3KSQA

Discovery of c-imidazole azaheptapyridine fpt inhibitors
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase, CAAX box, alpha
publication title Discovery of C-imidazole azaheptapyridine FPT inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 126
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3ksqA00
1KZPA 3DSXA 3DSUA 2H6GA 1TN6A 1O1SA 3E37A 3PZ1A 3E30A 3KSQA 4L9PA 3Q7FA 1MZCA 3Q79A 4GTSA 1TN8A 3KSLA 1TNOA 3HXBA 1JCQA 1SA4A 3DRAA 4YDOA 1S64A 3DSWA 1LD8A 1O1RA 3E33A 4EHMA 4GTRA 1JCRA 4GTOA 1N4QA 1S63A 3PZ2A 1TN7A 3EU5A 3DSTA 1O5MA 1TNUA 4YDEA 4MBGA 1FPPA 3HXCA 1N4RA 1D8DA 1NI1A 1TNZA 3DSVA 4LNBA 4LNGA 1D8EA 2ZIRA 1N94A 3E34A 1N4SA 3Q73A 2H6FA 1JCSA 1TNYA 3HXDA 1FT2A 1LD7A 4GTVA 2H6IA 3DSSA 3PZ3A 3Q78A 4GTPA 1FT1A 1SA5A 3EUVA 1N9AA 1N95A 3HXEA 3PZ4A 4GTQA 1KZOA 1X81A 1QBQA 3HXFA 3Q7AA 3C72A 3DPYA 2F0YA 4GTTA 3Q75A 1LTXA 2BEDA 3SFYA 1O1TA 2R2LA 2IEJA 1N4PA 2H6HA 3E32A 3SFXA 1TNBA 1DCEA 4GTMA 1NL4A 2ZISA
chains in the Genus database with same CATH superfamily
5CECB 2LUHA 3TXNA 5JHAA 3J5QB 2VQ2A 2P9LG 5KJNA 4K5AB 2MYOA 2YHEA 4G8LA 2CFZA 1N54A 3RJVA 3TXMA 4F7AA 2R03A 2DZOA 1WAO1 3OXGA 2V4HC 3VLDA 3FUNA 4GYWA 4HRMB 4CDNA 3CVWA 5AN8A 3APCA 3ONKA 3NQPA 3SNXA 3UM1A 3QC1A 3IEGA 4LSZE 3EJNA 4DI3A 3CVXA 1OCCE 4G25A 3MYVA 3L22A 4EZLA 2PQRA 4U0ZA 2V4LA 3FU3A 5EDSA 1FT1A 1N0QA 3GZ1A 2WM9A 2IOSA 4IRUA 4N39A 4UI9C 4APFA 5CRUA 1TNBA 5FIOA 3SBSA 3EDTB 3ASGA 3FU5A 5AIJA 1O1SA 3CSTA 2M63A 3TG4A 4A55A 1BU9A 4I6JA 4FJYA 5T3RA 1TNOA 1JCQA 4O6FA 5BV1A 3D9HA 3ZEFA 1S64A 1UJKA 4XEIG 3DEOA 4LERA 1OWPA 3B7TA 3SY2A 1PAQA 3LPZA 4GTRA 2KXPC 2VYIA 4GTOA 4PUCA 1TN7A 3G2TA 5FQ7A 1TNZA 4PS7A 1YMPA 3FULA 4GMJA 4C0MA 3CEQA 3LKUA 4G11A 4Y6WA 4FHJA 3LYAA 2HR2A 5LX8A 1E7VA 2X6IA 1E90A 4N5CA 2EINE 3LJ3A 3AJIA 3LCAA 3HXFA 3C72A 4ACLA 3RAUA 3W9GA 2JEKA 3CVUA 2X6FA 4G24A 4AY5A 3SFXA 4IYPA 4GZCA 1N52A 3X2QE 1KLXA 3BG1B 2MOWA 2HE0A 2P9KG 3EIJA 2GRRB 3ULQA 4JZYA 3B7SA 3DRAA 4N2QA 1HZ4A 4U0UA 3TWQA 1O1RA 2XPZA 5LOZA 5CBNA 3LY7A 2LXMA 3DEPA 4ACKA 1BI8B 4B93B 3EU5A 4JA9A 2NYJA 1QQEA 3PREA 4GAAA 4ILGA 2P9PG 2DBAA 2RFAA 2QFCA 4H7XA 3LDZA 3R9MA 4KXKB 3ML9A 2EQXA 4I17A 2OEWA 1WDYA 3QKYA 2WXJA 3K9IA 3FTWA 1E8ZA 4AOFA 2B0OE 4DLQA 4WNDA 3ZXSA 5H7PA 3UT8A 1OCOE 2PNNA 4C9BB 3V2XA 5C2YA 3D9MA 3GW4A 3ABLE 4XIFA 4F1SA 4BTBA 3MA5A 4YVQC 3QWPA 2BEDA 2NC9A 3CQGB 3APFA 4QQIA 2IEJA 4GCNA 4NQ0A 3UM2A 3CVPA 2ZISA 1KZPA 1SW6A 2H6GA 1HXIA 5C1DA 1MQSA 3L08A 3C3OA 4OVUA 5ARGA 1K8KG 4FA6A 5JHBA 1DNPA 1Z6TA 3ZYKA 3TWWA 2WXGA 4AP2A 3D3MA 3DXMG 1WM5A 2X3MA 4CYMD 1QNFA 1LD8A 2E0IA 2FF4A 3PE4A 3UX4A 3J5PA 3NAWA 1K1BA 3O4ZA 3JQ1A 4UUCA 2IQCA 4UQXA 1TJCA 1TYQG 3ESKA 4TV3A 4N3CA 1W3BA 5LP0A 2KCVA 3QB2A 3SZ7A 3AU4A 2GGFA 4ANWA 3CV0A 3ENEA 2X6HA 1H19A 4JA7A 3L54A 2ETCA 5CMYA 4BFRA 4C0EA 2BKKB 5B1BE 4HLEA 5FJYA 3UIPC 4NURA 4EZJA 3S7DA 2F8YA 2Y69E 3FUHA 1HO8A 3FEXA 3RIBA 4ATGA 1E8WA 2WB2A 3D9JA 3PRZA 1N95A 3PZ4A 3CKBA 1JPLA 3E4BA 2PQNA 3Q7AA 3RRUA 2ZGGA 3TJPA 4E85A 1RZ4A 4K03A 4ANVA 4UWKA 2IFUA 2KM4A 1O1TA 4DK5A 1OUVA 1IHGA 5HQ8A 5IY5E 2QYUA 3TL5A 2R05A 3DSXA 1NZNA 4JVSA 2J8SD 4EPZA 3FFLA 4A1SA 4UWFA 1DCQA 3PNLB 5AJDA 4DPRA 3HDXA 2DIWA 3ULYA 2KATA 4CDRA 2WMOA 4I1OB 4DRXE 1BI7B 4CDMA 3VLFA 4XZ4A 4FHKA 2VSOE 4ZHBA 4U8HA 1N4QA 2LAHA 1NP7A 3NF1A 2BUGA 4KZ0A 2WXPA 2AW6A 2BTDA 2CFUA 3D9OA 4BSXA 5AARA 2EIJE 2XGSA 1V54E 3FP3A 1JCSA 4KVMA 3EHRA 2BF0X 4HQDA 4BY6A 2PM6A 4WNEA 1NA3A 3L6AA 2C0MA 1Z5SC 2ILRA 2PL2A 4BX9A 3JQ0A 3ZXPA 1L5JA 4F3VA 2CHWA 1Z3XA 3TAXA 4J0UA 4FU3A 3CKCA 1OWOA 2XCCA 5FQ6A 4ILIA 1TN6A 4I1AA 3D9NA 3L17A 3B7BA 5EX3A 1UW4B 3ZYLA 4HOUA 4Q69A 4X8QA 2NXPA 3LVRE 2WXKA 3ASFA 3NB2A 2JABA 1SVXA 3DXKG 3QDNA 1E7UA 4N2SA 1HS6A 1IXVA 2P9UG 4CT4A 2P9NG 1OWMA 2WXOA 4DX5D 5FTPA 5JJ7A 1HU3A 3MV2B 4GZ5A 3C98A 3SQVA 4A1GA 1E8XA 3ZIMA 4GYYA 2J4DA 3SBTB 1D8DA 3ZN3A 1OY3D 4AEZC 1N0RA 4JL0A 4EZKA 3JXJA 4JEHA 4FADA 3RRNB 4KYOB 1PY1A 3U9WA 3PEUB 5KJMA 3ASHA 3F6QA 4WNFA 3FEYA 1Y8MA 1KPSB 2FBNA 4FC8A 3B7UX 1UN9A 1KZOA 1TR4A 5FZQA 3P1UA 1KT1A 5D2MC 2QZAA 3C3QA 4I2ZA 2V8SE 2VSNA 2XPYA 4U96D 3C3RA 2LNIA 5G05J 3B13A 3G2UA 3NOCD 3AG2E 2DCPA 1DCEA 3B95A 3Q15A 4NACA 3LJNA 3CSFA 4WAFA 2RG8A 3E37A 2UY1B 1D9SA 3SHFA 4LUNU 1A5EA 5JJTA 3Q79A 3ZPJA 3LY9A 5CBOA 3PVLA 4HBDA 2BKGA 4TXRA 2J4BA 4HXIA 2P2CP 3GYZA 2WQHA 2XEHA 1NA0A 4F53A 3E33A 3BG0B 4HLLA 3QAQA 2WMNA 2OEVA 3Q9UC 4G1TA 2I6HA 2QYJA 2I1KA 4PH4B 2I9CA 4AVXA 4HOQA 2QC9A 5D66A 3OXFA 4LNBA 3O48A 2IY0C 3ML8A 3PDNA 3V31A 3JUIA 1INZA 4K5BA 2OVBA 3KD7A 4KVOA 3RO3A 1ELKA 3HHMA 3CHSA 4GTVA 5A6CA 3G2SA 5FQ8A 1KT0A 5JJ6A 4DUIA 4DLOA 3EHMA 4RG9A 1UG3A 3T8MA 2A4ZA 2MHKA 2EIME 2AXVA 4ANXA 3S2AA 4JB8P 3FTSA 3AG1E 2HYZA 4XKBA 1K3ZD 5G04J 3FWVA 4LG6A 5HRYA 1QZ2A 1YCSB 3DSUA 2OVFA 3FH8A 3HVEB 4ANUA 2CHXA 2VGXB 4UI9K 3ONLA 4TXPA 2GRMA 2Y4UA 3WG7E 1IQUA 4TUMA 3CIAA 5LCWJ 2JLBA 2DYSE 4BT9A 3MEKA 4XKCA 4YDWA 4I9EA 3DBSA 3PS6A 4GA0A 5BXUA 4OAVB 1O5MA 3GZ2A 3QWVA 2WXHA 1ELRA 3EIQC 4ATZD 2FO7A 3MGBA 3ASDA 3MKRA 1XNFA 3FUMA 1H6PA 4LNGA 4GMLA 5T8IA 2ZIRA 2Y3AA 2P58C 1N4SA 3D9PA 3FTXA 4L1BA 4A3TA 4DX6D 3BU8A 4CT0A 3ZYMA 2L0IA 1JWGA 4L7TA 3CR3A 1HG2A 3MZLB 3G2VA 3URZA 2WXNA 2A5EA 2LO6A 4CZ2D 5KJLA 3Q75A 1IYGA 2L9BA 3CLJA 3PZDA 2DWZA 2I1JA 4HRLA 4BESA 4RVBA 3NZSA 4MLPA 4KMOA 5FT9A 3CVQA 3FTUA 3UXGA 2R17C 1TN8A 4DJAA 3JUEA 2OCCE 2XQ0A 1IKND 4J8SA 5JA4D 3PZ2A 4LRZA 5EYPF 4GA2A 4EECA 3Q5MA 2IJGX 2XGMA 3TWRA 4F1PA 4OVVA 1IHBA 4B94A 3RO2A 4ZFHA 2XRZA 2GROB 1B89A 1Q2ZA 2WXRA 5KJKA 2J09A 2XEEA 3T8KA 3T5XA 1Z3YA 3QNKA 4UQYA 5D0QD 5G2NA 2WXQA 2DZNA 1S0PA 1MHQA 4W9RA 1H6KA 5A23A 3CQCB 4UWLA 5AENA 2V5QC 4HB5A 5CEDB 1Y6IA 4LCTA 1HH8A 1QYMA 4GTTA 3KEZA 4JHJA 3SFYA 2CHZA 4RSYA 4JHRA 5ENTD 3EHNA 3HVEA 1EYHA 3IXEA 2VGXA 5LFAA 3BQOA 3QOUA 2DVWA 4I9CA 1HG5A 3ABME 3ESLA 5BXOA 1YYHA 2XCBA 5ANRA 3I5PA 2WQ6A 4GTSA 4J7WA 3G2WA 3V2OA 3FUDA 2AXZA 3P2BA 3KEAA 3QK0A 3UKUG 4A63B 3UUXA 3TWVA 4KZCA 3FU0A 2VSYA 3JCKC 1H6OA 3AG4E 4Y6CA 1MJ0A 2YINA 5ENOD 1S63A 3I4GA 1BLXB 1VDYA 4GU5A 2IF4A 3EU9A 3LEWA 3ZNGA 3V30A 5EIDA 5AJLA 1FPPA 4DI4A 2F37A 5BV0A 1OWNA 4URKA 1NFIE 1ZBPA 3CHQA 5FWQA 1XGWA 3W9FA 2HO1A 2FO1E 3MCXA 3Q73A 5CERB 4G26A 4Q96A 2C0LA 4HRNA 4I43A 3PH0C 1PC2A 3U4TA 2V5FA 3Q78A 4K0RA 3LVQE 1UJJA 2XEVA 4GYOA 3FTVA 4GTQA 4B8CB 4HORA 3LY8A 5EILA 3IV0A 3R7QA 1N4PA 3DWLG 5BT1A 3ISMC 2CG2A 5FINA 1H2VC 4I6GA 3PEVB 1OCRE 4EBAA 3TWUA 1BD8A 3KSQA 5EX0A 1H2UA 2GRNB 3BUAA 4GZ3A 3R9AB 4NRHB 1OWLA 3KSLA 3RK6A 3T9KA 1DC2A 3D9IA 2I2OA 3SD5A 5A7DB 3DSWA 2R5SA 3T5VA 3AS5A 2UWJG 4FLBA 2LSVA 4O60A 3ASOE 1RW2A 1AWCB 2X38A 5FZSA 4CRWA 1TNUA 4RLYA 1E8YA 5ANLA 4XX5A 3CHOA 3L9TA 4XE0A 1N94A 4GZDA 4DX2A 4JXTA 2H6FA 1MX2A 2VGEA 1SZ9A 3I3NA 5HKPA 3AU5A 4XI0A 4APOA 4IN3B 5BUZA 3S7BA 3DSSA 2YHCA 2ZU6B 5KNGA 4GTPA 1SA5A 2LXLA 3FUIA 1DVPA 4AV7A 1K1AA 1MYOA 5CEAA 2IONA 3UM0A 4L2YA 2OOEA 5ARFA 3UINC 3FUEA 4ILHB 3CGHA 5G05C 3HG0D 5EN5D 1S70B 3RSEG 4CCAA 5ENRD 2AJAA 5DBKA 4CGWA 2YNQA 3TWSA 2H6HA 4AJWA 1FCHA 2J07A 4P29A 4C48B 3UI2A 4U04A 3IHVA 3Q7FA 3FUFA 4HFGA 2WVIA 1OCZE 1G3NB 4GPMA 4FULA 2WXIA 4I6EA 1N11A 4KT6B 3ZRHA 2ZXWE 2PM7A 5D0OD 5CCMA 1EPUA 4YDOA 4EBAG 4J8FA 3TGOA 1U3CA 4EHMA 1U2VG 4AM9A 1EDUA 3ASNE 4U63A 4GCOA 1ELWA 4O1OA 4J8YA 2J49A 3HXCA 1JUQA 2RKKA 2WQ7A 3OTNA 5E76A 1ZU2A 3KS2A 3VTXA 4I1MA 4BT8A 4G23A 3E34A 3L16A 4FJZA 1UN8A 4WWNA 1EF1C 2IU1A 2KCLA 3JYSA 4MS6A 5AYWD 4B89A 2A5UA 2EILE 4D10C 3UQ3A 3PZ3A 3UKRG 4JD2G 2XHEA 3HXEA 3RKVA 4TUUA 5FQ4A 5J08A 4L2LA 3QJZA 4DX1A 1LTXA 1H2TC 2J9QA 3AAAC 2QY7A 4CGVA 4ABNA 5E75A 5EKQD 1U3DA 2Q7FA 4BWRA 5G04C 3ZU7B 4UI9J 3U3WA 5CRVA 1NL4A 4A3VA 2Y1LE 2EIKE 3FH5A 2KC7A 4GA1A 5AQBA 5JMND 4F6RD 5BNWA 3WXXA 3B7RL 4ME2A 5FZRA 3PE3A 1LF8A 5HI7A 4H7YA 4U7EB 4BETA 3R7RA 2R02A 4PS8A 1HE8A 2XS8A 5LCWC 2ETAA 2IOLA 1IQRA 4XI9A 3NBNB 2AXUA 5CCLA 4DX7D 4BTAA 2Y4TA 3LXUX 2L0TB 3DPDA 1P5QA 1FVFA 2KZTB 4AIFA 2V0PA 5AQ9A 4HI9A 1TJFA 4NIKA 2MRIA 1YA0A 1SQMA 3CK8A 1GW6A 4I2WA 4JEUA 4MBGA 3ZYQA 2XZDG 4PS3A 3HIZA 4HNAD 3DSVA 3L13A 3FHEA 4FP7A 4B0ZA 1D8EA 3S7JA 3APDA 3S7FA 3ZKJA 2F8XK 1TNYA 4BSZB 2KBXA 3ZVVA 5DIZA 4BX8A 2L6JA 5ITZF 4M7CA 4O1PA 3ABKE 3IBEA 3ZHEB 1MX4A 3MV3B 3SGHA 3FU6A 4BERA 1X81A 2P9SG 2GRQB 1H0AA 4U07A 5AAOA 4J8EA 3N71A 4G8KA 1HX8A 3I4RB 3VTYA 3SO8A 1JWFA 4Q94A 2GRLA 4OYSA 3CVLA 5M72A 2IO2C 2F0YA 4GMRA 3CVVA 3FTZA 4AY6A 2FULA 2RFMA 2YQ8A 4LNUD 5KCMA 2WPVA 5BW8C 1WY6A 1HF8A 3HYMB 2VTBB 4K5CA 3ZW3A 4TXQA 1SA4A 2J08A 2LAIA 2X6JA 3CK9A 2UY1A 2ETBA 2E2EA 4KBQA 4MRUA 2VGYA 2NSZA 5AQ7A 3AS8A 3Q47B 3D9LA 3HRAA 4N3AA 1BPOA 2IO3C 4HOSA 3UT4A 3RU0A 2WXLA 1NI1A 4HS2A 2P9IG 3GZSA 5KNHD 4WWOA 4G2VA 4JW1A 4MKTA 4RG6A 3AS4A 4BEPA 5KBAA 4B8AA 1LD7A 1MX6A 1WG0A 4PDXA 2VSXE 2Y0BG 1OT8A 2XENA 2R59A 3MKQB 3SI5A 4UWGA 3UT7A 4GZ6A 1ZB1A 4N3BA 3V79K 4OAUC 4E6HA 3UMVA 4EQFA 3LS8A 3CHMA 3MX3A 2ONDA 2X6KA 2L6BA 4Z68A 4WNGA 4LEUA 4JHKA 4JC8A 4R7LA 4M3OA 3PNTB 2KCKA 3Q9NC 2XPIA 1OXJA 3E30A 3Q49B 4CEMA 1MZCA 3CHPA 2FEZA 1A17A 2XGOA 3Q4AB 2KZTA 4YDYA 3C5RA 3PUJA 3QARA 5G55A 2DYRE 3CVYA 1JCRA 4FLHA 3AG3E 3TG5A 3UPVA 5BPPA 4YDEA 4JPSA 2FI7A 5B1AE 3FTYA 4J6IA 3L82A 4YNDA 3VLEA 3FDHA 2PZIA 1FVHA 3U66A 5KWDA 3ZHEA 3HXDA 3JXIA 1FT2A 5EYLA 5AQAA 2H6IA 3IHYA 2ZGDA 1AP7A 2WXMA 2AWIA 3FH7A 1X5BA 3EUVA 1QBQA 3DPYA 2C2LA 3FUKA 5HS0A 3QWWA 4UWHA 5B3SE 4AXHA 4GTMA 3KAEA 4HOTA 2VTBA 3CK7A 4V3IA 4HVBA 3UM3A 3PZ1A 3SF4A 3OXLA 4L9PA 3TWTA 4GPKA 2LSUA 3SFZA 3HXBA 3RRMB 3BEEA 4YVOA 3ULEG 4HI8A 3EHQA 4QFVA 3TWXA 5CMWA 4N5QA 4WUYA 5T4YA 2GW1A 2CG3A 5ENQD 2WXFA 3IKOB 3U64A 3UTMA 3DSTA 4RQIA 3FUJA 1N4RA 2VJ8A 5ENPD 2RD0A 2AVPA 1SZAA 2XZTG 3FY4A 4IULA 3CVNA 4J8DA 2XS1A 5J90A 2B6CA 5CHEE 3CHRA 3MKQA 3ZUVB 2XRYA 5EIBE 3D9KA 4UQZA 1V55E 3PUKA 2OV8A 1UOHA 3ZGQA 4TRQA 3ZFWA 4U95D 4U8YD 1N9AA 4WWPA 4L23A 3NZUA 1E96B 3UIOC 4U8VD 5ENSD 4U0SA 2GRPB 3OAWA 2HM8A 2R2LA 1TEZA 4GB9A 1HFAA 3NOGD 3MJWA 5ENNA 3E32A
chains in the Genus database with same CATH topology
1KZPA 3DSXA 3DSUA 2H6GA 1TN6A 1O1SA 3E37A 3PZ1A 3E30A 3KSQA 4L9PA 3Q7FA 1MZCA 3Q79A 4GTSA 1TN8A 3KSLA 1TNOA 3HXBA 1JCQA 1SA4A 3DRAA 4YDOA 1S64A 3DSWA 1LD8A 1O1RA 3E33A 4EHMA 4GTRA 1JCRA 4GTOA 1N4QA 1S63A 3PZ2A 1TN7A 3EU5A 3DSTA 1O5MA 1TNUA 4YDEA 4MBGA 1FPPA 3HXCA 1N4RA 1D8DA 1NI1A 1TNZA 3DSVA 4LNBA 4LNGA 1D8EA 2ZIRA 1N94A 3E34A 1N4SA 3Q73A 2H6FA 1JCSA 1TNYA 3HXDA 1FT2A 1LD7A 4GTVA 2H6IA 3DSSA 3PZ3A 3Q78A 4GTPA 1FT1A 1SA5A 3EUVA 1N9AA 1N95A 3HXEA 3PZ4A 4GTQA 1KZOA 1X81A 1QBQA 3HXFA 3Q7AA 3C72A 3DPYA 2F0YA 4GTTA 3Q75A 1LTXA 2BEDA 3SFYA 1O1TA 2R2LA 2IEJA 1N4PA 2H6HA 3E32A 3SFXA 1TNBA 1DCEA 4GTMA 1NL4A 2ZISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZP A;  3DSX A;  3DSU A;  2H6G A;  1TN6 A;  1O1S A;  3E37 A;  3PZ1 A;  3E30 A;  3KSQ A;  4L9P A;  3Q7F A;  1MZC A;  3Q79 A;  4GTS A;  1TN8 A;  3KSL A;  1TNO A;  3HXB A;  1JCQ A;  1SA4 A;  3DRA A;  4YDO A;  1S64 A;  3DSW A;  1LD8 A;  1O1R A;  3E33 A;  4EHM A;  4GTR A;  1JCR A;  4GTO A;  1N4Q A;  1S63 A;  3PZ2 A;  1TN7 A;  3EU5 A;  3DST A;  1O5M A;  1TNU A;  4YDE A;  4MBG A;  1FPP A;  3HXC A;  1N4R A;  1D8D A;  1NI1 A;  1TNZ A;  3DSV A;  4LNB A;  4LNG A;  1D8E A;  2ZIR A;  1N94 A;  3E34 A;  1N4S A;  3Q73 A;  2H6F A;  1JCS A;  1TNY A;  3HXD A;  1FT2 A;  1LD7 A;  4GTV A;  2H6I A;  3DSS A;  3PZ3 A;  3Q78 A;  4GTP A;  1FT1 A;  1SA5 A;  3EUV A;  1N9A A;  1N95 A;  3HXE A;  3PZ4 A;  4GTQ A;  1KZO A;  1X81 A;  1QBQ A;  3HXF A;  3Q7A A;  3C72 A;  3DPY A;  2F0Y A;  4GTT A;  3Q75 A;  1LTX A;  2BED A;  3SFY A;  1O1T A;  2R2L A;  2IEJ A;  1N4P A;  2H6H A;  3E32 A;  3SFX A;  1TNB A;  1DCE A;  4GTM A;  1NL4 A;  2ZIS A; 
#chains in the Genus database with same CATH topology
 5CEC B;  2LUH A;  3TXN A;  5JHA A;  3J5Q B;  2VQ2 A;  2P9L G;  5KJN A;  4K5A B;  2MYO A;  2YHE A;  4G8L A;  2CFZ A;  1N54 A;  3RJV A;  3TXM A;  4F7A A;  2R03 A;  2DZO A;  1WAO 1;  3OXG A;  2V4H C;  3VLD A;  3FUN A;  4GYW A;  4HRM B;  4CDN A;  3CVW A;  5AN8 A;  3APC A;  3ONK A;  3NQP A;  3SNX A;  3UM1 A;  3QC1 A;  3IEG A;  4LSZ E;  3EJN A;  4DI3 A;  3CVX A;  1OCC E;  4G25 A;  3MYV A;  3L22 A;  4EZL A;  2PQR A;  4U0Z A;  2V4L A;  3FU3 A;  5EDS A;  1FT1 A;  1N0Q A;  3GZ1 A;  2WM9 A;  2IOS A;  4IRU A;  4N39 A;  4UI9 C;  4APF A;  5CRU A;  1TNB A;  5FIO A;  3SBS A;  3EDT B;  3ASG A;  3FU5 A;  5AIJ A;  1O1S A;  3CST A;  2M63 A;  3TG4 A;  4A55 A;  1BU9 A;  4I6J A;  4FJY A;  5T3R A;  1TNO A;  1JCQ A;  4O6F A;  5BV1 A;  3D9H A;  3ZEF A;  1S64 A;  1UJK A;  4XEI G;  3DEO A;  4LER A;  1OWP A;  3B7T A;  3SY2 A;  1PAQ A;  3LPZ A;  4GTR A;  2KXP C;  2VYI A;  4GTO A;  4PUC A;  1TN7 A;  3G2T A;  5FQ7 A;  1TNZ A;  4PS7 A;  1YMP A;  3FUL A;  4GMJ A;  4C0M A;  3CEQ A;  3LKU A;  4G11 A;  4Y6W A;  4FHJ A;  3LYA A;  2HR2 A;  5LX8 A;  1E7V A;  2X6I A;  1E90 A;  4N5C A;  2EIN E;  3LJ3 A;  3AJI A;  3LCA A;  3HXF A;  3C72 A;  4ACL A;  3RAU A;  3W9G A;  2JEK A;  3CVU A;  2X6F A;  4G24 A;  4AY5 A;  3SFX A;  4IYP A;  4GZC A;  1N52 A;  3X2Q E;  1KLX A;  3BG1 B;  2MOW A;  2HE0 A;  2P9K G;  3EIJ A;  2GRR B;  3ULQ A;  4JZY A;  3B7S A;  3DRA A;  4N2Q A;  1HZ4 A;  4U0U A;  3TWQ A;  1O1R A;  2XPZ A;  5LOZ A;  5CBN A;  3LY7 A;  2LXM A;  3DEP A;  4ACK A;  1BI8 B;  4B93 B;  3EU5 A;  4JA9 A;  2NYJ A;  1QQE A;  3PRE A;  4GAA A;  4ILG A;  2P9P G;  2DBA A;  2RFA A;  2QFC A;  4H7X A;  3LDZ A;  3R9M A;  4KXK B;  3ML9 A;  2EQX A;  4I17 A;  2OEW A;  1WDY A;  3QKY A;  2WXJ A;  3K9I A;  3FTW A;  1E8Z A;  4AOF A;  2B0O E;  4DLQ A;  4WND A;  3ZXS A;  5H7P A;  3UT8 A;  1OCO E;  2PNN A;  4C9B B;  3V2X A;  5C2Y A;  3D9M A;  3GW4 A;  3ABL E;  4XIF A;  4F1S A;  4BTB A;  3MA5 A;  4YVQ C;  3QWP A;  2BED A;  2NC9 A;  3CQG B;  3APF A;  4QQI A;  2IEJ A;  4GCN A;  4NQ0 A;  3UM2 A;  3CVP A;  2ZIS A;  1KZP A;  1SW6 A;  2H6G A;  1HXI A;  5C1D A;  1MQS A;  3L08 A;  3C3O A;  4OVU A;  5ARG A;  1K8K G;  4FA6 A;  5JHB A;  1DNP A;  1Z6T A;  3ZYK A;  3TWW A;  2WXG A;  4AP2 A;  3D3M A;  3DXM G;  1WM5 A;  2X3M A;  4CYM D;  1QNF A;  1LD8 A;  2E0I A;  2FF4 A;  3PE4 A;  3UX4 A;  3J5P A;  3NAW A;  1K1B A;  3O4Z A;  3JQ1 A;  4UUC A;  2IQC A;  4UQX A;  1TJC A;  1TYQ G;  3ESK A;  4TV3 A;  4N3C A;  1W3B A;  5LP0 A;  2KCV A;  3QB2 A;  3SZ7 A;  3AU4 A;  2GGF A;  4ANW A;  3CV0 A;  3ENE A;  2X6H A;  1H19 A;  4JA7 A;  3L54 A;  2ETC A;  5CMY A;  4BFR A;  4C0E A;  2BKK B;  5B1B E;  4HLE A;  5FJY A;  3UIP C;  4NUR A;  4EZJ A;  3S7D A;  2F8Y A;  2Y69 E;  3FUH A;  1HO8 A;  3FEX A;  3RIB A;  4ATG A;  1E8W A;  2WB2 A;  3D9J A;  3PRZ A;  1N95 A;  3PZ4 A;  3CKB A;  1JPL A;  3E4B A;  2PQN A;  3Q7A A;  3RRU A;  2ZGG A;  3TJP A;  4E85 A;  1RZ4 A;  4K03 A;  4ANV A;  4UWK A;  2IFU A;  2KM4 A;  1O1T A;  4DK5 A;  1OUV A;  1IHG A;  5HQ8 A;  5IY5 E;  2QYU A;  3TL5 A;  2R05 A;  3DSX A;  1NZN A;  4JVS A;  2J8S D;  4EPZ A;  3FFL A;  4A1S A;  4UWF A;  1DCQ A;  3PNL B;  5AJD A;  4DPR A;  3HDX A;  2DIW A;  3ULY A;  2KAT A;  4CDR A;  2WMO A;  4I1O B;  4DRX E;  1BI7 B;  4CDM A;  3VLF A;  4XZ4 A;  4FHK A;  2VSO E;  4ZHB A;  4U8H A;  1N4Q A;  2LAH A;  1NP7 A;  3NF1 A;  2BUG A;  4KZ0 A;  2WXP A;  2AW6 A;  2BTD A;  2CFU A;  3D9O A;  4BSX A;  5AAR A;  2EIJ E;  2XGS A;  1V54 E;  3FP3 A;  1JCS A;  4KVM A;  3EHR A;  2BF0 X;  4HQD A;  4BY6 A;  2PM6 A;  4WNE A;  1NA3 A;  3L6A A;  2C0M A;  1Z5S C;  2ILR A;  2PL2 A;  4BX9 A;  3JQ0 A;  3ZXP A;  1L5J A;  4F3V A;  2CHW A;  1Z3X A;  3TAX A;  4J0U A;  4FU3 A;  3CKC A;  1OWO A;  2XCC A;  5FQ6 A;  4ILI A;  1TN6 A;  4I1A A;  3D9N A;  3L17 A;  3B7B A;  5EX3 A;  1UW4 B;  3ZYL A;  4HOU A;  4Q69 A;  4X8Q A;  2NXP A;  3LVR E;  2WXK A;  3ASF A;  3NB2 A;  2JAB A;  1SVX A;  3DXK G;  3QDN A;  1E7U A;  4N2S A;  1HS6 A;  1IXV A;  2P9U G;  4CT4 A;  2P9N G;  1OWM A;  2WXO A;  4DX5 D;  5FTP A;  5JJ7 A;  1HU3 A;  3MV2 B;  4GZ5 A;  3C98 A;  3SQV A;  4A1G A;  1E8X A;  3ZIM A;  4GYY A;  2J4D A;  3SBT B;  1D8D A;  3ZN3 A;  1OY3 D;  4AEZ C;  1N0R A;  4JL0 A;  4EZK A;  3JXJ A;  4JEH A;  4FAD A;  3RRN B;  4KYO B;  1PY1 A;  3U9W A;  3PEU B;  5KJM A;  3ASH A;  3F6Q A;  4WNF A;  3FEY A;  1Y8M A;  1KPS B;  2FBN A;  4FC8 A;  3B7U X;  1UN9 A;  1KZO A;  1TR4 A;  5FZQ A;  3P1U A;  1KT1 A;  5D2M C;  2QZA A;  3C3Q A;  4I2Z A;  2V8S E;  2VSN A;  2XPY A;  4U96 D;  3C3R A;  2LNI A;  5G05 J;  3B13 A;  3G2U A;  3NOC D;  3AG2 E;  2DCP A;  1DCE A;  3B95 A;  3Q15 A;  4NAC A;  3LJN A;  3CSF A;  4WAF A;  2RG8 A;  3E37 A;  2UY1 B;  1D9S A;  3SHF A;  4LUN U;  1A5E A;  5JJT A;  3Q79 A;  3ZPJ A;  3LY9 A;  5CBO A;  3PVL A;  4HBD A;  2BKG A;  4TXR A;  2J4B A;  4HXI A;  2P2C P;  3GYZ A;  2WQH A;  2XEH A;  1NA0 A;  4F53 A;  3E33 A;  3BG0 B;  4HLL A;  3QAQ A;  2WMN A;  2OEV A;  3Q9U C;  4G1T A;  2I6H A;  2QYJ A;  2I1K A;  4PH4 B;  2I9C A;  4AVX A;  4HOQ A;  2QC9 A;  5D66 A;  3OXF A;  4LNB A;  3O48 A;  2IY0 C;  3ML8 A;  3PDN A;  3V31 A;  3JUI A;  1INZ A;  4K5B A;  2OVB A;  3KD7 A;  4KVO A;  3RO3 A;  1ELK A;  3HHM A;  3CHS A;  4GTV A;  5A6C A;  3G2S A;  5FQ8 A;  1KT0 A;  5JJ6 A;  4DUI A;  4DLO A;  3EHM A;  4RG9 A;  1UG3 A;  3T8M A;  2A4Z A;  2MHK A;  2EIM E;  2AXV A;  4ANX A;  3S2A A;  4JB8 P;  3FTS A;  3AG1 E;  2HYZ A;  4XKB A;  1K3Z D;  5G04 J;  3FWV A;  4LG6 A;  5HRY A;  1QZ2 A;  1YCS B;  3DSU A;  2OVF A;  3FH8 A;  3HVE B;  4ANU A;  2CHX A;  2VGX B;  4UI9 K;  3ONL A;  4TXP A;  2GRM A;  2Y4U A;  3WG7 E;  1IQU A;  4TUM A;  3CIA A;  5LCW J;  2JLB A;  2DYS E;  4BT9 A;  3MEK A;  4XKC A;  4YDW A;  4I9E A;  3DBS A;  3PS6 A;  4GA0 A;  5BXU A;  4OAV B;  1O5M A;  3GZ2 A;  3QWV A;  2WXH A;  1ELR A;  3EIQ C;  4ATZ D;  2FO7 A;  3MGB A;  3ASD A;  3MKR A;  1XNF A;  3FUM A;  1H6P A;  4LNG A;  4GML A;  5T8I A;  2ZIR A;  2Y3A A;  2P58 C;  1N4S A;  3D9P A;  3FTX A;  4L1B A;  4A3T A;  4DX6 D;  3BU8 A;  4CT0 A;  3ZYM A;  2L0I A;  1JWG A;  4L7T A;  3CR3 A;  1HG2 A;  3MZL B;  3G2V A;  3URZ A;  2WXN A;  2A5E A;  2LO6 A;  4CZ2 D;  5KJL A;  3Q75 A;  1IYG A;  2L9B A;  3CLJ A;  3PZD A;  2DWZ A;  2I1J A;  4HRL A;  4BES A;  4RVB A;  3NZS A;  4MLP A;  4KMO A;  5FT9 A;  3CVQ A;  3FTU A;  3UXG A;  2R17 C;  1TN8 A;  4DJA A;  3JUE A;  2OCC E;  2XQ0 A;  1IKN D;  4J8S A;  5JA4 D;  3PZ2 A;  4LRZ A;  5EYP F;  4GA2 A;  4EEC A;  3Q5M A;  2IJG X;  2XGM A;  3TWR A;  4F1P A;  4OVV A;  1IHB A;  4B94 A;  3RO2 A;  4ZFH A;  2XRZ A;  2GRO B;  1B89 A;  1Q2Z A;  2WXR A;  5KJK A;  2J09 A;  2XEE A;  3T8K A;  3T5X A;  1Z3Y A;  3QNK A;  4UQY A;  5D0Q D;  5G2N A;  2WXQ A;  2DZN A;  1S0P A;  1MHQ A;  4W9R A;  1H6K A;  5A23 A;  3CQC B;  4UWL A;  5AEN A;  2V5Q C;  4HB5 A;  5CED B;  1Y6I A;  4LCT A;  1HH8 A;  1QYM A;  4GTT A;  3KEZ A;  4JHJ A;  3SFY A;  2CHZ A;  4RSY A;  4JHR A;  5ENT D;  3EHN A;  3HVE A;  1EYH A;  3IXE A;  2VGX A;  5LFA A;  3BQO A;  3QOU A;  2DVW A;  4I9C A;  1HG5 A;  3ABM E;  3ESL A;  5BXO A;  1YYH A;  2XCB A;  5ANR A;  3I5P A;  2WQ6 A;  4GTS A;  4J7W A;  3G2W A;  3V2O A;  3FUD A;  2AXZ A;  3P2B A;  3KEA A;  3QK0 A;  3UKU G;  4A63 B;  3UUX A;  3TWV A;  4KZC A;  3FU0 A;  2VSY A;  3JCK C;  1H6O A;  3AG4 E;  4Y6C A;  1MJ0 A;  2YIN A;  5ENO D;  1S63 A;  3I4G A;  1BLX B;  1VDY A;  4GU5 A;  2IF4 A;  3EU9 A;  3LEW A;  3ZNG A;  3V30 A;  5EID A;  5AJL A;  1FPP A;  4DI4 A;  2F37 A;  5BV0 A;  1OWN A;  4URK A;  1NFI E;  1ZBP A;  3CHQ A;  5FWQ A;  1XGW A;  3W9F A;  2HO1 A;  2FO1 E;  3MCX A;  3Q73 A;  5CER B;  4G26 A;  4Q96 A;  2C0L A;  4HRN A;  4I43 A;  3PH0 C;  1PC2 A;  3U4T A;  2V5F A;  3Q78 A;  4K0R A;  3LVQ E;  1UJJ A;  2XEV A;  4GYO A;  3FTV A;  4GTQ A;  4B8C B;  4HOR A;  3LY8 A;  5EIL A;  3IV0 A;  3R7Q A;  1N4P A;  3DWL G;  5BT1 A;  3ISM C;  2CG2 A;  5FIN A;  1H2V C;  4I6G A;  3PEV B;  1OCR E;  4EBA A;  3TWU A;  1BD8 A;  3KSQ A;  5EX0 A;  1H2U A;  2GRN B;  3BUA A;  4GZ3 A;  3R9A B;  4NRH B;  1OWL A;  3KSL A;  3RK6 A;  3T9K A;  1DC2 A;  3D9I A;  2I2O A;  3SD5 A;  5A7D B;  3DSW A;  2R5S A;  3T5V A;  3AS5 A;  2UWJ G;  4FLB A;  2LSV A;  4O60 A;  3ASO E;  1RW2 A;  1AWC B;  2X38 A;  5FZS A;  4CRW A;  1TNU A;  4RLY A;  1E8Y A;  5ANL A;  4XX5 A;  3CHO A;  3L9T A;  4XE0 A;  1N94 A;  4GZD A;  4DX2 A;  4JXT A;  2H6F A;  1MX2 A;  2VGE A;  1SZ9 A;  3I3N A;  5HKP A;  3AU5 A;  4XI0 A;  4APO A;  4IN3 B;  5BUZ A;  3S7B A;  3DSS A;  2YHC A;  2ZU6 B;  5KNG A;  4GTP A;  1SA5 A;  2LXL A;  3FUI A;  1DVP A;  4AV7 A;  1K1A A;  1MYO A;  5CEA A;  2ION A;  3UM0 A;  4L2Y A;  2OOE A;  5ARF A;  3UIN C;  3FUE A;  4ILH B;  3CGH A;  5G05 C;  3HG0 D;  5EN5 D;  1S70 B;  3RSE G;  4CCA A;  5ENR D;  2AJA A;  5DBK A;  4CGW A;  2YNQ A;  3TWS A;  2H6H A;  4AJW A;  1FCH A;  2J07 A;  4P29 A;  4C48 B;  3UI2 A;  4U04 A;  3IHV A;  3Q7F A;  3FUF A;  4HFG A;  2WVI A;  1OCZ E;  1G3N B;  4GPM A;  4FUL A;  2WXI A;  4I6E A;  1N11 A;  4KT6 B;  3ZRH A;  2ZXW E;  2PM7 A;  5D0O D;  5CCM A;  1EPU A;  4YDO A;  4EBA G;  4J8F A;  3TGO A;  1U3C A;  4EHM A;  1U2V G;  4AM9 A;  1EDU A;  3ASN E;  4U63 A;  4GCO A;  1ELW A;  4O1O A;  4J8Y A;  2J49 A;  3HXC A;  1JUQ A;  2RKK A;  2WQ7 A;  3OTN A;  5E76 A;  1ZU2 A;  3KS2 A;  3VTX A;  4I1M A;  4BT8 A;  4G23 A;  3E34 A;  3L16 A;  4FJZ A;  1UN8 A;  4WWN A;  1EF1 C;  2IU1 A;  2KCL A;  3JYS A;  4MS6 A;  5AYW D;  4B89 A;  2A5U A;  2EIL E;  4D10 C;  3UQ3 A;  3PZ3 A;  3UKR G;  4JD2 G;  2XHE A;  3HXE A;  3RKV A;  4TUU A;  5FQ4 A;  5J08 A;  4L2L A;  3QJZ A;  4DX1 A;  1LTX A;  1H2T C;  2J9Q A;  3AAA C;  2QY7 A;  4CGV A;  4ABN A;  5E75 A;  5EKQ D;  1U3D A;  2Q7F A;  4BWR A;  5G04 C;  3ZU7 B;  4UI9 J;  3U3W A;  5CRV A;  1NL4 A;  4A3V A;  2Y1L E;  2EIK E;  3FH5 A;  2KC7 A;  4GA1 A;  5AQB A;  5JMN D;  4F6R D;  5BNW A;  3WXX A;  3B7R L;  4ME2 A;  5FZR A;  3PE3 A;  1LF8 A;  5HI7 A;  4H7Y A;  4U7E B;  4BET A;  3R7R A;  2R02 A;  4PS8 A;  1HE8 A;  2XS8 A;  5LCW C;  2ETA A;  2IOL A;  1IQR A;  4XI9 A;  3NBN B;  2AXU A;  5CCL A;  4DX7 D;  4BTA A;  2Y4T A;  3LXU X;  2L0T B;  3DPD A;  1P5Q A;  1FVF A;  2KZT B;  4AIF A;  2V0P A;  5AQ9 A;  4HI9 A;  1TJF A;  4NIK A;  2MRI A;  1YA0 A;  1SQM A;  3CK8 A;  1GW6 A;  4I2W A;  4JEU A;  4MBG A;  3ZYQ A;  2XZD G;  4PS3 A;  3HIZ A;  4HNA D;  3DSV A;  3L13 A;  3FHE A;  4FP7 A;  4B0Z A;  1D8E A;  3S7J A;  3APD A;  3S7F A;  3ZKJ A;  2F8X K;  1TNY A;  4BSZ B;  2KBX A;  3ZVV A;  5DIZ A;  4BX8 A;  2L6J A;  5ITZ F;  4M7C A;  4O1P A;  3ABK E;  3IBE A;  3ZHE B;  1MX4 A;  3MV3 B;  3SGH A;  3FU6 A;  4BER A;  1X81 A;  2P9S G;  2GRQ B;  1H0A A;  4U07 A;  5AAO A;  4J8E A;  3N71 A;  4G8K A;  1HX8 A;  3I4R B;  3VTY A;  3SO8 A;  1JWF A;  4Q94 A;  2GRL A;  4OYS A;  3CVL A;  5M72 A;  2IO2 C;  2F0Y A;  4GMR A;  3CVV A;  3FTZ A;  4AY6 A;  2FUL A;  2RFM A;  2YQ8 A;  4LNU D;  5KCM A;  2WPV A;  5BW8 C;  1WY6 A;  1HF8 A;  3HYM B;  2VTB B;  4K5C A;  3ZW3 A;  4TXQ A;  1SA4 A;  2J08 A;  2LAI A;  2X6J A;  3CK9 A;  2UY1 A;  2ETB A;  2E2E A;  4KBQ A;  4MRU A;  2VGY A;  2NSZ A;  5AQ7 A;  3AS8 A;  3Q47 B;  3D9L A;  3HRA A;  4N3A A;  1BPO A;  2IO3 C;  4HOS A;  3UT4 A;  3RU0 A;  2WXL A;  1NI1 A;  4HS2 A;  2P9I G;  3GZS A;  5KNH D;  4WWO A;  4G2V A;  4JW1 A;  4MKT A;  4RG6 A;  3AS4 A;  4BEP A;  5KBA A;  4B8A A;  1LD7 A;  1MX6 A;  1WG0 A;  4PDX A;  2VSX E;  2Y0B G;  1OT8 A;  2XEN A;  2R59 A;  3MKQ B;  3SI5 A;  4UWG A;  3UT7 A;  4GZ6 A;  1ZB1 A;  4N3B A;  3V79 K;  4OAU C;  4E6H A;  3UMV A;  4EQF A;  3LS8 A;  3CHM A;  3MX3 A;  2OND A;  2X6K A;  2L6B A;  4Z68 A;  4WNG A;  4LEU A;  4JHK A;  4JC8 A;  4R7L A;  4M3O A;  3PNT B;  2KCK A;  3Q9N C;  2XPI A;  1OXJ A;  3E30 A;  3Q49 B;  4CEM A;  1MZC A;  3CHP A;  2FEZ A;  1A17 A;  2XGO A;  3Q4A B;  2KZT A;  4YDY A;  3C5R A;  3PUJ A;  3QAR A;  5G55 A;  2DYR E;  3CVY A;  1JCR A;  4FLH A;  3AG3 E;  3TG5 A;  3UPV A;  5BPP A;  4YDE A;  4JPS A;  2FI7 A;  5B1A E;  3FTY A;  4J6I A;  3L82 A;  4YND A;  3VLE A;  3FDH A;  2PZI A;  1FVH A;  3U66 A;  5KWD A;  3ZHE A;  3HXD A;  3JXI A;  1FT2 A;  5EYL A;  5AQA A;  2H6I A;  3IHY A;  2ZGD A;  1AP7 A;  2WXM A;  2AWI A;  3FH7 A;  1X5B A;  3EUV A;  1QBQ A;  3DPY A;  2C2L A;  3FUK A;  5HS0 A;  3QWW A;  4UWH A;  5B3S E;  4AXH A;  4GTM A;  3KAE A;  4HOT A;  2VTB A;  3CK7 A;  4V3I A;  4HVB A;  3UM3 A;  3PZ1 A;  3SF4 A;  3OXL A;  4L9P A;  3TWT A;  4GPK A;  2LSU A;  3SFZ A;  3HXB A;  3RRM B;  3BEE A;  4YVO A;  3ULE G;  4HI8 A;  3EHQ A;  4QFV A;  3TWX A;  5CMW A;  4N5Q A;  4WUY A;  5T4Y A;  2GW1 A;  2CG3 A;  5ENQ D;  2WXF A;  3IKO B;  3U64 A;  3UTM A;  3DST A;  4RQI A;  3FUJ A;  1N4R A;  2VJ8 A;  5ENP D;  2RD0 A;  2AVP A;  1SZA A;  2XZT G;  3FY4 A;  4IUL A;  3CVN A;  4J8D A;  2XS1 A;  5J90 A;  2B6C A;  5CHE E;  3CHR A;  3MKQ A;  3ZUV B;  2XRY A;  5EIB E;  3D9K A;  4UQZ A;  1V55 E;  3PUK A;  2OV8 A;  1UOH A;  3ZGQ A;  4TRQ A;  3ZFW A;  4U95 D;  4U8Y D;  1N9A A;  4WWP A;  4L23 A;  3NZU A;  1E96 B;  3UIO C;  4U8V D;  5ENS D;  4U0S A;  2GRP B;  3OAW A;  2HM8 A;  2R2L A;  1TEZ A;  4GB9 A;  1HFA A;  3NOG D;  3MJW A;  5ENN A;  3E32 A; 
#chains in the Genus database with same CATH homology
 1KZP A;  3DSX A;  3DSU A;  2H6G A;  1TN6 A;  1O1S A;  3E37 A;  3PZ1 A;  3E30 A;  3KSQ A;  4L9P A;  3Q7F A;  1MZC A;  3Q79 A;  4GTS A;  1TN8 A;  3KSL A;  1TNO A;  3HXB A;  1JCQ A;  1SA4 A;  3DRA A;  4YDO A;  1S64 A;  3DSW A;  1LD8 A;  1O1R A;  3E33 A;  4EHM A;  4GTR A;  1JCR A;  4GTO A;  1N4Q A;  1S63 A;  3PZ2 A;  1TN7 A;  3EU5 A;  3DST A;  1O5M A;  1TNU A;  4YDE A;  4MBG A;  1FPP A;  3HXC A;  1N4R A;  1D8D A;  1NI1 A;  1TNZ A;  3DSV A;  4LNB A;  4LNG A;  1D8E A;  2ZIR A;  1N94 A;  3E34 A;  1N4S A;  3Q73 A;  2H6F A;  1JCS A;  1TNY A;  3HXD A;  1FT2 A;  1LD7 A;  4GTV A;  2H6I A;  3DSS A;  3PZ3 A;  3Q78 A;  4GTP A;  1FT1 A;  1SA5 A;  3EUV A;  1N9A A;  1N95 A;  3HXE A;  3PZ4 A;  4GTQ A;  1KZO A;  1X81 A;  1QBQ A;  3HXF A;  3Q7A A;  3C72 A;  3DPY A;  2F0Y A;  4GTT A;  3Q75 A;  1LTX A;  2BED A;  3SFY A;  1O1T A;  2R2L A;  2IEJ A;  1N4P A;  2H6H A;  3E32 A;  3SFX A;  1TNB A;  1DCE A;  4GTM A;  1NL4 A;  2ZIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...