2M63A

The protease-resistant n-terminal domain of tir-domain containing adaptor molecule-1, ticam-1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
157
Chain Sequence
HMACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-terminal domain of TIR domain-containing adaptor molecule-1, TICAM-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TIR domain-containing adapter molecule 1
total genus 36
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17798 TRIF-NTD TRIF N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.780 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2m63A00
2M63A 4C0MA 4BSXA
chains in the Genus database with same CATH superfamily
4XE0A 2H6GA 5JJTA 4HS2A 2WXJA 3FU3A 4U0UA 3DXKG 2OEVA 3LJ3A 4U95D 3TWUA 2VGEA 4BT9A 2VYIA 4FHKA 3UT7A 4A3TA 1X81A 3ML9A 3VLDA 3EJNA 3L82A 5A6CA 5AAOA 3FEXA 4BT8A 2VGXA 3FUFA 3IKOB 4ACLA 2IONA 5DBKA 3UIPC 1OWLA 1IQRA 2Y4TA 4ZFHA 1XGWA 3RJVA 4DUIA 4LCTA 2JEKA 4JC8A 1HX8A 4A63B 2L0TB 1N0RA 4HNAD 4UQXA 3PUJA 2RFMA 1UN9A 4B8CB 4GZ6A 4PDXA 5DIZA 3DSWA 2DVWA 3BQOA 2PL2A 4CCAA 3UI2A 3D9OA 3CHRA 4U63A 2IFUA 4JA7A 3HXFA 1DCQA 4I1AA 1DVPA 3RRMB 3E34A 3UXGA 3ZXPA 4GMJA 4FJZA 3PZ3A 3ZHEB 2F8YA 2F37A 4F1PA 4U8HA 5CECB 2QYJA 3CVUA 4R7LA 2RG8A 1NL4A 4HVBA 3I3NA 3ABME 2Q7FA 1HFAA 3O48A 3Q9NC 4U07A 2CFZA 1QYMA 2XHEA 2KXPC 2RD0A 4U7EB 2EIKE 1HG5A 4YVOA 1MX6A 1N4QA 4UWGA 3ULQA 4WNGA 3U4TA 3QWWA 3MZLB 1YMPA 2ZXWE 3CVQA 4GZCA 3HG0D 5G05J 1H6PA 2WXNA 4HOSA 4AIFA 2QFCA 1KT0A 4GTTA 4KMOA 1K1BA 3JXJA 1BD8A 3C5RA 2PQRA 5CCMA 3GZ2A 3ESKA 2ETBA 3FH7A 4UQYA 5G04C 4ACKA 1MHQA 4AVXA 3FTUA 2XPZA 1Z5SC 3SFYA 2EQXA 3WXXA 5D66A 4J8SA 1WDYA 2X3MA 5HS0A 5CMYA 3DXMG 1NI1A 4YDEA 5D2MC 2VJ8A 4NRHB 3CHSA 2XRZA 1PY1A 1D8DA 2QZAA 4LG6A 5AJDA 4WWPA 2CHXA 3UIOC 1KZOA 3APDA 3UUXA 2KC7A 1H0AA 4F6RD 3IEGA 4Y6CA 5KJKA 2XEHA 3OXFA 4ABNA 4AY6A 1EF1C 3S7JA 3JQ1A 3VLEA 4DLOA 1A5EA 4RSYA 4GAAA 2CHZA 4EBAG 2GRLA 4J6IA 1U3CA 3KSLA 3ASOE 4JD2G 4MRUA 2A5EA 4GTSA 5CBOA 4J8YA 2V0PA 2OCCE 3W9GA 3E32A 1WG0A 5FINA 1HG2A 4APOA 4E6HA 4DPRA 4HOQA 3RSEG 5LOZA 5FQ4A 5BW8C 1LTXA 3SBTB 1LF8A 4RVBA 2ZGDA 1MX4A 2LNIA 3BU8A 3ZYMA 3FULA 4GPKA 1NZNA 5KNGA 2WMOA 5JJ7A 2VSYA 3T9KA 4EQFA 3DSSA 3FTZA 3X2QE 1HE8A 4G8KA 4ANUA 3FUKA 4A3VA 3TAXA 2X38A 3CQGB 2VGYA 4QQIA 3E33A 1S70B 4K5BA 4HORA 3ABKE 2VSXE 2DYSE 3FEYA 5FQ7A 1U2VG 3EHRA 2R5SA 5AJLA 4Q94A 1FPPA 3SBSA 3FTXA 2V4LA 4WNEA 4GZ5A 2GRRB 2CFUA 3SQVA 2IF4A 1WM5A 5ENTD 2LO6A 3B13A 4AM9A 3FU5A 4JVSA 1Z3YA 3FP3A 4DX5D 3CVNA 3FH8A 2YINA 3TG4A 4F7AA 4C0MA 2ONDA 3OAWA 3ZHEA 3EU5A 3LY7A 2XQ0A 4M7CA 2HR2A 3I5PA 5G04J 1KT1A 3HHMA 3CQCB 1OCRE 3KAEA 3S7FA 2KATA 1E90A 3FUEA 1QNFA 3B7UX 3CK7A 5M72A 5T4YA 4H7XA 2AXVA 1XNFA 4ME2A 4N2SA 5ENOD 3EUVA 4MBGA 5JHAA 3HVEA 3BG1B 2UY1B 2F8XK 4BWRA 4GCNA 1Z6TA 2PQNA 4GTPA 2FI7A 1H6OA 3B7TA 2Y1LE 3QWVA 3Q7FA 4A1GA 1X5BA 5A7DB 1MQSA 2E2EA 4CGVA 4W9RA 5ENPD 3C98A 4RG6A 1OCZE 3HRAA 4XX5A 3IXEA 4UI9K 5T8IA 3FTVA 2WXMA 4KBQA 4F1SA 2J9QA 3DSXA 3LPZA 4DX7D 3MV3B 4K03A 3L54A 1HF8A 4URKA 2DIWA 4JB8P 1FCHA 4YVQC 1WY6A 4U0ZA 2L0IA 3FTSA 2UY1A 3LVQE 4HI8A 2F0YA 2DWZA 3PZ4A 3SZ7A 4B94A 4L2LA 1K3ZD 2MYOA 4H7YA 3QK0A 2B6CA 4G1TA 4I43A 1ELWA 2GRMA 3UM0A 5ENQD 4C48B 1AWCB 3DSTA 4U0SA 4JHRA 2WB2A 3L13A 3ZPJA 1YYHA 3VTXA 3LKUA 1HZ4A 2XZDG 3FDHA 1SVXA 2P9KG 1ZU2A 5EKQD 4J8EA 3RIBA 3NF1A 3PE4A 4O6FA 4QFVA 2XS1A 1S63A 1TNBA 1AP7A 4HB5A 3C3RA 2IU1A 4PS3A 1UG3A 3PDNA 3IBEA 2WXLA 4LNGA 3UT8A 1N4RA 3UT4A 5C1DA 2L6BA 3R9AB 1O1RA 1FVFA 4N3AA 3MKRA 4TUUA 3ZYKA 1V55E 1IHBA 2HYZA 3T5XA 5CERB 3CSTA 4P29A 3KEZA 3ZN3A 5BXOA 5ITZF 4EZLA 2V8SE 4LERA 1RZ4A 5CBNA 2JABA 2XPIA 4JEHA 4KYOB 1K1AA 3Q15A 5FZSA 5IY5E 3NZSA 1NA0A 3SI5A 3JYSA 4UWKA 4I2ZA 2FULA 4OYSA 1DCEA 2AVPA 2VGXB 2QYUA 3U9WA 4HRMB 1BI8B 4FHJA 1YCSB 3K9IA 3DBSA 3IHYA 4GB9A 3EU9A 3NOCD 3RAUA 1OWMA 3AAAC 3HXDA 4F3VA 4X8QA 5D0OD 1BI7B 3FUDA 4TXPA 4C9BB 1SQMA 2P9NG 4JHKA 3FUIA 1N11A 2LXMA 4ILGA 4FADA 4BX9A 1ELKA 3ZIMA 3V30A 3NQPA 4GA1A 4OAUC 4UI9J 3CK9A 2LSUA 4I1MA 4BEPA 2H6HA 3T8KA 3GZ1A 3QC1A 3SF4A 1UJJA 3PS6A 2VQ2A 1OY3D 2FO7A 2WQHA 3E30A 2Y0BG 3EHQA 5B1BE 2MRIA 1BU9A 4PUCA 5G05C 5AENA 4RLYA 2Y4UA 4CEMA 1FT1A 3PZ1A 2KCLA 1N94A 4ANWA 3TXNA 3CHMA 3UPVA 4FULA 3QNKA 3NBNB 2C0MA 3EIJA 3UQ3A 3PEUB 5EIBE 1QQEA 3S2AA 4N39A 2DCPA 3APFA 5KCMA 2PM7A 3ASHA 3R9MA 3NAWA 4XEIG 3T5VA 1TN6A 4XZ4A 1QZ2A 2X6KA 4I1OB 4N3CA 2I1KA 4TXQA 2CHWA 3TWQA 3CIAA 3FTWA 4UWLA 4BX8A 1IQUA 5BV1A 3RK6A 3ZGQA 5HI7A 3CV0A 3MA5A 3ONKA 4B93B 5CCLA 5JA4D 4JHJA 2XGSA 2A4ZA 3HXEA 1E7VA 3ZRHA 5ANRA 3BEEA 3UM1A 2AXZA 4K5CA 1E8XA 2P2CP 4U8VD 5KJMA 2WXFA 4KZ0A 4UWHA 1OUVA 3BG0B 3FWVA 3LDZA 3OXLA 2BUGA 4ILIA 3QDNA 3URZA 3G2WA 1NA3A 2WMNA 2VTBB 1INZA 3QB2A 3D9HA 3HIZA 1E8ZA 4HBDA 1OXJA 3EDTB 3MX3A 3SD5A 3ZKJA 3ZW3A 3KEAA 3LS8A 1KLXA 3ULEG 5LX8A 4EHMA 1TEZA 2IO3C 2KZTB 2XZTG 5FQ8A 1HO8A 5AQAA 4NACA 4JEUA 3ZVVA 4NQ0A 2YHCA 4FLBA 2RFAA 4MKTA 4HI9A 2LAIA 4IRUA 2DZOA 5BUZA 4WNFA 3CHQA 3Q75A 3QWPA 2GRPB 4CDRA 3DSVA 2P9IG 5BT1A 3DEOA 3V31A 1TR4A 4IYPA 3Q9UC 1D8EA 4HFGA 5EX3A 5CEAA 2L6JA 3AG2E 2AXUA 2J09A 1V54E 3UMVA 4GTRA 2IEJA 2R2LA 2X6JA 2XEEA 4HLLA 2KZTA 4B8AA 2CG2A 4RG9A 3SO8A 1JCRA 4HOTA 1O1TA 4EBAA 4UQZA 2E0IA 3ISMC 3P1UA 3Q49B 3CVVA 4CGWA 1OWOA 5KNHD 5LCWC 4KVOA 3UM2A 4KVMA 3TWVA 3Q73A 2XEVA 3ASNE 4HOUA 2AWIA 4EPZA 2ZIRA 4YDWA 5HKPA 4BESA 3CHOA 5EYLA 4JPSA 1UJKA 1H6KA 4LUNU 4TV3A 3AG1E 4I6EA 4A1SA 3FHEA 3QOUA 4GA0A 4WWOA 4JA9A 3RRUA 4B0ZA 1SW6A 2PNNA 1N52A 3ZXSA 5CHEE 3G2SA 4EZJA 2BF0X 5EYPF 3MJWA 2L9BA 2HM8A 4FP7A 4C0EA 3MKQA 3CEQA 4IN3B 5D0QD 5ARFA 1NP7A 4FU3A 5CRVA 2B0OE 3PNTB 4KT6B 3ABLE 4YDYA 4G25A 3ENEA 2GGFA 1H2VC 2R02A 5EN5D 3SY2A 3PH0C 5G2NA 3UM3A 3ASDA 3G2TA 3ASFA 5BNWA 2J4BA 2YQ8A 4Y6WA 4AXHA 2J07A 4UI9C 2R17C 2PZIA 4BSZB 4XKCA 3MCXA 3G2VA 2VSOE 3WG7E 4AY5A 2X6HA 2LSVA 3L08A 3E4BA 3Q7AA 4JZYA 4Z68A 4GYWA 1JCQA 3LYAA 3AS4A 1Y8MA 4BERA 2WXRA 3UINC 1OWPA 1SA5A 3U66A 4OVVA 5FQ6A 4DI4A 4EZKA 1G3NB 2PM6A 5KJNA 1TJFA 2WXOA 4JL0A 4ATZD 4GYYA 2P58C 5EDSA 4L1BA 1H2UA 3I4GA 4WWNA 3ZEFA 1QBQA 3DEPA 5KWDA 2YNQA 3U3WA 1MZCA 3R7RA 3DRAA 2FF4A 4K5AB 3QARA 2M63A 1GW6A 3HDXA 2NC9A 4DI3A 4G2VA 3CR3A 4LNUD 3D9KA 2EILE 3EHMA 3HYMB 4HXIA 4OVUA 3W9FA 3LVRE 4CYMD 2P9PG 4GZ3A 5ENRD 2J4DA 3PREA 4AOFA 2LXLA 4WAFA 3C3OA 3LY9A 2I6HA 2KM4A 5CMWA 5BPPA 3D3MA 4CDMA 4HQDA 3O4ZA 1N95A 1OT8A 2EIJE 5FZQA 4DK5A 1N54A 3MV2B 4BTAA 5LCWJ 3HVEB 4CZ2D 4GZDA 4CDNA 3GYZA 4KZCA 4GTMA 4GA2A 2XCBA 2KCVA 3Q78A 1TNZA 1N4SA 4GTOA 2RKKA 2R05A 3D9NA 4HLEA 1H19A 3TWSA 1BPOA 4G26A 1TN7A 4NURA 3DWLG 4MS6A 1O5MA 4IULA 2WXIA 3KD7A 4G8LA 3D9MA 3LEWA 2LAHA 1FVHA 3TJPA 4FJYA 3C3QA 4A55A 2WXPA 4FC8A 2HE0A 4RQIA 4E85A 3MEKA 5FWQA 4F53A 1HS6A 3APCA 3RO3A 1NFIE 2ILRA 4GPMA 5LP0A 1ZBPA 5E75A 4N5CA 3QAQA 3JUIA 2I9CA 3FUHA 4LRZA 5G55A 1JCSA 1PC2A 5ANLA 3J5PA 4HRNA 5AQ9A 3UX4A 2J49A 5BXUA 3AU4A 3BUAA 1KZPA 4L23A 1E7UA 2WQ7A 3CKBA 3JCKC 4TUMA 3CSFA 3DPDA 3OTNA 3D9PA 4GMRA 3L6AA 4LNBA 4DLQA 2OVFA 3GW4A 2ETAA 2XS8A 3DSUA 2UWJG 3LXUX 2ZISA 2P9UG 4U04A 3FH5A 3MGBA 2ZU6B 4V3IA 4FA6A 4G23A 3TWXA 2X6IA 1TN8A 3PEVB 3PE3A 2NYJA 2GW1A 3I4RB 3QJZA 2ETCA 2FO1E 2OOEA 2IY0C 5EILA 3TWRA 3FUMA 2WPVA 1UOHA 1SA4A 3ZU7B 3ZUVB 1D9SA 4PS7A 4DX1A 1N4PA 1PAQA 1E96B 3B7BA 4U8YD 3CVWA 5AIJA 1W3BA 3IHVA 3PZDA 1LD7A 3VLFA 4AEZC 3RKVA 2IOSA 3QKYA 4DX6D 3ULYA 2ZGGA 3Q47B 3GZSA 2QC9A 1Z3XA 2HO1A 2J8SD 3B7SA 1FT2A 5AN8A 5FJYA 2CG3A 4BTBA 3CVXA 1O1SA 1E8WA 1TYQG 2BKKB 1IHGA 2FEZA 3Q4AB 2XCCA 3ONLA 3NZUA 2C2LA 3UKUG 3CLJA 3N71A 1B89A 1JPLA 4DJAA 5AQ7A 4LSZE 4I6JA 3T8MA 5T3RA 2OEWA 2JLBA 2AJAA 4HRLA 1DNPA 1HU3A 2EINE 3LY8A 2GRNB 2IQCA 3CVLA 5JJ6A 3FY4A 3F6QA 4JXTA 2AW6A 1IKND 5KJLA 1Q2ZA 4GCOA 3J5QB 3L22A 3AS5A 5AARA 1SZAA 3L9TA 2DZNA 5C2YA 1WAO1 4TRQA 4ZHBA 4XKBA 2BTDA 3AS8A 1OWNA 2WXKA 4GMLA 2XGOA 3ZYLA 4NIKA 4GTVA 2V4HC 3UKRG 4I17A 4XIFA 3VTYA 3AG3E 4AV7A 2LUHA 2P9SG 3TWTA 2WQ6A 3CVYA 4PH4B 4N2QA 3AG4E 3HXBA 1YA0A 5FT9A 5B1AE 3D9JA 4AJWA 3ASGA 4L7TA 4L2YA 3OXGA 1ZB1A 4BETA 5HQ8A 3HXCA 3LJNA 1EDUA 5AYWD 5JHBA 3V2XA 2KBXA 1LD8A 3JQ0A 1JWGA 4DX2A 2XPYA 3CGHA 1OCOE 5CRUA 3SHFA 2BKGA 2QY7A 1VDYA 2IJGX 3EHNA 1TJCA 4OAVB 1L5JA 1UW4B 4O60A 3LCAA 2GRQB 3CVPA 5JMND 3TG5A 2YHEA 5LFAA 4O1OA 3CK8A 1RW2A 5B3SE 4BFRA 5AQBA 5EIDA 4ATGA 2FBNA 3V2OA 3JUEA 4J0UA 2KCKA 1TNUA 2R03A 4D10C 4J8DA 2NSZA 2VTBA 1TNYA 4U96D 3FFLA 1EPUA 3S7DA 3CHPA 1SZ9A 3UTMA 3FUJA 1IYGA 1UN8A 1BLXB 3PVLA 4TXRA 3S7BA 4I6GA 3ZFWA 4WUYA 1U3DA 3FU6A 4XI9A 2BEDA 3B7RL 1TNOA 2I2OA 3B95A 3SFXA 3SGHA 1H2TC 2MHKA 4CT4A 2C0LA 4APFA 4JW1A 3KSQA 3PUKA 1Y6IA 2OV8A 2VSNA 3E37A 5FIOA 1IXVA 3L17A 4CRWA 4K0RA 3DPYA 4DRXE 5ENNA 4ANVA 3TWWA 4BSXA 4GTQA 4CT0A 1JWFA 2NXPA 4N3BA 1N0QA 2A5UA 1A17A 3G2UA 3MKQB 1MX2A 3JXIA 3NB2A 4GU5A 4AP2A 2P9LG 1N9AA 3TXMA 5A23A 2V5QC 3PRZA 1MYOA 4GYOA 1ELRA 3TL5A 2WM9A 3CKCA 1K8KG 4J7WA 1EYHA 3EIQC 2DBAA 3ZYQA 4G24A 3PZ2A 2IO2C 3SNXA 4XI0A 2Y69E 2GROB 2IOLA 3D9LA 1S0PA 4N5QA 3Q5MA 2XGMA 3RO2A 5HRYA 2WXGA 3MYVA 4KXKB 1KPSB 4Q96A 3R7QA 4G11A 4YNDA 5H7PA 1P5QA 5FZRA 4UUCA 5J90A 2X6FA 3AJIA 4ILHB 4B89A 4L9PA 5E76A 1E8YA 2WVIA 2DYRE 2WXHA 2H6FA 4O1PA 5EX0A 2V5FA 2EIME 3SFZA 1MJ0A 4PS8A 2H6IA 1HH8A 4UWFA 5FTPA 1HXIA 3Q79A 4I9CA 5J08A 2OVBA 2I1JA 1S64A 3AU5A 3RRNB 2WXQA 1DC2A 3ESLA 2XRYA 3NOGD 5ENSD 3ML8A 3FTYA 3FU0A 3L16A 4I9EA 3D9IA 5CEDB 4ANXA 4BY6A 4M3OA 2XENA 2Y3AA 3V79K 3U64A 4LEUA 3RU0A 1JUQA 3FUNA 4FLHA 3KS2A 3ZNGA 3TGOA 4I2WA 3IV0A 5KBAA 2J08A 2MOWA 4EECA 4WNDA 3P2BA 2R59A 4J8FA 1OCCE 4Q69A 3PNLB 5ARGA 5BV0A 4MLPA 3C72A 4YDOA
chains in the Genus database with same CATH topology
3GZSA 4XE0A 5JJTA 4HS2A 2E2EA 2WXJA 3FU3A 4CGVA 1Z3XA 4U0UA 2X6JA 2HO1A 4W9RA 3C98A 3LJ3A 3B7SA 2KZTA 4RG6A 4B8AA 2CG2A 4RG9A 4XX5A 4HOTA 4BT9A 2VYIA 4UI9K 5FJYA 3FTVA 4UQZA 2WXMA 5T8IA 4EBAA 4KBQA 2CG3A 4FHKA 2E0IA 3UT7A 2J9QA 3P1UA 4A3TA 3LPZA 3ML9A 3VLDA 3Q49B 4BTBA 4F1SA 3EJNA 1E8WA 3CVXA 3CVVA 5A6CA 3MV3B 1IHGA 2FEZA 3Q4AB 3FEXA 2XCCA 3L54A 4K03A 1HF8A 4CGWA 4BT8A 4URKA 2VGXA 3FUFA 3IKOB 4ACLA 3ONLA 2DIWA 3NZUA 2C2LA 1OWOA 2IONA 5DBKA 5LCWC 3CLJA 1FCHA 1OWLA 1IQRA 3N71A 1B89A 2Y4TA 4KVOA 4KVMA 4YVQC 1JPLA 1WY6A 1XGWA 4U0ZA 4DJAA 3RJVA 2L0IA 3FTSA 4LCTA 2UY1A 2XEVA 4I6JA 3LVQE 3T8MA 5T3RA 2JEKA 4JC8A 4HOUA 1HX8A 2AWIA 4EPZA 2L0TB 4UQXA 3PUJA 3CHOA 2JLBA 3SZ7A 4B94A 4L2LA 1UN9A 4JPSA 1UJKA 1DNPA 1H6KA 4GZ6A 4PDXA 4B8CB 5DIZA 4LUNU 4TV3A 2PL2A 4H7YA 4CCAA 1HU3A 3LY8A 4I6EA 2IQCA 3CVLA 3QK0A 4G1TA 4A1SA 5JJ6A 4I43A 1ELWA 2GRMA 3D9OA 3FHEA 3FY4A 3CHRA 4JXTA 3QOUA 2AW6A 4GA0A 4U0SA 4U63A 4JHRA 2IFUA 4JA7A 4WWOA 4JA9A 2WB2A 5KJLA 3RRUA 4B0ZA 4BY6A 3L13A 4GCOA 3ZPJA 3VTXA 3LKUA 1HZ4A 3L22A 3AS5A 1N52A 4I1AA 5CHEE 1DVPA 3ZXSA 3G2SA 3RRMB 4EZJA 1SZAA 4GMJA 4FJZA 2BF0X 3FDHA 5C2YA 1WAO1 4TRQA 3ZHEB 4XKBA 3MJWA 2L9BA 2BTDA 3AS8A 4U8HA 2HM8A 4FP7A 1OWNA 1ZU2A 2WXKA 5EKQD 4J8EA 3RIBA 3NF1A 2XGOA 4GMLA 3CVUA 3PE4A 4R7LA 2RG8A 3ZYLA 4C0EA 3MKQA 4O6FA 3CEQA 4IN3B 4QFVA 5D0QD 4HVBA 3I3NA 2Q7FA 2IU1A 1HFAA 3O48A 5ARFA 1NP7A 4FU3A 4U07A 2CFZA 4PS3A 3PNTB 1UG3A 3PDNA 4KT6B 2XHEA 4I17A 4XIFA 4G25A 2RD0A 3ENEA 2GGFA 1H2VC 3IBEA 2WXLA 3VTYA 3UT8A 3PH0C 5G2NA 1HG5A 3ASDA 3G2TA 4AV7A 3ASFA 3UT4A 4YVOA 5BNWA 2J4BA 2YQ8A 4Y6WA 4AXHA 5C1DA 2J07A 4UWGA 3ULQA 4WNGA 2WQ6A 3U4TA 4UI9C 3QWWA 3CVYA 2R17C 3MZLB 4PH4B 2PZIA 3R9AB 4N2QA 1FVFA 4XKCA 3CVQA 3MCXA 3G2VA 4N3AA 2VSOE 4GZCA 1YA0A 5FT9A 3MKRA 3D9JA 4TUUA 3ASGA 5G05J 4AJWA 2X6HA 4AY5A 3ZYKA 4L7TA 2LSVA 2WXNA 4HOSA 3L08A 3E4BA 4L2YA 3OXGA 2HYZA 4AIFA 4JZYA 5HQ8A 2QFCA 3T5XA 1KT0A 4KMOA 3CSTA 4GYWA 4P29A 3KEZA 3ZN3A 3LYAA 1EDUA 4EZLA 3AS4A 5AYWD 5JHBA 1Y8MA 2PQRA 5CCMA 3GZ2A 2V8SE 2WXRA 3ESKA 4LERA 3JQ0A 1OWPA 3U66A 4OVVA 5FQ6A 2XPIA 3FH7A 1JWGA 4JEHA 4UQYA 5G04C 4ACKA 4KYOB 1MHQA 4DI4A 3Q15A 2XPYA 4EZKA 2PM6A 5KJNA 3CGHA 4AVXA 1TJFA 2WXOA 4JL0A 3SHFA 4GYYA 2P58C 5FZSA 2QY7A 3NZSA 5EDSA 1VDYA 3FTUA 1NA0A 2XPZA 3SI5A 2IJGX 3EHNA 3JYSA 4L1BA 4UWKA 1H2UA 1TJCA 3I4GA 4I2ZA 1L5JA 4WWNA 1UW4B 2EQXA 3WXXA 2FULA 3LCAA 4OYSA 3ZEFA 3CVPA 4J8SA 3TG5A 2AVPA 2YHEA 5LFAA 2VGXB 2X3MA 3CK8A 3U9WA 2YNQA 5CMYA 4FHJA 3U3WA 3R7RA 3K9IA 4BFRA 2VJ8A 3DBSA 3IHYA 4NRHB 3CHSA 2FF4A 4ATGA 2XRZA 4GB9A 2FBNA 1PY1A 4J0UA 2KCKA 3QARA 2M63A 1GW6A 3HDXA 5AJDA 4WWPA 2NC9A 4D10C 4J8DA 2NSZA 2VTBA 4DI3A 4G2VA 2CHXA 1OWMA 3APDA 3CR3A 1EPUA 3FFLA 3D9KA 3S7DA 3CHPA 4F3VA 3EHMA 3UUXA 1SZ9A 2KC7A 3FUJA 3HYMB 4HXIA 1IYGA 1UN8A 3PVLA 5D0OD 3FUDA 1H0AA 4OVUA 4I6GA 3S7BA 4C9BB 1SQMA 3LVRE 3ZFWA 4GZ3A 4JHKA 3FUIA 4WUYA 1U3DA 3FU6A 4XI9A 2J4DA 3IEGA 4Y6CA 3B7RL 3PREA 3OXFA 4ABNA 5KJKA 4AY6A 1EF1C 2I2OA 4AOFA 4WAFA 3S7JA 3LY9A 3SGHA 2I6HA 3JQ1A 4ILGA 3VLEA 4FADA 1H2TC 2KM4A 2MHKA 5CMWA 4BX9A 1ELKA 4CT4A 5BPPA 2C0LA 4APFA 3ZIMA 3D3MA 4JW1A 4DLOA 4CDMA 4RSYA 3PUKA 3NQPA 1Y6IA 4GAAA 2OV8A 2CHZA 2VSNA 3O4ZA 4EBAG 4GA1A 2GRLA 5FZQA 4J6IA 1U3CA 4UI9J 3L17A 3CK9A 2LSUA 4I1MA 4DK5A 4CRWA 1N54A 4K0RA 4MRUA 3MV2B 2V0PA 5ENNA 4ANVA 4BTAA 3GZ1A 4BSXA 4CT0A 1JWFA 3QC1A 3SF4A 1UJJA 2NXPA 3PS6A 2VQ2A 1HG2A 4N3BA 4APOA 2FO7A 2WQHA 2A5UA 4E6HA 4DPRA 5LCWJ 4HOQA 1A17A 3G2UA 3HVEB 4GZDA 5LOZA 3MKQB 4CDNA 5FQ4A 5BW8C 3GYZA 4KZCA 4GU5A 3SBTB 4AP2A 1LF8A 4RVBA 2MRIA 2XCBA 4GA2A 2KCVA 4PUCA 3TXMA 5G05C 5A23A 5AENA 3PRZA 2Y4UA 3D9NA 4CEMA 4GYOA 4HLEA 2LNIA 2KCLA 1H19A 4ANWA 3TXNA 1BPOA 3CHMA 3ZYMA 4G26A 3UPVA 3FULA 3QNKA 4FULA 2C0MA 4GPKA 1ELRA 3TL5A 4NURA 2WM9A 3CKCA 1NZNA 3EIJA 4MS6A 2WMOA 4IULA 2WXIA 3UQ3A 3PEUB 5JJ7A 1EYHA 3EIQC 1QQEA 2VSYA 3KD7A 3S2AA 2DBAA 4N39A 4EQFA 2DCPA 3D9MA 3APFA 5KCMA 3LEWA 3FTZA 2PM7A 3ASHA 2LAHA 1FVHA 3TJPA 3ZYQA 1HE8A 4G24A 4ANUA 3T5VA 3FUKA 4FJYA 4A3VA 3TAXA 4A55A 2WXPA 4FC8A 2X38A 3CQGB 2VGYA 4XZ4A 4XI0A 1QZ2A 3SNXA 2X6KA 2IOLA 4I1OB 4E85A 4N3CA 3MEKA 3D9LA 5FWQA 4F53A 1HS6A 1S0PA 2I1KA 2CHWA 3APCA 3Q5MA 3RO3A 2ILRA 3CIAA 3FTWA 4UWLA 2XGMA 1IQUA 4BX8A 3RO2A 5BV1A 5LP0A 1ZBPA 4HORA 5E75A 2WXGA 3RK6A 3MYVA 4KXKB 3ZGQA 2VSXE 5HI7A 3CV0A 3MA5A 3QAQA 4N5CA 4Q96A 3ONKA 5CCLA 3R7QA 3FEYA 4G11A 4YNDA 3JUIA 4JHJA 2I9CA 3FUHA 4LRZA 2XGSA 5G55A 2A4ZA 1P5QA 5FQ7A 1E7VA 3ZRHA 5ANRA 1PC2A 3BEEA 2R5SA 5ANLA 2AXZA 5FZRA 5AJLA 1E8XA 5J90A 4Q94A 2X6FA 3UX4A 3SBSA 2J49A 3FTXA 3AU4A 2WXFA 4ILHB 2V4LA 4KZ0A 4UWHA 4GZ5A 4WNEA 4B89A 5KJMA 5E76A 1E8YA 2CFUA 1OUVA 3BG0B 3FWVA 2WVIA 3LDZA 4L23A 2IF4A 1E7UA 1WM5A 2WXHA 2WQ7A 3CKBA 2LO6A 3JCKC 3CSFA 3B13A 3OXLA 4AM9A 3FU5A 4JVSA 2BUGA 3DPDA 4ILIA 3OTNA 1Z3YA 3FP3A 3QDNA 3CVNA 5EX0A 2V5FA 3FH8A 3D9PA 3G2WA 3URZA 1NA3A 2WMNA 3SFZA 3L6AA 2VTBB 2YINA 4PS8A 4DLQA 2OVFA 3TG4A 1INZA 1HH8A 3QB2A 3GW4A 4UWFA 4F7AA 3HIZA 1E8ZA 4C0MA 2UWJG 3LXUX 3EDTB 3MX3A 3SD5A 5FTPA 2ONDA 4U04A 3OAWA 1HXIA 3FH5A 3MGBA 4I9CA 3ZW3A 3ZHEA 3LS8A 2ZU6B 1KLXA 4V3IA 5J08A 5LX8A 3LY7A 2XQ0A 2OVBA 4FA6A 2HR2A 3I5PA 4G23A 2I1JA 1TEZA 5G04J 3AU5A 2KZTB 2X6IA 1KT1A 2WXQA 3RRNB 3PEVB 3HHMA 3PE3A 2GW1A 5FQ8A 3CQCB 1HO8A 3ESLA 3I4RB 2XRYA 3QJZA 4NACA 2OOEA 3KAEA 4JEUA 3ML8A 3FTYA 3S7FA 3FU0A 3ZVVA 2KATA 1E90A 3FUEA 3L16A 1QNFA 4NQ0A 2YHCA 3B7UX 4FLBA 4I9EA 3D9IA 3FUMA 4ANXA 2WPVA 4M3OA 2Y3AA 3CK7A 4MKTA 4LEUA 5T4YA 4H7XA 3U64A 3RU0A 5M72A 2LAIA 2AXVA 4IRUA 1JUQA 3FUNA 1XNFA 4ME2A 4PS7A 4FLHA 5BUZA 3KS2A 4N2SA 4WNFA 1PAQA 3TGOA 5JHAA 1E96B 4I2WA 3IV0A 3HVEA 3CHQA 3BG1B 2UY1B 3CVWA 2J08A 3QWPA 5AIJA 2MOWA 1W3BA 4CDRA 4EECA 3IHVA 4BWRA 4WNDA 3P2BA 5BT1A 3PZDA 2R59A 4GCNA 4J8FA 3VLFA 1Z6TA 4AEZC 3RKVA 2PQNA 4IYPA 2IOSA 4Q69A 3QKYA 4HFGA 5EX3A 2FI7A 2L6JA 3PNLB 5ARGA 5BV0A 3B7TA 3QWVA 2AXUA 2J09A 4MLPA 3UMVA 4A1GA 3Q47B 1X5BA 5A7DB 1MQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M63 A;  4C0M A;  4BSX A; 
#chains in the Genus database with same CATH topology
 4XE0 A;  2H6G A;  5JJT A;  4HS2 A;  2WXJ A;  3FU3 A;  4U0U A;  3DXK G;  2OEV A;  3LJ3 A;  4U95 D;  3TWU A;  2VGE A;  4BT9 A;  2VYI A;  4FHK A;  3UT7 A;  4A3T A;  1X81 A;  3ML9 A;  3VLD A;  3EJN A;  3L82 A;  5A6C A;  5AAO A;  3FEX A;  4BT8 A;  2VGX A;  3FUF A;  3IKO B;  4ACL A;  2ION A;  5DBK A;  3UIP C;  1OWL A;  1IQR A;  2Y4T A;  4ZFH A;  1XGW A;  3RJV A;  4DUI A;  4LCT A;  2JEK A;  4JC8 A;  1HX8 A;  4A63 B;  2L0T B;  1N0R A;  4HNA D;  4UQX A;  3PUJ A;  2RFM A;  1UN9 A;  4B8C B;  4GZ6 A;  4PDX A;  5DIZ A;  3DSW A;  2DVW A;  3BQO A;  2PL2 A;  4CCA A;  3UI2 A;  3D9O A;  3CHR A;  4U63 A;  2IFU A;  4JA7 A;  3HXF A;  1DCQ A;  4I1A A;  1DVP A;  3RRM B;  3E34 A;  3UXG A;  3ZXP A;  4GMJ A;  4FJZ A;  3PZ3 A;  3ZHE B;  2F8Y A;  2F37 A;  4F1P A;  4U8H A;  5CEC B;  2QYJ A;  3CVU A;  4R7L A;  2RG8 A;  1NL4 A;  4HVB A;  3I3N A;  3ABM E;  2Q7F A;  1HFA A;  3O48 A;  3Q9N C;  4U07 A;  2CFZ A;  1QYM A;  2XHE A;  2KXP C;  2RD0 A;  4U7E B;  2EIK E;  1HG5 A;  4YVO A;  1MX6 A;  1N4Q A;  4UWG A;  3ULQ A;  4WNG A;  3U4T A;  3QWW A;  3MZL B;  1YMP A;  2ZXW E;  3CVQ A;  4GZC A;  3HG0 D;  5G05 J;  1H6P A;  2WXN A;  4HOS A;  4AIF A;  2QFC A;  1KT0 A;  4GTT A;  4KMO A;  1K1B A;  3JXJ A;  1BD8 A;  3C5R A;  2PQR A;  5CCM A;  3GZ2 A;  3ESK A;  2ETB A;  3FH7 A;  4UQY A;  5G04 C;  4ACK A;  1MHQ A;  4AVX A;  3FTU A;  2XPZ A;  1Z5S C;  3SFY A;  2EQX A;  3WXX A;  5D66 A;  4J8S A;  1WDY A;  2X3M A;  5HS0 A;  5CMY A;  3DXM G;  1NI1 A;  4YDE A;  5D2M C;  2VJ8 A;  4NRH B;  3CHS A;  2XRZ A;  1PY1 A;  1D8D A;  2QZA A;  4LG6 A;  5AJD A;  4WWP A;  2CHX A;  3UIO C;  1KZO A;  3APD A;  3UUX A;  2KC7 A;  1H0A A;  4F6R D;  3IEG A;  4Y6C A;  5KJK A;  2XEH A;  3OXF A;  4ABN A;  4AY6 A;  1EF1 C;  3S7J A;  3JQ1 A;  3VLE A;  4DLO A;  1A5E A;  4RSY A;  4GAA A;  2CHZ A;  4EBA G;  2GRL A;  4J6I A;  1U3C A;  3KSL A;  3ASO E;  4JD2 G;  4MRU A;  2A5E A;  4GTS A;  5CBO A;  4J8Y A;  2V0P A;  2OCC E;  3W9G A;  3E32 A;  1WG0 A;  5FIN A;  1HG2 A;  4APO A;  4E6H A;  4DPR A;  4HOQ A;  3RSE G;  5LOZ A;  5FQ4 A;  5BW8 C;  1LTX A;  3SBT B;  1LF8 A;  4RVB A;  2ZGD A;  1MX4 A;  2LNI A;  3BU8 A;  3ZYM A;  3FUL A;  4GPK A;  1NZN A;  5KNG A;  2WMO A;  5JJ7 A;  2VSY A;  3T9K A;  4EQF A;  3DSS A;  3FTZ A;  3X2Q E;  1HE8 A;  4G8K A;  4ANU A;  3FUK A;  4A3V A;  3TAX A;  2X38 A;  3CQG B;  2VGY A;  4QQI A;  3E33 A;  1S70 B;  4K5B A;  4HOR A;  3ABK E;  2VSX E;  2DYS E;  3FEY A;  5FQ7 A;  1U2V G;  3EHR A;  2R5S A;  5AJL A;  4Q94 A;  1FPP A;  3SBS A;  3FTX A;  2V4L A;  4WNE A;  4GZ5 A;  2GRR B;  2CFU A;  3SQV A;  2IF4 A;  1WM5 A;  5ENT D;  2LO6 A;  3B13 A;  4AM9 A;  3FU5 A;  4JVS A;  1Z3Y A;  3FP3 A;  4DX5 D;  3CVN A;  3FH8 A;  2YIN A;  3TG4 A;  4F7A A;  4C0M A;  2OND A;  3OAW A;  3ZHE A;  3EU5 A;  3LY7 A;  2XQ0 A;  4M7C A;  2HR2 A;  3I5P A;  5G04 J;  1KT1 A;  3HHM A;  3CQC B;  1OCR E;  3KAE A;  3S7F A;  2KAT A;  1E90 A;  3FUE A;  1QNF A;  3B7U X;  3CK7 A;  5M72 A;  5T4Y A;  4H7X A;  2AXV A;  1XNF A;  4ME2 A;  4N2S A;  5ENO D;  3EUV A;  4MBG A;  5JHA A;  3HVE A;  3BG1 B;  2UY1 B;  2F8X K;  4BWR A;  4GCN A;  1Z6T A;  2PQN A;  4GTP A;  2FI7 A;  1H6O A;  3B7T A;  2Y1L E;  3QWV A;  3Q7F A;  4A1G A;  1X5B A;  5A7D B;  1MQS A;  2E2E A;  4CGV A;  4W9R A;  5ENP D;  3C98 A;  4RG6 A;  1OCZ E;  3HRA A;  4XX5 A;  3IXE A;  4UI9 K;  5T8I A;  3FTV A;  2WXM A;  4KBQ A;  4F1S A;  2J9Q A;  3DSX A;  3LPZ A;  4DX7 D;  3MV3 B;  4K03 A;  3L54 A;  1HF8 A;  4URK A;  2DIW A;  4JB8 P;  1FCH A;  4YVQ C;  1WY6 A;  4U0Z A;  2L0I A;  3FTS A;  2UY1 A;  3LVQ E;  4HI8 A;  2F0Y A;  2DWZ A;  3PZ4 A;  3SZ7 A;  4B94 A;  4L2L A;  1K3Z D;  2MYO A;  4H7Y A;  3QK0 A;  2B6C A;  4G1T A;  4I43 A;  1ELW A;  2GRM A;  3UM0 A;  5ENQ D;  4C48 B;  1AWC B;  3DST A;  4U0S A;  4JHR A;  2WB2 A;  3L13 A;  3ZPJ A;  1YYH A;  3VTX A;  3LKU A;  1HZ4 A;  2XZD G;  3FDH A;  1SVX A;  2P9K G;  1ZU2 A;  5EKQ D;  4J8E A;  3RIB A;  3NF1 A;  3PE4 A;  4O6F A;  4QFV A;  2XS1 A;  1S63 A;  1TNB A;  1AP7 A;  4HB5 A;  3C3R A;  2IU1 A;  4PS3 A;  1UG3 A;  3PDN A;  3IBE A;  2WXL A;  4LNG A;  3UT8 A;  1N4R A;  3UT4 A;  5C1D A;  2L6B A;  3R9A B;  1O1R A;  1FVF A;  4N3A A;  3MKR A;  4TUU A;  3ZYK A;  1V55 E;  1IHB A;  2HYZ A;  3T5X A;  5CER B;  3CST A;  4P29 A;  3KEZ A;  3ZN3 A;  5BXO A;  5ITZ F;  4EZL A;  2V8S E;  4LER A;  1RZ4 A;  5CBN A;  2JAB A;  2XPI A;  4JEH A;  4KYO B;  1K1A A;  3Q15 A;  5FZS A;  5IY5 E;  3NZS A;  1NA0 A;  3SI5 A;  3JYS A;  4UWK A;  4I2Z A;  2FUL A;  4OYS A;  1DCE A;  2AVP A;  2VGX B;  2QYU A;  3U9W A;  4HRM B;  1BI8 B;  4FHJ A;  1YCS B;  3K9I A;  3DBS A;  3IHY A;  4GB9 A;  3EU9 A;  3NOC D;  3RAU A;  1OWM A;  3AAA C;  3HXD A;  4F3V A;  4X8Q A;  5D0O D;  1BI7 B;  3FUD A;  4TXP A;  4C9B B;  1SQM A;  2P9N G;  4JHK A;  3FUI A;  1N11 A;  2LXM A;  4ILG A;  4FAD A;  4BX9 A;  1ELK A;  3ZIM A;  3V30 A;  3NQP A;  4GA1 A;  4OAU C;  4UI9 J;  3CK9 A;  2LSU A;  4I1M A;  4BEP A;  2H6H A;  3T8K A;  3GZ1 A;  3QC1 A;  3SF4 A;  1UJJ A;  3PS6 A;  2VQ2 A;  1OY3 D;  2FO7 A;  2WQH A;  3E30 A;  2Y0B G;  3EHQ A;  5B1B E;  2MRI A;  1BU9 A;  4PUC A;  5G05 C;  5AEN A;  4RLY A;  2Y4U A;  4CEM A;  1FT1 A;  3PZ1 A;  2KCL A;  1N94 A;  4ANW A;  3TXN A;  3CHM A;  3UPV A;  4FUL A;  3QNK A;  3NBN B;  2C0M A;  3EIJ A;  3UQ3 A;  3PEU B;  5EIB E;  1QQE A;  3S2A A;  4N39 A;  2DCP A;  3APF A;  5KCM A;  2PM7 A;  3ASH A;  3R9M A;  3NAW A;  4XEI G;  3T5V A;  1TN6 A;  4XZ4 A;  1QZ2 A;  2X6K A;  4I1O B;  4N3C A;  2I1K A;  4TXQ A;  2CHW A;  3TWQ A;  3CIA A;  3FTW A;  4UWL A;  4BX8 A;  1IQU A;  5BV1 A;  3RK6 A;  3ZGQ A;  5HI7 A;  3CV0 A;  3MA5 A;  3ONK A;  4B93 B;  5CCL A;  5JA4 D;  4JHJ A;  2XGS A;  2A4Z A;  3HXE A;  1E7V A;  3ZRH A;  5ANR A;  3BEE A;  3UM1 A;  2AXZ A;  4K5C A;  1E8X A;  2P2C P;  4U8V D;  5KJM A;  2WXF A;  4KZ0 A;  4UWH A;  1OUV A;  3BG0 B;  3FWV A;  3LDZ A;  3OXL A;  2BUG A;  4ILI A;  3QDN A;  3URZ A;  3G2W A;  1NA3 A;  2WMN A;  2VTB B;  1INZ A;  3QB2 A;  3D9H A;  3HIZ A;  1E8Z A;  4HBD A;  1OXJ A;  3EDT B;  3MX3 A;  3SD5 A;  3ZKJ A;  3ZW3 A;  3KEA A;  3LS8 A;  1KLX A;  3ULE G;  5LX8 A;  4EHM A;  1TEZ A;  2IO3 C;  2KZT B;  2XZT G;  5FQ8 A;  1HO8 A;  5AQA A;  4NAC A;  4JEU A;  3ZVV A;  4NQ0 A;  2YHC A;  4FLB A;  2RFA A;  4MKT A;  4HI9 A;  2LAI A;  4IRU A;  2DZO A;  5BUZ A;  4WNF A;  3CHQ A;  3Q75 A;  3QWP A;  2GRP B;  4CDR A;  3DSV A;  2P9I G;  5BT1 A;  3DEO A;  3V31 A;  1TR4 A;  4IYP A;  3Q9U C;  1D8E A;  4HFG A;  5EX3 A;  5CEA A;  2L6J A;  3AG2 E;  2AXU A;  2J09 A;  1V54 E;  3UMV A;  4GTR A;  2IEJ A;  2R2L A;  2X6J A;  2XEE A;  4HLL A;  2KZT A;  4B8A A;  2CG2 A;  4RG9 A;  3SO8 A;  1JCR A;  4HOT A;  1O1T A;  4EBA A;  4UQZ A;  2E0I A;  3ISM C;  3P1U A;  3Q49 B;  3CVV A;  4CGW A;  1OWO A;  5KNH D;  5LCW C;  4KVO A;  3UM2 A;  4KVM A;  3TWV A;  3Q73 A;  2XEV A;  3ASN E;  4HOU A;  2AWI A;  4EPZ A;  2ZIR A;  4YDW A;  5HKP A;  4BES A;  3CHO A;  5EYL A;  4JPS A;  1UJK A;  1H6K A;  4LUN U;  4TV3 A;  3AG1 E;  4I6E A;  4A1S A;  3FHE A;  3QOU A;  4GA0 A;  4WWO A;  4JA9 A;  3RRU A;  4B0Z A;  1SW6 A;  2PNN A;  1N52 A;  3ZXS A;  5CHE E;  3G2S A;  4EZJ A;  2BF0 X;  5EYP F;  3MJW A;  2L9B A;  2HM8 A;  4FP7 A;  4C0E A;  3MKQ A;  3CEQ A;  4IN3 B;  5D0Q D;  5ARF A;  1NP7 A;  4FU3 A;  5CRV A;  2B0O E;  3PNT B;  4KT6 B;  3ABL E;  4YDY A;  4G25 A;  3ENE A;  2GGF A;  1H2V C;  2R02 A;  5EN5 D;  3SY2 A;  3PH0 C;  5G2N A;  3UM3 A;  3ASD A;  3G2T A;  3ASF A;  5BNW A;  2J4B A;  2YQ8 A;  4Y6W A;  4AXH A;  2J07 A;  4UI9 C;  2R17 C;  2PZI A;  4BSZ B;  4XKC A;  3MCX A;  3G2V A;  2VSO E;  3WG7 E;  4AY5 A;  2X6H A;  2LSV A;  3L08 A;  3E4B A;  3Q7A A;  4JZY A;  4Z68 A;  4GYW A;  1JCQ A;  3LYA A;  3AS4 A;  1Y8M A;  4BER A;  2WXR A;  3UIN C;  1OWP A;  1SA5 A;  3U66 A;  4OVV A;  5FQ6 A;  4DI4 A;  4EZK A;  1G3N B;  2PM6 A;  5KJN A;  1TJF A;  2WXO A;  4JL0 A;  4ATZ D;  4GYY A;  2P58 C;  5EDS A;  4L1B A;  1H2U A;  3I4G A;  4WWN A;  3ZEF A;  1QBQ A;  3DEP A;  5KWD A;  2YNQ A;  3U3W A;  1MZC A;  3R7R A;  3DRA A;  2FF4 A;  4K5A B;  3QAR A;  2M63 A;  1GW6 A;  3HDX A;  2NC9 A;  4DI3 A;  4G2V A;  3CR3 A;  4LNU D;  3D9K A;  2EIL E;  3EHM A;  3HYM B;  4HXI A;  4OVU A;  3W9F A;  3LVR E;  4CYM D;  2P9P G;  4GZ3 A;  5ENR D;  2J4D A;  3PRE A;  4AOF A;  2LXL A;  4WAF A;  3C3O A;  3LY9 A;  2I6H A;  2KM4 A;  5CMW A;  5BPP A;  3D3M A;  4CDM A;  4HQD A;  3O4Z A;  1N95 A;  1OT8 A;  2EIJ E;  5FZQ A;  4DK5 A;  1N54 A;  3MV2 B;  4BTA A;  5LCW J;  3HVE B;  4CZ2 D;  4GZD A;  4CDN A;  3GYZ A;  4KZC A;  4GTM A;  4GA2 A;  2XCB A;  2KCV A;  3Q78 A;  1TNZ A;  1N4S A;  4GTO A;  2RKK A;  2R05 A;  3D9N A;  4HLE A;  1H19 A;  3TWS A;  1BPO A;  4G26 A;  1TN7 A;  4NUR A;  3DWL G;  4MS6 A;  1O5M A;  4IUL A;  2WXI A;  3KD7 A;  4G8L A;  3D9M A;  3LEW A;  2LAH A;  1FVH A;  3TJP A;  4FJY A;  3C3Q A;  4A55 A;  2WXP A;  4FC8 A;  2HE0 A;  4RQI A;  4E85 A;  3MEK A;  5FWQ A;  4F53 A;  1HS6 A;  3APC A;  3RO3 A;  1NFI E;  2ILR A;  4GPM A;  5LP0 A;  1ZBP A;  5E75 A;  4N5C A;  3QAQ A;  3JUI A;  2I9C A;  3FUH A;  4LRZ A;  5G55 A;  1JCS A;  1PC2 A;  5ANL A;  3J5P A;  4HRN A;  5AQ9 A;  3UX4 A;  2J49 A;  5BXU A;  3AU4 A;  3BUA A;  1KZP A;  4L23 A;  1E7U A;  2WQ7 A;  3CKB A;  3JCK C;  4TUM A;  3CSF A;  3DPD A;  3OTN A;  3D9P A;  4GMR A;  3L6A A;  4LNB A;  4DLQ A;  2OVF A;  3GW4 A;  2ETA A;  2XS8 A;  3DSU A;  2UWJ G;  3LXU X;  2ZIS A;  2P9U G;  4U04 A;  3FH5 A;  3MGB A;  2ZU6 B;  4V3I A;  4FA6 A;  4G23 A;  3TWX A;  2X6I A;  1TN8 A;  3PEV B;  3PE3 A;  2NYJ A;  2GW1 A;  3I4R B;  3QJZ A;  2ETC A;  2FO1 E;  2OOE A;  2IY0 C;  5EIL A;  3TWR A;  3FUM A;  2WPV A;  1UOH A;  1SA4 A;  3ZU7 B;  3ZUV B;  1D9S A;  4PS7 A;  4DX1 A;  1N4P A;  1PAQ A;  1E96 B;  3B7B A;  4U8Y D;  3CVW A;  5AIJ A;  1W3B A;  3IHV A;  3PZD A;  1LD7 A;  3VLF A;  4AEZ C;  3RKV A;  2IOS A;  3QKY A;  4DX6 D;  3ULY A;  2ZGG A;  3Q47 B;  3GZS A;  2QC9 A;  1Z3X A;  2HO1 A;  2J8S D;  3B7S A;  1FT2 A;  5AN8 A;  5FJY A;  2CG3 A;  4BTB A;  3CVX A;  1O1S A;  1E8W A;  1TYQ G;  2BKK B;  1IHG A;  2FEZ A;  3Q4A B;  2XCC A;  3ONL A;  3NZU A;  2C2L A;  3UKU G;  3CLJ A;  3N71 A;  1B89 A;  1JPL A;  4DJA A;  5AQ7 A;  4LSZ E;  4I6J A;  3T8M A;  5T3R A;  2OEW A;  2JLB A;  2AJA A;  4HRL A;  1DNP A;  1HU3 A;  2EIN E;  3LY8 A;  2GRN B;  2IQC A;  3CVL A;  5JJ6 A;  3FY4 A;  3F6Q A;  4JXT A;  2AW6 A;  1IKN D;  5KJL A;  1Q2Z A;  4GCO A;  3J5Q B;  3L22 A;  3AS5 A;  5AAR A;  1SZA A;  3L9T A;  2DZN A;  5C2Y A;  1WAO 1;  4TRQ A;  4ZHB A;  4XKB A;  2BTD A;  3AS8 A;  1OWN A;  2WXK A;  4GML A;  2XGO A;  3ZYL A;  4NIK A;  4GTV A;  2V4H C;  3UKR G;  4I17 A;  4XIF A;  3VTY A;  3AG3 E;  4AV7 A;  2LUH A;  2P9S G;  3TWT A;  2WQ6 A;  3CVY A;  4PH4 B;  4N2Q A;  3AG4 E;  3HXB A;  1YA0 A;  5FT9 A;  5B1A E;  3D9J A;  4AJW A;  3ASG A;  4L7T A;  4L2Y A;  3OXG A;  1ZB1 A;  4BET A;  5HQ8 A;  3HXC A;  3LJN A;  1EDU A;  5AYW D;  5JHB A;  3V2X A;  2KBX A;  1LD8 A;  3JQ0 A;  1JWG A;  4DX2 A;  2XPY A;  3CGH A;  1OCO E;  5CRU A;  3SHF A;  2BKG A;  2QY7 A;  1VDY A;  2IJG X;  3EHN A;  1TJC A;  4OAV B;  1L5J A;  1UW4 B;  4O60 A;  3LCA A;  2GRQ B;  3CVP A;  5JMN D;  3TG5 A;  2YHE A;  5LFA A;  4O1O A;  3CK8 A;  1RW2 A;  5B3S E;  4BFR A;  5AQB A;  5EID A;  4ATG A;  2FBN A;  3V2O A;  3JUE A;  4J0U A;  2KCK A;  1TNU A;  2R03 A;  4D10 C;  4J8D A;  2NSZ A;  2VTB A;  1TNY A;  4U96 D;  3FFL A;  1EPU A;  3S7D A;  3CHP A;  1SZ9 A;  3UTM A;  3FUJ A;  1IYG A;  1UN8 A;  1BLX B;  3PVL A;  4TXR A;  3S7B A;  4I6G A;  3ZFW A;  4WUY A;  1U3D A;  3FU6 A;  4XI9 A;  2BED A;  3B7R L;  1TNO A;  2I2O A;  3B95 A;  3SFX A;  3SGH A;  1H2T C;  2MHK A;  4CT4 A;  2C0L A;  4APF A;  4JW1 A;  3KSQ A;  3PUK A;  1Y6I A;  2OV8 A;  2VSN A;  3E37 A;  5FIO A;  1IXV A;  3L17 A;  4CRW A;  4K0R A;  3DPY A;  4DRX E;  5ENN A;  4ANV A;  3TWW A;  4BSX A;  4GTQ A;  4CT0 A;  1JWF A;  2NXP A;  4N3B A;  1N0Q A;  2A5U A;  1A17 A;  3G2U A;  3MKQ B;  1MX2 A;  3JXI A;  3NB2 A;  4GU5 A;  4AP2 A;  2P9L G;  1N9A A;  3TXM A;  5A23 A;  2V5Q C;  3PRZ A;  1MYO A;  4GYO A;  1ELR A;  3TL5 A;  2WM9 A;  3CKC A;  1K8K G;  4J7W A;  1EYH A;  3EIQ C;  2DBA A;  3ZYQ A;  4G24 A;  3PZ2 A;  2IO2 C;  3SNX A;  4XI0 A;  2Y69 E;  2GRO B;  2IOL A;  3D9L A;  1S0P A;  4N5Q A;  3Q5M A;  2XGM A;  3RO2 A;  5HRY A;  2WXG A;  3MYV A;  4KXK B;  1KPS B;  4Q96 A;  3R7Q A;  4G11 A;  4YND A;  5H7P A;  1P5Q A;  5FZR A;  4UUC A;  5J90 A;  2X6F A;  3AJI A;  4ILH B;  4B89 A;  4L9P A;  5E76 A;  1E8Y A;  2WVI A;  2DYR E;  2WXH A;  2H6F A;  4O1P A;  5EX0 A;  2V5F A;  2EIM E;  3SFZ A;  1MJ0 A;  4PS8 A;  2H6I A;  1HH8 A;  4UWF A;  5FTP A;  1HXI A;  3Q79 A;  4I9C A;  5J08 A;  2OVB A;  2I1J A;  1S64 A;  3AU5 A;  3RRN B;  2WXQ A;  1DC2 A;  3ESL A;  2XRY A;  3NOG D;  5ENS D;  3ML8 A;  3FTY A;  3FU0 A;  3L16 A;  4I9E A;  3D9I A;  5CED B;  4ANX A;  4BY6 A;  4M3O A;  2XEN A;  2Y3A A;  3V79 K;  3U64 A;  4LEU A;  3RU0 A;  1JUQ A;  3FUN A;  4FLH A;  3KS2 A;  3ZNG A;  3TGO A;  4I2W A;  3IV0 A;  5KBA A;  2J08 A;  2MOW A;  4EEC A;  4WND A;  3P2B A;  2R59 A;  4J8F A;  1OCC E;  4Q69 A;  3PNL B;  5ARG A;  5BV0 A;  4MLP A;  3C72 A;  4YDO A; 
#chains in the Genus database with same CATH homology
 3GZS A;  4XE0 A;  5JJT A;  4HS2 A;  2E2E A;  2WXJ A;  3FU3 A;  4CGV A;  1Z3X A;  4U0U A;  2X6J A;  2HO1 A;  4W9R A;  3C98 A;  3LJ3 A;  3B7S A;  2KZT A;  4RG6 A;  4B8A A;  2CG2 A;  4RG9 A;  4XX5 A;  4HOT A;  4BT9 A;  2VYI A;  4UI9 K;  5FJY A;  3FTV A;  4UQZ A;  2WXM A;  5T8I A;  4EBA A;  4KBQ A;  2CG3 A;  4FHK A;  2E0I A;  3UT7 A;  2J9Q A;  3P1U A;  4A3T A;  3LPZ A;  3ML9 A;  3VLD A;  3Q49 B;  4BTB A;  4F1S A;  3EJN A;  1E8W A;  3CVX A;  3CVV A;  5A6C A;  3MV3 B;  1IHG A;  2FEZ A;  3Q4A B;  3FEX A;  2XCC A;  3L54 A;  4K03 A;  1HF8 A;  4CGW A;  4BT8 A;  4URK A;  2VGX A;  3FUF A;  3IKO B;  4ACL A;  3ONL A;  2DIW A;  3NZU A;  2C2L A;  1OWO A;  2ION A;  5DBK A;  5LCW C;  3CLJ A;  1FCH A;  1OWL A;  1IQR A;  3N71 A;  1B89 A;  2Y4T A;  4KVO A;  4KVM A;  4YVQ C;  1JPL A;  1WY6 A;  1XGW A;  4U0Z A;  4DJA A;  3RJV A;  2L0I A;  3FTS A;  4LCT A;  2UY1 A;  2XEV A;  4I6J A;  3LVQ E;  3T8M A;  5T3R A;  2JEK A;  4JC8 A;  4HOU A;  1HX8 A;  2AWI A;  4EPZ A;  2L0T B;  4UQX A;  3PUJ A;  3CHO A;  2JLB A;  3SZ7 A;  4B94 A;  4L2L A;  1UN9 A;  4JPS A;  1UJK A;  1DNP A;  1H6K A;  4GZ6 A;  4PDX A;  4B8C B;  5DIZ A;  4LUN U;  4TV3 A;  2PL2 A;  4H7Y A;  4CCA A;  1HU3 A;  3LY8 A;  4I6E A;  2IQC A;  3CVL A;  3QK0 A;  4G1T A;  4A1S A;  5JJ6 A;  4I43 A;  1ELW A;  2GRM A;  3D9O A;  3FHE A;  3FY4 A;  3CHR A;  4JXT A;  3QOU A;  2AW6 A;  4GA0 A;  4U0S A;  4U63 A;  4JHR A;  2IFU A;  4JA7 A;  4WWO A;  4JA9 A;  2WB2 A;  5KJL A;  3RRU A;  4B0Z A;  4BY6 A;  3L13 A;  4GCO A;  3ZPJ A;  3VTX A;  3LKU A;  1HZ4 A;  3L22 A;  3AS5 A;  1N52 A;  4I1A A;  5CHE E;  1DVP A;  3ZXS A;  3G2S A;  3RRM B;  4EZJ A;  1SZA A;  4GMJ A;  4FJZ A;  2BF0 X;  3FDH A;  5C2Y A;  1WAO 1;  4TRQ A;  3ZHE B;  4XKB A;  3MJW A;  2L9B A;  2BTD A;  3AS8 A;  4U8H A;  2HM8 A;  4FP7 A;  1OWN A;  1ZU2 A;  2WXK A;  5EKQ D;  4J8E A;  3RIB A;  3NF1 A;  2XGO A;  4GML A;  3CVU A;  3PE4 A;  4R7L A;  2RG8 A;  3ZYL A;  4C0E A;  3MKQ A;  4O6F A;  3CEQ A;  4IN3 B;  4QFV A;  5D0Q D;  4HVB A;  3I3N A;  2Q7F A;  2IU1 A;  1HFA A;  3O48 A;  5ARF A;  1NP7 A;  4FU3 A;  4U07 A;  2CFZ A;  4PS3 A;  3PNT B;  1UG3 A;  3PDN A;  4KT6 B;  2XHE A;  4I17 A;  4XIF A;  4G25 A;  2RD0 A;  3ENE A;  2GGF A;  1H2V C;  3IBE A;  2WXL A;  3VTY A;  3UT8 A;  3PH0 C;  5G2N A;  1HG5 A;  3ASD A;  3G2T A;  4AV7 A;  3ASF A;  3UT4 A;  4YVO A;  5BNW A;  2J4B A;  2YQ8 A;  4Y6W A;  4AXH A;  5C1D A;  2J07 A;  4UWG A;  3ULQ A;  4WNG A;  2WQ6 A;  3U4T A;  4UI9 C;  3QWW A;  3CVY A;  2R17 C;  3MZL B;  4PH4 B;  2PZI A;  3R9A B;  4N2Q A;  1FVF A;  4XKC A;  3CVQ A;  3MCX A;  3G2V A;  4N3A A;  2VSO E;  4GZC A;  1YA0 A;  5FT9 A;  3MKR A;  3D9J A;  4TUU A;  3ASG A;  5G05 J;  4AJW A;  2X6H A;  4AY5 A;  3ZYK A;  4L7T A;  2LSV A;  2WXN A;  4HOS A;  3L08 A;  3E4B A;  4L2Y A;  3OXG A;  2HYZ A;  4AIF A;  4JZY A;  5HQ8 A;  2QFC A;  3T5X A;  1KT0 A;  4KMO A;  3CST A;  4GYW A;  4P29 A;  3KEZ A;  3ZN3 A;  3LYA A;  1EDU A;  4EZL A;  3AS4 A;  5AYW D;  5JHB A;  1Y8M A;  2PQR A;  5CCM A;  3GZ2 A;  2V8S E;  2WXR A;  3ESK A;  4LER A;  3JQ0 A;  1OWP A;  3U66 A;  4OVV A;  5FQ6 A;  2XPI A;  3FH7 A;  1JWG A;  4JEH A;  4UQY A;  5G04 C;  4ACK A;  4KYO B;  1MHQ A;  4DI4 A;  3Q15 A;  2XPY A;  4EZK A;  2PM6 A;  5KJN A;  3CGH A;  4AVX A;  1TJF A;  2WXO A;  4JL0 A;  3SHF A;  4GYY A;  2P58 C;  5FZS A;  2QY7 A;  3NZS A;  5EDS A;  1VDY A;  3FTU A;  1NA0 A;  2XPZ A;  3SI5 A;  2IJG X;  3EHN A;  3JYS A;  4L1B A;  4UWK A;  1H2U A;  1TJC A;  3I4G A;  4I2Z A;  1L5J A;  4WWN A;  1UW4 B;  2EQX A;  3WXX A;  2FUL A;  3LCA A;  4OYS A;  3ZEF A;  3CVP A;  4J8S A;  3TG5 A;  2AVP A;  2YHE A;  5LFA A;  2VGX B;  2X3M A;  3CK8 A;  3U9W A;  2YNQ A;  5CMY A;  4FHJ A;  3U3W A;  3R7R A;  3K9I A;  4BFR A;  2VJ8 A;  3DBS A;  3IHY A;  4NRH B;  3CHS A;  2FF4 A;  4ATG A;  2XRZ A;  4GB9 A;  2FBN A;  1PY1 A;  4J0U A;  2KCK A;  3QAR A;  2M63 A;  1GW6 A;  3HDX A;  5AJD A;  4WWP A;  2NC9 A;  4D10 C;  4J8D A;  2NSZ A;  2VTB A;  4DI3 A;  4G2V A;  2CHX A;  1OWM A;  3APD A;  3CR3 A;  1EPU A;  3FFL A;  3D9K A;  3S7D A;  3CHP A;  4F3V A;  3EHM A;  3UUX A;  1SZ9 A;  2KC7 A;  3FUJ A;  3HYM B;  4HXI A;  1IYG A;  1UN8 A;  3PVL A;  5D0O D;  3FUD A;  1H0A A;  4OVU A;  4I6G A;  3S7B A;  4C9B B;  1SQM A;  3LVR E;  3ZFW A;  4GZ3 A;  4JHK A;  3FUI A;  4WUY A;  1U3D A;  3FU6 A;  4XI9 A;  2J4D A;  3IEG A;  4Y6C A;  3B7R L;  3PRE A;  3OXF A;  4ABN A;  5KJK A;  4AY6 A;  1EF1 C;  2I2O A;  4AOF A;  4WAF A;  3S7J A;  3LY9 A;  3SGH A;  2I6H A;  3JQ1 A;  4ILG A;  3VLE A;  4FAD A;  1H2T C;  2KM4 A;  2MHK A;  5CMW A;  4BX9 A;  1ELK A;  4CT4 A;  5BPP A;  2C0L A;  4APF A;  3ZIM A;  3D3M A;  4JW1 A;  4DLO A;  4CDM A;  4RSY A;  3PUK A;  3NQP A;  1Y6I A;  4GAA A;  2OV8 A;  2CHZ A;  2VSN A;  3O4Z A;  4EBA G;  4GA1 A;  2GRL A;  5FZQ A;  4J6I A;  1U3C A;  4UI9 J;  3L17 A;  3CK9 A;  2LSU A;  4I1M A;  4DK5 A;  4CRW A;  1N54 A;  4K0R A;  4MRU A;  3MV2 B;  2V0P A;  5ENN A;  4ANV A;  4BTA A;  3GZ1 A;  4BSX A;  4CT0 A;  1JWF A;  3QC1 A;  3SF4 A;  1UJJ A;  2NXP A;  3PS6 A;  2VQ2 A;  1HG2 A;  4N3B A;  4APO A;  2FO7 A;  2WQH A;  2A5U A;  4E6H A;  4DPR A;  5LCW J;  4HOQ A;  1A17 A;  3G2U A;  3HVE B;  4GZD A;  5LOZ A;  3MKQ B;  4CDN A;  5FQ4 A;  5BW8 C;  3GYZ A;  4KZC A;  4GU5 A;  3SBT B;  4AP2 A;  1LF8 A;  4RVB A;  2MRI A;  2XCB A;  4GA2 A;  2KCV A;  4PUC A;  3TXM A;  5G05 C;  5A23 A;  5AEN A;  3PRZ A;  2Y4U A;  3D9N A;  4CEM A;  4GYO A;  4HLE A;  2LNI A;  2KCL A;  1H19 A;  4ANW A;  3TXN A;  1BPO A;  3CHM A;  3ZYM A;  4G26 A;  3UPV A;  3FUL A;  3QNK A;  4FUL A;  2C0M A;  4GPK A;  1ELR A;  3TL5 A;  4NUR A;  2WM9 A;  3CKC A;  1NZN A;  3EIJ A;  4MS6 A;  2WMO A;  4IUL A;  2WXI A;  3UQ3 A;  3PEU B;  5JJ7 A;  1EYH A;  3EIQ C;  1QQE A;  2VSY A;  3KD7 A;  3S2A A;  2DBA A;  4N39 A;  4EQF A;  2DCP A;  3D9M A;  3APF A;  5KCM A;  3LEW A;  3FTZ A;  2PM7 A;  3ASH A;  2LAH A;  1FVH A;  3TJP A;  3ZYQ A;  1HE8 A;  4G24 A;  4ANU A;  3T5V A;  3FUK A;  4FJY A;  4A3V A;  3TAX A;  4A55 A;  2WXP A;  4FC8 A;  2X38 A;  3CQG B;  2VGY A;  4XZ4 A;  4XI0 A;  1QZ2 A;  3SNX A;  2X6K A;  2IOL A;  4I1O B;  4E85 A;  4N3C A;  3MEK A;  3D9L A;  5FWQ A;  4F53 A;  1HS6 A;  1S0P A;  2I1K A;  2CHW A;  3APC A;  3Q5M A;  3RO3 A;  2ILR A;  3CIA A;  3FTW A;  4UWL A;  2XGM A;  1IQU A;  4BX8 A;  3RO2 A;  5BV1 A;  5LP0 A;  1ZBP A;  4HOR A;  5E75 A;  2WXG A;  3RK6 A;  3MYV A;  4KXK B;  3ZGQ A;  2VSX E;  5HI7 A;  3CV0 A;  3MA5 A;  3QAQ A;  4N5C A;  4Q96 A;  3ONK A;  5CCL A;  3R7Q A;  3FEY A;  4G11 A;  4YND A;  3JUI A;  4JHJ A;  2I9C A;  3FUH A;  4LRZ A;  2XGS A;  5G55 A;  2A4Z A;  1P5Q A;  5FQ7 A;  1E7V A;  3ZRH A;  5ANR A;  1PC2 A;  3BEE A;  2R5S A;  5ANL A;  2AXZ A;  5FZR A;  5AJL A;  1E8X A;  5J90 A;  4Q94 A;  2X6F A;  3UX4 A;  3SBS A;  2J49 A;  3FTX A;  3AU4 A;  2WXF A;  4ILH B;  2V4L A;  4KZ0 A;  4UWH A;  4GZ5 A;  4WNE A;  4B89 A;  5KJM A;  5E76 A;  1E8Y A;  2CFU A;  1OUV A;  3BG0 B;  3FWV A;  2WVI A;  3LDZ A;  4L23 A;  2IF4 A;  1E7U A;  1WM5 A;  2WXH A;  2WQ7 A;  3CKB A;  2LO6 A;  3JCK C;  3CSF A;  3B13 A;  3OXL A;  4AM9 A;  3FU5 A;  4JVS A;  2BUG A;  3DPD A;  4ILI A;  3OTN A;  1Z3Y A;  3FP3 A;  3QDN A;  3CVN A;  5EX0 A;  2V5F A;  3FH8 A;  3D9P A;  3G2W A;  3URZ A;  1NA3 A;  2WMN A;  3SFZ A;  3L6A A;  2VTB B;  2YIN A;  4PS8 A;  4DLQ A;  2OVF A;  3TG4 A;  1INZ A;  1HH8 A;  3QB2 A;  3GW4 A;  4UWF A;  4F7A A;  3HIZ A;  1E8Z A;  4C0M A;  2UWJ G;  3LXU X;  3EDT B;  3MX3 A;  3SD5 A;  5FTP A;  2OND A;  4U04 A;  3OAW A;  1HXI A;  3FH5 A;  3MGB A;  4I9C A;  3ZW3 A;  3ZHE A;  3LS8 A;  2ZU6 B;  1KLX A;  4V3I A;  5J08 A;  5LX8 A;  3LY7 A;  2XQ0 A;  2OVB A;  4FA6 A;  2HR2 A;  3I5P A;  4G23 A;  2I1J A;  1TEZ A;  5G04 J;  3AU5 A;  2KZT B;  2X6I A;  1KT1 A;  2WXQ A;  3RRN B;  3PEV B;  3HHM A;  3PE3 A;  2GW1 A;  5FQ8 A;  3CQC B;  1HO8 A;  3ESL A;  3I4R B;  2XRY A;  3QJZ A;  4NAC A;  2OOE A;  3KAE A;  4JEU A;  3ML8 A;  3FTY A;  3S7F A;  3FU0 A;  3ZVV A;  2KAT A;  1E90 A;  3FUE A;  3L16 A;  1QNF A;  4NQ0 A;  2YHC A;  3B7U X;  4FLB A;  4I9E A;  3D9I A;  3FUM A;  4ANX A;  2WPV A;  4M3O A;  2Y3A A;  3CK7 A;  4MKT A;  4LEU A;  5T4Y A;  4H7X A;  3U64 A;  3RU0 A;  5M72 A;  2LAI A;  2AXV A;  4IRU A;  1JUQ A;  3FUN A;  1XNF A;  4ME2 A;  4PS7 A;  4FLH A;  5BUZ A;  3KS2 A;  4N2S A;  4WNF A;  1PAQ A;  3TGO A;  5JHA A;  1E96 B;  4I2W A;  3IV0 A;  3HVE A;  3CHQ A;  3BG1 B;  2UY1 B;  3CVW A;  2J08 A;  3QWP A;  5AIJ A;  2MOW A;  1W3B A;  4CDR A;  4EEC A;  3IHV A;  4BWR A;  4WND A;  3P2B A;  5BT1 A;  3PZD A;  2R59 A;  4GCN A;  4J8F A;  3VLF A;  1Z6T A;  4AEZ C;  3RKV A;  2PQN A;  4IYP A;  2IOS A;  4Q69 A;  3QKY A;  4HFG A;  5EX3 A;  2FI7 A;  2L6J A;  3PNL B;  5ARG A;  5BV0 A;  3B7T A;  3QWV A;  2AXU A;  2J09 A;  4MLP A;  3UMV A;  4A1G A;  3Q47 B;  1X5B A;  5A7D B;  1MQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...