2KBXA

Solution structure of ilk-pinch complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
171
Chain Sequence
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Integrin-linked protein kinase
publication title Cytosketal proteins
rcsb
source organism Homo sapiens
total genus 33
structure length 171
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2kbxA00
2NYJA 3TWVA 2PNNA 3Q9NC 1MYOA 4O1PA 2QYJA 1YMPA 4HRMB 5CBOA 3V30A 2DZOA 3DEPA 1TR4A 3V31A 5CBNA 3B95A 4RLYA 5JMND 5KBAA 2BKKB 4N5QA 3EHQA 5ENOD 4DRXE 2RFMA 5EYPF 4HI9A 2Y1LE 2V4HC 3J5QB 4J8YA 3ZUVB 1BD8A 1K1AA 4UUCA 2VGEA 1BU9A 3Q9UC 3T9KA 4LNUD 3V2XA 4BESA 5AQBA 2ZGGA 3NOCD 4YDYA 5BXOA 3IXEA 1A5EA 3F6QA 4LG6A 3C5RA 3HG0D 3T8KA 4Z68A 3TWRA 5AQ9A 1YCSB 4HLLA 1S70B 1WDYA 2ETCA 3W9FA 4ZFHA 1N0QA 5ENSD 3AAAC 4HRNA 3TWXA 1IXVA 1IHBA 2BKGA 5ITZF 4NIKA 3D9HA 5ENQD 1SVXA 5EIDA 2XENA 5KWDA 4DX2A 4U8YD 2DZNA 4HI8A 5HS0A 4DX7D 3EU9A 1BLXB 3DEOA 2F8YA 5CEAA 2F37A 4DX5D 2RFAA 3JUEA 5HKPA 5CECB 4K5AB 2DWZA 2P2CP 4YDWA 3UI2A 3TWQA 4O60A 4TUMA 4DUIA 2AJAA 4OAUC 1YYHA 2L6BA 5KNGA 1WG0A 3EHRA 4K5CA 3SO8A 5HRYA 5AN8A 4BERA 5AAOA 4HB5A 3TWTA 3ZKJA 3HRAA 2F8XK 3J5PA 1N0RA 4ZHBA 2XEHA 5ENRD 1OY3D 5FINA 3W9GA 2ZGDA 4DX1A 4ATZD 5AQAA 3V2OA 2KBXA 3UTMA 2KXPC 1NFIE 2ETAA 1BI8B 4G8KA 2FO1E 4F6RD 3ZNGA 1MX4A 4U96D 3TWUA 2JABA 5FIOA 4B93B 2J8SD 1DCQA 1UOHA 4K5BA 4GPMA 5KNHD 1OT8A 3UXGA 4HQDA 2Y0BG 1AP7A 5CEDB 4QQIA 4A63B 1AWCB 5EILA 3LJNA 4J7WA 1N11A 3ZU7B 4DX6D 1MJ0A 3V79K 3TWSA 5AARA 3NBNB 4JB8P 3TWWA 4OAVB 2A5EA 1G3NB 4C48B 2XZDG 4BETA 1MX2A 1QYMA 5EIBE 4U95D 5AQ7A 2DVWA 5CERB 3B7BA 4LSZE 1D9SA 2V5QC 4G8LA 5EN5D 2B0OE 2HE0A 4HNAD 1IKND 3JXIA 4CYMD 2XEEA 2ETBA 4CZ2D 5BXUA 1MX6A 2XZTG 4GMRA 4U8VD 4BEPA 2MYOA 5ENTD 4BSZB 3KEAA 2QC9A 3AJIA 4O1OA 5ENPD 1K3ZD 1SW6A 5EYLA 4HRLA 5D66A 3JXJA 5JA4D 1DC2A 1BI7B 3NOGD 4HBDA 4QFVA 1K1BA 4F1PA
chains in the Genus database with same CATH superfamily
4HOUA 1K8KG 3LJ3A 2GRPB 5CBNA 4HI9A 2AW6A 3FUJA 1N54A 4I9EA 4KVMA 3QK0A 4M7CA 2KM4A 3ENEA 3IXEA 3ASHA 5A7DB 4GTVA 2WXLA 3IKOB 3ASFA 5EIDA 4KZ0A 4GA0A 4FADA 5BNWA 1FVFA 4KBQA 3RKVA 3LPZA 3RU0A 4A1SA 3EHRA 4GYOA 5G55A 5EX3A 3D3MA 1DCEA 3VLEA 2V5FA 4PS7A 1IYGA 3TJPA 2KCKA 5AJLA 4GPMA 4CDNA 2P9NG 2XS8A 5LCWJ 3X2QE 3ZEFA 2GRRB 4DX6D 3TL5A 2L0IA 3P2BA 3MEKA 2V5QC 5A6CA 2FBNA 5ANRA 5D2MC 2IF4A 4L2YA 3DSWA 4NACA 5D66A 5FTPA 4P29A 3TG4A 2DYRE 1Z3YA 5JJ6A 3LVRE 3UMVA 3V31A 4GZ3A 3QWWA 4YDEA 1S63A 4WNFA 2NXPA 2XS1A 3SFZA 1E8YA 3PRZA 4BESA 2XEVA 1YCSB 1H2TC 1V54E 2X38A 4RSYA 4JXTA 2L0TB 3LS8A 5ITZF 1PY1A 3UKUG 3CHRA 4KZCA 3OAWA 4MLPA 3RJVA 1JCSA 4I2ZA 4DX5D 5ARGA 3U66A 4F53A 2I1KA 4H7XA 4RG9A 2P9KG 4KXKB 4FHJA 4DX1A 5EDSA 2C0LA 5KNHD 4A63B 2PM7A 2PM6A 2QYUA 1SA5A 3UM3A 3KSLA 2IEJA 3APDA 4XI0A 3SQVA 5T8IA 1D8EA 3Q7FA 3ZPJA 3CQGB 3MZLB 5G05J 3WXXA 2VQ2A 4EHMA 4ILIA 3UIPC 3L22A 4HBDA 2J49A 4AM9A 1HX8A 4GAAA 3ULEG 2QYJA 4U7EB 4I6JA 2XPYA 3WG7E 3B95A 3T8MA 3UM0A 3QB2A 3ZUVB 3AU4A 3MV2B 4F3VA 3Q9UC 3T9KA 2P58C 3DBSA 4XKCA 3F6QA 2PQNA 2R03A 3PNTB 2RG8A 1IHBA 2Y69E 4BX8A 4C0EA 3KD7A 2IJGX 3IBEA 2MRIA 1BLXB 2F37A 5DIZA 5FZRA 1IQUA 3U3WA 4JEHA 4YDWA 3TWQA 4DUIA 2AJAA 3HVEB 1XNFA 4CCAA 3ONLA 2H6HA 3IHYA 3D9OA 4ZHBA 2P9LG 3EUVA 5LX8A 4MRUA 4ATZD 3V2OA 5CCMA 4IN3B 4XE0A 4X8QA 4ACKA 4KVOA 1NA3A 1JPLA 3U4TA 5C2YA 1FPPA 2VTBB 2F0YA 3LJNA 5LFAA 5BPPA 5D0QD 4A1GA 4DLOA 1JWGA 3D9LA 4TXPA 2WMOA 3JQ1A 4B8AA 1KPSB 2B0OE 2IOLA 4KT6B 2E0IA 3SGHA 4BSZB 1UN8A 3BUAA 3DXKG 3Q78A 4QFVA 4ANWA 2C2LA 1OWLA 3GZSA 3AS8A 3GW4A 3EJNA 4K0RA 3CK7A 3DEPA 3NF1A 4KMOA 1O1SA 3EHQA 4HVBA 2B6CA 1XGWA 3KS2A 4A55A 1K1AA 4GTSA 4HS2A 3QDNA 3L08A 3SNXA 2AWIA 1WDYA 2GGFA 3W9FA 1ZU2A 3I3NA 2P9IG 3CHSA 1OWNA 5AIJA 5HKPA 3PEUB 3SZ7A 3G2VA 5LCWC 1UG3A 3CVLA 1YYHA 4OVUA 3FUKA 4MS6A 4HOTA 2JEKA 5CRUA 2QFCA 2P9PG 1E8WA 2WXHA 3TWTA 1OCCE 4XKBA 4J8FA 4CGVA 3MKQB 1OY3D 3ABME 3ULQA 2KBXA 2LO6A 2YINA 2A5UA 2XPIA 2EIJE 1BI8B 3TWUA 3ZYMA 2J8SD 2PL2A 2WVIA 2WXOA 3FU5A 2EILE 3PZ3A 4TXQA 1D9SA 1OXJA 3FUNA 4CZ2D 4GYWA 1H6PA 5CMWA 3B7TA 5LOZA 3CEQA 2IY0C 3APFA 3VTXA 5H7PA 3B7RL 3ZW3A 1MYOA 2M63A 2RFMA 4MBGA 3QARA 3DRAA 4BTBA 4JD2G 4GA1A 3DSVA 2IU1A 3FH5A 4LG6A 3I5PA 2CHXA 2LSVA 2WXQA 3FDHA 2XPZA 4IULA 4Q96A 4AEZC 1IXVA 3LY9A 3D9HA 3MGBA 1SVXA 3E37A 4K03A 3S7BA 2XGOA 1HO8A 3CVYA 1EYHA 4N3CA 3LXUX 4URKA 1E90A 3O4ZA 4APFA 4BTAA 2WMNA 3NZUA 3UM1A 5HRYA 5KJMA 3ZKJA 4XIFA 3LCAA 4AIFA 4G26A 5T3RA 1TEZA 3DSTA 3QKYA 4I1MA 4CDMA 4UQXA 1KLXA 2VSNA 3PZ1A 2OEWA 5B1AE 3HVEA 4U96D 1TNBA 1TN8A 4HQDA 3R9AB 5AYWD 5BT1A 2IO2C 2L9BA 3ONKA 4U63A 3TG5A 3B7BA 3HHMA 2I2OA 3JXIA 1E7VA 4GTPA 1TYQG 2VTBA 2WM9A 5KJKA 3UM2A 1E96B 2EIKE 3DXMG 1Z6TA 2R5SA 5KBAA 3UINC 3Q15A 3SD5A 4N2SA 2X6FA 2X6IA 4EBAG 1OWOA 3K9IA 3CVVA 5AQ9A 2X3MA 3D9PA 1BPOA 5HQ8A 4FU3A 3EU9A 1E7UA 3NZSA 1IQRA 2NSZA 2V8SE 4GTRA 1L5JA 1O1RA 4RVBA 3BEEA 4W9RA 2QY7A 3EU5A 3DSUA 2I6HA 4JHRA 4YVOA 3HXFA 4YNDA 3UKRG 5AQAA 4J8DA 4JL0A 3FU6A 4CT4A 3FP3A 3SBSA 2UY1A 4F6RD 1MX4A 2LXMA 2AVPA 2I9CA 4QQIA 5EILA 1VDYA 3MKQA 2FEZA 4JHKA 3Q75A 1MX2A 4BY6A 1S64A 2BF0X 3R9MA 4XX5A 3LKUA 5T4YA 3VLDA 3TAXA 3OXLA 2FO7A 4O1PA 3CSFA 2LUHA 1ELKA 4RLYA 2BKKB 3PUJA 4J8YA 5ANLA 3L17A 4UUCA 2MOWA 1TJCA 4BT9A 3V2XA 1EPUA 3NOCD 3BQOA 3HG0D 2FULA 3CVXA 2DYSE 5J90A 4WWOA 4HRNA 5EX0A 5BW8C 2XCCA 3E33A 3RO2A 4HI8A 1HG2A 3FFLA 3DEOA 2ZXWE 1HZ4A 3JUEA 1MQSA 3APCA 5E75A 4KYOB 4J0UA 4FLBA 1H19A 2F8XK 1H2VC 4BFRA 1FT2A 4I2WA 1UW4B 3Q73A 3UT7A 2OVBA 4E6HA 2UWJG 2KXPC 4G8KA 4GTMA 2KZTB 3ZNGA 2VGXB 4JA7A 1DCQA 1NI1A 4D10C 3UXGA 1A17A 4HFGA 3QNKA 5IY5E 3GZ2A 3LVQE 4AVXA 3C3OA 1UJKA 3PVLA 3HXBA 3CGHA 4ANXA 5EN5D 3QJZA 1KZOA 3FTSA 2XZTG 4HXIA 3D9JA 5ENTD 1Y6IA 3KEAA 5FT9A 2WXIA 4JW1A 4TV3A 3LY7A 3FY4A 3PUKA 3JUIA 4ACLA 3UQ3A 5EKQD 1N52A 3V30A 4UWKA 1OUVA 2DZOA 4I1AA 1HG5A 2XGSA 4JEUA 3DWLG 2ILRA 4I9CA 4B0ZA 3ZFWA 5AQBA 4TRQA 3VTYA 4EBAA 3IEGA 4ANUA 3FUMA 1FVHA 3AAAC 3TWXA 3ABKE 4NIKA 4CGWA 2BTDA 1IHGA 1OCZE 4EZKA 3CKBA 4DX7D 3TGOA 4JZYA 3NAWA 4OAUC 3FUDA 2HYZA 3MA5A 1TNZA 1DNPA 3G2WA 4I17A 4GTOA 2X6JA 3ML9A 4N3BA 3AU5A 1HS6A 3ZN3A 3UT8A 4G25A 1RW2A 4CEMA 1QZ2A 3FTUA 1N11A 4PS8A 2XRZA 5JHAA 3UIOC 3LEWA 4I6EA 3C98A 4U95D 3CIAA 4N39A 3Q7AA 2ONDA 4Q69A 3IHVA 3LY8A 4V3IA 5FQ6A 4DLQA 3JYSA 4GMLA 3SBTB 3AG1E 1DC2A 4AY6A 1K1BA 2A4ZA 5B1BE 4I6GA 3RAUA 1YMPA 1JCRA 3ZYQA 4LEUA 4IRUA 2RKKA 4J6IA 2VSOE 3FEXA 1UN9A 2R17C 5BXOA 2VGYA 4TXRA 2VYIA 3KEZA 4YDOA 3CK8A 2DZNA 4L2LA 5HS0A 4GPKA 2AXVA 3EDTB 1KT0A 3ZVVA 3RIBA 2ZISA 4AJWA 3C3QA 4GB9A 2WB2A 3J5PA 2LAIA 3FUEA 4H7YA 3UT4A 1P5QA 2J08A 5ENRD 4IYPA 2GW1A 3L6AA 3W9GA 3CV0A 1OWMA 4WNDA 4U07A 2WXKA 2GROB 4N5CA 3RK6A 2Y0BG 3FU0A 3JQ0A 5KCMA 3RRUA 3FTWA 4AV7A 3QC1A 2CG2A 5AARA 2XQ0A 2XZDG 5AQ7A 1KT1A 1IKND 2KZTA 2AXUA 3BG1B 2VGXA 1MX6A 2PZIA 2MYOA 4O1OA 3BG0B 3AJIA 1K3ZD 4HRLA 3NOGD 5KJNA 3E32A 3SI5A 1ELRA 4N5QA 5ENOD 4DRXE 2J09A 3CHOA 4ME2A 3EIJA 1UJJA 4I1OB 4PS3A 3PNLB 3VLFA 3GZ1A 3C5RA 4R7LA 1Z3XA 2KC7A 1N94A 4AOFA 2IONA 1TJFA 2BKGA 3G2SA 5KWDA 3FH8A 2WQHA 1E8XA 3S7FA 3SFXA 3L82A 3MX3A 3C72A 4AP2A 5CMYA 3CVUA 5CECB 4EPZA 2CFUA 3PZ2A 5G04C 3ZXSA 4DI3A 3C3RA 4C0MA 5AAOA 2WQ6A 1X5BA 5FQ4A 1SZAA 3S7JA 4GMJA 3Q5MA 4PH4B 2GRMA 2JABA 5FIOA 4NRHB 5FQ8A 1LD8A 3G2TA 3TWSA 2A5EA 4HNAD 4N3AA 2WXGA 2R02A 4L23A 3UX4A 1LF8A 5BXUA 1EF1C 4WNGA 1N95A 4HOSA 2DCPA 3S2AA 1NA0A 2Q7FA 3OXFA 5CEDB 3FHEA 2IFUA 4F1PA 1SA4A 2WPVA 2XCBA 3TWVA 5JHBA 1H0AA 3R7RA 3AS4A 3CVWA 4N2QA 4ATGA 4A3TA 1N9AA 2FI7A 2ZU6B 4M3OA 3IV0A 4FULA 4FP7A 3CHQA 3HXDA 2E2EA 4LNGA 1A5EA 3T8KA 2RD0A 3QAQA 4B94A 5KJLA 4RG6A 3E4BA 5FQ7A 2YHCA 4LNBA 4UI9K 4AY5A 2YQ8A 2DIWA 4UWLA 5AN8A 1RZ4A 2KCVA 5FZQA 3E30A 1NL4A 4XEIG 2XEHA 2BUGA 1B89A 3B7UX 3ZRHA 5FINA 1DVPA 4UWHA 2X6KA 2WQ7A 4LCTA 3G2UA 3ZYLA 4FJYA 1HF8A 2C0MA 2EINE 3N71A 1S0PA 1TN6A 1ZBPA 1MZCA 4HOQA 5ARFA 1G3NB 4EZLA 3D9NA 5CERB 4A3VA 4XI9A 2HE0A 3QOUA 2V0PA 2CHZA 2XEEA 4GU5A 1Y8MA 4APOA 5FWQA 3CVQA 1SQMA 5JJ7A 5JA4D 3HYMB 1N4PA 5CCLA 5ENNA 2WXFA 2EIME 2V4LA 4HRMB 4CDRA 1WM5A 2J07A 4MKTA 2KCLA 3SF4A 1GW6A 2V4HC 2GRLA 3GYZA 5CHEE 2HO1A 1BU9A 3NB2A 3ULYA 3RSEG 3L54A 1PC2A 3CLJA 5G2NA 4YDYA 1KZPA 3DSXA 3FWVA 3FUHA 4Z68A 3HIZA 1S70B 1Q2ZA 2ETCA 4DK5A 2GRQB 4BSXA 1E8ZA 2XENA 4DX2A 2OVFA 3E34A 4G11A 1JCQA 4O6FA 2R05A 5CEAA 1TNYA 2DWZA 2LAHA 3UI2A 3Q49B 1ZB1A 1WG0A 1QQEA 3SO8A 4FJZA 4LUNU 2P9SG 1TN7A 1U3DA 3FUIA 4GZCA 4EQFA 1MHQA 3B7SA 1FT1A 1H6KA 3KSQA 1NFIE 3Q4AB 2VSXE 4UI9C 4WWPA 4B93B 3TXMA 4B89A 2FF4A 1AP7A 1N4SA 4B8CB 2NC9A 4JB8P 4DI4A 3D9KA 1U3CA 1QYMA 4JVSA 3HDXA 1QBQA 4U8VD 2Y4TA 4BEPA 1NZNA 2QC9A 2YHEA 4U0UA 2OOEA 1BI7B 4U8HA 4L1BA 3FTXA 4NQ0A 2PNNA 5G04J 1OCOE 5JJTA 3QWVA 2XRYA 5FJYA 2Y1LE 3J5QB 2L6JA 1BD8A 4FA6A 4OYSA 1HFAA 3JCKC 4FLHA 3LDZA 4L7TA 3PREA 2KATA 2OEVA 4BX9A 4ZFHA 4Q94A 4EECA 4GYYA 1SZ9A 3ASGA 2JLBA 2J4DA 4GTQA 3URZA 3MV3B 3S7DA 4U8YD 1W3BA 4E85A 5CRVA 4Y6CA 3RRMB 2WXMA 3FTYA 5FZSA 3DPDA 3ML8A 3ABLE 4TUMA 2HR2A 2IO3C 2R2LA 3T5VA 5E76A 3PZDA 4XZ4A 4Y6WA 4GCNA 3DSSA 2FO1E 4HLEA 4BWRA 1UOHA 3P1UA 3OTNA 1N4RA 3AS5A 3L9TA 3BU8A 3AG3E 1HH8A 5DBKA 4OAVB 3FUFA 2X6HA 4UQYA 2Y3AA 4WNEA 3RRNB 3MKRA 4FHKA 3I4GA 3FH7A 2LXLA 3B13A 4GZDA 2H6FA 3L16A 5HI7A 3AG4E 5CBOA 4UQZA 4J8EA 3D9IA 2WXPA 2WXNA 1OCRE 4TUUA 4G1TA 2I1JA 3PH0C 2YNQA 2VGEA 4G24A 2CFZA 1OWPA 1NP7A 5M72A 1Z5SC 2H6IA 3CHPA 3PDNA 5BV0A 3Q79A 3AG2E 3PZ4A 2R59A 3ASOE 4F7AA 3ASNE 2RFAA 3QWPA 4I43A 4ABNA 3ZHEB 4G23A 1ELWA 3CKCA 5KNGA 4K5CA 2XGMA 4BERA 4WUYA 2EQXA 3HRAA 3T5XA 2VSYA 1HU3A 4GZ6A 4LERA 2ZGDA 1TNUA 3LYAA 3CK9A 3UTMA 3TXNA 3NQPA 2ETAA 2OCCE 2ZIRA 4PDXA 3SHFA 3KAEA 4K5BA 2XHEA 1WAO1 1TNOA 3ZU7B 1MJ0A 3NBNB 4JPSA 3SFYA 2DVWA 5J08A 4DJAA 2ETBA 5BUZA 2AXZA 2H6GA 4OVVA 1O1TA 4JHJA 2DBAA 3EIQC 3Q9NC 3L13A 3CQCB 4JA9A 2Y4UA 3PE4A 5BV1A 3D9MA 2WXRA 4F1SA 5D0OD 4UWGA 3CHMA 2UY1B 1X81A 4GCOA 1HE8A 4LNUD 4UI9J 1O5MA 2HM8A 1EDUA 3PE3A 1PAQA 2IOSA 3TWRA 4EZJA 3CSTA 1N0QA 3MJWA 1JWFA 4DPRA 5ENQD 1U2VG 2F8YA 3FULA 4J8SA 2OV8A 1WY6A 2P2CP 3ASDA 4WWNA 1HXIA 4U0SA 4RQIA 4AXHA 2J4BA 3CVNA 3EHMA 4JC8A 3HXEA 4ILHB 4BT8A 3FU3A 3Q47B 3ISMC 4C9BB 3UPVA 1LTXA 4J7WA 3V79K 3PEVB 3MCXA 2CHWA 4C48B 4BETA 3MYVA 2VJ8A 5EIBE 4LSZE 4G8LA 1JUQA 2LNIA 4CYMD 3ZIMA 1SW6A 2BEDA 4CRWA 4UWFA 3HXCA 2NYJA 1INZA 3FTZA 1H6OA 2IQCA 5A23A 1TR4A 5JMND 5AJDA 5B3SE 5AENA 5EYPF 3O48A 3R7QA 3CR3A 3PS6A 2LSUA 3EHNA 2CG3A 2MHKA 4HORA 2ZGGA 4GZ5A 4NURA 3OXGA 4HLLA 4L9PA 4LRZA 4U04A 4G2VA 5ENSD 5LP0A 3I4RB 5G05C 2PQRA 2GRNB 3UUXA 1N4QA 1FCHA 4CT0A 4ANVA 4GA2A 4K5AB 4O60A 3U9WA 2L6BA 4YVQC 3ESLA 1QNFA 4HB5A 1N0RA 4ILGA 1YA0A 1V55E 3SY2A 3DPYA 4WAFA 4PUCA 3ESKA 3ZYKA 2P9UG 3ZGQA 3ZHEA 4GTTA 3CVPA 2QZAA 1OT8A 3RO3A 2J9QA 1AWCB 2WXJA 1D8DA 3ZXPA 4U0ZA 3TWWA 3FTVA 4FC8A 1H2UA 1LD7A 3FEYA 4GMRA 5C1DA 5ENPD 5EYLA 3U64A 3JXJA
chains in the Genus database with same CATH topology
2NYJA 3TWVA 2PNNA 3Q9NC 1MYOA 4O1PA 2QYJA 1YMPA 4HRMB 5CBOA 3V30A 2DZOA 3DEPA 1TR4A 3V31A 5CBNA 3B95A 4RLYA 5JMND 5KBAA 2BKKB 4N5QA 3EHQA 5ENOD 4DRXE 2RFMA 5EYPF 4HI9A 2Y1LE 2V4HC 3J5QB 4J8YA 3ZUVB 1BD8A 1K1AA 4UUCA 2VGEA 1BU9A 3Q9UC 3T9KA 4LNUD 3V2XA 4BESA 5AQBA 2ZGGA 3NOCD 4YDYA 5BXOA 3IXEA 1A5EA 3F6QA 4LG6A 3C5RA 3HG0D 3T8KA 4Z68A 3TWRA 5AQ9A 1YCSB 4HLLA 1S70B 1WDYA 2ETCA 3W9FA 4ZFHA 1N0QA 5ENSD 3AAAC 4HRNA 3TWXA 1IXVA 1IHBA 2BKGA 5ITZF 4NIKA 3D9HA 5ENQD 1SVXA 5EIDA 2XENA 5KWDA 4DX2A 4U8YD 2DZNA 4HI8A 5HS0A 4DX7D 3EU9A 1BLXB 3DEOA 2F8YA 5CEAA 2F37A 4DX5D 2RFAA 3JUEA 5HKPA 5CECB 4K5AB 2DWZA 2P2CP 4YDWA 3UI2A 3TWQA 4O60A 4TUMA 4DUIA 2AJAA 4OAUC 1YYHA 2L6BA 5KNGA 1WG0A 3EHRA 4K5CA 3SO8A 5HRYA 5AN8A 4BERA 5AAOA 4HB5A 3TWTA 3ZKJA 3HRAA 2F8XK 3J5PA 1N0RA 4ZHBA 2XEHA 5ENRD 1OY3D 5FINA 3W9GA 2ZGDA 4DX1A 4ATZD 5AQAA 3V2OA 2KBXA 3UTMA 2KXPC 1NFIE 2ETAA 1BI8B 4G8KA 2FO1E 4F6RD 3ZNGA 1MX4A 4U96D 3TWUA 2JABA 5FIOA 4B93B 2J8SD 1DCQA 1UOHA 4K5BA 4GPMA 5KNHD 1OT8A 3UXGA 4HQDA 2Y0BG 1AP7A 5CEDB 4QQIA 4A63B 1AWCB 5EILA 3LJNA 4J7WA 1N11A 3ZU7B 4DX6D 1MJ0A 3V79K 3TWSA 5AARA 3NBNB 4JB8P 3TWWA 4OAVB 2A5EA 1G3NB 4C48B 2XZDG 4BETA 1MX2A 1QYMA 5EIBE 4U95D 5AQ7A 2DVWA 5CERB 3B7BA 4LSZE 1D9SA 2V5QC 4G8LA 5EN5D 2B0OE 2HE0A 4HNAD 1IKND 3JXIA 4CYMD 2XEEA 2ETBA 4CZ2D 5BXUA 1MX6A 2XZTG 4GMRA 4U8VD 4BEPA 2MYOA 5ENTD 4BSZB 3KEAA 2QC9A 3AJIA 4O1OA 5ENPD 1K3ZD 1SW6A 5EYLA 4HRLA 5D66A 3JXJA 5JA4D 1DC2A 1BI7B 3NOGD 4HBDA 4QFVA 1K1BA 4F1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYJ A;  3TWV A;  2PNN A;  3Q9N C;  1MYO A;  4O1P A;  2QYJ A;  1YMP A;  4HRM B;  5CBO A;  3V30 A;  2DZO A;  3DEP A;  1TR4 A;  3V31 A;  5CBN A;  3B95 A;  4RLY A;  5JMN D;  5KBA A;  2BKK B;  4N5Q A;  3EHQ A;  5ENO D;  4DRX E;  2RFM A;  5EYP F;  4HI9 A;  2Y1L E;  2V4H C;  3J5Q B;  4J8Y A;  3ZUV B;  1BD8 A;  1K1A A;  4UUC A;  2VGE A;  1BU9 A;  3Q9U C;  3T9K A;  4LNU D;  3V2X A;  4BES A;  5AQB A;  2ZGG A;  3NOC D;  4YDY A;  5BXO A;  3IXE A;  1A5E A;  3F6Q A;  4LG6 A;  3C5R A;  3HG0 D;  3T8K A;  4Z68 A;  3TWR A;  5AQ9 A;  1YCS B;  4HLL A;  1S70 B;  1WDY A;  2ETC A;  3W9F A;  4ZFH A;  1N0Q A;  5ENS D;  3AAA C;  4HRN A;  3TWX A;  1IXV A;  1IHB A;  2BKG A;  5ITZ F;  4NIK A;  3D9H A;  5ENQ D;  1SVX A;  5EID A;  2XEN A;  5KWD A;  4DX2 A;  4U8Y D;  2DZN A;  4HI8 A;  5HS0 A;  4DX7 D;  3EU9 A;  1BLX B;  3DEO A;  2F8Y A;  5CEA A;  2F37 A;  4DX5 D;  2RFA A;  3JUE A;  5HKP A;  5CEC B;  4K5A B;  2DWZ A;  2P2C P;  4YDW A;  3UI2 A;  3TWQ A;  4O60 A;  4TUM A;  4DUI A;  2AJA A;  4OAU C;  1YYH A;  2L6B A;  5KNG A;  1WG0 A;  3EHR A;  4K5C A;  3SO8 A;  5HRY A;  5AN8 A;  4BER A;  5AAO A;  4HB5 A;  3TWT A;  3ZKJ A;  3HRA A;  2F8X K;  3J5P A;  1N0R A;  4ZHB A;  2XEH A;  5ENR D;  1OY3 D;  5FIN A;  3W9G A;  2ZGD A;  4DX1 A;  4ATZ D;  5AQA A;  3V2O A;  2KBX A;  3UTM A;  2KXP C;  1NFI E;  2ETA A;  1BI8 B;  4G8K A;  2FO1 E;  4F6R D;  3ZNG A;  1MX4 A;  4U96 D;  3TWU A;  2JAB A;  5FIO A;  4B93 B;  2J8S D;  1DCQ A;  1UOH A;  4K5B A;  4GPM A;  5KNH D;  1OT8 A;  3UXG A;  4HQD A;  2Y0B G;  1AP7 A;  5CED B;  4QQI A;  4A63 B;  1AWC B;  5EIL A;  3LJN A;  4J7W A;  1N11 A;  3ZU7 B;  4DX6 D;  1MJ0 A;  3V79 K;  3TWS A;  5AAR A;  3NBN B;  4JB8 P;  3TWW A;  4OAV B;  2A5E A;  1G3N B;  4C48 B;  2XZD G;  4BET A;  1MX2 A;  1QYM A;  5EIB E;  4U95 D;  5AQ7 A;  2DVW A;  5CER B;  3B7B A;  4LSZ E;  1D9S A;  2V5Q C;  4G8L A;  5EN5 D;  2B0O E;  2HE0 A;  4HNA D;  1IKN D;  3JXI A;  4CYM D;  2XEE A;  2ETB A;  4CZ2 D;  5BXU A;  1MX6 A;  2XZT G;  4GMR A;  4U8V D;  4BEP A;  2MYO A;  5ENT D;  4BSZ B;  3KEA A;  2QC9 A;  3AJI A;  4O1O A;  5ENP D;  1K3Z D;  1SW6 A;  5EYL A;  4HRL A;  5D66 A;  3JXJ A;  5JA4 D;  1DC2 A;  1BI7 B;  3NOG D;  4HBD A;  4QFV A;  1K1B A;  4F1P A; 
#chains in the Genus database with same CATH topology
 4HOU A;  1K8K G;  3LJ3 A;  2GRP B;  5CBN A;  4HI9 A;  2AW6 A;  3FUJ A;  1N54 A;  4I9E A;  4KVM A;  3QK0 A;  4M7C A;  2KM4 A;  3ENE A;  3IXE A;  3ASH A;  5A7D B;  4GTV A;  2WXL A;  3IKO B;  3ASF A;  5EID A;  4KZ0 A;  4GA0 A;  4FAD A;  5BNW A;  1FVF A;  4KBQ A;  3RKV A;  3LPZ A;  3RU0 A;  4A1S A;  3EHR A;  4GYO A;  5G55 A;  5EX3 A;  3D3M A;  1DCE A;  3VLE A;  2V5F A;  4PS7 A;  1IYG A;  3TJP A;  2KCK A;  5AJL A;  4GPM A;  4CDN A;  2P9N G;  2XS8 A;  5LCW J;  3X2Q E;  3ZEF A;  2GRR B;  4DX6 D;  3TL5 A;  2L0I A;  3P2B A;  3MEK A;  2V5Q C;  5A6C A;  2FBN A;  5ANR A;  5D2M C;  2IF4 A;  4L2Y A;  3DSW A;  4NAC A;  5D66 A;  5FTP A;  4P29 A;  3TG4 A;  2DYR E;  1Z3Y A;  5JJ6 A;  3LVR E;  3UMV A;  3V31 A;  4GZ3 A;  3QWW A;  4YDE A;  1S63 A;  4WNF A;  2NXP A;  2XS1 A;  3SFZ A;  1E8Y A;  3PRZ A;  4BES A;  2XEV A;  1YCS B;  1H2T C;  1V54 E;  2X38 A;  4RSY A;  4JXT A;  2L0T B;  3LS8 A;  5ITZ F;  1PY1 A;  3UKU G;  3CHR A;  4KZC A;  3OAW A;  4MLP A;  3RJV A;  1JCS A;  4I2Z A;  4DX5 D;  5ARG A;  3U66 A;  4F53 A;  2I1K A;  4H7X A;  4RG9 A;  2P9K G;  4KXK B;  4FHJ A;  4DX1 A;  5EDS A;  2C0L A;  5KNH D;  4A63 B;  2PM7 A;  2PM6 A;  2QYU A;  1SA5 A;  3UM3 A;  3KSL A;  2IEJ A;  3APD A;  4XI0 A;  3SQV A;  5T8I A;  1D8E A;  3Q7F A;  3ZPJ A;  3CQG B;  3MZL B;  5G05 J;  3WXX A;  2VQ2 A;  4EHM A;  4ILI A;  3UIP C;  3L22 A;  4HBD A;  2J49 A;  4AM9 A;  1HX8 A;  4GAA A;  3ULE G;  2QYJ A;  4U7E B;  4I6J A;  2XPY A;  3WG7 E;  3B95 A;  3T8M A;  3UM0 A;  3QB2 A;  3ZUV B;  3AU4 A;  3MV2 B;  4F3V A;  3Q9U C;  3T9K A;  2P58 C;  3DBS A;  4XKC A;  3F6Q A;  2PQN A;  2R03 A;  3PNT B;  2RG8 A;  1IHB A;  2Y69 E;  4BX8 A;  4C0E A;  3KD7 A;  2IJG X;  3IBE A;  2MRI A;  1BLX B;  2F37 A;  5DIZ A;  5FZR A;  1IQU A;  3U3W A;  4JEH A;  4YDW A;  3TWQ A;  4DUI A;  2AJA A;  3HVE B;  1XNF A;  4CCA A;  3ONL A;  2H6H A;  3IHY A;  3D9O A;  4ZHB A;  2P9L G;  3EUV A;  5LX8 A;  4MRU A;  4ATZ D;  3V2O A;  5CCM A;  4IN3 B;  4XE0 A;  4X8Q A;  4ACK A;  4KVO A;  1NA3 A;  1JPL A;  3U4T A;  5C2Y A;  1FPP A;  2VTB B;  2F0Y A;  3LJN A;  5LFA A;  5BPP A;  5D0Q D;  4A1G A;  4DLO A;  1JWG A;  3D9L A;  4TXP A;  2WMO A;  3JQ1 A;  4B8A A;  1KPS B;  2B0O E;  2IOL A;  4KT6 B;  2E0I A;  3SGH A;  4BSZ B;  1UN8 A;  3BUA A;  3DXK G;  3Q78 A;  4QFV A;  4ANW A;  2C2L A;  1OWL A;  3GZS A;  3AS8 A;  3GW4 A;  3EJN A;  4K0R A;  3CK7 A;  3DEP A;  3NF1 A;  4KMO A;  1O1S A;  3EHQ A;  4HVB A;  2B6C A;  1XGW A;  3KS2 A;  4A55 A;  1K1A A;  4GTS A;  4HS2 A;  3QDN A;  3L08 A;  3SNX A;  2AWI A;  1WDY A;  2GGF A;  3W9F A;  1ZU2 A;  3I3N A;  2P9I G;  3CHS A;  1OWN A;  5AIJ A;  5HKP A;  3PEU B;  3SZ7 A;  3G2V A;  5LCW C;  1UG3 A;  3CVL A;  1YYH A;  4OVU A;  3FUK A;  4MS6 A;  4HOT A;  2JEK A;  5CRU A;  2QFC A;  2P9P G;  1E8W A;  2WXH A;  3TWT A;  1OCC E;  4XKB A;  4J8F A;  4CGV A;  3MKQ B;  1OY3 D;  3ABM E;  3ULQ A;  2KBX A;  2LO6 A;  2YIN A;  2A5U A;  2XPI A;  2EIJ E;  1BI8 B;  3TWU A;  3ZYM A;  2J8S D;  2PL2 A;  2WVI A;  2WXO A;  3FU5 A;  2EIL E;  3PZ3 A;  4TXQ A;  1D9S A;  1OXJ A;  3FUN A;  4CZ2 D;  4GYW A;  1H6P A;  5CMW A;  3B7T A;  5LOZ A;  3CEQ A;  2IY0 C;  3APF A;  3VTX A;  5H7P A;  3B7R L;  3ZW3 A;  1MYO A;  2M63 A;  2RFM A;  4MBG A;  3QAR A;  3DRA A;  4BTB A;  4JD2 G;  4GA1 A;  3DSV A;  2IU1 A;  3FH5 A;  4LG6 A;  3I5P A;  2CHX A;  2LSV A;  2WXQ A;  3FDH A;  2XPZ A;  4IUL A;  4Q96 A;  4AEZ C;  1IXV A;  3LY9 A;  3D9H A;  3MGB A;  1SVX A;  3E37 A;  4K03 A;  3S7B A;  2XGO A;  1HO8 A;  3CVY A;  1EYH A;  4N3C A;  3LXU X;  4URK A;  1E90 A;  3O4Z A;  4APF A;  4BTA A;  2WMN A;  3NZU A;  3UM1 A;  5HRY A;  5KJM A;  3ZKJ A;  4XIF A;  3LCA A;  4AIF A;  4G26 A;  5T3R A;  1TEZ A;  3DST A;  3QKY A;  4I1M A;  4CDM A;  4UQX A;  1KLX A;  2VSN A;  3PZ1 A;  2OEW A;  5B1A E;  3HVE A;  4U96 D;  1TNB A;  1TN8 A;  4HQD A;  3R9A B;  5AYW D;  5BT1 A;  2IO2 C;  2L9B A;  3ONK A;  4U63 A;  3TG5 A;  3B7B A;  3HHM A;  2I2O A;  3JXI A;  1E7V A;  4GTP A;  1TYQ G;  2VTB A;  2WM9 A;  5KJK A;  3UM2 A;  1E96 B;  2EIK E;  3DXM G;  1Z6T A;  2R5S A;  5KBA A;  3UIN C;  3Q15 A;  3SD5 A;  4N2S A;  2X6F A;  2X6I A;  4EBA G;  1OWO A;  3K9I A;  3CVV A;  5AQ9 A;  2X3M A;  3D9P A;  1BPO A;  5HQ8 A;  4FU3 A;  3EU9 A;  1E7U A;  3NZS A;  1IQR A;  2NSZ A;  2V8S E;  4GTR A;  1L5J A;  1O1R A;  4RVB A;  3BEE A;  4W9R A;  2QY7 A;  3EU5 A;  3DSU A;  2I6H A;  4JHR A;  4YVO A;  3HXF A;  4YND A;  3UKR G;  5AQA A;  4J8D A;  4JL0 A;  3FU6 A;  4CT4 A;  3FP3 A;  3SBS A;  2UY1 A;  4F6R D;  1MX4 A;  2LXM A;  2AVP A;  2I9C A;  4QQI A;  5EIL A;  1VDY A;  3MKQ A;  2FEZ A;  4JHK A;  3Q75 A;  1MX2 A;  4BY6 A;  1S64 A;  2BF0 X;  3R9M A;  4XX5 A;  3LKU A;  5T4Y A;  3VLD A;  3TAX A;  3OXL A;  2FO7 A;  4O1P A;  3CSF A;  2LUH A;  1ELK A;  4RLY A;  2BKK B;  3PUJ A;  4J8Y A;  5ANL A;  3L17 A;  4UUC A;  2MOW A;  1TJC A;  4BT9 A;  3V2X A;  1EPU A;  3NOC D;  3BQO A;  3HG0 D;  2FUL A;  3CVX A;  2DYS E;  5J90 A;  4WWO A;  4HRN A;  5EX0 A;  5BW8 C;  2XCC A;  3E33 A;  3RO2 A;  4HI8 A;  1HG2 A;  3FFL A;  3DEO A;  2ZXW E;  1HZ4 A;  3JUE A;  1MQS A;  3APC A;  5E75 A;  4KYO B;  4J0U A;  4FLB A;  1H19 A;  2F8X K;  1H2V C;  4BFR A;  1FT2 A;  4I2W A;  1UW4 B;  3Q73 A;  3UT7 A;  2OVB A;  4E6H A;  2UWJ G;  2KXP C;  4G8K A;  4GTM A;  2KZT B;  3ZNG A;  2VGX B;  4JA7 A;  1DCQ A;  1NI1 A;  4D10 C;  3UXG A;  1A17 A;  4HFG A;  3QNK A;  5IY5 E;  3GZ2 A;  3LVQ E;  4AVX A;  3C3O A;  1UJK A;  3PVL A;  3HXB A;  3CGH A;  4ANX A;  5EN5 D;  3QJZ A;  1KZO A;  3FTS A;  2XZT G;  4HXI A;  3D9J A;  5ENT D;  1Y6I A;  3KEA A;  5FT9 A;  2WXI A;  4JW1 A;  4TV3 A;  3LY7 A;  3FY4 A;  3PUK A;  3JUI A;  4ACL A;  3UQ3 A;  5EKQ D;  1N52 A;  3V30 A;  4UWK A;  1OUV A;  2DZO A;  4I1A A;  1HG5 A;  2XGS A;  4JEU A;  3DWL G;  2ILR A;  4I9C A;  4B0Z A;  3ZFW A;  5AQB A;  4TRQ A;  3VTY A;  4EBA A;  3IEG A;  4ANU A;  3FUM A;  1FVH A;  3AAA C;  3TWX A;  3ABK E;  4NIK A;  4CGW A;  2BTD A;  1IHG A;  1OCZ E;  4EZK A;  3CKB A;  4DX7 D;  3TGO A;  4JZY A;  3NAW A;  4OAU C;  3FUD A;  2HYZ A;  3MA5 A;  1TNZ A;  1DNP A;  3G2W A;  4I17 A;  4GTO A;  2X6J A;  3ML9 A;  4N3B A;  3AU5 A;  1HS6 A;  3ZN3 A;  3UT8 A;  4G25 A;  1RW2 A;  4CEM A;  1QZ2 A;  3FTU A;  1N11 A;  4PS8 A;  2XRZ A;  5JHA A;  3UIO C;  3LEW A;  4I6E A;  3C98 A;  4U95 D;  3CIA A;  4N39 A;  3Q7A A;  2OND A;  4Q69 A;  3IHV A;  3LY8 A;  4V3I A;  5FQ6 A;  4DLQ A;  3JYS A;  4GML A;  3SBT B;  3AG1 E;  1DC2 A;  4AY6 A;  1K1B A;  2A4Z A;  5B1B E;  4I6G A;  3RAU A;  1YMP A;  1JCR A;  3ZYQ A;  4LEU A;  4IRU A;  2RKK A;  4J6I A;  2VSO E;  3FEX A;  1UN9 A;  2R17 C;  5BXO A;  2VGY A;  4TXR A;  2VYI A;  3KEZ A;  4YDO A;  3CK8 A;  2DZN A;  4L2L A;  5HS0 A;  4GPK A;  2AXV A;  3EDT B;  1KT0 A;  3ZVV A;  3RIB A;  2ZIS A;  4AJW A;  3C3Q A;  4GB9 A;  2WB2 A;  3J5P A;  2LAI A;  3FUE A;  4H7Y A;  3UT4 A;  1P5Q A;  2J08 A;  5ENR D;  4IYP A;  2GW1 A;  3L6A A;  3W9G A;  3CV0 A;  1OWM A;  4WND A;  4U07 A;  2WXK A;  2GRO B;  4N5C A;  3RK6 A;  2Y0B G;  3FU0 A;  3JQ0 A;  5KCM A;  3RRU A;  3FTW A;  4AV7 A;  3QC1 A;  2CG2 A;  5AAR A;  2XQ0 A;  2XZD G;  5AQ7 A;  1KT1 A;  1IKN D;  2KZT A;  2AXU A;  3BG1 B;  2VGX A;  1MX6 A;  2PZI A;  2MYO A;  4O1O A;  3BG0 B;  3AJI A;  1K3Z D;  4HRL A;  3NOG D;  5KJN A;  3E32 A;  3SI5 A;  1ELR A;  4N5Q A;  5ENO D;  4DRX E;  2J09 A;  3CHO A;  4ME2 A;  3EIJ A;  1UJJ A;  4I1O B;  4PS3 A;  3PNL B;  3VLF A;  3GZ1 A;  3C5R A;  4R7L A;  1Z3X A;  2KC7 A;  1N94 A;  4AOF A;  2ION A;  1TJF A;  2BKG A;  3G2S A;  5KWD A;  3FH8 A;  2WQH A;  1E8X A;  3S7F A;  3SFX A;  3L82 A;  3MX3 A;  3C72 A;  4AP2 A;  5CMY A;  3CVU A;  5CEC B;  4EPZ A;  2CFU A;  3PZ2 A;  5G04 C;  3ZXS A;  4DI3 A;  3C3R A;  4C0M A;  5AAO A;  2WQ6 A;  1X5B A;  5FQ4 A;  1SZA A;  3S7J A;  4GMJ A;  3Q5M A;  4PH4 B;  2GRM A;  2JAB A;  5FIO A;  4NRH B;  5FQ8 A;  1LD8 A;  3G2T A;  3TWS A;  2A5E A;  4HNA D;  4N3A A;  2WXG A;  2R02 A;  4L23 A;  3UX4 A;  1LF8 A;  5BXU A;  1EF1 C;  4WNG A;  1N95 A;  4HOS A;  2DCP A;  3S2A A;  1NA0 A;  2Q7F A;  3OXF A;  5CED B;  3FHE A;  2IFU A;  4F1P A;  1SA4 A;  2WPV A;  2XCB A;  3TWV A;  5JHB A;  1H0A A;  3R7R A;  3AS4 A;  3CVW A;  4N2Q A;  4ATG A;  4A3T A;  1N9A A;  2FI7 A;  2ZU6 B;  4M3O A;  3IV0 A;  4FUL A;  4FP7 A;  3CHQ A;  3HXD A;  2E2E A;  4LNG A;  1A5E A;  3T8K A;  2RD0 A;  3QAQ A;  4B94 A;  5KJL A;  4RG6 A;  3E4B A;  5FQ7 A;  2YHC A;  4LNB A;  4UI9 K;  4AY5 A;  2YQ8 A;  2DIW A;  4UWL A;  5AN8 A;  1RZ4 A;  2KCV A;  5FZQ A;  3E30 A;  1NL4 A;  4XEI G;  2XEH A;  2BUG A;  1B89 A;  3B7U X;  3ZRH A;  5FIN A;  1DVP A;  4UWH A;  2X6K A;  2WQ7 A;  4LCT A;  3G2U A;  3ZYL A;  4FJY A;  1HF8 A;  2C0M A;  2EIN E;  3N71 A;  1S0P A;  1TN6 A;  1ZBP A;  1MZC A;  4HOQ A;  5ARF A;  1G3N B;  4EZL A;  3D9N A;  5CER B;  4A3V A;  4XI9 A;  2HE0 A;  3QOU A;  2V0P A;  2CHZ A;  2XEE A;  4GU5 A;  1Y8M A;  4APO A;  5FWQ A;  3CVQ A;  1SQM A;  5JJ7 A;  5JA4 D;  3HYM B;  1N4P A;  5CCL A;  5ENN A;  2WXF A;  2EIM E;  2V4L A;  4HRM B;  4CDR A;  1WM5 A;  2J07 A;  4MKT A;  2KCL A;  3SF4 A;  1GW6 A;  2V4H C;  2GRL A;  3GYZ A;  5CHE E;  2HO1 A;  1BU9 A;  3NB2 A;  3ULY A;  3RSE G;  3L54 A;  1PC2 A;  3CLJ A;  5G2N A;  4YDY A;  1KZP A;  3DSX A;  3FWV A;  3FUH A;  4Z68 A;  3HIZ A;  1S70 B;  1Q2Z A;  2ETC A;  4DK5 A;  2GRQ B;  4BSX A;  1E8Z A;  2XEN A;  4DX2 A;  2OVF A;  3E34 A;  4G11 A;  1JCQ A;  4O6F A;  2R05 A;  5CEA A;  1TNY A;  2DWZ A;  2LAH A;  3UI2 A;  3Q49 B;  1ZB1 A;  1WG0 A;  1QQE A;  3SO8 A;  4FJZ A;  4LUN U;  2P9S G;  1TN7 A;  1U3D A;  3FUI A;  4GZC A;  4EQF A;  1MHQ A;  3B7S A;  1FT1 A;  1H6K A;  3KSQ A;  1NFI E;  3Q4A B;  2VSX E;  4UI9 C;  4WWP A;  4B93 B;  3TXM A;  4B89 A;  2FF4 A;  1AP7 A;  1N4S A;  4B8C B;  2NC9 A;  4JB8 P;  4DI4 A;  3D9K A;  1U3C A;  1QYM A;  4JVS A;  3HDX A;  1QBQ A;  4U8V D;  2Y4T A;  4BEP A;  1NZN A;  2QC9 A;  2YHE A;  4U0U A;  2OOE A;  1BI7 B;  4U8H A;  4L1B A;  3FTX A;  4NQ0 A;  2PNN A;  5G04 J;  1OCO E;  5JJT A;  3QWV A;  2XRY A;  5FJY A;  2Y1L E;  3J5Q B;  2L6J A;  1BD8 A;  4FA6 A;  4OYS A;  1HFA A;  3JCK C;  4FLH A;  3LDZ A;  4L7T A;  3PRE A;  2KAT A;  2OEV A;  4BX9 A;  4ZFH A;  4Q94 A;  4EEC A;  4GYY A;  1SZ9 A;  3ASG A;  2JLB A;  2J4D A;  4GTQ A;  3URZ A;  3MV3 B;  3S7D A;  4U8Y D;  1W3B A;  4E85 A;  5CRV A;  4Y6C A;  3RRM B;  2WXM A;  3FTY A;  5FZS A;  3DPD A;  3ML8 A;  3ABL E;  4TUM A;  2HR2 A;  2IO3 C;  2R2L A;  3T5V A;  5E76 A;  3PZD A;  4XZ4 A;  4Y6W A;  4GCN A;  3DSS A;  2FO1 E;  4HLE A;  4BWR A;  1UOH A;  3P1U A;  3OTN A;  1N4R A;  3AS5 A;  3L9T A;  3BU8 A;  3AG3 E;  1HH8 A;  5DBK A;  4OAV B;  3FUF A;  2X6H A;  4UQY A;  2Y3A A;  4WNE A;  3RRN B;  3MKR A;  4FHK A;  3I4G A;  3FH7 A;  2LXL A;  3B13 A;  4GZD A;  2H6F A;  3L16 A;  5HI7 A;  3AG4 E;  5CBO A;  4UQZ A;  4J8E A;  3D9I A;  2WXP A;  2WXN A;  1OCR E;  4TUU A;  4G1T A;  2I1J A;  3PH0 C;  2YNQ A;  2VGE A;  4G24 A;  2CFZ A;  1OWP A;  1NP7 A;  5M72 A;  1Z5S C;  2H6I A;  3CHP A;  3PDN A;  5BV0 A;  3Q79 A;  3AG2 E;  3PZ4 A;  2R59 A;  3ASO E;  4F7A A;  3ASN E;  2RFA A;  3QWP A;  4I43 A;  4ABN A;  3ZHE B;  4G23 A;  1ELW A;  3CKC A;  5KNG A;  4K5C A;  2XGM A;  4BER A;  4WUY A;  2EQX A;  3HRA A;  3T5X A;  2VSY A;  1HU3 A;  4GZ6 A;  4LER A;  2ZGD A;  1TNU A;  3LYA A;  3CK9 A;  3UTM A;  3TXN A;  3NQP A;  2ETA A;  2OCC E;  2ZIR A;  4PDX A;  3SHF A;  3KAE A;  4K5B A;  2XHE A;  1WAO 1;  1TNO A;  3ZU7 B;  1MJ0 A;  3NBN B;  4JPS A;  3SFY A;  2DVW A;  5J08 A;  4DJA A;  2ETB A;  5BUZ A;  2AXZ A;  2H6G A;  4OVV A;  1O1T A;  4JHJ A;  2DBA A;  3EIQ C;  3Q9N C;  3L13 A;  3CQC B;  4JA9 A;  2Y4U A;  3PE4 A;  5BV1 A;  3D9M A;  2WXR A;  4F1S A;  5D0O D;  4UWG A;  3CHM A;  2UY1 B;  1X81 A;  4GCO A;  1HE8 A;  4LNU D;  4UI9 J;  1O5M A;  2HM8 A;  1EDU A;  3PE3 A;  1PAQ A;  2IOS A;  3TWR A;  4EZJ A;  3CST A;  1N0Q A;  3MJW A;  1JWF A;  4DPR A;  5ENQ D;  1U2V G;  2F8Y A;  3FUL A;  4J8S A;  2OV8 A;  1WY6 A;  2P2C P;  3ASD A;  4WWN A;  1HXI A;  4U0S A;  4RQI A;  4AXH A;  2J4B A;  3CVN A;  3EHM A;  4JC8 A;  3HXE A;  4ILH B;  4BT8 A;  3FU3 A;  3Q47 B;  3ISM C;  4C9B B;  3UPV A;  1LTX A;  4J7W A;  3V79 K;  3PEV B;  3MCX A;  2CHW A;  4C48 B;  4BET A;  3MYV A;  2VJ8 A;  5EIB E;  4LSZ E;  4G8L A;  1JUQ A;  2LNI A;  4CYM D;  3ZIM A;  1SW6 A;  2BED A;  4CRW A;  4UWF A;  3HXC A;  2NYJ A;  1INZ A;  3FTZ A;  1H6O A;  2IQC A;  5A23 A;  1TR4 A;  5JMN D;  5AJD A;  5B3S E;  5AEN A;  5EYP F;  3O48 A;  3R7Q A;  3CR3 A;  3PS6 A;  2LSU A;  3EHN A;  2CG3 A;  2MHK A;  4HOR A;  2ZGG A;  4GZ5 A;  4NUR A;  3OXG A;  4HLL A;  4L9P A;  4LRZ A;  4U04 A;  4G2V A;  5ENS D;  5LP0 A;  3I4R B;  5G05 C;  2PQR A;  2GRN B;  3UUX A;  1N4Q A;  1FCH A;  4CT0 A;  4ANV A;  4GA2 A;  4K5A B;  4O60 A;  3U9W A;  2L6B A;  4YVQ C;  3ESL A;  1QNF A;  4HB5 A;  1N0R A;  4ILG A;  1YA0 A;  1V55 E;  3SY2 A;  3DPY A;  4WAF A;  4PUC A;  3ESK A;  3ZYK A;  2P9U G;  3ZGQ A;  3ZHE A;  4GTT A;  3CVP A;  2QZA A;  1OT8 A;  3RO3 A;  2J9Q A;  1AWC B;  2WXJ A;  1D8D A;  3ZXP A;  4U0Z A;  3TWW A;  3FTV A;  4FC8 A;  1H2U A;  1LD7 A;  3FEY A;  4GMR A;  5C1D A;  5ENP D;  5EYL A;  3U64 A;  3JXJ A; 
#chains in the Genus database with same CATH homology
 2NYJ A;  3TWV A;  2PNN A;  3Q9N C;  1MYO A;  4O1P A;  2QYJ A;  1YMP A;  4HRM B;  5CBO A;  3V30 A;  2DZO A;  3DEP A;  1TR4 A;  3V31 A;  5CBN A;  3B95 A;  4RLY A;  5JMN D;  5KBA A;  2BKK B;  4N5Q A;  3EHQ A;  5ENO D;  4DRX E;  2RFM A;  5EYP F;  4HI9 A;  2Y1L E;  2V4H C;  3J5Q B;  4J8Y A;  3ZUV B;  1BD8 A;  1K1A A;  4UUC A;  2VGE A;  1BU9 A;  3Q9U C;  3T9K A;  4LNU D;  3V2X A;  4BES A;  5AQB A;  2ZGG A;  3NOC D;  4YDY A;  5BXO A;  3IXE A;  1A5E A;  3F6Q A;  4LG6 A;  3C5R A;  3HG0 D;  3T8K A;  4Z68 A;  3TWR A;  5AQ9 A;  1YCS B;  4HLL A;  1S70 B;  1WDY A;  2ETC A;  3W9F A;  4ZFH A;  1N0Q A;  5ENS D;  3AAA C;  4HRN A;  3TWX A;  1IXV A;  1IHB A;  2BKG A;  5ITZ F;  4NIK A;  3D9H A;  5ENQ D;  1SVX A;  5EID A;  2XEN A;  5KWD A;  4DX2 A;  4U8Y D;  2DZN A;  4HI8 A;  5HS0 A;  4DX7 D;  3EU9 A;  1BLX B;  3DEO A;  2F8Y A;  5CEA A;  2F37 A;  4DX5 D;  2RFA A;  3JUE A;  5HKP A;  5CEC B;  4K5A B;  2DWZ A;  2P2C P;  4YDW A;  3UI2 A;  3TWQ A;  4O60 A;  4TUM A;  4DUI A;  2AJA A;  4OAU C;  1YYH A;  2L6B A;  5KNG A;  1WG0 A;  3EHR A;  4K5C A;  3SO8 A;  5HRY A;  5AN8 A;  4BER A;  5AAO A;  4HB5 A;  3TWT A;  3ZKJ A;  3HRA A;  2F8X K;  3J5P A;  1N0R A;  4ZHB A;  2XEH A;  5ENR D;  1OY3 D;  5FIN A;  3W9G A;  2ZGD A;  4DX1 A;  4ATZ D;  5AQA A;  3V2O A;  2KBX A;  3UTM A;  2KXP C;  1NFI E;  2ETA A;  1BI8 B;  4G8K A;  2FO1 E;  4F6R D;  3ZNG A;  1MX4 A;  4U96 D;  3TWU A;  2JAB A;  5FIO A;  4B93 B;  2J8S D;  1DCQ A;  1UOH A;  4K5B A;  4GPM A;  5KNH D;  1OT8 A;  3UXG A;  4HQD A;  2Y0B G;  1AP7 A;  5CED B;  4QQI A;  4A63 B;  1AWC B;  5EIL A;  3LJN A;  4J7W A;  1N11 A;  3ZU7 B;  4DX6 D;  1MJ0 A;  3V79 K;  3TWS A;  5AAR A;  3NBN B;  4JB8 P;  3TWW A;  4OAV B;  2A5E A;  1G3N B;  4C48 B;  2XZD G;  4BET A;  1MX2 A;  1QYM A;  5EIB E;  4U95 D;  5AQ7 A;  2DVW A;  5CER B;  3B7B A;  4LSZ E;  1D9S A;  2V5Q C;  4G8L A;  5EN5 D;  2B0O E;  2HE0 A;  4HNA D;  1IKN D;  3JXI A;  4CYM D;  2XEE A;  2ETB A;  4CZ2 D;  5BXU A;  1MX6 A;  2XZT G;  4GMR A;  4U8V D;  4BEP A;  2MYO A;  5ENT D;  4BSZ B;  3KEA A;  2QC9 A;  3AJI A;  4O1O A;  5ENP D;  1K3Z D;  1SW6 A;  5EYL A;  4HRL A;  5D66 A;  3JXJ A;  5JA4 D;  1DC2 A;  1BI7 B;  3NOG D;  4HBD A;  4QFV A;  1K1B A;  4F1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...