3KSQA

Discovery of c-imidazole azaheptapyridine fpt inhibitors
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of C-imidazole azaheptapyridine FPT inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Farnesyltransferase, CAAX box, alpha
total genus 126
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3ksqA00
1KZPA 3E33A 1O1TA 3PZ2A 1SA4A 1S64A 1N4QA 3DPYA 3Q79A 3PZ3A 2H6GA 1S63A 4GTVA 4GTPA 4YDOA 2ZISA 3E32A 4EHMA 4GTOA 3HXBA 1N9AA 1TN7A 3PZ4A 1LD7A 3HXFA 4LNGA 3E37A 2IEJA 1N4PA 4GTMA 3KSQA 3HXDA 1TNUA 1N94A 1JCQA 1LD8A 1TN6A 3SFXA 4L9PA 3C72A 1JCSA 1D8DA 1TN8A 2H6HA 3EU5A 1LTXA 3Q7FA 2H6IA 3DSUA 2F0YA 1KZOA 2H6FA 1N4RA 3PZ1A 1N4SA 3DSSA 1SA5A 3DRAA 1FT1A 4GTTA 2BEDA 1TNZA 4GTQA 3Q7AA 1MZCA 3DSTA 4LNBA 3E30A 1FPPA 3Q73A 1X81A 1TNYA 3DSXA 3Q75A 1FT2A 1JCRA 1D8EA 1O5MA 3HXCA 1QBQA 1TNOA 4GTSA 3DSVA 3E34A 3EUVA 3SFYA 3Q78A 2R2LA 1TNBA 2ZIRA 4MBGA 4YDEA 3HXEA 1O1RA 1N95A 1O1SA 3DSWA 1NL4A 1NI1A 1DCEA 3KSLA 4GTRA
chains in the Genus database with same CATH superfamily
5EDSA 3CVLA 1S64A 2H6GA 3UTMA 2LAIA 4GTVA 4WUYA 4NRHB 5CMWA 3HVEA 5ANLA 5ITZF 3SHFA 2C0MA 3OXGA 2IQCA 2LSVA 4AM9A 4BSZB 4PH4B 3UM2A 1BPOA 2DWZA 4HLLA 3QJZA 4AY5A 3NZSA 1JWFA 3C72A 5BPPA 1HXIA 2VSOE 3BQOA 3EHNA 1KLXA 2E0IA 3NOGD 3D9LA 1WY6A 1MYOA 2J8SD 1Z5SC 2P9SG 1B89A 2IOSA 2DZNA 3TXMA 5ENTD 4GCOA 4OAVB 3UQ3A 2XCBA 3K9IA 2BEDA 1TNZA 5FQ7A 3LYAA 4RG9A 3FEXA 2WXRA 1E8ZA 1UJJA 4KYOB 2XENA 3HIZA 4EPZA 4AIFA 5C2YA 2DBAA 4EBAA 3MKQA 3JCKC 3EHRA 2JLBA 1KT1A 2AW6A 4MBGA 4QQIA 4C9BB 3DSWA 2VYIA 2DIWA 3MJWA 4E85A 1KZPA 3QNKA 2XRZA 4HRLA 3AG4E 2AXVA 2X6FA 4EECA 2ZXWE 2R03A 3L17A 5ENNA 3CVQA 4U8YD 4HQDA 1E90A 4LNGA 1HE8A 2VQ2A 4U96D 1N94A 2FF4A 1LD8A 5ANRA 4A3VA 3HDXA 5AENA 3LPZA 3C3RA 4BESA 3PZDA 3PEUB 4GMRA 3E4BA 3CK9A 3JQ0A 4N5QA 4GTTA 2V0PA 4HNAD 1MZCA 3AS8A 3DSTA 2VGXA 2IU1A 1U3DA 4Y6CA 2P9IG 2XQ0A 5BW8C 1TNYA 5A6CA 5A7DB 3Q75A 2VGEA 5EN5D 3AS5A 3ASOE 2YNQA 1TNBA 3MYVA 1H2UA 5AIJA 3T8KA 3CHRA 2LNIA 3HXEA 2A4ZA 4ATGA 4UQYA 1OWOA 1MX2A 3E33A 2NYJA 2MOWA 2I9CA 4K5BA 4Q94A 3IEGA 4JD2G 2OCCE 3LJNA 5G2NA 4LCTA 3FUFA 3QC1A 4M7CA 3B7UX 3QARA 4G11A 5FZQA 5M72A 3LY9A 4A63B 4CRWA 3FUMA 1LD7A 4KZCA 4YDYA 3I3NA 4BTBA 4X8QA 4J8FA 3D9IA 1TNUA 1JPLA 3CVXA 2IFUA 5EX3A 2ZGGA 3MA5A 3CHMA 2DZOA 3IBEA 5CERB 2CFZA 4ANWA 5FQ4A 2I1KA 3GZ2A 4XIFA 1N4SA 4IYPA 4H7XA 5AN8A 1E7VA 3N71A 2YINA 3B95A 2WXJA 2EIKE 1TJCA 3CQCB 4A55A 5D66A 4WWOA 2CHXA 5G05C 5HI7A 2NSZA 4AJWA 1JUQA 3EUVA 1OXJA 2IJGX 3ZHEA 2Y1LE 2ETCA 1N0QA 1OCCE 2DYSE 4I17A 1NA0A 4JHKA 1E8YA 2JABA 2XEVA 3R7QA 3LVRE 1SVXA 5CBNA 4ACKA 1OWNA 5BV0A 3ONKA 2WQ6A 3U3WA 2XEHA 2MYOA 5T3RA 3E37A 3ML9A 4FHJA 2XCCA 3URZA 4RLYA 4EZKA 1UN8A 2P9LG 4DK5A 1HU3A 3GZSA 4BT9A 3CVNA 1TN8A 2CHWA 2H6HA 3D9JA 2EQXA 1G3NB 3MX3A 4F53A 4BX9A 2F0YA 4FADA 2EIME 3PVLA 1Y8MA 2WXKA 4JHJA 4ACLA 3L22A 5G05J 3FU0A 2I6HA 2EIJE 3T5VA 5G04C 4LG6A 2BKGA 4J0UA 3TXNA 4F6RD 3CEQA 3EHQA 4HS2A 2OOEA 4P29A 3Q4AB 3ZKJA 5D0OD 3CGHA 5AAOA 4I43A 1JCRA 3SGHA 1SZAA 3FFLA 4GTSA 3E34A 2HE0A 4D10C 3NB2A 4I2ZA 4YDEA 4AY6A 2FO1E 4BT8A 1MX4A 3NF1A 3FWVA 2DYRE 3TL5A 4GCNA 3L16A 3J5PA 3SO8A 2WXNA 1LF8A 4Y6WA 4O60A 1OT8A 4GMLA 2KATA 2AJAA 3FH5A 4HI9A 1QQEA 2GROB 2V5QC 2XPYA 3QK0A 4LUNU 3VLEA 4BWRA 1ZBPA 4B8CB 5IY5E 3D9MA 3HXDA 2WXIA 4F7AA 3HYMB 1JWGA 1TN6A 1YCSB 5CEDB 2WXOA 1PAQA 4DRXE 5FTPA 4N2SA 1NA3A 4CEMA 4CGVA 5B1BE 4JW1A 4JZYA 4L2LA 2AXZA 3OAWA 4MRUA 2FI7A 4U7EB 1TEZA 3S7BA 2ILRA 1E7UA 3Q9UC 1OWLA 3RU0A 4GTQA 1EF1C 3UUXA 2BKKB 4J6IA 1FPPA 2LUHA 3W9GA 2A5EA 2V5FA 3FU3A 1MQSA 4PS8A 5CBOA 3ZUVB 3GW4A 2CHZA 5ENQD 4B0ZA 4N2QA 3AAAC 1ELWA 2R2LA 1HFAA 3NZUA 4XI9A 4HOUA 4YNDA 1U3CA 3KSLA 3Q79A 4B94A 3SBTB 3ISMC 3UXGA 3ASNE 4ANUA 4GTPA 3B7RL 4GTOA 5EKQD 2EINE 3HXBA 4KBQA 4R7LA 3X2QE 3F6QA 1Z3YA 5T4YA 5EYLA 4WNGA 2GRMA 1K8KG 5CEAA 4PDXA 4UWKA 4CDNA 2P9PG 2VSYA 2J08A 3SFXA 3B7TA 3PRZA 3ZXSA 1V55E 3ASDA 4U0UA 1XGWA 3LCAA 4ME2A 3UT7A 4GA1A 2WMOA 2V4HC 2R02A 3APFA 2YHCA 3ZIMA 3D3MA 3DSUA 5LCWJ 4JA7A 3FUJA 2XZDG 3ZU7B 1BI8B 3UPVA 4G2VA 4ABNA 1TYQG 1KPSB 5LFAA 1UW4B 3G2UA 1E8XA 1NZNA 3CLJA 3ULQA 3RO3A 1YYHA 3JUEA 4E6HA 3LJ3A 4BTAA 5KJLA 3R9MA 4B93B 3SFZA 5FJYA 2KZTB 3ZYMA 1H2VC 4U8HA 2RKKA 5AJDA 2ZIRA 3UM3A 1OWMA 5J90A 3VLDA 4NACA 2X6HA 1NL4A 5JMND 2OEVA 1RZ4A 3JXJA 4UI9K 3FUEA 1S63A 4B8AA 3OXFA 3TWRA 3TGOA 3W9FA 1GW6A 3PDNA 3C5RA 2X38A 4U8VD 4EBAG 4GZ5A 2UY1A 4G24A 3RAUA 2OEWA 3NAWA 4H7YA 4K5AB 2HR2A 3KSQA 3ONLA 4GPKA 3EJNA 4NIKA 4J8EA 4G23A 2VTBA 4XKBA 1DVPA 4L9PA 3HHMA 3CVPA 4JA9A 4G8KA 4XZ4A 3PUKA 2P9UG 4V3IA 3SI5A 1D9SA 2XGMA 4GYYA 2H6IA 3U66A 2HO1A 4N3CA 3QWPA 2FEZA 4FC8A 4I2WA 3RKVA 3EHMA 2F8YA 4CT0A 5CRVA 3FULA 4JHRA 2RFMA 4WNEA 4YVOA 1BI7B 3LVQE 4NQ0A 1QBQA 5JHAA 3FUKA 1HS6A 3NOCD 4U04A 3AG1E 3AS4A 1NP7A 2J09A 5AQAA 1N4QA 3L08A 4GYOA 1H2TC 1TJFA 1HF8A 2X3MA 3G2VA 2PL2A 4DX2A 2VGYA 2M63A 2VJ8A 2PNNA 2QYJA 2HYZA 4WWPA 3QKYA 5LX8A 2Y4UA 3FTVA 2IEJA 4HOQA 4GAAA 1OCOE 4GB9A 4FJYA 1JCQA 2C2LA 4ZFHA 5BUZA 4U0ZA 3TWXA 2YHEA 4FULA 4HRMB 4HOSA 1K1BA 1LTXA 4KVMA 4KT6B 3V2OA 4U0SA 4AEZC 4U95D 1AWCB 4ILIA 1N4RA 4I6GA 3NQPA 3HVEB 5CECB 3DSSA 3BG0B 3GZ1A 3ZPJA 3B7SA 5T8IA 2LXLA 3T9KA 3QB2A 4CGWA 4AXHA 2QY7A 3E30A 1FVHA 5H7PA 2WXHA 3O48A 1OY3D 5ENOD 1FT2A 3ZGQA 4JVSA 1HG5A 3PUJA 3LKUA 1ELKA 4N3AA 4L23A 5FQ6A 2XRYA 3Q78A 1Z3XA 2P58C 1HG2A 3FDHA 5HKPA 2VSXE 1WG0A 1DCEA 1IKND 3RSEG 3FUIA 1WAO1 4QFVA 3CVUA 2V8SE 4GA0A 3C3QA 3FTZA 4YDOA 1OCRE 4EHMA 2WXPA 3FHEA 5ENSD 2GW1A 3FU5A 3CKCA 4APOA 2QFCA 3GYZA 5BT1A 2CG3A 3ABLE 2RD0A 3I5PA 3MKQB 4GTMA 4N3BA 3T5XA 3EIJA 2RG8A 1N11A 3NBNB 5FIOA 1S0PA 3CIAA 4GA2A 1JCSA 5FQ8A 2R05A 2LXMA 3EU5A 4I1OB 3U4TA 4DX7D 3FH7A 5G55A 2WMNA 3U64A 1FVFA 2J9QA 4LERA 4ANXA 2H6FA 3CQGB 2XPZA 4UI9C 4UWLA 3P2BA 3CSTA 3B7BA 4BFRA 4DI4A 3D9NA 4XKCA 2PQRA 1HO8A 5CCMA 2R17C 3RO2A 4F1PA 4A3TA 4JEUA 1RW2A 3Q73A 3CVVA 1EYHA 3J5QB 5JHBA 1EDUA 2GRRB 3FY4A 3ZXPA 2PQNA 3FH8A 1AP7A 2QC9A 1OCZE 3JUIA 4G25A 4DLOA 3WG7E 2J49A 4O1OA 1N0RA 2XZTG 4GTRA 3UT8A 2Y3AA 3ULEG 2RFAA 3DPYA 3PZ3A 5A23A 4KXKB 1YMPA 2KM4A 5JA4D 1NFIE 4I6JA 1QZ2A 3TWWA 1Y6IA 3G2TA 3RRMB 4L1BA 3SY2A 1SW6A 3CK8A 4PS3A 1IXVA 2XHEA 2WVIA 4RG6A 3MEKA 3DBSA 3HXFA 4TXRA 4J8DA 3MV3B 4O1PA 4TRQA 3BG1B 2NC9A 3RIBA 3VTXA 4GYWA 2P9KG 1X5BA 2AWIA 2GRPB 4MKTA 3S7FA 4GMJA 5D0QD 2KCLA 2KBXA 2Q7FA 3EU9A 1HZ4A 4DX1A 1SZ9A 4UUCA 2GRLA 4FA6A 1SA5A 4CDRA 4C0MA 2F37A 3DEPA 3QAQA 3RRUA 4KMOA 2PM6A 3QWVA 4URKA 3SD5A 3CHPA 4LEUA 3DXKG 3UINC 1IHGA 3EDTB 3IHYA 2WXQA 3V79K 3TJPA 5KJNA 4Q96A 3SQVA 3U9WA 5CRUA 1O1RA 3R9AB 1NI1A 2EILE 1P5QA 4UWGA 2XS1A 5JJ7A 3RRNB 3FUDA 4HRNA 2KCKA 4ILGA 4CCAA 2ONDA 2OVBA 3G2WA 4K5CA 2WM9A 3CHOA 2KXPC 3E32A 4XEIG 1U2VG 2ETBA 3FP3A 2WQ7A 4XX5A 3MGBA 2BF0X 3SBSA 4I1MA 5BXUA 3D9PA 3UKRG 3Q5MA 3FTXA 4TV3A 5KWDA 3PH0C 5FZRA 1E8WA 1YA0A 2GGFA 3PE3A 3ESLA 5FT9A 1HX8A 2I1JA 4O6FA 4ILHB 3MZLB 3APCA 1DNPA 2XGSA 4L7TA 3TWSA 2WB2A 5LOZA 4UWHA 4BX8A 2FULA 3V30A 3G2SA 3JXIA 1V54E 2IF4A 2B0OE 5KCMA 1MJ0A 3PS6A 2FBNA 4ATZD 5C1DA 3UM0A 1IQRA 4FJZA 1D8EA 2HM8A 4G8LA 4N5CA 3UI2A 4GZDA 4I1AA 4JPSA 1N95A 2XEEA 4EZLA 4IULA 1S70B 5G04J 3UX4A 3PNTB 1N54A 4BETA 2QYUA 4YVQC 4CZ2D 3MKRA 3ASFA 2I2OA 4M3OA 1A17A 3KEZA 3Q9NC 3IXEA 2UY1B 3UIOC 3V31A 1N9AA 3ZFWA 3QDNA 3ZW3A 2AVPA 3CHSA 4TXPA 4DPRA 3UMVA 4F1SA 2IOLA 1N4PA 3L9TA 5EYPF 5CMYA 2VTBB 2V4LA 1H0AA 4WNFA 2L6BA 2PM7A 4HBDA 3BU8A 3B13A 2E2EA 5J08A 1ELRA 5B1AE 3BEEA 3LY8A 3Q7FA 2LSUA 5KJMA 3PZ1A 3ZHEB 4XE0A 3ESKA 1UOHA 5FWQA 1IHBA 3AJIA 4B89A 2A5UA 3TG4A 2ETAA 5KBAA 4CYMD 4CDMA 4APFA 4WAFA 2CFUA 4LNBA 3JQ1A 2XS8A 2QZAA 5AQ7A 4U63A 3ULYA 4BY6A 2WXGA 3ZYLA 4BEPA 5AQBA 4JB8P 4K03A 4HOTA 3IHVA 3QWWA 3SFYA 1IQUA 2L9BA 1EPUA 3IV0A 2P9NG 1UN9A 1O1SA 3CR3A 3S7JA 5KJKA 3L13A 5ENPD 2IO3C 1DCQA 2YQ8A 4G26A 3CKBA 2XPIA 5JJ6A 5DIZA 2L0IA 2DCPA 3HRAA 3RK6A 4HFGA 4OYSA 2ZGDA 3FTSA 2L0TB 3Q47B 4EZJA 3PZ4A 5AYWD 1W3BA 2UWJG 1XNFA 2MHKA 2GRQB 1UJKA 4KZ0A 5BNWA 4HVBA 4DI3A 3JYSA 2Y0BG 4DUIA 3UT4A 3SZ7A 5KNGA 3VLFA 3CK7A 3ZNGA 4JEHA 4FLHA 1MHQA 3CHQA 4LRZA 2WXMA 1FCHA 3DRAA 4GZCA 3TWTA 1FT1A 3RJVA 5BXOA 1OWPA 4A1GA 4OVUA 3DPDA 3TG5A 4AVXA 4TXQA 2VGXB 4FU3A 1X81A 4KVOA 3C98A 3SNXA 3Q15A 5AQ9A 1TNOA 2X6JA 3DSVA 3P1UA 3V2XA 4IRUA 2FO7A 1BD8A 5E76A 3CVYA 2X6IA 2R59A 3L82A 3D9HA 3O4ZA 1O1TA 2WXLA 3TWUA 5JJTA 5BV1A 1OUVA 3MV2B 5HS0A 3CSFA 3AU4A 1TN7A 4HXIA 2WPVA 4U07A 1PC2A 3CVWA 3T8MA 2L6JA 1H6KA 4Z68A 3ABKE 1HH8A 3TAXA 3OTNA 3C3OA 3ENEA 5KNHD 4F3VA 2KCVA 5ARFA 4HORA 3ZRHA 5HQ8A 3R7RA 3DXMG 4RSYA 5E75A 3ZYKA 3ASGA 3ZEFA 2MRIA 4JC8A 4AV7A 4GU5A 1ZU2A 3ZYQA 1K1AA 4TUUA 2NXPA 3MCXA 3Q49B 4J8SA 3LXUX 3ZN3A 2P2CP 3I4GA 4YDWA 3FTWA 3LY7A 4LNUD 1KT0A 3KD7A 2BUGA 3VTYA 5B3SE 2IONA 5CCLA 2BTDA 3CV0A 4DLQA 2DVWA 3D9OA 4PUCA 3L6AA 4L2YA 1L5JA 4FLBA 4NURA 4J8YA 5HRYA 4JL0A 3PZ2A 1SA4A 5DBKA 4XI0A 4ANVA 2R5SA 3FTUA 3AG3E 4PS7A 1H6PA 1WM5A 1SQMA 1E96B 4K0RA 1QNFA 4W9RA 4FHKA 4IN3B 5CHEE 2WXFA 3FUNA 5FZSA 3PNLB 4ZHBA 4AP2A 3DEOA 3KEAA 4DX5D 3I4RB 3QOUA 4GZ6A 2OV8A 2ZU6B 5LCWC 5AARA 3LDZA 4GZ3A 4Q69A 4C0EA 2B6CA 4AOFA 4HI8A 3KS2A 2KZTA 4I9CA 3D9KA 1TR4A 2PZIA 3LEWA 5FINA 4DX6D 1ZB1A 5LP0A 5EIDA 1WDYA 3FUHA 4FP7A 5D2MC 4WWNA 3OXLA 3PE4A 3Q7AA 4GPMA 2JEKA 3LS8A 5AJLA 1QYMA 2C0LA 3DSXA 4UQXA 1DC2A 1O5MA 3FEYA 3HXCA 3UKUG 5EX0A 2IY0C 1UG3A 1IYGA 2J4DA 1A5EA 4J7WA 3WXXA 4OAUC 1Z6TA 3ZVVA 3IKOB 2Y69E 3S2AA 1Q2ZA 4WNDA 2XGOA 1N52A 1H19A 4MS6A 4CT4A 4HLEA 4MLPA 2ZISA 4C48B 2F8XK 2X6KA 3S7DA 2GRNB 4N39A 3UIPC 3FU6A 3DWLG 4RVBA 4A1SA 1H6OA 2LO6A 4UWFA 3APDA 2OVFA 3TWQA 3L54A 2VSNA 1D8DA 4JXTA 1VDYA 1PY1A 4BERA 1KZOA 4DJAA 3EIQC 2J4BA 2J07A 4I6EA 4BSXA 3KAEA 4UQZA 4HB5A 1INZA 4RQIA 3AG2E 1MX6A 3ABME 2WQHA 4EQFA 2Y4TA 2KC7A 3FTYA 3AU5A 5ARGA 1BLXB 3HG0D 3PEVB 3ML8A 5EIBE 4LSZE 3BUAA 3PREA 2CG2A 4UI9J 3TWVA 5ENRD 5EILA 4OVVA 2IO2C 4G1TA 3ASHA 4I9EA 2LAHA 4TUMA 3UM1A 1BU9A 2AXUA 3SF4A 1K3ZD
chains in the Genus database with same CATH topology
1KZPA 3E33A 1O1TA 3PZ2A 1SA4A 1S64A 1N4QA 3DPYA 3Q79A 3PZ3A 2H6GA 1S63A 4GTVA 4GTPA 4YDOA 2ZISA 3E32A 4EHMA 4GTOA 3HXBA 1N9AA 1TN7A 3PZ4A 1LD7A 3HXFA 4LNGA 3E37A 2IEJA 1N4PA 4GTMA 3KSQA 3HXDA 1TNUA 1N94A 1JCQA 1LD8A 1TN6A 3SFXA 4L9PA 3C72A 1JCSA 1D8DA 1TN8A 2H6HA 3EU5A 1LTXA 3Q7FA 2H6IA 3DSUA 2F0YA 1KZOA 2H6FA 1N4RA 3PZ1A 1N4SA 3DSSA 1SA5A 3DRAA 1FT1A 4GTTA 2BEDA 1TNZA 4GTQA 3Q7AA 1MZCA 3DSTA 4LNBA 3E30A 1FPPA 3Q73A 1X81A 1TNYA 3DSXA 3Q75A 1FT2A 1JCRA 1D8EA 1O5MA 3HXCA 1QBQA 1TNOA 4GTSA 3DSVA 3E34A 3EUVA 3SFYA 3Q78A 2R2LA 1TNBA 2ZIRA 4MBGA 4YDEA 3HXEA 1O1RA 1N95A 1O1SA 3DSWA 1NL4A 1NI1A 1DCEA 3KSLA 4GTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZP A;  3E33 A;  1O1T A;  3PZ2 A;  1SA4 A;  1S64 A;  1N4Q A;  3DPY A;  3Q79 A;  3PZ3 A;  2H6G A;  1S63 A;  4GTV A;  4GTP A;  4YDO A;  2ZIS A;  3E32 A;  4EHM A;  4GTO A;  3HXB A;  1N9A A;  1TN7 A;  3PZ4 A;  1LD7 A;  3HXF A;  4LNG A;  3E37 A;  2IEJ A;  1N4P A;  4GTM A;  3KSQ A;  3HXD A;  1TNU A;  1N94 A;  1JCQ A;  1LD8 A;  1TN6 A;  3SFX A;  4L9P A;  3C72 A;  1JCS A;  1D8D A;  1TN8 A;  2H6H A;  3EU5 A;  1LTX A;  3Q7F A;  2H6I A;  3DSU A;  2F0Y A;  1KZO A;  2H6F A;  1N4R A;  3PZ1 A;  1N4S A;  3DSS A;  1SA5 A;  3DRA A;  1FT1 A;  4GTT A;  2BED A;  1TNZ A;  4GTQ A;  3Q7A A;  1MZC A;  3DST A;  4LNB A;  3E30 A;  1FPP A;  3Q73 A;  1X81 A;  1TNY A;  3DSX A;  3Q75 A;  1FT2 A;  1JCR A;  1D8E A;  1O5M A;  3HXC A;  1QBQ A;  1TNO A;  4GTS A;  3DSV A;  3E34 A;  3EUV A;  3SFY A;  3Q78 A;  2R2L A;  1TNB A;  2ZIR A;  4MBG A;  4YDE A;  3HXE A;  1O1R A;  1N95 A;  1O1S A;  3DSW A;  1NL4 A;  1NI1 A;  1DCE A;  3KSL A;  4GTR A; 
#chains in the Genus database with same CATH topology
 5EDS A;  3CVL A;  1S64 A;  2H6G A;  3UTM A;  2LAI A;  4GTV A;  4WUY A;  4NRH B;  5CMW A;  3HVE A;  5ANL A;  5ITZ F;  3SHF A;  2C0M A;  3OXG A;  2IQC A;  2LSV A;  4AM9 A;  4BSZ B;  4PH4 B;  3UM2 A;  1BPO A;  2DWZ A;  4HLL A;  3QJZ A;  4AY5 A;  3NZS A;  1JWF A;  3C72 A;  5BPP A;  1HXI A;  2VSO E;  3BQO A;  3EHN A;  1KLX A;  2E0I A;  3NOG D;  3D9L A;  1WY6 A;  1MYO A;  2J8S D;  1Z5S C;  2P9S G;  1B89 A;  2IOS A;  2DZN A;  3TXM A;  5ENT D;  4GCO A;  4OAV B;  3UQ3 A;  2XCB A;  3K9I A;  2BED A;  1TNZ A;  5FQ7 A;  3LYA A;  4RG9 A;  3FEX A;  2WXR A;  1E8Z A;  1UJJ A;  4KYO B;  2XEN A;  3HIZ A;  4EPZ A;  4AIF A;  5C2Y A;  2DBA A;  4EBA A;  3MKQ A;  3JCK C;  3EHR A;  2JLB A;  1KT1 A;  2AW6 A;  4MBG A;  4QQI A;  4C9B B;  3DSW A;  2VYI A;  2DIW A;  3MJW A;  4E85 A;  1KZP A;  3QNK A;  2XRZ A;  4HRL A;  3AG4 E;  2AXV A;  2X6F A;  4EEC A;  2ZXW E;  2R03 A;  3L17 A;  5ENN A;  3CVQ A;  4U8Y D;  4HQD A;  1E90 A;  4LNG A;  1HE8 A;  2VQ2 A;  4U96 D;  1N94 A;  2FF4 A;  1LD8 A;  5ANR A;  4A3V A;  3HDX A;  5AEN A;  3LPZ A;  3C3R A;  4BES A;  3PZD A;  3PEU B;  4GMR A;  3E4B A;  3CK9 A;  3JQ0 A;  4N5Q A;  4GTT A;  2V0P A;  4HNA D;  1MZC A;  3AS8 A;  3DST A;  2VGX A;  2IU1 A;  1U3D A;  4Y6C A;  2P9I G;  2XQ0 A;  5BW8 C;  1TNY A;  5A6C A;  5A7D B;  3Q75 A;  2VGE A;  5EN5 D;  3AS5 A;  3ASO E;  2YNQ A;  1TNB A;  3MYV A;  1H2U A;  5AIJ A;  3T8K A;  3CHR A;  2LNI A;  3HXE A;  2A4Z A;  4ATG A;  4UQY A;  1OWO A;  1MX2 A;  3E33 A;  2NYJ A;  2MOW A;  2I9C A;  4K5B A;  4Q94 A;  3IEG A;  4JD2 G;  2OCC E;  3LJN A;  5G2N A;  4LCT A;  3FUF A;  3QC1 A;  4M7C A;  3B7U X;  3QAR A;  4G11 A;  5FZQ A;  5M72 A;  3LY9 A;  4A63 B;  4CRW A;  3FUM A;  1LD7 A;  4KZC A;  4YDY A;  3I3N A;  4BTB A;  4X8Q A;  4J8F A;  3D9I A;  1TNU A;  1JPL A;  3CVX A;  2IFU A;  5EX3 A;  2ZGG A;  3MA5 A;  3CHM A;  2DZO A;  3IBE A;  5CER B;  2CFZ A;  4ANW A;  5FQ4 A;  2I1K A;  3GZ2 A;  4XIF A;  1N4S A;  4IYP A;  4H7X A;  5AN8 A;  1E7V A;  3N71 A;  2YIN A;  3B95 A;  2WXJ A;  2EIK E;  1TJC A;  3CQC B;  4A55 A;  5D66 A;  4WWO A;  2CHX A;  5G05 C;  5HI7 A;  2NSZ A;  4AJW A;  1JUQ A;  3EUV A;  1OXJ A;  2IJG X;  3ZHE A;  2Y1L E;  2ETC A;  1N0Q A;  1OCC E;  2DYS E;  4I17 A;  1NA0 A;  4JHK A;  1E8Y A;  2JAB A;  2XEV A;  3R7Q A;  3LVR E;  1SVX A;  5CBN A;  4ACK A;  1OWN A;  5BV0 A;  3ONK A;  2WQ6 A;  3U3W A;  2XEH A;  2MYO A;  5T3R A;  3E37 A;  3ML9 A;  4FHJ A;  2XCC A;  3URZ A;  4RLY A;  4EZK A;  1UN8 A;  2P9L G;  4DK5 A;  1HU3 A;  3GZS A;  4BT9 A;  3CVN A;  1TN8 A;  2CHW A;  2H6H A;  3D9J A;  2EQX A;  1G3N B;  3MX3 A;  4F53 A;  4BX9 A;  2F0Y A;  4FAD A;  2EIM E;  3PVL A;  1Y8M A;  2WXK A;  4JHJ A;  4ACL A;  3L22 A;  5G05 J;  3FU0 A;  2I6H A;  2EIJ E;  3T5V A;  5G04 C;  4LG6 A;  2BKG A;  4J0U A;  3TXN A;  4F6R D;  3CEQ A;  3EHQ A;  4HS2 A;  2OOE A;  4P29 A;  3Q4A B;  3ZKJ A;  5D0O D;  3CGH A;  5AAO A;  4I43 A;  1JCR A;  3SGH A;  1SZA A;  3FFL A;  4GTS A;  3E34 A;  2HE0 A;  4D10 C;  3NB2 A;  4I2Z A;  4YDE A;  4AY6 A;  2FO1 E;  4BT8 A;  1MX4 A;  3NF1 A;  3FWV A;  2DYR E;  3TL5 A;  4GCN A;  3L16 A;  3J5P A;  3SO8 A;  2WXN A;  1LF8 A;  4Y6W A;  4O60 A;  1OT8 A;  4GML A;  2KAT A;  2AJA A;  3FH5 A;  4HI9 A;  1QQE A;  2GRO B;  2V5Q C;  2XPY A;  3QK0 A;  4LUN U;  3VLE A;  4BWR A;  1ZBP A;  4B8C B;  5IY5 E;  3D9M A;  3HXD A;  2WXI A;  4F7A A;  3HYM B;  1JWG A;  1TN6 A;  1YCS B;  5CED B;  2WXO A;  1PAQ A;  4DRX E;  5FTP A;  4N2S A;  1NA3 A;  4CEM A;  4CGV A;  5B1B E;  4JW1 A;  4JZY A;  4L2L A;  2AXZ A;  3OAW A;  4MRU A;  2FI7 A;  4U7E B;  1TEZ A;  3S7B A;  2ILR A;  1E7U A;  3Q9U C;  1OWL A;  3RU0 A;  4GTQ A;  1EF1 C;  3UUX A;  2BKK B;  4J6I A;  1FPP A;  2LUH A;  3W9G A;  2A5E A;  2V5F A;  3FU3 A;  1MQS A;  4PS8 A;  5CBO A;  3ZUV B;  3GW4 A;  2CHZ A;  5ENQ D;  4B0Z A;  4N2Q A;  3AAA C;  1ELW A;  2R2L A;  1HFA A;  3NZU A;  4XI9 A;  4HOU A;  4YND A;  1U3C A;  3KSL A;  3Q79 A;  4B94 A;  3SBT B;  3ISM C;  3UXG A;  3ASN E;  4ANU A;  4GTP A;  3B7R L;  4GTO A;  5EKQ D;  2EIN E;  3HXB A;  4KBQ A;  4R7L A;  3X2Q E;  3F6Q A;  1Z3Y A;  5T4Y A;  5EYL A;  4WNG A;  2GRM A;  1K8K G;  5CEA A;  4PDX A;  4UWK A;  4CDN A;  2P9P G;  2VSY A;  2J08 A;  3SFX A;  3B7T A;  3PRZ A;  3ZXS A;  1V55 E;  3ASD A;  4U0U A;  1XGW A;  3LCA A;  4ME2 A;  3UT7 A;  4GA1 A;  2WMO A;  2V4H C;  2R02 A;  3APF A;  2YHC A;  3ZIM A;  3D3M A;  3DSU A;  5LCW J;  4JA7 A;  3FUJ A;  2XZD G;  3ZU7 B;  1BI8 B;  3UPV A;  4G2V A;  4ABN A;  1TYQ G;  1KPS B;  5LFA A;  1UW4 B;  3G2U A;  1E8X A;  1NZN A;  3CLJ A;  3ULQ A;  3RO3 A;  1YYH A;  3JUE A;  4E6H A;  3LJ3 A;  4BTA A;  5KJL A;  3R9M A;  4B93 B;  3SFZ A;  5FJY A;  2KZT B;  3ZYM A;  1H2V C;  4U8H A;  2RKK A;  5AJD A;  2ZIR A;  3UM3 A;  1OWM A;  5J90 A;  3VLD A;  4NAC A;  2X6H A;  1NL4 A;  5JMN D;  2OEV A;  1RZ4 A;  3JXJ A;  4UI9 K;  3FUE A;  1S63 A;  4B8A A;  3OXF A;  3TWR A;  3TGO A;  3W9F A;  1GW6 A;  3PDN A;  3C5R A;  2X38 A;  4U8V D;  4EBA G;  4GZ5 A;  2UY1 A;  4G24 A;  3RAU A;  2OEW A;  3NAW A;  4H7Y A;  4K5A B;  2HR2 A;  3KSQ A;  3ONL A;  4GPK A;  3EJN A;  4NIK A;  4J8E A;  4G23 A;  2VTB A;  4XKB A;  1DVP A;  4L9P A;  3HHM A;  3CVP A;  4JA9 A;  4G8K A;  4XZ4 A;  3PUK A;  2P9U G;  4V3I A;  3SI5 A;  1D9S A;  2XGM A;  4GYY A;  2H6I A;  3U66 A;  2HO1 A;  4N3C A;  3QWP A;  2FEZ A;  4FC8 A;  4I2W A;  3RKV A;  3EHM A;  2F8Y A;  4CT0 A;  5CRV A;  3FUL A;  4JHR A;  2RFM A;  4WNE A;  4YVO A;  1BI7 B;  3LVQ E;  4NQ0 A;  1QBQ A;  5JHA A;  3FUK A;  1HS6 A;  3NOC D;  4U04 A;  3AG1 E;  3AS4 A;  1NP7 A;  2J09 A;  5AQA A;  1N4Q A;  3L08 A;  4GYO A;  1H2T C;  1TJF A;  1HF8 A;  2X3M A;  3G2V A;  2PL2 A;  4DX2 A;  2VGY A;  2M63 A;  2VJ8 A;  2PNN A;  2QYJ A;  2HYZ A;  4WWP A;  3QKY A;  5LX8 A;  2Y4U A;  3FTV A;  2IEJ A;  4HOQ A;  4GAA A;  1OCO E;  4GB9 A;  4FJY A;  1JCQ A;  2C2L A;  4ZFH A;  5BUZ A;  4U0Z A;  3TWX A;  2YHE A;  4FUL A;  4HRM B;  4HOS A;  1K1B A;  1LTX A;  4KVM A;  4KT6 B;  3V2O A;  4U0S A;  4AEZ C;  4U95 D;  1AWC B;  4ILI A;  1N4R A;  4I6G A;  3NQP A;  3HVE B;  5CEC B;  3DSS A;  3BG0 B;  3GZ1 A;  3ZPJ A;  3B7S A;  5T8I A;  2LXL A;  3T9K A;  3QB2 A;  4CGW A;  4AXH A;  2QY7 A;  3E30 A;  1FVH A;  5H7P A;  2WXH A;  3O48 A;  1OY3 D;  5ENO D;  1FT2 A;  3ZGQ A;  4JVS A;  1HG5 A;  3PUJ A;  3LKU A;  1ELK A;  4N3A A;  4L23 A;  5FQ6 A;  2XRY A;  3Q78 A;  1Z3X A;  2P58 C;  1HG2 A;  3FDH A;  5HKP A;  2VSX E;  1WG0 A;  1DCE A;  1IKN D;  3RSE G;  3FUI A;  1WAO 1;  4QFV A;  3CVU A;  2V8S E;  4GA0 A;  3C3Q A;  3FTZ A;  4YDO A;  1OCR E;  4EHM A;  2WXP A;  3FHE A;  5ENS D;  2GW1 A;  3FU5 A;  3CKC A;  4APO A;  2QFC A;  3GYZ A;  5BT1 A;  2CG3 A;  3ABL E;  2RD0 A;  3I5P A;  3MKQ B;  4GTM A;  4N3B A;  3T5X A;  3EIJ A;  2RG8 A;  1N11 A;  3NBN B;  5FIO A;  1S0P A;  3CIA A;  4GA2 A;  1JCS A;  5FQ8 A;  2R05 A;  2LXM A;  3EU5 A;  4I1O B;  3U4T A;  4DX7 D;  3FH7 A;  5G55 A;  2WMN A;  3U64 A;  1FVF A;  2J9Q A;  4LER A;  4ANX A;  2H6F A;  3CQG B;  2XPZ A;  4UI9 C;  4UWL A;  3P2B A;  3CST A;  3B7B A;  4BFR A;  4DI4 A;  3D9N A;  4XKC A;  2PQR A;  1HO8 A;  5CCM A;  2R17 C;  3RO2 A;  4F1P A;  4A3T A;  4JEU A;  1RW2 A;  3Q73 A;  3CVV A;  1EYH A;  3J5Q B;  5JHB A;  1EDU A;  2GRR B;  3FY4 A;  3ZXP A;  2PQN A;  3FH8 A;  1AP7 A;  2QC9 A;  1OCZ E;  3JUI A;  4G25 A;  4DLO A;  3WG7 E;  2J49 A;  4O1O A;  1N0R A;  2XZT G;  4GTR A;  3UT8 A;  2Y3A A;  3ULE G;  2RFA A;  3DPY A;  3PZ3 A;  5A23 A;  4KXK B;  1YMP A;  2KM4 A;  5JA4 D;  1NFI E;  4I6J A;  1QZ2 A;  3TWW A;  1Y6I A;  3G2T A;  3RRM B;  4L1B A;  3SY2 A;  1SW6 A;  3CK8 A;  4PS3 A;  1IXV A;  2XHE A;  2WVI A;  4RG6 A;  3MEK A;  3DBS A;  3HXF A;  4TXR A;  4J8D A;  3MV3 B;  4O1P A;  4TRQ A;  3BG1 B;  2NC9 A;  3RIB A;  3VTX A;  4GYW A;  2P9K G;  1X5B A;  2AWI A;  2GRP B;  4MKT A;  3S7F A;  4GMJ A;  5D0Q D;  2KCL A;  2KBX A;  2Q7F A;  3EU9 A;  1HZ4 A;  4DX1 A;  1SZ9 A;  4UUC A;  2GRL A;  4FA6 A;  1SA5 A;  4CDR A;  4C0M A;  2F37 A;  3DEP A;  3QAQ A;  3RRU A;  4KMO A;  2PM6 A;  3QWV A;  4URK A;  3SD5 A;  3CHP A;  4LEU A;  3DXK G;  3UIN C;  1IHG A;  3EDT B;  3IHY A;  2WXQ A;  3V79 K;  3TJP A;  5KJN A;  4Q96 A;  3SQV A;  3U9W A;  5CRU A;  1O1R A;  3R9A B;  1NI1 A;  2EIL E;  1P5Q A;  4UWG A;  2XS1 A;  5JJ7 A;  3RRN B;  3FUD A;  4HRN A;  2KCK A;  4ILG A;  4CCA A;  2OND A;  2OVB A;  3G2W A;  4K5C A;  2WM9 A;  3CHO A;  2KXP C;  3E32 A;  4XEI G;  1U2V G;  2ETB A;  3FP3 A;  2WQ7 A;  4XX5 A;  3MGB A;  2BF0 X;  3SBS A;  4I1M A;  5BXU A;  3D9P A;  3UKR G;  3Q5M A;  3FTX A;  4TV3 A;  5KWD A;  3PH0 C;  5FZR A;  1E8W A;  1YA0 A;  2GGF A;  3PE3 A;  3ESL A;  5FT9 A;  1HX8 A;  2I1J A;  4O6F A;  4ILH B;  3MZL B;  3APC A;  1DNP A;  2XGS A;  4L7T A;  3TWS A;  2WB2 A;  5LOZ A;  4UWH A;  4BX8 A;  2FUL A;  3V30 A;  3G2S A;  3JXI A;  1V54 E;  2IF4 A;  2B0O E;  5KCM A;  1MJ0 A;  3PS6 A;  2FBN A;  4ATZ D;  5C1D A;  3UM0 A;  1IQR A;  4FJZ A;  1D8E A;  2HM8 A;  4G8L A;  4N5C A;  3UI2 A;  4GZD A;  4I1A A;  4JPS A;  1N95 A;  2XEE A;  4EZL A;  4IUL A;  1S70 B;  5G04 J;  3UX4 A;  3PNT B;  1N54 A;  4BET A;  2QYU A;  4YVQ C;  4CZ2 D;  3MKR A;  3ASF A;  2I2O A;  4M3O A;  1A17 A;  3KEZ A;  3Q9N C;  3IXE A;  2UY1 B;  3UIO C;  3V31 A;  1N9A A;  3ZFW A;  3QDN A;  3ZW3 A;  2AVP A;  3CHS A;  4TXP A;  4DPR A;  3UMV A;  4F1S A;  2IOL A;  1N4P A;  3L9T A;  5EYP F;  5CMY A;  2VTB B;  2V4L A;  1H0A A;  4WNF A;  2L6B A;  2PM7 A;  4HBD A;  3BU8 A;  3B13 A;  2E2E A;  5J08 A;  1ELR A;  5B1A E;  3BEE A;  3LY8 A;  3Q7F A;  2LSU A;  5KJM A;  3PZ1 A;  3ZHE B;  4XE0 A;  3ESK A;  1UOH A;  5FWQ A;  1IHB A;  3AJI A;  4B89 A;  2A5U A;  3TG4 A;  2ETA A;  5KBA A;  4CYM D;  4CDM A;  4APF A;  4WAF A;  2CFU A;  4LNB A;  3JQ1 A;  2XS8 A;  2QZA A;  5AQ7 A;  4U63 A;  3ULY A;  4BY6 A;  2WXG A;  3ZYL A;  4BEP A;  5AQB A;  4JB8 P;  4K03 A;  4HOT A;  3IHV A;  3QWW A;  3SFY A;  1IQU A;  2L9B A;  1EPU A;  3IV0 A;  2P9N G;  1UN9 A;  1O1S A;  3CR3 A;  3S7J A;  5KJK A;  3L13 A;  5ENP D;  2IO3 C;  1DCQ A;  2YQ8 A;  4G26 A;  3CKB A;  2XPI A;  5JJ6 A;  5DIZ A;  2L0I A;  2DCP A;  3HRA A;  3RK6 A;  4HFG A;  4OYS A;  2ZGD A;  3FTS A;  2L0T B;  3Q47 B;  4EZJ A;  3PZ4 A;  5AYW D;  1W3B A;  2UWJ G;  1XNF A;  2MHK A;  2GRQ B;  1UJK A;  4KZ0 A;  5BNW A;  4HVB A;  4DI3 A;  3JYS A;  2Y0B G;  4DUI A;  3UT4 A;  3SZ7 A;  5KNG A;  3VLF A;  3CK7 A;  3ZNG A;  4JEH A;  4FLH A;  1MHQ A;  3CHQ A;  4LRZ A;  2WXM A;  1FCH A;  3DRA A;  4GZC A;  3TWT A;  1FT1 A;  3RJV A;  5BXO A;  1OWP A;  4A1G A;  4OVU A;  3DPD A;  3TG5 A;  4AVX A;  4TXQ A;  2VGX B;  4FU3 A;  1X81 A;  4KVO A;  3C98 A;  3SNX A;  3Q15 A;  5AQ9 A;  1TNO A;  2X6J A;  3DSV A;  3P1U A;  3V2X A;  4IRU A;  2FO7 A;  1BD8 A;  5E76 A;  3CVY A;  2X6I A;  2R59 A;  3L82 A;  3D9H A;  3O4Z A;  1O1T A;  2WXL A;  3TWU A;  5JJT A;  5BV1 A;  1OUV A;  3MV2 B;  5HS0 A;  3CSF A;  3AU4 A;  1TN7 A;  4HXI A;  2WPV A;  4U07 A;  1PC2 A;  3CVW A;  3T8M A;  2L6J A;  1H6K A;  4Z68 A;  3ABK E;  1HH8 A;  3TAX A;  3OTN A;  3C3O A;  3ENE A;  5KNH D;  4F3V A;  2KCV A;  5ARF A;  4HOR A;  3ZRH A;  5HQ8 A;  3R7R A;  3DXM G;  4RSY A;  5E75 A;  3ZYK A;  3ASG A;  3ZEF A;  2MRI A;  4JC8 A;  4AV7 A;  4GU5 A;  1ZU2 A;  3ZYQ A;  1K1A A;  4TUU A;  2NXP A;  3MCX A;  3Q49 B;  4J8S A;  3LXU X;  3ZN3 A;  2P2C P;  3I4G A;  4YDW A;  3FTW A;  3LY7 A;  4LNU D;  1KT0 A;  3KD7 A;  2BUG A;  3VTY A;  5B3S E;  2ION A;  5CCL A;  2BTD A;  3CV0 A;  4DLQ A;  2DVW A;  3D9O A;  4PUC A;  3L6A A;  4L2Y A;  1L5J A;  4FLB A;  4NUR A;  4J8Y A;  5HRY A;  4JL0 A;  3PZ2 A;  1SA4 A;  5DBK A;  4XI0 A;  4ANV A;  2R5S A;  3FTU A;  3AG3 E;  4PS7 A;  1H6P A;  1WM5 A;  1SQM A;  1E96 B;  4K0R A;  1QNF A;  4W9R A;  4FHK A;  4IN3 B;  5CHE E;  2WXF A;  3FUN A;  5FZS A;  3PNL B;  4ZHB A;  4AP2 A;  3DEO A;  3KEA A;  4DX5 D;  3I4R B;  3QOU A;  4GZ6 A;  2OV8 A;  2ZU6 B;  5LCW C;  5AAR A;  3LDZ A;  4GZ3 A;  4Q69 A;  4C0E A;  2B6C A;  4AOF A;  4HI8 A;  3KS2 A;  2KZT A;  4I9C A;  3D9K A;  1TR4 A;  2PZI A;  3LEW A;  5FIN A;  4DX6 D;  1ZB1 A;  5LP0 A;  5EID A;  1WDY A;  3FUH A;  4FP7 A;  5D2M C;  4WWN A;  3OXL A;  3PE4 A;  3Q7A A;  4GPM A;  2JEK A;  3LS8 A;  5AJL A;  1QYM A;  2C0L A;  3DSX A;  4UQX A;  1DC2 A;  1O5M A;  3FEY A;  3HXC A;  3UKU G;  5EX0 A;  2IY0 C;  1UG3 A;  1IYG A;  2J4D A;  1A5E A;  4J7W A;  3WXX A;  4OAU C;  1Z6T A;  3ZVV A;  3IKO B;  2Y69 E;  3S2A A;  1Q2Z A;  4WND A;  2XGO A;  1N52 A;  1H19 A;  4MS6 A;  4CT4 A;  4HLE A;  4MLP A;  2ZIS A;  4C48 B;  2F8X K;  2X6K A;  3S7D A;  2GRN B;  4N39 A;  3UIP C;  3FU6 A;  3DWL G;  4RVB A;  4A1S A;  1H6O A;  2LO6 A;  4UWF A;  3APD A;  2OVF A;  3TWQ A;  3L54 A;  2VSN A;  1D8D A;  4JXT A;  1VDY A;  1PY1 A;  4BER A;  1KZO A;  4DJA A;  3EIQ C;  2J4B A;  2J07 A;  4I6E A;  4BSX A;  3KAE A;  4UQZ A;  4HB5 A;  1INZ A;  4RQI A;  3AG2 E;  1MX6 A;  3ABM E;  2WQH A;  4EQF A;  2Y4T A;  2KC7 A;  3FTY A;  3AU5 A;  5ARG A;  1BLX B;  3HG0 D;  3PEV B;  3ML8 A;  5EIB E;  4LSZ E;  3BUA A;  3PRE A;  2CG2 A;  4UI9 J;  3TWV A;  5ENR D;  5EIL A;  4OVV A;  2IO2 C;  4G1T A;  3ASH A;  4I9E A;  2LAH A;  4TUM A;  3UM1 A;  1BU9 A;  2AXU A;  3SF4 A;  1K3Z D; 
#chains in the Genus database with same CATH homology
 1KZP A;  3E33 A;  1O1T A;  3PZ2 A;  1SA4 A;  1S64 A;  1N4Q A;  3DPY A;  3Q79 A;  3PZ3 A;  2H6G A;  1S63 A;  4GTV A;  4GTP A;  4YDO A;  2ZIS A;  3E32 A;  4EHM A;  4GTO A;  3HXB A;  1N9A A;  1TN7 A;  3PZ4 A;  1LD7 A;  3HXF A;  4LNG A;  3E37 A;  2IEJ A;  1N4P A;  4GTM A;  3KSQ A;  3HXD A;  1TNU A;  1N94 A;  1JCQ A;  1LD8 A;  1TN6 A;  3SFX A;  4L9P A;  3C72 A;  1JCS A;  1D8D A;  1TN8 A;  2H6H A;  3EU5 A;  1LTX A;  3Q7F A;  2H6I A;  3DSU A;  2F0Y A;  1KZO A;  2H6F A;  1N4R A;  3PZ1 A;  1N4S A;  3DSS A;  1SA5 A;  3DRA A;  1FT1 A;  4GTT A;  2BED A;  1TNZ A;  4GTQ A;  3Q7A A;  1MZC A;  3DST A;  4LNB A;  3E30 A;  1FPP A;  3Q73 A;  1X81 A;  1TNY A;  3DSX A;  3Q75 A;  1FT2 A;  1JCR A;  1D8E A;  1O5M A;  3HXC A;  1QBQ A;  1TNO A;  4GTS A;  3DSV A;  3E34 A;  3EUV A;  3SFY A;  3Q78 A;  2R2L A;  1TNB A;  2ZIR A;  4MBG A;  4YDE A;  3HXE A;  1O1R A;  1N95 A;  1O1S A;  3DSW A;  1NL4 A;  1NI1 A;  1DCE A;  3KSL A;  4GTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...