3KSQA

Discovery of c-imidazole azaheptapyridine fpt inhibitors
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyltransferase, CAAX box, alpha
publication title Discovery of C-imidazole azaheptapyridine FPT inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 126
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3ksqA00
3Q75A 1JCRA 1N4PA 3DSWA 1KZPA 1NI1A 1FT2A 3C72A 3Q73A 3EU5A 3HXBA 1O5MA 3PZ4A 4GTOA 1SA4A 1TN6A 1N9AA 1O1TA 1SA5A 4GTSA 1FT1A 1NL4A 3Q78A 3HXEA 3PZ2A 3DPYA 1S64A 2F0YA 3DSUA 3Q79A 1N4QA 2H6GA 4YDOA 3SFXA 3DSXA 2H6HA 2ZISA 1TNZA 3DSSA 4GTRA 3EUVA 1LD7A 3SFYA 1JCQA 4GTPA 1D8EA 2BEDA 4L9PA 2H6IA 3E32A 1N4RA 3E34A 3DRAA 3E33A 3PZ3A 2H6FA 4GTVA 1D8DA 3KSLA 1S63A 4LNBA 1N4SA 3Q7FA 3Q7AA 4EHMA 1X81A 1O1SA 1QBQA 1TNUA 3DSTA 3E37A 1TN7A 3DSVA 1JCSA 1MZCA 2IEJA 4GTQA 1N94A 4GTMA 4YDEA 3HXDA 1DCEA 1FPPA 1TNYA 3KSQA 1TN8A 1TNBA 1LTXA 3E30A 1O1RA 1KZOA 1TNOA 4GTTA 4MBGA 2ZIRA 3PZ1A 1N95A 3HXFA 2R2LA 4LNGA 1LD8A 3HXCA
chains in the Genus database with same CATH superfamily
4JW1A 3MA5A 4HOUA 3SBTB 1WY6A 4C0MA 5CMYA 1H2UA 4FHJA 2RFMA 1NZNA 4RG6A 3ZU7B 2VGYA 1NA0A 3IHYA 5B1BE 3ABLE 2V5QC 2V8SE 2GRMA 1K3ZD 4DK5A 4EBAG 2XPYA 1NFIE 4GTRA 4IYPA 4CGWA 4F53A 2C0MA 3PUKA 2UY1B 2LAHA 5AQ9A 3FUEA 3SZ7A 2Y3AA 3E33A 2ZU6B 2LSVA 2Y4UA 2XGMA 3L17A 4FJZA 4BT8A 3CVUA 2FEZA 1FVHA 2PQRA 3TG5A 1V54E 2IEJA 3EDTB 3MKQB 1TJCA 2XQ0A 4AM9A 1BU9A 4OVUA 1OCCE 2M63A 3VLFA 2KM4A 5FWQA 1Y6IA 3JUIA 3APCA 1N52A 3UIOC 1BLXB 2GGFA 3SD5A 4AOFA 2XENA 3SFZA 4YDYA 4NURA 2VGEA 4ILGA 4R7LA 5EKQD 4FU3A 3DSUA 3B13A 4JEHA 3V30A 1JPLA 5FQ7A 2IF4A 3R7QA 4YVOA 3Q49B 2R03A 3FHEA 4UQYA 2YHCA 3LVQE 4L2YA 1UJJA 3ABKE 3L6AA 4U04A 4Q69A 3PE4A 4JHKA 4KT6B 1IHBA 5E76A 5BV0A 2V4HC 2MOWA 4GZ5A 4U63A 5AARA 1O1SA 4L1BA 4LG6A 3ZGQA 5ITZF 2WQHA 5AQBA 5CCLA 3PDNA 3FU0A 3IXEA 2LUHA 1OXJA 2Y1LE 4G23A 1MYOA 4J8DA 4APFA 5BT1A 4F7AA 5H7PA 4XE0A 2L6BA 4EQFA 3U66A 2JLBA 4ZFHA 4HLLA 1KT1A 4GYOA 3J5QB 2LAIA 3FU3A 4DRXE 3C72A 5T4YA 3QK0A 1QNFA 1FT1A 1KPSB 3U64A 2P2CP 4XKCA 3HXEA 3DPYA 5LX8A 4AJWA 4BTAA 3CQGB 3QC1A 4JEUA 1QYMA 3JUEA 5EN5D 5FZRA 2WXRA 3RIBA 4WNEA 2J08A 3J5PA 4GZ6A 3LS8A 5BPPA 2X6KA 3FUMA 3ULYA 5D2MC 3OAWA 4WNDA 4HOSA 4Q94A 1JWGA 4M7CA 4N5QA 2XPIA 4XIFA 3RRNB 2WXNA 3MYVA 1MX4A 3JXJA 4J8YA 3APDA 2J4DA 2HO1A 3P1UA 3MZLB 2ETBA 4FULA 1OWLA 5AN8A 4A3VA 2DYSE 3HG0D 3CIAA 4CT4A 4FA6A 1XGWA 2IJGX 3MX3A 1UOHA 4QQIA 5HI7A 3ZVVA 5B1AE 2OEVA 2OVFA 4LUNU 3SY2A 2J49A 4FADA 4BX9A 4H7XA 2QZAA 2QY7A 2XEVA 4JPSA 2F37A 4HQDA 3PEVB 2A5UA 3PUJA 4GAAA 4BESA 2P9KG 2MYOA 3APFA 3ZW3A 3HYMB 1YYHA 2RD0A 4FHKA 3AS8A 4UQXA 5AJDA 2NSZA 3ZFWA 4QFVA 4DI3A 4UUCA 3B7RL 3E4BA 3I4GA 1OT8A 3FUHA 3UXGA 3FFLA 1S64A 2AXZA 2Y0BG 2XZTG 1NP7A 2L0IA 5EYPF 4GMLA 4WAFA 1P5QA 4UWKA 3SFYA 3CSFA 4GU5A 4GTPA 1AWCB 3GYZA 2BKGA 3B7SA 4O60A 1N4RA 4TXPA 5FQ8A 2B0OE 2EIKE 4AV7A 4PS8A 4GTVA 4I9CA 3MV2B 3PREA 5ENNA 3QOUA 5JHAA 4U8YD 1N4SA 5FQ4A 5KJNA 3CHQA 4CGVA 2XRZA 4K5CA 2OV8A 1BD8A 3AG4E 3ZYMA 1FVFA 4HVBA 1INZA 3RU0A 3SQVA 4B94A 3CVYA 4J8SA 3E37A 1HZ4A 3VTYA 3W9FA 4DX1A 3PEUB 3SF4A 3TWSA 3LCAA 3CK9A 2CHWA 2XS8A 4B89A 3OXGA 4A3TA 2R02A 4EZKA 1HO8A 4G2VA 4EECA 4I2ZA 2XEHA 1JUQA 4K5AB 4Z68A 3NZSA 4HXIA 2YQ8A 3KAEA 1A17A 3R9MA 2XHEA 4ABNA 3ZNGA 3QNKA 3EU5A 4ZHBA 4NQ0A 2X6IA 4GTSA 3HVEA 4YNDA 3C3RA 4XX5A 4V3IA 5KJKA 4LEUA 3Q79A 2HYZA 2P9IG 4J6IA 1EF1C 4F6RD 2P9PG 3EUVA 3QDNA 3RO2A 5C1DA 4I1AA 2KXPC 1Z6TA 2H6IA 5DIZA 4HRLA 1TR4A 5BUZA 4C0EA 3TXMA 1E7UA 2H6FA 1SW6A 2V0PA 1ZBPA 3ML8A 4CT0A 1HU3A 2WXPA 2KCKA 4P29A 4UWFA 3RRMB 3C3OA 1Y8MA 4HOTA 3R9AB 5ANRA 5AQ7A 3TWVA 5ENOD 3ASOE 1QZ2A 4LCTA 3ESKA 4UI9K 3LY8A 5C2YA 3E30A 1O1RA 3AAAC 2QYUA 5JJ6A 4CDRA 5ENPD 3DPDA 5A7DB 1LD8A 3BQOA 4H7YA 3EHMA 5LCWJ 2WXKA 2BUGA 3IV0A 4E6HA 1Q2ZA 3NOGD 3EHQA 1WG0A 2WXJA 3CK8A 4D10C 2LO6A 4K0RA 1NL4A 2IY0C 2AW6A 2QFCA 3FH7A 4N3BA 2UY1A 1TJFA 5FZQA 3G2SA 4XKBA 3FTSA 3K9IA 3C5RA 4OAUC 1HXIA 4PUCA 3NB2A 2Y69E 2BEDA 2YHEA 2J4BA 3G2UA 3TAXA 4K5BA 1QQEA 2GRLA 3RRUA 2GW1A 3AS5A 2CHZA 1U2VG 3NF1A 1YMPA 3Q9UC 5CHEE 3UT8A 3RJVA 3UT7A 4TRQA 3Q7FA 4JHJA 3MKQA 1E8WA 2VTBB 4I6GA 3I3NA 2KATA 4UWLA 4L7TA 2WMNA 3OXLA 2KCVA 3TG4A 5LCWC 1IQRA 1PY1A 5FTPA 1H6PA 3LY9A 5AQAA 5HS0A 2CG3A 3TWRA 4F3VA 1AP7A 4IRUA 4LNUD 3UKUG 2XCCA 2MRIA 5AJLA 1YCSB 4L23A 5JJTA 4HRNA 4WWPA 4HBDA 3BG0B 4O6FA 3NAWA 2XPZA 4C9BB 5CBOA 1VDYA 3RSEG 1DCQA 1HS6A 3FY4A 5AYWD 4CZ2D 5LFAA 3TGOA 4I2WA 3FDHA 2J07A 2DIWA 2LNIA 3IEGA 2VSOE 2FO7A 3UI2A 3FTVA 4BSZB 1XNFA 5LOZA 3TWUA 1OWPA 3SFXA 3UTMA 2PM6A 4KVOA 4B0ZA 3ASNE 4KZCA 3S7DA 2PL2A 3U9WA 5BV1A 3ZEFA 1GW6A 5JMND 4NRHB 4DX5D 2GRQB 3LPZA 4MLPA 3CVXA 1S63A 5CEDB 2GRRB 3KEAA 3ISMC 4Y6WA 4DX2A 3ZUVB 2FI7A 4UWHA 4JL0A 1UN8A 2DWZA 2HR2A 3D9PA 2HE0A 3NOCD 1MZCA 5CCMA 3T8MA 4GTQA 4HB5A 4YDEA 1DCEA 3LVRE 1TNYA 4A63B 1PAQA 4FC8A 5EYLA 3ZHEA 3PZ1A 4U8HA 3UM0A 4A1GA 2WXLA 3CVQA 3CV0A 2ETCA 3FEXA 4GTOA 2XGOA 1SVXA 4I6JA 3S7FA 1OWMA 2V5FA 3ZYLA 2F0YA 3JQ0A 2VGXA 4YVQC 3RK6A 1L5JA 4G24A 4U0ZA 2CHXA 4DJAA 3L13A 4AY5A 2KCLA 3ZHEB 3V79K 3IHVA 1MX2A 4J7WA 3CVWA 5FJYA 1ELKA 4TV3A 4GZ3A 3CHMA 3SNXA 3ZKJA 4AY6A 2F8YA 2QC9A 3MJWA 4ANVA 1OCRE 4BTBA 5D0OD 5J90A 5T3RA 3CHRA 2VGXB 3LY7A 3DEPA 2HM8A 4GMJA 3L9TA 4HNAD 5KBAA 5ENTD 4TXRA 3ASHA 2E2EA 4GPKA 2KZTB 1FPPA 3FTXA 3ASDA 1LTXA 4HS2A 5CERB 2AVPA 4GTTA 5KJMA 2X6HA 3JYSA 2RG8A 2P58C 3AJIA 4W9RA 2WXGA 4KVMA 2XEEA 1O5MA 5E75A 3PZ4A 3IKOB 4RSYA 3G2TA 1O1TA 1E8YA 2PQNA 4AEZC 2P9LG 3ZXSA 3C3QA 3CVNA 3TJPA 5G04J 2XS1A 3N71A 3DBSA 4HOQA 2IO3C 4HRMB 3I5PA 1JCQA 1OY3D 4G25A 3LKUA 4N3AA 4HI8A 1PC2A 5CEAA 2AXUA 1OWNA 4DLQA 3B7TA 1H2TC 2FULA 4Q96A 3CVVA 2XZDG 5LP0A 1SQMA 3MEKA 4BT9A 1U3CA 2VYIA 2NXPA 2DZNA 1E8ZA 2EIJE 2EINE 2WXMA 4O1PA 1OCOE 5KJLA 3KS2A 4M3OA 2ILRA 1MHQA 2QYJA 3PE3A 4GTMA 1BPOA 3CVPA 1X5BA 3HXDA 4G8LA 1K1AA 4TUMA 3LJNA 5DBKA 1TNOA 3C98A 4GYWA 4HORA 2X6FA 4I9EA 4EPZA 4MKTA 5G04C 1N9AA 4NIKA 3PZ2A 2BKKB 4CDNA 4G11A 3TWQA 1H0AA 3UT4A 3CK7A 4AIFA 2IQCA 4EZJA 1V55E 1N4QA 2ETAA 4JZYA 4URKA 3LEWA 1DNPA 2VQ2A 4ANUA 4I17A 1H6KA 2C2LA 2WQ6A 4YDWA 4KXKB 4J8EA 1WM5A 4B8CB 4U0SA 4AVXA 3LDZA 1IKND 5KCMA 4N5CA 4DLOA 2CG2A 4OAVB 3E34A 3TWXA 2LXLA 3CEQA 2FF4A 5BNWA 1UW4B 4PS3A 1Z3XA 2GRPB 4WNGA 1HX8A 3KSLA 1D9SA 3TXNA 4XEIG 2AXVA 3QWWA 1IHGA 4JHRA 3HHMA 1UG3A 3FTZA 1JCSA 4JB8P 3D9IA 5CECB 1LF8A 2DBAA 4CDMA 1KLXA 2R5SA 5HQ8A 3IBEA 3QJZA 1K8KG 3MV3B 4RVBA 4LRZA 4MBGA 1H2VC 1H6OA 2I1KA 3T8KA 3FP3A 3Q15A 3OTNA 1KZPA 3BG1B 3QKYA 4GA1A 2DYRE 5HRYA 3U3WA 2YINA 1HE8A 4DI4A 5FIOA 4U8VD 5J08A 3ZRHA 5EIBE 3EHNA 3Q5MA 3LXUX 3P2BA 2Y4TA 1ELRA 4YDOA 2L9BA 2EIME 3FUFA 1OCZE 4MRUA 3FTWA 3X2QE 4J8FA 2NYJA 2WM9A 4NACA 5EX0A 3W9GA 5EDSA 2VTBA 2L0TB 1SZ9A 4BFRA 5CMWA 3U4TA 3L08A 5ARGA 3SI5A 1RW2A 3BUAA 5ENSD 3PNTB 3CKCA 4KZ0A 3DSTA 3S7BA 1B89A 3RAUA 1Z5SC 2J8SD 1NA3A 4FJYA 5JA4D 2VSYA 5FINA 2BF0X 4GPMA 3RKVA 1N94A 5D0QD 2RFAA 2GROB 3V2XA 2L6JA 1EPUA 4I6EA 3D9OA 3GZ1A 1KZOA 2JEKA 3TWTA 2LXMA 3BU8A 3HXCA 2B6CA 3AU5A 3Q75A 1HF8A 1OWOA 3D9KA 1FT2A 5A23A 5M72A 5IY5E 2P9SG 4I43A 4BX8A 3LYAA 5KNGA 2I1JA 3Q9NC 1K1BA 2A4ZA 3D9NA 3QAQA 2A5EA 3ULQA 4I1OB 2H6HA 2XCBA 4Y6CA 4J0UA 3B95A 2WXOA 3UINC 1HFAA 3DEOA 4L9PA 4XI9A 4U7EB 5AIJA 3NBNB 3T5XA 1IXVA 1KT0A 4AP2A 3AU4A 4B93B 4FLHA 4K03A 3SHFA 2CFUA 4LNBA 2IOSA 3Q7AA 4TUUA 1X81A 1H19A 5JHBA 1DVPA 3UIPC 4N3CA 2AJAA 3S7JA 2J09A 5HKPA 3FH8A 4U96D 1E96B 4RQIA 2P9UG 3D3MA 3FU5A 1N11A 1TNBA 1WAO1 3EHRA 4DUIA 1N95A 5EIDA 4EBAA 2PNNA 3ESLA 2CFZA 3B7BA 4UWGA 3SO8A 3PRZA 1JCRA 4GYYA 5KNHD 1N4PA 3UMVA 5BXUA 3FUNA 4ILIA 1YA0A 2IONA 2LSUA 5G05J 3GZ2A 1DC2A 3AS4A 2VJ8A 3DXMG 4KBQA 4UQZA 1JWFA 2WXFA 3GZSA 3ZPJA 5ENQD 4X8QA 4ME2A 4DX7D 2EILE 5ARFA 4G8KA 3Q4AB 3JXIA 2H6GA 1N0RA 3T9KA 2AWIA 2R17C 2XRYA 5AAOA 3G2WA 3FU6A 2Q7FA 3QARA 3CR3A 2KBXA 2VSNA 3MCXA 1ZB1A 2XGSA 4ATGA 4ANWA 2WB2A 3S2AA 2FO1E 3L16A 2FBNA 3AG2E 4WUYA 3CGHA 3FULA 4EHMA 3DWLG 3ABME 2UWJG 3QWVA 4ILHB 5EX3A 4A55A 2KZTA 3UX4A 4GA2A 1TEZA 2IU1A 3NZUA 1TYQG 3EU9A 4FLBA 4AXHA 3HDXA 4LSZE 3D9HA 3KSQA 1HG2A 4WNFA 1A5EA 2X3MA 5G05C 4BWRA 2WXQA 3D9LA 3L54A 3HIZA 3CHOA 3CSTA 4GZCA 1MQSA 2V4LA 3DSWA 3Q73A 4F1PA 1EDUA 3HXBA 1W3BA 2ZGDA 1ZU2A 3KEZA 5EILA 4KMOA 2DCPA 1E90A 3Q78A 3EIQC 4ATZD 3FWVA 3I4RB 3CQCB 3WXXA 1IQUA 3ENEA 3ASFA 3FH5A 3VLEA 5KWDA 3WG7E 5CBNA 3QWPA 3D9JA 3FUIA 3VLDA 3ZIMA 1IYGA 1Z3YA 3TWWA 4CYMD 1S0PA 2WXIA 3UKRG 5FZSA 1UN9A 3NQPA 2ZGGA 1D8EA 2VSXE 2KC7A 4JA7A 3E32A 4DX6D 5BXOA 2GRNB 3CVLA 3ONLA 4L2LA 2WQ7A 1D8DA 4PS7A 4ACKA 1FCHA 1EYHA 1ELWA 4JXTA 3QB2A 5FQ6A 3CHPA 4GCNA 3DSVA 4CCAA 2IFUA 2J9QA 3TL5A 5ANLA 4IULA 2P9NG 4OYSA 1WDYA 4BERA 1G3NB 2X38A 3MGBA 1S70B 3DXKG 1OUVA 5CRVA 3PNLB 5BW8C 2ZIRA 2R59A 2X6JA 3URZA 4LNGA 3ASGA 4ACLA 3LJ3A 3GW4A 4OVVA 2OEWA 3OXFA 1NI1A 5G2NA 3HRAA 4PDXA 4GB9A 3EIJA 4CEMA 1TN6A 4G26A 3UPVA 3ULEG 2EQXA 3SGHA 4U0UA 4GMRA 1HH8A 2WXHA 3DSXA 3O4ZA 1E8XA 1SZAA 3JQ1A 3BEEA 2JABA 4N2SA 3DSSA 4U95D 4IN3B 4PH4B 2E0IA 2OOEA 4U07A 2OVBA 3DRAA 2WMOA 1HG5A 3FUKA 2I6HA 3PVLA 2YNQA 3PZ3A 3KD7A 4N39A 3O48A 3CKBA 2BTDA 4EZLA 4GA0A 3MKRA 2WPVA 1QBQA 3ZXPA 1TNUA 2IO2C 2ONDA 1BI7B 3UM3A 3UUXA 3ML9A 4UI9J 4ANXA 3SBSA 3B7UX 2MHKA 3UQ3A 3PS6A 1TN8A 2OCCE 4DPRA 3FTYA 3T5VA 2C0LA 2DZOA 4I1MA 4G1TA 4APOA 2R2LA 2WVIA 1MX6A 4CRWA 4A1SA 1N0QA 4JD2G 3Q47B 3CHSA 1BI8B 3AG1E 2IOLA 2RKKA 3JCKC 3ZYQA 1SA4A 5CRUA 4N2QA 1SA5A 3ZYKA 2F8XK 1E7VA 4RG9A 4LERA 5FT9A 4KYOB 4GCOA 4C48B 3FTUA 4BY6A 1UJKA 3F6QA 5T8IA 1MJ0A 5ENRD 3RO3A 3PH0C 4JA9A 2I2OA 2I9CA 2ZXWE 4JC8A 4XI0A 5A6CA 4WWOA 3HVEB 2ZISA 3ONKA 1TNZA 2NC9A 4TXQA 1U3DA 3L82A 1LD7A 4HFGA 4F1SA 1N54A 1RZ4A 3D9MA 5G55A 3PZDA 3FEYA 3FUDA 3EJNA 3CLJA 4E85A 5D66A 3V31A 3G2VA 4BETA 4BEPA 4UI9C 4MS6A 4O1OA 4B8AA 4RLYA 3VTXA 4XZ4A 4BSXA 3UM1A 1TN7A 2PM7A 3V2OA 3AG3E 4HLEA 3ZN3A 4WWNA 5JJ7A 4GZDA 3FUJA 2DVWA 4JVSA 3UM2A 5B3SE 2R05A 4FP7A 2PZIA 4HI9A 3L22A 5AENA 3HXFA 3R7RA
chains in the Genus database with same CATH topology
3Q75A 1JCRA 1N4PA 3DSWA 1KZPA 1NI1A 1FT2A 3C72A 3Q73A 3EU5A 3HXBA 1O5MA 3PZ4A 4GTOA 1SA4A 1TN6A 1N9AA 1O1TA 1SA5A 4GTSA 1FT1A 1NL4A 3Q78A 3HXEA 3PZ2A 3DPYA 1S64A 2F0YA 3DSUA 3Q79A 1N4QA 2H6GA 4YDOA 3SFXA 3DSXA 2H6HA 2ZISA 1TNZA 3DSSA 4GTRA 3EUVA 1LD7A 3SFYA 1JCQA 4GTPA 1D8EA 2BEDA 4L9PA 2H6IA 3E32A 1N4RA 3E34A 3DRAA 3E33A 3PZ3A 2H6FA 4GTVA 1D8DA 3KSLA 1S63A 4LNBA 1N4SA 3Q7FA 3Q7AA 4EHMA 1X81A 1O1SA 1QBQA 1TNUA 3DSTA 3E37A 1TN7A 3DSVA 1JCSA 1MZCA 2IEJA 4GTQA 1N94A 4GTMA 4YDEA 3HXDA 1DCEA 1FPPA 1TNYA 3KSQA 1TN8A 1TNBA 1LTXA 3E30A 1O1RA 1KZOA 1TNOA 4GTTA 4MBGA 2ZIRA 3PZ1A 1N95A 3HXFA 2R2LA 4LNGA 1LD8A 3HXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q75 A;  1JCR A;  1N4P A;  3DSW A;  1KZP A;  1NI1 A;  1FT2 A;  3C72 A;  3Q73 A;  3EU5 A;  3HXB A;  1O5M A;  3PZ4 A;  4GTO A;  1SA4 A;  1TN6 A;  1N9A A;  1O1T A;  1SA5 A;  4GTS A;  1FT1 A;  1NL4 A;  3Q78 A;  3HXE A;  3PZ2 A;  3DPY A;  1S64 A;  2F0Y A;  3DSU A;  3Q79 A;  1N4Q A;  2H6G A;  4YDO A;  3SFX A;  3DSX A;  2H6H A;  2ZIS A;  1TNZ A;  3DSS A;  4GTR A;  3EUV A;  1LD7 A;  3SFY A;  1JCQ A;  4GTP A;  1D8E A;  2BED A;  4L9P A;  2H6I A;  3E32 A;  1N4R A;  3E34 A;  3DRA A;  3E33 A;  3PZ3 A;  2H6F A;  4GTV A;  1D8D A;  3KSL A;  1S63 A;  4LNB A;  1N4S A;  3Q7F A;  3Q7A A;  4EHM A;  1X81 A;  1O1S A;  1QBQ A;  1TNU A;  3DST A;  3E37 A;  1TN7 A;  3DSV A;  1JCS A;  1MZC A;  2IEJ A;  4GTQ A;  1N94 A;  4GTM A;  4YDE A;  3HXD A;  1DCE A;  1FPP A;  1TNY A;  3KSQ A;  1TN8 A;  1TNB A;  1LTX A;  3E30 A;  1O1R A;  1KZO A;  1TNO A;  4GTT A;  4MBG A;  2ZIR A;  3PZ1 A;  1N95 A;  3HXF A;  2R2L A;  4LNG A;  1LD8 A;  3HXC A; 
#chains in the Genus database with same CATH topology
 4JW1 A;  3MA5 A;  4HOU A;  3SBT B;  1WY6 A;  4C0M A;  5CMY A;  1H2U A;  4FHJ A;  2RFM A;  1NZN A;  4RG6 A;  3ZU7 B;  2VGY A;  1NA0 A;  3IHY A;  5B1B E;  3ABL E;  2V5Q C;  2V8S E;  2GRM A;  1K3Z D;  4DK5 A;  4EBA G;  2XPY A;  1NFI E;  4GTR A;  4IYP A;  4CGW A;  4F53 A;  2C0M A;  3PUK A;  2UY1 B;  2LAH A;  5AQ9 A;  3FUE A;  3SZ7 A;  2Y3A A;  3E33 A;  2ZU6 B;  2LSV A;  2Y4U A;  2XGM A;  3L17 A;  4FJZ A;  4BT8 A;  3CVU A;  2FEZ A;  1FVH A;  2PQR A;  3TG5 A;  1V54 E;  2IEJ A;  3EDT B;  3MKQ B;  1TJC A;  2XQ0 A;  4AM9 A;  1BU9 A;  4OVU A;  1OCC E;  2M63 A;  3VLF A;  2KM4 A;  5FWQ A;  1Y6I A;  3JUI A;  3APC A;  1N52 A;  3UIO C;  1BLX B;  2GGF A;  3SD5 A;  4AOF A;  2XEN A;  3SFZ A;  4YDY A;  4NUR A;  2VGE A;  4ILG A;  4R7L A;  5EKQ D;  4FU3 A;  3DSU A;  3B13 A;  4JEH A;  3V30 A;  1JPL A;  5FQ7 A;  2IF4 A;  3R7Q A;  4YVO A;  3Q49 B;  2R03 A;  3FHE A;  4UQY A;  2YHC A;  3LVQ E;  4L2Y A;  1UJJ A;  3ABK E;  3L6A A;  4U04 A;  4Q69 A;  3PE4 A;  4JHK A;  4KT6 B;  1IHB A;  5E76 A;  5BV0 A;  2V4H C;  2MOW A;  4GZ5 A;  4U63 A;  5AAR A;  1O1S A;  4L1B A;  4LG6 A;  3ZGQ A;  5ITZ F;  2WQH A;  5AQB A;  5CCL A;  3PDN A;  3FU0 A;  3IXE A;  2LUH A;  1OXJ A;  2Y1L E;  4G23 A;  1MYO A;  4J8D A;  4APF A;  5BT1 A;  4F7A A;  5H7P A;  4XE0 A;  2L6B A;  4EQF A;  3U66 A;  2JLB A;  4ZFH A;  4HLL A;  1KT1 A;  4GYO A;  3J5Q B;  2LAI A;  3FU3 A;  4DRX E;  3C72 A;  5T4Y A;  3QK0 A;  1QNF A;  1FT1 A;  1KPS B;  3U64 A;  2P2C P;  4XKC A;  3HXE A;  3DPY A;  5LX8 A;  4AJW A;  4BTA A;  3CQG B;  3QC1 A;  4JEU A;  1QYM A;  3JUE A;  5EN5 D;  5FZR A;  2WXR A;  3RIB A;  4WNE A;  2J08 A;  3J5P A;  4GZ6 A;  3LS8 A;  5BPP A;  2X6K A;  3FUM A;  3ULY A;  5D2M C;  3OAW A;  4WND A;  4HOS A;  4Q94 A;  1JWG A;  4M7C A;  4N5Q A;  2XPI A;  4XIF A;  3RRN B;  2WXN A;  3MYV A;  1MX4 A;  3JXJ A;  4J8Y A;  3APD A;  2J4D A;  2HO1 A;  3P1U A;  3MZL B;  2ETB A;  4FUL A;  1OWL A;  5AN8 A;  4A3V A;  2DYS E;  3HG0 D;  3CIA A;  4CT4 A;  4FA6 A;  1XGW A;  2IJG X;  3MX3 A;  1UOH A;  4QQI A;  5HI7 A;  3ZVV A;  5B1A E;  2OEV A;  2OVF A;  4LUN U;  3SY2 A;  2J49 A;  4FAD A;  4BX9 A;  4H7X A;  2QZA A;  2QY7 A;  2XEV A;  4JPS A;  2F37 A;  4HQD A;  3PEV B;  2A5U A;  3PUJ A;  4GAA A;  4BES A;  2P9K G;  2MYO A;  3APF A;  3ZW3 A;  3HYM B;  1YYH A;  2RD0 A;  4FHK A;  3AS8 A;  4UQX A;  5AJD A;  2NSZ A;  3ZFW A;  4QFV A;  4DI3 A;  4UUC A;  3B7R L;  3E4B A;  3I4G A;  1OT8 A;  3FUH A;  3UXG A;  3FFL A;  1S64 A;  2AXZ A;  2Y0B G;  2XZT G;  1NP7 A;  2L0I A;  5EYP F;  4GML A;  4WAF A;  1P5Q A;  4UWK A;  3SFY A;  3CSF A;  4GU5 A;  4GTP A;  1AWC B;  3GYZ A;  2BKG A;  3B7S A;  4O60 A;  1N4R A;  4TXP A;  5FQ8 A;  2B0O E;  2EIK E;  4AV7 A;  4PS8 A;  4GTV A;  4I9C A;  3MV2 B;  3PRE A;  5ENN A;  3QOU A;  5JHA A;  4U8Y D;  1N4S A;  5FQ4 A;  5KJN A;  3CHQ A;  4CGV A;  2XRZ A;  4K5C A;  2OV8 A;  1BD8 A;  3AG4 E;  3ZYM A;  1FVF A;  4HVB A;  1INZ A;  3RU0 A;  3SQV A;  4B94 A;  3CVY A;  4J8S A;  3E37 A;  1HZ4 A;  3VTY A;  3W9F A;  4DX1 A;  3PEU B;  3SF4 A;  3TWS A;  3LCA A;  3CK9 A;  2CHW A;  2XS8 A;  4B89 A;  3OXG A;  4A3T A;  2R02 A;  4EZK A;  1HO8 A;  4G2V A;  4EEC A;  4I2Z A;  2XEH A;  1JUQ A;  4K5A B;  4Z68 A;  3NZS A;  4HXI A;  2YQ8 A;  3KAE A;  1A17 A;  3R9M A;  2XHE A;  4ABN A;  3ZNG A;  3QNK A;  3EU5 A;  4ZHB A;  4NQ0 A;  2X6I A;  4GTS A;  3HVE A;  4YND A;  3C3R A;  4XX5 A;  4V3I A;  5KJK A;  4LEU A;  3Q79 A;  2HYZ A;  2P9I G;  4J6I A;  1EF1 C;  4F6R D;  2P9P G;  3EUV A;  3QDN A;  3RO2 A;  5C1D A;  4I1A A;  2KXP C;  1Z6T A;  2H6I A;  5DIZ A;  4HRL A;  1TR4 A;  5BUZ A;  4C0E A;  3TXM A;  1E7U A;  2H6F A;  1SW6 A;  2V0P A;  1ZBP A;  3ML8 A;  4CT0 A;  1HU3 A;  2WXP A;  2KCK A;  4P29 A;  4UWF A;  3RRM B;  3C3O A;  1Y8M A;  4HOT A;  3R9A B;  5ANR A;  5AQ7 A;  3TWV A;  5ENO D;  3ASO E;  1QZ2 A;  4LCT A;  3ESK A;  4UI9 K;  3LY8 A;  5C2Y A;  3E30 A;  1O1R A;  3AAA C;  2QYU A;  5JJ6 A;  4CDR A;  5ENP D;  3DPD A;  5A7D B;  1LD8 A;  3BQO A;  4H7Y A;  3EHM A;  5LCW J;  2WXK A;  2BUG A;  3IV0 A;  4E6H A;  1Q2Z A;  3NOG D;  3EHQ A;  1WG0 A;  2WXJ A;  3CK8 A;  4D10 C;  2LO6 A;  4K0R A;  1NL4 A;  2IY0 C;  2AW6 A;  2QFC A;  3FH7 A;  4N3B A;  2UY1 A;  1TJF A;  5FZQ A;  3G2S A;  4XKB A;  3FTS A;  3K9I A;  3C5R A;  4OAU C;  1HXI A;  4PUC A;  3NB2 A;  2Y69 E;  2BED A;  2YHE A;  2J4B A;  3G2U A;  3TAX A;  4K5B A;  1QQE A;  2GRL A;  3RRU A;  2GW1 A;  3AS5 A;  2CHZ A;  1U2V G;  3NF1 A;  1YMP A;  3Q9U C;  5CHE E;  3UT8 A;  3RJV A;  3UT7 A;  4TRQ A;  3Q7F A;  4JHJ A;  3MKQ A;  1E8W A;  2VTB B;  4I6G A;  3I3N A;  2KAT A;  4UWL A;  4L7T A;  2WMN A;  3OXL A;  2KCV A;  3TG4 A;  5LCW C;  1IQR A;  1PY1 A;  5FTP A;  1H6P A;  3LY9 A;  5AQA A;  5HS0 A;  2CG3 A;  3TWR A;  4F3V A;  1AP7 A;  4IRU A;  4LNU D;  3UKU G;  2XCC A;  2MRI A;  5AJL A;  1YCS B;  4L23 A;  5JJT A;  4HRN A;  4WWP A;  4HBD A;  3BG0 B;  4O6F A;  3NAW A;  2XPZ A;  4C9B B;  5CBO A;  1VDY A;  3RSE G;  1DCQ A;  1HS6 A;  3FY4 A;  5AYW D;  4CZ2 D;  5LFA A;  3TGO A;  4I2W A;  3FDH A;  2J07 A;  2DIW A;  2LNI A;  3IEG A;  2VSO E;  2FO7 A;  3UI2 A;  3FTV A;  4BSZ B;  1XNF A;  5LOZ A;  3TWU A;  1OWP A;  3SFX A;  3UTM A;  2PM6 A;  4KVO A;  4B0Z A;  3ASN E;  4KZC A;  3S7D A;  2PL2 A;  3U9W A;  5BV1 A;  3ZEF A;  1GW6 A;  5JMN D;  4NRH B;  4DX5 D;  2GRQ B;  3LPZ A;  4MLP A;  3CVX A;  1S63 A;  5CED B;  2GRR B;  3KEA A;  3ISM C;  4Y6W A;  4DX2 A;  3ZUV B;  2FI7 A;  4UWH A;  4JL0 A;  1UN8 A;  2DWZ A;  2HR2 A;  3D9P A;  2HE0 A;  3NOC D;  1MZC A;  5CCM A;  3T8M A;  4GTQ A;  4HB5 A;  4YDE A;  1DCE A;  3LVR E;  1TNY A;  4A63 B;  1PAQ A;  4FC8 A;  5EYL A;  3ZHE A;  3PZ1 A;  4U8H A;  3UM0 A;  4A1G A;  2WXL A;  3CVQ A;  3CV0 A;  2ETC A;  3FEX A;  4GTO A;  2XGO A;  1SVX A;  4I6J A;  3S7F A;  1OWM A;  2V5F A;  3ZYL A;  2F0Y A;  3JQ0 A;  2VGX A;  4YVQ C;  3RK6 A;  1L5J A;  4G24 A;  4U0Z A;  2CHX A;  4DJA A;  3L13 A;  4AY5 A;  2KCL A;  3ZHE B;  3V79 K;  3IHV A;  1MX2 A;  4J7W A;  3CVW A;  5FJY A;  1ELK A;  4TV3 A;  4GZ3 A;  3CHM A;  3SNX A;  3ZKJ A;  4AY6 A;  2F8Y A;  2QC9 A;  3MJW A;  4ANV A;  1OCR E;  4BTB A;  5D0O D;  5J90 A;  5T3R A;  3CHR A;  2VGX B;  3LY7 A;  3DEP A;  2HM8 A;  4GMJ A;  3L9T A;  4HNA D;  5KBA A;  5ENT D;  4TXR A;  3ASH A;  2E2E A;  4GPK A;  2KZT B;  1FPP A;  3FTX A;  3ASD A;  1LTX A;  4HS2 A;  5CER B;  2AVP A;  4GTT A;  5KJM A;  2X6H A;  3JYS A;  2RG8 A;  2P58 C;  3AJI A;  4W9R A;  2WXG A;  4KVM A;  2XEE A;  1O5M A;  5E75 A;  3PZ4 A;  3IKO B;  4RSY A;  3G2T A;  1O1T A;  1E8Y A;  2PQN A;  4AEZ C;  2P9L G;  3ZXS A;  3C3Q A;  3CVN A;  3TJP A;  5G04 J;  2XS1 A;  3N71 A;  3DBS A;  4HOQ A;  2IO3 C;  4HRM B;  3I5P A;  1JCQ A;  1OY3 D;  4G25 A;  3LKU A;  4N3A A;  4HI8 A;  1PC2 A;  5CEA A;  2AXU A;  1OWN A;  4DLQ A;  3B7T A;  1H2T C;  2FUL A;  4Q96 A;  3CVV A;  2XZD G;  5LP0 A;  1SQM A;  3MEK A;  4BT9 A;  1U3C A;  2VYI A;  2NXP A;  2DZN A;  1E8Z A;  2EIJ E;  2EIN E;  2WXM A;  4O1P A;  1OCO E;  5KJL A;  3KS2 A;  4M3O A;  2ILR A;  1MHQ A;  2QYJ A;  3PE3 A;  4GTM A;  1BPO A;  3CVP A;  1X5B A;  3HXD A;  4G8L A;  1K1A A;  4TUM A;  3LJN A;  5DBK A;  1TNO A;  3C98 A;  4GYW A;  4HOR A;  2X6F A;  4I9E A;  4EPZ A;  4MKT A;  5G04 C;  1N9A A;  4NIK A;  3PZ2 A;  2BKK B;  4CDN A;  4G11 A;  3TWQ A;  1H0A A;  3UT4 A;  3CK7 A;  4AIF A;  2IQC A;  4EZJ A;  1V55 E;  1N4Q A;  2ETA A;  4JZY A;  4URK A;  3LEW A;  1DNP A;  2VQ2 A;  4ANU A;  4I17 A;  1H6K A;  2C2L A;  2WQ6 A;  4YDW A;  4KXK B;  4J8E A;  1WM5 A;  4B8C B;  4U0S A;  4AVX A;  3LDZ A;  1IKN D;  5KCM A;  4N5C A;  4DLO A;  2CG2 A;  4OAV B;  3E34 A;  3TWX A;  2LXL A;  3CEQ A;  2FF4 A;  5BNW A;  1UW4 B;  4PS3 A;  1Z3X A;  2GRP B;  4WNG A;  1HX8 A;  3KSL A;  1D9S A;  3TXN A;  4XEI G;  2AXV A;  3QWW A;  1IHG A;  4JHR A;  3HHM A;  1UG3 A;  3FTZ A;  1JCS A;  4JB8 P;  3D9I A;  5CEC B;  1LF8 A;  2DBA A;  4CDM A;  1KLX A;  2R5S A;  5HQ8 A;  3IBE A;  3QJZ A;  1K8K G;  3MV3 B;  4RVB A;  4LRZ A;  4MBG A;  1H2V C;  1H6O A;  2I1K A;  3T8K A;  3FP3 A;  3Q15 A;  3OTN A;  1KZP A;  3BG1 B;  3QKY A;  4GA1 A;  2DYR E;  5HRY A;  3U3W A;  2YIN A;  1HE8 A;  4DI4 A;  5FIO A;  4U8V D;  5J08 A;  3ZRH A;  5EIB E;  3EHN A;  3Q5M A;  3LXU X;  3P2B A;  2Y4T A;  1ELR A;  4YDO A;  2L9B A;  2EIM E;  3FUF A;  1OCZ E;  4MRU A;  3FTW A;  3X2Q E;  4J8F A;  2NYJ A;  2WM9 A;  4NAC A;  5EX0 A;  3W9G A;  5EDS A;  2VTB A;  2L0T B;  1SZ9 A;  4BFR A;  5CMW A;  3U4T A;  3L08 A;  5ARG A;  3SI5 A;  1RW2 A;  3BUA A;  5ENS D;  3PNT B;  3CKC A;  4KZ0 A;  3DST A;  3S7B A;  1B89 A;  3RAU A;  1Z5S C;  2J8S D;  1NA3 A;  4FJY A;  5JA4 D;  2VSY A;  5FIN A;  2BF0 X;  4GPM A;  3RKV A;  1N94 A;  5D0Q D;  2RFA A;  2GRO B;  3V2X A;  2L6J A;  1EPU A;  4I6E A;  3D9O A;  3GZ1 A;  1KZO A;  2JEK A;  3TWT A;  2LXM A;  3BU8 A;  3HXC A;  2B6C A;  3AU5 A;  3Q75 A;  1HF8 A;  1OWO A;  3D9K A;  1FT2 A;  5A23 A;  5M72 A;  5IY5 E;  2P9S G;  4I43 A;  4BX8 A;  3LYA A;  5KNG A;  2I1J A;  3Q9N C;  1K1B A;  2A4Z A;  3D9N A;  3QAQ A;  2A5E A;  3ULQ A;  4I1O B;  2H6H A;  2XCB A;  4Y6C A;  4J0U A;  3B95 A;  2WXO A;  3UIN C;  1HFA A;  3DEO A;  4L9P A;  4XI9 A;  4U7E B;  5AIJ A;  3NBN B;  3T5X A;  1IXV A;  1KT0 A;  4AP2 A;  3AU4 A;  4B93 B;  4FLH A;  4K03 A;  3SHF A;  2CFU A;  4LNB A;  2IOS A;  3Q7A A;  4TUU A;  1X81 A;  1H19 A;  5JHB A;  1DVP A;  3UIP C;  4N3C A;  2AJA A;  3S7J A;  2J09 A;  5HKP A;  3FH8 A;  4U96 D;  1E96 B;  4RQI A;  2P9U G;  3D3M A;  3FU5 A;  1N11 A;  1TNB A;  1WAO 1;  3EHR A;  4DUI A;  1N95 A;  5EID A;  4EBA A;  2PNN A;  3ESL A;  2CFZ A;  3B7B A;  4UWG A;  3SO8 A;  3PRZ A;  1JCR A;  4GYY A;  5KNH D;  1N4P A;  3UMV A;  5BXU A;  3FUN A;  4ILI A;  1YA0 A;  2ION A;  2LSU A;  5G05 J;  3GZ2 A;  1DC2 A;  3AS4 A;  2VJ8 A;  3DXM G;  4KBQ A;  4UQZ A;  1JWF A;  2WXF A;  3GZS A;  3ZPJ A;  5ENQ D;  4X8Q A;  4ME2 A;  4DX7 D;  2EIL E;  5ARF A;  4G8K A;  3Q4A B;  3JXI A;  2H6G A;  1N0R A;  3T9K A;  2AWI A;  2R17 C;  2XRY A;  5AAO A;  3G2W A;  3FU6 A;  2Q7F A;  3QAR A;  3CR3 A;  2KBX A;  2VSN A;  3MCX A;  1ZB1 A;  2XGS A;  4ATG A;  4ANW A;  2WB2 A;  3S2A A;  2FO1 E;  3L16 A;  2FBN A;  3AG2 E;  4WUY A;  3CGH A;  3FUL A;  4EHM A;  3DWL G;  3ABM E;  2UWJ G;  3QWV A;  4ILH B;  5EX3 A;  4A55 A;  2KZT A;  3UX4 A;  4GA2 A;  1TEZ A;  2IU1 A;  3NZU A;  1TYQ G;  3EU9 A;  4FLB A;  4AXH A;  3HDX A;  4LSZ E;  3D9H A;  3KSQ A;  1HG2 A;  4WNF A;  1A5E A;  2X3M A;  5G05 C;  4BWR A;  2WXQ A;  3D9L A;  3L54 A;  3HIZ A;  3CHO A;  3CST A;  4GZC A;  1MQS A;  2V4L A;  3DSW A;  3Q73 A;  4F1P A;  1EDU A;  3HXB A;  1W3B A;  2ZGD A;  1ZU2 A;  3KEZ A;  5EIL A;  4KMO A;  2DCP A;  1E90 A;  3Q78 A;  3EIQ C;  4ATZ D;  3FWV A;  3I4R B;  3CQC B;  3WXX A;  1IQU A;  3ENE A;  3ASF A;  3FH5 A;  3VLE A;  5KWD A;  3WG7 E;  5CBN A;  3QWP A;  3D9J A;  3FUI A;  3VLD A;  3ZIM A;  1IYG A;  1Z3Y A;  3TWW A;  4CYM D;  1S0P A;  2WXI A;  3UKR G;  5FZS A;  1UN9 A;  3NQP A;  2ZGG A;  1D8E A;  2VSX E;  2KC7 A;  4JA7 A;  3E32 A;  4DX6 D;  5BXO A;  2GRN B;  3CVL A;  3ONL A;  4L2L A;  2WQ7 A;  1D8D A;  4PS7 A;  4ACK A;  1FCH A;  1EYH A;  1ELW A;  4JXT A;  3QB2 A;  5FQ6 A;  3CHP A;  4GCN A;  3DSV A;  4CCA A;  2IFU A;  2J9Q A;  3TL5 A;  5ANL A;  4IUL A;  2P9N G;  4OYS A;  1WDY A;  4BER A;  1G3N B;  2X38 A;  3MGB A;  1S70 B;  3DXK G;  1OUV A;  5CRV A;  3PNL B;  5BW8 C;  2ZIR A;  2R59 A;  2X6J A;  3URZ A;  4LNG A;  3ASG A;  4ACL A;  3LJ3 A;  3GW4 A;  4OVV A;  2OEW A;  3OXF A;  1NI1 A;  5G2N A;  3HRA A;  4PDX A;  4GB9 A;  3EIJ A;  4CEM A;  1TN6 A;  4G26 A;  3UPV A;  3ULE G;  2EQX A;  3SGH A;  4U0U A;  4GMR A;  1HH8 A;  2WXH A;  3DSX A;  3O4Z A;  1E8X A;  1SZA A;  3JQ1 A;  3BEE A;  2JAB A;  4N2S A;  3DSS A;  4U95 D;  4IN3 B;  4PH4 B;  2E0I A;  2OOE A;  4U07 A;  2OVB A;  3DRA A;  2WMO A;  1HG5 A;  3FUK A;  2I6H A;  3PVL A;  2YNQ A;  3PZ3 A;  3KD7 A;  4N39 A;  3O48 A;  3CKB A;  2BTD A;  4EZL A;  4GA0 A;  3MKR A;  2WPV A;  1QBQ A;  3ZXP A;  1TNU A;  2IO2 C;  2OND A;  1BI7 B;  3UM3 A;  3UUX A;  3ML9 A;  4UI9 J;  4ANX A;  3SBS A;  3B7U X;  2MHK A;  3UQ3 A;  3PS6 A;  1TN8 A;  2OCC E;  4DPR A;  3FTY A;  3T5V A;  2C0L A;  2DZO A;  4I1M A;  4G1T A;  4APO A;  2R2L A;  2WVI A;  1MX6 A;  4CRW A;  4A1S A;  1N0Q A;  4JD2 G;  3Q47 B;  3CHS A;  1BI8 B;  3AG1 E;  2IOL A;  2RKK A;  3JCK C;  3ZYQ A;  1SA4 A;  5CRU A;  4N2Q A;  1SA5 A;  3ZYK A;  2F8X K;  1E7V A;  4RG9 A;  4LER A;  5FT9 A;  4KYO B;  4GCO A;  4C48 B;  3FTU A;  4BY6 A;  1UJK A;  3F6Q A;  5T8I A;  1MJ0 A;  5ENR D;  3RO3 A;  3PH0 C;  4JA9 A;  2I2O A;  2I9C A;  2ZXW E;  4JC8 A;  4XI0 A;  5A6C A;  4WWO A;  3HVE B;  2ZIS A;  3ONK A;  1TNZ A;  2NC9 A;  4TXQ A;  1U3D A;  3L82 A;  1LD7 A;  4HFG A;  4F1S A;  1N54 A;  1RZ4 A;  3D9M A;  5G55 A;  3PZD A;  3FEY A;  3FUD A;  3EJN A;  3CLJ A;  4E85 A;  5D66 A;  3V31 A;  3G2V A;  4BET A;  4BEP A;  4UI9 C;  4MS6 A;  4O1O A;  4B8A A;  4RLY A;  3VTX A;  4XZ4 A;  4BSX A;  3UM1 A;  1TN7 A;  2PM7 A;  3V2O A;  3AG3 E;  4HLE A;  3ZN3 A;  4WWN A;  5JJ7 A;  4GZD A;  3FUJ A;  2DVW A;  4JVS A;  3UM2 A;  5B3S E;  2R05 A;  4FP7 A;  2PZI A;  4HI9 A;  3L22 A;  5AEN A;  3HXF A;  3R7R A; 
#chains in the Genus database with same CATH homology
 3Q75 A;  1JCR A;  1N4P A;  3DSW A;  1KZP A;  1NI1 A;  1FT2 A;  3C72 A;  3Q73 A;  3EU5 A;  3HXB A;  1O5M A;  3PZ4 A;  4GTO A;  1SA4 A;  1TN6 A;  1N9A A;  1O1T A;  1SA5 A;  4GTS A;  1FT1 A;  1NL4 A;  3Q78 A;  3HXE A;  3PZ2 A;  3DPY A;  1S64 A;  2F0Y A;  3DSU A;  3Q79 A;  1N4Q A;  2H6G A;  4YDO A;  3SFX A;  3DSX A;  2H6H A;  2ZIS A;  1TNZ A;  3DSS A;  4GTR A;  3EUV A;  1LD7 A;  3SFY A;  1JCQ A;  4GTP A;  1D8E A;  2BED A;  4L9P A;  2H6I A;  3E32 A;  1N4R A;  3E34 A;  3DRA A;  3E33 A;  3PZ3 A;  2H6F A;  4GTV A;  1D8D A;  3KSL A;  1S63 A;  4LNB A;  1N4S A;  3Q7F A;  3Q7A A;  4EHM A;  1X81 A;  1O1S A;  1QBQ A;  1TNU A;  3DST A;  3E37 A;  1TN7 A;  3DSV A;  1JCS A;  1MZC A;  2IEJ A;  4GTQ A;  1N94 A;  4GTM A;  4YDE A;  3HXD A;  1DCE A;  1FPP A;  1TNY A;  3KSQ A;  1TN8 A;  1TNB A;  1LTX A;  3E30 A;  1O1R A;  1KZO A;  1TNO A;  4GTT A;  4MBG A;  2ZIR A;  3PZ1 A;  1N95 A;  3HXF A;  2R2L A;  4LNG A;  1LD8 A;  3HXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...