2M63A

The protease-resistant n-terminal domain of tir-domain containing adaptor molecule-1, ticam-1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
157
Chain Sequence
HMACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TIR domain-containing adapter molecule 1
publication title The N-terminal domain of TIR domain-containing adaptor molecule-1, TICAM-1
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17798 TRIF-NTD TRIF N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.780 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2m63A00
2M63A 4C0MA 4BSXA
chains in the Genus database with same CATH superfamily
4GPMA 3CHMA 2KXPC 4V3IA 2B6CA 3BG0B 1HXIA 2X6KA 4FJYA 5EN5D 3ZW3A 4N5QA 2C2LA 1NL4A 4DX1A 3ZNGA 3TG4A 2GGFA 2IQCA 3Q7FA 2H6GA 4C48B 4J7WA 3G2VA 1SVXA 2KZTB 3ZGQA 1JUQA 2WXLA 5AIJA 4OVUA 4F53A 3CKBA 4I6EA 2WQ6A 3QKYA 3DSTA 2ZGGA 5KBAA 4DPRA 4K5BA 3D9MA 3ASGA 5B3SE 2VGEA 1JPLA 4J8DA 3R7RA 2VJ8A 4GMRA 2WM9A 3GYZA 1ZBPA 4IRUA 4CDNA 3UI2A 1TNUA 1P5QA 3TWXA 1O1RA 3IEGA 3URZA 4GZ5A 4BESA 4CGWA 4JA9A 2OV8A 2WXRA 4B8CB 2R59A 3AJIA 2NSZA 2FO1E 4BETA 2FBNA 4U8VD 1WM5A 3JXJA 4I6GA 2WQ7A 2XENA 4U0ZA 5CRUA 3E34A 2XPIA 3IXEA 3ZHEA 3Q5MA 3QWPA 4GTTA 3NOGD 2YQ8A 4K5CA 4BTAA 4G1TA 3ZIMA 5G2NA 2BKGA 4NURA 3SBTB 3BEEA 3SFYA 2Y4UA 5ANRA 4BEPA 4HB5A 3FU0A 5AENA 5FTPA 3X2QE 2L6JA 4AJWA 4HOQA 4BT9A 4HS2A 3HXEA 4OAUC 1H6OA 4C9BB 3FY4A 3SNXA 5D0OD 4TRQA 3IBEA 4GU5A 4Y6WA 1TR4A 2HM8A 4DX2A 2XGOA 4H7XA 3QWWA 4O60A 4GA1A 3D9IA 5M72A 2QYUA 2IJGX 5FIOA 3FTXA 3TWWA 1PAQA 5CRVA 4GYWA 2OVFA 5DIZA 3L16A 3DEOA 3B7TA 2IY0C 4EBAA 4HOSA 3C3OA 1UOHA 3KSLA 4APFA 3U64A 4CEMA 1NP7A 1E7VA 5JHAA 4LSZE 1MJ0A 5FZRA 4AY6A 1JWGA 4AEZC 2RFMA 4GPKA 3PUJA 4NIKA 3S7FA 5AQBA 3AS8A 4RSYA 2IEJA 1OWOA 1LF8A 1HU3A 2V4HC 3QB2A 3U9WA 3D9NA 4U8HA 3APCA 4N3CA 1INZA 1JCQA 4MS6A 1HG5A 3L13A 4U0UA 1MQSA 2ONDA 3FU6A 1Z3XA 3UUXA 4JZYA 2XCCA 5HS0A 1DNPA 3LJNA 1MHQA 3E32A 1UW4B 4GTPA 4YVQC 1EDUA 2GRNB 2CG3A 1N0QA 3EU9A 4B94A 1H6KA 1VDYA 2B0OE 3RU0A 3FTVA 2I9CA 3ZFWA 3UKRG 5A23A 3TAXA 3ESKA 3T8MA 4GZCA 5AN8A 3UINC 2EILE 4ILGA 4FC8A 1E8ZA 5AJLA 4PUCA 1E90A 5A7DB 3RRUA 3B7BA 4K5AB 3MEKA 1LD8A 3MV3B 3RJVA 4HNAD 1HS6A 4JVSA 4UQYA 4YDOA 2F37A 4I1OB 4JPSA 4A1GA 5KJKA 3SD5A 3CVUA 5ENQD 3MKRA 3CVLA 3C72A 4KYOB 2CHWA 1IHGA 3PNTB 4HI9A 3LY9A 4CT0A 2XCBA 1NA0A 1DC2A 5EX3A 4L7TA 4GZDA 1JWFA 4LERA 1MX2A 4GTQA 3ZXSA 1N52A 4FP7A 4R7LA 4U95D 3DSSA 1YMPA 4APOA 4FHKA 3RO2A 4Y6CA 1H2TC 3CVYA 3NOCD 4GZ6A 4CT4A 5T4YA 2FULA 2AXZA 3RIBA 4IN3B 3O4ZA 3ASHA 4GA0A 5LP0A 5JJ6A 4BERA 2P9SG 3DSVA 3EHRA 2KCKA 1ELRA 1HF8A 3FUIA 3ULYA 1A17A 5EIBE 4CGVA 2VSYA 2HE0A 2AW6A 4O1PA 3C3RA 4XE0A 2P9NG 1O1SA 4M7CA 3BG1B 4O1OA 3S7JA 3SI5A 4AY5A 2JABA 4LG6A 2R03A 3PUKA 3ENEA 4KZCA 5KJNA 1KZOA 3T5XA 4MKTA 4GTVA 1JCSA 3AG4E 4I1MA 3HXCA 4XEIG 3TJPA 2RD0A 1TN7A 3ZYKA 4XKBA 5CCMA 2DBAA 4ABNA 1V55E 2WXFA 3FHEA 4B89A 2XGMA 2BEDA 3VTXA 3DXKG 5CEAA 4NACA 4JL0A 3L22A 5BXOA 5KJMA 2XEVA 2XRZA 2PZIA 3FDHA 4LRZA 3CQGB 3Q49B 3EHMA 2LAIA 2LO6A 3IHYA 3FUNA 4P29A 3UIPC 2KBXA 1E8YA 4CCAA 3PVLA 5DBKA 2E0IA 4JD2G 5FJYA 4WWOA 3B7UX 3QJZA 4UI9K 4HRLA 4HI8A 3PEUB 2ETAA 4JXTA 4QQIA 3LPZA 1IHBA 3CIAA 3D3MA 1HZ4A 3FEYA 3U4TA 3SFXA 3E4BA 5FZSA 3ZPJA 2WXGA 4KMOA 1Y6IA 2GROB 3FTUA 5AQ7A 4A63B 2LAHA 2NXPA 2ZISA 4HQDA 1TJFA 3ZRHA 3DXMG 2CG2A 3ESLA 4GTSA 3WXXA 5BT1A 4PS7A 4XKCA 3R7QA 3Q75A 3KD7A 4AM9A 4KT6B 3FUHA 1WAO1 4EZJA 4OYSA 2XPYA 2BUGA 4YVOA 3TWSA 3O48A 5AARA 1E8WA 1YA0A 2P9PG 5ENPD 5ARGA 5JMND 2L9BA 3N71A 4XIFA 3LVQE 3V79K 4F7AA 2YINA 2HO1A 3LY8A 3MKQA 4OVVA 2PM7A 2J07A 2LSUA 5FWQA 3RSEG 2EINE 3EIJA 5ARFA 5EDSA 1OCRE 3JCKC 2XS1A 5HRYA 3QC1A 3MCXA 4TXRA 3RKVA 4X8QA 3S7DA 5ENSD 1OXJA 1S64A 2H6HA 3PNLB 4AXHA 3OXFA 1G3NB 1MZCA 1EYHA 3G2WA 5LCWC 4W9RA 1KZPA 3LY7A 4FJZA 4I9EA 3Q47B 1N94A 2X6IA 1SZAA 3ZYLA 1S70B 5HKPA 3LVRE 4DX7D 2DWZA 4E6HA 3TG5A 3E30A 4K0RA 1TNZA 4AIFA 1BI8B 2PQNA 3NAWA 3CQCB 3D9HA 3FTYA 4BX9A 1DVPA 1IQUA 3SBSA 4PS3A 2ETCA 2CFZA 3C98A 3G2UA 1Y8MA 4RLYA 4IULA 3C5RA 2R5SA 2WQHA 2V5FA 2WVIA 3EJNA 1OCCE 2X6FA 4PS8A 3HYMB 3J5QB 5AQAA 1OY3D 5E75A 1H2VC 1KLXA 4AV7A 3I4GA 3UM1A 4J8EA 4J0UA 3PRZA 3PZDA 2RFAA 3U3WA 2R02A 4EZLA 2CFUA 1V54E 1OWMA 3PE3A 3AU4A 1GW6A 4DUIA 1FVFA 5G05C 4RG6A 4U0SA 3IKOB 5BV1A 4RQIA 5CCLA 2EIME 1N4RA 4RVBA 3NZUA 5D2MC 5CEDB 2ZXWE 2P9UG 3QAQA 1X81A 4G25A 4J8SA 3PZ3A 3CVVA 1OCOE 3Q9UC 3ISMC 4WNGA 3R9MA 3V31A 1BPOA 5FT9A 3LS8A 2KATA 5KNHD 4EQFA 3QWVA 3L6AA 3D9LA 1FPPA 1N4QA 1HX8A 3V2OA 3V30A 4LCTA 3FU3A 2AVPA 4HLLA 1OWLA 3ABME 5CHEE 3TWVA 3ULQA 4GYYA 2YHCA 2ETBA 2Y69E 3OTNA 3ZVVA 1K3ZD 1UN8A 2A5UA 4KXKB 2Y0BG 4ACKA 2E2EA 1ELWA 3IV0A 3QK0A 3UKUG 2X38A 3LYAA 3UM3A 5LOZA 2X6JA 1D8DA 1DCEA 2KCLA 1KT1A 3TGOA 2Y4TA 2H6FA 3FP3A 2AJAA 3OXGA 1SA4A 3DSXA 3ZN3A 4U7EB 3Q73A 3SHFA 1UJJA 1IQRA 5A6CA 1EF1C 1N95A 2IOLA 4I2WA 3UT7A 1U2VG 5E76A 2VGYA 3ASFA 4UWGA 4UWLA 3D9OA 4HORA 3MGBA 2WXPA 5KCMA 3B7SA 4XI9A 4WWNA 4BY6A 3HDXA 4GYOA 3EHNA 3UXGA 3HIZA 1O1TA 1QYMA 4JHKA 4XI0A 2LXLA 4DI4A 2Q7FA 1KT0A 4ZFHA 3HXBA 3PZ2A 1HO8A 4URKA 2FF4A 3DPYA 4DK5A 3EDTB 2MOWA 1K8KG 2F8XK 4MRUA 1ELKA 3VLEA 1OCZE 3Q15A 3W9GA 3SZ7A 2IO2C 4FU3A 1TNBA 3SY2A 1HG2A 2OEWA 4N5CA 3B95A 3CHOA 4WAFA 2GRQB 2BTDA 3ZYQA 2IF4A 5JHBA 3FH8A 5FQ4A 3PS6A 3SFZA 4EPZA 3MKQB 3CVXA 4G8LA 5FQ8A 4GTOA 1NFIE 3E37A 5FZQA 3L08A 4PH4B 4U63A 2VYIA 4ANXA 3JYSA 3VTYA 2CHXA 4HFGA 4O6FA 5AYWD 3FUFA 5CECB 1S0PA 3UM0A 4F6RD 5BPPA 4G23A 3UIOC 3ZKJA 5KWDA 4J8YA 4GZ3A 2HYZA 3GZ2A 2VTBA 1UJKA 3UPVA 5EYPF 1H19A 3VLDA 3ZXPA 5BW8C 4M3OA 2WXQA 2LNIA 1WY6A 2DVWA 1SA5A 3ULEG 3FWVA 3PZ1A 4HBDA 3RO3A 2UY1B 2WXJA 3ZEFA 2HR2A 4D10C 2EIKE 2VSNA 3HVEB 2CHZA 2BKKB 2YHEA 2DZOA 3NBNB 2OEVA 3QNKA 2WXIA 3FH7A 3Q9NC 4J6IA 3RRNB 2Y1LE 2M63A 4WUYA 4UWKA 3K9IA 5ENOD 2P9KG 5LCWJ 2EQXA 5LX8A 2XEHA 3UT8A 3OAWA 4N2SA 3B13A 2GRPB 4BWRA 5HI7A 4JEHA 3HXDA 4L2YA 5EX0A 1H2UA 5J08A 3FUKA 2EIJE 3S2AA 4L23A 4L1BA 1DCQA 4G24A 3KEAA 5G04J 1IYGA 2IOSA 5JJTA 4BSZB 1JCRA 3P1UA 1KPSB 3BQOA 2MRIA 3DRAA 2H6IA 3DSWA 2VGXA 2WMOA 4B8AA 3SO8A 3TWUA 2I1KA 1FT1A 4OAVB 4J8FA 5C2YA 3W9FA 2XS8A 3T5VA 4L9PA 3FUEA 3OXLA 3EU5A 4YDWA 4I6JA 4CDMA 3UTMA 2QFCA 2IFUA 5BNWA 1N0RA 1K1BA 2DIWA 4UQXA 1O5MA 4K03A 5ENTD 2DZNA 3CV0A 5ENRD 3T8KA 2XPZA 3L9TA 3QDNA 3FEXA 4F1SA 2ZIRA 3CVQA 1HFAA 3AG3E 4GA2A 1SZ9A 1Z6TA 1EPUA 4TUUA 1AP7A 2J49A 5G05J 3ABKE 3MYVA 4LNUD 1SW6A 4U04A 4FA6A 4HRNA 3EIQC 4N2QA 4HXIA 1TJCA 3PZ4A 2WXOA 4Q69A 2C0MA 2XRYA 1ZU2A 2KC7A 4GCOA 2PNNA 3MA5A 2QC9A 4G8KA 4NQ0A 2OCCE 5T3RA 3NF1A 3CVNA 4KZ0A 3PREA 3RK6A 1TNOA 1H6PA 2BF0X 1MX6A 1LTXA 2MHKA 2WXKA 1OT8A 4YNDA 2I6HA 3JQ1A 3ZU7B 4ANUA 2R2LA 2UY1A 3FH5A 3HVEA 4JW1A 4GTMA 5G04C 1U3DA 2ILRA 3MZLB 3RRMB 4Q96A 2V0PA 3APDA 3LXUX 5CMWA 3FTSA 2ZGDA 2X3MA 3U66A 3BUAA 3PDNA 4UWHA 2L6BA 3AG1E 2GRRB 4LNBA 1N54A 1LD7A 2J8SD 3TL5A 2GRMA 1TN8A 5D0QD 1NZNA 3P2BA 1RZ4A 2WB2A 4JEUA 3APFA 3GZ1A 4FULA 3T9KA 4GB9A 3DEPA 1B89A 2P9IG 1XNFA 5IY5E 4I1AA 3PH0C 1TN6A 4UQZA 3CLJA 3FUDA 3S7BA 2JLBA 1WG0A 4AOFA 3KEZA 4CRWA 2OOEA 4HOUA 1HH8A 4UI9J 2XZTG 4DJAA 1N4PA 3B7RL 4KBQA 3Q4AB 4WNDA 3HRAA 1TNYA 1X5BA 2DYSE 4I17A 3NB2A 3CKCA 3CK9A 4HOTA 1BLXB 3D9JA 3MX3A 5AJDA 2I1JA 4GMJA 4ILHB 2QY7A 4KVMA 4HVBA 5CMYA 2GW1A 2J9QA 4B0ZA 1WDYA 1S63A 2A4ZA 4I9CA 2KM4A 3GZSA 4N3BA 4BX8A 3BU8A 1W3BA 3FUJA 2XZDG 5D66A 3L82A 4ACLA 4AVXA 2QZAA 2AXUA 2RG8A 4GCNA 2VTBB 3GW4A 2PQRA 4EHMA 3ML9A 1TYQG 1AWCB 3ZYMA 4BFRA 3NZSA 4FHJA 5KJLA 1YCSB 3CVPA 5AAOA 1QNFA 3DBSA 5CERB 2KZTA 2VSOE 1BI7B 4FLHA 4DLQA 1Z5SC 4XX5A 2IO3C 5KNGA 4UUCA 3JQ0A 3SGHA 4A3TA 2WPVA 2R05A 4PDXA 4DLOA 2L0TB 3JUIA 3TWQA 2J4BA 5EILA 3UT4A 3UQ3A 4A1SA 3NQPA 3EHQA 4UWFA 2PM6A 4CZ2D 4ANWA 1BU9A 4EECA 1TEZA 5EIDA 5B1BE 3VLFA 1PY1A 3AS5A 4WNFA 4CDRA 1N4SA 5ENNA 3KS2A 4I43A 1H0AA 2AXVA 4BT8A 2WXMA 4GMLA 2V5QC 3FFLA 2QYJA 5JJ7A 1BD8A 4XZ4A 1E96B 2VSXE 3I4RB 2JEKA 1L5JA 3DWLG 1YYHA 4UI9C 2IU1A 5AQ9A 1NI1A 3L54A 3ASNE 5EKQD 1QQEA 3KAEA 2VGXB 3HG0D 5FQ7A 5C1DA 5J90A 3EUVA 3IHVA 2KCVA 1OUVA 3PEVB 3TXNA 1HE8A 1U3CA 5G55A 4TXQA 4ZHBA 1UG3A 3FUMA 5JA4D 4I2ZA 2NC9A 3LJ3A 3ABLE 3JUEA 2WXHA 4KVOA 5BV0A 5EYLA 4TXPA 1NA3A 1SQMA 2FI7A 3ONKA 3G2TA 4E85A 3J5PA 2J4DA 3C3QA 2P2CP 4FLBA 2GRLA 2IONA 1Q2ZA 4BSXA 2J08A 4YDYA 4JHRA 4QFVA 4EZKA 3Q78A 4G2VA 4F3VA 1A5EA 3CK7A 4N39A 2RKKA 4U96D 1N9AA 4WNEA 3LDZA 4F1PA 2WXNA 3AAAC 3CK8A 1D9SA 1K1AA 3D9KA 4DRXE 1RW2A 2PL2A 2V8SE 2ZU6B 3CHPA 1UN9A 3FTZA 3ASOE 4ATZD 1QZ2A 4MBGA 3L17A 3CVWA 3AS4A 4ANVA 2P9LG 4JA7A 2DCPA 3FTWA 4JC8A 1N11A 3FULA 4TV3A 5ITZF 1Z3YA 2I2OA 3ASDA 1IXVA 2LXMA 3Q7AA 3Q79A 3E33A 2F8YA 1OWNA 4ME2A 2DYRE 3TWRA 4DX6D 4DI3A 4MLPA 2XHEA 3CHSA 1FVHA 3TWTA 2LUHA 4FADA 4LEUA 2XEEA 4H7YA 4WWPA 5ANLA 4IYPA 3UX4A 1MYOA 3CEQA 4BTBA 4N3AA 4Q94A 3I3NA 1MX4A 2R17C 4TUMA 4B93B 2A5EA 4EBAG 3R9AB 2X6HA 3F6QA 5CBOA 3ONLA 1QBQA 5LFAA 4CYMD 3ZHEB 1PC2A 3MJWA 3SQVA 2NYJA 5B1AE 1E8XA 2UWJG 4LUNU 5BXUA 3FU5A 2P58C 1FT2A 3AU5A 4HLEA 1OWPA 1FCHA 3HHMA 3QOUA 5H7PA 1XGWA 4JB8P 4RG9A 3LCAA 3LKUA 4ILIA 3UM2A 5FQ6A 4A3VA 3PE4A 3AG2E 4YDEA 4U07A 2V4LA 5FINA 3ZUVB 4GTRA 4JHJA 3SF4A 5CBNA 3KSQA 3CSFA 4NRHB 5HQ8A 2C0LA 3CGHA 4Z68A 3RAUA 4G11A 3TXMA 3I5PA 2J09A 3HXFA 4ATGA 4A55A 3CHQA 2LSVA 2OVBA 4HRMB 3D9PA 3DPDA 3WG7E 3ML8A 4LNGA 2AWIA 1E7UA 1ZB1A 3DSUA 2XQ0A 2L0IA 2Y3AA 4U8YD 3V2XA 2WMNA 3CSTA 3LEWA 3G2SA 2FEZA 2FO7A 4C0MA 2XGSA 3CR3A 3CHRA 1IKND 4AP2A 2VQ2A 1D8EA 3MV2B 4C0EA 4G26A 4L2LA 3UMVA 4DX5D 5BUZA 2MYOA 2F0YA 5T8IA 2YNQA 3QARA 3JXIA 4GAAA
chains in the Genus database with same CATH topology
4CRWA 3CHMA 4I1MA 2OOEA 4V3IA 3BG0B 3ZN3A 3TJPA 4HOUA 2RD0A 1HH8A 3ZYKA 1HXIA 4UI9J 4XKBA 2X6KA 4FJYA 4DJAA 5CCMA 2DBAA 3B7RL 4ABNA 3ZW3A 4KBQA 3Q4AB 2C2LA 3SHFA 1UJJA 1IQRA 5A6CA 4WNDA 3TG4A 1EF1C 2IOLA 4I2WA 2GGFA 2IQCA 3UT7A 2WXFA 3FHEA 5E76A 4B89A 1X5BA 2VGYA 2XGMA 3ASFA 4UWGA 3VTXA 4UWLA 3G2VA 3D9OA 4NACA 4HORA 2KZTB 2WXPA 3MGBA 5KCMA 3ZGQA 1JUQA 4I17A 2WXLA 3B7SA 5AIJA 4OVUA 4F53A 3CKBA 4I6EA 4JL0A 4XI9A 4WWNA 3L22A 2WQ6A 5KJMA 2XEVA 3CKCA 3CK9A 2XRZA 4HOTA 3QKYA 3D9JA 2PZIA 4BY6A 3FDHA 3HDXA 3MX3A 4GYOA 3EHNA 3HIZA 5AJDA 4DPRA 4LRZA 3CQGB 2I1JA 3Q49B 4GMJA 4ILHB 4JHKA 3D9MA 3EHMA 4XI0A 4DI4A 2QY7A 2LAIA 2LO6A 4KVMA 4HVBA 5CMYA 3ASGA 2GW1A 3FUNA 3IHYA 4P29A 2J9QA 2Q7FA 4B0ZA 1JPLA 1KT0A 4J8DA 1E8YA 3R7RA 2VJ8A 4CCAA 2A4ZA 2WM9A 3GYZA 3PVLA 1ZBPA 4I9CA 1HO8A 2E0IA 2KM4A 4IRUA 3GZSA 2FF4A 4N3BA 5DBKA 5FJYA 4BX8A 4CDNA 3EDTB 4DK5A 4URKA 2MOWA 1W3BA 4WWOA 3FUJA 3B7UX 4MRUA 3QJZA 1ELKA 4UI9K 4ACLA 1P5QA 3VLEA 4AVXA 3PEUB 3Q15A 3IEGA 2AXUA 2RG8A 3URZA 4GCNA 4GZ5A 3SZ7A 4JXTA 2VTBB 4CGWA 3GW4A 4FU3A 2PQRA 3LPZA 4JA9A 3ML9A 1HG2A 2OV8A 2WXRA 3ZYMA 4B8CB 4N5CA 4BFRA 2R59A 3CHOA 4WAFA 3NZSA 2NSZA 2BTDA 3CIAA 2IF4A 3D3MA 4FHJA 3ZYQA 2FBNA 5JHBA 5KJLA 3CVPA 1WM5A 4I6GA 2WQ7A 1QNFA 1HZ4A 3FEYA 4U0ZA 3U4TA 3DBSA 2KZTA 3FH8A 2XPIA 3E4BA 5FQ4A 2VSOE 3PS6A 5FZSA 2WXGA 3ZHEA 3ZPJA 3SFZA 3Q5MA 4EPZA 4KMOA 1Y6IA 4FLHA 4DLQA 3MKQB 3QWPA 3CVXA 3FTUA 4XX5A 5FQ8A 3SGHA 3JQ0A 4A3TA 2WPVA 2YQ8A 5FZQA 4PDXA 3L08A 4PH4B 4G1TA 2VYIA 4U63A 3ZIMA 4ANXA 4BTAA 4DLOA 3JYSA 2LAHA 5G2NA 3VTYA 2L0TB 2NXPA 3JUIA 2CHXA 4HFGA 4NURA 3SBTB 1TJFA 3ZRHA 3BEEA 4O6FA 5AYWD 3FUFA 2J4BA 1S0PA 2CG2A 3ESLA 2Y4UA 5ANRA 3UT4A 3UQ3A 4A1SA 3WXXA 5BT1A 3NQPA 5BPPA 4PS7A 3FU0A 5AENA 4UWFA 5FTPA 2L6JA 4AJWA 4G23A 2PM6A 4HOQA 4BT9A 4HS2A 4ANWA 4XKCA 3R7QA 4EECA 3KD7A 1TEZA 4AM9A 3VLFA 4GZ3A 2HYZA 4KT6B 1PY1A 3AS5A 4WNFA 3GZ2A 4CDRA 4C9BB 5ENNA 3KS2A 2VTBA 3FUHA 3FY4A 4I43A 3SNXA 1WAO1 4EZJA 1H0AA 4OYSA 2AXVA 5D0OD 2XPYA 1UJKA 2WXMA 4GMLA 4BT8A 3FFLA 3UPVA 2BUGA 4YVOA 4TRQA 3IBEA 3O48A 4GU5A 4Y6WA 1H19A 5JJ7A 1E8WA 4XZ4A 1YA0A 3VLDA 5ARGA 1E96B 5BW8C 2VSXE 3I4RB 2WXQA 4M3OA 2JEKA 1L5JA 2HM8A 2XGOA 2LNIA 1WY6A 2L9BA 4H7XA 4UI9C 3N71A 3QWWA 2IU1A 4XIFA 3LVQE 3L54A 3FWVA 3D9IA 4GA1A 5M72A 3RO3A 4F7AA 5EKQD 2UY1B 2WXJA 2IJGX 2YINA 1QQEA 3ZEFA 2HR2A 3FTXA 2HO1A 3LY8A 3KAEA 3MKQA 4D10C 2VSNA 3HVEB 1PAQA 4OVVA 2CHZA 2VGXB 2PM7A 2YHEA 2J07A 4GYWA 5FQ7A 2LSUA 5C1DA 5FWQA 2OVFA 3IHVA 5J90A 3QNKA 2WXIA 3EIJA 2KCVA 5DIZA 3L16A 5ARFA 1OUVA 3FH7A 3PEVB 3TXNA 5EDSA 3JCKC 4J6IA 1HE8A 3RRNB 1U3CA 5G55A 2M63A 4WUYA 3B7TA 4UWKA 3QC1A 1UG3A 3K9IA 4EBAA 3MCXA 3FUMA 3RKVA 4I2ZA 2NC9A 3S7DA 5LCWJ 3LJ3A 4HOSA 2EQXA 4APFA 5LX8A 3U64A 4CEMA 2WXHA 1NP7A 4KVOA 5BV0A 1E7VA 3PNLB 3UT8A 4AXHA 3OXFA 3OAWA 5JHAA 1NA3A 5FZRA 4N2SA 4AY6A 1JWGA 3B13A 4AEZC 4BWRA 1EYHA 1SQMA 5HI7A 2FI7A 4GPKA 3PUJA 3ONKA 4JEHA 3G2WA 3G2TA 3S7FA 5LCWC 4E85A 3AS8A 4RSYA 4W9RA 3LY7A 2J4DA 4L2YA 1H2UA 5EX0A 5J08A 4FLBA 2GRLA 2IONA 3FUKA 1OWOA 4FJZA 1LF8A 2J08A 4BSXA 4JHRA 4I9EA 1HU3A 3S2AA 3Q47B 2X6IA 4L23A 1SZAA 4L1BA 4QFVA 3QB2A 3U9WA 3D9NA 4U8HA 3ZYLA 4EZKA 4G24A 4G2VA 4F3VA 3APCA 3CK7A 3LVRE 4N3CA 4N39A 5G04J 1INZA 1IYGA 2IOSA 5JJTA 4E6HA 3TG5A 4WNEA 3LDZA 1HG5A 3P1UA 2WXNA 3L13A 4MS6A 4U0UA 4K0RA 1MQSA 2MRIA 3CK8A 2ONDA 3FU6A 2VGXA 4AIFA 1Z3XA 2PQNA 3UUXA 4JZYA 3D9KA 2XCCA 2WMOA 3CQCB 2PL2A 3FTYA 4BX9A 1DVPA 2V8SE 2ZU6B 1IQUA 3CHPA 4B8AA 1DNPA 3SBSA 1MHQA 4PS3A 1UW4B 4YVQC 2I1KA 1UN9A 1EDUA 3FTZA 2CG3A 4J8FA 2CFZA 1QZ2A 4B94A 3L17A 1H6KA 5C2YA 3C98A 3T5VA 3CVWA 3AS4A 4ANVA 4JA7A 3G2UA 2DCPA 3FTWA 1Y8MA 1VDYA 4JC8A 3FUEA 3RU0A 3FULA 3OXLA 3FTVA 4TV3A 2I9CA 3ZFWA 4IULA 5A23A 1Z3YA 2I2OA 3ASDA 2R5SA 3ESKA 4I6JA 3TAXA 4CDMA 2WQHA 3T8MA 4GZCA 2QFCA 2V5FA 2WVIA 3EJNA 1OWNA 2IFUA 4ILGA 2X6FA 4ME2A 4PS8A 5BNWA 4FC8A 3HYMB 2DIWA 1E8ZA 4UQXA 5AJLA 5E75A 4PUCA 1E90A 5A7DB 4K03A 3CV0A 3RRUA 4DI3A 1H2VC 2XPZA 3MEKA 2XHEA 4MLPA 3MV3B 1KLXA 3QDNA 3RJVA 4AV7A 3I4GA 3CHSA 1FVHA 1HS6A 4J8EA 4JVSA 4UQYA 3FEXA 4FADA 4LEUA 4I1OB 4JPSA 4F1SA 4J0UA 3PRZA 3PZDA 4H7YA 3CVQA 4WWPA 5ANLA 1HFAA 4A1GA 5KJKA 3SD5A 3CVUA 4GA2A 1SZ9A 1Z6TA 3U3WA 1EPUA 4TUUA 3MKRA 3CVLA 4IYPA 4EZLA 3UX4A 2J49A 2CFUA 4KYOB 5G05J 3CEQA 3MYVA 4BTBA 4N3AA 1OWMA 4Q94A 3I3NA 2CHWA 1IHGA 3PNTB 2R17C 3AU4A 3PE3A 4U04A 4FA6A 1GW6A 3EIQC 4EBAG 1FVFA 3R9AB 4N2QA 5G05C 4HXIA 4RG6A 1TJCA 4U0SA 2X6HA 2WXOA 3LY9A 2C0MA 4CT0A 4Q69A 3IKOB 5BV1A 2XRYA 2XCBA 1ZU2A 3ONLA 5CCLA 2KC7A 4GCOA 1NA0A 4RVBA 3NZUA 5LFAA 3ZHEB 1PC2A 3MA5A 3MJWA 5EX3A 1E8XA 2UWJG 4LUNU 4L7TA 3FU5A 4NQ0A 2P58C 5T3RA 3AU5A 4HLEA 1OWPA 3NF1A 1FCHA 4GZDA 3HHMA 3QOUA 3QAQA 1XGWA 1JWFA 4LERA 4RG9A 3LCAA 4G25A 3CVNA 3LKUA 4ILIA 4J8SA 4KZ0A 3ZXSA 3PREA 3RK6A 3CVVA 1N52A 4FP7A 5FQ6A 4A3VA 2BF0X 3PE4A 4R7LA 4WNGA 4APOA 4U07A 4FHKA 3RO2A 1BPOA 4Y6CA 2V4LA 5FT9A 4JHJA 3SF4A 3LS8A 2KATA 4EQFA 2MHKA 1H2TC 3CVYA 3CSFA 4NRHB 2WXKA 5HQ8A 4YNDA 2I6HA 3JQ1A 2C0LA 3QWVA 3L6AA 4ANUA 4GZ6A 3D9LA 3CGHA 4CT4A 2UY1A 5T4YA 2FULA 2AXZA 3FH5A 1HX8A 3RIBA 3HVEA 4IN3B 3O4ZA 3ASHA 4GA0A 4G11A 4JW1A 3TXMA 5LP0A 5G04C 1U3DA 5JJ6A 2ILRA 4LCTA 3MZLB 3FU3A 3RRMB 2AVPA 3I5PA 4Q96A 2J09A 4ATGA 4A55A 2V0PA 3APDA 3LXUX 3CHQA 2LSVA 2OVBA 5CMWA 1OWLA 3FTSA 2X3MA 5CHEE 3D9PA 2KCKA 3U66A 1ELRA 3DPDA 3ML8A 3ULQA 2AWIA 1HF8A 3PDNA 4UWHA 3FUIA 1E7UA 4GYYA 2YHCA 1A17A 1N54A 4CGVA 2VSYA 2XQ0A 3OTNA 2L0IA 3TL5A 2GRMA 5D0QD 3ZVVA 2Y3AA 2AW6A 1NZNA 1UN8A 2A5UA 4KXKB 3P2BA 4ACKA 2WMNA 4XE0A 3CSTA 3LEWA 3G2SA 2FEZA 2E2EA 1ELWA 2FO7A 3IV0A 4C0MA 2XGSA 3BG1B 3CR3A 3QK0A 3CHRA 2WB2A 4JEUA 4AP2A 3S7JA 3APFA 3GZ1A 2VQ2A 4FULA 2X38A 3LYAA 3SI5A 4AY5A 3MV2B 2X6JA 5LOZA 4C0EA 4GB9A 1B89A 4G26A 4L2LA 1XNFA 3UMVA 2KCLA 5BUZA 3PUKA 3ENEA 4I1AA 1KT1A 3PH0C 4KZCA 2YNQA 5T8IA 5KJNA 3TGOA 4UQZA 2Y4TA 3CLJA 3FUDA 3S7BA 3FP3A 3T5XA 3QARA 2JLBA 4MKTA 4AOFA 3KEZA 4GAAA 3OXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M63 A;  4C0M A;  4BSX A; 
#chains in the Genus database with same CATH topology
 4GPM A;  3CHM A;  2KXP C;  4V3I A;  2B6C A;  3BG0 B;  1HXI A;  2X6K A;  4FJY A;  5EN5 D;  3ZW3 A;  4N5Q A;  2C2L A;  1NL4 A;  4DX1 A;  3ZNG A;  3TG4 A;  2GGF A;  2IQC A;  3Q7F A;  2H6G A;  4C48 B;  4J7W A;  3G2V A;  1SVX A;  2KZT B;  3ZGQ A;  1JUQ A;  2WXL A;  5AIJ A;  4OVU A;  4F53 A;  3CKB A;  4I6E A;  2WQ6 A;  3QKY A;  3DST A;  2ZGG A;  5KBA A;  4DPR A;  4K5B A;  3D9M A;  3ASG A;  5B3S E;  2VGE A;  1JPL A;  4J8D A;  3R7R A;  2VJ8 A;  4GMR A;  2WM9 A;  3GYZ A;  1ZBP A;  4IRU A;  4CDN A;  3UI2 A;  1TNU A;  1P5Q A;  3TWX A;  1O1R A;  3IEG A;  3URZ A;  4GZ5 A;  4BES A;  4CGW A;  4JA9 A;  2OV8 A;  2WXR A;  4B8C B;  2R59 A;  3AJI A;  2NSZ A;  2FO1 E;  4BET A;  2FBN A;  4U8V D;  1WM5 A;  3JXJ A;  4I6G A;  2WQ7 A;  2XEN A;  4U0Z A;  5CRU A;  3E34 A;  2XPI A;  3IXE A;  3ZHE A;  3Q5M A;  3QWP A;  4GTT A;  3NOG D;  2YQ8 A;  4K5C A;  4BTA A;  4G1T A;  3ZIM A;  5G2N A;  2BKG A;  4NUR A;  3SBT B;  3BEE A;  3SFY A;  2Y4U A;  5ANR A;  4BEP A;  4HB5 A;  3FU0 A;  5AEN A;  5FTP A;  3X2Q E;  2L6J A;  4AJW A;  4HOQ A;  4BT9 A;  4HS2 A;  3HXE A;  4OAU C;  1H6O A;  4C9B B;  3FY4 A;  3SNX A;  5D0O D;  4TRQ A;  3IBE A;  4GU5 A;  4Y6W A;  1TR4 A;  2HM8 A;  4DX2 A;  2XGO A;  4H7X A;  3QWW A;  4O60 A;  4GA1 A;  3D9I A;  5M72 A;  2QYU A;  2IJG X;  5FIO A;  3FTX A;  3TWW A;  1PAQ A;  5CRV A;  4GYW A;  2OVF A;  5DIZ A;  3L16 A;  3DEO A;  3B7T A;  2IY0 C;  4EBA A;  4HOS A;  3C3O A;  1UOH A;  3KSL A;  4APF A;  3U64 A;  4CEM A;  1NP7 A;  1E7V A;  5JHA A;  4LSZ E;  1MJ0 A;  5FZR A;  4AY6 A;  1JWG A;  4AEZ C;  2RFM A;  4GPK A;  3PUJ A;  4NIK A;  3S7F A;  5AQB A;  3AS8 A;  4RSY A;  2IEJ A;  1OWO A;  1LF8 A;  1HU3 A;  2V4H C;  3QB2 A;  3U9W A;  3D9N A;  4U8H A;  3APC A;  4N3C A;  1INZ A;  1JCQ A;  4MS6 A;  1HG5 A;  3L13 A;  4U0U A;  1MQS A;  2OND A;  3FU6 A;  1Z3X A;  3UUX A;  4JZY A;  2XCC A;  5HS0 A;  1DNP A;  3LJN A;  1MHQ A;  3E32 A;  1UW4 B;  4GTP A;  4YVQ C;  1EDU A;  2GRN B;  2CG3 A;  1N0Q A;  3EU9 A;  4B94 A;  1H6K A;  1VDY A;  2B0O E;  3RU0 A;  3FTV A;  2I9C A;  3ZFW A;  3UKR G;  5A23 A;  3TAX A;  3ESK A;  3T8M A;  4GZC A;  5AN8 A;  3UIN C;  2EIL E;  4ILG A;  4FC8 A;  1E8Z A;  5AJL A;  4PUC A;  1E90 A;  5A7D B;  3RRU A;  3B7B A;  4K5A B;  3MEK A;  1LD8 A;  3MV3 B;  3RJV A;  4HNA D;  1HS6 A;  4JVS A;  4UQY A;  4YDO A;  2F37 A;  4I1O B;  4JPS A;  4A1G A;  5KJK A;  3SD5 A;  3CVU A;  5ENQ D;  3MKR A;  3CVL A;  3C72 A;  4KYO B;  2CHW A;  1IHG A;  3PNT B;  4HI9 A;  3LY9 A;  4CT0 A;  2XCB A;  1NA0 A;  1DC2 A;  5EX3 A;  4L7T A;  4GZD A;  1JWF A;  4LER A;  1MX2 A;  4GTQ A;  3ZXS A;  1N52 A;  4FP7 A;  4R7L A;  4U95 D;  3DSS A;  1YMP A;  4APO A;  4FHK A;  3RO2 A;  4Y6C A;  1H2T C;  3CVY A;  3NOC D;  4GZ6 A;  4CT4 A;  5T4Y A;  2FUL A;  2AXZ A;  3RIB A;  4IN3 B;  3O4Z A;  3ASH A;  4GA0 A;  5LP0 A;  5JJ6 A;  4BER A;  2P9S G;  3DSV A;  3EHR A;  2KCK A;  1ELR A;  1HF8 A;  3FUI A;  3ULY A;  1A17 A;  5EIB E;  4CGV A;  2VSY A;  2HE0 A;  2AW6 A;  4O1P A;  3C3R A;  4XE0 A;  2P9N G;  1O1S A;  4M7C A;  3BG1 B;  4O1O A;  3S7J A;  3SI5 A;  4AY5 A;  2JAB A;  4LG6 A;  2R03 A;  3PUK A;  3ENE A;  4KZC A;  5KJN A;  1KZO A;  3T5X A;  4MKT A;  4GTV A;  1JCS A;  3AG4 E;  4I1M A;  3HXC A;  4XEI G;  3TJP A;  2RD0 A;  1TN7 A;  3ZYK A;  4XKB A;  5CCM A;  2DBA A;  4ABN A;  1V55 E;  2WXF A;  3FHE A;  4B89 A;  2XGM A;  2BED A;  3VTX A;  3DXK G;  5CEA A;  4NAC A;  4JL0 A;  3L22 A;  5BXO A;  5KJM A;  2XEV A;  2XRZ A;  2PZI A;  3FDH A;  4LRZ A;  3CQG B;  3Q49 B;  3EHM A;  2LAI A;  2LO6 A;  3IHY A;  3FUN A;  4P29 A;  3UIP C;  2KBX A;  1E8Y A;  4CCA A;  3PVL A;  5DBK A;  2E0I A;  4JD2 G;  5FJY A;  4WWO A;  3B7U X;  3QJZ A;  4UI9 K;  4HRL A;  4HI8 A;  3PEU B;  2ETA A;  4JXT A;  4QQI A;  3LPZ A;  1IHB A;  3CIA A;  3D3M A;  1HZ4 A;  3FEY A;  3U4T A;  3SFX A;  3E4B A;  5FZS A;  3ZPJ A;  2WXG A;  4KMO A;  1Y6I A;  2GRO B;  3FTU A;  5AQ7 A;  4A63 B;  2LAH A;  2NXP A;  2ZIS A;  4HQD A;  1TJF A;  3ZRH A;  3DXM G;  2CG2 A;  3ESL A;  4GTS A;  3WXX A;  5BT1 A;  4PS7 A;  4XKC A;  3R7Q A;  3Q75 A;  3KD7 A;  4AM9 A;  4KT6 B;  3FUH A;  1WAO 1;  4EZJ A;  4OYS A;  2XPY A;  2BUG A;  4YVO A;  3TWS A;  3O48 A;  5AAR A;  1E8W A;  1YA0 A;  2P9P G;  5ENP D;  5ARG A;  5JMN D;  2L9B A;  3N71 A;  4XIF A;  3LVQ E;  3V79 K;  4F7A A;  2YIN A;  2HO1 A;  3LY8 A;  3MKQ A;  4OVV A;  2PM7 A;  2J07 A;  2LSU A;  5FWQ A;  3RSE G;  2EIN E;  3EIJ A;  5ARF A;  5EDS A;  1OCR E;  3JCK C;  2XS1 A;  5HRY A;  3QC1 A;  3MCX A;  4TXR A;  3RKV A;  4X8Q A;  3S7D A;  5ENS D;  1OXJ A;  1S64 A;  2H6H A;  3PNL B;  4AXH A;  3OXF A;  1G3N B;  1MZC A;  1EYH A;  3G2W A;  5LCW C;  4W9R A;  1KZP A;  3LY7 A;  4FJZ A;  4I9E A;  3Q47 B;  1N94 A;  2X6I A;  1SZA A;  3ZYL A;  1S70 B;  5HKP A;  3LVR E;  4DX7 D;  2DWZ A;  4E6H A;  3TG5 A;  3E30 A;  4K0R A;  1TNZ A;  4AIF A;  1BI8 B;  2PQN A;  3NAW A;  3CQC B;  3D9H A;  3FTY A;  4BX9 A;  1DVP A;  1IQU A;  3SBS A;  4PS3 A;  2ETC A;  2CFZ A;  3C98 A;  3G2U A;  1Y8M A;  4RLY A;  4IUL A;  3C5R A;  2R5S A;  2WQH A;  2V5F A;  2WVI A;  3EJN A;  1OCC E;  2X6F A;  4PS8 A;  3HYM B;  3J5Q B;  5AQA A;  1OY3 D;  5E75 A;  1H2V C;  1KLX A;  4AV7 A;  3I4G A;  3UM1 A;  4J8E A;  4J0U A;  3PRZ A;  3PZD A;  2RFA A;  3U3W A;  2R02 A;  4EZL A;  2CFU A;  1V54 E;  1OWM A;  3PE3 A;  3AU4 A;  1GW6 A;  4DUI A;  1FVF A;  5G05 C;  4RG6 A;  4U0S A;  3IKO B;  5BV1 A;  4RQI A;  5CCL A;  2EIM E;  1N4R A;  4RVB A;  3NZU A;  5D2M C;  5CED B;  2ZXW E;  2P9U G;  3QAQ A;  1X81 A;  4G25 A;  4J8S A;  3PZ3 A;  3CVV A;  1OCO E;  3Q9U C;  3ISM C;  4WNG A;  3R9M A;  3V31 A;  1BPO A;  5FT9 A;  3LS8 A;  2KAT A;  5KNH D;  4EQF A;  3QWV A;  3L6A A;  3D9L A;  1FPP A;  1N4Q A;  1HX8 A;  3V2O A;  3V30 A;  4LCT A;  3FU3 A;  2AVP A;  4HLL A;  1OWL A;  3ABM E;  5CHE E;  3TWV A;  3ULQ A;  4GYY A;  2YHC A;  2ETB A;  2Y69 E;  3OTN A;  3ZVV A;  1K3Z D;  1UN8 A;  2A5U A;  4KXK B;  2Y0B G;  4ACK A;  2E2E A;  1ELW A;  3IV0 A;  3QK0 A;  3UKU G;  2X38 A;  3LYA A;  3UM3 A;  5LOZ A;  2X6J A;  1D8D A;  1DCE A;  2KCL A;  1KT1 A;  3TGO A;  2Y4T A;  2H6F A;  3FP3 A;  2AJA A;  3OXG A;  1SA4 A;  3DSX A;  3ZN3 A;  4U7E B;  3Q73 A;  3SHF A;  1UJJ A;  1IQR A;  5A6C A;  1EF1 C;  1N95 A;  2IOL A;  4I2W A;  3UT7 A;  1U2V G;  5E76 A;  2VGY A;  3ASF A;  4UWG A;  4UWL A;  3D9O A;  4HOR A;  3MGB A;  2WXP A;  5KCM A;  3B7S A;  4XI9 A;  4WWN A;  4BY6 A;  3HDX A;  4GYO A;  3EHN A;  3UXG A;  3HIZ A;  1O1T A;  1QYM A;  4JHK A;  4XI0 A;  2LXL A;  4DI4 A;  2Q7F A;  1KT0 A;  4ZFH A;  3HXB A;  3PZ2 A;  1HO8 A;  4URK A;  2FF4 A;  3DPY A;  4DK5 A;  3EDT B;  2MOW A;  1K8K G;  2F8X K;  4MRU A;  1ELK A;  3VLE A;  1OCZ E;  3Q15 A;  3W9G A;  3SZ7 A;  2IO2 C;  4FU3 A;  1TNB A;  3SY2 A;  1HG2 A;  2OEW A;  4N5C A;  3B95 A;  3CHO A;  4WAF A;  2GRQ B;  2BTD A;  3ZYQ A;  2IF4 A;  5JHB A;  3FH8 A;  5FQ4 A;  3PS6 A;  3SFZ A;  4EPZ A;  3MKQ B;  3CVX A;  4G8L A;  5FQ8 A;  4GTO A;  1NFI E;  3E37 A;  5FZQ A;  3L08 A;  4PH4 B;  4U63 A;  2VYI A;  4ANX A;  3JYS A;  3VTY A;  2CHX A;  4HFG A;  4O6F A;  5AYW D;  3FUF A;  5CEC B;  1S0P A;  3UM0 A;  4F6R D;  5BPP A;  4G23 A;  3UIO C;  3ZKJ A;  5KWD A;  4J8Y A;  4GZ3 A;  2HYZ A;  3GZ2 A;  2VTB A;  1UJK A;  3UPV A;  5EYP F;  1H19 A;  3VLD A;  3ZXP A;  5BW8 C;  4M3O A;  2WXQ A;  2LNI A;  1WY6 A;  2DVW A;  1SA5 A;  3ULE G;  3FWV A;  3PZ1 A;  4HBD A;  3RO3 A;  2UY1 B;  2WXJ A;  3ZEF A;  2HR2 A;  4D10 C;  2EIK E;  2VSN A;  3HVE B;  2CHZ A;  2BKK B;  2YHE A;  2DZO A;  3NBN B;  2OEV A;  3QNK A;  2WXI A;  3FH7 A;  3Q9N C;  4J6I A;  3RRN B;  2Y1L E;  2M63 A;  4WUY A;  4UWK A;  3K9I A;  5ENO D;  2P9K G;  5LCW J;  2EQX A;  5LX8 A;  2XEH A;  3UT8 A;  3OAW A;  4N2S A;  3B13 A;  2GRP B;  4BWR A;  5HI7 A;  4JEH A;  3HXD A;  4L2Y A;  5EX0 A;  1H2U A;  5J08 A;  3FUK A;  2EIJ E;  3S2A A;  4L23 A;  4L1B A;  1DCQ A;  4G24 A;  3KEA A;  5G04 J;  1IYG A;  2IOS A;  5JJT A;  4BSZ B;  1JCR A;  3P1U A;  1KPS B;  3BQO A;  2MRI A;  3DRA A;  2H6I A;  3DSW A;  2VGX A;  2WMO A;  4B8A A;  3SO8 A;  3TWU A;  2I1K A;  1FT1 A;  4OAV B;  4J8F A;  5C2Y A;  3W9F A;  2XS8 A;  3T5V A;  4L9P A;  3FUE A;  3OXL A;  3EU5 A;  4YDW A;  4I6J A;  4CDM A;  3UTM A;  2QFC A;  2IFU A;  5BNW A;  1N0R A;  1K1B A;  2DIW A;  4UQX A;  1O5M A;  4K03 A;  5ENT D;  2DZN A;  3CV0 A;  5ENR D;  3T8K A;  2XPZ A;  3L9T A;  3QDN A;  3FEX A;  4F1S A;  2ZIR A;  3CVQ A;  1HFA A;  3AG3 E;  4GA2 A;  1SZ9 A;  1Z6T A;  1EPU A;  4TUU A;  1AP7 A;  2J49 A;  5G05 J;  3ABK E;  3MYV A;  4LNU D;  1SW6 A;  4U04 A;  4FA6 A;  4HRN A;  3EIQ C;  4N2Q A;  4HXI A;  1TJC A;  3PZ4 A;  2WXO A;  4Q69 A;  2C0M A;  2XRY A;  1ZU2 A;  2KC7 A;  4GCO A;  2PNN A;  3MA5 A;  2QC9 A;  4G8K A;  4NQ0 A;  2OCC E;  5T3R A;  3NF1 A;  3CVN A;  4KZ0 A;  3PRE A;  3RK6 A;  1TNO A;  1H6P A;  2BF0 X;  1MX6 A;  1LTX A;  2MHK A;  2WXK A;  1OT8 A;  4YND A;  2I6H A;  3JQ1 A;  3ZU7 B;  4ANU A;  2R2L A;  2UY1 A;  3FH5 A;  3HVE A;  4JW1 A;  4GTM A;  5G04 C;  1U3D A;  2ILR A;  3MZL B;  3RRM B;  4Q96 A;  2V0P A;  3APD A;  3LXU X;  5CMW A;  3FTS A;  2ZGD A;  2X3M A;  3U66 A;  3BUA A;  3PDN A;  4UWH A;  2L6B A;  3AG1 E;  2GRR B;  4LNB A;  1N54 A;  1LD7 A;  2J8S D;  3TL5 A;  2GRM A;  1TN8 A;  5D0Q D;  1NZN A;  3P2B A;  1RZ4 A;  2WB2 A;  4JEU A;  3APF A;  3GZ1 A;  4FUL A;  3T9K A;  4GB9 A;  3DEP A;  1B89 A;  2P9I G;  1XNF A;  5IY5 E;  4I1A A;  3PH0 C;  1TN6 A;  4UQZ A;  3CLJ A;  3FUD A;  3S7B A;  2JLB A;  1WG0 A;  4AOF A;  3KEZ A;  4CRW A;  2OOE A;  4HOU A;  1HH8 A;  4UI9 J;  2XZT G;  4DJA A;  1N4P A;  3B7R L;  4KBQ A;  3Q4A B;  4WND A;  3HRA A;  1TNY A;  1X5B A;  2DYS E;  4I17 A;  3NB2 A;  3CKC A;  3CK9 A;  4HOT A;  1BLX B;  3D9J A;  3MX3 A;  5AJD A;  2I1J A;  4GMJ A;  4ILH B;  2QY7 A;  4KVM A;  4HVB A;  5CMY A;  2GW1 A;  2J9Q A;  4B0Z A;  1WDY A;  1S63 A;  2A4Z A;  4I9C A;  2KM4 A;  3GZS A;  4N3B A;  4BX8 A;  3BU8 A;  1W3B A;  3FUJ A;  2XZD G;  5D66 A;  3L82 A;  4ACL A;  4AVX A;  2QZA A;  2AXU A;  2RG8 A;  4GCN A;  2VTB B;  3GW4 A;  2PQR A;  4EHM A;  3ML9 A;  1TYQ G;  1AWC B;  3ZYM A;  4BFR A;  3NZS A;  4FHJ A;  5KJL A;  1YCS B;  3CVP A;  5AAO A;  1QNF A;  3DBS A;  5CER B;  2KZT A;  2VSO E;  1BI7 B;  4FLH A;  4DLQ A;  1Z5S C;  4XX5 A;  2IO3 C;  5KNG A;  4UUC A;  3JQ0 A;  3SGH A;  4A3T A;  2WPV A;  2R05 A;  4PDX A;  4DLO A;  2L0T B;  3JUI A;  3TWQ A;  2J4B A;  5EIL A;  3UT4 A;  3UQ3 A;  4A1S A;  3NQP A;  3EHQ A;  4UWF A;  2PM6 A;  4CZ2 D;  4ANW A;  1BU9 A;  4EEC A;  1TEZ A;  5EID A;  5B1B E;  3VLF A;  1PY1 A;  3AS5 A;  4WNF A;  4CDR A;  1N4S A;  5ENN A;  3KS2 A;  4I43 A;  1H0A A;  2AXV A;  4BT8 A;  2WXM A;  4GML A;  2V5Q C;  3FFL A;  2QYJ A;  5JJ7 A;  1BD8 A;  4XZ4 A;  1E96 B;  2VSX E;  3I4R B;  2JEK A;  1L5J A;  3DWL G;  1YYH A;  4UI9 C;  2IU1 A;  5AQ9 A;  1NI1 A;  3L54 A;  3ASN E;  5EKQ D;  1QQE A;  3KAE A;  2VGX B;  3HG0 D;  5FQ7 A;  5C1D A;  5J90 A;  3EUV A;  3IHV A;  2KCV A;  1OUV A;  3PEV B;  3TXN A;  1HE8 A;  1U3C A;  5G55 A;  4TXQ A;  4ZHB A;  1UG3 A;  3FUM A;  5JA4 D;  4I2Z A;  2NC9 A;  3LJ3 A;  3ABL E;  3JUE A;  2WXH A;  4KVO A;  5BV0 A;  5EYL A;  4TXP A;  1NA3 A;  1SQM A;  2FI7 A;  3ONK A;  3G2T A;  4E85 A;  3J5P A;  2J4D A;  3C3Q A;  2P2C P;  4FLB A;  2GRL A;  2ION A;  1Q2Z A;  4BSX A;  2J08 A;  4YDY A;  4JHR A;  4QFV A;  4EZK A;  3Q78 A;  4G2V A;  4F3V A;  1A5E A;  3CK7 A;  4N39 A;  2RKK A;  4U96 D;  1N9A A;  4WNE A;  3LDZ A;  4F1P A;  2WXN A;  3AAA C;  3CK8 A;  1D9S A;  1K1A A;  3D9K A;  4DRX E;  1RW2 A;  2PL2 A;  2V8S E;  2ZU6 B;  3CHP A;  1UN9 A;  3FTZ A;  3ASO E;  4ATZ D;  1QZ2 A;  4MBG A;  3L17 A;  3CVW A;  3AS4 A;  4ANV A;  2P9L G;  4JA7 A;  2DCP A;  3FTW A;  4JC8 A;  1N11 A;  3FUL A;  4TV3 A;  5ITZ F;  1Z3Y A;  2I2O A;  3ASD A;  1IXV A;  2LXM A;  3Q7A A;  3Q79 A;  3E33 A;  2F8Y A;  1OWN A;  4ME2 A;  2DYR E;  3TWR A;  4DX6 D;  4DI3 A;  4MLP A;  2XHE A;  3CHS A;  1FVH A;  3TWT A;  2LUH A;  4FAD A;  4LEU A;  2XEE A;  4H7Y A;  4WWP A;  5ANL A;  4IYP A;  3UX4 A;  1MYO A;  3CEQ A;  4BTB A;  4N3A A;  4Q94 A;  3I3N A;  1MX4 A;  2R17 C;  4TUM A;  4B93 B;  2A5E A;  4EBA G;  3R9A B;  2X6H A;  3F6Q A;  5CBO A;  3ONL A;  1QBQ A;  5LFA A;  4CYM D;  3ZHE B;  1PC2 A;  3MJW A;  3SQV A;  2NYJ A;  5B1A E;  1E8X A;  2UWJ G;  4LUN U;  5BXU A;  3FU5 A;  2P58 C;  1FT2 A;  3AU5 A;  4HLE A;  1OWP A;  1FCH A;  3HHM A;  3QOU A;  5H7P A;  1XGW A;  4JB8 P;  4RG9 A;  3LCA A;  3LKU A;  4ILI A;  3UM2 A;  5FQ6 A;  4A3V A;  3PE4 A;  3AG2 E;  4YDE A;  4U07 A;  2V4L A;  5FIN A;  3ZUV B;  4GTR A;  4JHJ A;  3SF4 A;  5CBN A;  3KSQ A;  3CSF A;  4NRH B;  5HQ8 A;  2C0L A;  3CGH A;  4Z68 A;  3RAU A;  4G11 A;  3TXM A;  3I5P A;  2J09 A;  3HXF A;  4ATG A;  4A55 A;  3CHQ A;  2LSV A;  2OVB A;  4HRM B;  3D9P A;  3DPD A;  3WG7 E;  3ML8 A;  4LNG A;  2AWI A;  1E7U A;  1ZB1 A;  3DSU A;  2XQ0 A;  2L0I A;  2Y3A A;  4U8Y D;  3V2X A;  2WMN A;  3CST A;  3LEW A;  3G2S A;  2FEZ A;  2FO7 A;  4C0M A;  2XGS A;  3CR3 A;  3CHR A;  1IKN D;  4AP2 A;  2VQ2 A;  1D8E A;  3MV2 B;  4C0E A;  4G26 A;  4L2L A;  3UMV A;  4DX5 D;  5BUZ A;  2MYO A;  2F0Y A;  5T8I A;  2YNQ A;  3QAR A;  3JXI A;  4GAA A; 
#chains in the Genus database with same CATH homology
 4CRW A;  3CHM A;  4I1M A;  2OOE A;  4V3I A;  3BG0 B;  3ZN3 A;  3TJP A;  4HOU A;  2RD0 A;  1HH8 A;  3ZYK A;  1HXI A;  4UI9 J;  4XKB A;  2X6K A;  4FJY A;  4DJA A;  5CCM A;  2DBA A;  3B7R L;  4ABN A;  3ZW3 A;  4KBQ A;  3Q4A B;  2C2L A;  3SHF A;  1UJJ A;  1IQR A;  5A6C A;  4WND A;  3TG4 A;  1EF1 C;  2IOL A;  4I2W A;  2GGF A;  2IQC A;  3UT7 A;  2WXF A;  3FHE A;  5E76 A;  4B89 A;  1X5B A;  2VGY A;  2XGM A;  3ASF A;  4UWG A;  3VTX A;  4UWL A;  3G2V A;  3D9O A;  4NAC A;  4HOR A;  2KZT B;  2WXP A;  3MGB A;  5KCM A;  3ZGQ A;  1JUQ A;  4I17 A;  2WXL A;  3B7S A;  5AIJ A;  4OVU A;  4F53 A;  3CKB A;  4I6E A;  4JL0 A;  4XI9 A;  4WWN A;  3L22 A;  2WQ6 A;  5KJM A;  2XEV A;  3CKC A;  3CK9 A;  2XRZ A;  4HOT A;  3QKY A;  3D9J A;  2PZI A;  4BY6 A;  3FDH A;  3HDX A;  3MX3 A;  4GYO A;  3EHN A;  3HIZ A;  5AJD A;  4DPR A;  4LRZ A;  3CQG B;  2I1J A;  3Q49 B;  4GMJ A;  4ILH B;  4JHK A;  3D9M A;  3EHM A;  4XI0 A;  4DI4 A;  2QY7 A;  2LAI A;  2LO6 A;  4KVM A;  4HVB A;  5CMY A;  3ASG A;  2GW1 A;  3FUN A;  3IHY A;  4P29 A;  2J9Q A;  2Q7F A;  4B0Z A;  1JPL A;  1KT0 A;  4J8D A;  1E8Y A;  3R7R A;  2VJ8 A;  4CCA A;  2A4Z A;  2WM9 A;  3GYZ A;  3PVL A;  1ZBP A;  4I9C A;  1HO8 A;  2E0I A;  2KM4 A;  4IRU A;  3GZS A;  2FF4 A;  4N3B A;  5DBK A;  5FJY A;  4BX8 A;  4CDN A;  3EDT B;  4DK5 A;  4URK A;  2MOW A;  1W3B A;  4WWO A;  3FUJ A;  3B7U X;  4MRU A;  3QJZ A;  1ELK A;  4UI9 K;  4ACL A;  1P5Q A;  3VLE A;  4AVX A;  3PEU B;  3Q15 A;  3IEG A;  2AXU A;  2RG8 A;  3URZ A;  4GCN A;  4GZ5 A;  3SZ7 A;  4JXT A;  2VTB B;  4CGW A;  3GW4 A;  4FU3 A;  2PQR A;  3LPZ A;  4JA9 A;  3ML9 A;  1HG2 A;  2OV8 A;  2WXR A;  3ZYM A;  4B8C B;  4N5C A;  4BFR A;  2R59 A;  3CHO A;  4WAF A;  3NZS A;  2NSZ A;  2BTD A;  3CIA A;  2IF4 A;  3D3M A;  4FHJ A;  3ZYQ A;  2FBN A;  5JHB A;  5KJL A;  3CVP A;  1WM5 A;  4I6G A;  2WQ7 A;  1QNF A;  1HZ4 A;  3FEY A;  4U0Z A;  3U4T A;  3DBS A;  2KZT A;  3FH8 A;  2XPI A;  3E4B A;  5FQ4 A;  2VSO E;  3PS6 A;  5FZS A;  2WXG A;  3ZHE A;  3ZPJ A;  3SFZ A;  3Q5M A;  4EPZ A;  4KMO A;  1Y6I A;  4FLH A;  4DLQ A;  3MKQ B;  3QWP A;  3CVX A;  3FTU A;  4XX5 A;  5FQ8 A;  3SGH A;  3JQ0 A;  4A3T A;  2WPV A;  2YQ8 A;  5FZQ A;  4PDX A;  3L08 A;  4PH4 B;  4G1T A;  2VYI A;  4U63 A;  3ZIM A;  4ANX A;  4BTA A;  4DLO A;  3JYS A;  2LAH A;  5G2N A;  3VTY A;  2L0T B;  2NXP A;  3JUI A;  2CHX A;  4HFG A;  4NUR A;  3SBT B;  1TJF A;  3ZRH A;  3BEE A;  4O6F A;  5AYW D;  3FUF A;  2J4B A;  1S0P A;  2CG2 A;  3ESL A;  2Y4U A;  5ANR A;  3UT4 A;  3UQ3 A;  4A1S A;  3WXX A;  5BT1 A;  3NQP A;  5BPP A;  4PS7 A;  3FU0 A;  5AEN A;  4UWF A;  5FTP A;  2L6J A;  4AJW A;  4G23 A;  2PM6 A;  4HOQ A;  4BT9 A;  4HS2 A;  4ANW A;  4XKC A;  3R7Q A;  4EEC A;  3KD7 A;  1TEZ A;  4AM9 A;  3VLF A;  4GZ3 A;  2HYZ A;  4KT6 B;  1PY1 A;  3AS5 A;  4WNF A;  3GZ2 A;  4CDR A;  4C9B B;  5ENN A;  3KS2 A;  2VTB A;  3FUH A;  3FY4 A;  4I43 A;  3SNX A;  1WAO 1;  4EZJ A;  1H0A A;  4OYS A;  2AXV A;  5D0O D;  2XPY A;  1UJK A;  2WXM A;  4GML A;  4BT8 A;  3FFL A;  3UPV A;  2BUG A;  4YVO A;  4TRQ A;  3IBE A;  3O48 A;  4GU5 A;  4Y6W A;  1H19 A;  5JJ7 A;  1E8W A;  4XZ4 A;  1YA0 A;  3VLD A;  5ARG A;  1E96 B;  5BW8 C;  2VSX E;  3I4R B;  2WXQ A;  4M3O A;  2JEK A;  1L5J A;  2HM8 A;  2XGO A;  2LNI A;  1WY6 A;  2L9B A;  4H7X A;  4UI9 C;  3N71 A;  3QWW A;  2IU1 A;  4XIF A;  3LVQ E;  3L54 A;  3FWV A;  3D9I A;  4GA1 A;  5M72 A;  3RO3 A;  4F7A A;  5EKQ D;  2UY1 B;  2WXJ A;  2IJG X;  2YIN A;  1QQE A;  3ZEF A;  2HR2 A;  3FTX A;  2HO1 A;  3LY8 A;  3KAE A;  3MKQ A;  4D10 C;  2VSN A;  3HVE B;  1PAQ A;  4OVV A;  2CHZ A;  2VGX B;  2PM7 A;  2YHE A;  2J07 A;  4GYW A;  5FQ7 A;  2LSU A;  5C1D A;  5FWQ A;  2OVF A;  3IHV A;  5J90 A;  3QNK A;  2WXI A;  3EIJ A;  2KCV A;  5DIZ A;  3L16 A;  5ARF A;  1OUV A;  3FH7 A;  3PEV B;  3TXN A;  5EDS A;  3JCK C;  4J6I A;  1HE8 A;  3RRN B;  1U3C A;  5G55 A;  2M63 A;  4WUY A;  3B7T A;  4UWK A;  3QC1 A;  1UG3 A;  3K9I A;  4EBA A;  3MCX A;  3FUM A;  3RKV A;  4I2Z A;  2NC9 A;  3S7D A;  5LCW J;  3LJ3 A;  4HOS A;  2EQX A;  4APF A;  5LX8 A;  3U64 A;  4CEM A;  2WXH A;  1NP7 A;  4KVO A;  5BV0 A;  1E7V A;  3PNL B;  3UT8 A;  4AXH A;  3OXF A;  3OAW A;  5JHA A;  1NA3 A;  5FZR A;  4N2S A;  4AY6 A;  1JWG A;  3B13 A;  4AEZ C;  4BWR A;  1EYH A;  1SQM A;  5HI7 A;  2FI7 A;  4GPK A;  3PUJ A;  3ONK A;  4JEH A;  3G2W A;  3G2T A;  3S7F A;  5LCW C;  4E85 A;  3AS8 A;  4RSY A;  4W9R A;  3LY7 A;  2J4D A;  4L2Y A;  1H2U A;  5EX0 A;  5J08 A;  4FLB A;  2GRL A;  2ION A;  3FUK A;  1OWO A;  4FJZ A;  1LF8 A;  2J08 A;  4BSX A;  4JHR A;  4I9E A;  1HU3 A;  3S2A A;  3Q47 B;  2X6I A;  4L23 A;  1SZA A;  4L1B A;  4QFV A;  3QB2 A;  3U9W A;  3D9N A;  4U8H A;  3ZYL A;  4EZK A;  4G24 A;  4G2V A;  4F3V A;  3APC A;  3CK7 A;  3LVR E;  4N3C A;  4N39 A;  5G04 J;  1INZ A;  1IYG A;  2IOS A;  5JJT A;  4E6H A;  3TG5 A;  4WNE A;  3LDZ A;  1HG5 A;  3P1U A;  2WXN A;  3L13 A;  4MS6 A;  4U0U A;  4K0R A;  1MQS A;  2MRI A;  3CK8 A;  2OND A;  3FU6 A;  2VGX A;  4AIF A;  1Z3X A;  2PQN A;  3UUX A;  4JZY A;  3D9K A;  2XCC A;  2WMO A;  3CQC B;  2PL2 A;  3FTY A;  4BX9 A;  1DVP A;  2V8S E;  2ZU6 B;  1IQU A;  3CHP A;  4B8A A;  1DNP A;  3SBS A;  1MHQ A;  4PS3 A;  1UW4 B;  4YVQ C;  2I1K A;  1UN9 A;  1EDU A;  3FTZ A;  2CG3 A;  4J8F A;  2CFZ A;  1QZ2 A;  4B94 A;  3L17 A;  1H6K A;  5C2Y A;  3C98 A;  3T5V A;  3CVW A;  3AS4 A;  4ANV A;  4JA7 A;  3G2U A;  2DCP A;  3FTW A;  1Y8M A;  1VDY A;  4JC8 A;  3FUE A;  3RU0 A;  3FUL A;  3OXL A;  3FTV A;  4TV3 A;  2I9C A;  3ZFW A;  4IUL A;  5A23 A;  1Z3Y A;  2I2O A;  3ASD A;  2R5S A;  3ESK A;  4I6J A;  3TAX A;  4CDM A;  2WQH A;  3T8M A;  4GZC A;  2QFC A;  2V5F A;  2WVI A;  3EJN A;  1OWN A;  2IFU A;  4ILG A;  2X6F A;  4ME2 A;  4PS8 A;  5BNW A;  4FC8 A;  3HYM B;  2DIW A;  1E8Z A;  4UQX A;  5AJL A;  5E75 A;  4PUC A;  1E90 A;  5A7D B;  4K03 A;  3CV0 A;  3RRU A;  4DI3 A;  1H2V C;  2XPZ A;  3MEK A;  2XHE A;  4MLP A;  3MV3 B;  1KLX A;  3QDN A;  3RJV A;  4AV7 A;  3I4G A;  3CHS A;  1FVH A;  1HS6 A;  4J8E A;  4JVS A;  4UQY A;  3FEX A;  4FAD A;  4LEU A;  4I1O B;  4JPS A;  4F1S A;  4J0U A;  3PRZ A;  3PZD A;  4H7Y A;  3CVQ A;  4WWP A;  5ANL A;  1HFA A;  4A1G A;  5KJK A;  3SD5 A;  3CVU A;  4GA2 A;  1SZ9 A;  1Z6T A;  3U3W A;  1EPU A;  4TUU A;  3MKR A;  3CVL A;  4IYP A;  4EZL A;  3UX4 A;  2J49 A;  2CFU A;  4KYO B;  5G05 J;  3CEQ A;  3MYV A;  4BTB A;  4N3A A;  1OWM A;  4Q94 A;  3I3N A;  2CHW A;  1IHG A;  3PNT B;  2R17 C;  3AU4 A;  3PE3 A;  4U04 A;  4FA6 A;  1GW6 A;  3EIQ C;  4EBA G;  1FVF A;  3R9A B;  4N2Q A;  5G05 C;  4HXI A;  4RG6 A;  1TJC A;  4U0S A;  2X6H A;  2WXO A;  3LY9 A;  2C0M A;  4CT0 A;  4Q69 A;  3IKO B;  5BV1 A;  2XRY A;  2XCB A;  1ZU2 A;  3ONL A;  5CCL A;  2KC7 A;  4GCO A;  1NA0 A;  4RVB A;  3NZU A;  5LFA A;  3ZHE B;  1PC2 A;  3MA5 A;  3MJW A;  5EX3 A;  1E8X A;  2UWJ G;  4LUN U;  4L7T A;  3FU5 A;  4NQ0 A;  2P58 C;  5T3R A;  3AU5 A;  4HLE A;  1OWP A;  3NF1 A;  1FCH A;  4GZD A;  3HHM A;  3QOU A;  3QAQ A;  1XGW A;  1JWF A;  4LER A;  4RG9 A;  3LCA A;  4G25 A;  3CVN A;  3LKU A;  4ILI A;  4J8S A;  4KZ0 A;  3ZXS A;  3PRE A;  3RK6 A;  3CVV A;  1N52 A;  4FP7 A;  5FQ6 A;  4A3V A;  2BF0 X;  3PE4 A;  4R7L A;  4WNG A;  4APO A;  4U07 A;  4FHK A;  3RO2 A;  1BPO A;  4Y6C A;  2V4L A;  5FT9 A;  4JHJ A;  3SF4 A;  3LS8 A;  2KAT A;  4EQF A;  2MHK A;  1H2T C;  3CVY A;  3CSF A;  4NRH B;  2WXK A;  5HQ8 A;  4YND A;  2I6H A;  3JQ1 A;  2C0L A;  3QWV A;  3L6A A;  4ANU A;  4GZ6 A;  3D9L A;  3CGH A;  4CT4 A;  2UY1 A;  5T4Y A;  2FUL A;  2AXZ A;  3FH5 A;  1HX8 A;  3RIB A;  3HVE A;  4IN3 B;  3O4Z A;  3ASH A;  4GA0 A;  4G11 A;  4JW1 A;  3TXM A;  5LP0 A;  5G04 C;  1U3D A;  5JJ6 A;  2ILR A;  4LCT A;  3MZL B;  3FU3 A;  3RRM B;  2AVP A;  3I5P A;  4Q96 A;  2J09 A;  4ATG A;  4A55 A;  2V0P A;  3APD A;  3LXU X;  3CHQ A;  2LSV A;  2OVB A;  5CMW A;  1OWL A;  3FTS A;  2X3M A;  5CHE E;  3D9P A;  2KCK A;  3U66 A;  1ELR A;  3DPD A;  3ML8 A;  3ULQ A;  2AWI A;  1HF8 A;  3PDN A;  4UWH A;  3FUI A;  1E7U A;  4GYY A;  2YHC A;  1A17 A;  1N54 A;  4CGV A;  2VSY A;  2XQ0 A;  3OTN A;  2L0I A;  3TL5 A;  2GRM A;  5D0Q D;  3ZVV A;  2Y3A A;  2AW6 A;  1NZN A;  1UN8 A;  2A5U A;  4KXK B;  3P2B A;  4ACK A;  2WMN A;  4XE0 A;  3CST A;  3LEW A;  3G2S A;  2FEZ A;  2E2E A;  1ELW A;  2FO7 A;  3IV0 A;  4C0M A;  2XGS A;  3BG1 B;  3CR3 A;  3QK0 A;  3CHR A;  2WB2 A;  4JEU A;  4AP2 A;  3S7J A;  3APF A;  3GZ1 A;  2VQ2 A;  4FUL A;  2X38 A;  3LYA A;  3SI5 A;  4AY5 A;  3MV2 B;  2X6J A;  5LOZ A;  4C0E A;  4GB9 A;  1B89 A;  4G26 A;  4L2L A;  1XNF A;  3UMV A;  2KCL A;  5BUZ A;  3PUK A;  3ENE A;  4I1A A;  1KT1 A;  3PH0 C;  4KZC A;  2YNQ A;  5T8I A;  5KJN A;  3TGO A;  4UQZ A;  2Y4T A;  3CLJ A;  3FUD A;  3S7B A;  3FP3 A;  3T5X A;  3QAR A;  2JLB A;  4MKT A;  4AOF A;  3KEZ A;  4GAA A;  3OXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...