2M63A

The protease-resistant n-terminal domain of tir-domain containing adaptor molecule-1, ticam-1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
157
Chain Sequence
HMACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-terminal domain of TIR domain-containing adaptor molecule-1, TICAM-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TIR domain-containing adapter molecule 1
total genus 36
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17798 TRIF-NTD TRIF N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.780 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2m63A00
2M63A 4BSXA 4C0MA
chains in the Genus database with same CATH superfamily
4N2QA 1HO8A 4FC8A 5B1AE 2IOSA 1W3BA 4HQDA 4X8QA 1MX4A 4H7YA 4XI9A 1HF8A 3V30A 5EKQD 2PQNA 5T4YA 3DWLG 4GTOA 4HNAD 3E30A 1BPOA 1U2VG 2J8SD 1N95A 2XRYA 5LP0A 3FEXA 2IFUA 3ZU7B 3NF1A 4I43A 4FA6A 4HRMB 3C72A 4LRZA 1U3DA 3V31A 3SNXA 3EUVA 1D8EA 3ENEA 1L5JA 2XEHA 2YINA 2WMNA 2AVPA 4PH4B 4JPSA 3VLFA 1LD8A 3HIZA 4RQIA 4AEZC 5ENNA 4LG6A 5FJYA 3SFYA 3ZYQA 2C2LA 4LERA 4DRXE 3NOCD 4C0MA 3PREA 4JA7A 4XZ4A 1NA0A 2X3MA 2YHCA 3NZUA 3APCA 3Q5MA 4ZFHA 2P2CP 3FH7A 4UQZA 3VLEA 2HR2A 3SGHA 3J5PA 3OXFA 4XX5A 4UUCA 4HOUA 2LUHA 3UM2A 3UT8A 1IQRA 2HYZA 4ANWA 2OCCE 3FUHA 4R7LA 4U8VD 5EIDA 2R05A 1SW6A 5AARA 1BI7B 1EYHA 2OVFA 1KZPA 4I6EA 5CCLA 1EPUA 3TWXA 1NA3A 1X5BA 1ZBPA 4NQ0A 2P9NG 5CMWA 2WQHA 3DSVA 4NIKA 4CDRA 3MV2B 1K1BA 3ZHEA 3LY9A 2CHXA 1FCHA 3B7TA 5JHBA 4U96D 4UQYA 2R02A 4MBGA 2IU1A 2FO1E 4GZ6A 3E33A 4FP7A 4FLBA 1Y6IA 1V54E 3MZLB 3S7DA 3U64A 3ASNE 5T8IA 2FEZA 2L0IA 1H19A 4O60A 1ZU2A 3CGHA 4I2ZA 3U66A 2ZIRA 3KAEA 3TWRA 4J8FA 5LFAA 3CVNA 3JUIA 3RK6A 1TEZA 3RIBA 1MX2A 2AXZA 2IONA 2WXOA 1WDYA 3F6QA 4N3AA 3AU4A 3TWVA 1FPPA 4CDMA 4GTSA 3SO8A 3KS2A 4JVSA 3HVEA 1N4PA 4WNFA 1IQUA 5FINA 3BG0B 2BKGA 4A3TA 3C3OA 2F8YA 3CVVA 3BQOA 4BTBA 3AS5A 1Z6TA 4GMLA 3UI2A 1BLXB 3LVQE 2LAIA 3DEPA 4U95D 4M7CA 4JEHA 2Y3AA 3FULA 3ASOE 2EIKE 1IKND 4I1MA 5EYLA 3U9WA 3T9KA 2XGOA 3EIJA 3JXJA 4GYYA 5A23A 4KVOA 3S7FA 4D10C 2Y69E 1E8ZA 2PM7A 1OWOA 1U3CA 1N11A 1H6PA 2HE0A 3TAXA 4B0ZA 1XGWA 2A5UA 1H2VC 3CK8A 4GPMA 3RRNB 3D9LA 2YQ8A 4DX2A 3CVLA 3CIAA 3CHPA 4JEUA 4AY5A 2KATA 2OOEA 2E0IA 4F6RD 1O5MA 4TUMA 4CRWA 3FTSA 3QDNA 2WXRA 3JXIA 4C48B 3CK9A 1YYHA 4XKBA 4WNGA 4RG6A 4KZ0A 2UWJG 4JC8A 4ATZD 4GTMA 4GB9A 2X6HA 2V8SE 2JLBA 3W9GA 3L6AA 5AQAA 5EIBE 4A63B 5G05J 3RSEG 1E96B 3U3WA 3QC1A 2R17C 2E2EA 2J07A 2WXMA 3G2VA 2WB2A 1AWCB 4WNEA 4JD2G 1TN8A 4XE0A 3ASFA 2MYOA 2X6KA 1NZNA 2P58C 4GU5A 2LO6A 2BEDA 1D9SA 4JXTA 3AG2E 4BERA 3UM1A 3FH8A 3OAWA 1OCRE 5CEDB 2NSZA 3JCKC 4WWNA 1MJ0A 2R59A 4LEUA 4U0ZA 4V3IA 2L9BA 3TGOA 4CYMD 3ZW3A 3FUKA 3D9OA 1HFAA 1KZOA 3Q15A 4GTRA 2X38A 4FU3A 2ZGGA 3CHMA 5E75A 5D2MC 4A1GA 4LUNU 4ILGA 4BT8A 3ZN3A 5B1BE 4BEPA 3L82A 4AIFA 1JCQA 2V5QC 3JQ0A 4UI9C 2V5FA 3UT4A 2R2LA 3QJZA 2IQCA 4HRLA 5BNWA 2C0MA 1JWFA 2J4BA 4F7AA 3MGBA 3MKQB 2GRMA 3SFZA 2H6GA 2QC9A 5C2YA 4EHMA 5JJ6A 4IN3B 1SZ9A 4G23A 1NI1A 3CQCB 3C3RA 3NOGD 2ETBA 5ANLA 4U8HA 2BF0X 3LS8A 5BT1A 4W9RA 4MKTA 4AXHA 4GA0A 4EZJA 1XNFA 5LOZA 4FADA 3RJVA 2KM4A 2MOWA 4CCAA 4U07A 4BY6A 3CHQA 3HRAA 4IYPA 1YMPA 3QK0A 1E8XA 3CVYA 5CECB 4B8AA 3CVPA 2F8XK 3PE4A 3D9NA 1NP7A 5FWQA 2AJAA 3FUEA 2WXHA 5G04J 3WXXA 1WG0A 4BWRA 1KT1A 4ME2A 4O1OA 4AOFA 2KCKA 3AG3E 3ULYA 2ONDA 2Q7FA 5EX3A 3ASHA 3FDHA 3ZEFA 5FQ4A 1H6OA 5BUZA 2PQRA 5JA4D 3L9TA 4GMRA 1ELRA 3ASGA 4UWGA 1EDUA 1RW2A 4K5CA 3FU5A 3VTYA 1EF1C 2KCLA 1N4RA 4GZ5A 4G26A 3Q7AA 1INZA 3FTXA 3FU6A 1OCCE 3I3NA 2PM6A 4BX8A 4ACLA 5J90A 5HRYA 1MX6A 1JUQA 1JCRA 4JZYA 2WQ6A 3Q9UC 5CRVA 3RKVA 1KT0A 2V0PA 1FT2A 4L2LA 2EINE 2IOLA 3MX3A 3R9AB 3UIPC 2P9SG 3SF4A 2V4HC 5G05C 1LD7A 1SA5A 3T8KA 2XQ0A 3CEQA 2YNQA 3ML8A 1JCSA 4Q69A 3DPDA 4JW1A 3C3QA 4LCTA 3UQ3A 3FTWA 3L54A 4HBDA 3UTMA 1OXJA 5EN5D 1S63A 2AW6A 3IV0A 1MHQA 4HOTA 2WXLA 4CGWA 4PS3A 1OWNA 4Q96A 1WM5A 3AAAC 2QYUA 3IHYA 2ETCA 2IO2C 4YVOA 3PRZA 3BUAA 3ZFWA 1ZB1A 3PZDA 4G8LA 2Y0BG 3I4GA 3FH5A 3Q79A 2HM8A 2H6HA 1UG3A 3HXEA 5FQ7A 2KZTA 4HI9A 5FZQA 4DI3A 4MS6A 4G2VA 1WAO1 2XCCA 4XKCA 4FJZA 4HFGA 5BW8C 4GMJA 4UWHA 1N9AA 1HXIA 3OXGA 2LXLA 3FEYA 2FI7A 5A6CA 3P2BA 3S7JA 5ITZF 3SBTB 3EIQC 3DPYA 1YA0A 2WQ7A 1HZ4A 3GZ1A 3FHEA 2MHKA 3ZIMA 3MEKA 3GW4A 5FZRA 4KXKB 1DNPA 1BI8B 5D66A 2OVBA 3RRMB 2YHEA 4FLHA 2AWIA 4RG9A 2VGXA 1JWGA 1Z3YA 4FJYA 3E34A 3V79K 2WMOA 1TNZA 3SHFA 5JJTA 3L13A 1H6KA 3CVQA 3HDXA 5CCMA 2LNIA 3EHNA 3LXUX 3EHQA 2NXPA 2ZXWE 4KYOB 4GCOA 3PEVB 3E32A 5CERB 3IKOB 3AS8A 3FTZA 4C0EA 4KVMA 1OCZE 4CEMA 2XZTG 3DSSA 3IBEA 3W9FA 1RZ4A 4JHRA 4F1PA 4LSZE 3MA5A 3CHOA 3JYSA 3DSWA 3ISMC 2WPVA 1TN6A 1S70B 3RRUA 1ELKA 4J8DA 1BU9A 3AG4E 2GGFA 4BX9A 4YDOA 3LPZA 3D9IA 2AXVA 4U8YD 5CHEE 5EILA 2XPYA 4J7WA 2UY1B 1HH8A 3P1UA 1KPSB 2VGXB 4YNDA 3UT7A 3QKYA 3B7SA 3TWTA 1O1RA 3PVLA 1UJKA 4YDEA 5LCWJ 5LX8A 4I17A 5KBAA 4JA9A 2C0LA 2AXUA 1NL4A 2L6JA 1WY6A 4K5AB 2J08A 3NQPA 3I4RB 2RG8A 2LSVA 3BU8A 4OAUC 4XIFA 3PUJA 1SQMA 4KBQA 3ABKE 4AM9A 2LXMA 1IHBA 3FY4A 5D0OD 1E90A 1FVFA 4ATGA 1S0PA 3V2XA 3DEOA 4UWLA 5CEAA 3CR3A 3LDZA 3PNLB 4OYSA 4BSZB 4U04A 4HRNA 3AU5A 3DBSA 3UMVA 2VGYA 3MKRA 4QFVA 2OEVA 1E7UA 5KJNA 4G11A 3Q4AB 3TWQA 4WWOA 1KLXA 3FU3A 5HQ8A 4ILIA 4E85A 2JEKA 3QARA 3GZSA 1BD8A 2A5EA 3ESLA 5BV1A 2DVWA 2GRNB 3SI5A 4HVBA 3ML9A 4RSYA 2R5SA 4CDNA 2DYSE 3C5RA 3T5VA 5AYWD 4GZ3A 4CGVA 2XPIA 3PS6A 3LY7A 3FFLA 1QNFA 4PS8A 4L23A 4BT9A 1OT8A 3PH0C 4GA2A 3PUKA 4TXQA 4N5QA 2IF4A 2DBAA 3ZYKA 2J4DA 4TV3A 4F53A 4EECA 1K1AA 1OWLA 4J0UA 3QOUA 1B89A 2P9PG 1TYQG 4RVBA 1Q2ZA 3DSXA 2PL2A 4BFRA 3FP3A 3AG1E 3ZRHA 4HOSA 1OY3D 1LF8A 3LCAA 4DUIA 3EU5A 4EBAG 3FU0A 5G55A 1E7VA 2CFUA 2NYJA 4P29A 5HS0A 4UQXA 4LNUD 3NB2A 4ZHBA 3TG4A 2EIME 3S2AA 4NRHB 3AJIA 3E4BA 3GYZA 3ZYLA 4JL0A 2PNNA 4GTPA 3B95A 4WAFA 3ABME 3APFA 2X6JA 2P9UG 4XEIG 2ZISA 2VJ8A 3UM3A 1H2UA 2P9IG 3HXBA 2M63A 2ZU6B 1TJCA 3Q47B 3O48A 4N5CA 3HXFA 4HORA 3ZHEB 2DZNA 1O1TA 2ETAA 1Y8MA 3U4TA 4O1PA 5CBNA 4UI9J 3X2QE 4O6FA 2MRIA 2J09A 3PNTB 5BPPA 3I5PA 4I9CA 1Z5SC 4APFA 3AS4A 2XCBA 2FBNA 4I6JA 3ZYMA 2CHWA 4DX7D 3JQ1A 4F1SA 4AP2A 1JPLA 3Q49B 3TJPA 4N3BA 2WXPA 4F3VA 2NC9A 4XI0A 1X81A 4CT0A 2GW1A 2I9CA 2IO3C 4HS2A 4KMOA 1IYGA 2Y4UA 4ANXA 1HS6A 1HG5A 2VGEA 3HG0D 3Q75A 4Y6CA 2P9KG 3HHMA 3ZNGA 1DC2A 3MCXA 3KD7A 1DVPA 3HVEB 3RAUA 4BTAA 1N52A 2DCPA 4U63A 3FTVA 3HXDA 1TNOA 1K8KG 4N39A 5AIJA 4YDYA 1HE8A 2OV8A 3KSLA 1TNUA 3L17A 2DWZA 1UJJA 5A7DB 2I1KA 3QB2A 2KCVA 4N2SA 2X6FA 5AJLA 2KZTB 3E37A 3ONKA 3CVUA 5KJMA 3RO2A 4TXRA 1S64A 2DZOA 3CLJA 4BSXA 5CBOA 4LNGA 2RFMA 2BUGA 4GYWA 2DIWA 3EJNA 1N94A 3CSTA 2FO7A 1G3NB 4ACKA 2WM9A 3IXEA 5AQ7A 5FTPA 3EHRA 2VSYA 3BEEA 4FULA 3UX4A 4Q94A 4GTQA 3VLDA 4L2YA 3L16A 2XHEA 3L22A 3TXNA 5HKPA 2KBXA 2WXQA 4IRUA 5AAOA 1QQEA 4FHJA 5JJ7A 1O1SA 4A3VA 3MYVA 4I1AA 3RO3A 3SFXA 5JHAA 1N0QA 2Y4TA 3MKQA 4CT4A 2R03A 3OTNA 2I2OA 3GZ2A 3LKUA 5AQBA 5JMND 4GA1A 2P9LG 1FT1A 2VSOE 4G8KA 1IHGA 5KJLA 3KEZA 2UY1A 1QYMA 5KNGA 3PZ3A 1VDYA 4UWKA 4OAVB 3ASDA 4B89A 5EYPF 4U7EB 1SVXA 4L7TA 2A4ZA 5FQ8A 4G25A 1MQSA 4EZLA 4H7XA 1YCSB 4ILHB 1TJFA 5DBKA 5M72A 3CK7A 1N0RA 3G2UA 4JHJA 3ZXSA 4JB8P 4CZ2D 3R7QA 2XGMA 5C1DA 2IJGX 3FUNA 3Q73A 3DSTA 4GCNA 3CHSA 4PS7A 1DCQA 4OVVA 4YVQC 4DI4A 5B3SE 3QNKA 2DYRE 1HX8A 3NAWA 3IHVA 4WUYA 4G1TA 1E8YA 3WG7E 3OXLA 4GPKA 4K0RA 1TR4A 5G04C 3NZSA 5KWDA 5CMYA 4I6GA 5E76A 5HI7A 3PEUB 4DLQA 3MJWA 1H2TC 2WXNA 4DK5A 2ZGDA 1LTXA 2GRQB 3UKUG 3ULQA 5ENSD 4ABNA 2WVIA 4AVXA 3SD5A 3RU0A 1TNBA 3QWWA 4KZCA 1GW6A 4E6HA 2BKKB 1MZCA 3R9MA 1UOHA 5G2NA 3TWWA 1A5EA 1N4QA 4I2WA 2L0TB 1D8DA 2RFAA 2CG3A 3LY8A 4Y6WA 3G2WA 3D9MA 3QWVA 3KSQA 4AV7A 3D9KA 1AP7A 4HOQA 3TWUA 4MLPA 2XEEA 3V2OA 4EZKA 2IY0C 3LVRE 1NFIE 2WXFA 1OWMA 3CKBA 3TL5A 2EQXA 3SQVA 5T3RA 2VSNA 5D0QD 3EDTB 1A17A 4EQFA 5DIZA 4PDXA 3J5QB 3TXMA 5BXOA 2EILE 5ENPD 3DXMG 5LCWC 1SA4A 4A1SA 2V4LA 2PZIA 3CQGB 3D3MA 5BV0A 2H6FA 2KXPC 3QWPA 2WXIA 3C98A 3QAQA 2VQ2A 5ARGA 4GTTA 5ENTD 3DSUA 3PZ1A 4UI9K 4U0SA 4PUCA 2IEJA 2LSUA 2RD0A 3Q9NC 3UKRG 2QYJA 3SY2A 2J9QA 2CG2A 3B7BA 5J08A 2WXGA 2CHZA 5AN8A 1N4SA 1QZ2A 2FULA 3N71A 3JUEA 4URKA 1FVHA 3ZUVB 4DLOA 4HB5A 2B0OE 4TRQA 3ONLA 3FUJA 5FIOA 3CHRA 4WNDA 4DX5D 4J8SA 1N54A 3PDNA 3EHMA 5H7PA 3L08A 3FUIA 2LAHA 4HI8A 5CRUA 4B93B 4I9EA 4J8EA 3DRAA 3MV3B 2F37A 4N3CA 2XS8A 3CVXA 4YDWA 5AENA 4K03A 2F0YA 3FTYA 4HXIA 2XGSA 3CVWA 5ENOD 2WXJA 3UINC 3LJ3A 1TN7A 3CSFA 2FF4A 2KC7A 2L6BA 3UUXA 3BG1B 2I1JA 3FUMA 4GTVA 3DXKG 1PAQA 3FWVA 1ELWA 2QY7A 2XRZA 4BESA 4HLLA 4HLEA 2XZDG 2Y1LE 5KCMA 1DCEA 1IXVA 3KEAA 3HXCA 4WWPA 3APDA 1PC2A 4APOA 4C9BB 4DX6D 1PY1A 3B7UX 5FZSA 4LNBA 3LJNA 3URZA 4I1OB 2BTDA 4AJWA 4GZCA 3NBNB 3G2SA 1UN8A 5ENQD 1MYOA 4L9PA 5FT9A 1HU3A 3ZVVA 3FTUA 3K9IA 4B94A 2WXKA 1P5QA 4RLYA 4GZDA 3LYAA 3CKCA 4B8CB 4DPRA 3ZKJA 3HYMB 1QBQA 3SZ7A 5KNHD 5BXUA 2VTBB 5EX0A 4EBAA 3VTXA 1H0AA 2QZAA 3ZPJA 5IY5E 3TG5A 3ESKA 3O4ZA 1HG2A 4K5BA 1V55E 2CFZA 3IEGA 3R7RA 5ANRA 4M3OA 3TWSA 2X6IA 2GRRB 2VTBA 1OCOE 1Z3XA 2XENA 1TNYA 4QQIA 2XEVA 3G2TA 3D9JA 4OVUA 4IULA 3D9PA 2ILRA 1UN9A 4NURA 4J8YA 3UIOC 2EIJE 3SBSA 3ULEG 4DX1A 1K3ZD 2OEWA 2VYIA 2GRLA 3T8MA 3PE3A 5AJDA 3LEWA 4BETA 4UWFA 2XPZA 5AQ9A 4GYOA 4TUUA 1E8WA 2HO1A 4DJAA 3FUDA 3B7RL 3Q78A 3S7BA 3UPVA 5KJKA 2GROB 4TXPA 3CV0A 4ANVA 3ABLE 4AY6A 2I6HA 4A55A 5ENRD 4NACA 4GAAA 1SZAA 4Z68A 2JABA 4G24A 4FHKA 1OWPA 2VSXE 1OUVA 3T5XA 5FQ6A 3Q7FA 4J6IA 3UM0A 2RKKA 4ANUA 3B13A 4MRUA 2GRPB 3PZ4A 4L1BA 2B6CA 3D9HA 2QFCA 4KT6B 3ZGQA 2XS1A 3UXGA 2J49A 3FUFA 5ARFA 2H6IA 4U0UA 1UW4B 4JHKA 3ZXPA 5EDSA 4EPZA 3EU9A 3PZ2A
chains in the Genus database with same CATH topology
2CG3A 3LY8A 4N2QA 4Y6WA 3G2WA 3D9MA 3QWVA 2J4BA 4F7AA 4AV7A 1HO8A 3ESLA 4FC8A 3D9KA 5BV1A 2IOSA 4HOQA 1W3BA 3MGBA 3MKQB 4MLPA 2GRMA 3SFZA 4H7YA 4XI9A 1HF8A 5C2YA 4EZKA 5EKQD 2PQNA 5T4YA 3SI5A 4HVBA 5JJ6A 4IN3B 3LVRE 3ML9A 4RSYA 2R5SA 1SZ9A 2WXFA 1BPOA 4CDNA 1OWMA 3CKBA 4G23A 3TL5A 2EQXA 5T3RA 3T5VA 5AYWD 2XRYA 3CQCB 4GZ3A 5LP0A 3FEXA 5ANLA 4CGVA 2VSNA 5D0QD 2IFUA 2XPIA 3NF1A 4I43A 3EDTB 3PS6A 4U8HA 3LY7A 2BF0X 3LS8A 4FA6A 5BT1A 3FFLA 4W9RA 1A17A 1QNFA 1U3DA 4LRZA 4MKTA 4L23A 4PS8A 3SNXA 4BT9A 4EQFA 4AXHA 4GA0A 5DIZA 4EZJA 4PDXA 1XNFA 3PH0C 5LOZA 4GA2A 4FADA 3ENEA 3PUKA 3RJVA 3TXMA 2KM4A 1L5JA 2IF4A 2MOWA 2DBAA 2YINA 4CCAA 4U07A 2WMNA 3ZYKA 2AVPA 4BY6A 2J4DA 4TV3A 3CHQA 4F53A 4IYPA 4EECA 4PH4B 3QK0A 1OWLA 4JPSA 3VLFA 3CVYA 3HIZA 4B8AA 4J0UA 3CVPA 3PE4A 3D9NA 3QOUA 1NP7A 4AEZC 1B89A 5ENNA 5FWQA 5LCWC 4A1SA 3FUEA 2V4LA 1JWFA 4RVBA 2WXHA 5FJYA 2PL2A 3ZYQA 2PZIA 4BFRA 2C2LA 4LERA 3CQGB 3D3MA 5G04J 3WXXA 5BV0A 3FP3A 4C0MA 4BWRA 1KT1A 3PREA 4ME2A 4JA7A 4XZ4A 3ZRHA 4HOSA 1NA0A 2X3MA 2YHCA 3NZUA 4AOFA 3APCA 1LF8A 2KCKA 3QWPA 3LCAA 2ONDA 3Q5MA 2Q7FA 2WXIA 4EBAG 3C98A 3FH7A 4UQZA 3ASHA 3FU0A 3QAQA 5EX3A 2VQ2A 3VLEA 2HR2A 3FDHA 3SGHA 5ARGA 5FQ4A 3ZEFA 3OXFA 5BUZA 4XX5A 4HOUA 2PQRA 5G55A 1E7VA 2CFUA 3UT8A 1ELRA 1IQRA 2HYZA 3ASGA 4P29A 4ANWA 4UI9K 4U0SA 3FUHA 4PUCA 4UWGA 1EDUA 4UQXA 2LSUA 4R7LA 2RD0A 3TG4A 3FU5A 3S2AA 3VTYA 1EF1C 4NRHB 3E4BA 2KCLA 1EYHA 4GZ5A 2J9QA 2OVFA 4G26A 4I6EA 5CCLA 2CG2A 3GYZA 3ZYLA 1INZA 1EPUA 3FTXA 3FU6A 1NA3A 1X5BA 5J08A 1ZBPA 4JL0A 3I3NA 2PM6A 2WXGA 4NQ0A 4ACLA 4BX8A 5J90A 2CHZA 4WAFA 5CMWA 3APFA 2X6JA 2WQHA 1QZ2A 2FULA 2VJ8A 4CDRA 3N71A 1H2UA 1JUQA 3MV2B 3ZHEA 2M63A 2ZU6B 4JZYA 4URKA 2WQ6A 3RKVA 1TJCA 3Q47B 1FVHA 1KT0A 3O48A 4N5CA 3LY9A 4DLOA 2CHXA 1FCHA 2V0PA 3B7TA 4L2LA 4TRQA 3ONLA 5JHBA 3FUJA 4HORA 4UQYA 3CHRA 4WNDA 3ZHEB 4J8SA 2IOLA 1N54A 3MX3A 3PDNA 3R9AB 3EHMA 1Y8MA 3L08A 3FUIA 2LAHA 3U4TA 4UI9J 3SF4A 5G05C 2IU1A 4O6FA 2MRIA 2J09A 3PNTB 4I9EA 4GZ6A 3I5PA 5BPPA 4I9CA 4J8EA 3MV3B 4N3CA 2XQ0A 3CEQA 4FP7A 2YNQA 3ML8A 4APFA 3CVXA 4Q69A 5AENA 3DPDA 3AS4A 4FLBA 4JW1A 1Y6IA 4K03A 2XCBA 3MZLB 2FBNA 3FTYA 4I6JA 3ZYMA 4HXIA 2XGSA 3S7DA 4LCTA 3U64A 3UQ3A 3CVWA 2CHWA 5T8IA 2WXJA 3FTWA 3LJ3A 3L54A 2FEZA 3CSFA 3JQ1A 4F1SA 2L0IA 2FF4A 2KC7A 4AP2A 1H19A 3UUXA 2AW6A 1JPLA 3BG1B 3Q49B 1ZU2A 3TJPA 2I1JA 3CGHA 3FUMA 3IV0A 4I2ZA 3U66A 4N3BA 2WXPA 3KAEA 1PAQA 4F3VA 4J8FA 1MHQA 5LFAA 4HOTA 3CVNA 3JUIA 2WXLA 3RK6A 2NC9A 4XI0A 4CT0A 3FWVA 4PS3A 4CGWA 1OWNA 1ELWA 2GW1A 4Q96A 2I9CA 1TEZA 1WM5A 3RIBA 2QY7A 2XRZA 4HS2A 2AXZA 4KMOA 2IONA 1IYGA 2Y4UA 2WXOA 3IHYA 4HLEA 4YVOA 4N3AA 4ANXA 1HS6A 3AU4A 5KCMA 4CDMA 1HG5A 3PRZA 4WWPA 3KS2A 4JVSA 3ZFWA 3PZDA 3HVEA 3APDA 1PC2A 4Y6CA 4APOA 3I4GA 3HHMA 4C9BB 1PY1A 3B7UX 3FH5A 4WNFA 1IQUA 3MCXA 2HM8A 3KD7A 5FZSA 1DVPA 1UG3A 3HVEB 5FQ7A 2KZTA 3BG0B 4BTAA 1N52A 5FZQA 3URZA 4DI3A 4I1OB 2DCPA 4MS6A 4U63A 4A3TA 3FTVA 2BTDA 4G2VA 4AJWA 1WAO1 2XCCA 4XKCA 4FJZA 4GZCA 4HFGA 5BW8C 4GMJA 4UWHA 1HXIA 3OXGA 3FEYA 3G2SA 1UN8A 4N39A 5AIJA 2FI7A 5FT9A 5A6CA 1HE8A 1HU3A 3P2BA 3ZVVA 3CVVA 3FTUA 2OV8A 3S7JA 3K9IA 3L17A 4BTBA 3AS5A 1Z6TA 4GMLA 1UJJA 3SBTB 3EIQC 5A7DB 4B94A 2I1KA 2WXKA 1YA0A 2WQ7A 3LVQE 3QB2A 2KCVA 1P5QA 4N2SA 2X6FA 1HZ4A 2LAIA 3GZ1A 5AJLA 2KZTB 4GZDA 3ONKA 3LYAA 3CVUA 3FHEA 3CKCA 5KJMA 4B8CB 3RO2A 4DPRA 2MHKA 3CLJA 4JEHA 3HYMB 4BSXA 3ZIMA 3MEKA 3GW4A 5FZRA 3SZ7A 2Y3AA 3FULA 4KXKB 1DNPA 2BUGA 4GYWA 2DIWA 4I1MA 3EJNA 2OVBA 3RRMB 2YHEA 4FLHA 2AWIA 4RG9A 3U9WA 3CSTA 2VTBB 2FO7A 2VGXA 2XGOA 3EIJA 4ACKA 1JWGA 4GYYA 1Z3YA 4FJYA 5EX0A 2WM9A 4EBAA 3VTXA 1H0AA 3ZPJA 2WMOA 4KVOA 3S7FA 4D10C 5A23A 3SHFA 5JJTA 1E8ZA 1H6KA 3L13A 5FTPA 3TG5A 2PM7A 1OWOA 2VSYA 3BEEA 3CVQA 3ESKA 3O4ZA 4FULA 3UX4A 1U3CA 3HDXA 4Q94A 1HG2A 3VLDA 3TAXA 4L2YA 4B0ZA 3L16A 5CCMA 1XGWA 2LNIA 2XHEA 3EHNA 3L22A 2CFZA 3LXUX 2A5UA 3TXNA 1H2VC 2NXPA 3CK8A 3IEGA 4KYOB 3RRNB 2WXQA 4GCOA 3R7RA 3PEVB 3D9LA 2YQ8A 5ANRA 4IRUA 3IKOB 1QQEA 4M3OA 3AS8A 3CVLA 3CIAA 3CHPA 3FTZA 4JEUA 4FHJA 2KATA 4KVMA 4AY5A 4C0EA 5JJ7A 4A3VA 2X6IA 2VTBA 2OOEA 2E0IA 3MYVA 4CEMA 1Z3XA 4CRWA 3IBEA 3FTSA 3QDNA 2WXRA 4I1AA 2Y4TA 3MKQA 3RO3A 4CT4A 5JHAA 4JHRA 3CK9A 2XEVA 3MA5A 3CHOA 3G2TA 3D9JA 3JYSA 3OTNA 4OVUA 2I2OA 4IULA 3D9PA 2ILRA 3GZ2A 1UN9A 4XKBA 4WNGA 2WPVA 4NURA 4RG6A 4KZ0A 3LKUA 3RRUA 1ELKA 4GA1A 4J8DA 2UWJG 4JC8A 2GGFA 4GB9A 2VSOE 4BX9A 2X6HA 3LPZA 3SBSA 3D9IA 2AXVA 2JLBA 3L6AA 1IHGA 2VYIA 5KJLA 5CHEE 2GRLA 3KEZA 2UY1A 5G05J 3T8MA 1VDYA 2XPYA 4UWKA 2UY1B 1HH8A 3ASDA 3P1UA 2VGXB 3PE3A 1E96B 4YNDA 3QC1A 4B89A 5AJDA 3U3WA 3LEWA 2R17C 2E2EA 3UT7A 4L7TA 2J07A 2A4ZA 3QKYA 5FQ8A 3B7SA 4G25A 1MQSA 4UWFA 3PVLA 4EZLA 2WXMA 1UJKA 3G2VA 4H7XA 5LCWJ 4ILHB 2WB2A 1TJFA 4WNEA 5LX8A 2XPZA 4GYOA 4TUUA 1E8WA 2HO1A 4XE0A 3ASFA 4I17A 5DBKA 4DJAA 5M72A 3CK7A 3G2UA 4JHJA 3ZXSA 4JA9A 2C0LA 2X6KA 2AXUA 1NZNA 2P58C 2L6JA 3FUDA 1WY6A 3B7RL 4GU5A 2LO6A 3R7QA 2XGMA 4JXTA 5C1DA 2IJGX 3FUNA 2J08A 3NQPA 3I4RB 3S7BA 3UPVA 4GCNA 2RG8A 5KJKA 2LSVA 3FH8A 3OAWA 3CHSA 4XIFA 3CV0A 3PUJA 1SQMA 2NSZA 4KBQA 3JCKC 4PS7A 4ANVA 4WWNA 4OVVA 4YVQC 2R59A 4LEUA 2I6HA 4AM9A 4DI4A 4AY6A 3QNKA 4A55A 4U0ZA 4NACA 1HX8A 4V3IA 3IHVA 4GAAA 2L9BA 3TGOA 4WUYA 1SZAA 3FY4A 5D0OD 4G1TA 1E90A 1FVFA 4ATGA 3ZW3A 1E8YA 3FUKA 3D9OA 3OXLA 1HFAA 4GPKA 1S0PA 4G24A 4K0RA 4FHKA 5G04C 3Q15A 3NZSA 1OWPA 2X38A 4FU3A 5CMYA 4UWLA 4I6GA 5E76A 2VSXE 3CHMA 5HI7A 3PEUB 3CR3A 3LDZA 3PNLB 4DLQA 1OUVA 5E75A 3MJWA 1H2TC 4OYSA 3T5XA 4A1GA 2WXNA 4DK5A 5FQ6A 4LUNU 4J6IA 4ILGA 4U04A 4BT8A 3AU5A 3DBSA 3UMVA 3ZN3A 3B13A 2VGYA 4MRUA 3ULQA 4ANUA 4ABNA 2WVIA 4AVXA 3MKRA 3SD5A 3RU0A 4QFVA 4AIFA 1E7UA 4L1BA 3JQ0A 3QWWA 4KZCA 5KJNA 1GW6A 2QFCA 4KT6B 4UI9C 2V5FA 4G11A 3UT4A 3ZGQA 4E6HA 3Q4AB 2J49A 3FUFA 4WWOA 1KLXA 5ARFA 3QJZA 3FU3A 5HQ8A 4U0UA 5G2NA 1UW4B 2IQCA 4ILIA 4JHKA 4E85A 4I2WA 5EDSA 2JEKA 4EPZA 5BNWA 3QARA 2L0TB 2C0MA 3GZSA 2V8SE 1E8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M63 A;  4BSX A;  4C0M A; 
#chains in the Genus database with same CATH topology
 4N2Q A;  1HO8 A;  4FC8 A;  5B1A E;  2IOS A;  1W3B A;  4HQD A;  4X8Q A;  1MX4 A;  4H7Y A;  4XI9 A;  1HF8 A;  3V30 A;  5EKQ D;  2PQN A;  5T4Y A;  3DWL G;  4GTO A;  4HNA D;  3E30 A;  1BPO A;  1U2V G;  2J8S D;  1N95 A;  2XRY A;  5LP0 A;  3FEX A;  2IFU A;  3ZU7 B;  3NF1 A;  4I43 A;  4FA6 A;  4HRM B;  3C72 A;  4LRZ A;  1U3D A;  3V31 A;  3SNX A;  3EUV A;  1D8E A;  3ENE A;  1L5J A;  2XEH A;  2YIN A;  2WMN A;  2AVP A;  4PH4 B;  4JPS A;  3VLF A;  1LD8 A;  3HIZ A;  4RQI A;  4AEZ C;  5ENN A;  4LG6 A;  5FJY A;  3SFY A;  3ZYQ A;  2C2L A;  4LER A;  4DRX E;  3NOC D;  4C0M A;  3PRE A;  4JA7 A;  4XZ4 A;  1NA0 A;  2X3M A;  2YHC A;  3NZU A;  3APC A;  3Q5M A;  4ZFH A;  2P2C P;  3FH7 A;  4UQZ A;  3VLE A;  2HR2 A;  3SGH A;  3J5P A;  3OXF A;  4XX5 A;  4UUC A;  4HOU A;  2LUH A;  3UM2 A;  3UT8 A;  1IQR A;  2HYZ A;  4ANW A;  2OCC E;  3FUH A;  4R7L A;  4U8V D;  5EID A;  2R05 A;  1SW6 A;  5AAR A;  1BI7 B;  1EYH A;  2OVF A;  1KZP A;  4I6E A;  5CCL A;  1EPU A;  3TWX A;  1NA3 A;  1X5B A;  1ZBP A;  4NQ0 A;  2P9N G;  5CMW A;  2WQH A;  3DSV A;  4NIK A;  4CDR A;  3MV2 B;  1K1B A;  3ZHE A;  3LY9 A;  2CHX A;  1FCH A;  3B7T A;  5JHB A;  4U96 D;  4UQY A;  2R02 A;  4MBG A;  2IU1 A;  2FO1 E;  4GZ6 A;  3E33 A;  4FP7 A;  4FLB A;  1Y6I A;  1V54 E;  3MZL B;  3S7D A;  3U64 A;  3ASN E;  5T8I A;  2FEZ A;  2L0I A;  1H19 A;  4O60 A;  1ZU2 A;  3CGH A;  4I2Z A;  3U66 A;  2ZIR A;  3KAE A;  3TWR A;  4J8F A;  5LFA A;  3CVN A;  3JUI A;  3RK6 A;  1TEZ A;  3RIB A;  1MX2 A;  2AXZ A;  2ION A;  2WXO A;  1WDY A;  3F6Q A;  4N3A A;  3AU4 A;  3TWV A;  1FPP A;  4CDM A;  4GTS A;  3SO8 A;  3KS2 A;  4JVS A;  3HVE A;  1N4P A;  4WNF A;  1IQU A;  5FIN A;  3BG0 B;  2BKG A;  4A3T A;  3C3O A;  2F8Y A;  3CVV A;  3BQO A;  4BTB A;  3AS5 A;  1Z6T A;  4GML A;  3UI2 A;  1BLX B;  3LVQ E;  2LAI A;  3DEP A;  4U95 D;  4M7C A;  4JEH A;  2Y3A A;  3FUL A;  3ASO E;  2EIK E;  1IKN D;  4I1M A;  5EYL A;  3U9W A;  3T9K A;  2XGO A;  3EIJ A;  3JXJ A;  4GYY A;  5A23 A;  4KVO A;  3S7F A;  4D10 C;  2Y69 E;  1E8Z A;  2PM7 A;  1OWO A;  1U3C A;  1N11 A;  1H6P A;  2HE0 A;  3TAX A;  4B0Z A;  1XGW A;  2A5U A;  1H2V C;  3CK8 A;  4GPM A;  3RRN B;  3D9L A;  2YQ8 A;  4DX2 A;  3CVL A;  3CIA A;  3CHP A;  4JEU A;  4AY5 A;  2KAT A;  2OOE A;  2E0I A;  4F6R D;  1O5M A;  4TUM A;  4CRW A;  3FTS A;  3QDN A;  2WXR A;  3JXI A;  4C48 B;  3CK9 A;  1YYH A;  4XKB A;  4WNG A;  4RG6 A;  4KZ0 A;  2UWJ G;  4JC8 A;  4ATZ D;  4GTM A;  4GB9 A;  2X6H A;  2V8S E;  2JLB A;  3W9G A;  3L6A A;  5AQA A;  5EIB E;  4A63 B;  5G05 J;  3RSE G;  1E96 B;  3U3W A;  3QC1 A;  2R17 C;  2E2E A;  2J07 A;  2WXM A;  3G2V A;  2WB2 A;  1AWC B;  4WNE A;  4JD2 G;  1TN8 A;  4XE0 A;  3ASF A;  2MYO A;  2X6K A;  1NZN A;  2P58 C;  4GU5 A;  2LO6 A;  2BED A;  1D9S A;  4JXT A;  3AG2 E;  4BER A;  3UM1 A;  3FH8 A;  3OAW A;  1OCR E;  5CED B;  2NSZ A;  3JCK C;  4WWN A;  1MJ0 A;  2R59 A;  4LEU A;  4U0Z A;  4V3I A;  2L9B A;  3TGO A;  4CYM D;  3ZW3 A;  3FUK A;  3D9O A;  1HFA A;  1KZO A;  3Q15 A;  4GTR A;  2X38 A;  4FU3 A;  2ZGG A;  3CHM A;  5E75 A;  5D2M C;  4A1G A;  4LUN U;  4ILG A;  4BT8 A;  3ZN3 A;  5B1B E;  4BEP A;  3L82 A;  4AIF A;  1JCQ A;  2V5Q C;  3JQ0 A;  4UI9 C;  2V5F A;  3UT4 A;  2R2L A;  3QJZ A;  2IQC A;  4HRL A;  5BNW A;  2C0M A;  1JWF A;  2J4B A;  4F7A A;  3MGB A;  3MKQ B;  2GRM A;  3SFZ A;  2H6G A;  2QC9 A;  5C2Y A;  4EHM A;  5JJ6 A;  4IN3 B;  1SZ9 A;  4G23 A;  1NI1 A;  3CQC B;  3C3R A;  3NOG D;  2ETB A;  5ANL A;  4U8H A;  2BF0 X;  3LS8 A;  5BT1 A;  4W9R A;  4MKT A;  4AXH A;  4GA0 A;  4EZJ A;  1XNF A;  5LOZ A;  4FAD A;  3RJV A;  2KM4 A;  2MOW A;  4CCA A;  4U07 A;  4BY6 A;  3CHQ A;  3HRA A;  4IYP A;  1YMP A;  3QK0 A;  1E8X A;  3CVY A;  5CEC B;  4B8A A;  3CVP A;  2F8X K;  3PE4 A;  3D9N A;  1NP7 A;  5FWQ A;  2AJA A;  3FUE A;  2WXH A;  5G04 J;  3WXX A;  1WG0 A;  4BWR A;  1KT1 A;  4ME2 A;  4O1O A;  4AOF A;  2KCK A;  3AG3 E;  3ULY A;  2OND A;  2Q7F A;  5EX3 A;  3ASH A;  3FDH A;  3ZEF A;  5FQ4 A;  1H6O A;  5BUZ A;  2PQR A;  5JA4 D;  3L9T A;  4GMR A;  1ELR A;  3ASG A;  4UWG A;  1EDU A;  1RW2 A;  4K5C A;  3FU5 A;  3VTY A;  1EF1 C;  2KCL A;  1N4R A;  4GZ5 A;  4G26 A;  3Q7A A;  1INZ A;  3FTX A;  3FU6 A;  1OCC E;  3I3N A;  2PM6 A;  4BX8 A;  4ACL A;  5J90 A;  5HRY A;  1MX6 A;  1JUQ A;  1JCR A;  4JZY A;  2WQ6 A;  3Q9U C;  5CRV A;  3RKV A;  1KT0 A;  2V0P A;  1FT2 A;  4L2L A;  2EIN E;  2IOL A;  3MX3 A;  3R9A B;  3UIP C;  2P9S G;  3SF4 A;  2V4H C;  5G05 C;  1LD7 A;  1SA5 A;  3T8K A;  2XQ0 A;  3CEQ A;  2YNQ A;  3ML8 A;  1JCS A;  4Q69 A;  3DPD A;  4JW1 A;  3C3Q A;  4LCT A;  3UQ3 A;  3FTW A;  3L54 A;  4HBD A;  3UTM A;  1OXJ A;  5EN5 D;  1S63 A;  2AW6 A;  3IV0 A;  1MHQ A;  4HOT A;  2WXL A;  4CGW A;  4PS3 A;  1OWN A;  4Q96 A;  1WM5 A;  3AAA C;  2QYU A;  3IHY A;  2ETC A;  2IO2 C;  4YVO A;  3PRZ A;  3BUA A;  3ZFW A;  1ZB1 A;  3PZD A;  4G8L A;  2Y0B G;  3I4G A;  3FH5 A;  3Q79 A;  2HM8 A;  2H6H A;  1UG3 A;  3HXE A;  5FQ7 A;  2KZT A;  4HI9 A;  5FZQ A;  4DI3 A;  4MS6 A;  4G2V A;  1WAO 1;  2XCC A;  4XKC A;  4FJZ A;  4HFG A;  5BW8 C;  4GMJ A;  4UWH A;  1N9A A;  1HXI A;  3OXG A;  2LXL A;  3FEY A;  2FI7 A;  5A6C A;  3P2B A;  3S7J A;  5ITZ F;  3SBT B;  3EIQ C;  3DPY A;  1YA0 A;  2WQ7 A;  1HZ4 A;  3GZ1 A;  3FHE A;  2MHK A;  3ZIM A;  3MEK A;  3GW4 A;  5FZR A;  4KXK B;  1DNP A;  1BI8 B;  5D66 A;  2OVB A;  3RRM B;  2YHE A;  4FLH A;  2AWI A;  4RG9 A;  2VGX A;  1JWG A;  1Z3Y A;  4FJY A;  3E34 A;  3V79 K;  2WMO A;  1TNZ A;  3SHF A;  5JJT A;  3L13 A;  1H6K A;  3CVQ A;  3HDX A;  5CCM A;  2LNI A;  3EHN A;  3LXU X;  3EHQ A;  2NXP A;  2ZXW E;  4KYO B;  4GCO A;  3PEV B;  3E32 A;  5CER B;  3IKO B;  3AS8 A;  3FTZ A;  4C0E A;  4KVM A;  1OCZ E;  4CEM A;  2XZT G;  3DSS A;  3IBE A;  3W9F A;  1RZ4 A;  4JHR A;  4F1P A;  4LSZ E;  3MA5 A;  3CHO A;  3JYS A;  3DSW A;  3ISM C;  2WPV A;  1TN6 A;  1S70 B;  3RRU A;  1ELK A;  4J8D A;  1BU9 A;  3AG4 E;  2GGF A;  4BX9 A;  4YDO A;  3LPZ A;  3D9I A;  2AXV A;  4U8Y D;  5CHE E;  5EIL A;  2XPY A;  4J7W A;  2UY1 B;  1HH8 A;  3P1U A;  1KPS B;  2VGX B;  4YND A;  3UT7 A;  3QKY A;  3B7S A;  3TWT A;  1O1R A;  3PVL A;  1UJK A;  4YDE A;  5LCW J;  5LX8 A;  4I17 A;  5KBA A;  4JA9 A;  2C0L A;  2AXU A;  1NL4 A;  2L6J A;  1WY6 A;  4K5A B;  2J08 A;  3NQP A;  3I4R B;  2RG8 A;  2LSV A;  3BU8 A;  4OAU C;  4XIF A;  3PUJ A;  1SQM A;  4KBQ A;  3ABK E;  4AM9 A;  2LXM A;  1IHB A;  3FY4 A;  5D0O D;  1E90 A;  1FVF A;  4ATG A;  1S0P A;  3V2X A;  3DEO A;  4UWL A;  5CEA A;  3CR3 A;  3LDZ A;  3PNL B;  4OYS A;  4BSZ B;  4U04 A;  4HRN A;  3AU5 A;  3DBS A;  3UMV A;  2VGY A;  3MKR A;  4QFV A;  2OEV A;  1E7U A;  5KJN A;  4G11 A;  3Q4A B;  3TWQ A;  4WWO A;  1KLX A;  3FU3 A;  5HQ8 A;  4ILI A;  4E85 A;  2JEK A;  3QAR A;  3GZS A;  1BD8 A;  2A5E A;  3ESL A;  5BV1 A;  2DVW A;  2GRN B;  3SI5 A;  4HVB A;  3ML9 A;  4RSY A;  2R5S A;  4CDN A;  2DYS E;  3C5R A;  3T5V A;  5AYW D;  4GZ3 A;  4CGV A;  2XPI A;  3PS6 A;  3LY7 A;  3FFL A;  1QNF A;  4PS8 A;  4L23 A;  4BT9 A;  1OT8 A;  3PH0 C;  4GA2 A;  3PUK A;  4TXQ A;  4N5Q A;  2IF4 A;  2DBA A;  3ZYK A;  2J4D A;  4TV3 A;  4F53 A;  4EEC A;  1K1A A;  1OWL A;  4J0U A;  3QOU A;  1B89 A;  2P9P G;  1TYQ G;  4RVB A;  1Q2Z A;  3DSX A;  2PL2 A;  4BFR A;  3FP3 A;  3AG1 E;  3ZRH A;  4HOS A;  1OY3 D;  1LF8 A;  3LCA A;  4DUI A;  3EU5 A;  4EBA G;  3FU0 A;  5G55 A;  1E7V A;  2CFU A;  2NYJ A;  4P29 A;  5HS0 A;  4UQX A;  4LNU D;  3NB2 A;  4ZHB A;  3TG4 A;  2EIM E;  3S2A A;  4NRH B;  3AJI A;  3E4B A;  3GYZ A;  3ZYL A;  4JL0 A;  2PNN A;  4GTP A;  3B95 A;  4WAF A;  3ABM E;  3APF A;  2X6J A;  2P9U G;  4XEI G;  2ZIS A;  2VJ8 A;  3UM3 A;  1H2U A;  2P9I G;  3HXB A;  2M63 A;  2ZU6 B;  1TJC A;  3Q47 B;  3O48 A;  4N5C A;  3HXF A;  4HOR A;  3ZHE B;  2DZN A;  1O1T A;  2ETA A;  1Y8M A;  3U4T A;  4O1P A;  5CBN A;  4UI9 J;  3X2Q E;  4O6F A;  2MRI A;  2J09 A;  3PNT B;  5BPP A;  3I5P A;  4I9C A;  1Z5S C;  4APF A;  3AS4 A;  2XCB A;  2FBN A;  4I6J A;  3ZYM A;  2CHW A;  4DX7 D;  3JQ1 A;  4F1S A;  4AP2 A;  1JPL A;  3Q49 B;  3TJP A;  4N3B A;  2WXP A;  4F3V A;  2NC9 A;  4XI0 A;  1X81 A;  4CT0 A;  2GW1 A;  2I9C A;  2IO3 C;  4HS2 A;  4KMO A;  1IYG A;  2Y4U A;  4ANX A;  1HS6 A;  1HG5 A;  2VGE A;  3HG0 D;  3Q75 A;  4Y6C A;  2P9K G;  3HHM A;  3ZNG A;  1DC2 A;  3MCX A;  3KD7 A;  1DVP A;  3HVE B;  3RAU A;  4BTA A;  1N52 A;  2DCP A;  4U63 A;  3FTV A;  3HXD A;  1TNO A;  1K8K G;  4N39 A;  5AIJ A;  4YDY A;  1HE8 A;  2OV8 A;  3KSL A;  1TNU A;  3L17 A;  2DWZ A;  1UJJ A;  5A7D B;  2I1K A;  3QB2 A;  2KCV A;  4N2S A;  2X6F A;  5AJL A;  2KZT B;  3E37 A;  3ONK A;  3CVU A;  5KJM A;  3RO2 A;  4TXR A;  1S64 A;  2DZO A;  3CLJ A;  4BSX A;  5CBO A;  4LNG A;  2RFM A;  2BUG A;  4GYW A;  2DIW A;  3EJN A;  1N94 A;  3CST A;  2FO7 A;  1G3N B;  4ACK A;  2WM9 A;  3IXE A;  5AQ7 A;  5FTP A;  3EHR A;  2VSY A;  3BEE A;  4FUL A;  3UX4 A;  4Q94 A;  4GTQ A;  3VLD A;  4L2Y A;  3L16 A;  2XHE A;  3L22 A;  3TXN A;  5HKP A;  2KBX A;  2WXQ A;  4IRU A;  5AAO A;  1QQE A;  4FHJ A;  5JJ7 A;  1O1S A;  4A3V A;  3MYV A;  4I1A A;  3RO3 A;  3SFX A;  5JHA A;  1N0Q A;  2Y4T A;  3MKQ A;  4CT4 A;  2R03 A;  3OTN A;  2I2O A;  3GZ2 A;  3LKU A;  5AQB A;  5JMN D;  4GA1 A;  2P9L G;  1FT1 A;  2VSO E;  4G8K A;  1IHG A;  5KJL A;  3KEZ A;  2UY1 A;  1QYM A;  5KNG A;  3PZ3 A;  1VDY A;  4UWK A;  4OAV B;  3ASD A;  4B89 A;  5EYP F;  4U7E B;  1SVX A;  4L7T A;  2A4Z A;  5FQ8 A;  4G25 A;  1MQS A;  4EZL A;  4H7X A;  1YCS B;  4ILH B;  1TJF A;  5DBK A;  5M72 A;  3CK7 A;  1N0R A;  3G2U A;  4JHJ A;  3ZXS A;  4JB8 P;  4CZ2 D;  3R7Q A;  2XGM A;  5C1D A;  2IJG X;  3FUN A;  3Q73 A;  3DST A;  4GCN A;  3CHS A;  4PS7 A;  1DCQ A;  4OVV A;  4YVQ C;  4DI4 A;  5B3S E;  3QNK A;  2DYR E;  1HX8 A;  3NAW A;  3IHV A;  4WUY A;  4G1T A;  1E8Y A;  3WG7 E;  3OXL A;  4GPK A;  4K0R A;  1TR4 A;  5G04 C;  3NZS A;  5KWD A;  5CMY A;  4I6G A;  5E76 A;  5HI7 A;  3PEU B;  4DLQ A;  3MJW A;  1H2T C;  2WXN A;  4DK5 A;  2ZGD A;  1LTX A;  2GRQ B;  3UKU G;  3ULQ A;  5ENS D;  4ABN A;  2WVI A;  4AVX A;  3SD5 A;  3RU0 A;  1TNB A;  3QWW A;  4KZC A;  1GW6 A;  4E6H A;  2BKK B;  1MZC A;  3R9M A;  1UOH A;  5G2N A;  3TWW A;  1A5E A;  1N4Q A;  4I2W A;  2L0T B;  1D8D A;  2RFA A;  2CG3 A;  3LY8 A;  4Y6W A;  3G2W A;  3D9M A;  3QWV A;  3KSQ A;  4AV7 A;  3D9K A;  1AP7 A;  4HOQ A;  3TWU A;  4MLP A;  2XEE A;  3V2O A;  4EZK A;  2IY0 C;  3LVR E;  1NFI E;  2WXF A;  1OWM A;  3CKB A;  3TL5 A;  2EQX A;  3SQV A;  5T3R A;  2VSN A;  5D0Q D;  3EDT B;  1A17 A;  4EQF A;  5DIZ A;  4PDX A;  3J5Q B;  3TXM A;  5BXO A;  2EIL E;  5ENP D;  3DXM G;  5LCW C;  1SA4 A;  4A1S A;  2V4L A;  2PZI A;  3CQG B;  3D3M A;  5BV0 A;  2H6F A;  2KXP C;  3QWP A;  2WXI A;  3C98 A;  3QAQ A;  2VQ2 A;  5ARG A;  4GTT A;  5ENT D;  3DSU A;  3PZ1 A;  4UI9 K;  4U0S A;  4PUC A;  2IEJ A;  2LSU A;  2RD0 A;  3Q9N C;  3UKR G;  2QYJ A;  3SY2 A;  2J9Q A;  2CG2 A;  3B7B A;  5J08 A;  2WXG A;  2CHZ A;  5AN8 A;  1N4S A;  1QZ2 A;  2FUL A;  3N71 A;  3JUE A;  4URK A;  1FVH A;  3ZUV B;  4DLO A;  4HB5 A;  2B0O E;  4TRQ A;  3ONL A;  3FUJ A;  5FIO A;  3CHR A;  4WND A;  4DX5 D;  4J8S A;  1N54 A;  3PDN A;  3EHM A;  5H7P A;  3L08 A;  3FUI A;  2LAH A;  4HI8 A;  5CRU A;  4B93 B;  4I9E A;  4J8E A;  3DRA A;  3MV3 B;  2F37 A;  4N3C A;  2XS8 A;  3CVX A;  4YDW A;  5AEN A;  4K03 A;  2F0Y A;  3FTY A;  4HXI A;  2XGS A;  3CVW A;  5ENO D;  2WXJ A;  3UIN C;  3LJ3 A;  1TN7 A;  3CSF A;  2FF4 A;  2KC7 A;  2L6B A;  3UUX A;  3BG1 B;  2I1J A;  3FUM A;  4GTV A;  3DXK G;  1PAQ A;  3FWV A;  1ELW A;  2QY7 A;  2XRZ A;  4BES A;  4HLL A;  4HLE A;  2XZD G;  2Y1L E;  5KCM A;  1DCE A;  1IXV A;  3KEA A;  3HXC A;  4WWP A;  3APD A;  1PC2 A;  4APO A;  4C9B B;  4DX6 D;  1PY1 A;  3B7U X;  5FZS A;  4LNB A;  3LJN A;  3URZ A;  4I1O B;  2BTD A;  4AJW A;  4GZC A;  3NBN B;  3G2S A;  1UN8 A;  5ENQ D;  1MYO A;  4L9P A;  5FT9 A;  1HU3 A;  3ZVV A;  3FTU A;  3K9I A;  4B94 A;  2WXK A;  1P5Q A;  4RLY A;  4GZD A;  3LYA A;  3CKC A;  4B8C B;  4DPR A;  3ZKJ A;  3HYM B;  1QBQ A;  3SZ7 A;  5KNH D;  5BXU A;  2VTB B;  5EX0 A;  4EBA A;  3VTX A;  1H0A A;  2QZA A;  3ZPJ A;  5IY5 E;  3TG5 A;  3ESK A;  3O4Z A;  1HG2 A;  4K5B A;  1V55 E;  2CFZ A;  3IEG A;  3R7R A;  5ANR A;  4M3O A;  3TWS A;  2X6I A;  2GRR B;  2VTB A;  1OCO E;  1Z3X A;  2XEN A;  1TNY A;  4QQI A;  2XEV A;  3G2T A;  3D9J A;  4OVU A;  4IUL A;  3D9P A;  2ILR A;  1UN9 A;  4NUR A;  4J8Y A;  3UIO C;  2EIJ E;  3SBS A;  3ULE G;  4DX1 A;  1K3Z D;  2OEW A;  2VYI A;  2GRL A;  3T8M A;  3PE3 A;  5AJD A;  3LEW A;  4BET A;  4UWF A;  2XPZ A;  5AQ9 A;  4GYO A;  4TUU A;  1E8W A;  2HO1 A;  4DJA A;  3FUD A;  3B7R L;  3Q78 A;  3S7B A;  3UPV A;  5KJK A;  2GRO B;  4TXP A;  3CV0 A;  4ANV A;  3ABL E;  4AY6 A;  2I6H A;  4A55 A;  5ENR D;  4NAC A;  4GAA A;  1SZA A;  4Z68 A;  2JAB A;  4G24 A;  4FHK A;  1OWP A;  2VSX E;  1OUV A;  3T5X A;  5FQ6 A;  3Q7F A;  4J6I A;  3UM0 A;  2RKK A;  4ANU A;  3B13 A;  4MRU A;  2GRP B;  3PZ4 A;  4L1B A;  2B6C A;  3D9H A;  2QFC A;  4KT6 B;  3ZGQ A;  2XS1 A;  3UXG A;  2J49 A;  3FUF A;  5ARF A;  2H6I A;  4U0U A;  1UW4 B;  4JHK A;  3ZXP A;  5EDS A;  4EPZ A;  3EU9 A;  3PZ2 A; 
#chains in the Genus database with same CATH homology
 2CG3 A;  3LY8 A;  4N2Q A;  4Y6W A;  3G2W A;  3D9M A;  3QWV A;  2J4B A;  4F7A A;  4AV7 A;  1HO8 A;  3ESL A;  4FC8 A;  3D9K A;  5BV1 A;  2IOS A;  4HOQ A;  1W3B A;  3MGB A;  3MKQ B;  4MLP A;  2GRM A;  3SFZ A;  4H7Y A;  4XI9 A;  1HF8 A;  5C2Y A;  4EZK A;  5EKQ D;  2PQN A;  5T4Y A;  3SI5 A;  4HVB A;  5JJ6 A;  4IN3 B;  3LVR E;  3ML9 A;  4RSY A;  2R5S A;  1SZ9 A;  2WXF A;  1BPO A;  4CDN A;  1OWM A;  3CKB A;  4G23 A;  3TL5 A;  2EQX A;  5T3R A;  3T5V A;  5AYW D;  2XRY A;  3CQC B;  4GZ3 A;  5LP0 A;  3FEX A;  5ANL A;  4CGV A;  2VSN A;  5D0Q D;  2IFU A;  2XPI A;  3NF1 A;  4I43 A;  3EDT B;  3PS6 A;  4U8H A;  3LY7 A;  2BF0 X;  3LS8 A;  4FA6 A;  5BT1 A;  3FFL A;  4W9R A;  1A17 A;  1QNF A;  1U3D A;  4LRZ A;  4MKT A;  4L23 A;  4PS8 A;  3SNX A;  4BT9 A;  4EQF A;  4AXH A;  4GA0 A;  5DIZ A;  4EZJ A;  4PDX A;  1XNF A;  3PH0 C;  5LOZ A;  4GA2 A;  4FAD A;  3ENE A;  3PUK A;  3RJV A;  3TXM A;  2KM4 A;  1L5J A;  2IF4 A;  2MOW A;  2DBA A;  2YIN A;  4CCA A;  4U07 A;  2WMN A;  3ZYK A;  2AVP A;  4BY6 A;  2J4D A;  4TV3 A;  3CHQ A;  4F53 A;  4IYP A;  4EEC A;  4PH4 B;  3QK0 A;  1OWL A;  4JPS A;  3VLF A;  3CVY A;  3HIZ A;  4B8A A;  4J0U A;  3CVP A;  3PE4 A;  3D9N A;  3QOU A;  1NP7 A;  4AEZ C;  1B89 A;  5ENN A;  5FWQ A;  5LCW C;  4A1S A;  3FUE A;  2V4L A;  1JWF A;  4RVB A;  2WXH A;  5FJY A;  2PL2 A;  3ZYQ A;  2PZI A;  4BFR A;  2C2L A;  4LER A;  3CQG B;  3D3M A;  5G04 J;  3WXX A;  5BV0 A;  3FP3 A;  4C0M A;  4BWR A;  1KT1 A;  3PRE A;  4ME2 A;  4JA7 A;  4XZ4 A;  3ZRH A;  4HOS A;  1NA0 A;  2X3M A;  2YHC A;  3NZU A;  4AOF A;  3APC A;  1LF8 A;  2KCK A;  3QWP A;  3LCA A;  2OND A;  3Q5M A;  2Q7F A;  2WXI A;  4EBA G;  3C98 A;  3FH7 A;  4UQZ A;  3ASH A;  3FU0 A;  3QAQ A;  5EX3 A;  2VQ2 A;  3VLE A;  2HR2 A;  3FDH A;  3SGH A;  5ARG A;  5FQ4 A;  3ZEF A;  3OXF A;  5BUZ A;  4XX5 A;  4HOU A;  2PQR A;  5G55 A;  1E7V A;  2CFU A;  3UT8 A;  1ELR A;  1IQR A;  2HYZ A;  3ASG A;  4P29 A;  4ANW A;  4UI9 K;  4U0S A;  3FUH A;  4PUC A;  4UWG A;  1EDU A;  4UQX A;  2LSU A;  4R7L A;  2RD0 A;  3TG4 A;  3FU5 A;  3S2A A;  3VTY A;  1EF1 C;  4NRH B;  3E4B A;  2KCL A;  1EYH A;  4GZ5 A;  2J9Q A;  2OVF A;  4G26 A;  4I6E A;  5CCL A;  2CG2 A;  3GYZ A;  3ZYL A;  1INZ A;  1EPU A;  3FTX A;  3FU6 A;  1NA3 A;  1X5B A;  5J08 A;  1ZBP A;  4JL0 A;  3I3N A;  2PM6 A;  2WXG A;  4NQ0 A;  4ACL A;  4BX8 A;  5J90 A;  2CHZ A;  4WAF A;  5CMW A;  3APF A;  2X6J A;  2WQH A;  1QZ2 A;  2FUL A;  2VJ8 A;  4CDR A;  3N71 A;  1H2U A;  1JUQ A;  3MV2 B;  3ZHE A;  2M63 A;  2ZU6 B;  4JZY A;  4URK A;  2WQ6 A;  3RKV A;  1TJC A;  3Q47 B;  1FVH A;  1KT0 A;  3O48 A;  4N5C A;  3LY9 A;  4DLO A;  2CHX A;  1FCH A;  2V0P A;  3B7T A;  4L2L A;  4TRQ A;  3ONL A;  5JHB A;  3FUJ A;  4HOR A;  4UQY A;  3CHR A;  4WND A;  3ZHE B;  4J8S A;  2IOL A;  1N54 A;  3MX3 A;  3PDN A;  3R9A B;  3EHM A;  1Y8M A;  3L08 A;  3FUI A;  2LAH A;  3U4T A;  4UI9 J;  3SF4 A;  5G05 C;  2IU1 A;  4O6F A;  2MRI A;  2J09 A;  3PNT B;  4I9E A;  4GZ6 A;  3I5P A;  5BPP A;  4I9C A;  4J8E A;  3MV3 B;  4N3C A;  2XQ0 A;  3CEQ A;  4FP7 A;  2YNQ A;  3ML8 A;  4APF A;  3CVX A;  4Q69 A;  5AEN A;  3DPD A;  3AS4 A;  4FLB A;  4JW1 A;  1Y6I A;  4K03 A;  2XCB A;  3MZL B;  2FBN A;  3FTY A;  4I6J A;  3ZYM A;  4HXI A;  2XGS A;  3S7D A;  4LCT A;  3U64 A;  3UQ3 A;  3CVW A;  2CHW A;  5T8I A;  2WXJ A;  3FTW A;  3LJ3 A;  3L54 A;  2FEZ A;  3CSF A;  3JQ1 A;  4F1S A;  2L0I A;  2FF4 A;  2KC7 A;  4AP2 A;  1H19 A;  3UUX A;  2AW6 A;  1JPL A;  3BG1 B;  3Q49 B;  1ZU2 A;  3TJP A;  2I1J A;  3CGH A;  3FUM A;  3IV0 A;  4I2Z A;  3U66 A;  4N3B A;  2WXP A;  3KAE A;  1PAQ A;  4F3V A;  4J8F A;  1MHQ A;  5LFA A;  4HOT A;  3CVN A;  3JUI A;  2WXL A;  3RK6 A;  2NC9 A;  4XI0 A;  4CT0 A;  3FWV A;  4PS3 A;  4CGW A;  1OWN A;  1ELW A;  2GW1 A;  4Q96 A;  2I9C A;  1TEZ A;  1WM5 A;  3RIB A;  2QY7 A;  2XRZ A;  4HS2 A;  2AXZ A;  4KMO A;  2ION A;  1IYG A;  2Y4U A;  2WXO A;  3IHY A;  4HLE A;  4YVO A;  4N3A A;  4ANX A;  1HS6 A;  3AU4 A;  5KCM A;  4CDM A;  1HG5 A;  3PRZ A;  4WWP A;  3KS2 A;  4JVS A;  3ZFW A;  3PZD A;  3HVE A;  3APD A;  1PC2 A;  4Y6C A;  4APO A;  3I4G A;  3HHM A;  4C9B B;  1PY1 A;  3B7U X;  3FH5 A;  4WNF A;  1IQU A;  3MCX A;  2HM8 A;  3KD7 A;  5FZS A;  1DVP A;  1UG3 A;  3HVE B;  5FQ7 A;  2KZT A;  3BG0 B;  4BTA A;  1N52 A;  5FZQ A;  3URZ A;  4DI3 A;  4I1O B;  2DCP A;  4MS6 A;  4U63 A;  4A3T A;  3FTV A;  2BTD A;  4G2V A;  4AJW A;  1WAO 1;  2XCC A;  4XKC A;  4FJZ A;  4GZC A;  4HFG A;  5BW8 C;  4GMJ A;  4UWH A;  1HXI A;  3OXG A;  3FEY A;  3G2S A;  1UN8 A;  4N39 A;  5AIJ A;  2FI7 A;  5FT9 A;  5A6C A;  1HE8 A;  1HU3 A;  3P2B A;  3ZVV A;  3CVV A;  3FTU A;  2OV8 A;  3S7J A;  3K9I A;  3L17 A;  4BTB A;  3AS5 A;  1Z6T A;  4GML A;  1UJJ A;  3SBT B;  3EIQ C;  5A7D B;  4B94 A;  2I1K A;  2WXK A;  1YA0 A;  2WQ7 A;  3LVQ E;  3QB2 A;  2KCV A;  1P5Q A;  4N2S A;  2X6F A;  1HZ4 A;  2LAI A;  3GZ1 A;  5AJL A;  2KZT B;  4GZD A;  3ONK A;  3LYA A;  3CVU A;  3FHE A;  3CKC A;  5KJM A;  4B8C B;  3RO2 A;  4DPR A;  2MHK A;  3CLJ A;  4JEH A;  3HYM B;  4BSX A;  3ZIM A;  3MEK A;  3GW4 A;  5FZR A;  3SZ7 A;  2Y3A A;  3FUL A;  4KXK B;  1DNP A;  2BUG A;  4GYW A;  2DIW A;  4I1M A;  3EJN A;  2OVB A;  3RRM B;  2YHE A;  4FLH A;  2AWI A;  4RG9 A;  3U9W A;  3CST A;  2VTB B;  2FO7 A;  2VGX A;  2XGO A;  3EIJ A;  4ACK A;  1JWG A;  4GYY A;  1Z3Y A;  4FJY A;  5EX0 A;  2WM9 A;  4EBA A;  3VTX A;  1H0A A;  3ZPJ A;  2WMO A;  4KVO A;  3S7F A;  4D10 C;  5A23 A;  3SHF A;  5JJT A;  1E8Z A;  1H6K A;  3L13 A;  5FTP A;  3TG5 A;  2PM7 A;  1OWO A;  2VSY A;  3BEE A;  3CVQ A;  3ESK A;  3O4Z A;  4FUL A;  3UX4 A;  1U3C A;  3HDX A;  4Q94 A;  1HG2 A;  3VLD A;  3TAX A;  4L2Y A;  4B0Z A;  3L16 A;  5CCM A;  1XGW A;  2LNI A;  2XHE A;  3EHN A;  3L22 A;  2CFZ A;  3LXU X;  2A5U A;  3TXN A;  1H2V C;  2NXP A;  3CK8 A;  3IEG A;  4KYO B;  3RRN B;  2WXQ A;  4GCO A;  3R7R A;  3PEV B;  3D9L A;  2YQ8 A;  5ANR A;  4IRU A;  3IKO B;  1QQE A;  4M3O A;  3AS8 A;  3CVL A;  3CIA A;  3CHP A;  3FTZ A;  4JEU A;  4FHJ A;  2KAT A;  4KVM A;  4AY5 A;  4C0E A;  5JJ7 A;  4A3V A;  2X6I A;  2VTB A;  2OOE A;  2E0I A;  3MYV A;  4CEM A;  1Z3X A;  4CRW A;  3IBE A;  3FTS A;  3QDN A;  2WXR A;  4I1A A;  2Y4T A;  3MKQ A;  3RO3 A;  4CT4 A;  5JHA A;  4JHR A;  3CK9 A;  2XEV A;  3MA5 A;  3CHO A;  3G2T A;  3D9J A;  3JYS A;  3OTN A;  4OVU A;  2I2O A;  4IUL A;  3D9P A;  2ILR A;  3GZ2 A;  1UN9 A;  4XKB A;  4WNG A;  2WPV A;  4NUR A;  4RG6 A;  4KZ0 A;  3LKU A;  3RRU A;  1ELK A;  4GA1 A;  4J8D A;  2UWJ G;  4JC8 A;  2GGF A;  4GB9 A;  2VSO E;  4BX9 A;  2X6H A;  3LPZ A;  3SBS A;  3D9I A;  2AXV A;  2JLB A;  3L6A A;  1IHG A;  2VYI A;  5KJL A;  5CHE E;  2GRL A;  3KEZ A;  2UY1 A;  5G05 J;  3T8M A;  1VDY A;  2XPY A;  4UWK A;  2UY1 B;  1HH8 A;  3ASD A;  3P1U A;  2VGX B;  3PE3 A;  1E96 B;  4YND A;  3QC1 A;  4B89 A;  5AJD A;  3U3W A;  3LEW A;  2R17 C;  2E2E A;  3UT7 A;  4L7T A;  2J07 A;  2A4Z A;  3QKY A;  5FQ8 A;  3B7S A;  4G25 A;  1MQS A;  4UWF A;  3PVL A;  4EZL A;  2WXM A;  1UJK A;  3G2V A;  4H7X A;  5LCW J;  4ILH B;  2WB2 A;  1TJF A;  4WNE A;  5LX8 A;  2XPZ A;  4GYO A;  4TUU A;  1E8W A;  2HO1 A;  4XE0 A;  3ASF A;  4I17 A;  5DBK A;  4DJA A;  5M72 A;  3CK7 A;  3G2U A;  4JHJ A;  3ZXS A;  4JA9 A;  2C0L A;  2X6K A;  2AXU A;  1NZN A;  2P58 C;  2L6J A;  3FUD A;  1WY6 A;  3B7R L;  4GU5 A;  2LO6 A;  3R7Q A;  2XGM A;  4JXT A;  5C1D A;  2IJG X;  3FUN A;  2J08 A;  3NQP A;  3I4R B;  3S7B A;  3UPV A;  4GCN A;  2RG8 A;  5KJK A;  2LSV A;  3FH8 A;  3OAW A;  3CHS A;  4XIF A;  3CV0 A;  3PUJ A;  1SQM A;  2NSZ A;  4KBQ A;  3JCK C;  4PS7 A;  4ANV A;  4WWN A;  4OVV A;  4YVQ C;  2R59 A;  4LEU A;  2I6H A;  4AM9 A;  4DI4 A;  4AY6 A;  3QNK A;  4A55 A;  4U0Z A;  4NAC A;  1HX8 A;  4V3I A;  3IHV A;  4GAA A;  2L9B A;  3TGO A;  4WUY A;  1SZA A;  3FY4 A;  5D0O D;  4G1T A;  1E90 A;  1FVF A;  4ATG A;  3ZW3 A;  1E8Y A;  3FUK A;  3D9O A;  3OXL A;  1HFA A;  4GPK A;  1S0P A;  4G24 A;  4K0R A;  4FHK A;  5G04 C;  3Q15 A;  3NZS A;  1OWP A;  2X38 A;  4FU3 A;  5CMY A;  4UWL A;  4I6G A;  5E76 A;  2VSX E;  3CHM A;  5HI7 A;  3PEU B;  3CR3 A;  3LDZ A;  3PNL B;  4DLQ A;  1OUV A;  5E75 A;  3MJW A;  1H2T C;  4OYS A;  3T5X A;  4A1G A;  2WXN A;  4DK5 A;  5FQ6 A;  4LUN U;  4J6I A;  4ILG A;  4U04 A;  4BT8 A;  3AU5 A;  3DBS A;  3UMV A;  3ZN3 A;  3B13 A;  2VGY A;  4MRU A;  3ULQ A;  4ANU A;  4ABN A;  2WVI A;  4AVX A;  3MKR A;  3SD5 A;  3RU0 A;  4QFV A;  4AIF A;  1E7U A;  4L1B A;  3JQ0 A;  3QWW A;  4KZC A;  5KJN A;  1GW6 A;  2QFC A;  4KT6 B;  4UI9 C;  2V5F A;  4G11 A;  3UT4 A;  3ZGQ A;  4E6H A;  3Q4A B;  2J49 A;  3FUF A;  4WWO A;  1KLX A;  5ARF A;  3QJZ A;  3FU3 A;  5HQ8 A;  4U0U A;  5G2N A;  1UW4 B;  2IQC A;  4ILI A;  4JHK A;  4E85 A;  4I2W A;  5EDS A;  2JEK A;  4EPZ A;  5BNW A;  3QAR A;  2L0T B;  2C0M A;  3GZS A;  2V8S E;  1E8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...