3KSQA

Discovery of c-imidazole azaheptapyridine fpt inhibitors
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of C-imidazole azaheptapyridine FPT inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Farnesyltransferase, CAAX box, alpha
total genus 126
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3ksqA00
4GTRA 2ZIRA 3DSWA 2R2LA 3DSXA 2H6GA 4GTOA 3DSUA 1MZCA 3DSVA 1JCQA 3E32A 3E37A 4GTTA 1X81A 4GTVA 3PZ3A 1N4QA 1KZPA 3E33A 1TNUA 1TN8A 3DSTA 3Q7AA 1NI1A 1SA5A 1O1TA 1D8DA 1S63A 3Q79A 1D8EA 3DSSA 3HXBA 1N4SA 4GTMA 1O5MA 2H6IA 4YDOA 1N94A 1FPPA 1JCSA 3EUVA 1NL4A 2BEDA 3Q78A 4LNGA 2IEJA 1TNOA 4EHMA 3PZ2A 1N4PA 3EU5A 1SA4A 3PZ4A 1LD8A 1JCRA 2F0YA 3HXDA 1TNYA 1LD7A 1S64A 1TN7A 2H6FA 3E34A 3HXFA 3DPYA 3DRAA 2ZISA 1TNBA 1TN6A 1LTXA 1N95A 3PZ1A 1O1RA 3E30A 3HXCA 4YDEA 2H6HA 1QBQA 3Q75A 1DCEA 4L9PA 3KSQA 1N4RA 3C72A 3SFYA 4GTPA 4MBGA 1O1SA 3KSLA 1N9AA 4GTSA 1FT1A 1TNZA 4LNBA 1KZOA 3SFXA 3HXEA 4GTQA 1FT2A 3Q73A 3Q7FA
chains in the Genus database with same CATH superfamily
4LNUD 3UT8A 1BU9A 4UI9J 3ASFA 3C5RA 1W3BA 1JWGA 4TUMA 1JCQA 5KBAA 5HKPA 5JJ6A 5A7DB 4CEMA 1BPOA 5D66A 1SVXA 4F53A 4BESA 2P58C 4KVMA 1TNUA 4KXKB 3FDHA 5KJLA 3FTXA 1UW4B 2BKKB 4B8CB 3FUNA 1OUVA 3UQ3A 2OOEA 4GZ5A 4GCNA 3SD5A 3ABLE 4GTMA 2H6IA 4I1AA 4N39A 3ZYMA 1U3DA 2PNNA 3L82A 1K8KG 4PH4B 2P9SG 3KD7A 4LG6A 2KZTA 1TNOA 5T3RA 3ENEA 2GRLA 5B1AE 4W9RA 4ANUA 3G2VA 2KM4A 2RFAA 2CG3A 3E34A 1UOHA 5EX0A 3MYVA 5FQ4A 2PM6A 3R9AB 3AG2E 3DXMG 3U9WA 4UWKA 3RRMB 2A5EA 5FQ6A 4CDRA 5KNHD 5FQ8A 4IYPA 4DLQA 5AARA 3ISMC 4WWPA 4B93B 1K3ZD 1O1SA 3KSLA 4GU5A 3U66A 4F7AA 2VGYA 2EIKE 2ILRA 4RQIA 3LXUX 3SFXA 4DLOA 1Z3XA 2WB2A 4R7LA 2NC9A 3TWSA 3TAXA 4WWOA 5JJ7A 1OWMA 3AG1E 3GYZA 2J4DA 2M63A 5BT1A 1ZB1A 1E8ZA 2LAHA 1SZAA 3CHOA 2RFMA 2Y1LE 1PAQA 4AP2A 3ULQA 1D8DA 1FCHA 1ELRA 1D8EA 4WAFA 4ATZD 3DSSA 2V8SE 2Y3AA 2WM9A 3C3OA 3CVQA 2Q7FA 4LCTA 5FWQA 5A6CA 4J0UA 4LNGA 2XGSA 2WQ7A 3G2UA 3TJPA 1JCRA 2VSXE 3UUXA 3CHSA 2L6BA 3UT7A 1N95A 2WXJA 2P9LG 4JW1A 3SF4A 3AG4E 4KVOA 2XZTG 3EDTB 4ZHBA 3Q47B 3QWPA 3AS4A 3T5VA 1Q2ZA 1FT1A 5JHAA 3KAEA 1E7VA 1OCOE 1DVPA 1KZOA 1V54E 4GB9A 4WNDA 1HH8A 5LCWJ 1OY3D 3MZLB 5D0OD 2J07A 5CEDB 3U3WA 4GMRA 4CYMD 2Y0BG 4GTOA 3W9GA 1TYQG 4BETA 2EIME 3MJWA 2XRYA 1OWNA 1XNFA 3UM0A 1OWOA 4FHJA 3B7SA 2EILE 4Z68A 3V31A 3IKOB 3DSTA 3D9JA 3FWVA 1SA5A 1G3NB 3Q9NC 1L5JA 1JWFA 4BT8A 3Q79A 2LSVA 3J5QB 4EZJA 4U07A 4DUIA 4RLYA 3PS6A 5AQ9A 3AG3E 2YHCA 4URKA 4AXHA 2VGEA 3PZ4A 3TWXA 5LFAA 3RKVA 3ESLA 2I1JA 4BSZB 5FZSA 4DJAA 4DX2A 1OT8A 4G2VA 4EBAG 1TN6A 1LTXA 5FZQA 3UPVA 1QYMA 5FTPA 4TXRA 5CBOA 4CGVA 1NA0A 3URZA 4EECA 3VLDA 3IEGA 3LY9A 1HG5A 2PM7A 3Q5MA 3L08A 2XGOA 3CSFA 2HE0A 4A55A 4B89A 2QFCA 4NIKA 4LSZE 3VLEA 1MZCA 3E32A 2GRMA 3TWQA 2R5SA 5HQ8A 1N54A 2NXPA 1KPSB 3BG0B 2X6KA 1H19A 3NAWA 3E33A 4N3BA 3LS8A 2LNIA 2QYJA 1NI1A 2P9UG 3WG7E 3BEEA 2XCBA 4HRNA 3ZGQA 2OEVA 5JA4D 4IULA 4A1GA 4DI3A 1DC2A 2IY0C 2LSUA 2Y4TA 3LKUA 4HRMB 1E8XA 1DNPA 3RAUA 3L22A 3TWTA 4JC8A 4XI9A 4TRQA 2GGFA 2ZISA 5EYPF 4NRHB 3UIPC 1IKND 3FTUA 3ML8A 2MOWA 3UXGA 1EYHA 1KLXA 1OWLA 1BI8B 4G1TA 5FJYA 3C72A 4XE0A 4U0UA 2PZIA 3EU9A 4IN3B 2GW1A 4JVSA 3TG5A 3DEPA 3WXXA 5CCLA 4X8QA 4U0SA 5AJDA 2DIWA 4FLBA 4MRUA 1H2TC 4H7YA 3MKQB 4V3IA 2KCLA 3MGBA 3EJNA 1Z6TA 1E8YA 1FVFA 3HYMB 3NF1A 2IQCA 1KZPA 2CHZA 1PY1A 3ZW3A 5CCMA 4GA1A 1UG3A 3BG1B 3QWWA 1MYOA 2E0IA 3RRNB 2HO1A 4J7WA 1ELKA 2X6HA 1H6OA 1UJJA 3CSTA 1MX2A 3SNXA 3FUMA 3RK6A 3FTSA 3CV0A 1S70B 1WY6A 3NZSA 3QJZA 1E7UA 2QC9A 3APDA 3B7UX 4CCAA 4XI0A 5G55A 5BW8C 4UWFA 5A23A 3L54A 2IF4A 2X3MA 2WMOA 3PZ1A 4KZ0A 3B95A 3T9KA 4ABNA 4F6RD 2KC7A 3IHVA 5EN5D 3FUFA 4WWNA 4GYOA 3R7RA 5JMND 2E2EA 2JEKA 4MBGA 4U7EB 3G2SA 1Z5SC 4GYYA 2HR2A 3QC1A 4NURA 2VQ2A 3Q73A 2WXKA 4I6EA 4G11A 3FEYA 3G2TA 2YHEA 2KZTB 5B1BE 1H6KA 1EDUA 3D3MA 3MV3B 3CKBA 3PEUB 2WXGA 4MLPA 4WUYA 5H7PA 3U4TA 3FH8A 4DX6D 3CVUA 4M3OA 4G24A 4RG6A 3UTMA 4P29A 2LO6A 4EZKA 1OCCE 2VSOE 3FU6A 2A5UA 4N2QA 3UT4A 3CHQA 4J8DA 3CHPA 2EIJE 3Q49B 4XIFA 5ARGA 3TXNA 5CECB 1AWCB 4PDXA 1TJFA 3MX3A 4OYSA 3QKYA 3CVVA 2WXNA 3LY7A 5BV1A 1TNYA 2L0TB 2KXPC 4WNEA 4HOTA 4AEZC 5G04J 4O6FA 5LOZA 2VGXB 4G8KA 4L2LA 2WXLA 3Q4AB 5CERB 4HLLA 3SY2A 3DEOA 2GRRB 4NACA 3QNKA 4ATGA 3TWVA 3I5PA 2OCCE 2Y4UA 1NA3A 3ABKE 1HXIA 2EINE 3PUKA 3PE4A 3HXEA 4MKTA 3GZSA 2XPIA 1NFIE 3NZUA 5ANLA 4U96D 4K5CA 3C3QA 2H6GA 4F3VA 3CVYA 4KYOB 2DZNA 2KCKA 5ENRD 3PDNA 4GTTA 3FEXA 2RD0A 3JYSA 3NOGD 3SFZA 1N4QA 2ONDA 4HXIA 3ZKJA 2CHWA 1YCSB 4HI8A 4I43A 2RKKA 1O1TA 1E90A 2WVIA 4EZLA 1YA0A 2IO3C 3TGOA 3CEQA 2FULA 4I2ZA 3UM2A 5AQ7A 1JCSA 1K1AA 2VGXA 3FULA 3ZN3A 2IEJA 3JXJA 2F37A 3TWRA 2LUHA 4AY6A 2VJ8A 4XKCA 5FINA 4G23A 3ZVVA 1TJCA 2DZOA 1NP7A 4TUUA 1IQRA 3JXIA 2AWIA 4I9EA 3MV2B 4IRUA 4BSXA 4YDEA 4C0MA 2H6HA 1QBQA 3T8MA 5EIBE 3Q75A 3D9MA 1HS6A 3UKRG 3SFYA 3CK8A 2XEEA 3TXMA 1HF8A 4EQFA 2EQXA 5EX3A 1SQMA 3PEVB 3N71A 2R2LA 4YDWA 3FUEA 4RSYA 4UQZA 2ZGGA 3TL5A 1MX6A 2XGMA 4Q96A 1H6PA 1GW6A 4U8HA 3S7BA 2DVWA 5CMYA 1XGWA 3W9FA 3OXGA 2WQHA 4OVVA 3RIBA 3C3RA 5BXUA 3C98A 5BNWA 3EHNA 1V55E 2I1KA 3HXBA 1O5MA 3GW4A 3AS8A 2WXHA 4DRXE 3KS2A 1IHGA 1D9SA 2JABA 4QFVA 3FTYA 3EUVA 2UY1B 2J08A 1SA4A 4FLHA 1TEZA 3ULYA 2H6FA 5ENQD 4YVQC 5CMWA 4U8YD 1IXVA 4PS7A 3E30A 3ULEG 1TR4A 5M72A 3BU8A 2YQ8A 3ZYQA 4DI4A 4HFGA 3HVEB 3SQVA 4N3CA 3MEKA 5D0QD 1INZA 4CGWA 4GTQA 1QZ2A 3FTZA 5EYLA 2V0PA 3FU5A 3ZYKA 3B13A 2HM8A 4RG9A 4DX1A 3L13A 1Y6IA 2JLBA 3CKCA 3QWVA 4GAAA 4XKBA 1HG2A 1X81A 2ZGDA 3DWLG 1BI7B 4KBQA 1ELWA 4I6JA 1S0PA 2AXVA 1U2VG 4I2WA 3O4ZA 1S63A 3D9HA 1Y8MA 5BV0A 4ANXA 5IY5E 3LY8A 4K0RA 2XPZA 4UWHA 3ASDA 2VTBA 1AP7A 1FPPA 2R03A 4FP7A 2GRNB 3D9NA 2VSYA 5ANRA 3RU0A 2OV8A 5J90A 4ACKA 4GYWA 4BY6A 1N4PA 4EPZA 4K5BA 3JQ1A 3UKUG 3QOUA 5AYWD 4GZDA 4UI9C 3SBSA 3NBNB 4CRWA 3QAQA 3SBTB 2R17C 4WNGA 5FZRA 3UM3A 4A3VA 4G8LA 4JD2G 4G26A 4Q94A 4ILGA 3CR3A 3ONKA 3J5PA 4HOSA 1N0RA 2DYRE 3B7BA 4JHRA 4JZYA 2DCPA 3ZEFA 1JUQA 3Q7FA 3TWWA 1E8WA 2ZIRA 4U63A 2C0LA 5E75A 5T8IA 4HORA 4XZ4A 4AVXA 3CQCB 3X2QE 1N52A 2J4BA 2L6JA 4AOFA 2QZAA 2LAIA 4N3AA 4BEPA 4CT4A 3PZ3A 4DX5D 2L9BA 4A63B 4E6HA 3FTWA 4J8YA 4B94A 2PQRA 2UWJG 2J49A 4YDYA 5AQBA 5G04C 4YDOA 3ZRHA 4GZ6A 2IOSA 1NL4A 5DIZA 5ENOD 3UINC 4YVOA 3ASOE 4I1MA 3QDNA 4JA7A 4JL0A 3UX4A 3FUIA 4FADA 2F0YA 2DWZA 3ABME 3O48A 2B6CA 2NYJA 1TNBA 4JEUA 3ZPJA 3SZ7A 1OCRE 2WXQA 5C1DA 3UMVA 2I2OA 4DPRA 3U64A 4HOUA 1JPLA 3IHYA 4BFRA 4H7XA 1BLXB 2BF0X 3R9MA 2P9KG 5KJNA 4EBAA 3MCXA 2ZXWE 1KT0A 1UN8A 5G2NA 3ZXPA 3NOCD 4NQ0A 1P5QA 3CQGB 4DX7D 4HB5A 3PVLA 3MKRA 4QQIA 4TV3A 2LXMA 1ZBPA 5KJKA 5KJMA 4GTVA 1RZ4A 5KCMA 3SI5A 5ARFA 4LERA 4Y6WA 2YINA 3JQ0A 5ENNA 2NSZA 1SW6A 5AN8A 2ZU6B 5AQAA 5KNGA 3DPDA 1LF8A 2XS8A 3ESKA 3ML9A 2J09A 3ZYLA 1N94A 3AU4A 3HIZA 3GZ2A 2IO2C 1EF1C 3P2BA 1WM5A 1H2VC 1A5EA 2P9PG 3UIOC 3PH0C 1S64A 4CDMA 4TXQA 3DPYA 3DRAA 2DYSE 3SHFA 5EDSA 3PZDA 4Q69A 5FT9A 4ILIA 1IYGA 3KEAA 3D9PA 3HXCA 5ENPD 5D2MC 3VLFA 3IV0A 3FH5A 3ZNGA 2XENA 4L9PA 2ETCA 1HU3A 4HS2A 3D9LA 3L16A 2CG2A 4GZ3A 1SZ9A 3CIAA 2I9CA 4J6IA 1RW2A 4AV7A 2KBXA 2AXUA 2OVBA 2FF4A 2VYIA 1UN9A 3ZUVB 3OTNA 1TN8A 3PE3A 3VTXA 3DSWA 2ETAA 4UWLA 3FUJA 3AU5A 3DSUA 2AXZA 3AJIA 3F6QA 1NZNA 4HI9A 4BT9A 4ACLA 3CK9A 1YMPA 3CLJA 2GROB 3LYAA 4HLEA 3S7JA 4B8AA 4JXTA 4FU3A 4AY5A 3P1UA 2UY1A 2V5FA 5G05C 2J9QA 5HI7A 3OAWA 3ASGA 3Q9UC 3S2AA 1N4SA 4Y6CA 4A1SA 4OAVB 3HDXA 3CVPA 3OXFA 4CZ2D 2CFUA 2GRQB 4C9BB 4MS6A 2IFUA 3EHRA 2P9IG 1OCZE 2IONA 3EU5A 2ETBA 1LD8A 4PS8A 5EIDA 3EHQA 3HXFA 3HRAA 4B0ZA 4RVBA 4OAUC 4O60A 2XHEA 5CEAA 3FUDA 2XCCA 2V4LA 4GPMA 4ANWA 3RRUA 3JUIA 3BUAA 3FHEA 3AS5A 3G2WA 4GTPA 4UQYA 4KMOA 1H0AA 1PC2A 4E85A 4GMJA 3B7TA 3S7FA 2MHKA 3ZIMA 2V5QC 3NQPA 5EILA 3I4RB 4AM9A 3APFA 1WG0A 5BUZA 3DSVA 3RSEG 3JUEA 4I17A 3RJVA 3I4GA 1KT1A 2BTDA 5CBNA 4BTBA 1HX8A 3HVEA 2XS1A 4J8SA 5FIOA 2KCVA 3VTYA 2LXLA 2FO1E 1VDYA 2F8XK 4FULA 1HZ4A 1IQUA 2B0OE 2CHXA 2CFZA 3ZXSA 5CRVA 3Q78A 1WDYA 3D9KA 4I1OB 3MKQA 3V2XA 3FTVA 3L9TA 2FBNA 4XEIG 3FU0A 1TN7A 1U3CA 4OVUA 3CVWA 1QNFA 3Q15A 1A17A 1O1RA 4ANVA 3QARA 1QQEA 4CT0A 2XEHA 2XQ0A 4HVBA 5C2YA 3HHMA 1Z3YA 2R02A 1IHBA 4HOQA 4GTSA 3I3NA 3QK0A 2X6JA 5AIJA 1TNZA 2FO7A 3EHMA 4I6GA 4UI9K 3ZU7B 1FT2A 5HS0A 4JB8P 4HBDA 3CVLA 4U8VD 4L7TA 3LDZA 4L2YA 1YYHA 2C0MA 3DBSA 3V2OA 3D9IA 2VTBB 4HRLA 4BWRA 4K5AB 3FUKA 1HO8A 3LVRE 5BXOA 2WXPA 3V79K 3Q7AA 3CK7A 4L1BA 4LEUA 4JEHA 1OXJA 4FA6A 3UI2A 4L23A 4BTAA 4U0ZA 4GCOA 2FI7A 2AVPA 1UJKA 2XEVA 2XZDG 3QB2A 4JA9A 4GA2A 5J08A 4ILHB 2BEDA 3PRZA 4UQXA 1DCQA 4EHMA 5E76A 4JHJA 2XPYA 2YNQA 4LRZA 2WPVA 3E4BA 2IOLA 3CVNA 2WQ6A 4M7CA 1ZU2A 2Y69E 2OEWA 4APOA 2KATA 4FC8A 2R59A 2P9NG 4I9CA 4UWGA 2PL2A 4J8EA 3ONLA 1N4RA 4UUCA 3CGHA 3RO3A 2XRZA 2OVFA 2AJAA 4ME2A 3IBEA 3UM1A 4GTRA 4FJZA 3IXEA 4GMLA 3OXLA 2A4ZA 3HG0D 4J8FA 1X5BA 4AIFA 3LVQE 3E37A 2WXIA 3FY4A 3T8KA 5CHEE 4KZCA 2X6IA 3TG4A 1FVHA 1HFAA 4PUCA 2P2CP 2WXOA 3JCKC 3ZHEB 2V4HC 4FHKA 4CDNA 1EPUA 3FFLA 4GPKA 4HQDA 3EIJA 3LEWA 2AW6A 4YNDA 5CRUA 2WXFA 3AAAC 3B7RL 2VSNA 4HNAD 2F8YA 2HYZA 4KT6B 5LP0A 3RO2A 3CHMA 4C0EA 5DBKA 3HXDA 4F1PA 4BERA 3BQOA 2R05A 3LJNA 3LCAA 5JJTA 4XX5A 3LJ3A 1B89A 4G25A 5EKQD 4U95D 2J8SD 4N5QA 1MJ0A 3TWUA 2X38A 4PS3A 1N9AA 5AENA 4K03A 5AJLA 2MRIA 2I6HA 4WNFA 4LNBA 5LCWC 5AAOA 2QY7A 4LUNU 2BKGA 3L17A 1H2UA 1MX4A 3ZFWA 3LPZA 3DSXA 4APFA 5T4YA 3APCA 3GZ1A 3FUHA 3PNLB 4FJYA 5FQ7A 3MA5A 5ITZF 3D9OA 4F1SA 3CVXA 5KWDA 2MYOA 4O1PA 4A3TA 2DBAA 3PREA 2GRPB 3DXKG 2L0IA 5LX8A 4C48B 2WXRA 2WMNA 4ZFHA 3NB2A 5ENTD 2IU1A 3KEZA 2PQNA 5G05J 2RG8A 2FEZA 4N5CA 3ZHEA 3FH7A 1MQSA 4GA0A 4N2SA 3R7QA 5B3SE 3FP3A 4BX9A 1E96B 3K9IA 3PZ2A 5HRYA 1WAO1 3EIQC 3T5XA 3FU3A 1LD7A 5ENSD 4D10C 3ASNE 4TXPA 3PNTB 5JHBA 2WXMA 1K1BA 2QYUA 2X6FA 3SO8A 4DK5A 1N0QA 2IJGX 3SGHA 1DCEA 4AJWA 3KSQA 4JPSA 3CHRA 3S7DA 4O1OA 3ASHA 4BX8A 1MHQA 1OWPA 2C2LA 3L6AA 3PUJA 1BD8A 4U04A 2BUGA 4JHKA 4GZCA 1HE8A 3V30A 5BPPA 1N11A
chains in the Genus database with same CATH topology
4GTRA 2ZIRA 3DSWA 2R2LA 3DSXA 2H6GA 4GTOA 3DSUA 1MZCA 3DSVA 1JCQA 3E32A 3E37A 4GTTA 1X81A 4GTVA 3PZ3A 1N4QA 1KZPA 3E33A 1TNUA 1TN8A 3DSTA 3Q7AA 1NI1A 1SA5A 1O1TA 1D8DA 1S63A 3Q79A 1D8EA 3DSSA 3HXBA 1N4SA 4GTMA 1O5MA 2H6IA 4YDOA 1N94A 1FPPA 1JCSA 3EUVA 1NL4A 2BEDA 3Q78A 4LNGA 2IEJA 1TNOA 4EHMA 3PZ2A 1N4PA 3EU5A 1SA4A 3PZ4A 1LD8A 1JCRA 2F0YA 3HXDA 1TNYA 1LD7A 1S64A 1TN7A 2H6FA 3E34A 3HXFA 3DPYA 3DRAA 2ZISA 1TNBA 1TN6A 1LTXA 1N95A 3PZ1A 1O1RA 3E30A 3HXCA 4YDEA 2H6HA 1QBQA 3Q75A 1DCEA 4L9PA 3KSQA 1N4RA 3C72A 3SFYA 4GTPA 4MBGA 1O1SA 3KSLA 1N9AA 4GTSA 1FT1A 1TNZA 4LNBA 1KZOA 3SFXA 3HXEA 4GTQA 1FT2A 3Q73A 3Q7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTR A;  2ZIR A;  3DSW A;  2R2L A;  3DSX A;  2H6G A;  4GTO A;  3DSU A;  1MZC A;  3DSV A;  1JCQ A;  3E32 A;  3E37 A;  4GTT A;  1X81 A;  4GTV A;  3PZ3 A;  1N4Q A;  1KZP A;  3E33 A;  1TNU A;  1TN8 A;  3DST A;  3Q7A A;  1NI1 A;  1SA5 A;  1O1T A;  1D8D A;  1S63 A;  3Q79 A;  1D8E A;  3DSS A;  3HXB A;  1N4S A;  4GTM A;  1O5M A;  2H6I A;  4YDO A;  1N94 A;  1FPP A;  1JCS A;  3EUV A;  1NL4 A;  2BED A;  3Q78 A;  4LNG A;  2IEJ A;  1TNO A;  4EHM A;  3PZ2 A;  1N4P A;  3EU5 A;  1SA4 A;  3PZ4 A;  1LD8 A;  1JCR A;  2F0Y A;  3HXD A;  1TNY A;  1LD7 A;  1S64 A;  1TN7 A;  2H6F A;  3E34 A;  3HXF A;  3DPY A;  3DRA A;  2ZIS A;  1TNB A;  1TN6 A;  1LTX A;  1N95 A;  3PZ1 A;  1O1R A;  3E30 A;  3HXC A;  4YDE A;  2H6H A;  1QBQ A;  3Q75 A;  1DCE A;  4L9P A;  3KSQ A;  1N4R A;  3C72 A;  3SFY A;  4GTP A;  4MBG A;  1O1S A;  3KSL A;  1N9A A;  4GTS A;  1FT1 A;  1TNZ A;  4LNB A;  1KZO A;  3SFX A;  3HXE A;  4GTQ A;  1FT2 A;  3Q73 A;  3Q7F A; 
#chains in the Genus database with same CATH topology
 4LNU D;  3UT8 A;  1BU9 A;  4UI9 J;  3ASF A;  3C5R A;  1W3B A;  1JWG A;  4TUM A;  1JCQ A;  5KBA A;  5HKP A;  5JJ6 A;  5A7D B;  4CEM A;  1BPO A;  5D66 A;  1SVX A;  4F53 A;  4BES A;  2P58 C;  4KVM A;  1TNU A;  4KXK B;  3FDH A;  5KJL A;  3FTX A;  1UW4 B;  2BKK B;  4B8C B;  3FUN A;  1OUV A;  3UQ3 A;  2OOE A;  4GZ5 A;  4GCN A;  3SD5 A;  3ABL E;  4GTM A;  2H6I A;  4I1A A;  4N39 A;  3ZYM A;  1U3D A;  2PNN A;  3L82 A;  1K8K G;  4PH4 B;  2P9S G;  3KD7 A;  4LG6 A;  2KZT A;  1TNO A;  5T3R A;  3ENE A;  2GRL A;  5B1A E;  4W9R A;  4ANU A;  3G2V A;  2KM4 A;  2RFA A;  2CG3 A;  3E34 A;  1UOH A;  5EX0 A;  3MYV A;  5FQ4 A;  2PM6 A;  3R9A B;  3AG2 E;  3DXM G;  3U9W A;  4UWK A;  3RRM B;  2A5E A;  5FQ6 A;  4CDR A;  5KNH D;  5FQ8 A;  4IYP A;  4DLQ A;  5AAR A;  3ISM C;  4WWP A;  4B93 B;  1K3Z D;  1O1S A;  3KSL A;  4GU5 A;  3U66 A;  4F7A A;  2VGY A;  2EIK E;  2ILR A;  4RQI A;  3LXU X;  3SFX A;  4DLO A;  1Z3X A;  2WB2 A;  4R7L A;  2NC9 A;  3TWS A;  3TAX A;  4WWO A;  5JJ7 A;  1OWM A;  3AG1 E;  3GYZ A;  2J4D A;  2M63 A;  5BT1 A;  1ZB1 A;  1E8Z A;  2LAH A;  1SZA A;  3CHO A;  2RFM A;  2Y1L E;  1PAQ A;  4AP2 A;  3ULQ A;  1D8D A;  1FCH A;  1ELR A;  1D8E A;  4WAF A;  4ATZ D;  3DSS A;  2V8S E;  2Y3A A;  2WM9 A;  3C3O A;  3CVQ A;  2Q7F A;  4LCT A;  5FWQ A;  5A6C A;  4J0U A;  4LNG A;  2XGS A;  2WQ7 A;  3G2U A;  3TJP A;  1JCR A;  2VSX E;  3UUX A;  3CHS A;  2L6B A;  3UT7 A;  1N95 A;  2WXJ A;  2P9L G;  4JW1 A;  3SF4 A;  3AG4 E;  4KVO A;  2XZT G;  3EDT B;  4ZHB A;  3Q47 B;  3QWP A;  3AS4 A;  3T5V A;  1Q2Z A;  1FT1 A;  5JHA A;  3KAE A;  1E7V A;  1OCO E;  1DVP A;  1KZO A;  1V54 E;  4GB9 A;  4WND A;  1HH8 A;  5LCW J;  1OY3 D;  3MZL B;  5D0O D;  2J07 A;  5CED B;  3U3W A;  4GMR A;  4CYM D;  2Y0B G;  4GTO A;  3W9G A;  1TYQ G;  4BET A;  2EIM E;  3MJW A;  2XRY A;  1OWN A;  1XNF A;  3UM0 A;  1OWO A;  4FHJ A;  3B7S A;  2EIL E;  4Z68 A;  3V31 A;  3IKO B;  3DST A;  3D9J A;  3FWV A;  1SA5 A;  1G3N B;  3Q9N C;  1L5J A;  1JWF A;  4BT8 A;  3Q79 A;  2LSV A;  3J5Q B;  4EZJ A;  4U07 A;  4DUI A;  4RLY A;  3PS6 A;  5AQ9 A;  3AG3 E;  2YHC A;  4URK A;  4AXH A;  2VGE A;  3PZ4 A;  3TWX A;  5LFA A;  3RKV A;  3ESL A;  2I1J A;  4BSZ B;  5FZS A;  4DJA A;  4DX2 A;  1OT8 A;  4G2V A;  4EBA G;  1TN6 A;  1LTX A;  5FZQ A;  3UPV A;  1QYM A;  5FTP A;  4TXR A;  5CBO A;  4CGV A;  1NA0 A;  3URZ A;  4EEC A;  3VLD A;  3IEG A;  3LY9 A;  1HG5 A;  2PM7 A;  3Q5M A;  3L08 A;  2XGO A;  3CSF A;  2HE0 A;  4A55 A;  4B89 A;  2QFC A;  4NIK A;  4LSZ E;  3VLE A;  1MZC A;  3E32 A;  2GRM A;  3TWQ A;  2R5S A;  5HQ8 A;  1N54 A;  2NXP A;  1KPS B;  3BG0 B;  2X6K A;  1H19 A;  3NAW A;  3E33 A;  4N3B A;  3LS8 A;  2LNI A;  2QYJ A;  1NI1 A;  2P9U G;  3WG7 E;  3BEE A;  2XCB A;  4HRN A;  3ZGQ A;  2OEV A;  5JA4 D;  4IUL A;  4A1G A;  4DI3 A;  1DC2 A;  2IY0 C;  2LSU A;  2Y4T A;  3LKU A;  4HRM B;  1E8X A;  1DNP A;  3RAU A;  3L22 A;  3TWT A;  4JC8 A;  4XI9 A;  4TRQ A;  2GGF A;  2ZIS A;  5EYP F;  4NRH B;  3UIP C;  1IKN D;  3FTU A;  3ML8 A;  2MOW A;  3UXG A;  1EYH A;  1KLX A;  1OWL A;  1BI8 B;  4G1T A;  5FJY A;  3C72 A;  4XE0 A;  4U0U A;  2PZI A;  3EU9 A;  4IN3 B;  2GW1 A;  4JVS A;  3TG5 A;  3DEP A;  3WXX A;  5CCL A;  4X8Q A;  4U0S A;  5AJD A;  2DIW A;  4FLB A;  4MRU A;  1H2T C;  4H7Y A;  3MKQ B;  4V3I A;  2KCL A;  3MGB A;  3EJN A;  1Z6T A;  1E8Y A;  1FVF A;  3HYM B;  3NF1 A;  2IQC A;  1KZP A;  2CHZ A;  1PY1 A;  3ZW3 A;  5CCM A;  4GA1 A;  1UG3 A;  3BG1 B;  3QWW A;  1MYO A;  2E0I A;  3RRN B;  2HO1 A;  4J7W A;  1ELK A;  2X6H A;  1H6O A;  1UJJ A;  3CST A;  1MX2 A;  3SNX A;  3FUM A;  3RK6 A;  3FTS A;  3CV0 A;  1S70 B;  1WY6 A;  3NZS A;  3QJZ A;  1E7U A;  2QC9 A;  3APD A;  3B7U X;  4CCA A;  4XI0 A;  5G55 A;  5BW8 C;  4UWF A;  5A23 A;  3L54 A;  2IF4 A;  2X3M A;  2WMO A;  3PZ1 A;  4KZ0 A;  3B95 A;  3T9K A;  4ABN A;  4F6R D;  2KC7 A;  3IHV A;  5EN5 D;  3FUF A;  4WWN A;  4GYO A;  3R7R A;  5JMN D;  2E2E A;  2JEK A;  4MBG A;  4U7E B;  3G2S A;  1Z5S C;  4GYY A;  2HR2 A;  3QC1 A;  4NUR A;  2VQ2 A;  3Q73 A;  2WXK A;  4I6E A;  4G11 A;  3FEY A;  3G2T A;  2YHE A;  2KZT B;  5B1B E;  1H6K A;  1EDU A;  3D3M A;  3MV3 B;  3CKB A;  3PEU B;  2WXG A;  4MLP A;  4WUY A;  5H7P A;  3U4T A;  3FH8 A;  4DX6 D;  3CVU A;  4M3O A;  4G24 A;  4RG6 A;  3UTM A;  4P29 A;  2LO6 A;  4EZK A;  1OCC E;  2VSO E;  3FU6 A;  2A5U A;  4N2Q A;  3UT4 A;  3CHQ A;  4J8D A;  3CHP A;  2EIJ E;  3Q49 B;  4XIF A;  5ARG A;  3TXN A;  5CEC B;  1AWC B;  4PDX A;  1TJF A;  3MX3 A;  4OYS A;  3QKY A;  3CVV A;  2WXN A;  3LY7 A;  5BV1 A;  1TNY A;  2L0T B;  2KXP C;  4WNE A;  4HOT A;  4AEZ C;  5G04 J;  4O6F A;  5LOZ A;  2VGX B;  4G8K A;  4L2L A;  2WXL A;  3Q4A B;  5CER B;  4HLL A;  3SY2 A;  3DEO A;  2GRR B;  4NAC A;  3QNK A;  4ATG A;  3TWV A;  3I5P A;  2OCC E;  2Y4U A;  1NA3 A;  3ABK E;  1HXI A;  2EIN E;  3PUK A;  3PE4 A;  3HXE A;  4MKT A;  3GZS A;  2XPI A;  1NFI E;  3NZU A;  5ANL A;  4U96 D;  4K5C A;  3C3Q A;  2H6G A;  4F3V A;  3CVY A;  4KYO B;  2DZN A;  2KCK A;  5ENR D;  3PDN A;  4GTT A;  3FEX A;  2RD0 A;  3JYS A;  3NOG D;  3SFZ A;  1N4Q A;  2OND A;  4HXI A;  3ZKJ A;  2CHW A;  1YCS B;  4HI8 A;  4I43 A;  2RKK A;  1O1T A;  1E90 A;  2WVI A;  4EZL A;  1YA0 A;  2IO3 C;  3TGO A;  3CEQ A;  2FUL A;  4I2Z A;  3UM2 A;  5AQ7 A;  1JCS A;  1K1A A;  2VGX A;  3FUL A;  3ZN3 A;  2IEJ A;  3JXJ A;  2F37 A;  3TWR A;  2LUH A;  4AY6 A;  2VJ8 A;  4XKC A;  5FIN A;  4G23 A;  3ZVV A;  1TJC A;  2DZO A;  1NP7 A;  4TUU A;  1IQR A;  3JXI A;  2AWI A;  4I9E A;  3MV2 B;  4IRU A;  4BSX A;  4YDE A;  4C0M A;  2H6H A;  1QBQ A;  3T8M A;  5EIB E;  3Q75 A;  3D9M A;  1HS6 A;  3UKR G;  3SFY A;  3CK8 A;  2XEE A;  3TXM A;  1HF8 A;  4EQF A;  2EQX A;  5EX3 A;  1SQM A;  3PEV B;  3N71 A;  2R2L A;  4YDW A;  3FUE A;  4RSY A;  4UQZ A;  2ZGG A;  3TL5 A;  1MX6 A;  2XGM A;  4Q96 A;  1H6P A;  1GW6 A;  4U8H A;  3S7B A;  2DVW A;  5CMY A;  1XGW A;  3W9F A;  3OXG A;  2WQH A;  4OVV A;  3RIB A;  3C3R A;  5BXU A;  3C98 A;  5BNW A;  3EHN A;  1V55 E;  2I1K A;  3HXB A;  1O5M A;  3GW4 A;  3AS8 A;  2WXH A;  4DRX E;  3KS2 A;  1IHG A;  1D9S A;  2JAB A;  4QFV A;  3FTY A;  3EUV A;  2UY1 B;  2J08 A;  1SA4 A;  4FLH A;  1TEZ A;  3ULY A;  2H6F A;  5ENQ D;  4YVQ C;  5CMW A;  4U8Y D;  1IXV A;  4PS7 A;  3E30 A;  3ULE G;  1TR4 A;  5M72 A;  3BU8 A;  2YQ8 A;  3ZYQ A;  4DI4 A;  4HFG A;  3HVE B;  3SQV A;  4N3C A;  3MEK A;  5D0Q D;  1INZ A;  4CGW A;  4GTQ A;  1QZ2 A;  3FTZ A;  5EYL A;  2V0P A;  3FU5 A;  3ZYK A;  3B13 A;  2HM8 A;  4RG9 A;  4DX1 A;  3L13 A;  1Y6I A;  2JLB A;  3CKC A;  3QWV A;  4GAA A;  4XKB A;  1HG2 A;  1X81 A;  2ZGD A;  3DWL G;  1BI7 B;  4KBQ A;  1ELW A;  4I6J A;  1S0P A;  2AXV A;  1U2V G;  4I2W A;  3O4Z A;  1S63 A;  3D9H A;  1Y8M A;  5BV0 A;  4ANX A;  5IY5 E;  3LY8 A;  4K0R A;  2XPZ A;  4UWH A;  3ASD A;  2VTB A;  1AP7 A;  1FPP A;  2R03 A;  4FP7 A;  2GRN B;  3D9N A;  2VSY A;  5ANR A;  3RU0 A;  2OV8 A;  5J90 A;  4ACK A;  4GYW A;  4BY6 A;  1N4P A;  4EPZ A;  4K5B A;  3JQ1 A;  3UKU G;  3QOU A;  5AYW D;  4GZD A;  4UI9 C;  3SBS A;  3NBN B;  4CRW A;  3QAQ A;  3SBT B;  2R17 C;  4WNG A;  5FZR A;  3UM3 A;  4A3V A;  4G8L A;  4JD2 G;  4G26 A;  4Q94 A;  4ILG A;  3CR3 A;  3ONK A;  3J5P A;  4HOS A;  1N0R A;  2DYR E;  3B7B A;  4JHR A;  4JZY A;  2DCP A;  3ZEF A;  1JUQ A;  3Q7F A;  3TWW A;  1E8W A;  2ZIR A;  4U63 A;  2C0L A;  5E75 A;  5T8I A;  4HOR A;  4XZ4 A;  4AVX A;  3CQC B;  3X2Q E;  1N52 A;  2J4B A;  2L6J A;  4AOF A;  2QZA A;  2LAI A;  4N3A A;  4BEP A;  4CT4 A;  3PZ3 A;  4DX5 D;  2L9B A;  4A63 B;  4E6H A;  3FTW A;  4J8Y A;  4B94 A;  2PQR A;  2UWJ G;  2J49 A;  4YDY A;  5AQB A;  5G04 C;  4YDO A;  3ZRH A;  4GZ6 A;  2IOS A;  1NL4 A;  5DIZ A;  5ENO D;  3UIN C;  4YVO A;  3ASO E;  4I1M A;  3QDN A;  4JA7 A;  4JL0 A;  3UX4 A;  3FUI A;  4FAD A;  2F0Y A;  2DWZ A;  3ABM E;  3O48 A;  2B6C A;  2NYJ A;  1TNB A;  4JEU A;  3ZPJ A;  3SZ7 A;  1OCR E;  2WXQ A;  5C1D A;  3UMV A;  2I2O A;  4DPR A;  3U64 A;  4HOU A;  1JPL A;  3IHY A;  4BFR A;  4H7X A;  1BLX B;  2BF0 X;  3R9M A;  2P9K G;  5KJN A;  4EBA A;  3MCX A;  2ZXW E;  1KT0 A;  1UN8 A;  5G2N A;  3ZXP A;  3NOC D;  4NQ0 A;  1P5Q A;  3CQG B;  4DX7 D;  4HB5 A;  3PVL A;  3MKR A;  4QQI A;  4TV3 A;  2LXM A;  1ZBP A;  5KJK A;  5KJM A;  4GTV A;  1RZ4 A;  5KCM A;  3SI5 A;  5ARF A;  4LER A;  4Y6W A;  2YIN A;  3JQ0 A;  5ENN A;  2NSZ A;  1SW6 A;  5AN8 A;  2ZU6 B;  5AQA A;  5KNG A;  3DPD A;  1LF8 A;  2XS8 A;  3ESK A;  3ML9 A;  2J09 A;  3ZYL A;  1N94 A;  3AU4 A;  3HIZ A;  3GZ2 A;  2IO2 C;  1EF1 C;  3P2B A;  1WM5 A;  1H2V C;  1A5E A;  2P9P G;  3UIO C;  3PH0 C;  1S64 A;  4CDM A;  4TXQ A;  3DPY A;  3DRA A;  2DYS E;  3SHF A;  5EDS A;  3PZD A;  4Q69 A;  5FT9 A;  4ILI A;  1IYG A;  3KEA A;  3D9P A;  3HXC A;  5ENP D;  5D2M C;  3VLF A;  3IV0 A;  3FH5 A;  3ZNG A;  2XEN A;  4L9P A;  2ETC A;  1HU3 A;  4HS2 A;  3D9L A;  3L16 A;  2CG2 A;  4GZ3 A;  1SZ9 A;  3CIA A;  2I9C A;  4J6I A;  1RW2 A;  4AV7 A;  2KBX A;  2AXU A;  2OVB A;  2FF4 A;  2VYI A;  1UN9 A;  3ZUV B;  3OTN A;  1TN8 A;  3PE3 A;  3VTX A;  3DSW A;  2ETA A;  4UWL A;  3FUJ A;  3AU5 A;  3DSU A;  2AXZ A;  3AJI A;  3F6Q A;  1NZN A;  4HI9 A;  4BT9 A;  4ACL A;  3CK9 A;  1YMP A;  3CLJ A;  2GRO B;  3LYA A;  4HLE A;  3S7J A;  4B8A A;  4JXT A;  4FU3 A;  4AY5 A;  3P1U A;  2UY1 A;  2V5F A;  5G05 C;  2J9Q A;  5HI7 A;  3OAW A;  3ASG A;  3Q9U C;  3S2A A;  1N4S A;  4Y6C A;  4A1S A;  4OAV B;  3HDX A;  3CVP A;  3OXF A;  4CZ2 D;  2CFU A;  2GRQ B;  4C9B B;  4MS6 A;  2IFU A;  3EHR A;  2P9I G;  1OCZ E;  2ION A;  3EU5 A;  2ETB A;  1LD8 A;  4PS8 A;  5EID A;  3EHQ A;  3HXF A;  3HRA A;  4B0Z A;  4RVB A;  4OAU C;  4O60 A;  2XHE A;  5CEA A;  3FUD A;  2XCC A;  2V4L A;  4GPM A;  4ANW A;  3RRU A;  3JUI A;  3BUA A;  3FHE A;  3AS5 A;  3G2W A;  4GTP A;  4UQY A;  4KMO A;  1H0A A;  1PC2 A;  4E85 A;  4GMJ A;  3B7T A;  3S7F A;  2MHK A;  3ZIM A;  2V5Q C;  3NQP A;  5EIL A;  3I4R B;  4AM9 A;  3APF A;  1WG0 A;  5BUZ A;  3DSV A;  3RSE G;  3JUE A;  4I17 A;  3RJV A;  3I4G A;  1KT1 A;  2BTD A;  5CBN A;  4BTB A;  1HX8 A;  3HVE A;  2XS1 A;  4J8S A;  5FIO A;  2KCV A;  3VTY A;  2LXL A;  2FO1 E;  1VDY A;  2F8X K;  4FUL A;  1HZ4 A;  1IQU A;  2B0O E;  2CHX A;  2CFZ A;  3ZXS A;  5CRV A;  3Q78 A;  1WDY A;  3D9K A;  4I1O B;  3MKQ A;  3V2X A;  3FTV A;  3L9T A;  2FBN A;  4XEI G;  3FU0 A;  1TN7 A;  1U3C A;  4OVU A;  3CVW A;  1QNF A;  3Q15 A;  1A17 A;  1O1R A;  4ANV A;  3QAR A;  1QQE A;  4CT0 A;  2XEH A;  2XQ0 A;  4HVB A;  5C2Y A;  3HHM A;  1Z3Y A;  2R02 A;  1IHB A;  4HOQ A;  4GTS A;  3I3N A;  3QK0 A;  2X6J A;  5AIJ A;  1TNZ A;  2FO7 A;  3EHM A;  4I6G A;  4UI9 K;  3ZU7 B;  1FT2 A;  5HS0 A;  4JB8 P;  4HBD A;  3CVL A;  4U8V D;  4L7T A;  3LDZ A;  4L2Y A;  1YYH A;  2C0M A;  3DBS A;  3V2O A;  3D9I A;  2VTB B;  4HRL A;  4BWR A;  4K5A B;  3FUK A;  1HO8 A;  3LVR E;  5BXO A;  2WXP A;  3V79 K;  3Q7A A;  3CK7 A;  4L1B A;  4LEU A;  4JEH A;  1OXJ A;  4FA6 A;  3UI2 A;  4L23 A;  4BTA A;  4U0Z A;  4GCO A;  2FI7 A;  2AVP A;  1UJK A;  2XEV A;  2XZD G;  3QB2 A;  4JA9 A;  4GA2 A;  5J08 A;  4ILH B;  2BED A;  3PRZ A;  4UQX A;  1DCQ A;  4EHM A;  5E76 A;  4JHJ A;  2XPY A;  2YNQ A;  4LRZ A;  2WPV A;  3E4B A;  2IOL A;  3CVN A;  2WQ6 A;  4M7C A;  1ZU2 A;  2Y69 E;  2OEW A;  4APO A;  2KAT A;  4FC8 A;  2R59 A;  2P9N G;  4I9C A;  4UWG A;  2PL2 A;  4J8E A;  3ONL A;  1N4R A;  4UUC A;  3CGH A;  3RO3 A;  2XRZ A;  2OVF A;  2AJA A;  4ME2 A;  3IBE A;  3UM1 A;  4GTR A;  4FJZ A;  3IXE A;  4GML A;  3OXL A;  2A4Z A;  3HG0 D;  4J8F A;  1X5B A;  4AIF A;  3LVQ E;  3E37 A;  2WXI A;  3FY4 A;  3T8K A;  5CHE E;  4KZC A;  2X6I A;  3TG4 A;  1FVH A;  1HFA A;  4PUC A;  2P2C P;  2WXO A;  3JCK C;  3ZHE B;  2V4H C;  4FHK A;  4CDN A;  1EPU A;  3FFL A;  4GPK A;  4HQD A;  3EIJ A;  3LEW A;  2AW6 A;  4YND A;  5CRU A;  2WXF A;  3AAA C;  3B7R L;  2VSN A;  4HNA D;  2F8Y A;  2HYZ A;  4KT6 B;  5LP0 A;  3RO2 A;  3CHM A;  4C0E A;  5DBK A;  3HXD A;  4F1P A;  4BER A;  3BQO A;  2R05 A;  3LJN A;  3LCA A;  5JJT A;  4XX5 A;  3LJ3 A;  1B89 A;  4G25 A;  5EKQ D;  4U95 D;  2J8S D;  4N5Q A;  1MJ0 A;  3TWU A;  2X38 A;  4PS3 A;  1N9A A;  5AEN A;  4K03 A;  5AJL A;  2MRI A;  2I6H A;  4WNF A;  4LNB A;  5LCW C;  5AAO A;  2QY7 A;  4LUN U;  2BKG A;  3L17 A;  1H2U A;  1MX4 A;  3ZFW A;  3LPZ A;  3DSX A;  4APF A;  5T4Y A;  3APC A;  3GZ1 A;  3FUH A;  3PNL B;  4FJY A;  5FQ7 A;  3MA5 A;  5ITZ F;  3D9O A;  4F1S A;  3CVX A;  5KWD A;  2MYO A;  4O1P A;  4A3T A;  2DBA A;  3PRE A;  2GRP B;  3DXK G;  2L0I A;  5LX8 A;  4C48 B;  2WXR A;  2WMN A;  4ZFH A;  3NB2 A;  5ENT D;  2IU1 A;  3KEZ A;  2PQN A;  5G05 J;  2RG8 A;  2FEZ A;  4N5C A;  3ZHE A;  3FH7 A;  1MQS A;  4GA0 A;  4N2S A;  3R7Q A;  5B3S E;  3FP3 A;  4BX9 A;  1E96 B;  3K9I A;  3PZ2 A;  5HRY A;  1WAO 1;  3EIQ C;  3T5X A;  3FU3 A;  1LD7 A;  5ENS D;  4D10 C;  3ASN E;  4TXP A;  3PNT B;  5JHB A;  2WXM A;  1K1B A;  2QYU A;  2X6F A;  3SO8 A;  4DK5 A;  1N0Q A;  2IJG X;  3SGH A;  1DCE A;  4AJW A;  3KSQ A;  4JPS A;  3CHR A;  3S7D A;  4O1O A;  3ASH A;  4BX8 A;  1MHQ A;  1OWP A;  2C2L A;  3L6A A;  3PUJ A;  1BD8 A;  4U04 A;  2BUG A;  4JHK A;  4GZC A;  1HE8 A;  3V30 A;  5BPP A;  1N11 A; 
#chains in the Genus database with same CATH homology
 4GTR A;  2ZIR A;  3DSW A;  2R2L A;  3DSX A;  2H6G A;  4GTO A;  3DSU A;  1MZC A;  3DSV A;  1JCQ A;  3E32 A;  3E37 A;  4GTT A;  1X81 A;  4GTV A;  3PZ3 A;  1N4Q A;  1KZP A;  3E33 A;  1TNU A;  1TN8 A;  3DST A;  3Q7A A;  1NI1 A;  1SA5 A;  1O1T A;  1D8D A;  1S63 A;  3Q79 A;  1D8E A;  3DSS A;  3HXB A;  1N4S A;  4GTM A;  1O5M A;  2H6I A;  4YDO A;  1N94 A;  1FPP A;  1JCS A;  3EUV A;  1NL4 A;  2BED A;  3Q78 A;  4LNG A;  2IEJ A;  1TNO A;  4EHM A;  3PZ2 A;  1N4P A;  3EU5 A;  1SA4 A;  3PZ4 A;  1LD8 A;  1JCR A;  2F0Y A;  3HXD A;  1TNY A;  1LD7 A;  1S64 A;  1TN7 A;  2H6F A;  3E34 A;  3HXF A;  3DPY A;  3DRA A;  2ZIS A;  1TNB A;  1TN6 A;  1LTX A;  1N95 A;  3PZ1 A;  1O1R A;  3E30 A;  3HXC A;  4YDE A;  2H6H A;  1QBQ A;  3Q75 A;  1DCE A;  4L9P A;  3KSQ A;  1N4R A;  3C72 A;  3SFY A;  4GTP A;  4MBG A;  1O1S A;  3KSL A;  1N9A A;  4GTS A;  1FT1 A;  1TNZ A;  4LNB A;  1KZO A;  3SFX A;  3HXE A;  4GTQ A;  1FT2 A;  3Q73 A;  3Q7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...