2M63A

The protease-resistant n-terminal domain of tir-domain containing adaptor molecule-1, ticam-1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
157
Chain Sequence
HMACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TIR domain-containing adapter molecule 1
publication title The N-terminal domain of TIR domain-containing adaptor molecule-1, TICAM-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17798 TRIF-NTD TRIF N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.780 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2m63A00
4BSXA 4C0MA 2M63A
chains in the Genus database with same CATH superfamily
3ABME 3DEPA 2RD0A 2XHEA 4XZ4A 4F7AA 4NRHB 4LEUA 3V31A 4LCTA 3R9AB 5ENSD 2P9LG 2HM8A 5KWDA 3CHMA 4G8LA 1IQRA 1H6OA 4JPSA 3DRAA 1HG2A 3UKRG 4I2ZA 4CZ2D 2NC9A 2V8SE 5KJLA 3QC1A 4HLEA 1MJ0A 1NA3A 2NYJA 4GTVA 1JWFA 3D9IA 5JHAA 5D0QD 1KZOA 4OVVA 2J08A 1OUVA 2I1KA 3E30A 3FHEA 2FO1E 1NP7A 4GMRA 2XEEA 4MS6A 4WUYA 3Q7AA 3FTVA 5DIZA 1DC2A 1XNFA 1D9SA 3N71A 1OXJA 4GU5A 3R7QA 2I6HA 1JCQA 2VSNA 3TWTA 4GTSA 4EHMA 3AU5A 3ZHEB 1HFAA 4KVMA 4ATZD 1RZ4A 3PREA 2VGEA 2BTDA 2ETAA 3QB2A 2WXIA 4HQDA 4OYSA 5FWQA 4A1GA 4J8FA 1PAQA 3B7TA 3EDTB 2AW6A 1N4RA 5G55A 3HHMA 1QQEA 1Y6IA 1KLXA 2YHCA 3UIOC 4DX7D 4XI0A 4EZKA 4Z68A 2VTBB 1WM5A 4RG6A 2OCCE 3QWWA 4FLBA 3PH0C 1IHGA 1P5QA 5AN8A 4U0ZA 4G24A 3LJ3A 4C0MA 3PZ3A 1D8EA 4ILIA 2WQ7A 5ENRD 4HOTA 3FU0A 4P29A 1WDYA 3WXXA 4YDWA 2CHZA 3VLEA 2WXRA 4B89A 3Q9UC 2HO1A 3ASFA 2ZU6B 1KZPA 2CHWA 2FI7A 2WB2A 2R02A 1TN6A 3SQVA 1OCRE 4APOA 4HXIA 1IQUA 1UG3A 3ZRHA 2WXLA 2WXPA 1E8ZA 4FLHA 3QJZA 2JABA 3E32A 1N95A 3ZPJA 2IY0C 4DRXE 5CRVA 4I9EA 4U63A 4PDXA 5BPPA 4YDOA 5LFAA 2VYIA 5ENTD 3E4BA 2F0YA 2IOLA 2KXPC 2WXFA 4GTPA 4GCOA 2LSUA 2P58C 2FEZA 2WXJA 3Q15A 2DIWA 3DXMG 5FTPA 4A55A 4LSZE 2I2OA 1V55E 5EYLA 4U8YD 3CVPA 3OXGA 3ZUVB 4B0ZA 4WWPA 1MYOA 3Q79A 3UXGA 4EBAG 3WG7E 3TWXA 3BQOA 1N94A 3T9KA 5LCWC 3SBTB 4C48B 3CQCB 5M72A 1TNOA 2DVWA 4C9BB 2HYZA 5FZRA 4GTQA 3PNTB 5T3RA 3QOUA 5G04J 2XGSA 2H6FA 2KCKA 1E8XA 3JQ0A 4LNBA 3PZDA 3FWVA 1OWPA 2IONA 4J0UA 3UM2A 1N0QA 1PY1A 4N2QA 4DK5A 1JCSA 4BT8A 3APFA 3PS6A 2BKGA 3DEOA 4JVSA 2AXZA 2Y4TA 3CVYA 4CGWA 1SQMA 4JW1A 3UX4A 1AWCB 2ETCA 3D9OA 2J9QA 3HVEB 1DNPA 3CK9A 5CCLA 1BU9A 2MRIA 1H6KA 4HOQA 4GA1A 5AARA 4FJZA 1OWLA 3LY7A 1YYHA 3SFZA 5FQ4A 1OY3D 3VTYA 4FA6A 3TXMA 3W9GA 4GTTA 4OVUA 4IULA 3CHQA 3TWWA 4JEHA 3ENEA 3L82A 1NI1A 2R2LA 1H6PA 1Z3YA 1AP7A 1UJJA 1QBQA 1JWGA 4K5BA 3U64A 2RFAA 5EX0A 5G05C 2XENA 3JXJA 2X6KA 1O1RA 3FH5A 5ITZF 1ELKA 4JC8A 4X8QA 3FUMA 4XX5A 4HS2A 3VLFA 3S7JA 1INZA 2ETBA 4AP2A 4BX9A 5AJDA 4N3CA 1SA4A 4MBGA 4AY5A 3KD7A 1EF1C 3RAUA 2LXMA 1MX2A 2GRLA 4BFRA 1HE8A 1H2TC 2DWZA 3MX3A 2AXUA 5ENOD 4D10C 4FADA 4HRNA 4QQIA 1VDYA 2PM6A 4BSXA 3B13A 4JHJA 1DCEA 4AV7A 3CSFA 4KXKB 4L2YA 1X5BA 4J8SA 3MJWA 4AIFA 3EUVA 2DYRE 4A1SA 3RKVA 4UWLA 2L0IA 1SA5A 4JXTA 3JUEA 2R05A 4KYOB 3QNKA 3QKYA 2E0IA 5FQ6A 3T8KA 4UQXA 5KBAA 5E75A 5EILA 2C0LA 5C2YA 1YA0A 2Y69E 4EZJA 3CVVA 2IFUA 1N9AA 2KZTB 1W3BA 4K5AB 5LOZA 3BU8A 4WNFA 2V4HC 1Y8MA 3ZGQA 2IO2C 4JEUA 1JUQA 4XE0A 4WAFA 2Q7FA 2UWJG 1TJFA 1ZU2A 3UKUG 5D2MC 1LD8A 3G2SA 3CEQA 5T8IA 3MEKA 3CSTA 1TYQG 2Y4UA 1OCOE 1TR4A 4AXHA 2VGXB 2XGMA 4A3TA 4G1TA 4YVOA 5CCMA 1NL4A 3FEYA 4BTBA 3AG4E 3G2VA 3U4TA 4GYWA 3HG0D 3OXFA 2YNQA 2LUHA 4LUNU 2IQCA 2L9BA 3D9JA 3HYMB 3VLDA 2YHEA 2QYUA 2EIJE 5D0OD 1B89A 4U07A 3ZYLA 5FQ7A 4PS8A 4QFVA 1UOHA 4ZHBA 4JZYA 2XCCA 4RQIA 3LYAA 2OEWA 3HIZA 3EU9A 2QYJA 3MKQB 3SI5A 3PEVB 2IF4A 3ZHEA 2E2EA 3MV3B 2WQ6A 2QFCA 3B7BA 4L23A 3IXEA 4CEMA 4DX5D 4K5CA 3EHMA 2V5FA 1MZCA 3ZU7B 4FC8A 4W9RA 2CHXA 3RSEG 1E7VA 4TRQA 4AOFA 3FDHA 3LVRE 4GMJA 3C3RA 3E37A 1BI8B 4U95D 1JCRA 2BF0X 5AIJA 4BWRA 2XS8A 1HF8A 4N3BA 4NACA 4CYMD 1FT2A 4UUCA 2CFUA 2IJGX 2X6IA 3FH7A 4URKA 3C72A 4KMOA 2F8XK 3P1UA 1IKND 4RG9A 5AQAA 1K1BA 3KEZA 3HXEA 3FFLA 3DSUA 3PZ2A 5BNWA 2X38A 3ML8A 4LRZA 2GW1A 3D9PA 1Q2ZA 2XPYA 2DCPA 3URZA 2IEJA 3UM0A 3NB2A 2P9SG 3QAQA 4GYYA 3JQ1A 3MA5A 4GZDA 1K8KG 2R03A 5CERB 4J7WA 3I4GA 1HU3A 5E76A 4ILHB 2DBAA 2X3MA 3CVXA 3CVQA 3ASDA 4GTOA 3NOCD 5B1BE 4ME2A 5BXUA 4HB5A 3HXDA 3P2BA 5AENA 2WM9A 4L7TA 4G11A 5CBOA 3UM1A 4BESA 1UN9A 4Q69A 4LNGA 4N5QA 3LJNA 4AVXA 5EDSA 4AY6A 3EIQC 1LTXA 3KAEA 2EILE 3TWVA 4RLYA 3FY4A 2HR2A 4AM9A 5FZSA 4I1AA 4ANXA 2WXMA 2Y0BG 3SF4A 2PNNA 3FUHA 3ASNE 3Q47B 3UI2A 3TWRA 3MGBA 2CG3A 3Q5MA 4WNDA 3JUIA 1HO8A 2J4DA 3HXBA 3IBEA 4JHKA 3W9FA 3LDZA 1OCCE 3SO8A 3CQGB 2XZDG 2M63A 3FUDA 1O5MA 4WWOA 3Q49B 3E33A 5FINA 3V30A 3LVQE 3BG0B 3Q75A 4ABNA 1KT1A 1E8WA 1H19A 1TNUA 3T8MA 4AEZC 1TNBA 1DVPA 1GW6A 3SHFA 2Y3AA 2GRQB 2P2CP 3RRMB 3UUXA 1YCSB 2H6HA 2R17C 2XCBA 3DSTA 3ZIMA 4ILGA 3J5PA 3LCAA 4DUIA 3UQ3A 2DYSE 4CT4A 4FHKA 3HVEA 3TAXA 2PZIA 4U7EB 3ZN3A 4ZFHA 3PEUB 1S70B 3ZNGA 2IOSA 3RK6A 4IRUA 4EBAA 5J08A 5JJ6A 2R59A 4GA2A 2B0OE 4F53A 2GRPB 5CMWA 3DSSA 4BETA 2HE0A 4B8AA 3AAAC 5AQBA 3ASGA 4PH4B 3MKRA 4DI3A 3UT4A 1N4PA 2FBNA 4DJAA 3B95A 4O6FA 5CBNA 3S7BA 3RRNB 3BG1B 2DZNA 5CEDB 5C1DA 3CVNA 5JHBA 5KCMA 1FPPA 4ANVA 1S63A 4B93B 4XEIG 3DBSA 3L22A 4EQFA 5CHEE 2EQXA 3NAWA 1BI7B 3KEAA 2XPIA 2XS1A 1FCHA 5FQ8A 1N11A 3G2TA 3ZKJA 2X6FA 1PC2A 5CMYA 2I9CA 3CR3A 1OWMA 4UWGA 2L6BA 2RFMA 2JEKA 5AAOA 3IV0A 3B7RL 3LKUA 5LCWJ 3ZVVA 2FF4A 5KJMA 5BXOA 3BEEA 3MYVA 4HI9A 5ENPD 2OOEA 3FU3A 3UT7A 3E34A 1SW6A 3PE4A 4YNDA 4DLOA 3SNXA 2ZISA 3LXUX 4U8HA 2FULA 2PQNA 3L08A 2KATA 4R7LA 1YMPA 4LNUD 3TXNA 1LD7A 1HG5A 1OWOA 4I2WA 1N4SA 2GRNB 1MX4A 5LX8A 4E6HA 4G2VA 4DX2A 2UY1B 5DBKA 3TJPA 3HXCA 4K03A 3LS8A 4HBDA 4I1OB 4PUCA 1HX8A 2ZGDA 3BUAA 3PRZA 1G3NB 3NF1A 4ATGA 4ANUA 2WVIA 4NIKA 3CKCA 4UWKA 3FTSA 5JJ7A 4U0SA 4HVBA 2OVFA 4CCAA 2L6JA 4GYOA 1FVHA 3UT8A 5ANLA 4HOSA 4OAVB 3PZ1A 5BUZA 2Y1LE 1BD8A 2BEDA 5BT1A 2VGXA 3JXIA 2LNIA 3CIAA 3QWVA 1IYGA 4O60A 4V3IA 4GAAA 5B1AE 3NOGD 1Z6TA 4E85A 4L1BA 2GRRB 3D9HA 3F6QA 2KBXA 1K3ZD 3T5XA 5H7PA 2A5UA 1DCQA 3PZ4A 5G05J 4DI4A 2KCVA 4HI8A 5EN5D 4CT0A 3KS2A 3FP3A 5LP0A 3Q73A 3HDXA 4U0UA 3Q78A 3MKQA 5ARGA 4F1PA 4Y6CA 3I3NA 3KSLA 4G26A 4MLPA 2LO6A 2QY7A 2X6JA 2P9KG 4I9CA 4ACLA 3I4RB 3ZXPA 4GPMA 4NQ0A 3PNLB 4XKCA 3CVWA 3UM3A 3UTMA 1L5JA 1QZ2A 3V79K 4GCNA 4XKBA 3C98A 3D9LA 2WXGA 3GYZA 3ML9A 4LERA 4U96D 4YVQC 3LEWA 2EIME 3EJNA 3NZUA 2VJ8A 3Q4AB 5EIBE 1A5EA 4BERA 1E7UA 3O4ZA 3DSWA 3IKOB 1QYMA 2AXVA 3EIJA 1H2UA 4UQZA 4DPRA 4JB8P 3KSQA 4MKTA 4I17A 2P9PG 1HZ4A 3D9NA 3FTUA 1OWNA 3B7SA 1SVXA 1TNYA 1ZBPA 1TN7A 2XZTG 3IEGA 1NFIE 4HFGA 3DSXA 3ONLA 3CHRA 2J07A 3VTXA 4ANWA 4H7XA 2XPZA 1N0RA 2V5QC 1MQSA 4UI9C 4F3VA 1X81A 2J4BA 2ONDA 4B94A 3R7RA 2J09A 3LY9A 4O1OA 3Q9NC 1NA0A 5AJLA 5AYWD 1D8DA 4G23A 5JA4D 2P9NG 3ZYKA 5BW8C 3IHYA 1TN8A 1UJKA 3RO3A 4F6RD 4TUMA 2VTBA 2XEHA 2B6CA 4N5CA 3AS8A 5AQ7A 3QARA 1HXIA 4GZ5A 3AG1E 1U3DA 3D9MA 1QNFA 3G2WA 2PM7A 2AWIA 3PDNA 5J90A 4FHJA 1H2VC 4L9PA 3FTXA 3OXLA 4G25A 2J8SD 3SFXA 4FP7A 2ILRA 1WG0A 3RU0A 2YQ8A 4M7CA 5A6CA 3C5RA 1JPLA 1BLXB 4UI9J 4J8YA 4C0EA 3L6AA 4HRLA 4HORA 5CRUA 3X2QE 1K1AA 3TWUA 2NSZA 3TG4A 3APDA 4WNEA 3U3WA 3V2OA 2WXNA 4N3AA 4KZ0A 3U9WA 3CGHA 4HOUA 1RW2A 4IYPA 3SBSA 3ZYMA 3NQPA 3DPYA 5JJTA 2C0MA 4U8VD 3CHOA 3LY8A 3PUKA 3S2AA 5FIOA 3UMVA 2YINA 3SFYA 3HRAA 3ESKA 2H6GA 2V4LA 4XI9A 3TWSA 4I6GA 5T4YA 1E8YA 2VSYA 4OAUC 2VGYA 3CHSA 5EX3A 3CV0A 2IO3C 3FULA 2XGOA 1U2VG 3UINC 3RRUA 1SZ9A 3L9TA 4TXRA 2XRYA 1OCZE 1KT0A 4J6IA 1A17A 3AS4A 4BY6A 4JA7A 3EU5A 3ABKE 1IXVA 1H0AA 2PQRA 4BTAA 1ELWA 3TG5A 3J5QB 4UWHA 2LXLA 3TWQA 2L0TB 3OAWA 3FH8A 5KNHD 5EYPF 3ULEG 1N52A 3EHQA 3FUJA 1N4QA 1TEZA 4I1MA 5ARFA 3ULQA 4I43A 4Q96A 3GZ2A 4GMLA 3NBNB 4NURA 3QDNA 2WPVA 4IN3B 5G04C 1WAO1 2VQ2A 4TXPA 2XEVA 2KC7A 3RIBA 2C2LA 4YDYA 2BKKB 2VSXE 4FJYA 3FTZA 2WQHA 4YDEA 3R9MA 3FU6A 4EPZA 4UQYA 4RSYA 5B3SE 2OV8A 2H6IA 3ZYQA 3FUNA 3TL5A 5ENNA 3FUIA 3D9KA 4RVBA 4JL0A 3ASOE 1FT1A 3ASHA 3DWLG 2EINE 3SGHA 1ZB1A 3CVLA 3ULYA 4JD2G 4A3VA 4DLQA 4CDNA 4BX8A 3ISMC 3V2XA 2MYOA 2BUGA 3SZ7A 5BV0A 1MX6A 2UY1A 1S0PA 3PVLA 4LG6A 2GRMA 4J8EA 1O1SA 1ELRA 5BV1A 2LAIA 1N54A 3AG3E 4BEPA 4EECA 5FJYA 4K0RA 2RG8A 3U66A 4XIFA 2WXKA 3FTYA 3DSVA 5A7DB 4EZLA 4I6JA 3FTWA 2WMNA 4H7YA 3QK0A 5HQ8A 2MHKA 4GA0A 2ZXWE 3L54A 5CECB 5HKPA 4GTRA 4CGVA 1SZAA 5ENQD 2P9UG 4JA9A 5CEAA 4ACKA 4G8KA 4HRMB 3SD5A 2A4ZA 1HS6A 5JMND 3ZEFA 3GZ1A 3G2UA 1TNZA 3CKBA 1IHBA 3AS5A 3PUJA 3AU4A 3TGOA 1FVFA 3IHVA 4GZ3A 3L17A 4I6EA 1TJCA 2CG2A 3K9IA 4AJWA 3CLJA 2AJAA 1UW4B 3FUKA 2KCLA 5KNGA 3ZXSA 2KM4A 3LPZA 4J8DA 2MOWA 3AJIA 5EKQD 2KZTA 2GGFA 2WXHA 4GPKA 3RO2A 4TXQA 2WMOA 3QWPA 5KJNA 3Q7FA 3CK7A 2V0PA 3C3QA 3GZSA 5G2NA 2J49A 1E96B 3EHNA 3SY2A 1KPSB 1MHQA 4U04A 3APCA 3D3MA 3GW4A 3ZW3A 2PL2A 1OT8A 2OVBA 3OTNA 2XRZA 4HLLA 2XQ0A 1UN8A 4PS3A 5HS0A 4WWNA 4BSZB 1WY6A 3FUEA 5HRYA 2R5SA 4TV3A 4L2LA 4KVOA 3CK8A 2IU1A 4GZCA 3MCXA 2I1JA 3CHPA 2DZOA 2ZGGA 2VSOE 3O48A 2NXPA 4APFA 1BPOA 4KT6B 1LF8A 4UI9K 1S64A 2WXQA 3PE3A 1EPUA 2FO7A 1NZNA 3FEXA 4DX6D 3I5PA 3FUFA 4KBQA 3MZLB 4M3OA 3ABLE 3ZFWA 5HI7A 4F1SA 3UIPC 2CFZA 4O1PA 2OEVA 3UPVA 2A5EA 4B8CB 5KJKA 4A63B 2WXOA 5EIDA 4JHRA 4CDRA 4CRWA 2F37A 1V54E 4HNAD 5IY5E 3ONKA 1U3CA 4PS7A 3DXKG 3L13A 5FT9A 3FU5A 3RJVA 2JLBA 4GZ6A 2LAHA 5ANRA 3DPDA 3S7DA 4WNGA 3JCKC 2P9IG 4TUUA 5FZQA 5A23A 4FU3A 1Z5SC 4N39A 3JYSA 1Z3XA 3AG2E 3ESLA 3T5VA 1E90A 3C3OA 4GTMA 4BT9A 1HH8A 1O1TA 3EHRA 5D66A 4UWFA 1EDUA 4Q94A 4MRUA 4GB9A 2EIKE 3L16A 3MV2B 1XGWA 3B7UX 4CDMA 4Y6WA 3NZSA 3S7FA 1EYHA 2LSVA 5AQ9A 2AVPA 2GROB 3CVUA 2QC9A 4DX1A 2QZAA 4FULA 2X6HA 2RKKA 2ZIRA 2F8YA 4N2SA 3HXFA 4KZCA
chains in the Genus database with same CATH topology
2PM6A 4BSXA 3RRUA 2RD0A 1SZ9A 2XHEA 3DBSA 3L22A 3B13A 4JHJA 4XZ4A 4EQFA 4F7AA 4AV7A 4NRHB 3CSFA 5CHEE 2EQXA 4LEUA 4KXKB 4LCTA 1X5BA 4L2YA 4J8SA 2XPIA 3R9AB 1FCHA 5FQ8A 2HM8A 3G2TA 2XRYA 3CHMA 1KT0A 4J6IA 1A17A 2X6FA 3AS4A 3MJWA 4JA7A 1PC2A 4BY6A 5CMYA 4AIFA 2I9CA 3CR3A 1OWMA 4UWGA 1IQRA 2JEKA 4A1SA 3RKVA 3IV0A 4UWLA 1H0AA 2L0IA 3B7RL 2PQRA 4JXTA 3LKUA 4JPSA 1ELWA 3TG5A 4BTAA 5LCWJ 3ZVVA 1HG2A 2FF4A 4I2ZA 4UWHA 4KYOB 5KJMA 2L0TB 2NC9A 3OAWA 3QNKA 3FH8A 3BEEA 3MYVA 3QKYA 2E0IA 2V8SE 1N52A 2OOEA 3FUJA 3FU3A 5KJLA 1TEZA 5FQ6A 4UQXA 4I1MA 5E75A 3QC1A 3UT7A 4HLEA 5ARFA 2C0LA 5C2YA 1YA0A 4EZJA 3ULQA 1NA3A 4I43A 3CVVA 4Q96A 3PE4A 2IFUA 3GZ2A 1JWFA 3D9IA 2KZTB 5JHAA 1W3BA 4YNDA 4GMLA 4DLOA 5D0QD 3SNXA 4NURA 3QDNA 2WPVA 4IN3B 5G04C 3LXUX 4U8HA 4OVVA 2FULA 2PQNA 3L08A 2J08A 1OUVA 1WAO1 2KATA 2VQ2A 4WNFA 5LOZA 2I1KA 4R7LA 1Y8MA 2XEVA 2KC7A 3ZGQA 3FHEA 3TXNA 3RIBA 1NP7A 1HG5A 2C2LA 1OWOA 4JEUA 1JUQA 4I2WA 4XE0A 4WAFA 2Q7FA 4MS6A 4WUYA 3FTVA 5DIZA 2UWJG 1TJFA 2VSXE 1ZU2A 4FJYA 1XNFA 3FTZA 2WQHA 3G2SA 3CEQA 5LX8A 4E6HA 5T8IA 3MEKA 4G2VA 3N71A 2UY1B 3FU6A 3CSTA 4GU5A 5DBKA 3R7QA 3TJPA 2Y4UA 4K03A 4EPZA 2I6HA 4UQYA 4RSYA 4AXHA 2VSNA 3LS8A 2OV8A 2VGXB 4I1OB 4PUCA 2XGMA 4A3TA 4G1TA 1HX8A 3AU5A 4YVOA 3PRZA 3ZYQA 3FUNA 3TL5A 3ZHEB 3FEYA 3NF1A 4BTBA 5CCMA 1HFAA 3G2VA 4KVMA 5ENNA 3FUIA 3D9KA 4GYWA 3U4TA 4RVBA 3OXFA 2YNQA 4ATGA 4JL0A 3PREA 4LUNU 4ANUA 2BTDA 3QB2A 2IQCA 2WVIA 2WXIA 3ASHA 2L9BA 3D9JA 3HYMB 3CKCA 4UWKA 3VLDA 2YHEA 3SGHA 3FTSA 4OYSA 5D0OD 5FWQA 1B89A 4U07A 4U0SA 5JJ7A 3ZYLA 4A1GA 5FQ7A 3CVLA 4A3VA 4PS8A 4HVBA 2OVFA 4CCAA 4DLQA 4QFVA 2L6JA 4J8FA 1PAQA 4BX8A 4CDNA 4GYOA 1FVHA 4JZYA 3UT8A 2XCCA 2BUGA 5ANLA 3B7TA 3SZ7A 4HOSA 3LYAA 3EDTB 3HIZA 5BV0A 2UY1A 5BUZA 2AW6A 1S0PA 3PVLA 5G55A 3HHMA 5BT1A 2GRMA 2VGXA 1QQEA 3MKQB 4J8EA 1Y6IA 1KLXA 2LNIA 3SI5A 2YHCA 3PEVB 1ELRA 2IF4A 3CIAA 2LAIA 4XI0A 5BV1A 1N54A 4EZKA 3ZHEA 2VTBB 1WM5A 2E2EA 3MV3B 4RG6A 3QWWA 4FLBA 4EECA 3QWVA 1IYGA 5FJYA 2WQ6A 2QFCA 4GAAA 4L23A 4V3IA 3PH0C 1IHGA 1P5QA 4K0RA 4U0ZA 2RG8A 4CEMA 1Z6TA 4E85A 4L1BA 3EHMA 2V5FA 4G24A 3U66A 3LJ3A 4XIFA 2WXKA 3FTYA 4C0MA 4ILIA 4FC8A 4W9RA 5A7DB 2WQ7A 2CHXA 4EZLA 4HOTA 3FU0A 4P29A 4I6JA 3FTWA 3T5XA 2WMNA 3WXXA 2CHZA 3VLEA 1E7VA 2WXRA 4TRQA 4AOFA 2A5UA 4B89A 3FDHA 5G05J 4DI4A 2HO1A 3LVRE 2KCVA 4H7YA 3ASFA 4GMJA 2ZU6B 2CHWA 3QK0A 5HQ8A 4CT0A 2MHKA 3KS2A 4GA0A 3FP3A 2BF0X 5AIJA 2FI7A 4BWRA 5LP0A 3L54A 3HDXA 4U0UA 5ARGA 3MKQA 2WB2A 1HF8A 4N3BA 4Y6CA 3I3NA 4CGVA 4G26A 4MLPA 4NACA 2LO6A 1SZAA 4APOA 2QY7A 4HXIA 1IQUA 1UG3A 2WXLA 2WXPA 3ZRHA 4JA9A 1E8ZA 2X6JA 4FLHA 4I9CA 3QJZA 4ACKA 2CFUA 2IJGX 2X6IA 3FH7A 4URKA 4ACLA 3I4RB 3ZPJA 4NQ0A 4KMOA 3SD5A 3P1UA 3PNLB 4XKCA 4I9EA 4RG9A 4F3VA 2A4ZA 3CVWA 1HS6A 3KEZA 3ZEFA 4U63A 3GZ1A 4PDXA 5BPPA 5LFAA 3G2UA 2VYIA 3E4BA 3FFLA 3CKBA 3AS5A 3PUJA 5BNWA 1L5JA 2X38A 1QZ2A 2IOLA 2WXFA 3AU4A 3ML8A 4LRZA 3TGOA 1FVFA 2GW1A 3D9PA 4GCNA 3IHVA 4GZ3A 4GCOA 2LSUA 2P58C 3L17A 4XKBA 2XPYA 3C98A 4I6EA 2DCPA 3URZA 3D9LA 2FEZA 2WXGA 1TJCA 3GYZA 2CG2A 2WXJA 3K9IA 3ML9A 3Q15A 4LERA 2DIWA 4AJWA 3CLJA 1UW4B 3FUKA 3QAQA 5FTPA 2KCLA 4A55A 4GYYA 4YVQC 3JQ1A 2I2OA 3LEWA 3ZXSA 2KM4A 3LPZA 4J8DA 3EJNA 3MA5A 3NZUA 4GZDA 2MOWA 2VJ8A 3Q4AB 5EKQD 3CVPA 1E7UA 3OXGA 2KZTA 3I4GA 2GGFA 3O4ZA 1HU3A 2WXHA 5E76A 4GPKA 3IKOB 4B0ZA 4WWPA 3RO2A 2WMOA 2AXVA 3QWPA 4EBAG 5KJNA 3EIJA 1H2UA 2DBAA 4ILHB 4UQZA 4DPRA 2X3MA 4MKTA 3CK7A 2V0PA 3CVXA 3CVQA 3ASDA 4I17A 1HZ4A 3D9NA 3FTUA 3GZSA 5G2NA 5LCWC 1OWNA 2J49A 3B7SA 3SBTB 1E96B 3EHNA 4ME2A 1ZBPA 3P2BA 5AENA 3CQCB 1MHQA 2WM9A 4L7TA 5M72A 4U04A 3IEGA 4G11A 3APCA 3D3MA 4HFGA 1UN9A 3GW4A 3ZW3A 4C9BB 4Q69A 2PL2A 2HYZA 5FZRA 3PNTB 5T3RA 3ONLA 3QOUA 3CHRA 5G04J 2J07A 2XGSA 3VTXA 2KCKA 4AVXA 5EDSA 4ANWA 2OVBA 3OTNA 1E8XA 2XPZA 4H7XA 3JQ0A 2XRZA 4AY6A 3EIQC 3KAEA 1MQSA 4CT4A 2XQ0A 3FY4A 3PZDA 4UI9C 3FWVA 1OWPA 2IONA 2J4BA 2ONDA 4B94A 4J0UA 2HR2A 1PY1A 3R7RA 2J09A 1UN8A 3LY9A 4AM9A 4N2QA 5FZSA 4I1AA 4ANXA 2WXMA 4PS3A 4DK5A 3SF4A 4WWNA 4BT8A 3APFA 3PS6A 1WY6A 3FUEA 3FUHA 3Q47B 1NA0A 4JVSA 2AXZA 2R5SA 4TV3A 4L2LA 4KVOA 2Y4TA 3CK8A 2IU1A 4GZCA 5AJLA 3CVYA 5AYWD 4CGWA 3MCXA 2I1JA 3MGBA 3CHPA 2CG3A 3Q5MA 4G23A 3JUIA 1SQMA 4WNDA 3ZYKA 1HO8A 4JW1A 5BW8C 2J4DA 2VSOE 3UX4A 3IHYA 3O48A 1UJKA 3IBEA 4JHKA 3RO3A 2NXPA 3LDZA 3D9OA 4APFA 1BPOA 4KT6B 2VTBA 1LF8A 2J9QA 3CQGB 2M63A 4N5CA 4UI9K 3HVEB 2WXQA 1DNPA 3CK9A 3FUDA 3PE3A 4WWOA 1EPUA 3AS8A 5CCLA 2FO7A 3Q49B 1NZNA 1HXIA 2MRIA 3FEXA 3QARA 3I5PA 3FUFA 4GZ5A 1H6KA 4KBQA 1U3DA 3D9MA 1QNFA 3MZLB 3G2WA 3LVQE 3BG0B 4M3OA 4ABNA 1KT1A 2PM7A 3ZFWA 5HI7A 4F1SA 4HOQA 2CFZA 4GA1A 1E8WA 1H19A 3T8MA 2AWIA 4AEZC 4FJZA 1DVPA 1GW6A 3PDNA 5J90A 1OWLA 1H2VC 4FHJA 3SHFA 3FTXA 3UPVA 3LY7A 2Y3AA 3OXLA 4G25A 5FQ4A 3SFZA 4B8CB 3RRMB 5KJKA 3VTYA 4FA6A 3UUXA 4FP7A 2WXOA 2ILRA 2R17C 4JHRA 4CDRA 2XCBA 4CRWA 3ZIMA 3RU0A 4ILGA 3TXMA 2YQ8A 3ONKA 1U3CA 5A6CA 4OVUA 1JPLA 3LCAA 4IULA 4PS7A 3UQ3A 3CHQA 4JEHA 3ENEA 3L13A 3HVEA 4FHKA 3FU5A 4UI9J 5FT9A 3TAXA 2PZIA 4C0EA 3L6AA 3RJVA 3ZN3A 2JLBA 4HORA 4GZ6A 2LAHA 3PEUB 5ANRA 3DPDA 1Z3YA 1UJJA 3S7DA 4WNGA 3JCKC 1JWGA 2IOSA 2NSZA 4TUUA 5FZQA 3TG4A 3APDA 5A23A 4FU3A 3U64A 4WNEA 3U3WA 3RK6A 4IRUA 4EBAA 5EX0A 5J08A 4N39A 5JJ6A 3JYSA 2WXNA 5G05C 2R59A 4GA2A 1Z3XA 4N3AA 2X6KA 4KZ0A 3FH5A 3ESLA 3U9WA 3CGHA 4HOUA 4IYPA 4F53A 1ELKA 4JC8A 3SBSA 3T5VA 3ZYMA 3FUMA 4XX5A 5CMWA 4HS2A 3NQPA 3VLFA 1E90A 5JJTA 4B8AA 2C0MA 3S7JA 1INZA 4AP2A 3ASGA 4PH4B 4BT9A 3MKRA 1HH8A 4BX9A 4DI3A 3CHOA 5AJDA 3UT4A 2FBNA 4N3CA 4UWFA 1EDUA 4Q94A 4DJAA 4MRUA 3LY8A 4AY5A 3KD7A 4GB9A 3PUKA 3S2AA 4O6FA 3UMVA 2YINA 3S7BA 1EF1C 3RRNB 3BG1B 3L16A 3MV2B 1XGWA 3B7UX 4CDMA 3ESKA 2GRLA 5C1DA 4BFRA 2V4LA 1HE8A 4XI9A 1H2TC 4Y6WA 3NZSA 3S7FA 1EYHA 4I6GA 2LSVA 5T4YA 1E8YA 3MX3A 2VSYA 2VGYA 2AXUA 3CVNA 2AVPA 5JHBA 3CVUA 4D10C 3CHSA 5KCMA 5EX3A 3CV0A 4FULA 4ANVA 4FADA 2X6HA 3FULA 1VDYA 2XGOA 4N2SA 4KZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BSX A;  4C0M A;  2M63 A; 
#chains in the Genus database with same CATH topology
 3ABM E;  3DEP A;  2RD0 A;  2XHE A;  4XZ4 A;  4F7A A;  4NRH B;  4LEU A;  3V31 A;  4LCT A;  3R9A B;  5ENS D;  2P9L G;  2HM8 A;  5KWD A;  3CHM A;  4G8L A;  1IQR A;  1H6O A;  4JPS A;  3DRA A;  1HG2 A;  3UKR G;  4I2Z A;  4CZ2 D;  2NC9 A;  2V8S E;  5KJL A;  3QC1 A;  4HLE A;  1MJ0 A;  1NA3 A;  2NYJ A;  4GTV A;  1JWF A;  3D9I A;  5JHA A;  5D0Q D;  1KZO A;  4OVV A;  2J08 A;  1OUV A;  2I1K A;  3E30 A;  3FHE A;  2FO1 E;  1NP7 A;  4GMR A;  2XEE A;  4MS6 A;  4WUY A;  3Q7A A;  3FTV A;  5DIZ A;  1DC2 A;  1XNF A;  1D9S A;  3N71 A;  1OXJ A;  4GU5 A;  3R7Q A;  2I6H A;  1JCQ A;  2VSN A;  3TWT A;  4GTS A;  4EHM A;  3AU5 A;  3ZHE B;  1HFA A;  4KVM A;  4ATZ D;  1RZ4 A;  3PRE A;  2VGE A;  2BTD A;  2ETA A;  3QB2 A;  2WXI A;  4HQD A;  4OYS A;  5FWQ A;  4A1G A;  4J8F A;  1PAQ A;  3B7T A;  3EDT B;  2AW6 A;  1N4R A;  5G55 A;  3HHM A;  1QQE A;  1Y6I A;  1KLX A;  2YHC A;  3UIO C;  4DX7 D;  4XI0 A;  4EZK A;  4Z68 A;  2VTB B;  1WM5 A;  4RG6 A;  2OCC E;  3QWW A;  4FLB A;  3PH0 C;  1IHG A;  1P5Q A;  5AN8 A;  4U0Z A;  4G24 A;  3LJ3 A;  4C0M A;  3PZ3 A;  1D8E A;  4ILI A;  2WQ7 A;  5ENR D;  4HOT A;  3FU0 A;  4P29 A;  1WDY A;  3WXX A;  4YDW A;  2CHZ A;  3VLE A;  2WXR A;  4B89 A;  3Q9U C;  2HO1 A;  3ASF A;  2ZU6 B;  1KZP A;  2CHW A;  2FI7 A;  2WB2 A;  2R02 A;  1TN6 A;  3SQV A;  1OCR E;  4APO A;  4HXI A;  1IQU A;  1UG3 A;  3ZRH A;  2WXL A;  2WXP A;  1E8Z A;  4FLH A;  3QJZ A;  2JAB A;  3E32 A;  1N95 A;  3ZPJ A;  2IY0 C;  4DRX E;  5CRV A;  4I9E A;  4U63 A;  4PDX A;  5BPP A;  4YDO A;  5LFA A;  2VYI A;  5ENT D;  3E4B A;  2F0Y A;  2IOL A;  2KXP C;  2WXF A;  4GTP A;  4GCO A;  2LSU A;  2P58 C;  2FEZ A;  2WXJ A;  3Q15 A;  2DIW A;  3DXM G;  5FTP A;  4A55 A;  4LSZ E;  2I2O A;  1V55 E;  5EYL A;  4U8Y D;  3CVP A;  3OXG A;  3ZUV B;  4B0Z A;  4WWP A;  1MYO A;  3Q79 A;  3UXG A;  4EBA G;  3WG7 E;  3TWX A;  3BQO A;  1N94 A;  3T9K A;  5LCW C;  3SBT B;  4C48 B;  3CQC B;  5M72 A;  1TNO A;  2DVW A;  4C9B B;  2HYZ A;  5FZR A;  4GTQ A;  3PNT B;  5T3R A;  3QOU A;  5G04 J;  2XGS A;  2H6F A;  2KCK A;  1E8X A;  3JQ0 A;  4LNB A;  3PZD A;  3FWV A;  1OWP A;  2ION A;  4J0U A;  3UM2 A;  1N0Q A;  1PY1 A;  4N2Q A;  4DK5 A;  1JCS A;  4BT8 A;  3APF A;  3PS6 A;  2BKG A;  3DEO A;  4JVS A;  2AXZ A;  2Y4T A;  3CVY A;  4CGW A;  1SQM A;  4JW1 A;  3UX4 A;  1AWC B;  2ETC A;  3D9O A;  2J9Q A;  3HVE B;  1DNP A;  3CK9 A;  5CCL A;  1BU9 A;  2MRI A;  1H6K A;  4HOQ A;  4GA1 A;  5AAR A;  4FJZ A;  1OWL A;  3LY7 A;  1YYH A;  3SFZ A;  5FQ4 A;  1OY3 D;  3VTY A;  4FA6 A;  3TXM A;  3W9G A;  4GTT A;  4OVU A;  4IUL A;  3CHQ A;  3TWW A;  4JEH A;  3ENE A;  3L82 A;  1NI1 A;  2R2L A;  1H6P A;  1Z3Y A;  1AP7 A;  1UJJ A;  1QBQ A;  1JWG A;  4K5B A;  3U64 A;  2RFA A;  5EX0 A;  5G05 C;  2XEN A;  3JXJ A;  2X6K A;  1O1R A;  3FH5 A;  5ITZ F;  1ELK A;  4JC8 A;  4X8Q A;  3FUM A;  4XX5 A;  4HS2 A;  3VLF A;  3S7J A;  1INZ A;  2ETB A;  4AP2 A;  4BX9 A;  5AJD A;  4N3C A;  1SA4 A;  4MBG A;  4AY5 A;  3KD7 A;  1EF1 C;  3RAU A;  2LXM A;  1MX2 A;  2GRL A;  4BFR A;  1HE8 A;  1H2T C;  2DWZ A;  3MX3 A;  2AXU A;  5ENO D;  4D10 C;  4FAD A;  4HRN A;  4QQI A;  1VDY A;  2PM6 A;  4BSX A;  3B13 A;  4JHJ A;  1DCE A;  4AV7 A;  3CSF A;  4KXK B;  4L2Y A;  1X5B A;  4J8S A;  3MJW A;  4AIF A;  3EUV A;  2DYR E;  4A1S A;  3RKV A;  4UWL A;  2L0I A;  1SA5 A;  4JXT A;  3JUE A;  2R05 A;  4KYO B;  3QNK A;  3QKY A;  2E0I A;  5FQ6 A;  3T8K A;  4UQX A;  5KBA A;  5E75 A;  5EIL A;  2C0L A;  5C2Y A;  1YA0 A;  2Y69 E;  4EZJ A;  3CVV A;  2IFU A;  1N9A A;  2KZT B;  1W3B A;  4K5A B;  5LOZ A;  3BU8 A;  4WNF A;  2V4H C;  1Y8M A;  3ZGQ A;  2IO2 C;  4JEU A;  1JUQ A;  4XE0 A;  4WAF A;  2Q7F A;  2UWJ G;  1TJF A;  1ZU2 A;  3UKU G;  5D2M C;  1LD8 A;  3G2S A;  3CEQ A;  5T8I A;  3MEK A;  3CST A;  1TYQ G;  2Y4U A;  1OCO E;  1TR4 A;  4AXH A;  2VGX B;  2XGM A;  4A3T A;  4G1T A;  4YVO A;  5CCM A;  1NL4 A;  3FEY A;  4BTB A;  3AG4 E;  3G2V A;  3U4T A;  4GYW A;  3HG0 D;  3OXF A;  2YNQ A;  2LUH A;  4LUN U;  2IQC A;  2L9B A;  3D9J A;  3HYM B;  3VLD A;  2YHE A;  2QYU A;  2EIJ E;  5D0O D;  1B89 A;  4U07 A;  3ZYL A;  5FQ7 A;  4PS8 A;  4QFV A;  1UOH A;  4ZHB A;  4JZY A;  2XCC A;  4RQI A;  3LYA A;  2OEW A;  3HIZ A;  3EU9 A;  2QYJ A;  3MKQ B;  3SI5 A;  3PEV B;  2IF4 A;  3ZHE A;  2E2E A;  3MV3 B;  2WQ6 A;  2QFC A;  3B7B A;  4L23 A;  3IXE A;  4CEM A;  4DX5 D;  4K5C A;  3EHM A;  2V5F A;  1MZC A;  3ZU7 B;  4FC8 A;  4W9R A;  2CHX A;  3RSE G;  1E7V A;  4TRQ A;  4AOF A;  3FDH A;  3LVR E;  4GMJ A;  3C3R A;  3E37 A;  1BI8 B;  4U95 D;  1JCR A;  2BF0 X;  5AIJ A;  4BWR A;  2XS8 A;  1HF8 A;  4N3B A;  4NAC A;  4CYM D;  1FT2 A;  4UUC A;  2CFU A;  2IJG X;  2X6I A;  3FH7 A;  4URK A;  3C72 A;  4KMO A;  2F8X K;  3P1U A;  1IKN D;  4RG9 A;  5AQA A;  1K1B A;  3KEZ A;  3HXE A;  3FFL A;  3DSU A;  3PZ2 A;  5BNW A;  2X38 A;  3ML8 A;  4LRZ A;  2GW1 A;  3D9P A;  1Q2Z A;  2XPY A;  2DCP A;  3URZ A;  2IEJ A;  3UM0 A;  3NB2 A;  2P9S G;  3QAQ A;  4GYY A;  3JQ1 A;  3MA5 A;  4GZD A;  1K8K G;  2R03 A;  5CER B;  4J7W A;  3I4G A;  1HU3 A;  5E76 A;  4ILH B;  2DBA A;  2X3M A;  3CVX A;  3CVQ A;  3ASD A;  4GTO A;  3NOC D;  5B1B E;  4ME2 A;  5BXU A;  4HB5 A;  3HXD A;  3P2B A;  5AEN A;  2WM9 A;  4L7T A;  4G11 A;  5CBO A;  3UM1 A;  4BES A;  1UN9 A;  4Q69 A;  4LNG A;  4N5Q A;  3LJN A;  4AVX A;  5EDS A;  4AY6 A;  3EIQ C;  1LTX A;  3KAE A;  2EIL E;  3TWV A;  4RLY A;  3FY4 A;  2HR2 A;  4AM9 A;  5FZS A;  4I1A A;  4ANX A;  2WXM A;  2Y0B G;  3SF4 A;  2PNN A;  3FUH A;  3ASN E;  3Q47 B;  3UI2 A;  3TWR A;  3MGB A;  2CG3 A;  3Q5M A;  4WND A;  3JUI A;  1HO8 A;  2J4D A;  3HXB A;  3IBE A;  4JHK A;  3W9F A;  3LDZ A;  1OCC E;  3SO8 A;  3CQG B;  2XZD G;  2M63 A;  3FUD A;  1O5M A;  4WWO A;  3Q49 B;  3E33 A;  5FIN A;  3V30 A;  3LVQ E;  3BG0 B;  3Q75 A;  4ABN A;  1KT1 A;  1E8W A;  1H19 A;  1TNU A;  3T8M A;  4AEZ C;  1TNB A;  1DVP A;  1GW6 A;  3SHF A;  2Y3A A;  2GRQ B;  2P2C P;  3RRM B;  3UUX A;  1YCS B;  2H6H A;  2R17 C;  2XCB A;  3DST A;  3ZIM A;  4ILG A;  3J5P A;  3LCA A;  4DUI A;  3UQ3 A;  2DYS E;  4CT4 A;  4FHK A;  3HVE A;  3TAX A;  2PZI A;  4U7E B;  3ZN3 A;  4ZFH A;  3PEU B;  1S70 B;  3ZNG A;  2IOS A;  3RK6 A;  4IRU A;  4EBA A;  5J08 A;  5JJ6 A;  2R59 A;  4GA2 A;  2B0O E;  4F53 A;  2GRP B;  5CMW A;  3DSS A;  4BET A;  2HE0 A;  4B8A A;  3AAA C;  5AQB A;  3ASG A;  4PH4 B;  3MKR A;  4DI3 A;  3UT4 A;  1N4P A;  2FBN A;  4DJA A;  3B95 A;  4O6F A;  5CBN A;  3S7B A;  3RRN B;  3BG1 B;  2DZN A;  5CED B;  5C1D A;  3CVN A;  5JHB A;  5KCM A;  1FPP A;  4ANV A;  1S63 A;  4B93 B;  4XEI G;  3DBS A;  3L22 A;  4EQF A;  5CHE E;  2EQX A;  3NAW A;  1BI7 B;  3KEA A;  2XPI A;  2XS1 A;  1FCH A;  5FQ8 A;  1N11 A;  3G2T A;  3ZKJ A;  2X6F A;  1PC2 A;  5CMY A;  2I9C A;  3CR3 A;  1OWM A;  4UWG A;  2L6B A;  2RFM A;  2JEK A;  5AAO A;  3IV0 A;  3B7R L;  3LKU A;  5LCW J;  3ZVV A;  2FF4 A;  5KJM A;  5BXO A;  3BEE A;  3MYV A;  4HI9 A;  5ENP D;  2OOE A;  3FU3 A;  3UT7 A;  3E34 A;  1SW6 A;  3PE4 A;  4YND A;  4DLO A;  3SNX A;  2ZIS A;  3LXU X;  4U8H A;  2FUL A;  2PQN A;  3L08 A;  2KAT A;  4R7L A;  1YMP A;  4LNU D;  3TXN A;  1LD7 A;  1HG5 A;  1OWO A;  4I2W A;  1N4S A;  2GRN B;  1MX4 A;  5LX8 A;  4E6H A;  4G2V A;  4DX2 A;  2UY1 B;  5DBK A;  3TJP A;  3HXC A;  4K03 A;  3LS8 A;  4HBD A;  4I1O B;  4PUC A;  1HX8 A;  2ZGD A;  3BUA A;  3PRZ A;  1G3N B;  3NF1 A;  4ATG A;  4ANU A;  2WVI A;  4NIK A;  3CKC A;  4UWK A;  3FTS A;  5JJ7 A;  4U0S A;  4HVB A;  2OVF A;  4CCA A;  2L6J A;  4GYO A;  1FVH A;  3UT8 A;  5ANL A;  4HOS A;  4OAV B;  3PZ1 A;  5BUZ A;  2Y1L E;  1BD8 A;  2BED A;  5BT1 A;  2VGX A;  3JXI A;  2LNI A;  3CIA A;  3QWV A;  1IYG A;  4O60 A;  4V3I A;  4GAA A;  5B1A E;  3NOG D;  1Z6T A;  4E85 A;  4L1B A;  2GRR B;  3D9H A;  3F6Q A;  2KBX A;  1K3Z D;  3T5X A;  5H7P A;  2A5U A;  1DCQ A;  3PZ4 A;  5G05 J;  4DI4 A;  2KCV A;  4HI8 A;  5EN5 D;  4CT0 A;  3KS2 A;  3FP3 A;  5LP0 A;  3Q73 A;  3HDX A;  4U0U A;  3Q78 A;  3MKQ A;  5ARG A;  4F1P A;  4Y6C A;  3I3N A;  3KSL A;  4G26 A;  4MLP A;  2LO6 A;  2QY7 A;  2X6J A;  2P9K G;  4I9C A;  4ACL A;  3I4R B;  3ZXP A;  4GPM A;  4NQ0 A;  3PNL B;  4XKC A;  3CVW A;  3UM3 A;  3UTM A;  1L5J A;  1QZ2 A;  3V79 K;  4GCN A;  4XKB A;  3C98 A;  3D9L A;  2WXG A;  3GYZ A;  3ML9 A;  4LER A;  4U96 D;  4YVQ C;  3LEW A;  2EIM E;  3EJN A;  3NZU A;  2VJ8 A;  3Q4A B;  5EIB E;  1A5E A;  4BER A;  1E7U A;  3O4Z A;  3DSW A;  3IKO B;  1QYM A;  2AXV A;  3EIJ A;  1H2U A;  4UQZ A;  4DPR A;  4JB8 P;  3KSQ A;  4MKT A;  4I17 A;  2P9P G;  1HZ4 A;  3D9N A;  3FTU A;  1OWN A;  3B7S A;  1SVX A;  1TNY A;  1ZBP A;  1TN7 A;  2XZT G;  3IEG A;  1NFI E;  4HFG A;  3DSX A;  3ONL A;  3CHR A;  2J07 A;  3VTX A;  4ANW A;  4H7X A;  2XPZ A;  1N0R A;  2V5Q C;  1MQS A;  4UI9 C;  4F3V A;  1X81 A;  2J4B A;  2OND A;  4B94 A;  3R7R A;  2J09 A;  3LY9 A;  4O1O A;  3Q9N C;  1NA0 A;  5AJL A;  5AYW D;  1D8D A;  4G23 A;  5JA4 D;  2P9N G;  3ZYK A;  5BW8 C;  3IHY A;  1TN8 A;  1UJK A;  3RO3 A;  4F6R D;  4TUM A;  2VTB A;  2XEH A;  2B6C A;  4N5C A;  3AS8 A;  5AQ7 A;  3QAR A;  1HXI A;  4GZ5 A;  3AG1 E;  1U3D A;  3D9M A;  1QNF A;  3G2W A;  2PM7 A;  2AWI A;  3PDN A;  5J90 A;  4FHJ A;  1H2V C;  4L9P A;  3FTX A;  3OXL A;  4G25 A;  2J8S D;  3SFX A;  4FP7 A;  2ILR A;  1WG0 A;  3RU0 A;  2YQ8 A;  4M7C A;  5A6C A;  3C5R A;  1JPL A;  1BLX B;  4UI9 J;  4J8Y A;  4C0E A;  3L6A A;  4HRL A;  4HOR A;  5CRU A;  3X2Q E;  1K1A A;  3TWU A;  2NSZ A;  3TG4 A;  3APD A;  4WNE A;  3U3W A;  3V2O A;  2WXN A;  4N3A A;  4KZ0 A;  3U9W A;  3CGH A;  4HOU A;  1RW2 A;  4IYP A;  3SBS A;  3ZYM A;  3NQP A;  3DPY A;  5JJT A;  2C0M A;  4U8V D;  3CHO A;  3LY8 A;  3PUK A;  3S2A A;  5FIO A;  3UMV A;  2YIN A;  3SFY A;  3HRA A;  3ESK A;  2H6G A;  2V4L A;  4XI9 A;  3TWS A;  4I6G A;  5T4Y A;  1E8Y A;  2VSY A;  4OAU C;  2VGY A;  3CHS A;  5EX3 A;  3CV0 A;  2IO3 C;  3FUL A;  2XGO A;  1U2V G;  3UIN C;  3RRU A;  1SZ9 A;  3L9T A;  4TXR A;  2XRY A;  1OCZ E;  1KT0 A;  4J6I A;  1A17 A;  3AS4 A;  4BY6 A;  4JA7 A;  3EU5 A;  3ABK E;  1IXV A;  1H0A A;  2PQR A;  4BTA A;  1ELW A;  3TG5 A;  3J5Q B;  4UWH A;  2LXL A;  3TWQ A;  2L0T B;  3OAW A;  3FH8 A;  5KNH D;  5EYP F;  3ULE G;  1N52 A;  3EHQ A;  3FUJ A;  1N4Q A;  1TEZ A;  4I1M A;  5ARF A;  3ULQ A;  4I43 A;  4Q96 A;  3GZ2 A;  4GML A;  3NBN B;  4NUR A;  3QDN A;  2WPV A;  4IN3 B;  5G04 C;  1WAO 1;  2VQ2 A;  4TXP A;  2XEV A;  2KC7 A;  3RIB A;  2C2L A;  4YDY A;  2BKK B;  2VSX E;  4FJY A;  3FTZ A;  2WQH A;  4YDE A;  3R9M A;  3FU6 A;  4EPZ A;  4UQY A;  4RSY A;  5B3S E;  2OV8 A;  2H6I A;  3ZYQ A;  3FUN A;  3TL5 A;  5ENN A;  3FUI A;  3D9K A;  4RVB A;  4JL0 A;  3ASO E;  1FT1 A;  3ASH A;  3DWL G;  2EIN E;  3SGH A;  1ZB1 A;  3CVL A;  3ULY A;  4JD2 G;  4A3V A;  4DLQ A;  4CDN A;  4BX8 A;  3ISM C;  3V2X A;  2MYO A;  2BUG A;  3SZ7 A;  5BV0 A;  1MX6 A;  2UY1 A;  1S0P A;  3PVL A;  4LG6 A;  2GRM A;  4J8E A;  1O1S A;  1ELR A;  5BV1 A;  2LAI A;  1N54 A;  3AG3 E;  4BEP A;  4EEC A;  5FJY A;  4K0R A;  2RG8 A;  3U66 A;  4XIF A;  2WXK A;  3FTY A;  3DSV A;  5A7D B;  4EZL A;  4I6J A;  3FTW A;  2WMN A;  4H7Y A;  3QK0 A;  5HQ8 A;  2MHK A;  4GA0 A;  2ZXW E;  3L54 A;  5CEC B;  5HKP A;  4GTR A;  4CGV A;  1SZA A;  5ENQ D;  2P9U G;  4JA9 A;  5CEA A;  4ACK A;  4G8K A;  4HRM B;  3SD5 A;  2A4Z A;  1HS6 A;  5JMN D;  3ZEF A;  3GZ1 A;  3G2U A;  1TNZ A;  3CKB A;  1IHB A;  3AS5 A;  3PUJ A;  3AU4 A;  3TGO A;  1FVF A;  3IHV A;  4GZ3 A;  3L17 A;  4I6E A;  1TJC A;  2CG2 A;  3K9I A;  4AJW A;  3CLJ A;  2AJA A;  1UW4 B;  3FUK A;  2KCL A;  5KNG A;  3ZXS A;  2KM4 A;  3LPZ A;  4J8D A;  2MOW A;  3AJI A;  5EKQ D;  2KZT A;  2GGF A;  2WXH A;  4GPK A;  3RO2 A;  4TXQ A;  2WMO A;  3QWP A;  5KJN A;  3Q7F A;  3CK7 A;  2V0P A;  3C3Q A;  3GZS A;  5G2N A;  2J49 A;  1E96 B;  3EHN A;  3SY2 A;  1KPS B;  1MHQ A;  4U04 A;  3APC A;  3D3M A;  3GW4 A;  3ZW3 A;  2PL2 A;  1OT8 A;  2OVB A;  3OTN A;  2XRZ A;  4HLL A;  2XQ0 A;  1UN8 A;  4PS3 A;  5HS0 A;  4WWN A;  4BSZ B;  1WY6 A;  3FUE A;  5HRY A;  2R5S A;  4TV3 A;  4L2L A;  4KVO A;  3CK8 A;  2IU1 A;  4GZC A;  3MCX A;  2I1J A;  3CHP A;  2DZO A;  2ZGG A;  2VSO E;  3O48 A;  2NXP A;  4APF A;  1BPO A;  4KT6 B;  1LF8 A;  4UI9 K;  1S64 A;  2WXQ A;  3PE3 A;  1EPU A;  2FO7 A;  1NZN A;  3FEX A;  4DX6 D;  3I5P A;  3FUF A;  4KBQ A;  3MZL B;  4M3O A;  3ABL E;  3ZFW A;  5HI7 A;  4F1S A;  3UIP C;  2CFZ A;  4O1P A;  2OEV A;  3UPV A;  2A5E A;  4B8C B;  5KJK A;  4A63 B;  2WXO A;  5EID A;  4JHR A;  4CDR A;  4CRW A;  2F37 A;  1V54 E;  4HNA D;  5IY5 E;  3ONK A;  1U3C A;  4PS7 A;  3DXK G;  3L13 A;  5FT9 A;  3FU5 A;  3RJV A;  2JLB A;  4GZ6 A;  2LAH A;  5ANR A;  3DPD A;  3S7D A;  4WNG A;  3JCK C;  2P9I G;  4TUU A;  5FZQ A;  5A23 A;  4FU3 A;  1Z5S C;  4N39 A;  3JYS A;  1Z3X A;  3AG2 E;  3ESL A;  3T5V A;  1E90 A;  3C3O A;  4GTM A;  4BT9 A;  1HH8 A;  1O1T A;  3EHR A;  5D66 A;  4UWF A;  1EDU A;  4Q94 A;  4MRU A;  4GB9 A;  2EIK E;  3L16 A;  3MV2 B;  1XGW A;  3B7U X;  4CDM A;  4Y6W A;  3NZS A;  3S7F A;  1EYH A;  2LSV A;  5AQ9 A;  2AVP A;  2GRO B;  3CVU A;  2QC9 A;  4DX1 A;  2QZA A;  4FUL A;  2X6H A;  2RKK A;  2ZIR A;  2F8Y A;  4N2S A;  3HXF A;  4KZC A; 
#chains in the Genus database with same CATH homology
 2PM6 A;  4BSX A;  3RRU A;  2RD0 A;  1SZ9 A;  2XHE A;  3DBS A;  3L22 A;  3B13 A;  4JHJ A;  4XZ4 A;  4EQF A;  4F7A A;  4AV7 A;  4NRH B;  3CSF A;  5CHE E;  2EQX A;  4LEU A;  4KXK B;  4LCT A;  1X5B A;  4L2Y A;  4J8S A;  2XPI A;  3R9A B;  1FCH A;  5FQ8 A;  2HM8 A;  3G2T A;  2XRY A;  3CHM A;  1KT0 A;  4J6I A;  1A17 A;  2X6F A;  3AS4 A;  3MJW A;  4JA7 A;  1PC2 A;  4BY6 A;  5CMY A;  4AIF A;  2I9C A;  3CR3 A;  1OWM A;  4UWG A;  1IQR A;  2JEK A;  4A1S A;  3RKV A;  3IV0 A;  4UWL A;  1H0A A;  2L0I A;  3B7R L;  2PQR A;  4JXT A;  3LKU A;  4JPS A;  1ELW A;  3TG5 A;  4BTA A;  5LCW J;  3ZVV A;  1HG2 A;  2FF4 A;  4I2Z A;  4UWH A;  4KYO B;  5KJM A;  2L0T B;  2NC9 A;  3OAW A;  3QNK A;  3FH8 A;  3BEE A;  3MYV A;  3QKY A;  2E0I A;  2V8S E;  1N52 A;  2OOE A;  3FUJ A;  3FU3 A;  5KJL A;  1TEZ A;  5FQ6 A;  4UQX A;  4I1M A;  5E75 A;  3QC1 A;  3UT7 A;  4HLE A;  5ARF A;  2C0L A;  5C2Y A;  1YA0 A;  4EZJ A;  3ULQ A;  1NA3 A;  4I43 A;  3CVV A;  4Q96 A;  3PE4 A;  2IFU A;  3GZ2 A;  1JWF A;  3D9I A;  2KZT B;  5JHA A;  1W3B A;  4YND A;  4GML A;  4DLO A;  5D0Q D;  3SNX A;  4NUR A;  3QDN A;  2WPV A;  4IN3 B;  5G04 C;  3LXU X;  4U8H A;  4OVV A;  2FUL A;  2PQN A;  3L08 A;  2J08 A;  1OUV A;  1WAO 1;  2KAT A;  2VQ2 A;  4WNF A;  5LOZ A;  2I1K A;  4R7L A;  1Y8M A;  2XEV A;  2KC7 A;  3ZGQ A;  3FHE A;  3TXN A;  3RIB A;  1NP7 A;  1HG5 A;  2C2L A;  1OWO A;  4JEU A;  1JUQ A;  4I2W A;  4XE0 A;  4WAF A;  2Q7F A;  4MS6 A;  4WUY A;  3FTV A;  5DIZ A;  2UWJ G;  1TJF A;  2VSX E;  1ZU2 A;  4FJY A;  1XNF A;  3FTZ A;  2WQH A;  3G2S A;  3CEQ A;  5LX8 A;  4E6H A;  5T8I A;  3MEK A;  4G2V A;  3N71 A;  2UY1 B;  3FU6 A;  3CST A;  4GU5 A;  5DBK A;  3R7Q A;  3TJP A;  2Y4U A;  4K03 A;  4EPZ A;  2I6H A;  4UQY A;  4RSY A;  4AXH A;  2VSN A;  3LS8 A;  2OV8 A;  2VGX B;  4I1O B;  4PUC A;  2XGM A;  4A3T A;  4G1T A;  1HX8 A;  3AU5 A;  4YVO A;  3PRZ A;  3ZYQ A;  3FUN A;  3TL5 A;  3ZHE B;  3FEY A;  3NF1 A;  4BTB A;  5CCM A;  1HFA A;  3G2V A;  4KVM A;  5ENN A;  3FUI A;  3D9K A;  4GYW A;  3U4T A;  4RVB A;  3OXF A;  2YNQ A;  4ATG A;  4JL0 A;  3PRE A;  4LUN U;  4ANU A;  2BTD A;  3QB2 A;  2IQC A;  2WVI A;  2WXI A;  3ASH A;  2L9B A;  3D9J A;  3HYM B;  3CKC A;  4UWK A;  3VLD A;  2YHE A;  3SGH A;  3FTS A;  4OYS A;  5D0O D;  5FWQ A;  1B89 A;  4U07 A;  4U0S A;  5JJ7 A;  3ZYL A;  4A1G A;  5FQ7 A;  3CVL A;  4A3V A;  4PS8 A;  4HVB A;  2OVF A;  4CCA A;  4DLQ A;  4QFV A;  2L6J A;  4J8F A;  1PAQ A;  4BX8 A;  4CDN A;  4GYO A;  1FVH A;  4JZY A;  3UT8 A;  2XCC A;  2BUG A;  5ANL A;  3B7T A;  3SZ7 A;  4HOS A;  3LYA A;  3EDT B;  3HIZ A;  5BV0 A;  2UY1 A;  5BUZ A;  2AW6 A;  1S0P A;  3PVL A;  5G55 A;  3HHM A;  5BT1 A;  2GRM A;  2VGX A;  1QQE A;  3MKQ B;  4J8E A;  1Y6I A;  1KLX A;  2LNI A;  3SI5 A;  2YHC A;  3PEV B;  1ELR A;  2IF4 A;  3CIA A;  2LAI A;  4XI0 A;  5BV1 A;  1N54 A;  4EZK A;  3ZHE A;  2VTB B;  1WM5 A;  2E2E A;  3MV3 B;  4RG6 A;  3QWW A;  4FLB A;  4EEC A;  3QWV A;  1IYG A;  5FJY A;  2WQ6 A;  2QFC A;  4GAA A;  4L23 A;  4V3I A;  3PH0 C;  1IHG A;  1P5Q A;  4K0R A;  4U0Z A;  2RG8 A;  4CEM A;  1Z6T A;  4E85 A;  4L1B A;  3EHM A;  2V5F A;  4G24 A;  3U66 A;  3LJ3 A;  4XIF A;  2WXK A;  3FTY A;  4C0M A;  4ILI A;  4FC8 A;  4W9R A;  5A7D B;  2WQ7 A;  2CHX A;  4EZL A;  4HOT A;  3FU0 A;  4P29 A;  4I6J A;  3FTW A;  3T5X A;  2WMN A;  3WXX A;  2CHZ A;  3VLE A;  1E7V A;  2WXR A;  4TRQ A;  4AOF A;  2A5U A;  4B89 A;  3FDH A;  5G05 J;  4DI4 A;  2HO1 A;  3LVR E;  2KCV A;  4H7Y A;  3ASF A;  4GMJ A;  2ZU6 B;  2CHW A;  3QK0 A;  5HQ8 A;  4CT0 A;  2MHK A;  3KS2 A;  4GA0 A;  3FP3 A;  2BF0 X;  5AIJ A;  2FI7 A;  4BWR A;  5LP0 A;  3L54 A;  3HDX A;  4U0U A;  5ARG A;  3MKQ A;  2WB2 A;  1HF8 A;  4N3B A;  4Y6C A;  3I3N A;  4CGV A;  4G26 A;  4MLP A;  4NAC A;  2LO6 A;  1SZA A;  4APO A;  2QY7 A;  4HXI A;  1IQU A;  1UG3 A;  2WXL A;  2WXP A;  3ZRH A;  4JA9 A;  1E8Z A;  2X6J A;  4FLH A;  4I9C A;  3QJZ A;  4ACK A;  2CFU A;  2IJG X;  2X6I A;  3FH7 A;  4URK A;  4ACL A;  3I4R B;  3ZPJ A;  4NQ0 A;  4KMO A;  3SD5 A;  3P1U A;  3PNL B;  4XKC A;  4I9E A;  4RG9 A;  4F3V A;  2A4Z A;  3CVW A;  1HS6 A;  3KEZ A;  3ZEF A;  4U63 A;  3GZ1 A;  4PDX A;  5BPP A;  5LFA A;  3G2U A;  2VYI A;  3E4B A;  3FFL A;  3CKB A;  3AS5 A;  3PUJ A;  5BNW A;  1L5J A;  2X38 A;  1QZ2 A;  2IOL A;  2WXF A;  3AU4 A;  3ML8 A;  4LRZ A;  3TGO A;  1FVF A;  2GW1 A;  3D9P A;  4GCN A;  3IHV A;  4GZ3 A;  4GCO A;  2LSU A;  2P58 C;  3L17 A;  4XKB A;  2XPY A;  3C98 A;  4I6E A;  2DCP A;  3URZ A;  3D9L A;  2FEZ A;  2WXG A;  1TJC A;  3GYZ A;  2CG2 A;  2WXJ A;  3K9I A;  3ML9 A;  3Q15 A;  4LER A;  2DIW A;  4AJW A;  3CLJ A;  1UW4 B;  3FUK A;  3QAQ A;  5FTP A;  2KCL A;  4A55 A;  4GYY A;  4YVQ C;  3JQ1 A;  2I2O A;  3LEW A;  3ZXS A;  2KM4 A;  3LPZ A;  4J8D A;  3EJN A;  3MA5 A;  3NZU A;  4GZD A;  2MOW A;  2VJ8 A;  3Q4A B;  5EKQ D;  3CVP A;  1E7U A;  3OXG A;  2KZT A;  3I4G A;  2GGF A;  3O4Z A;  1HU3 A;  2WXH A;  5E76 A;  4GPK A;  3IKO B;  4B0Z A;  4WWP A;  3RO2 A;  2WMO A;  2AXV A;  3QWP A;  4EBA G;  5KJN A;  3EIJ A;  1H2U A;  2DBA A;  4ILH B;  4UQZ A;  4DPR A;  2X3M A;  4MKT A;  3CK7 A;  2V0P A;  3CVX A;  3CVQ A;  3ASD A;  4I17 A;  1HZ4 A;  3D9N A;  3FTU A;  3GZS A;  5G2N A;  5LCW C;  1OWN A;  2J49 A;  3B7S A;  3SBT B;  1E96 B;  3EHN A;  4ME2 A;  1ZBP A;  3P2B A;  5AEN A;  3CQC B;  1MHQ A;  2WM9 A;  4L7T A;  5M72 A;  4U04 A;  3IEG A;  4G11 A;  3APC A;  3D3M A;  4HFG A;  1UN9 A;  3GW4 A;  3ZW3 A;  4C9B B;  4Q69 A;  2PL2 A;  2HYZ A;  5FZR A;  3PNT B;  5T3R A;  3ONL A;  3QOU A;  3CHR A;  5G04 J;  2J07 A;  2XGS A;  3VTX A;  2KCK A;  4AVX A;  5EDS A;  4ANW A;  2OVB A;  3OTN A;  1E8X A;  2XPZ A;  4H7X A;  3JQ0 A;  2XRZ A;  4AY6 A;  3EIQ C;  3KAE A;  1MQS A;  4CT4 A;  2XQ0 A;  3FY4 A;  3PZD A;  4UI9 C;  3FWV A;  1OWP A;  2ION A;  2J4B A;  2OND A;  4B94 A;  4J0U A;  2HR2 A;  1PY1 A;  3R7R A;  2J09 A;  1UN8 A;  3LY9 A;  4AM9 A;  4N2Q A;  5FZS A;  4I1A A;  4ANX A;  2WXM A;  4PS3 A;  4DK5 A;  3SF4 A;  4WWN A;  4BT8 A;  3APF A;  3PS6 A;  1WY6 A;  3FUE A;  3FUH A;  3Q47 B;  1NA0 A;  4JVS A;  2AXZ A;  2R5S A;  4TV3 A;  4L2L A;  4KVO A;  2Y4T A;  3CK8 A;  2IU1 A;  4GZC A;  5AJL A;  3CVY A;  5AYW D;  4CGW A;  3MCX A;  2I1J A;  3MGB A;  3CHP A;  2CG3 A;  3Q5M A;  4G23 A;  3JUI A;  1SQM A;  4WND A;  3ZYK A;  1HO8 A;  4JW1 A;  5BW8 C;  2J4D A;  2VSO E;  3UX4 A;  3IHY A;  3O48 A;  1UJK A;  3IBE A;  4JHK A;  3RO3 A;  2NXP A;  3LDZ A;  3D9O A;  4APF A;  1BPO A;  4KT6 B;  2VTB A;  1LF8 A;  2J9Q A;  3CQG B;  2M63 A;  4N5C A;  4UI9 K;  3HVE B;  2WXQ A;  1DNP A;  3CK9 A;  3FUD A;  3PE3 A;  4WWO A;  1EPU A;  3AS8 A;  5CCL A;  2FO7 A;  3Q49 B;  1NZN A;  1HXI A;  2MRI A;  3FEX A;  3QAR A;  3I5P A;  3FUF A;  4GZ5 A;  1H6K A;  4KBQ A;  1U3D A;  3D9M A;  1QNF A;  3MZL B;  3G2W A;  3LVQ E;  3BG0 B;  4M3O A;  4ABN A;  1KT1 A;  2PM7 A;  3ZFW A;  5HI7 A;  4F1S A;  4HOQ A;  2CFZ A;  4GA1 A;  1E8W A;  1H19 A;  3T8M A;  2AWI A;  4AEZ C;  4FJZ A;  1DVP A;  1GW6 A;  3PDN A;  5J90 A;  1OWL A;  1H2V C;  4FHJ A;  3SHF A;  3FTX A;  3UPV A;  3LY7 A;  2Y3A A;  3OXL A;  4G25 A;  5FQ4 A;  3SFZ A;  4B8C B;  3RRM B;  5KJK A;  3VTY A;  4FA6 A;  3UUX A;  4FP7 A;  2WXO A;  2ILR A;  2R17 C;  4JHR A;  4CDR A;  2XCB A;  4CRW A;  3ZIM A;  3RU0 A;  4ILG A;  3TXM A;  2YQ8 A;  3ONK A;  1U3C A;  5A6C A;  4OVU A;  1JPL A;  3LCA A;  4IUL A;  4PS7 A;  3UQ3 A;  3CHQ A;  4JEH A;  3ENE A;  3L13 A;  3HVE A;  4FHK A;  3FU5 A;  4UI9 J;  5FT9 A;  3TAX A;  2PZI A;  4C0E A;  3L6A A;  3RJV A;  3ZN3 A;  2JLB A;  4HOR A;  4GZ6 A;  2LAH A;  3PEU B;  5ANR A;  3DPD A;  1Z3Y A;  1UJJ A;  3S7D A;  4WNG A;  3JCK C;  1JWG A;  2IOS A;  2NSZ A;  4TUU A;  5FZQ A;  3TG4 A;  3APD A;  5A23 A;  4FU3 A;  3U64 A;  4WNE A;  3U3W A;  3RK6 A;  4IRU A;  4EBA A;  5EX0 A;  5J08 A;  4N39 A;  5JJ6 A;  3JYS A;  2WXN A;  5G05 C;  2R59 A;  4GA2 A;  1Z3X A;  4N3A A;  2X6K A;  4KZ0 A;  3FH5 A;  3ESL A;  3U9W A;  3CGH A;  4HOU A;  4IYP A;  4F53 A;  1ELK A;  4JC8 A;  3SBS A;  3T5V A;  3ZYM A;  3FUM A;  4XX5 A;  5CMW A;  4HS2 A;  3NQP A;  3VLF A;  1E90 A;  5JJT A;  4B8A A;  2C0M A;  3S7J A;  1INZ A;  4AP2 A;  3ASG A;  4PH4 B;  4BT9 A;  3MKR A;  1HH8 A;  4BX9 A;  4DI3 A;  3CHO A;  5AJD A;  3UT4 A;  2FBN A;  4N3C A;  4UWF A;  1EDU A;  4Q94 A;  4DJA A;  4MRU A;  3LY8 A;  4AY5 A;  3KD7 A;  4GB9 A;  3PUK A;  3S2A A;  4O6F A;  3UMV A;  2YIN A;  3S7B A;  1EF1 C;  3RRN B;  3BG1 B;  3L16 A;  3MV2 B;  1XGW A;  3B7U X;  4CDM A;  3ESK A;  2GRL A;  5C1D A;  4BFR A;  2V4L A;  1HE8 A;  4XI9 A;  1H2T C;  4Y6W A;  3NZS A;  3S7F A;  1EYH A;  4I6G A;  2LSV A;  5T4Y A;  1E8Y A;  3MX3 A;  2VSY A;  2VGY A;  2AXU A;  3CVN A;  2AVP A;  5JHB A;  3CVU A;  4D10 C;  3CHS A;  5KCM A;  5EX3 A;  3CV0 A;  4FUL A;  4ANV A;  4FAD A;  2X6H A;  3FUL A;  1VDY A;  2XGO A;  4N2S A;  4KZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...