R A;  4E85 A;  5B1B E;  2JEK A;  3JUE A;  4EZJ A;  2HM8 A;  3TAX A;  1S0P A;  1TYQ G;  5AN8 A;  4DX2 A;  1RW2 A;  3APD A;  3QJZ A;  1FT2 A;  3FUL A;  4LUN U;  3EHN A;  3OXF A;  3S7F A;  3I4G A;  5B3S E;  1JWG A;  2P2C P;  2YNQ A;  4NAC A;  1V54 E;  3EIQ C;  2UWJ G;  4CYM D;  4I2W A;  3FTV A;  1HZ4 A;  4G25 A;  3RO3 A;  4I6J A;  2GRP B;  3ZEF A;  1N95 A;  5ARF A;  3ZNG A;  2DZN A;  3QK0 A;  4BET A;  4A1G A;  2HYZ A;  4N3A A;  4HOQ A;  4DLO A;  1MX4 A;  1S63 A;  4CZ2 D;  3CVY A;  4A63 B;  2WXQ A;  3C3R A;  1Y8M A;  1QYM A;  3DSX A;  4GYO A;  3L17 A;  1TJF A;  5AJL A;  2XCC A;  2PM7 A;  3MA5 A;  1G3N B;  3CVL A;  3VTY A;  2EQX A;  4DX7 D;  4I1O B;  3ML8 A;  4HOU A;  2F37 A;  3SF4 A;  4WND A;  2ION A;  2VGX B;  3G2U A;  4U0U A;  3CHO A;  3Q15 A;  2LO6 A;  2LAH A;  2AJA A;  3B7U X;  3OTN A;  4A3T A;  4TUM A;  2B0O E;  3DRA A;  1X5B A;  5FQ7 A;  4UWL A;  3RRM B;  1H2T C;  3AJI A;  4XEI G;  4V3I A;  3FFL A;  1NP7 A;  2FO7 A;  3MKQ B;  2XHE A;  3RRU A;  3SO8 A;  1HFA A;  4LG6 A;  4K5B A;  4WUY A;  2ZXW E;  2QYU A;  2WQH A;  5FTP A;  3UM0 A;  3CIA A;  4L2Y A;  4GMR A;  3ONL A;  4TXR A;  2VGY A;  2X6I A;  3DPD A;  5D0Q D;  3UT4 A;  1HO8 A;  4EBA A;  5BXU A;  3HRA A;  1D8E A;  3QC1 A;  4N39 A;  3FUI A;  2WXH A;  3SFZ A;  3ZPJ A;  1BU9 A;  3ULY A;  2FO1 E;  4LCT A;  2GRQ B;  4FJZ A;  3UQ3 A;  3CVV A;  1TN8 A;  3BU8 A;  1JWF A;  3LY7 A;  4GA2 A;  4EBA G;  4GZ5 A;  3MX3 A;  3DEP A;  2A4Z A;  3ASG A;  4CEM A;  2IO3 C;  4TXQ A;  4AV7 A;  3TWT A;  2XS8 A;  1H0A A;  4XIF A;  1H6K A;  3L82 A;  5JHA A;  2FI7 A;  3DXM G;  4KVO A;  3JXI A;  3U3W A;  3JXJ A;  2XPZ A;  5BXO A;  4L23 A;  3UMV A;  2NSZ A;  5JJT A;  2LNI A;  2R03 A;  4UWH A;  3ONK A;  2XS1 A;  2A5U A;  2AXU A;  3I4R B;  3ZXS A;  2YHE A;  3FUK A;  3TXN A;  3EU5 A;  5CCL A;  3PUJ A;  2DBA A;  2DCP A;  4HVB A;  2KM4 A;  3RO2 A;  4PUC A;  2WXM A;  3EUV A;  1E7U A;  4BES A;  4BT9 A;  4HOT A;  5LX8 A;  2KAT A;  4U8Y D;  3ESK A;  3LJN A;  2VSX E;  1NA3 A;  4Z68 A;  3MYV A;  4I17 A;  3CV0 A;  4FHJ A;  3ABK E;  4I43 A;  2R2L A;  3I3N A;  3PH0 C;  4FA6 A;  3V2X A;  4G2V A;  5FZR A;  4KMO A;  4RLY A;  3ZVV A;  2PZI A;  2DYS E;  3DSV A;  4UQX A;  3Q79 A;  2OV8 A;  4JA9 A;  1HS6 A;  5E76 A;  3SBT B;  3E33 A;  2WXK A;  3ZHE B;  5ARG A;  2MRI A;  4F1S A;  1MJ0 A;  3ZXP A;  4BSX A;  2L0T B;  1INZ A;  2I1J A;  3GZ2 A;  3L6A A;  4CGV A;  4U07 A;  4GTR A;  3D9M A;  2DWZ A;  5CEA A;  2GRR B;  1HH8 A;  2AVP A;  1N9A A;  2VTB B;  3NZU A;  4DPR A;  1N0Q A;  1BI8 B;  3QNK A;  5AIJ A;  3CVQ A;  3L13 A;  3D9J A;  4AEZ C;  4C0E A;  1HG5 A;  5EX3 A;  3WXX A;  4J6I A; 
#chains in the Genus database with same CATH homology
 3AG3 E;  3ASO E;  3ABM E;  2DYS E;  2EIM E;  3WG7 E;  2Y69 E;  3X2Q E;  2EIL E;  5IY5 E;  1OCZ E;  2OCC E;  2EIJ E;  3ABK E;  3ASN E;  5B3S E;  3ABL E;  1OCR E;  2DYR E;  1V55 E;  1OCO E;  2EIN E;  3AG4 E;  2EIK E;  2ZXW E;  3AG1 E;  1V54 E;  1OCC E;  5B1A E;  3AG2 E;  5B1B E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...