3KSQA

Discovery of c-imidazole azaheptapyridine fpt inhibitors
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase, CAAX box, alpha
publication title Discovery of C-imidazole azaheptapyridine FPT inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 126
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3ksqA00
4EHMA 1N9AA 3DSUA 1FPPA 1N4QA 3C72A 3Q75A 1SA4A 2H6FA 1S64A 3KSLA 1SA5A 2IEJA 1LTXA 3DSSA 1JCQA 1S63A 3E30A 3HXCA 3HXBA 1D8DA 1QBQA 2F0YA 4MBGA 1TNUA 1JCRA 1DCEA 3DSVA 3E34A 4YDOA 1N94A 2ZIRA 4GTQA 2H6IA 1NI1A 3Q78A 3DRAA 3Q7AA 3PZ1A 4GTTA 3HXDA 1TNYA 3PZ3A 1X81A 1TN8A 1FT2A 3KSQA 1O1TA 3EUVA 1LD7A 3EU5A 3Q79A 3PZ4A 1N4SA 4GTVA 4GTRA 3HXEA 4GTOA 3DPYA 2R2LA 4LNBA 3E33A 1JCSA 4YDEA 2ZISA 1LD8A 1TNZA 2H6HA 3E37A 1TN7A 4GTMA 3DSXA 1D8EA 4L9PA 1TNOA 3E32A 1O1SA 4GTPA 3DSTA 3SFXA 1FT1A 1N4RA 1NL4A 2BEDA 1TNBA 3HXFA 4LNGA 2H6GA 3SFYA 3DSWA 4GTSA 1N95A 1KZPA 3PZ2A 1TN6A 1N4PA 1O1RA 3Q7FA 1MZCA 1O5MA 3Q73A 1KZOA
chains in the Genus database with same CATH superfamily
3PNTB 5LOZA 4G26A 3CSFA 1S64A 3FUJA 3APDA 1QQEA 2KBXA 3GYZA 3PE4A 5CECB 5CMYA 3V2XA 4I6GA 2LSUA 2X3MA 4JL0A 1NFIE 4GZCA 4EPZA 2WXQA 3L22A 5KCMA 4YVOA 3EHNA 3G2SA 3LY7A 2X6KA 4WUYA 3DRAA 1Z3YA 1TNYA 4F1SA 3SZ7A 4XI9A 1TN8A 1K1AA 4TXRA 1V54E 3FTYA 2KZTA 4QFVA 2F37A 3ZIMA 5BV1A 3K9IA 5FIOA 2YINA 4U63A 2FO7A 4TV3A 4A3VA 4AP2A 2VJ8A 4UWHA 4YDYA 3MJWA 1HE8A 4YDEA 1Q2ZA 1DNPA 2WXHA 4XX5A 2I2OA 3AU4A 2OVFA 3OXLA 3URZA 4CDNA 2Y69E 5C2YA 3G2VA 1N4RA 3HIZA 3CV0A 2C0MA 4KYOB 4I6JA 5G04C 1TJFA 3RK6A 4G8LA 1PAQA 4YDWA 2P9IG 5G05J 4HORA 3UTMA 1HG2A 4NURA 3JCKC 3RJVA 2QC9A 2XEEA 4BWRA 5KBAA 2OOEA 3FTZA 4EHMA 3SY2A 3D9KA 1FPPA 5B1BE 3C72A 3Q75A 4DUIA 1H2UA 2DBAA 4KMOA 3HXCA 4LERA 3VLDA 4UQXA 1E8XA 3CK8A 4DRXE 4HOTA 4I9EA 1INZA 1FCHA 4GMRA 2WXKA 2DCPA 3BEEA 5FZQA 3PNLB 4LCTA 4FLBA 4TUUA 2F8XK 3FH5A 3L17A 5T4YA 3CQCB 2KM4A 3SBTB 3V30A 3P2BA 1Z5SC 1N4SA 2XHEA 1MJ0A 4PS3A 4FA6A 2J8SD 1RZ4A 3FFLA 2XPYA 5ANRA 4LNBA 1JCSA 1ELWA 3UUXA 4PS8A 4WWNA 3FHEA 2BEDA 2P9LG 4GA2A 1TEZA 5CHEE 3ZGQA 3SHFA 4HS2A 4ANVA 4U8YD 3TXMA 4A63B 5JHAA 2XGMA 2VYIA 5JJ6A 3SFZA 4OVUA 4CGWA 4J8SA 5G05C 2CHWA 2GRNB 3QK0A 3L9TA 2A5UA 3RU0A 1FVHA 5D66A 1GW6A 3MGBA 1N4QA 4NQ0A 3B7BA 4C0MA 5BPPA 3E30A 4JB8P 4LEUA 3UIOC 3EHMA 2RKKA 2XRYA 5AAOA 3DSVA 4UWFA 4HQDA 1NA0A 3D9PA 4BESA 1PC2A 5FZSA 1UW4B 1E7VA 3DWLG 3MKQA 5CCLA 3D9LA 3S7FA 5JJ7A 3Q79A 3D9OA 2QYUA 3OXGA 2LSVA 4BX8A 5M72A 5AJDA 4FLHA 2ZISA 3FU0A 1YCSB 5BV0A 3E37A 2ILRA 4MRUA 2NXPA 3WXXA 2OCCE 3UT4A 4L9PA 2XQ0A 3R7QA 4RSYA 3VLEA 3MV3B 1KLXA 4MS6A 4G2VA 4D10C 4EZKA 3JXJA 2WPVA 4K0RA 1OWNA 1Z3XA 3CHSA 4UI9K 2QFCA 5D2MC 2J08A 1TN6A 3PH0C 3D9IA 1N4PA 3EU9A 2R02A 3QWWA 3TGOA 3QWVA 4GB9A 4B8CB 1TJCA 2L9BA 3RRNB 5KJMA 1TNUA 1JCRA 5FWQA 2WB2A 4GPMA 5ARFA 2J9QA 5B3SE 3E34A 4RG6A 3LEWA 4L2YA 4LUNU 2XGSA 1NI1A 2FI7A 3TWSA 2QZAA 4EZLA 3LS8A 3OTNA 4TRQA 2J09A 1HFAA 1D9SA 4C9BB 3R7RA 4L23A 4N3AA 3FTWA 2A4ZA 3LY9A 3IHYA 3MKQB 4F7AA 5D0OD 3U64A 4I6EA 2CG2A 2NC9A 3L13A 5FTPA 1DCQA 2MOWA 5KJLA 3E32A 2XGOA 5B1AE 3LXUX 4OAVB 5AQ9A 4I2WA 1HF8A 3MCXA 3JXIA 1BD8A 1P5QA 3BG0B 3RIBA 1JUQA 3O4ZA 3PZ2A 1ZU2A 2BKKB 4JEHA 4BEPA 4FHKA 1JPLA 3ASNE 5JMND 1BI7B 1KZOA 1OT8A 1HG5A 2WXIA 3FU5A 3KSLA 5KJNA 2WMNA 4PUCA 3KEZA 4TUMA 1SVXA 1OY3D 3HXBA 1D8DA 2YHEA 5T8IA 3PS6A 2MRIA 2VSYA 3CHPA 1V55E 3G2TA 1HS6A 5EILA 2OV8A 3IHVA 2VQ2A 2KXPC 5BXUA 4I17A 3ABME 4B0ZA 5H7PA 3CR3A 4GTVA 3QC1A 3Q15A 3CVXA 3ZRHA 1OWLA 1A17A 4JC8A 3DEOA 2YQ8A 3D9HA 4ILGA 4HLEA 2XEHA 3LDZA 1HH8A 3NQPA 2V8SE 4KZCA 4RG9A 2VSXE 3UQ3A 4ATZD 3TAXA 1UN9A 1FVFA 2WVIA 3FTXA 3HXFA 1OCCE 3NB2A 3CVQA 1WY6A 3UI2A 5FQ7A 3I5PA 3LKUA 4HNAD 3AAAC 4H7YA 4GTSA 3CGHA 2YNQA 5CBNA 4DX2A 4K5CA 1O1RA 1WDYA 4G8KA 5E76A 3B7SA 3EDTB 4JHJA 3DSUA 2VTBA 1U2VG 3LJNA 3SF4A 4BETA 1K1BA 1QBQA 3FDHA 4UQZA 5HS0A 1HZ4A 3JYSA 3PZDA 3F6QA 1MYOA 4R7LA 2WQ7A 4ACKA 3ZXPA 4AIFA 3Q78A 3U4TA 4WNDA 3TWVA 1ELKA 2ZXWE 3IBEA 3PZ4A 1JWGA 2JEKA 5EIBE 1MX2A 1N11A 4ATGA 3HXEA 5ENRD 1N52A 5E75A 2PNNA 3UKUG 2WQ6A 4HFGA 3KD7A 2DWZA 3C5RA 2P9NG 5IY5E 1OWMA 1TNOA 3MX3A 2CG3A 1MHQA 3Q9NC 4BTBA 2LNIA 2LAHA 5ANLA 4FU3A 1XNFA 3AG4E 2KCKA 4WWOA 4UUCA 3DSWA 3PUKA 3NAWA 3FY4A 4JXTA 3ML8A 3CVUA 3PUJA 2HE0A 3AS8A 3ZFWA 5CCMA 1MZCA 4GMLA 4ILHB 4J0UA 5FQ6A 3RRUA 3ASOE 2X38A 2VSOE 2Q7FA 5EDSA 1YA0A 1LTXA 4C48B 3VTYA 5CEDB 5HRYA 4ME2A 2CHXA 2HM8A 3SI5A 4FJZA 4DLQA 2M63A 2EIKE 3IXEA 3NZSA 1S70B 1OWOA 3N71A 3FWVA 4HLLA 3DEPA 2VTBB 3FEXA 1IQRA 3AS5A 4J8DA 2R17C 4AJWA 4CYMD 5CRVA 4DLOA 4I1AA 3GZ1A 4MKTA 3FH7A 2LAIA 1UG3A 2I6HA 1EPUA 3OXFA 3L16A 3PDNA 1VDYA 1TNZA 3T5XA 2ETCA 3TG4A 3QOUA 2BKGA 1D8EA 3TWXA 2QYJA 1N54A 1FT1A 1NA3A 4Q69A 4EZJA 1YMPA 4AY5A 3NOGD 4GAAA 1KT0A 4HRLA 2MHKA 5DIZA 5J08A 2KZTB 1B89A 2XS1A 4XIFA 3FTSA 2AXVA 3ZN3A 5HQ8A 5CERB 4GMJA 2GRQB 5EYLA 3FUNA 1SA4A 4ILIA 4G25A 2B6CA 4E6HA 3T8MA 3ISMC 4J8EA 3D3MA 3PE3A 1HX8A 3AG2E 4WNFA 4GTQA 4GZ6A 5BXOA 3TXNA 4JPSA 3Q7AA 2R59A 3QDNA 3CKCA 3I3NA 5D0QD 4GA1A 2IONA 3QKYA 3VLFA 4A3TA 3D9MA 2RD0A 3LPZA 3EHRA 2IY0C 1QZ2A 2KATA 2VSNA 4FP7A 2PQRA 1ELRA 2H6HA 4UWLA 5FJYA 4CDMA 1PY1A 4CT4A 2UWJG 4J6IA 3LVRE 4I2ZA 2BTDA 4BERA 2R03A 3APCA 4WWPA 1WAO1 3MZLB 2HR2A 5JJTA 3C3QA 3ULYA 1ZBPA 3AU5A 2E0IA 1H2VC 2NYJA 3MA5A 4AVXA 1G3NB 3TG5A 4U07A 5EYPF 5JA4D 2B0OE 4XE0A 3BQOA 3VTXA 4PDXA 3ENEA 3BUAA 1HXIA 4QQIA 4J7WA 5AYWD 3QNKA 1BU9A 3CVNA 3AJIA 1E8YA 3X2QE 1LF8A 1EDUA 4YNDA 3ESLA 4B8AA 4F53A 2AWIA 3CK7A 2EINE 4JZYA 3J5PA 5A6CA 2H6IA 1E8WA 5FQ4A 4GTTA 1X81A 2QY7A 3CHMA 4CEMA 1OXJA 3KSQA 4NACA 1HU3A 2XRZA 2FBNA 5CBOA 4JHKA 3CK9A 3AS4A 3KEAA 2C2LA 4IN3B 4UQYA 2AVPA 4GU5A 1UN8A 3HRAA 3J5QB 3UINC 4K03A 3FEYA 1O1SA 3ML9A 3U66A 4KVOA 2OEWA 3FUIA 3W9GA 4XI0A 3UXGA 1RW2A 3UT8A 3ZHEA 1TR4A 4HRMB 4WNGA 2LO6A 3TWQA 4IULA 4AV7A 4EBAA 4OAUC 3L6AA 1TYQG 5DBKA 2X6FA 2L6JA 4EQFA 1OCOE 2IEJA 1K8KG 4Q94A 4GZ5A 1H6KA 3FH8A 5G55A 2F0YA 3ABKE 3B7TA 4B94A 2WXJA 1JWFA 2FF4A 3W9FA 2JABA 3LY8A 1N94A 4X8QA 5HKPA 4B93B 1KPSB 2ZU6B 4APFA 2P58C 4U0UA 5AQAA 1H6PA 3PZ1A 4GYWA 4U0SA 3PZ3A 2WXRA 2EIJE 2IO2C 4NRHB 2AXUA 1BI8B 2UY1A 4HI8A 4AEZC 3EIQC 4GTRA 3PRZA 4BX9A 2X6HA 4ANUA 4BTAA 2IO3C 5ENQD 2JLBA 5BUZA 1UOHA 3TJPA 3QAQA 3FUMA 4GTMA 2P9PG 5C1DA 1E8ZA 3DXMG 4GTPA 3NOCD 2X6IA 1TNBA 3L08A 4GCOA 4DJAA 2YHCA 3U9WA 4KZ0A 1Z6TA 1N0RA 3FU3A 2DYRE 2J4BA 3Q5MA 4GZDA 4Y6WA 2BUGA 1UJJA 4O1OA 4Z68A 2P9UG 1QNFA 2IOSA 2DVWA 2WXGA 3Q73A 2ETAA 1N9AA 4U8HA 5EIDA 2X6JA 3ZHEB 3ZEFA 5ARGA 4P29A 4G11A 4JA7A 4MBGA 3GZ2A 3EJNA 3JUEA 4A1SA 4ANWA 3G2UA 5A7DB 3CVVA 3ASDA 4XEIG 2PL2A 4O6FA 4M7CA 5LFAA 3T5VA 4I1OB 3CLJA 4DI4A 3FTVA 3V79K 2WXNA 3UIPC 4N2SA 2L0IA 1FT2A 5ITZF 3EU5A 3S7BA 2GRRB 5BNWA 3HYMB 3FUDA 4C0EA 3DPYA 2OEVA 4DX7D 4CGVA 3ULQA 1S0PA 3FUEA 3TWWA 2XEVA 1LD8A 5AJLA 4FC8A 1EF1C 1SZ9A 4GYOA 3JQ1A 5ENOD 4I1MA 3ULEG 1DVPA 3ZW3A 3KS2A 3LYAA 5KJKA 2P9KG 3MEKA 2DZOA 1K3ZD 3ABLE 2LUHA 4L2LA 2ONDA 1MX4A 1IKND 5CEAA 1H2TC 3PEUB 3JUIA 2LXMA 3NF1A 5CMWA 4UWGA 3APFA 2A5EA 5G2NA 4K5BA 4ANXA 1OUVA 4H7XA 4IYPA 2KCVA 1IHGA 3O48A 2VGYA 5LX8A 3ZUVB 3D9NA 3SNXA 4U04A 1DCEA 4JD2G 4BT8A 5LP0A 2XPIA 3E4BA 4DI3A 4EECA 2ZGDA 4YDOA 3ZVVA 2ZIRA 4BSZB 2I9CA 3QJZA 4N3BA 4GCNA 5KNHD 4KVMA 3GW4A 4MLPA 4LG6A 3S2AA 3L54A 2IQCA 2IFUA 1HO8A 3RAUA 3SD5A 3ASFA 4HRNA 4DK5A 3Q4AB 4DPRA 3B95A 4CT0A 2IOLA 3IV0A 3FUKA 4F1PA 3UM2A 1A5EA 3HVEA 5AN8A 3ZXSA 4OVVA 1UJKA 3MV2B 4PS7A 4DX5D 4URKA 1OCZE 3ESKA 4U8VD 4ZFHA 5EN5D 3T9KA 1E96B 3EIJA 2MYOA 2CFUA 3V31A 2IJGX 3BG1B 3ZYKA 3L82A 2L0TB 5EKQD 3AG1E 4J8FA 3HHMA 4LRZA 3Q47B 3B13A 1SA5A 3DSSA 3EHQA 1S63A 3U3WA 4XKCA 2WQHA 3FUFA 2FEZA 5A23A 4JHRA 1N0QA 4L7TA 2BF0X 1H6OA 2PQNA 1DC2A 3CVPA 1OCRE 3LJ3A 1XGWA 2V0PA 2V4LA 4JVSA 2GROB 5KWDA 1IHBA 1E90A 5HI7A 2AJAA 3CQGB 2XCBA 4APOA 4UWKA 4TXPA 4N5CA 5J90A 3UKRG 3EUVA 3C3RA 1LD7A 3PEVB 4F6RD 1BPOA 4BFRA 3R9AB 3B7UX 2WMOA 3LVQE 4V3IA 3TWUA 4LSZE 3E33A 4O60A 3ASHA 3DPDA 4YVQC 3FUHA 3ZPJA 3TL5A 4RVBA 5BT1A 4G24A 2R05A 3D9JA 3NZUA 4XZ4A 5AARA 2PZIA 1H0AA 3DSTA 3SFXA 4N2QA 2GRMA 4FJYA 4M3OA 3RSEG 4GA0A 2KCLA 2FULA 4N5QA 1YYHA 2WXOA 3SO8A 2GGFA 4XKBA 2J49A 3B7RL 3HVEB 1ZB1A 2XENA 4HOQA 2PM6A 3FULA 3RRMB 3UMVA 4RLYA 4GPKA 3OAWA 2V4HC 5ENTD 2XS8A 4CCAA 2EIME 3CHRA 2ZGGA 2ETBA 5CRUA 4EBAG 2XZDG 3NBNB 3HDXA 2Y4TA 1H19A 5EX3A 2HYZA 2GRLA 4CDRA 2F8YA 1U3DA 4AXHA 1BLXB 3FTUA 3I4RB 5AQBA 2WM9A 4AM9A 3MYVA 4O1PA 1O1TA 4HXIA 4N3CA 2WXMA 1NZNA 4RQIA 1IXVA 3BU8A 2R2LA 3RKVA 1W3BA 1SW6A 2Y1LE 2AW6A 3DSXA 4K5AB 3ZYLA 3SQVA 1NL4A 1OWPA 2EILE 2C0LA 3UT7A 5T3RA 2H6GA 2GRPB 2XPZA 2IF4A 4E85A 5FINA 1NP7A 3FU6A 3IEGA 1AP7A 3UM1A 3ASGA 4U7EB 1KZPA 3CHOA 2OVBA 3LCAA 4NIKA 1SZAA 2VGXA 2RFAA 4TXQA 3JQ0A 2RG8A 1SQMA 4AY6A 2VGEA 4FADA 4KT6B 2DZNA 5FT9A 3ONLA 1JCQA 4HI9A 5LCWJ 4CZ2D 2J07A 5AENA 3T8KA 4Y6CA 4GYYA 3Q49B 4DX1A 2XCCA 3UM3A 4JW1A 4BSXA 2Y4UA 2E2EA 1MQSA 3CVLA 1IQUA 4UI9J 4G1TA 4HOUA 4HB5A 2I1KA 4F3VA 3CHQA 3WG7E 1EYHA 2V5QC 3SBSA 2DIWA 5JHBA 2I1JA 3KAEA 2P9SG 5EX0A 4KBQA 3IKOB 4U96D 5AIJA 3UM0A 4U0ZA 1TN7A 1Y6IA 3ZYQA 1WG0A 2FO1E 3UX4A 2NSZA 3C98A 3RO2A 3ZU7B 3ZNGA 4A1GA 2WXLA 2R5SA 3I4GA 4CRWA 4LNGA 2DYSE 2WXPA 2CFZA 2Y0BG 1Y8MA 4J8YA 1QYMA 2XZTG 3CSTA 4ACLA 4W9RA 3ZYMA 3PREA 3G2WA 3P1UA 2GW1A 4A55A 3HG0D 3Q7FA 4HVBA 4HBDA 3TWRA 3GZSA 3QARA 2V5FA 2CHZA 4DX6D 2H6FA 2RFMA 1AWCB 3S7DA 3DXKG 4KXKB 3CKBA 5ENPD 4G23A 4JA9A 3QWPA 4PH4B 4BT9A 3C3OA 2VGXB 4B89A 5ENSD 5LCWC 4BY6A 4ABNA 4N39A 3ONKA 1E7UA 4GZ3A 2HO1A 3TWTA 2EQXA 4WAFA 2AXZA 2J4DA 5BW8C 3HXDA 3CEQA 3UPVA 1MX6A 4UI9C 4LNUD 3QB2A 4AOFA 2IU1A 4HOSA 4GTOA 1X5BA 3PVLA 5ENNA 4Q96A 1U3CA 5FZRA 2KC7A 4ZHBA 4L1BA 4OYSA 3S7JA 4FULA 3ZKJA 4U95D 3MKRA 2Y3AA 4I43A 2P2CP 5G04J 5AQ7A 3CVYA 3SGHA 4FHJA 1KT1A 5KNGA 3FP3A 3Q9UC 3R9MA 5FQ8A 3CIAA 1IYGA 3AG3E 2LXLA 1L5JA 4WNEA 3CVWA 3SFYA 2PM7A 1N95A 2L6BA 4JEUA 4I9CA 1WM5A 2UY1B 3RO3A 4IRUA 3DBSA 2WXFA 1O5MA 3V2OA
chains in the Genus database with same CATH topology
4EHMA 1N9AA 3DSUA 1FPPA 1N4QA 3C72A 3Q75A 1SA4A 2H6FA 1S64A 3KSLA 1SA5A 2IEJA 1LTXA 3DSSA 1JCQA 1S63A 3E30A 3HXCA 3HXBA 1D8DA 1QBQA 2F0YA 4MBGA 1TNUA 1JCRA 1DCEA 3DSVA 3E34A 4YDOA 1N94A 2ZIRA 4GTQA 2H6IA 1NI1A 3Q78A 3DRAA 3Q7AA 3PZ1A 4GTTA 3HXDA 1TNYA 3PZ3A 1X81A 1TN8A 1FT2A 3KSQA 1O1TA 3EUVA 1LD7A 3EU5A 3Q79A 3PZ4A 1N4SA 4GTVA 4GTRA 3HXEA 4GTOA 3DPYA 2R2LA 4LNBA 3E33A 1JCSA 4YDEA 2ZISA 1LD8A 1TNZA 2H6HA 3E37A 1TN7A 4GTMA 3DSXA 1D8EA 4L9PA 1TNOA 3E32A 1O1SA 4GTPA 3DSTA 3SFXA 1FT1A 1N4RA 1NL4A 2BEDA 1TNBA 3HXFA 4LNGA 2H6GA 3SFYA 3DSWA 4GTSA 1N95A 1KZPA 3PZ2A 1TN6A 1N4PA 1O1RA 3Q7FA 1MZCA 1O5MA 3Q73A 1KZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EHM A;  1N9A A;  3DSU A;  1FPP A;  1N4Q A;  3C72 A;  3Q75 A;  1SA4 A;  2H6F A;  1S64 A;  3KSL A;  1SA5 A;  2IEJ A;  1LTX A;  3DSS A;  1JCQ A;  1S63 A;  3E30 A;  3HXC A;  3HXB A;  1D8D A;  1QBQ A;  2F0Y A;  4MBG A;  1TNU A;  1JCR A;  1DCE A;  3DSV A;  3E34 A;  4YDO A;  1N94 A;  2ZIR A;  4GTQ A;  2H6I A;  1NI1 A;  3Q78 A;  3DRA A;  3Q7A A;  3PZ1 A;  4GTT A;  3HXD A;  1TNY A;  3PZ3 A;  1X81 A;  1TN8 A;  1FT2 A;  3KSQ A;  1O1T A;  3EUV A;  1LD7 A;  3EU5 A;  3Q79 A;  3PZ4 A;  1N4S A;  4GTV A;  4GTR A;  3HXE A;  4GTO A;  3DPY A;  2R2L A;  4LNB A;  3E33 A;  1JCS A;  4YDE A;  2ZIS A;  1LD8 A;  1TNZ A;  2H6H A;  3E37 A;  1TN7 A;  4GTM A;  3DSX A;  1D8E A;  4L9P A;  1TNO A;  3E32 A;  1O1S A;  4GTP A;  3DST A;  3SFX A;  1FT1 A;  1N4R A;  1NL4 A;  2BED A;  1TNB A;  3HXF A;  4LNG A;  2H6G A;  3SFY A;  3DSW A;  4GTS A;  1N95 A;  1KZP A;  3PZ2 A;  1TN6 A;  1N4P A;  1O1R A;  3Q7F A;  1MZC A;  1O5M A;  3Q73 A;  1KZO A; 
#chains in the Genus database with same CATH topology
 3PNT B;  5LOZ A;  4G26 A;  3CSF A;  1S64 A;  3FUJ A;  3APD A;  1QQE A;  2KBX A;  3GYZ A;  3PE4 A;  5CEC B;  5CMY A;  3V2X A;  4I6G A;  2LSU A;  2X3M A;  4JL0 A;  1NFI E;  4GZC A;  4EPZ A;  2WXQ A;  3L22 A;  5KCM A;  4YVO A;  3EHN A;  3G2S A;  3LY7 A;  2X6K A;  4WUY A;  3DRA A;  1Z3Y A;  1TNY A;  4F1S A;  3SZ7 A;  4XI9 A;  1TN8 A;  1K1A A;  4TXR A;  1V54 E;  3FTY A;  2KZT A;  4QFV A;  2F37 A;  3ZIM A;  5BV1 A;  3K9I A;  5FIO A;  2YIN A;  4U63 A;  2FO7 A;  4TV3 A;  4A3V A;  4AP2 A;  2VJ8 A;  4UWH A;  4YDY A;  3MJW A;  1HE8 A;  4YDE A;  1Q2Z A;  1DNP A;  2WXH A;  4XX5 A;  2I2O A;  3AU4 A;  2OVF A;  3OXL A;  3URZ A;  4CDN A;  2Y69 E;  5C2Y A;  3G2V A;  1N4R A;  3HIZ A;  3CV0 A;  2C0M A;  4KYO B;  4I6J A;  5G04 C;  1TJF A;  3RK6 A;  4G8L A;  1PAQ A;  4YDW A;  2P9I G;  5G05 J;  4HOR A;  3UTM A;  1HG2 A;  4NUR A;  3JCK C;  3RJV A;  2QC9 A;  2XEE A;  4BWR A;  5KBA A;  2OOE A;  3FTZ A;  4EHM A;  3SY2 A;  3D9K A;  1FPP A;  5B1B E;  3C72 A;  3Q75 A;  4DUI A;  1H2U A;  2DBA A;  4KMO A;  3HXC A;  4LER A;  3VLD A;  4UQX A;  1E8X A;  3CK8 A;  4DRX E;  4HOT A;  4I9E A;  1INZ A;  1FCH A;  4GMR A;  2WXK A;  2DCP A;  3BEE A;  5FZQ A;  3PNL B;  4LCT A;  4FLB A;  4TUU A;  2F8X K;  3FH5 A;  3L17 A;  5T4Y A;  3CQC B;  2KM4 A;  3SBT B;  3V30 A;  3P2B A;  1Z5S C;  1N4S A;  2XHE A;  1MJ0 A;  4PS3 A;  4FA6 A;  2J8S D;  1RZ4 A;  3FFL A;  2XPY A;  5ANR A;  4LNB A;  1JCS A;  1ELW A;  3UUX A;  4PS8 A;  4WWN A;  3FHE A;  2BED A;  2P9L G;  4GA2 A;  1TEZ A;  5CHE E;  3ZGQ A;  3SHF A;  4HS2 A;  4ANV A;  4U8Y D;  3TXM A;  4A63 B;  5JHA A;  2XGM A;  2VYI A;  5JJ6 A;  3SFZ A;  4OVU A;  4CGW A;  4J8S A;  5G05 C;  2CHW A;  2GRN B;  3QK0 A;  3L9T A;  2A5U A;  3RU0 A;  1FVH A;  5D66 A;  1GW6 A;  3MGB A;  1N4Q A;  4NQ0 A;  3B7B A;  4C0M A;  5BPP A;  3E30 A;  4JB8 P;  4LEU A;  3UIO C;  3EHM A;  2RKK A;  2XRY A;  5AAO A;  3DSV A;  4UWF A;  4HQD A;  1NA0 A;  3D9P A;  4BES A;  1PC2 A;  5FZS A;  1UW4 B;  1E7V A;  3DWL G;  3MKQ A;  5CCL A;  3D9L A;  3S7F A;  5JJ7 A;  3Q79 A;  3D9O A;  2QYU A;  3OXG A;  2LSV A;  4BX8 A;  5M72 A;  5AJD A;  4FLH A;  2ZIS A;  3FU0 A;  1YCS B;  5BV0 A;  3E37 A;  2ILR A;  4MRU A;  2NXP A;  3WXX A;  2OCC E;  3UT4 A;  4L9P A;  2XQ0 A;  3R7Q A;  4RSY A;  3VLE A;  3MV3 B;  1KLX A;  4MS6 A;  4G2V A;  4D10 C;  4EZK A;  3JXJ A;  2WPV A;  4K0R A;  1OWN A;  1Z3X A;  3CHS A;  4UI9 K;  2QFC A;  5D2M C;  2J08 A;  1TN6 A;  3PH0 C;  3D9I A;  1N4P A;  3EU9 A;  2R02 A;  3QWW A;  3TGO A;  3QWV A;  4GB9 A;  4B8C B;  1TJC A;  2L9B A;  3RRN B;  5KJM A;  1TNU A;  1JCR A;  5FWQ A;  2WB2 A;  4GPM A;  5ARF A;  2J9Q A;  5B3S E;  3E34 A;  4RG6 A;  3LEW A;  4L2Y A;  4LUN U;  2XGS A;  1NI1 A;  2FI7 A;  3TWS A;  2QZA A;  4EZL A;  3LS8 A;  3OTN A;  4TRQ A;  2J09 A;  1HFA A;  1D9S A;  4C9B B;  3R7R A;  4L23 A;  4N3A A;  3FTW A;  2A4Z A;  3LY9 A;  3IHY A;  3MKQ B;  4F7A A;  5D0O D;  3U64 A;  4I6E A;  2CG2 A;  2NC9 A;  3L13 A;  5FTP A;  1DCQ A;  2MOW A;  5KJL A;  3E32 A;  2XGO A;  5B1A E;  3LXU X;  4OAV B;  5AQ9 A;  4I2W A;  1HF8 A;  3MCX A;  3JXI A;  1BD8 A;  1P5Q A;  3BG0 B;  3RIB A;  1JUQ A;  3O4Z A;  3PZ2 A;  1ZU2 A;  2BKK B;  4JEH A;  4BEP A;  4FHK A;  1JPL A;  3ASN E;  5JMN D;  1BI7 B;  1KZO A;  1OT8 A;  1HG5 A;  2WXI A;  3FU5 A;  3KSL A;  5KJN A;  2WMN A;  4PUC A;  3KEZ A;  4TUM A;  1SVX A;  1OY3 D;  3HXB A;  1D8D A;  2YHE A;  5T8I A;  3PS6 A;  2MRI A;  2VSY A;  3CHP A;  1V55 E;  3G2T A;  1HS6 A;  5EIL A;  2OV8 A;  3IHV A;  2VQ2 A;  2KXP C;  5BXU A;  4I17 A;  3ABM E;  4B0Z A;  5H7P A;  3CR3 A;  4GTV A;  3QC1 A;  3Q15 A;  3CVX A;  3ZRH A;  1OWL A;  1A17 A;  4JC8 A;  3DEO A;  2YQ8 A;  3D9H A;  4ILG A;  4HLE A;  2XEH A;  3LDZ A;  1HH8 A;  3NQP A;  2V8S E;  4KZC A;  4RG9 A;  2VSX E;  3UQ3 A;  4ATZ D;  3TAX A;  1UN9 A;  1FVF A;  2WVI A;  3FTX A;  3HXF A;  1OCC E;  3NB2 A;  3CVQ A;  1WY6 A;  3UI2 A;  5FQ7 A;  3I5P A;  3LKU A;  4HNA D;  3AAA C;  4H7Y A;  4GTS A;  3CGH A;  2YNQ A;  5CBN A;  4DX2 A;  4K5C A;  1O1R A;  1WDY A;  4G8K A;  5E76 A;  3B7S A;  3EDT B;  4JHJ A;  3DSU A;  2VTB A;  1U2V G;  3LJN A;  3SF4 A;  4BET A;  1K1B A;  1QBQ A;  3FDH A;  4UQZ A;  5HS0 A;  1HZ4 A;  3JYS A;  3PZD A;  3F6Q A;  1MYO A;  4R7L A;  2WQ7 A;  4ACK A;  3ZXP A;  4AIF A;  3Q78 A;  3U4T A;  4WND A;  3TWV A;  1ELK A;  2ZXW E;  3IBE A;  3PZ4 A;  1JWG A;  2JEK A;  5EIB E;  1MX2 A;  1N11 A;  4ATG A;  3HXE A;  5ENR D;  1N52 A;  5E75 A;  2PNN A;  3UKU G;  2WQ6 A;  4HFG A;  3KD7 A;  2DWZ A;  3C5R A;  2P9N G;  5IY5 E;  1OWM A;  1TNO A;  3MX3 A;  2CG3 A;  1MHQ A;  3Q9N C;  4BTB A;  2LNI A;  2LAH A;  5ANL A;  4FU3 A;  1XNF A;  3AG4 E;  2KCK A;  4WWO A;  4UUC A;  3DSW A;  3PUK A;  3NAW A;  3FY4 A;  4JXT A;  3ML8 A;  3CVU A;  3PUJ A;  2HE0 A;  3AS8 A;  3ZFW A;  5CCM A;  1MZC A;  4GML A;  4ILH B;  4J0U A;  5FQ6 A;  3RRU A;  3ASO E;  2X38 A;  2VSO E;  2Q7F A;  5EDS A;  1YA0 A;  1LTX A;  4C48 B;  3VTY A;  5CED B;  5HRY A;  4ME2 A;  2CHX A;  2HM8 A;  3SI5 A;  4FJZ A;  4DLQ A;  2M63 A;  2EIK E;  3IXE A;  3NZS A;  1S70 B;  1OWO A;  3N71 A;  3FWV A;  4HLL A;  3DEP A;  2VTB B;  3FEX A;  1IQR A;  3AS5 A;  4J8D A;  2R17 C;  4AJW A;  4CYM D;  5CRV A;  4DLO A;  4I1A A;  3GZ1 A;  4MKT A;  3FH7 A;  2LAI A;  1UG3 A;  2I6H A;  1EPU A;  3OXF A;  3L16 A;  3PDN A;  1VDY A;  1TNZ A;  3T5X A;  2ETC A;  3TG4 A;  3QOU A;  2BKG A;  1D8E A;  3TWX A;  2QYJ A;  1N54 A;  1FT1 A;  1NA3 A;  4Q69 A;  4EZJ A;  1YMP A;  4AY5 A;  3NOG D;  4GAA A;  1KT0 A;  4HRL A;  2MHK A;  5DIZ A;  5J08 A;  2KZT B;  1B89 A;  2XS1 A;  4XIF A;  3FTS A;  2AXV A;  3ZN3 A;  5HQ8 A;  5CER B;  4GMJ A;  2GRQ B;  5EYL A;  3FUN A;  1SA4 A;  4ILI A;  4G25 A;  2B6C A;  4E6H A;  3T8M A;  3ISM C;  4J8E A;  3D3M A;  3PE3 A;  1HX8 A;  3AG2 E;  4WNF A;  4GTQ A;  4GZ6 A;  5BXO A;  3TXN A;  4JPS A;  3Q7A A;  2R59 A;  3QDN A;  3CKC A;  3I3N A;  5D0Q D;  4GA1 A;  2ION A;  3QKY A;  3VLF A;  4A3T A;  3D9M A;  2RD0 A;  3LPZ A;  3EHR A;  2IY0 C;  1QZ2 A;  2KAT A;  2VSN A;  4FP7 A;  2PQR A;  1ELR A;  2H6H A;  4UWL A;  5FJY A;  4CDM A;  1PY1 A;  4CT4 A;  2UWJ G;  4J6I A;  3LVR E;  4I2Z A;  2BTD A;  4BER A;  2R03 A;  3APC A;  4WWP A;  1WAO 1;  3MZL B;  2HR2 A;  5JJT A;  3C3Q A;  3ULY A;  1ZBP A;  3AU5 A;  2E0I A;  1H2V C;  2NYJ A;  3MA5 A;  4AVX A;  1G3N B;  3TG5 A;  4U07 A;  5EYP F;  5JA4 D;  2B0O E;  4XE0 A;  3BQO A;  3VTX A;  4PDX A;  3ENE A;  3BUA A;  1HXI A;  4QQI A;  4J7W A;  5AYW D;  3QNK A;  1BU9 A;  3CVN A;  3AJI A;  1E8Y A;  3X2Q E;  1LF8 A;  1EDU A;  4YND A;  3ESL A;  4B8A A;  4F53 A;  2AWI A;  3CK7 A;  2EIN E;  4JZY A;  3J5P A;  5A6C A;  2H6I A;  1E8W A;  5FQ4 A;  4GTT A;  1X81 A;  2QY7 A;  3CHM A;  4CEM A;  1OXJ A;  3KSQ A;  4NAC A;  1HU3 A;  2XRZ A;  2FBN A;  5CBO A;  4JHK A;  3CK9 A;  3AS4 A;  3KEA A;  2C2L A;  4IN3 B;  4UQY A;  2AVP A;  4GU5 A;  1UN8 A;  3HRA A;  3J5Q B;  3UIN C;  4K03 A;  3FEY A;  1O1S A;  3ML9 A;  3U66 A;  4KVO A;  2OEW A;  3FUI A;  3W9G A;  4XI0 A;  3UXG A;  1RW2 A;  3UT8 A;  3ZHE A;  1TR4 A;  4HRM B;  4WNG A;  2LO6 A;  3TWQ A;  4IUL A;  4AV7 A;  4EBA A;  4OAU C;  3L6A A;  1TYQ G;  5DBK A;  2X6F A;  2L6J A;  4EQF A;  1OCO E;  2IEJ A;  1K8K G;  4Q94 A;  4GZ5 A;  1H6K A;  3FH8 A;  5G55 A;  2F0Y A;  3ABK E;  3B7T A;  4B94 A;  2WXJ A;  1JWF A;  2FF4 A;  3W9F A;  2JAB A;  3LY8 A;  1N94 A;  4X8Q A;  5HKP A;  4B93 B;  1KPS B;  2ZU6 B;  4APF A;  2P58 C;  4U0U A;  5AQA A;  1H6P A;  3PZ1 A;  4GYW A;  4U0S A;  3PZ3 A;  2WXR A;  2EIJ E;  2IO2 C;  4NRH B;  2AXU A;  1BI8 B;  2UY1 A;  4HI8 A;  4AEZ C;  3EIQ C;  4GTR A;  3PRZ A;  4BX9 A;  2X6H A;  4ANU A;  4BTA A;  2IO3 C;  5ENQ D;  2JLB A;  5BUZ A;  1UOH A;  3TJP A;  3QAQ A;  3FUM A;  4GTM A;  2P9P G;  5C1D A;  1E8Z A;  3DXM G;  4GTP A;  3NOC D;  2X6I A;  1TNB A;  3L08 A;  4GCO A;  4DJA A;  2YHC A;  3U9W A;  4KZ0 A;  1Z6T A;  1N0R A;  3FU3 A;  2DYR E;  2J4B A;  3Q5M A;  4GZD A;  4Y6W A;  2BUG A;  1UJJ A;  4O1O A;  4Z68 A;  2P9U G;  1QNF A;  2IOS A;  2DVW A;  2WXG A;  3Q73 A;  2ETA A;  1N9A A;  4U8H A;  5EID A;  2X6J A;  3ZHE B;  3ZEF A;  5ARG A;  4P29 A;  4G11 A;  4JA7 A;  4MBG A;  3GZ2 A;  3EJN A;  3JUE A;  4A1S A;  4ANW A;  3G2U A;  5A7D B;  3CVV A;  3ASD A;  4XEI G;  2PL2 A;  4O6F A;  4M7C A;  5LFA A;  3T5V A;  4I1O B;  3CLJ A;  4DI4 A;  3FTV A;  3V79 K;  2WXN A;  3UIP C;  4N2S A;  2L0I A;  1FT2 A;  5ITZ F;  3EU5 A;  3S7B A;  2GRR B;  5BNW A;  3HYM B;  3FUD A;  4C0E A;  3DPY A;  2OEV A;  4DX7 D;  4CGV A;  3ULQ A;  1S0P A;  3FUE A;  3TWW A;  2XEV A;  1LD8 A;  5AJL A;  4FC8 A;  1EF1 C;  1SZ9 A;  4GYO A;  3JQ1 A;  5ENO D;  4I1M A;  3ULE G;  1DVP A;  3ZW3 A;  3KS2 A;  3LYA A;  5KJK A;  2P9K G;  3MEK A;  2DZO A;  1K3Z D;  3ABL E;  2LUH A;  4L2L A;  2OND A;  1MX4 A;  1IKN D;  5CEA A;  1H2T C;  3PEU B;  3JUI A;  2LXM A;  3NF1 A;  5CMW A;  4UWG A;  3APF A;  2A5E A;  5G2N A;  4K5B A;  4ANX A;  1OUV A;  4H7X A;  4IYP A;  2KCV A;  1IHG A;  3O48 A;  2VGY A;  5LX8 A;  3ZUV B;  3D9N A;  3SNX A;  4U04 A;  1DCE A;  4JD2 G;  4BT8 A;  5LP0 A;  2XPI A;  3E4B A;  4DI3 A;  4EEC A;  2ZGD A;  4YDO A;  3ZVV A;  2ZIR A;  4BSZ B;  2I9C A;  3QJZ A;  4N3B A;  4GCN A;  5KNH D;  4KVM A;  3GW4 A;  4MLP A;  4LG6 A;  3S2A A;  3L54 A;  2IQC A;  2IFU A;  1HO8 A;  3RAU A;  3SD5 A;  3ASF A;  4HRN A;  4DK5 A;  3Q4A B;  4DPR A;  3B95 A;  4CT0 A;  2IOL A;  3IV0 A;  3FUK A;  4F1P A;  3UM2 A;  1A5E A;  3HVE A;  5AN8 A;  3ZXS A;  4OVV A;  1UJK A;  3MV2 B;  4PS7 A;  4DX5 D;  4URK A;  1OCZ E;  3ESK A;  4U8V D;  4ZFH A;  5EN5 D;  3T9K A;  1E96 B;  3EIJ A;  2MYO A;  2CFU A;  3V31 A;  2IJG X;  3BG1 B;  3ZYK A;  3L82 A;  2L0T B;  5EKQ D;  3AG1 E;  4J8F A;  3HHM A;  4LRZ A;  3Q47 B;  3B13 A;  1SA5 A;  3DSS A;  3EHQ A;  1S63 A;  3U3W A;  4XKC A;  2WQH A;  3FUF A;  2FEZ A;  5A23 A;  4JHR A;  1N0Q A;  4L7T A;  2BF0 X;  1H6O A;  2PQN A;  1DC2 A;  3CVP A;  1OCR E;  3LJ3 A;  1XGW A;  2V0P A;  2V4L A;  4JVS A;  2GRO B;  5KWD A;  1IHB A;  1E90 A;  5HI7 A;  2AJA A;  3CQG B;  2XCB A;  4APO A;  4UWK A;  4TXP A;  4N5C A;  5J90 A;  3UKR G;  3EUV A;  3C3R A;  1LD7 A;  3PEV B;  4F6R D;  1BPO A;  4BFR A;  3R9A B;  3B7U X;  2WMO A;  3LVQ E;  4V3I A;  3TWU A;  4LSZ E;  3E33 A;  4O60 A;  3ASH A;  3DPD A;  4YVQ C;  3FUH A;  3ZPJ A;  3TL5 A;  4RVB A;  5BT1 A;  4G24 A;  2R05 A;  3D9J A;  3NZU A;  4XZ4 A;  5AAR A;  2PZI A;  1H0A A;  3DST A;  3SFX A;  4N2Q A;  2GRM A;  4FJY A;  4M3O A;  3RSE G;  4GA0 A;  2KCL A;  2FUL A;  4N5Q A;  1YYH A;  2WXO A;  3SO8 A;  2GGF A;  4XKB A;  2J49 A;  3B7R L;  3HVE B;  1ZB1 A;  2XEN A;  4HOQ A;  2PM6 A;  3FUL A;  3RRM B;  3UMV A;  4RLY A;  4GPK A;  3OAW A;  2V4H C;  5ENT D;  2XS8 A;  4CCA A;  2EIM E;  3CHR A;  2ZGG A;  2ETB A;  5CRU A;  4EBA G;  2XZD G;  3NBN B;  3HDX A;  2Y4T A;  1H19 A;  5EX3 A;  2HYZ A;  2GRL A;  4CDR A;  2F8Y A;  1U3D A;  4AXH A;  1BLX B;  3FTU A;  3I4R B;  5AQB A;  2WM9 A;  4AM9 A;  3MYV A;  4O1P A;  1O1T A;  4HXI A;  4N3C A;  2WXM A;  1NZN A;  4RQI A;  1IXV A;  3BU8 A;  2R2L A;  3RKV A;  1W3B A;  1SW6 A;  2Y1L E;  2AW6 A;  3DSX A;  4K5A B;  3ZYL A;  3SQV A;  1NL4 A;  1OWP A;  2EIL E;  2C0L A;  3UT7 A;  5T3R A;  2H6G A;  2GRP B;  2XPZ A;  2IF4 A;  4E85 A;  5FIN A;  1NP7 A;  3FU6 A;  3IEG A;  1AP7 A;  3UM1 A;  3ASG A;  4U7E B;  1KZP A;  3CHO A;  2OVB A;  3LCA A;  4NIK A;  1SZA A;  2VGX A;  2RFA A;  4TXQ A;  3JQ0 A;  2RG8 A;  1SQM A;  4AY6 A;  2VGE A;  4FAD A;  4KT6 B;  2DZN A;  5FT9 A;  3ONL A;  1JCQ A;  4HI9 A;  5LCW J;  4CZ2 D;  2J07 A;  5AEN A;  3T8K A;  4Y6C A;  4GYY A;  3Q49 B;  4DX1 A;  2XCC A;  3UM3 A;  4JW1 A;  4BSX A;  2Y4U A;  2E2E A;  1MQS A;  3CVL A;  1IQU A;  4UI9 J;  4G1T A;  4HOU A;  4HB5 A;  2I1K A;  4F3V A;  3CHQ A;  3WG7 E;  1EYH A;  2V5Q C;  3SBS A;  2DIW A;  5JHB A;  2I1J A;  3KAE A;  2P9S G;  5EX0 A;  4KBQ A;  3IKO B;  4U96 D;  5AIJ A;  3UM0 A;  4U0Z A;  1TN7 A;  1Y6I A;  3ZYQ A;  1WG0 A;  2FO1 E;  3UX4 A;  2NSZ A;  3C98 A;  3RO2 A;  3ZU7 B;  3ZNG A;  4A1G A;  2WXL A;  2R5S A;  3I4G A;  4CRW A;  4LNG A;  2DYS E;  2WXP A;  2CFZ A;  2Y0B G;  1Y8M A;  4J8Y A;  1QYM A;  2XZT G;  3CST A;  4ACL A;  4W9R A;  3ZYM A;  3PRE A;  3G2W A;  3P1U A;  2GW1 A;  4A55 A;  3HG0 D;  3Q7F A;  4HVB A;  4HBD A;  3TWR A;  3GZS A;  3QAR A;  2V5F A;  2CHZ A;  4DX6 D;  2H6F A;  2RFM A;  1AWC B;  3S7D A;  3DXK G;  4KXK B;  3CKB A;  5ENP D;  4G23 A;  4JA9 A;  3QWP A;  4PH4 B;  4BT9 A;  3C3O A;  2VGX B;  4B89 A;  5ENS D;  5LCW C;  4BY6 A;  4ABN A;  4N39 A;  3ONK A;  1E7U A;  4GZ3 A;  2HO1 A;  3TWT A;  2EQX A;  4WAF A;  2AXZ A;  2J4D A;  5BW8 C;  3HXD A;  3CEQ A;  3UPV A;  1MX6 A;  4UI9 C;  4LNU D;  3QB2 A;  4AOF A;  2IU1 A;  4HOS A;  4GTO A;  1X5B A;  3PVL A;  5ENN A;  4Q96 A;  1U3C A;  5FZR A;  2KC7 A;  4ZHB A;  4L1B A;  4OYS A;  3S7J A;  4FUL A;  3ZKJ A;  4U95 D;  3MKR A;  2Y3A A;  4I43 A;  2P2C P;  5G04 J;  5AQ7 A;  3CVY A;  3SGH A;  4FHJ A;  1KT1 A;  5KNG A;  3FP3 A;  3Q9U C;  3R9M A;  5FQ8 A;  3CIA A;  1IYG A;  3AG3 E;  2LXL A;  1L5J A;  4WNE A;  3CVW A;  3SFY A;  2PM7 A;  1N95 A;  2L6B A;  4JEU A;  4I9C A;  1WM5 A;  2UY1 B;  3RO3 A;  4IRU A;  3DBS A;  2WXF A;  1O5M A;  3V2O A; 
#chains in the Genus database with same CATH homology
 4EHM A;  1N9A A;  3DSU A;  1FPP A;  1N4Q A;  3C72 A;  3Q75 A;  1SA4 A;  2H6F A;  1S64 A;  3KSL A;  1SA5 A;  2IEJ A;  1LTX A;  3DSS A;  1JCQ A;  1S63 A;  3E30 A;  3HXC A;  3HXB A;  1D8D A;  1QBQ A;  2F0Y A;  4MBG A;  1TNU A;  1JCR A;  1DCE A;  3DSV A;  3E34 A;  4YDO A;  1N94 A;  2ZIR A;  4GTQ A;  2H6I A;  1NI1 A;  3Q78 A;  3DRA A;  3Q7A A;  3PZ1 A;  4GTT A;  3HXD A;  1TNY A;  3PZ3 A;  1X81 A;  1TN8 A;  1FT2 A;  3KSQ A;  1O1T A;  3EUV A;  1LD7 A;  3EU5 A;  3Q79 A;  3PZ4 A;  1N4S A;  4GTV A;  4GTR A;  3HXE A;  4GTO A;  3DPY A;  2R2L A;  4LNB A;  3E33 A;  1JCS A;  4YDE A;  2ZIS A;  1LD8 A;  1TNZ A;  2H6H A;  3E37 A;  1TN7 A;  4GTM A;  3DSX A;  1D8E A;  4L9P A;  1TNO A;  3E32 A;  1O1S A;  4GTP A;  3DST A;  3SFX A;  1FT1 A;  1N4R A;  1NL4 A;  2BED A;  1TNB A;  3HXF A;  4LNG A;  2H6G A;  3SFY A;  3DSW A;  4GTS A;  1N95 A;  1KZP A;  3PZ2 A;  1TN6 A;  1N4P A;  1O1R A;  3Q7F A;  1MZC A;  1O5M A;  3Q73 A;  1KZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...