2KBXA

Solution structure of ilk-pinch complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
171
Chain Sequence
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin-linked protein kinase
publication title Cytosketal proteins
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 33
structure length 171
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2kbxA00
4BERA 3AJIA 3EHRA 3T8KA 5JA4D 2NYJA 2L6BA 5FIOA 4CZ2D 4DUIA 1S70B 1D9SA 1DCQA 4J7WA 4ATZD 3W9GA 1K1BA 3EHQA 4ZFHA 4J8YA 3NOGD 2DWZA 2ETBA 5EYLA 3NOCD 1BI8B 2HE0A 1YYHA 2F8XK 3ZKJA 4K5AB 4DX7D 1K3ZD 4O1OA 4YDYA 2F37A 1MX6A 4O60A 5KNHD 2B0OE 3Q9NC 4OAVB 1BD8A 3ZUVB 2PNNA 3DEOA 5KWDA 1OT8A 1MX2A 5ENPD 3ZU7B 5HRYA 1MJ0A 1DC2A 1UOHA 3TWRA 1SW6A 1BU9A 2ETAA 4HNAD 4QFVA 1N11A 3J5PA 4U96D 1N0RA 3TWSA 5ITZF 3LJNA 4HRMB 5ENQD 1YCSB 1N0QA 1IXVA 2DZNA 2V5QC 4A63B 4UUCA 2ZGGA 1QYMA 2MYOA 5EN5D 5HKPA 2P2CP 5KNGA 4HB5A 1IKND 4HI8A 2DZOA 1NFIE 1TR4A 1G3NB 3T9KA 5AQ9A 2BKGA 2XEHA 2QC9A 2AJAA 2Y1LE 3TWWA 4DX2A 4DX1A 4QQIA 4U8VD 3B7BA 2DVWA 4G8LA 4GMRA 4F6RD 4ZHBA 2FO1E 3HRAA 2A5EA 3F6QA 3JXIA 2ETCA 4LNUD 5AAOA 5JMND 3TWXA 1AWCB 5CBOA 3ZNGA 3DEPA 5AQ7A 4C48B 1K1AA 4BESA 4B93B 5HS0A 1AP7A 4U95D 1YMPA 4F1PA 2XZDG 4Z68A 2XZTG 3HG0D 4BETA 4DX6D 1BLXB 3C5RA 4BSZB 3V2XA 2JABA 2ZGDA 4HQDA 5EIBE 4YDWA 3B95A 2XENA 4RLYA 4HI9A 5AN8A 1WG0A 2RFMA 3EU9A 5BXOA 5AQAA 3J5QB 3UI2A 4HRNA 3IXEA 4K5CA 3SO8A 4O1PA 4DX5D 3JXJA 1IHBA 2Y0BG 5FINA 5CEAA 1SVXA 1BI7B 2BKKB 2VGEA 4GPMA 4LG6A 5ENTD 1OY3D 5CEDB 5ENOD 5D66A 5EILA 4DRXE 2RFAA 1MYOA 1MX4A 5ENRD 1A5EA 4JB8P 3TWVA 5KBAA 3V2OA 3AAAC 4TUMA 5CBNA 3NBNB 3UTMA 4HBDA 5EIDA 4LSZE 2QYJA 4HRLA 3TWUA 5CERB 3JUEA 2F8YA 4N5QA 5BXUA 2J8SD 4G8KA 2V4HC 4OAUC 3W9FA 4HLLA 5ENSD 2XEEA 3D9HA 4K5BA 2KBXA 3KEAA 5EYPF 5CECB 3TWTA 4U8YD 3UXGA 3V31A 4BEPA 2KXPC 5AQBA 3V30A 4CYMD 3Q9UC 5AARA 1WDYA 3TWQA 4NIKA 3V79K
chains in the Genus database with same CATH superfamily
1PC2A 3PRZA 3UKRG 2E2EA 4JHJA 2LSVA 3ZW3A 4K5AB 4G23A 2VSYA 2WXIA 2AVPA 1OT8A 3RO2A 1UG3A 3CKBA 4HLEA 5CRUA 3PUKA 4JVSA 4XEIG 2WXPA 2DZNA 3VLDA 3FUNA 4DLOA 5KNGA 1JWGA 2OVBA 1TN8A 3I3NA 4Q69A 1UJKA 4F6RD 3F6QA 1N4QA 4LNGA 4N39A 1FPPA 1KT0A 1K1AA 3ZRHA 4Z68A 3DSXA 3MYVA 3CVLA 3JQ0A 4BETA 1N94A 2YQ8A 3MZLB 4BSZB 3ISMC 3B95A 3WXXA 2CHWA 2ONDA 2I2OA 4HI9A 3ASOE 2B6CA 3HXBA 2KCKA 3IXEA 3U4TA 3SO8A 3CK8A 3VTYA 1SZ9A 2VGEA 1N4PA 2XGMA 3AG2E 3HXDA 5CBNA 2AXZA 3UIOC 1EYHA 1E7VA 1U3DA 4HRLA 3E32A 4UWHA 2H6IA 4XIFA 1BPOA 4HLLA 2DYSE 3CVPA 5FQ7A 3ZFWA 5LOZA 2C2LA 3QWPA 4FJYA 5JJ7A 3FUFA 5EYLA 1BI8B 3HHMA 3ZKJA 4AXHA 3U64A 2FEZA 4V3IA 5HRYA 1UOHA 3TG5A 4TRQA 4FLHA 3J5PA 5FQ6A 2H6HA 4HOSA 4UQXA 4NQ0A 3E34A 4I6GA 1D8EA 2P2CP 4HB5A 2PQNA 2VTBA 3FTVA 1S0PA 2WXQA 4Q96A 2WXGA 3LKUA 4PDXA 2LAHA 4EECA 1MZCA 4D10C 3PS6A 2MHKA 4KMOA 1PY1A 4B8AA 5JHBA 3CQGB 1W3BA 2XZDG 3SY2A 3LY8A 2R17C 4DX6D 2A4ZA 4WNFA 3C5RA 4WUYA 4HVBA 4KZ0A 4GZ3A 5CMWA 3SFZA 1UN9A 1E8WA 1TNOA 2L0IA 2H6GA 2WB2A 3FWVA 1K8KG 2BUGA 2VTBB 3DSWA 3FTUA 5ENOD 4L1BA 4BWRA 4XX5A 3PVLA 5KJKA 4YDEA 3R7QA 4L9PA 4GYOA 2CG2A 5T8IA 5D2MC 3W9FA 2P9LG 4XKCA 2IO3C 2FO7A 1EDUA 3RKVA 4HOQA 4TUUA 3EHNA 4BFRA 4X8QA 2V5FA 3GYZA 3L22A 2NYJA 2L6BA 2Y4TA 3ZYMA 3LEWA 2XGSA 3SF4A 1OUVA 2NC9A 2WQ6A 3HXFA 4B89A 4UWKA 4ACKA 1TNYA 2FBNA 3TWRA 3CVUA 4QFVA 2P9SG 1HF8A 5T3RA 1IXVA 2MRIA 1JCQA 3SHFA 3D9NA 3T5VA 2UWJG 4HXIA 4GA0A 2EIKE 3IV0A 2J49A 4ZHBA 2Q7FA 4L2YA 1SA5A 3LS8A 3D9KA 1HO8A 4BT8A 4ACLA 1H19A 2IONA 3UQ3A 2L9BA 2J4DA 5G55A 5LCWJ 3L16A 1H6PA 3JUIA 3V2XA 3UI2A 1UN8A 2HM8A 1Y6IA 4GTVA 4DRXE 4R7LA 4GAAA 4I6JA 3V2OA 4C0EA 4ANVA 4LSZE 3TWUA 4AV7A 5AIJA 4EHMA 2VSOE 3ZVVA 1SZAA 1OWPA 4FHJA 3LCAA 4TXRA 3AJIA 4GTTA 4G11A 4BT9A 1K1BA 3PE4A 3KSQA 3QWWA 3FTXA 2X6HA 3Q7FA 4AVXA 2HE0A 4DX7D 1U3CA 4CCAA 2F37A 5AENA 2I9CA 2GRLA 1V54E 3S7FA 3DEOA 4AP2A 4B0ZA 3QC1A 4BSXA 2R05A 4AJWA 4WAFA 4FC8A 3B13A 1YCSB 3ABKE 3U66A 2C0LA 2I6HA 5FQ8A 3C98A 4GTPA 5DIZA 2XEHA 5BNWA 3IHVA 4GZCA 3JXIA 5BUZA 5JMND 4U0ZA 3CVVA 1IQUA 3OXGA 1H6KA 3R7RA 4XI9A 3BQOA 4A3VA 2LSUA 2L0TB 1Y8MA 3UM1A 3JYSA 4MS6A 2ILRA 3CV0A 2M63A 5FZSA 5EILA 4KBQA 3TWVA 4JHKA 2P9UG 3UTMA 3CLJA 3ESLA 3AU5A 3SBTB 4WWPA 2RG8A 3PEVB 2WXLA 1MQSA 2WQHA 3HXCA 3NZSA 3TWQA 5FT9A 3JQ1A 4XZ4A 2XRZA 1D9SA 3FFLA 1N95A 3FUDA 2DWZA 1JUQA 4DI4A 5KNHD 5KCMA 1BD8A 2QFCA 2PNNA 4XKBA 4K03A 2PM6A 4GTMA 3MKRA 4B94A 2R5SA 3ZXSA 3ZYLA 5ENQD 1KT1A 3VLFA 3E33A 3NF1A 1ELRA 5FZRA 3ULYA 1TYQG 3AS8A 2X6KA 3IKOB 2FO1E 3APFA 3DEPA 4KT6B 3FTYA 3FU6A 3G2WA 2WMOA 3FH8A 2XS1A 2X6JA 1BLXB 3BEEA 2WM9A 3SFYA 3EU9A 3UPVA 3G2SA 3J5QB 4GTQA 2PQRA 3T8MA 2BKKB 1OY3D 3I4RB 1MYOA 1A17A 2OV8A 4JB8P 5M72A 1HG5A 2DIWA 1Z3XA 4DPRA 2GRPB 4GZ5A 2R03A 3FTSA 4G8KA 4JHRA 4YVQC 3Q75A 2VYIA 3V31A 2KZTB 5J08A 1B89A 3ONLA 1IYGA 3RSEG 5JHAA 3VTXA 2IU1A 4I9EA 4A1SA 4JPSA 3PZ1A 1E8YA 2F8XK 1K3ZD 5G05C 2WXOA 2LNIA 3O4ZA 3RIBA 1MX2A 1DC2A 4AIFA 4I2WA 2V8SE 4JZYA 5EX0A 4MRUA 3L82A 1O1TA 3C3QA 2I1KA 1IKND 1TR4A 2Y69E 2JLBA 2QC9A 3QK0A 2Y1LE 3TWWA 3CVQA 2OEVA 4ME2A 1H0AA 2DYRE 1AWCB 1ELWA 4UQZA 1NP7A 4WNGA 4F1PA 3ESKA 1KPSB 4TV3A 2ZGDA 3LVRE 3HDXA 2AXUA 2P9KG 4KVMA 3UM3A 5CEAA 3T5XA 5KBAA 3AAAC 3NBNB 4RVBA 2XPZA 4GYWA 4BX8A 3CHPA 3TXMA 4GCNA 3FEXA 3CK7A 3FTZA 2J9QA 4GMLA 4GYYA 1WDYA 2MOWA 4KZCA 1D8DA 3V79K 2J09A 1S70B 1KZPA 4IN3B 4J8YA 3CKCA 3PE3A 4CDRA 4DJAA 3PZ4A 1MX6A 3UX4A 4O6FA 2LO6A 2GGFA 2QYUA 5ENPD 1SW6A 2WXJA 3TWSA 3LJNA 3TJPA 2RKKA 1N0QA 3WG7E 5LP0A 3QAQA 2DZOA 5BPPA 5ANRA 4M3OA 1FCHA 1H2TC 4U8VD 2LXMA 4KVOA 4G24A 3GZ1A 3U9WA 2PZIA 3ZNGA 4RG6A 5AQ7A 1JPLA 4FHKA 4F3VA 4DLQA 3Q49B 2BTDA 2P9NG 4YVOA 3FUIA 4GTOA 3FH7A 3B7RL 3ML8A 2CFZA 3DWLG 1EPUA 2YNQA 1HFAA 4WNDA 1Q2ZA 5FTPA 4GCOA 3QDNA 1JCSA 5FJYA 3TGOA 5CRVA 2X38A 4TUMA 5KJLA 4B8CB 4EPZA 4HBDA 1KZOA 4N5QA 2FF4A 3LY7A 2LUHA 5G04C 5ENSD 4GPKA 3MA5A 5AQBA 3D9JA 5B1AE 1S63A 2KATA 1X81A 3AS4A 3DPDA 2IEJA 2XEVA 3FUEA 3RRNB 3E30A 3SNXA 1N9AA 4G1TA 2ETBA 3AG1E 4W9RA 3NOCD 4I43A 3X2QE 4O1OA 4YDYA 1HE8A 2B0OE 4N3CA 4F7AA 5ENNA 2GROB 2IQCA 4U04A 1VDYA 5ITZF 4MBGA 1MHQA 3GZ2A 3DSVA 5FZQA 5D0QD 3S2AA 3NAWA 3G2UA 1G3NB 4URKA 4DI3A 1LD8A 4FA6A 3HXEA 4G8LA 4UI9C 4Y6WA 4BTBA 4A55A 5ARFA 2J08A 2ETCA 4AOFA 4L23A 4LUNU 5HS0A 1YMPA 3GZSA 1S64A 3K9IA 3LPZA 3C3RA 5A6CA 3S7JA 2XRYA 2AXVA 2JABA 3DXKG 3VLEA 4RSYA 1WG0A 3PDNA 4WWOA 3MV2B 3PZ3A 4LRZA 5BV1A 1HS6A 2QYJA 2J07A 3JCKC 4JEHA 5B3SE 1OWOA 2V0PA 3CEQA 2WXNA 3IEGA 3P1UA 3S7DA 3T8KA 2GRMA 3D9MA 4EZLA 3FUKA 2CHXA 1DCQA 4J7WA 4ZFHA 3MJWA 3ML9A 2I1JA 3PZ2A 3BG0B 3AG3E 4OAVB 4HS2A 2AWIA 2ZXWE 3FU5A 2KM4A 3CHQA 1WM5A 3FHEA 4U96D 1N0RA 3Q5MA 4J0UA 3KS2A 3B7SA 4GTSA 4E6HA 4UUCA 3DSUA 3G2VA 4HORA 3RJVA 1XGWA 2KCLA 5AAOA 4J6IA 2JEKA 3ASHA 2QY7A 2H6FA 3Q4AB 5EIBE 3C72A 3ZEFA 5A7DB 2RFMA 2LAIA 4O1PA 5ENTD 2RFAA 5ENRD 4AEZC 4A1GA 4UWFA 1NI1A 4H7XA 3JUEA 3Q73A 5EKQD 3UKUG 3CQCB 3UXGA 4CYMD 4UQYA 4NIKA 2VQ2A 2IY0C 5JA4D 5HQ8A 4TXPA 1LD7A 5G2NA 1H6OA 2L6JA 1IHGA 2UY1A 5EX3A 3QNKA 4OVUA 1H2UA 1TNBA 4C0MA 3Q79A 3UINC 2IF4A 2OVFA 4FP7A 2X6FA 1QYMA 1Z5SC 3QARA 1YA0A 4KYOB 4HI8A 3ZHEA 3T9KA 3KSLA 3D3MA 2WMNA 5BW8C 2P58C 4Q94A 5ARGA 3URZA 3HRAA 1Z3YA 4HOTA 1DCEA 2X6IA 5LFAA 4AM9A 3UIPC 1HG2A 3ULQA 4U07A 3LY9A 5H7PA 2XQ0A 3E4BA 4I9CA 5JJTA 2BEDA 3RRMB 3SBSA 3FTWA 3ZXPA 2VGYA 2GW1A 1PAQA 4M7CA 4DK5A 2XENA 4ILGA 1TN7A 3LYAA 3UT7A 3ZHEB 3SZ7A 2Y0BG 1E8XA 5CMYA 2C0MA 5CCLA 4LNBA 1O5MA 3SFXA 5ANLA 5BT1A 4N2QA 3MGBA 4NRHB 3IBEA 2GRNB 4HOUA 3MCXA 4YDOA 3D9HA 5CHEE 5DBKA 3LJ3A 2KXPC 5E76A 2RD0A 3V30A 1SA4A 1TJCA 1RW2A 4LCTA 3EHRA 1N52A 4CZ2D 4F1SA 3BUAA 2BF0X 3EHQA 3C3OA 2IJGX 1O1SA 3QB2A 3EHMA 3ENEA 1NZNA 4OYSA 4JD2G 3L9TA 3ZU7B 1KLXA 1BU9A 4HNAD 4YNDA 1N11A 3CK9A 3UT8A 4JW1A 4EZJA 2IFUA 1OCOE 3FEYA 3KEZA 2BKGA 3TL5A 3UM0A 4DX2A 2ZISA 3PUJA 3FH5A 4IRUA 3B7BA 3ASDA 1GW6A 2WXRA 1NA0A 4IULA 3TWXA 3B7TA 4JA7A 4U95D 3UUXA 5D0OD 4EZKA 3DSTA 3TXNA 3U3WA 2WVIA 4APFA 3ZGQA 4NURA 4MLPA 3CSTA 1E7UA 3PZDA 1BI7B 4I6EA 1IQRA 5CEDB 4ABNA 4I1AA 1MX4A 3BG1B 2E0IA 4N2SA 1NA3A 4FJZA 3MX3A 4CEMA 4PH4B 5HI7A 5CERB 5BXUA 4OAUC 3BU8A 4K5BA 4L7TA 3NB2A 4CDMA 4MKTA 3ASGA 1JWFA 4N3BA 3E37A 3EUVA 3PREA 2KCVA 3D9IA 4Y6CA 5G05J 1DVPA 2XS8A 1YYHA 3HIZA 2R02A 2F0YA 3OTNA 1LTXA 4JC8A 1N4RA 4C9BB 3GW4A 1H2VC 2V5QC 3FDHA 1E90A 2ZGGA 1SQMA 2MYOA 5HKPA 1FVFA 4G25A 1OWMA 1E96B 3HYMB 3Q7AA 2LXLA 4ANXA 5J90A 5T4YA 4C48B 2GRRB 1RZ4A 2A5UA 2VGXA 2XZTG 3HG0D 3ZN3A 1OCZE 3CIAA 4WNEA 4YDWA 5BXOA 4GA2A 3L08A 4HRNA 2ZU6B 4K5CA 3PNLB 4E85A 2Y3AA 1SVXA 4EQFA 4GPMA 4GA1A 4EBAG 4APOA 1FT1A 3SQVA 5KJMA 2DBAA 4PUCA 4ILIA 2EIJE 1QNFA 1U2VG 5JJ6A 1NL4A 1UW4B 4I1MA 5EYPF 3TWTA 3ASNE 4J8SA 2VGXB 2XPIA 3ONKA 2J4BA 5AARA 3ZYKA 3LDZA 3SD5A 1OWLA 2IOLA 2FULA 2ZIRA 1OCCE 3PH0C 2YINA 3W9GA 4K0RA 1EF1C 3DXMG 3SGHA 4UWGA 2HR2A 4AY6A 3HVEA 4J8EA 3Q15A 3Q47B 1O1RA 3D9PA 4PS8A 5IY5E 4G2VA 1OWNA 4A63B 2EILE 3ABME 3B7UX 1N54A 2FI7A 1HZ4A 5AQ9A 2XCBA 1ZU2A 3QWVA 2IOSA 3L17A 4U63A 1TNZA 1WY6A 1JCRA 4GMRA 1HH8A 1HU3A 4LNUD 3D9OA 3Q78A 3HVEB 4U0UA 3OXLA 3KAEA 1WAO1 1QQEA 5LCWC 4HQDA 1ELKA 4LERA 3QOUA 2P9PG 2GRQB 2NXPA 4FLBA 2XPYA 4NACA 5D66A 3D9LA 1A5EA 4CT4A 3AS5A 1L5JA 5G04J 3AU4A 3TG4A 2J8SD 3EIQC 2XEEA 3I5PA 2V4LA 3RK6A 3ZYQA 3L54A 3Q9UC 4PS3A 3CGHA 4H7YA 5FIOA 2HYZA 1QBQA 4ATZD 1X5BA 4JEUA 5KWDA 4N3AA 1MJ0A 2R2LA 2ETAA 3DSSA 5LX8A 3PEUB 2EINE 3LXUX 2NSZA 3RU0A 4CDNA 3FULA 5EN5D 4JL0A 4ATGA 3FU3A 4UI9J 4UI9K 4QQIA 2HO1A 5AJLA 4GMJA 1DNPA 2A5EA 4BY6A 4XI0A 4P29A 4J8DA 3IHYA 4U7EB 4RLYA 4LEUA 2OOEA 4HFGA 1INZA 5AQAA 4WWNA 4L2LA 5AYWD 3FUJA 4DX5D 4UWLA 2R59A 4RQIA 1ZB1A 1N4SA 3ABLE 3NZUA 1FT2A 3APCA 3QKYA 3MV3B 1V55E 4CGWA 2WXHA 1TEZA 2CFUA 2F8YA 1TJFA 3DBSA 1HX8A 1Z6TA 2IO2C 4N5CA 3P2BA 4FADA 5CECB 2CHZA 1OXJA 3CVWA 4JXTA 4BERA 3CHOA 2YHEA 3FUMA 2WQ7A 4DUIA 4I17A 2Y4UA 4KXKB 2KC7A 4GB9A 2XHEA 5BV0A 3Q9NC 2QZAA 3QJZA 4G26A 4CGVA 3O48A 2VJ8A 1UJJA 2P9IG 3UT4A 3EIJA 4HRMB 5B1BE 1NFIE 1ZBPA 3L13A 2VSXE 3TAXA 4I1OB 1QZ2A 3PNTB 4GZDA 2WXKA 3KD7A 4DX1A 5AJDA 1LF8A 2DVWA 3DPYA 3R9AB 5FQ4A 2OCCE 1HXIA 2AW6A 3L6AA 4ILHB 2CG3A 3MKQA 2YHCA 4GU5A 3CHSA 3S7BA 2PL2A 3NQPA 4JA9A 5FWQA 3I4GA 5AN8A 3CSFA 2WPVA 2VSNA 2UY1B 3MEKA 5EDSA 3DRAA 4TXQA 1FVHA 4EBAA 2DCPA 2EQXA 3ASFA 4BX9A 2KBXA 3KEAA 3SI5A 3MKQB 3EDTB 1OCRE 3CVYA 4A3TA 4RG9A 2EIME 3EJNA 4FULA 3FP3A 3G2TA 4XE0A 2XCCA 3APDA 3NOGD 4O60A 4IYPA 3ZUVB 2X3MA 4PS7A 3ULEG 4ANWA 5A23A 3UMVA 3RO3A 4ANUA 3CVXA 3FU0A 1P5QA 4I2ZA 1TNUA 2WXFA 2KZTA 5C2YA 3ZIMA 4U0SA 5C1DA 2AJAA 4AY5A 3OXFA 4CT0A 4J8FA 4F53A 4OVVA 3LVQE 5CBOA 5E75A 4BESA 3AG4E 4B93B 1AP7A 3CHMA 5CCMA 3RRUA 3FY4A 3RAUA 2PM7A 5KJNA 3ZPJA 3JXJA 1IHBA 5FINA 4LG6A 2OEWA 3R9MA 3OAWA 4BTAA 4FU3A 3CR3A 5EIDA 1TN6A 1E8ZA 4CRWA 2V4HC 4U8HA 3FUHA 3EU5A 3CVNA 2WXMA 3N71A 3CHRA 4U8YD 4BEPA 2XGOA 3UM2A 4GZ6A 1XNFA 4GTRA
chains in the Genus database with same CATH topology
4BERA 3AJIA 3EHRA 3T8KA 5JA4D 2NYJA 2L6BA 5FIOA 4CZ2D 4DUIA 1S70B 1D9SA 1DCQA 4J7WA 4ATZD 3W9GA 1K1BA 3EHQA 4ZFHA 4J8YA 3NOGD 2DWZA 2ETBA 5EYLA 3NOCD 1BI8B 2HE0A 1YYHA 2F8XK 3ZKJA 4K5AB 4DX7D 1K3ZD 4O1OA 4YDYA 2F37A 1MX6A 4O60A 5KNHD 2B0OE 3Q9NC 4OAVB 1BD8A 3ZUVB 2PNNA 3DEOA 5KWDA 1OT8A 1MX2A 5ENPD 3ZU7B 5HRYA 1MJ0A 1DC2A 1UOHA 3TWRA 1SW6A 1BU9A 2ETAA 4HNAD 4QFVA 1N11A 3J5PA 4U96D 1N0RA 3TWSA 5ITZF 3LJNA 4HRMB 5ENQD 1YCSB 1N0QA 1IXVA 2DZNA 2V5QC 4A63B 4UUCA 2ZGGA 1QYMA 2MYOA 5EN5D 5HKPA 2P2CP 5KNGA 4HB5A 1IKND 4HI8A 2DZOA 1NFIE 1TR4A 1G3NB 3T9KA 5AQ9A 2BKGA 2XEHA 2QC9A 2AJAA 2Y1LE 3TWWA 4DX2A 4DX1A 4QQIA 4U8VD 3B7BA 2DVWA 4G8LA 4GMRA 4F6RD 4ZHBA 2FO1E 3HRAA 2A5EA 3F6QA 3JXIA 2ETCA 4LNUD 5AAOA 5JMND 3TWXA 1AWCB 5CBOA 3ZNGA 3DEPA 5AQ7A 4C48B 1K1AA 4BESA 4B93B 5HS0A 1AP7A 4U95D 1YMPA 4F1PA 2XZDG 4Z68A 2XZTG 3HG0D 4BETA 4DX6D 1BLXB 3C5RA 4BSZB 3V2XA 2JABA 2ZGDA 4HQDA 5EIBE 4YDWA 3B95A 2XENA 4RLYA 4HI9A 5AN8A 1WG0A 2RFMA 3EU9A 5BXOA 5AQAA 3J5QB 3UI2A 4HRNA 3IXEA 4K5CA 3SO8A 4O1PA 4DX5D 3JXJA 1IHBA 2Y0BG 5FINA 5CEAA 1SVXA 1BI7B 2BKKB 2VGEA 4GPMA 4LG6A 5ENTD 1OY3D 5CEDB 5ENOD 5D66A 5EILA 4DRXE 2RFAA 1MYOA 1MX4A 5ENRD 1A5EA 4JB8P 3TWVA 5KBAA 3V2OA 3AAAC 4TUMA 5CBNA 3NBNB 3UTMA 4HBDA 5EIDA 4LSZE 2QYJA 4HRLA 3TWUA 5CERB 3JUEA 2F8YA 4N5QA 5BXUA 2J8SD 4G8KA 2V4HC 4OAUC 3W9FA 4HLLA 5ENSD 2XEEA 3D9HA 4K5BA 2KBXA 3KEAA 5EYPF 5CECB 3TWTA 4U8YD 3UXGA 3V31A 4BEPA 2KXPC 5AQBA 3V30A 4CYMD 3Q9UC 5AARA 1WDYA 3TWQA 4NIKA 3V79K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BER A;  3AJI A;  3EHR A;  3T8K A;  5JA4 D;  2NYJ A;  2L6B A;  5FIO A;  4CZ2 D;  4DUI A;  1S70 B;  1D9S A;  1DCQ A;  4J7W A;  4ATZ D;  3W9G A;  1K1B A;  3EHQ A;  4ZFH A;  4J8Y A;  3NOG D;  2DWZ A;  2ETB A;  5EYL A;  3NOC D;  1BI8 B;  2HE0 A;  1YYH A;  2F8X K;  3ZKJ A;  4K5A B;  4DX7 D;  1K3Z D;  4O1O A;  4YDY A;  2F37 A;  1MX6 A;  4O60 A;  5KNH D;  2B0O E;  3Q9N C;  4OAV B;  1BD8 A;  3ZUV B;  2PNN A;  3DEO A;  5KWD A;  1OT8 A;  1MX2 A;  5ENP D;  3ZU7 B;  5HRY A;  1MJ0 A;  1DC2 A;  1UOH A;  3TWR A;  1SW6 A;  1BU9 A;  2ETA A;  4HNA D;  4QFV A;  1N11 A;  3J5P A;  4U96 D;  1N0R A;  3TWS A;  5ITZ F;  3LJN A;  4HRM B;  5ENQ D;  1YCS B;  1N0Q A;  1IXV A;  2DZN A;  2V5Q C;  4A63 B;  4UUC A;  2ZGG A;  1QYM A;  2MYO A;  5EN5 D;  5HKP A;  2P2C P;  5KNG A;  4HB5 A;  1IKN D;  4HI8 A;  2DZO A;  1NFI E;  1TR4 A;  1G3N B;  3T9K A;  5AQ9 A;  2BKG A;  2XEH A;  2QC9 A;  2AJA A;  2Y1L E;  3TWW A;  4DX2 A;  4DX1 A;  4QQI A;  4U8V D;  3B7B A;  2DVW A;  4G8L A;  4GMR A;  4F6R D;  4ZHB A;  2FO1 E;  3HRA A;  2A5E A;  3F6Q A;  3JXI A;  2ETC A;  4LNU D;  5AAO A;  5JMN D;  3TWX A;  1AWC B;  5CBO A;  3ZNG A;  3DEP A;  5AQ7 A;  4C48 B;  1K1A A;  4BES A;  4B93 B;  5HS0 A;  1AP7 A;  4U95 D;  1YMP A;  4F1P A;  2XZD G;  4Z68 A;  2XZT G;  3HG0 D;  4BET A;  4DX6 D;  1BLX B;  3C5R A;  4BSZ B;  3V2X A;  2JAB A;  2ZGD A;  4HQD A;  5EIB E;  4YDW A;  3B95 A;  2XEN A;  4RLY A;  4HI9 A;  5AN8 A;  1WG0 A;  2RFM A;  3EU9 A;  5BXO A;  5AQA A;  3J5Q B;  3UI2 A;  4HRN A;  3IXE A;  4K5C A;  3SO8 A;  4O1P A;  4DX5 D;  3JXJ A;  1IHB A;  2Y0B G;  5FIN A;  5CEA A;  1SVX A;  1BI7 B;  2BKK B;  2VGE A;  4GPM A;  4LG6 A;  5ENT D;  1OY3 D;  5CED B;  5ENO D;  5D66 A;  5EIL A;  4DRX E;  2RFA A;  1MYO A;  1MX4 A;  5ENR D;  1A5E A;  4JB8 P;  3TWV A;  5KBA A;  3V2O A;  3AAA C;  4TUM A;  5CBN A;  3NBN B;  3UTM A;  4HBD A;  5EID A;  4LSZ E;  2QYJ A;  4HRL A;  3TWU A;  5CER B;  3JUE A;  2F8Y A;  4N5Q A;  5BXU A;  2J8S D;  4G8K A;  2V4H C;  4OAU C;  3W9F A;  4HLL A;  5ENS D;  2XEE A;  3D9H A;  4K5B A;  2KBX A;  3KEA A;  5EYP F;  5CEC B;  3TWT A;  4U8Y D;  3UXG A;  3V31 A;  4BEP A;  2KXP C;  5AQB A;  3V30 A;  4CYM D;  3Q9U C;  5AAR A;  1WDY A;  3TWQ A;  4NIK A;  3V79 K; 
#chains in the Genus database with same CATH topology
 1PC2 A;  3PRZ A;  3UKR G;  2E2E A;  4JHJ A;  2LSV A;  3ZW3 A;  4K5A B;  4G23 A;  2VSY A;  2WXI A;  2AVP A;  1OT8 A;  3RO2 A;  1UG3 A;  3CKB A;  4HLE A;  5CRU A;  3PUK A;  4JVS A;  4XEI G;  2WXP A;  2DZN A;  3VLD A;  3FUN A;  4DLO A;  5KNG A;  1JWG A;  2OVB A;  1TN8 A;  3I3N A;  4Q69 A;  1UJK A;  4F6R D;  3F6Q A;  1N4Q A;  4LNG A;  4N39 A;  1FPP A;  1KT0 A;  1K1A A;  3ZRH A;  4Z68 A;  3DSX A;  3MYV A;  3CVL A;  3JQ0 A;  4BET A;  1N94 A;  2YQ8 A;  3MZL B;  4BSZ B;  3ISM C;  3B95 A;  3WXX A;  2CHW A;  2OND A;  2I2O A;  4HI9 A;  3ASO E;  2B6C A;  3HXB A;  2KCK A;  3IXE A;  3U4T A;  3SO8 A;  3CK8 A;  3VTY A;  1SZ9 A;  2VGE A;  1N4P A;  2XGM A;  3AG2 E;  3HXD A;  5CBN A;  2AXZ A;  3UIO C;  1EYH A;  1E7V A;  1U3D A;  4HRL A;  3E32 A;  4UWH A;  2H6I A;  4XIF A;  1BPO A;  4HLL A;  2DYS E;  3CVP A;  5FQ7 A;  3ZFW A;  5LOZ A;  2C2L A;  3QWP A;  4FJY A;  5JJ7 A;  3FUF A;  5EYL A;  1BI8 B;  3HHM A;  3ZKJ A;  4AXH A;  3U64 A;  2FEZ A;  4V3I A;  5HRY A;  1UOH A;  3TG5 A;  4TRQ A;  4FLH A;  3J5P A;  5FQ6 A;  2H6H A;  4HOS A;  4UQX A;  4NQ0 A;  3E34 A;  4I6G A;  1D8E A;  2P2C P;  4HB5 A;  2PQN A;  2VTB A;  3FTV A;  1S0P A;  2WXQ A;  4Q96 A;  2WXG A;  3LKU A;  4PDX A;  2LAH A;  4EEC A;  1MZC A;  4D10 C;  3PS6 A;  2MHK A;  4KMO A;  1PY1 A;  4B8A A;  5JHB A;  3CQG B;  1W3B A;  2XZD G;  3SY2 A;  3LY8 A;  2R17 C;  4DX6 D;  2A4Z A;  4WNF A;  3C5R A;  4WUY A;  4HVB A;  4KZ0 A;  4GZ3 A;  5CMW A;  3SFZ A;  1UN9 A;  1E8W A;  1TNO A;  2L0I A;  2H6G A;  2WB2 A;  3FWV A;  1K8K G;  2BUG A;  2VTB B;  3DSW A;  3FTU A;  5ENO D;  4L1B A;  4BWR A;  4XX5 A;  3PVL A;  5KJK A;  4YDE A;  3R7Q A;  4L9P A;  4GYO A;  2CG2 A;  5T8I A;  5D2M C;  3W9F A;  2P9L G;  4XKC A;  2IO3 C;  2FO7 A;  1EDU A;  3RKV A;  4HOQ A;  4TUU A;  3EHN A;  4BFR A;  4X8Q A;  2V5F A;  3GYZ A;  3L22 A;  2NYJ A;  2L6B A;  2Y4T A;  3ZYM A;  3LEW A;  2XGS A;  3SF4 A;  1OUV A;  2NC9 A;  2WQ6 A;  3HXF A;  4B89 A;  4UWK A;  4ACK A;  1TNY A;  2FBN A;  3TWR A;  3CVU A;  4QFV A;  2P9S G;  1HF8 A;  5T3R A;  1IXV A;  2MRI A;  1JCQ A;  3SHF A;  3D9N A;  3T5V A;  2UWJ G;  4HXI A;  4GA0 A;  2EIK E;  3IV0 A;  2J49 A;  4ZHB A;  2Q7F A;  4L2Y A;  1SA5 A;  3LS8 A;  3D9K A;  1HO8 A;  4BT8 A;  4ACL A;  1H19 A;  2ION A;  3UQ3 A;  2L9B A;  2J4D A;  5G55 A;  5LCW J;  3L16 A;  1H6P A;  3JUI A;  3V2X A;  3UI2 A;  1UN8 A;  2HM8 A;  1Y6I A;  4GTV A;  4DRX E;  4R7L A;  4GAA A;  4I6J A;  3V2O A;  4C0E A;  4ANV A;  4LSZ E;  3TWU A;  4AV7 A;  5AIJ A;  4EHM A;  2VSO E;  3ZVV A;  1SZA A;  1OWP A;  4FHJ A;  3LCA A;  4TXR A;  3AJI A;  4GTT A;  4G11 A;  4BT9 A;  1K1B A;  3PE4 A;  3KSQ A;  3QWW A;  3FTX A;  2X6H A;  3Q7F A;  4AVX A;  2HE0 A;  4DX7 D;  1U3C A;  4CCA A;  2F37 A;  5AEN A;  2I9C A;  2GRL A;  1V54 E;  3S7F A;  3DEO A;  4AP2 A;  4B0Z A;  3QC1 A;  4BSX A;  2R05 A;  4AJW A;  4WAF A;  4FC8 A;  3B13 A;  1YCS B;  3ABK E;  3U66 A;  2C0L A;  2I6H A;  5FQ8 A;  3C98 A;  4GTP A;  5DIZ A;  2XEH A;  5BNW A;  3IHV A;  4GZC A;  3JXI A;  5BUZ A;  5JMN D;  4U0Z A;  3CVV A;  1IQU A;  3OXG A;  1H6K A;  3R7R A;  4XI9 A;  3BQO A;  4A3V A;  2LSU A;  2L0T B;  1Y8M A;  3UM1 A;  3JYS A;  4MS6 A;  2ILR A;  3CV0 A;  2M63 A;  5FZS A;  5EIL A;  4KBQ A;  3TWV A;  4JHK A;  2P9U G;  3UTM A;  3CLJ A;  3ESL A;  3AU5 A;  3SBT B;  4WWP A;  2RG8 A;  3PEV B;  2WXL A;  1MQS A;  2WQH A;  3HXC A;  3NZS A;  3TWQ A;  5FT9 A;  3JQ1 A;  4XZ4 A;  2XRZ A;  1D9S A;  3FFL A;  1N95 A;  3FUD A;  2DWZ A;  1JUQ A;  4DI4 A;  5KNH D;  5KCM A;  1BD8 A;  2QFC A;  2PNN A;  4XKB A;  4K03 A;  2PM6 A;  4GTM A;  3MKR A;  4B94 A;  2R5S A;  3ZXS A;  3ZYL A;  5ENQ D;  1KT1 A;  3VLF A;  3E33 A;  3NF1 A;  1ELR A;  5FZR A;  3ULY A;  1TYQ G;  3AS8 A;  2X6K A;  3IKO B;  2FO1 E;  3APF A;  3DEP A;  4KT6 B;  3FTY A;  3FU6 A;  3G2W A;  2WMO A;  3FH8 A;  2XS1 A;  2X6J A;  1BLX B;  3BEE A;  2WM9 A;  3SFY A;  3EU9 A;  3UPV A;  3G2S A;  3J5Q B;  4GTQ A;  2PQR A;  3T8M A;  2BKK B;  1OY3 D;  3I4R B;  1MYO A;  1A17 A;  2OV8 A;  4JB8 P;  5M72 A;  1HG5 A;  2DIW A;  1Z3X A;  4DPR A;  2GRP B;  4GZ5 A;  2R03 A;  3FTS A;  4G8K A;  4JHR A;  4YVQ C;  3Q75 A;  2VYI A;  3V31 A;  2KZT B;  5J08 A;  1B89 A;  3ONL A;  1IYG A;  3RSE G;  5JHA A;  3VTX A;  2IU1 A;  4I9E A;  4A1S A;  4JPS A;  3PZ1 A;  1E8Y A;  2F8X K;  1K3Z D;  5G05 C;  2WXO A;  2LNI A;  3O4Z A;  3RIB A;  1MX2 A;  1DC2 A;  4AIF A;  4I2W A;  2V8S E;  4JZY A;  5EX0 A;  4MRU A;  3L82 A;  1O1T A;  3C3Q A;  2I1K A;  1IKN D;  1TR4 A;  2Y69 E;  2JLB A;  2QC9 A;  3QK0 A;  2Y1L E;  3TWW A;  3CVQ A;  2OEV A;  4ME2 A;  1H0A A;  2DYR E;  1AWC B;  1ELW A;  4UQZ A;  1NP7 A;  4WNG A;  4F1P A;  3ESK A;  1KPS B;  4TV3 A;  2ZGD A;  3LVR E;  3HDX A;  2AXU A;  2P9K G;  4KVM A;  3UM3 A;  5CEA A;  3T5X A;  5KBA A;  3AAA C;  3NBN B;  4RVB A;  2XPZ A;  4GYW A;  4BX8 A;  3CHP A;  3TXM A;  4GCN A;  3FEX A;  3CK7 A;  3FTZ A;  2J9Q A;  4GML A;  4GYY A;  1WDY A;  2MOW A;  4KZC A;  1D8D A;  3V79 K;  2J09 A;  1S70 B;  1KZP A;  4IN3 B;  4J8Y A;  3CKC A;  3PE3 A;  4CDR A;  4DJA A;  3PZ4 A;  1MX6 A;  3UX4 A;  4O6F A;  2LO6 A;  2GGF A;  2QYU A;  5ENP D;  1SW6 A;  2WXJ A;  3TWS A;  3LJN A;  3TJP A;  2RKK A;  1N0Q A;  3WG7 E;  5LP0 A;  3QAQ A;  2DZO A;  5BPP A;  5ANR A;  4M3O A;  1FCH A;  1H2T C;  4U8V D;  2LXM A;  4KVO A;  4G24 A;  3GZ1 A;  3U9W A;  2PZI A;  3ZNG A;  4RG6 A;  5AQ7 A;  1JPL A;  4FHK A;  4F3V A;  4DLQ A;  3Q49 B;  2BTD A;  2P9N G;  4YVO A;  3FUI A;  4GTO A;  3FH7 A;  3B7R L;  3ML8 A;  2CFZ A;  3DWL G;  1EPU A;  2YNQ A;  1HFA A;  4WND A;  1Q2Z A;  5FTP A;  4GCO A;  3QDN A;  1JCS A;  5FJY A;  3TGO A;  5CRV A;  2X38 A;  4TUM A;  5KJL A;  4B8C B;  4EPZ A;  4HBD A;  1KZO A;  4N5Q A;  2FF4 A;  3LY7 A;  2LUH A;  5G04 C;  5ENS D;  4GPK A;  3MA5 A;  5AQB A;  3D9J A;  5B1A E;  1S63 A;  2KAT A;  1X81 A;  3AS4 A;  3DPD A;  2IEJ A;  2XEV A;  3FUE A;  3RRN B;  3E30 A;  3SNX A;  1N9A A;  4G1T A;  2ETB A;  3AG1 E;  4W9R A;  3NOC D;  4I43 A;  3X2Q E;  4O1O A;  4YDY A;  1HE8 A;  2B0O E;  4N3C A;  4F7A A;  5ENN A;  2GRO B;  2IQC A;  4U04 A;  1VDY A;  5ITZ F;  4MBG A;  1MHQ A;  3GZ2 A;  3DSV A;  5FZQ A;  5D0Q D;  3S2A A;  3NAW A;  3G2U A;  1G3N B;  4URK A;  4DI3 A;  1LD8 A;  4FA6 A;  3HXE A;  4G8L A;  4UI9 C;  4Y6W A;  4BTB A;  4A55 A;  5ARF A;  2J08 A;  2ETC A;  4AOF A;  4L23 A;  4LUN U;  5HS0 A;  1YMP A;  3GZS A;  1S64 A;  3K9I A;  3LPZ A;  3C3R A;  5A6C A;  3S7J A;  2XRY A;  2AXV A;  2JAB A;  3DXK G;  3VLE A;  4RSY A;  1WG0 A;  3PDN A;  4WWO A;  3MV2 B;  3PZ3 A;  4LRZ A;  5BV1 A;  1HS6 A;  2QYJ A;  2J07 A;  3JCK C;  4JEH A;  5B3S E;  1OWO A;  2V0P A;  3CEQ A;  2WXN A;  3IEG A;  3P1U A;  3S7D A;  3T8K A;  2GRM A;  3D9M A;  4EZL A;  3FUK A;  2CHX A;  1DCQ A;  4J7W A;  4ZFH A;  3MJW A;  3ML9 A;  2I1J A;  3PZ2 A;  3BG0 B;  3AG3 E;  4OAV B;  4HS2 A;  2AWI A;  2ZXW E;  3FU5 A;  2KM4 A;  3CHQ A;  1WM5 A;  3FHE A;  4U96 D;  1N0R A;  3Q5M A;  4J0U A;  3KS2 A;  3B7S A;  4GTS A;  4E6H A;  4UUC A;  3DSU A;  3G2V A;  4HOR A;  3RJV A;  1XGW A;  2KCL A;  5AAO A;  4J6I A;  2JEK A;  3ASH A;  2QY7 A;  2H6F A;  3Q4A B;  5EIB E;  3C72 A;  3ZEF A;  5A7D B;  2RFM A;  2LAI A;  4O1P A;  5ENT D;  2RFA A;  5ENR D;  4AEZ C;  4A1G A;  4UWF A;  1NI1 A;  4H7X A;  3JUE A;  3Q73 A;  5EKQ D;  3UKU G;  3CQC B;  3UXG A;  4CYM D;  4UQY A;  4NIK A;  2VQ2 A;  2IY0 C;  5JA4 D;  5HQ8 A;  4TXP A;  1LD7 A;  5G2N A;  1H6O A;  2L6J A;  1IHG A;  2UY1 A;  5EX3 A;  3QNK A;  4OVU A;  1H2U A;  1TNB A;  4C0M A;  3Q79 A;  3UIN C;  2IF4 A;  2OVF A;  4FP7 A;  2X6F A;  1QYM A;  1Z5S C;  3QAR A;  1YA0 A;  4KYO B;  4HI8 A;  3ZHE A;  3T9K A;  3KSL A;  3D3M A;  2WMN A;  5BW8 C;  2P58 C;  4Q94 A;  5ARG A;  3URZ A;  3HRA A;  1Z3Y A;  4HOT A;  1DCE A;  2X6I A;  5LFA A;  4AM9 A;  3UIP C;  1HG2 A;  3ULQ A;  4U07 A;  3LY9 A;  5H7P A;  2XQ0 A;  3E4B A;  4I9C A;  5JJT A;  2BED A;  3RRM B;  3SBS A;  3FTW A;  3ZXP A;  2VGY A;  2GW1 A;  1PAQ A;  4M7C A;  4DK5 A;  2XEN A;  4ILG A;  1TN7 A;  3LYA A;  3UT7 A;  3ZHE B;  3SZ7 A;  2Y0B G;  1E8X A;  5CMY A;  2C0M A;  5CCL A;  4LNB A;  1O5M A;  3SFX A;  5ANL A;  5BT1 A;  4N2Q A;  3MGB A;  4NRH B;  3IBE A;  2GRN B;  4HOU A;  3MCX A;  4YDO A;  3D9H A;  5CHE E;  5DBK A;  3LJ3 A;  2KXP C;  5E76 A;  2RD0 A;  3V30 A;  1SA4 A;  1TJC A;  1RW2 A;  4LCT A;  3EHR A;  1N52 A;  4CZ2 D;  4F1S A;  3BUA A;  2BF0 X;  3EHQ A;  3C3O A;  2IJG X;  1O1S A;  3QB2 A;  3EHM A;  3ENE A;  1NZN A;  4OYS A;  4JD2 G;  3L9T A;  3ZU7 B;  1KLX A;  1BU9 A;  4HNA D;  4YND A;  1N11 A;  3CK9 A;  3UT8 A;  4JW1 A;  4EZJ A;  2IFU A;  1OCO E;  3FEY A;  3KEZ A;  2BKG A;  3TL5 A;  3UM0 A;  4DX2 A;  2ZIS A;  3PUJ A;  3FH5 A;  4IRU A;  3B7B A;  3ASD A;  1GW6 A;  2WXR A;  1NA0 A;  4IUL A;  3TWX A;  3B7T A;  4JA7 A;  4U95 D;  3UUX A;  5D0O D;  4EZK A;  3DST A;  3TXN A;  3U3W A;  2WVI A;  4APF A;  3ZGQ A;  4NUR A;  4MLP A;  3CST A;  1E7U A;  3PZD A;  1BI7 B;  4I6E A;  1IQR A;  5CED B;  4ABN A;  4I1A A;  1MX4 A;  3BG1 B;  2E0I A;  4N2S A;  1NA3 A;  4FJZ A;  3MX3 A;  4CEM A;  4PH4 B;  5HI7 A;  5CER B;  5BXU A;  4OAU C;  3BU8 A;  4K5B A;  4L7T A;  3NB2 A;  4CDM A;  4MKT A;  3ASG A;  1JWF A;  4N3B A;  3E37 A;  3EUV A;  3PRE A;  2KCV A;  3D9I A;  4Y6C A;  5G05 J;  1DVP A;  2XS8 A;  1YYH A;  3HIZ A;  2R02 A;  2F0Y A;  3OTN A;  1LTX A;  4JC8 A;  1N4R A;  4C9B B;  3GW4 A;  1H2V C;  2V5Q C;  3FDH A;  1E90 A;  2ZGG A;  1SQM A;  2MYO A;  5HKP A;  1FVF A;  4G25 A;  1OWM A;  1E96 B;  3HYM B;  3Q7A A;  2LXL A;  4ANX A;  5J90 A;  5T4Y A;  4C48 B;  2GRR B;  1RZ4 A;  2A5U A;  2VGX A;  2XZT G;  3HG0 D;  3ZN3 A;  1OCZ E;  3CIA A;  4WNE A;  4YDW A;  5BXO A;  4GA2 A;  3L08 A;  4HRN A;  2ZU6 B;  4K5C A;  3PNL B;  4E85 A;  2Y3A A;  1SVX A;  4EQF A;  4GPM A;  4GA1 A;  4EBA G;  4APO A;  1FT1 A;  3SQV A;  5KJM A;  2DBA A;  4PUC A;  4ILI A;  2EIJ E;  1QNF A;  1U2V G;  5JJ6 A;  1NL4 A;  1UW4 B;  4I1M A;  5EYP F;  3TWT A;  3ASN E;  4J8S A;  2VGX B;  2XPI A;  3ONK A;  2J4B A;  5AAR A;  3ZYK A;  3LDZ A;  3SD5 A;  1OWL A;  2IOL A;  2FUL A;  2ZIR A;  1OCC E;  3PH0 C;  2YIN A;  3W9G A;  4K0R A;  1EF1 C;  3DXM G;  3SGH A;  4UWG A;  2HR2 A;  4AY6 A;  3HVE A;  4J8E A;  3Q15 A;  3Q47 B;  1O1R A;  3D9P A;  4PS8 A;  5IY5 E;  4G2V A;  1OWN A;  4A63 B;  2EIL E;  3ABM E;  3B7U X;  1N54 A;  2FI7 A;  1HZ4 A;  5AQ9 A;  2XCB A;  1ZU2 A;  3QWV A;  2IOS A;  3L17 A;  4U63 A;  1TNZ A;  1WY6 A;  1JCR A;  4GMR A;  1HH8 A;  1HU3 A;  4LNU D;  3D9O A;  3Q78 A;  3HVE B;  4U0U A;  3OXL A;  3KAE A;  1WAO 1;  1QQE A;  5LCW C;  4HQD A;  1ELK A;  4LER A;  3QOU A;  2P9P G;  2GRQ B;  2NXP A;  4FLB A;  2XPY A;  4NAC A;  5D66 A;  3D9L A;  1A5E A;  4CT4 A;  3AS5 A;  1L5J A;  5G04 J;  3AU4 A;  3TG4 A;  2J8S D;  3EIQ C;  2XEE A;  3I5P A;  2V4L A;  3RK6 A;  3ZYQ A;  3L54 A;  3Q9U C;  4PS3 A;  3CGH A;  4H7Y A;  5FIO A;  2HYZ A;  1QBQ A;  4ATZ D;  1X5B A;  4JEU A;  5KWD A;  4N3A A;  1MJ0 A;  2R2L A;  2ETA A;  3DSS A;  5LX8 A;  3PEU B;  2EIN E;  3LXU X;  2NSZ A;  3RU0 A;  4CDN A;  3FUL A;  5EN5 D;  4JL0 A;  4ATG A;  3FU3 A;  4UI9 J;  4UI9 K;  4QQI A;  2HO1 A;  5AJL A;  4GMJ A;  1DNP A;  2A5E A;  4BY6 A;  4XI0 A;  4P29 A;  4J8D A;  3IHY A;  4U7E B;  4RLY A;  4LEU A;  2OOE A;  4HFG A;  1INZ A;  5AQA A;  4WWN A;  4L2L A;  5AYW D;  3FUJ A;  4DX5 D;  4UWL A;  2R59 A;  4RQI A;  1ZB1 A;  1N4S A;  3ABL E;  3NZU A;  1FT2 A;  3APC A;  3QKY A;  3MV3 B;  1V55 E;  4CGW A;  2WXH A;  1TEZ A;  2CFU A;  2F8Y A;  1TJF A;  3DBS A;  1HX8 A;  1Z6T A;  2IO2 C;  4N5C A;  3P2B A;  4FAD A;  5CEC B;  2CHZ A;  1OXJ A;  3CVW A;  4JXT A;  4BER A;  3CHO A;  2YHE A;  3FUM A;  2WQ7 A;  4DUI A;  4I17 A;  2Y4U A;  4KXK B;  2KC7 A;  4GB9 A;  2XHE A;  5BV0 A;  3Q9N C;  2QZA A;  3QJZ A;  4G26 A;  4CGV A;  3O48 A;  2VJ8 A;  1UJJ A;  2P9I G;  3UT4 A;  3EIJ A;  4HRM B;  5B1B E;  1NFI E;  1ZBP A;  3L13 A;  2VSX E;  3TAX A;  4I1O B;  1QZ2 A;  3PNT B;  4GZD A;  2WXK A;  3KD7 A;  4DX1 A;  5AJD A;  1LF8 A;  2DVW A;  3DPY A;  3R9A B;  5FQ4 A;  2OCC E;  1HXI A;  2AW6 A;  3L6A A;  4ILH B;  2CG3 A;  3MKQ A;  2YHC A;  4GU5 A;  3CHS A;  3S7B A;  2PL2 A;  3NQP A;  4JA9 A;  5FWQ A;  3I4G A;  5AN8 A;  3CSF A;  2WPV A;  2VSN A;  2UY1 B;  3MEK A;  5EDS A;  3DRA A;  4TXQ A;  1FVH A;  4EBA A;  2DCP A;  2EQX A;  3ASF A;  4BX9 A;  2KBX A;  3KEA A;  3SI5 A;  3MKQ B;  3EDT B;  1OCR E;  3CVY A;  4A3T A;  4RG9 A;  2EIM E;  3EJN A;  4FUL A;  3FP3 A;  3G2T A;  4XE0 A;  2XCC A;  3APD A;  3NOG D;  4O60 A;  4IYP A;  3ZUV B;  2X3M A;  4PS7 A;  3ULE G;  4ANW A;  5A23 A;  3UMV A;  3RO3 A;  4ANU A;  3CVX A;  3FU0 A;  1P5Q A;  4I2Z A;  1TNU A;  2WXF A;  2KZT A;  5C2Y A;  3ZIM A;  4U0S A;  5C1D A;  2AJA A;  4AY5 A;  3OXF A;  4CT0 A;  4J8F A;  4F53 A;  4OVV A;  3LVQ E;  5CBO A;  5E75 A;  4BES A;  3AG4 E;  4B93 B;  1AP7 A;  3CHM A;  5CCM A;  3RRU A;  3FY4 A;  3RAU A;  2PM7 A;  5KJN A;  3ZPJ A;  3JXJ A;  1IHB A;  5FIN A;  4LG6 A;  2OEW A;  3R9M A;  3OAW A;  4BTA A;  4FU3 A;  3CR3 A;  5EID A;  1TN6 A;  1E8Z A;  4CRW A;  2V4H C;  4U8H A;  3FUH A;  3EU5 A;  3CVN A;  2WXM A;  3N71 A;  3CHR A;  4U8Y D;  4BEP A;  2XGO A;  3UM2 A;  4GZ6 A;  1XNF A;  4GTR A; 
#chains in the Genus database with same CATH homology
 4BER A;  3AJI A;  3EHR A;  3T8K A;  5JA4 D;  2NYJ A;  2L6B A;  5FIO A;  4CZ2 D;  4DUI A;  1S70 B;  1D9S A;  1DCQ A;  4J7W A;  4ATZ D;  3W9G A;  1K1B A;  3EHQ A;  4ZFH A;  4J8Y A;  3NOG D;  2DWZ A;  2ETB A;  5EYL A;  3NOC D;  1BI8 B;  2HE0 A;  1YYH A;  2F8X K;  3ZKJ A;  4K5A B;  4DX7 D;  1K3Z D;  4O1O A;  4YDY A;  2F37 A;  1MX6 A;  4O60 A;  5KNH D;  2B0O E;  3Q9N C;  4OAV B;  1BD8 A;  3ZUV B;  2PNN A;  3DEO A;  5KWD A;  1OT8 A;  1MX2 A;  5ENP D;  3ZU7 B;  5HRY A;  1MJ0 A;  1DC2 A;  1UOH A;  3TWR A;  1SW6 A;  1BU9 A;  2ETA A;  4HNA D;  4QFV A;  1N11 A;  3J5P A;  4U96 D;  1N0R A;  3TWS A;  5ITZ F;  3LJN A;  4HRM B;  5ENQ D;  1YCS B;  1N0Q A;  1IXV A;  2DZN A;  2V5Q C;  4A63 B;  4UUC A;  2ZGG A;  1QYM A;  2MYO A;  5EN5 D;  5HKP A;  2P2C P;  5KNG A;  4HB5 A;  1IKN D;  4HI8 A;  2DZO A;  1NFI E;  1TR4 A;  1G3N B;  3T9K A;  5AQ9 A;  2BKG A;  2XEH A;  2QC9 A;  2AJA A;  2Y1L E;  3TWW A;  4DX2 A;  4DX1 A;  4QQI A;  4U8V D;  3B7B A;  2DVW A;  4G8L A;  4GMR A;  4F6R D;  4ZHB A;  2FO1 E;  3HRA A;  2A5E A;  3F6Q A;  3JXI A;  2ETC A;  4LNU D;  5AAO A;  5JMN D;  3TWX A;  1AWC B;  5CBO A;  3ZNG A;  3DEP A;  5AQ7 A;  4C48 B;  1K1A A;  4BES A;  4B93 B;  5HS0 A;  1AP7 A;  4U95 D;  1YMP A;  4F1P A;  2XZD G;  4Z68 A;  2XZT G;  3HG0 D;  4BET A;  4DX6 D;  1BLX B;  3C5R A;  4BSZ B;  3V2X A;  2JAB A;  2ZGD A;  4HQD A;  5EIB E;  4YDW A;  3B95 A;  2XEN A;  4RLY A;  4HI9 A;  5AN8 A;  1WG0 A;  2RFM A;  3EU9 A;  5BXO A;  5AQA A;  3J5Q B;  3UI2 A;  4HRN A;  3IXE A;  4K5C A;  3SO8 A;  4O1P A;  4DX5 D;  3JXJ A;  1IHB A;  2Y0B G;  5FIN A;  5CEA A;  1SVX A;  1BI7 B;  2BKK B;  2VGE A;  4GPM A;  4LG6 A;  5ENT D;  1OY3 D;  5CED B;  5ENO D;  5D66 A;  5EIL A;  4DRX E;  2RFA A;  1MYO A;  1MX4 A;  5ENR D;  1A5E A;  4JB8 P;  3TWV A;  5KBA A;  3V2O A;  3AAA C;  4TUM A;  5CBN A;  3NBN B;  3UTM A;  4HBD A;  5EID A;  4LSZ E;  2QYJ A;  4HRL A;  3TWU A;  5CER B;  3JUE A;  2F8Y A;  4N5Q A;  5BXU A;  2J8S D;  4G8K A;  2V4H C;  4OAU C;  3W9F A;  4HLL A;  5ENS D;  2XEE A;  3D9H A;  4K5B A;  2KBX A;  3KEA A;  5EYP F;  5CEC B;  3TWT A;  4U8Y D;  3UXG A;  3V31 A;  4BEP A;  2KXP C;  5AQB A;  3V30 A;  4CYM D;  3Q9U C;  5AAR A;  1WDY A;  3TWQ A;  4NIK A;  3V79 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...