2PL2A

Crystal structure of ttc0263: a thermophilic tpr protein in thermus thermophilus hb27
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
194
structure length
194
Chain Sequence
AEQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALYRQAEDRERGKGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQALALEDTPEIRSALAELYLSMGRLDEALAQYAKALEQAPKDLDLRVRYASALLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical conserved protein TTC0263
publication title Crystal structure of TTC0263, a thermophilic TPR protein from Thermus thermophilus HB27.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Protein binding
total genus 76
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13176 TPR_7 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pl2A00
3O48A 1WAO1 1FCHA 3U4TA 3AS8A 3MA5A 3ESKA 5JJTA 2YQ8A 2DBAA 4WNFA 5KJMA 3PE3A 2UY1B 3U3WA 5CCLA 4LEUA 3S7FA 4W9RA 2FBNA 4WNGA 4U04A 4UQXA 3KAEA 2C0MA 1XNFA 4N3CA 4GZ5A 4CGVA 3ULQA 3FWVA 4KYOB 2VGYA 3RO2A 3AS5A 3ZFWA 3GYZA 2UWJG 4BT9A 3GZ1A 4I2WA 3LPZA 3CK8A 2FF4A 4HORA 3LY9A 4CDRA 4JL0A 4NRHB 2XCBA 5KJNA 4J8FA 4I9EA 4U0UA 3RJVA 3TGOA 1HZ4A 3S7BA 5BNWA 3CK7A 5KJKA 1IHGA 5FZSA 5KJLA 5AYWD 4GPKA 2PZIA 4B94A 3ZHEB 3SZ7A 2IF4A 4GCOA 2WQHA 3CVQA 3CEQA 3QWWA 5BW8C 3QKYA 3UPVA 2VGXA 3LYAA 4UQYA 4WNEA 2VYIA 5EKQD 5ARGA 3ZN3A 3IEGA 4ME2A 5G04J 3OXGA 4XI9A 2BUGA 3VTYA 2L6JA 3FFLA 2I6HA 2KCVA 4AM9A 2LNIA 4AY6A 2PL2A 4I17A 4HOTA 4BTBA 5LCWJ 3ASFA 2VSYA 5HQ8A 4AIFA 5G04C 3N71A 4GA2A 2WPVA 4G24A 4H7YA 3K9IA 3GZ2A 4I1AA 1A17A 5CHEE 1QZ2A 2XGMA 5LCWC 1W3BA 3KD7A 4UI9J 1OUVA 3QWPA 3CVLA 4BTAA 5A6CA 1YA0A 1ELWA 4IN3B 3E4BA 3CVNA 4G1TA 2KCLA 4GA1A 3QOUA 3Q15A 1NA0A 3OXFA 4G26A 4UI9C 3TG4A 4A1SA 3ASHA 3UUXA 2KATA 2JLBA 4UQZA 2C0LA 4UI9K 1NZNA 3Q5MA 5C1DA 3ASDA 3AS4A 2VGXB 4YVOA 2Y4TA 3LY8A 2XPIA 3CV0A 1QQEA 5JJ7A 3QDNA 2GW1A 4G23A 3RKVA 3QWVA 2Q7FA 1IYGA 1P5QA 5D0QD 2IFUA 2HR2A 4GCNA 3UQ3A 4YVQC 3SF4A 3Q49B 3ZGQA 1ELRA 4I2ZA 5A7DB 2PQRA 4XIFA 2PQNA 3MKRA 2HO1A 4GZ6A 2LSUA 4GA0A 3JYSA 2FEZA 4RG9A 1ZBPA 4O6FA 3Q4AB 2XGSA 1WM5A 5HI7A 3GW4A 4EQFA 2KC7A 3EDTB 5FJYA 4WNDA 1ZU2A 2R5SA 5G05J 2HYZA 2Y4UA 3ZHEA 3R9AB 1HH8A 3TAXA 2YHCA 1Y8MA 4AY5A 3WXXA 4CGWA 4F3VA 5DIZA 1B89A 4RG6A 1KT1A 4JA9A 5G05C 5BT1A 4N39A 2V5FA 4GYWA 3S7DA 3LY7A 4WUYA 4ABNA 4I9CA 4YNDA 2C2LA 4U0ZA 5EX0A 4U0SA 3MEKA 3URZA 5D0OD 4N3BA 3BEEA 4J8EA 1TJCA 2XGOA 4XI0A 2XCCA 5M72A 5JJ6A 2OOEA 3VTXA 2UY1A 4J8DA 3PDNA 5CCMA 3HYMB 5ARFA 2NC9A 4N3AA 4HOQA 1KLXA 2FI7A 3CK9A 1HXIA 2AVPA 1PC2A 2ONDA 2P58C 3RU0A 4APOA 4KBQA 3NF1A 4GZ3A 4H7XA 3RO3A 2KCKA 2LSVA 2MHKA 4HOSA 3PE4A 2FO7A 2J9QA 4NQ0A 4Y6WA 2QFCA 3TG5A 4HOUA 4BWRA 2E2EA 4N2QA 3CKCA 3KS2A 3ZPJA 3Q47B 3CKBA 5FZRA 5FZQA 3MV3B 3ASGA 4BT8A 3FP3A 4JHRA 5FTPA 3MV2B 4JA7A 1E96B 4KXKB 5DBKA 4N5CA 3LCAA 4Y6CA 3RIBA 4G2VA 3OXLA 4GYOA 5EX3A 1KT0A 3CVPA 3LKUA 2VQ2A 4GYYA 3S7JA 2VSNA 4N2SA 4U07A 2XEVA 5FT9A 1NA3A 4J0UA 4G25A
chains in the Genus database with same CATH superfamily
4BX9A 5AJDA 4DI4A 3CHPA 1UJJA 2RD0A 3MA5A 4RLYA 3OTNA 2DBAA 4BERA 2X6FA 4GU5A 1OWMA 2L6BA 2ZGDA 4FLHA 4BX8A 5BV0A 5CCLA 3S7FA 3RRMB 4O1PA 1IKND 4HI8A 4GMJA 4WNGA 3KAEA 1XNFA 4F53A 4GZ5A 4CGVA 2P9IG 2XRYA 3RSEG 2AJAA 3AU4A 4ZHBA 3ABKE 4MS6A 2VGYA 4HI9A 3TWQA 3IBEA 3ZFWA 5FQ4A 2BTDA 4Q94A 2B6CA 3C3RA 2WXOA 3L9TA 3MX3A 5AQ9A 4KT6B 3PUJA 1N52A 1K1BA 1EYHA 1OT8A 2XZTG 4GTOA 1JCSA 1NFIE 4O1OA 1UG3A 2KM4A 4J8FA 4EZKA 4PS8A 2M63A 3S7BA 1TNBA 3MJWA 1H2UA 3CK7A 3TXMA 4K5BA 3E34A 4FP7A 3VLEA 2PZIA 3R9MA 4B94A 4LNUD 3EHMA 4XKCA 4DLQA 3DBSA 3CVYA 2QYUA 5AQBA 3B7UX 3IV0A 4JHJA 4UQYA 5EN5D 3TWRA 4TXRA 4OAVB 5EKQD 3MGBA 1N4SA 2PM6A 4YDOA 4ME2A 5AQAA 2L0TB 4JPSA 2AXUA 4C9BB 3UKUG 2L6JA 3ISMC 2I6HA 2KCVA 4AM9A 2WXGA 2WXLA 1SZAA 4G8KA 1EDUA 4HOTA 2VSXE 2VSYA 3HXBA 5HQ8A 5LP0A 4TXPA 3ZYMA 2YHEA 4U8VD 1E90A 2WPVA 2P9UG 5CRUA 5ANRA 2WXQA 4L1BA 5BV1A 2XGMA 4DRXE 2OEWA 4UI9J 1OUVA 1MHQA 4BTAA 5A6CA 2VJ8A 3BG0B 2KCLA 1KZOA 4GA1A 3TL5A 3UT7A 3EUVA 4UI9C 3FUFA 2DYSE 2AWIA 3AU5A 4LUNU 2JLBA 4U96D 3CVUA 1OWPA 3UM2A 1HS6A 1S64A 4BFRA 4EECA 3FH8A 3ASDA 3AS4A 2X6IA 4AOFA 2XPIA 1MZCA 5CRVA 1E8YA 1TNUA 2XEHA 3D9HA 2ZGGA 4G23A 2Q7FA 3IHVA 1K3ZD 4HRMB 1IYGA 3PVLA 3IHYA 3E37A 5EIDA 4GCNA 3QC1A 2J07A 3UQ3A 2OVBA 5B1BE 3FTVA 4I6JA 3Q49B 3ZGQA 4U95D 4GZDA 4I2ZA 3CGHA 3EIJA 5A7DB 5KBAA 2PQNA 3MKRA 2DZOA 3Q7AA 3SFYA 3DXMG 3MZLB 4GA0A 2MRIA 4NIKA 2CG2A 4EPZA 2X6JA 4O6FA 3Q4AB 5HI7A 4GTMA 2J49A 4HB5A 2Y0BG 4G8LA 2R5SA 3AJIA 4YDWA 4PDXA 2PNNA 2RFAA 2L9BA 1UN8A 3FUDA 4F3VA 1OWLA 2Y1LE 5CMYA 1ELKA 1RW2A 5BT1A 1BLXB 5ENRD 2WXMA 2KZTA 4CT4A 2V5FA 3FUNA 2F0YA 2LAIA 4ABNA 2QY7A 3D9NA 3V79K 2GROB 4M3OA 2HE0A 2GRLA 2I1KA 1NL4A 4OAUC 3BEEA 2IONA 4J8EA 4CDMA 4FADA 1YCSB 4YDYA 2WB2A 4XI0A 3FU0A 2XCCA 3FTZA 3TWVA 3VTXA 2UY1A 4A63B 3HYMB 4QFVA 2NC9A 1WY6A 3FY4A 4HOQA 3CQGB 1KLXA 3JUIA 4M7CA 1H19A 1HXIA 3LVQE 1PC2A 2R03A 3DXKG 1A5EA 5D2MC 3RO3A 2A5EA 3SGHA 3FHEA 1V54E 5G2NA 2KCKA 2MHKA 1S63A 4JC8A 2LUHA 4B8AA 2J9QA 3AAAC 2R2LA 4JZYA 5BXUA 1IXVA 4LNGA 1E8ZA 2WMOA 3SI5A 4MLPA 4UWGA 4FJYA 3CKBA 2XZDG 3KEZA 4EZLA 3OAWA 5HS0A 2V4HC 3FUIA 4ILIA 1BD8A 4JA7A 1E96B 5AJLA 3MKQA 4Y6CA 2XPYA 3RIBA 2KZTB 3Q75A 5ENOD 4GYOA 3ZYKA 1MX2A 1YMPA 3EU5A 4LRZA 2EINE 2KBXA 4U07A 4KVOA 5CECB 2IU1A 2ILRA 1FCHA 2JABA 3DEPA 1TNOA 2YQ8A 4C0MA 3T5VA 1N95A 4WAFA 1N4PA 4HXIA 2UY1B 3UM3A 4GTVA 2FBNA 1TN6A 4U04A 1MYOA 4HBDA 3L13A 3TWTA 3JQ1A 3ULQA 3ONLA 1TN8A 3FWVA 2QZAA 2J09A 3D9KA 3LJNA 3AS5A 3HRAA 4BETA 3TXNA 3L17A 4DX6D 3PZ4A 2P9LG 2J08A 4AVXA 3G2UA 4JVSA 5G55A 3LY9A 4DX2A 4CDRA 3DSXA 5KJNA 4I9EA 2ZXWE 1HZ4A 2CFUA 2P9SG 5BNWA 1KPSB 2BKGA 4GTRA 4X8QA 1K1AA 3F6QA 2EIKE 3C3QA 3PS6A 3LS8A 3MKQB 5ENNA 5KJKA 2QYJA 1DNPA 3SY2A 1N94A 3KSLA 3FU3A 3TWSA 3ZHEB 1NP7A 4GCOA 1N9AA 2WQHA 3Q9NC 3CEQA 4I43A 5E75A 3QKYA 3CSFA 3MYVA 4LG6A 1SQMA 3PUKA 2RFMA 4NACA 5ENSD 4RSYA 3NBNB 3ZN3A 5J08A 3NB2A 1OCZE 5CEAA 4F1PA 2DVWA 1TNZA 3OXGA 5G04J 3G2VA 1IQUA 4GMRA 4ANWA 4CEMA 3I4RB 3CVWA 2WXIA 2LNIA 2PL2A 3ZKJA 4I17A 4J7WA 4BTBA 3EHNA 3FEXA 1TEZA 5G04C 1SVXA 2GRQB 3VLFA 4AP2A 3EIQC 4GA2A 2WXNA 5EDSA 2KXPC 4H7YA 3K9IA 5BUZA 3GZ2A 1BPOA 5FQ6A 4A3TA 1JUQA 1TYQG 1HF8A 3MCXA 3QWPA 3IKOB 1OCOE 1H6PA 1YA0A 4IN3B 3QOUA 4UWHA 3EHQA 5D66A 3Q15A 1EF1C 1G3NB 1NA0A 4A1SA 1BI8B 3ASHA 4LERA 3NAWA 1HE8A 3UUXA 1NI1A 1RZ4A 1PY1A 2I9CA 1Z5SC 5FWQA 1NZNA 3FU6A 4XKBA 1O1TA 4F7AA 3FTUA 3Q5MA 5C1DA 1H6KA 4YVOA 1Y6IA 2RKKA 5T8IA 3BU8A 3FH5A 1HG2A 4GAAA 5JJ7A 3QDNA 4HQDA 3QB2A 3UXGA 2GW1A 2OVFA 3G2TA 3QWVA 1L5JA 1P5QA 2IFUA 1D9SA 5CMWA 2HR2A 2WQ7A 5T4YA 3EU9A 3J5QB 1GW6A 1S70B 1MQSA 4ANUA 1E7VA 2PQRA 1HFAA 1X81A 3W9GA 2DCPA 2HO1A 2DIWA 5E76A 2FEZA 2AXZA 2WXHA 1QNFA 1ZBPA 3FUMA 3GW4A 3P2BA 1FPPA 4XZ4A 1H6OA 5C2YA 4ACKA 4XE0A 1QBQA 3TAXA 4JEUA 3UMVA 2IEJA 3PZDA 3ZIMA 3EHRA 2IO2C 3C3OA 4RG6A 4K5CA 4I6EA 5KCMA 3PEUB 3V2OA 4DX1A 1SW6A 4J6IA 4K5AB 3ABME 4HRLA 3DWLG 4WUYA 4Q69A 4GPMA 2WM9A 1E7UA 2C2LA 4U0ZA 5EX0A 2FO1E 2H6HA 3JQ0A 3MEKA 2VGEA 2GRNB 3L54A 4OVVA 3URZA 3UT8A 1TJCA 3FTYA 2XGOA 4MRUA 2BF0X 4ILHB 1UN9A 3FTXA 4J8DA 3L6AA 4DUIA 5ARFA 2WXJA 5CEDB 1V55E 4XEIG 3Q9UC 2FI7A 3UTMA 3QJZA 2ONDA 5FINA 4YDEA 2H6GA 4UWFA 2IQCA 4I1OB 3FDHA 3NF1A 1UW4B 3ENEA 1DCQA 2R59A 2FO7A 2F37A 4GZCA 4Y6WA 3LDZA 3TG5A 1WDYA 1H2VC 4HOUA 1MX4A 2E2EA 4N2QA 3CKCA 4HRNA 3ZPJA 3Q47B 2VSOE 1Z3YA 4B89A 4JHRA 3FEYA 3PEVB 4TXQA 5B3SE 1HX8A 3D9PA 3DSWA 3SBTB 4A3VA 3ZRHA 5EX3A 4GYYA 2VSNA 5FT9A 2P9PG 2F8XK 1Z3XA 4KZ0A 3DSUA 4G25A 4Q96A 4GMLA 3O48A 3PREA 1WAO1 1UJKA 3U4TA 3AS8A 3CVVA 1N0QA 3SBSA 4GTQA 5HRYA 3CQCB 3I3NA 4W9RA 2PM7A 3QAQA 4N3CA 5HKPA 3RRUA 3HIZA 3GZSA 4KYOB 4NURA 4KZCA 4J8SA 2A5UA 2ETAA 4B93B 4C0EA 1YYHA 3CR3A 3CHMA 4BT9A 3LPZA 3B7BA 4CDNA 1JWGA 3ASOE 3IXEA 4L23A 4CYMD 4HORA 1DCEA 3D9LA 4K0RA 4I6GA 4JL0A 2CHXA 4PUCA 3TGOA 3ZYQA 3TWWA 1QYMA 3ZUVB 2L0IA 5AENA 5ENQD 3FTSA 1IHGA 5FZSA 3D3MA 5AYWD 2R17C 2XPZA 3E30A 1AP7A 1JCRA 3SZ7A 3U64A 3ZNGA 3CVQA 3QWWA 1N0RA 2VGXA 3LYAA 3FUEA 3ESLA 2WQ6A 3WG7E 4DI3A 4WNEA 2H6IA 3Q73A 2CHWA 4BSXA 4FULA 1HU3A 3R7RA 2XRZA 2R02A 3IEGA 3HXCA 3ZVVA 3SD5A 2BUGA 3VTYA 4TUMA 3AG3E 3QK0A 4UWKA 3HXFA 4AY6A 2XS1A 4FC8A 5LCWJ 3ASFA 2V5QC 2GRMA 4OVUA 4FA6A 4ATZD 5CERB 4K03A 5AAOA 4AIFA 4KVMA 4F1SA 2EQXA 4I1AA 3CVXA 5T3RA 3T5XA 2CFZA 1A17A 3UM1A 2VTBA 4A1GA 1Z6TA 5LCWC 2LXMA 1W3BA 4FLBA 4E85A 1SA5A 4IYPA 4JEHA 1XGWA 3D9JA 3D9IA 4RQIA 1OCCE 3DSVA 3CVNA 3CLJA 4G1TA 5J90A 4TV3A 2V8SE 1INZA 3LEWA 4U8HA 5JHAA 4APFA 2ETBA 1S0PA 4G26A 3TG4A 2WVIA 3T9KA 2KATA 2C0LA 3I4GA 4UI9K 1K8KG 2EIJE 2IY0C 2VGXB 3PZ1A 5JMND 3LY8A 1QQEA 4PS7A 1DVPA 3JCKC 3ZEFA 3RKVA 4U63A 1O1RA 4LSZE 3B13A 3U9WA 5D0QD 2WXPA 5KNGA 4GTSA 2CG3A 3LXUX 5ENTD 2BKKB 2ZU6B 4L7TA 1ELRA 4BSZB 5LX8A 3V31A 1U3CA 3KEAA 4FHJA 1WG0A 3L08A 2LSUA 4GZ6A 2X6HA 3JYSA 4RG9A 3KSQA 3P1UA 3UINC 5BXOA 1JPLA 2B0OE 2XGSA 3X2QE 1WM5A 1N54A 2KC7A 2V4LA 2VTBB 4BY6A 4WNDA 3RK6A 1ZU2A 3ZXSA 3HG0D 5G05J 2HYZA 2Y4UA 2OCCE 1PAQA 2YHCA 3BG1B 2WMNA 4BESA 4AEZC 5CBOA 3E32A 4AY5A 1OWOA 3TWXA 3EJNA 3HXEA 4CZ2D 2XHEA 1B89A 4TUUA 2V0PA 2J4DA 4HLLA 5JHBA 1IHBA 2XS8A 4JA9A 4MBGA 5G05C 3HXDA 4N39A 3S7DA 2MYOA 5A23A 3LY7A 4XX5A 2J8SD 4EBAA 4YNDA 3UT4A 4ATGA 4WWPA 3NOGD 5ITZF 5FIOA 1OY3D 3ZYLA 2P9KG 3DEOA 5D0OD 1LD7A 4HLEA 4ANVA 3UKRG 5FQ8A 3BQOA 2OOEA 3Q78A 3AG2E 4EBAG 3UI2A 5LFAA 5CCMA 1MJ0A 1N4QA 4UUCA 3HVEA 3TJPA 3NQPA 4GTPA 1N4RA 3UIPC 5ENPD 5AN8A 4URKA 3CK9A 4JB8P 2X38A 5IY5E 2P58C 4APOA 3J5PA 4FHKA 4KBQA 4GZ3A 4H7XA 2IO3C 3ULYA 4EZJA 5LOZA 3ZU7B 1H2TC 3PE4A 5AQ7A 1TJFA 3PNLB 4L2LA 2QFCA 1O5MA 3SO8A 2IOLA 3KS2A 4IRUA 5FZQA 2AW6A 3MV3B 4BT8A 3FP3A 3L22A 4JHKA 3T8KA 5FTPA 2OV8A 1JCQA 5DBKA 3UX4A 3LCAA 2H6FA 4I1MA 4MKTA 1TN7A 3C98A 3DPDA 5KNHD 2X3MA 2FULA 3V2XA 2JEKA 3CVPA 2VQ2A 1U2VG 4JD2G 4FU3A 3CSTA 4A55A 2YINA 5H7PA 1H0AA 4DPRA 2XENA 3ESKA 4L9PA 5JJTA 4ILGA 2XEEA 4WNFA 5EYLA 4DK5A 5KJMA 3PE3A 3U3WA 3UIOC 4LEUA 3PNTB 3CHOA 1SZ9A 4UQXA 3HVEB 1LD8A 2C0MA 3C72A 3DSTA 3ZXPA 3ML9A 2WXKA 3CHRA 2X6KA 1U3DA 3DSSA 2E0IA 3PZ3A 3RO2A 2MOWA 3R7QA 5FQ7A 1JWFA 3Q7FA 3GYZA 2UWJG 4E6HA 4UWLA 3GZ1A 4I2WA 3CK8A 2FF4A 4G11A 3CHSA 3NZUA 3B7RL 4NRHB 2XCBA 3AG1E 4U0UA 1N11A 3RJVA 3CIAA 5ANLA 2OEVA 2QC9A 5KWDA 4Z68A 4L2YA 2I2OA 4HNAD 5KJLA 3G2SA 2NXPA 4GPKA 2CHZA 2I1JA 3SNXA 1SA4A 3W9FA 2IF4A 5BW8C 2WXRA 3UPVA 3B7TA 3LJ3A 4DX5D 2RG8A 1FVFA 2VYIA 1Q2ZA 5ARGA 2EIME 2R05A 2WXFA 4F6RD 4J8YA 4AJWA 5CBNA 4XI9A 3D9OA 3APFA 3FFLA 1FT2A 3HDXA 4AV7A 3O4ZA 2XQ0A 2ZISA 3N71A 4G24A 3FTWA 2BEDA 5CHEE 1QZ2A 4JW1A 2DYRE 3CHQA 1O1SA 3KD7A 3ZW3A 3FUKA 3CVLA 5EIBE 4P29A 4R7LA 4IULA 1ELWA 3E4BA 3FUHA 3APCA 3ML8A 3OXFA 5AIJA 4DX7D 2P2CP 3QNKA 3B7SA 4UQZA 1LF8A 3I5PA 3SHFA 2Y4TA 3CV0A 2P9NG 4QQIA 3QARA 4BEPA 3ULEG 1FT1A 3JXJA 3L16A 3HHMA 1D8DA 1HG5A 2EILE 4YVQC 4TRQA 2GGFA 4N5QA 3APDA 4C48B 3SF4A 2HM8A 4DLOA 4XIFA 2GRPB 2AXVA 4B8CB 3U66A 4CT0A 1OXJA 1OCRE 4WWOA 1ZB1A 3C5RA 3TWUA 3PRZA 3SQVA 4EHMA 3RAUA 3DRAA 4EQFA 4CRWA 4FJZA 3EDTB 4RVBA 5FJYA 3DPYA 1E8XA 3RRNB 4O60A 3FULA 4AXHA 3R9AB 3SFZA 3ZHEA 1HH8A 1AWCB 3E33A 4OYSA 3ABLE 1Y8MA 1EPUA 3ONKA 3JUEA 4HFGA 3WXXA 5BPPA 4CGWA 5DIZA 4PH4B 4ANXA 1MX6A 2YNQA 1KT1A 1HO8A 2LAHA 3FH7A 4D10C 3PH0C 4DJAA 2ETCA 4GYWA 2F8YA 2IOSA 2NSZA 1DC2A 3L82A 3D9MA 4I9CA 1KZPA 4PS3A 4U0SA 5AARA 2A4ZA 2DZNA 4U7EB 4N3BA 3FU5A 1FVHA 3B95A 1D8EA 5M72A 5JJ6A 1BU9A 3UM0A 3BUAA 3PDNA 3VLDA 4KMOA 1TR4A 5JA4D 1LTXA 4HS2A 2GRRB 4GTTA 4WWNA 4N3AA 3NOCD 4HVBA 3JXIA 4U8YD 1IQRA 3G2WA 2AVPA 2LXLA 3RU0A 4GB9A 3ASNE 2LO6A 4LCTA 4ACLA 5EYPF 2LSVA 4HOSA 1TNYA 4NQ0A 4ZFHA 2Y69E 2DWZA 3AG4E 2J4BA 4BWRA 2NYJA 5FZRA 1OWNA 3ASGA 3NZSA 3PZ2A 1VDYA 4V3IA 1E8WA 3MV2B 2IJGX 4KXKB 3LVRE 4N5CA 1UOHA 4G2VA 5B1AE 3T8MA 3S2AA 5EILA 3V30A 2ZIRA 3Q79A 3OXLA 4CCAA 1KT0A 3SFXA 3LKUA 2Y3AA 1X5BA 3S7JA 3FUJA 4N2SA 4LNBA 2XEVA 4JXTA 1BI7B 1NA3A 4B0ZA 4J0UA
chains in the Genus database with same CATH topology
4GMLA 2YINA 3O48A 3PREA 4BX9A 1WAO1 2IU1A 5AJDA 4DI4A 2ILRA 3CHPA 1UJKA 1UJJA 1FCHA 1H0AA 3U4TA 2RD0A 3AS8A 3MA5A 4DPRA 3CVVA 3ESKA 3OTNA 5JJTA 2YQ8A 2DBAA 3SBSA 4C0MA 3T5VA 4ILGA 2X6FA 4WAFA 4WNFA 4DK5A 5KJMA 4GU5A 3PE3A 4HXIA 2UY1B 1OWMA 4FLHA 4KZ0A 3U3WA 4BX8A 5BV0A 3CQCB 3I3NA 5CCLA 4LEUA 3RRMB 3S7FA 4W9RA 3PNTB 2FBNA 3CHOA 1SZ9A 4GMJA 4U04A 4UQXA 3HVEB 4WNGA 3KAEA 2PM7A 2C0MA 1XNFA 3L13A 3QAQA 4N3CA 4GZ5A 4F53A 3ML9A 3JQ1A 3RRUA 3HIZA 4CGVA 3ULQA 2XRYA 3GZSA 3ONLA 3FWVA 4KYOB 4NURA 3AU4A 2WXKA 3CHRA 2X6KA 1U3DA 4KZCA 4J8SA 2A5UA 4MS6A 2J09A 2VGYA 3D9KA 2E0IA 3RO2A 3IBEA 3AS5A 2MOWA 3ZFWA 4C0EA 3R7QA 5FQ7A 1JWFA 5FQ4A 2BTDA 4Q94A 3GYZA 2UWJG 4E6HA 3CR3A 3CHMA 2WXOA 3MX3A 4UWLA 3TXNA 4BT9A 3GZ1A 4KT6B 4I2WA 3L17A 3LPZA 3PUJA 1N52A 3CK8A 4CDNA 1JWGA 1EYHA 2J08A 4AVXA 3G2UA 4L23A 4JVSA 2FF4A 4G11A 4HORA 5G55A 3D9LA 3LY9A 1UG3A 2KM4A 3CHSA 3NZUA 3B7RL 4K0RA 4I6GA 4JL0A 4NRHB 2XCBA 4CDRA 5KJNA 2CHXA 4J8FA 4I9EA 4U0UA 3RJVA 4PUCA 4EZKA 3TGOA 3CIAA 1HZ4A 2CFUA 2M63A 4PS8A 3S7BA 3ZYQA 5ANLA 3MJWA 5BNWA 2L0IA 4L2YA 1H2UA 2I2OA 3CK7A 3PS6A 3LS8A 3MKQB 3TXMA 5AENA 5ENNA 4FP7A 3FTSA 5KJKA 1IHGA 5FZSA 3VLEA 5KJLA 3D3MA 5AYWD 2R17C 3G2SA 2NXPA 4GPKA 2XPZA 1DNPA 2PZIA 3FU3A 4B94A 2CHZA 2I1JA 3ZHEB 1NP7A 3SNXA 3SZ7A 3EHMA 3U64A 2IF4A 4GCOA 2WQHA 3CVQA 4XKCA 3CEQA 3QWWA 4I43A 5BW8C 4DLQA 5E75A 2WXRA 3DBSA 3QKYA 3CVYA 3CSFA 3UPVA 2VGXA 3LYAA 3MYVA 3B7UX 3FUEA 3IV0A 4JHJA 1SQMA 3ESLA 4UQYA 3PUKA 2WQ6A 4DI3A 4WNEA 4NACA 3B7TA 2CHWA 3LJ3A 2RG8A 4BSXA 4FULA 1HU3A 4RSYA 3R7RA 2XRZA 1FVFA 2VYIA 5EKQD 3MGBA 5ARGA 3ZN3A 5J08A 2PM6A 2WXFA 3IEGA 4ME2A 5G04J 3OXGA 2L0TB 3ZVVA 4AJWA 3G2VA 4JPSA 4XI9A 3SD5A 1IQUA 2BUGA 2AXUA 4ANWA 3VTYA 3I4RB 3D9OA 4C9BB 4CEMA 3APFA 2L6JA 3FFLA 2I6HA 3QK0A 4UWKA 2KCVA 3CVWA 4AM9A 2WXIA 2LNIA 2WXGA 2WXLA 4AY6A 2PL2A 1SZAA 4I17A 1EDUA 4HOTA 4FC8A 4BTBA 3HDXA 3EHNA 5LCWJ 3ASFA 2VSXE 2GRMA 2VSYA 4OVUA 4AV7A 4FA6A 3FEXA 3O4ZA 1TEZA 5LP0A 5HQ8A 2XQ0A 4K03A 4AIFA 4KVMA 3ZYMA 5G04C 3VLFA 3N71A 4AP2A 3EIQC 2YHEA 4GA2A 1E90A 2WPVA 2WXNA 4G24A 5EDSA 4F1SA 3FTWA 4H7YA 2EQXA 3K9IA 5BUZA 3GZ2A 4I1AA 1BPOA 5FQ6A 5T3RA 5ANRA 3T5XA 2WXQA 4L1BA 3CVXA 4A3TA 2CFZA 1A17A 5BV1A 5CHEE 4A1GA 2VTBA 1QZ2A 1Z6TA 4JW1A 2XGMA 3CHQA 1JUQA 5LCWC 1W3BA 3KD7A 4FLBA 4E85A 3ZW3A 1HF8A 3MCXA 1OUVA 4UI9J 3FUKA 3QWPA 3IKOB 3CVLA 4IYPA 1MHQA 4P29A 4JEHA 4BTAA 5A6CA 4R7LA 2VJ8A 1YA0A 1ELWA 1XGWA 3BG0B 3D9JA 3D9IA 4IULA 4IN3B 3E4BA 3CVNA 3CLJA 4G1TA 5J90A 4TV3A 2KCLA 4GA1A 3QOUA 2V8SE 4UWHA 3FUHA 1INZA 3TL5A 3LEWA 4U8HA 5JHAA 3Q15A 1EF1C 1NA0A 3APCA 4APFA 3ML8A 3OXFA 3UT7A 5AIJA 1S0PA 4G26A 4UI9C 3TG4A 4A1SA 3QNKA 3FUFA 2WVIA 2AWIA 3AU5A 3ASHA 3B7SA 4LERA 1HE8A 3UUXA 4LUNU 2KATA 2JLBA 3CVUA 1PY1A 1OWPA 2I9CA 2C0LA 3I4GA 1HS6A 4UQZA 1LF8A 4UI9K 5FWQA 1NZNA 3FU6A 4BFRA 4XKBA 4EECA 3I5PA 4F7AA 3FH8A 3FTUA 3Q5MA 5C1DA 3ASDA 3AS4A 2X6IA 1H6KA 2VGXB 4YVOA 1Y6IA 3SHFA 4AOFA 2Y4TA 5T8IA 3LY8A 2XPIA 3CV0A 1QQEA 1HG2A 3FH5A 4GAAA 1E8YA 1DVPA 3QDNA 4PS7A 3JCKC 3ZEFA 3QB2A 2GW1A 4G23A 3QARA 2OVFA 3G2TA 3RKVA 3QWVA 4U63A 2Q7FA 3IHVA 1IYGA 1L5JA 3B13A 3U9WA 1P5QA 3PVLA 5D0QD 2IFUA 5CMWA 2HR2A 3IHYA 2WQ7A 2WXPA 3L16A 5T4YA 3HHMA 4GCNA 1HG5A 3QC1A 2CG3A 2J07A 3UQ3A 4YVQC 2OVBA 4TRQA 2GGFA 3FTVA 3LXUX 3APDA 4I6JA 1GW6A 2ZU6B 3SF4A 3Q49B 1MQSA 2HM8A 1ELRA 1E7VA 4L7TA 3ZGQA 4ANUA 4GZDA 4I2ZA 3CGHA 3EIJA 5A7DB 4DLOA 2PQRA 4XIFA 1HFAA 5LX8A 5JJ7A 2AXVA 1U3CA 2PQNA 4B8CB 3MKRA 4CT0A 2DCPA 2HO1A 4FHJA 3U66A 2DIWA 3L08A 2LSUA 4GZ6A 4WWOA 3MZLB 4GA0A 2MRIA 2X6HA 5E76A 3JYSA 2FEZA 2AXZA 4RG9A 2CG2A 4EPZA 3P1UA 2WXHA 1QNFA 3PRZA 1JPLA 1ZBPA 2X6JA 4O6FA 3Q4AB 2XGSA 1WM5A 5HI7A 3FUMA 3GW4A 3P2BA 4EQFA 2J49A 4XZ4A 4CRWA 4FJZA 1N54A 2KC7A 3EDTB 4RVBA 2V4LA 5FJYA 2VTBB 4BY6A 5C2YA 4WNDA 3RK6A 1E8XA 1ZU2A 3ZXSA 4ACKA 2R5SA 5G05J 4XE0A 3RRNB 3FULA 4AXHA 2HYZA 2Y4UA 3R9AB 3SFZA 3ZHEA 1HH8A 4JEUA 3TAXA 1PAQA 2YHCA 3UMVA 3BG1B 2WMNA 4AEZC 4OYSA 3PZDA 4PDXA 1Y8MA 1EPUA 3ONKA 4HFGA 3ZIMA 4AY5A 1OWOA 2L9BA 3WXXA 5BPPA 4CGWA 1UN8A 3EJNA 3FUDA 2XHEA 4F3VA 5DIZA 1OWLA 4PH4B 1B89A 4TUUA 4ANXA 2V0PA 2J4DA 4RG6A 2YNQA 5JHBA 4I6EA 1KT1A 5CMYA 5KCMA 1ELKA 3PEUB 4JA9A 5G05C 5BT1A 2WXMA 2KZTA 1HO8A 4CT4A 4J6IA 4N39A 2LAHA 3FH7A 4D10C 3PH0C 4DJAA 2V5FA 3FUNA 4GYWA 3S7DA 5A23A 3LY7A 2IOSA 2LAIA 2NSZA 4WUYA 4Q69A 4ABNA 4XX5A 2QY7A 3D9MA 4I9CA 4EBAA 2WM9A 4YNDA 1E7UA 2C2LA 3D9NA 4U0ZA 3UT4A 4ATGA 5EX0A 4PS3A 4WWPA 4M3OA 3JQ0A 2GRLA 4U0SA 3ZYLA 2I1KA 3MEKA 2A4ZA 3L54A 4OVVA 3URZA 5D0OD 4N3BA 3BEEA 2IONA 4J8EA 3UT8A 1TJCA 4CDMA 4FADA 3FU5A 4HLEA 3FTYA 4ANVA 2XGOA 4MRUA 2WB2A 2BF0X 1FVHA 4ILHB 5FQ8A 4XI0A 1UN9A 3FU0A 2XCCA 3FTZA 5M72A 5JJ6A 2OOEA 4EBAG 3VTXA 2UY1A 3FTXA 4J8DA 5LFAA 3PDNA 3VLDA 5CCMA 4KMOA 4HS2A 3HYMB 4QFVA 3L6AA 5ARFA 2NC9A 1WY6A 3FY4A 3HVEA 3TJPA 3NQPA 4N3AA 4WWNA 2WXJA 4HOQA 4HVBA 3CQGB 1KLXA 3JUIA 4URKA 1IQRA 2FI7A 1H19A 1HXIA 2AVPA 3CK9A 3G2WA 2X38A 3LVQE 1PC2A 3QJZA 2ONDA 2P58C 3RU0A 4GB9A 4UWFA 4APOA 2IQCA 4I1OB 3FDHA 3NF1A 2LO6A 4FHKA 4KBQA 4GZ3A 4H7XA 3RO3A 4LCTA 4ACLA 3SGHA 3FHEA 4EZJA 5LOZA 1UW4B 5G2NA 2KCKA 2LSVA 2MHKA 3ENEA 1H2TC 4HOSA 4JC8A 3PE4A 2R59A 4B8AA 2FO7A 2J9QA 4GZCA 4NQ0A 1TJFA 4Y6WA 3PNLB 4L2LA 4JZYA 2QFCA 3LDZA 3TG5A 1H2VC 4HOUA 1E8ZA 2WMOA 2J4BA 2E2EA 3SI5A 4MLPA 2IOLA 3CKCA 3KS2A 4BWRA 4N2QA 4IRUA 3ZPJA 3Q47B 4UWGA 4FJYA 2VSOE 3CKBA 3KEZA 5FZRA 5FZQA 1OWNA 2AW6A 3MV3B 1Z3YA 3ASGA 3NZSA 4BT8A 3FP3A 3L22A 4JHKA 4JHRA 4B89A 1VDYA 4EZLA 3OAWA 5FTPA 4V3IA 3FUIA 2OV8A 1E8WA 3FEYA 3PEVB 3MV2B 4ILIA 2IJGX 4JA7A 1E96B 4KXKB 5AJLA 3MKQA 3LVRE 5DBKA 3UX4A 4N5CA 3LCAA 4Y6CA 2XPYA 3RIBA 4G2VA 1HX8A 3D9PA 4I1MA 4MKTA 2KZTB 3SBTB 3C98A 3DPDA 3S2AA 3T8MA 4A3VA 3ZRHA 3OXLA 4CCAA 4GYOA 2X3MA 2FULA 5EX3A 1KT0A 2JEKA 3ZYKA 3CVPA 2Y3AA 3LKUA 1X5BA 2VQ2A 4GYYA 4LRZA 3S7JA 2VSNA 3FUJA 4N2SA 4FU3A 4U07A 2XEVA 3CSTA 5FT9A 4JXTA 1NA3A 4KVOA 4A55A 1Z3XA 4J0UA 4B0ZA 4G25A 4Q96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O48 A;  1WAO 1;  1FCH A;  3U4T A;  3AS8 A;  3MA5 A;  3ESK A;  5JJT A;  2YQ8 A;  2DBA A;  4WNF A;  5KJM A;  3PE3 A;  2UY1 B;  3U3W A;  5CCL A;  4LEU A;  3S7F A;  4W9R A;  2FBN A;  4WNG A;  4U04 A;  4UQX A;  3KAE A;  2C0M A;  1XNF A;  4N3C A;  4GZ5 A;  4CGV A;  3ULQ A;  3FWV A;  4KYO B;  2VGY A;  3RO2 A;  3AS5 A;  3ZFW A;  3GYZ A;  2UWJ G;  4BT9 A;  3GZ1 A;  4I2W A;  3LPZ A;  3CK8 A;  2FF4 A;  4HOR A;  3LY9 A;  4CDR A;  4JL0 A;  4NRH B;  2XCB A;  5KJN A;  4J8F A;  4I9E A;  4U0U A;  3RJV A;  3TGO A;  1HZ4 A;  3S7B A;  5BNW A;  3CK7 A;  5KJK A;  1IHG A;  5FZS A;  5KJL A;  5AYW D;  4GPK A;  2PZI A;  4B94 A;  3ZHE B;  3SZ7 A;  2IF4 A;  4GCO A;  2WQH A;  3CVQ A;  3CEQ A;  3QWW A;  5BW8 C;  3QKY A;  3UPV A;  2VGX A;  3LYA A;  4UQY A;  4WNE A;  2VYI A;  5EKQ D;  5ARG A;  3ZN3 A;  3IEG A;  4ME2 A;  5G04 J;  3OXG A;  4XI9 A;  2BUG A;  3VTY A;  2L6J A;  3FFL A;  2I6H A;  2KCV A;  4AM9 A;  2LNI A;  4AY6 A;  2PL2 A;  4I17 A;  4HOT A;  4BTB A;  5LCW J;  3ASF A;  2VSY A;  5HQ8 A;  4AIF A;  5G04 C;  3N71 A;  4GA2 A;  2WPV A;  4G24 A;  4H7Y A;  3K9I A;  3GZ2 A;  4I1A A;  1A17 A;  5CHE E;  1QZ2 A;  2XGM A;  5LCW C;  1W3B A;  3KD7 A;  4UI9 J;  1OUV A;  3QWP A;  3CVL A;  4BTA A;  5A6C A;  1YA0 A;  1ELW A;  4IN3 B;  3E4B A;  3CVN A;  4G1T A;  2KCL A;  4GA1 A;  3QOU A;  3Q15 A;  1NA0 A;  3OXF A;  4G26 A;  4UI9 C;  3TG4 A;  4A1S A;  3ASH A;  3UUX A;  2KAT A;  2JLB A;  4UQZ A;  2C0L A;  4UI9 K;  1NZN A;  3Q5M A;  5C1D A;  3ASD A;  3AS4 A;  2VGX B;  4YVO A;  2Y4T A;  3LY8 A;  2XPI A;  3CV0 A;  1QQE A;  5JJ7 A;  3QDN A;  2GW1 A;  4G23 A;  3RKV A;  3QWV A;  2Q7F A;  1IYG A;  1P5Q A;  5D0Q D;  2IFU A;  2HR2 A;  4GCN A;  3UQ3 A;  4YVQ C;  3SF4 A;  3Q49 B;  3ZGQ A;  1ELR A;  4I2Z A;  5A7D B;  2PQR A;  4XIF A;  2PQN A;  3MKR A;  2HO1 A;  4GZ6 A;  2LSU A;  4GA0 A;  3JYS A;  2FEZ A;  4RG9 A;  1ZBP A;  4O6F A;  3Q4A B;  2XGS A;  1WM5 A;  5HI7 A;  3GW4 A;  4EQF A;  2KC7 A;  3EDT B;  5FJY A;  4WND A;  1ZU2 A;  2R5S A;  5G05 J;  2HYZ A;  2Y4U A;  3ZHE A;  3R9A B;  1HH8 A;  3TAX A;  2YHC A;  1Y8M A;  4AY5 A;  3WXX A;  4CGW A;  4F3V A;  5DIZ A;  1B89 A;  4RG6 A;  1KT1 A;  4JA9 A;  5G05 C;  5BT1 A;  4N39 A;  2V5F A;  4GYW A;  3S7D A;  3LY7 A;  4WUY A;  4ABN A;  4I9C A;  4YND A;  2C2L A;  4U0Z A;  5EX0 A;  4U0S A;  3MEK A;  3URZ A;  5D0O D;  4N3B A;  3BEE A;  4J8E A;  1TJC A;  2XGO A;  4XI0 A;  2XCC A;  5M72 A;  5JJ6 A;  2OOE A;  3VTX A;  2UY1 A;  4J8D A;  3PDN A;  5CCM A;  3HYM B;  5ARF A;  2NC9 A;  4N3A A;  4HOQ A;  1KLX A;  2FI7 A;  3CK9 A;  1HXI A;  2AVP A;  1PC2 A;  2OND A;  2P58 C;  3RU0 A;  4APO A;  4KBQ A;  3NF1 A;  4GZ3 A;  4H7X A;  3RO3 A;  2KCK A;  2LSV A;  2MHK A;  4HOS A;  3PE4 A;  2FO7 A;  2J9Q A;  4NQ0 A;  4Y6W A;  2QFC A;  3TG5 A;  4HOU A;  4BWR A;  2E2E A;  4N2Q A;  3CKC A;  3KS2 A;  3ZPJ A;  3Q47 B;  3CKB A;  5FZR A;  5FZQ A;  3MV3 B;  3ASG A;  4BT8 A;  3FP3 A;  4JHR A;  5FTP A;  3MV2 B;  4JA7 A;  1E96 B;  4KXK B;  5DBK A;  4N5C A;  3LCA A;  4Y6C A;  3RIB A;  4G2V A;  3OXL A;  4GYO A;  5EX3 A;  1KT0 A;  3CVP A;  3LKU A;  2VQ2 A;  4GYY A;  3S7J A;  2VSN A;  4N2S A;  4U07 A;  2XEV A;  5FT9 A;  1NA3 A;  4J0U A;  4G25 A; 
#chains in the Genus database with same CATH topology
 4BX9 A;  5AJD A;  4DI4 A;  3CHP A;  1UJJ A;  2RD0 A;  3MA5 A;  4RLY A;  3OTN A;  2DBA A;  4BER A;  2X6F A;  4GU5 A;  1OWM A;  2L6B A;  2ZGD A;  4FLH A;  4BX8 A;  5BV0 A;  5CCL A;  3S7F A;  3RRM B;  4O1P A;  1IKN D;  4HI8 A;  4GMJ A;  4WNG A;  3KAE A;  1XNF A;  4F53 A;  4GZ5 A;  4CGV A;  2P9I G;  2XRY A;  3RSE G;  2AJA A;  3AU4 A;  4ZHB A;  3ABK E;  4MS6 A;  2VGY A;  4HI9 A;  3TWQ A;  3IBE A;  3ZFW A;  5FQ4 A;  2BTD A;  4Q94 A;  2B6C A;  3C3R A;  2WXO A;  3L9T A;  3MX3 A;  5AQ9 A;  4KT6 B;  3PUJ A;  1N52 A;  1K1B A;  1EYH A;  1OT8 A;  2XZT G;  4GTO A;  1JCS A;  1NFI E;  4O1O A;  1UG3 A;  2KM4 A;  4J8F A;  4EZK A;  4PS8 A;  2M63 A;  3S7B A;  1TNB A;  3MJW A;  1H2U A;  3CK7 A;  3TXM A;  4K5B A;  3E34 A;  4FP7 A;  3VLE A;  2PZI A;  3R9M A;  4B94 A;  4LNU D;  3EHM A;  4XKC A;  4DLQ A;  3DBS A;  3CVY A;  2QYU A;  5AQB A;  3B7U X;  3IV0 A;  4JHJ A;  4UQY A;  5EN5 D;  3TWR A;  4TXR A;  4OAV B;  5EKQ D;  3MGB A;  1N4S A;  2PM6 A;  4YDO A;  4ME2 A;  5AQA A;  2L0T B;  4JPS A;  2AXU A;  4C9B B;  3UKU G;  2L6J A;  3ISM C;  2I6H A;  2KCV A;  4AM9 A;  2WXG A;  2WXL A;  1SZA A;  4G8K A;  1EDU A;  4HOT A;  2VSX E;  2VSY A;  3HXB A;  5HQ8 A;  5LP0 A;  4TXP A;  3ZYM A;  2YHE A;  4U8V D;  1E90 A;  2WPV A;  2P9U G;  5CRU A;  5ANR A;  2WXQ A;  4L1B A;  5BV1 A;  2XGM A;  4DRX E;  2OEW A;  4UI9 J;  1OUV A;  1MHQ A;  4BTA A;  5A6C A;  2VJ8 A;  3BG0 B;  2KCL A;  1KZO A;  4GA1 A;  3TL5 A;  3UT7 A;  3EUV A;  4UI9 C;  3FUF A;  2DYS E;  2AWI A;  3AU5 A;  4LUN U;  2JLB A;  4U96 D;  3CVU A;  1OWP A;  3UM2 A;  1HS6 A;  1S64 A;  4BFR A;  4EEC A;  3FH8 A;  3ASD A;  3AS4 A;  2X6I A;  4AOF A;  2XPI A;  1MZC A;  5CRV A;  1E8Y A;  1TNU A;  2XEH A;  3D9H A;  2ZGG A;  4G23 A;  2Q7F A;  3IHV A;  1K3Z D;  4HRM B;  1IYG A;  3PVL A;  3IHY A;  3E37 A;  5EID A;  4GCN A;  3QC1 A;  2J07 A;  3UQ3 A;  2OVB A;  5B1B E;  3FTV A;  4I6J A;  3Q49 B;  3ZGQ A;  4U95 D;  4GZD A;  4I2Z A;  3CGH A;  3EIJ A;  5A7D B;  5KBA A;  2PQN A;  3MKR A;  2DZO A;  3Q7A A;  3SFY A;  3DXM G;  3MZL B;  4GA0 A;  2MRI A;  4NIK A;  2CG2 A;  4EPZ A;  2X6J A;  4O6F A;  3Q4A B;  5HI7 A;  4GTM A;  2J49 A;  4HB5 A;  2Y0B G;  4G8L A;  2R5S A;  3AJI A;  4YDW A;  4PDX A;  2PNN A;  2RFA A;  2L9B A;  1UN8 A;  3FUD A;  4F3V A;  1OWL A;  2Y1L E;  5CMY A;  1ELK A;  1RW2 A;  5BT1 A;  1BLX B;  5ENR D;  2WXM A;  2KZT A;  4CT4 A;  2V5F A;  3FUN A;  2F0Y A;  2LAI A;  4ABN A;  2QY7 A;  3D9N A;  3V79 K;  2GRO B;  4M3O A;  2HE0 A;  2GRL A;  2I1K A;  1NL4 A;  4OAU C;  3BEE A;  2ION A;  4J8E A;  4CDM A;  4FAD A;  1YCS B;  4YDY A;  2WB2 A;  4XI0 A;  3FU0 A;  2XCC A;  3FTZ A;  3TWV A;  3VTX A;  2UY1 A;  4A63 B;  3HYM B;  4QFV A;  2NC9 A;  1WY6 A;  3FY4 A;  4HOQ A;  3CQG B;  1KLX A;  3JUI A;  4M7C A;  1H19 A;  1HXI A;  3LVQ E;  1PC2 A;  2R03 A;  3DXK G;  1A5E A;  5D2M C;  3RO3 A;  2A5E A;  3SGH A;  3FHE A;  1V54 E;  5G2N A;  2KCK A;  2MHK A;  1S63 A;  4JC8 A;  2LUH A;  4B8A A;  2J9Q A;  3AAA C;  2R2L A;  4JZY A;  5BXU A;  1IXV A;  4LNG A;  1E8Z A;  2WMO A;  3SI5 A;  4MLP A;  4UWG A;  4FJY A;  3CKB A;  2XZD G;  3KEZ A;  4EZL A;  3OAW A;  5HS0 A;  2V4H C;  3FUI A;  4ILI A;  1BD8 A;  4JA7 A;  1E96 B;  5AJL A;  3MKQ A;  4Y6C A;  2XPY A;  3RIB A;  2KZT B;  3Q75 A;  5ENO D;  4GYO A;  3ZYK A;  1MX2 A;  1YMP A;  3EU5 A;  4LRZ A;  2EIN E;  2KBX A;  4U07 A;  4KVO A;  5CEC B;  2IU1 A;  2ILR A;  1FCH A;  2JAB A;  3DEP A;  1TNO A;  2YQ8 A;  4C0M A;  3T5V A;  1N95 A;  4WAF A;  1N4P A;  4HXI A;  2UY1 B;  3UM3 A;  4GTV A;  2FBN A;  1TN6 A;  4U04 A;  1MYO A;  4HBD A;  3L13 A;  3TWT A;  3JQ1 A;  3ULQ A;  3ONL A;  1TN8 A;  3FWV A;  2QZA A;  2J09 A;  3D9K A;  3LJN A;  3AS5 A;  3HRA A;  4BET A;  3TXN A;  3L17 A;  4DX6 D;  3PZ4 A;  2P9L G;  2J08 A;  4AVX A;  3G2U A;  4JVS A;  5G55 A;  3LY9 A;  4DX2 A;  4CDR A;  3DSX A;  5KJN A;  4I9E A;  2ZXW E;  1HZ4 A;  2CFU A;  2P9S G;  5BNW A;  1KPS B;  2BKG A;  4GTR A;  4X8Q A;  1K1A A;  3F6Q A;  2EIK E;  3C3Q A;  3PS6 A;  3LS8 A;  3MKQ B;  5ENN A;  5KJK A;  2QYJ A;  1DNP A;  3SY2 A;  1N94 A;  3KSL A;  3FU3 A;  3TWS A;  3ZHE B;  1NP7 A;  4GCO A;  1N9A A;  2WQH A;  3Q9N C;  3CEQ A;  4I43 A;  5E75 A;  3QKY A;  3CSF A;  3MYV A;  4LG6 A;  1SQM A;  3PUK A;  2RFM A;  4NAC A;  5ENS D;  4RSY A;  3NBN B;  3ZN3 A;  5J08 A;  3NB2 A;  1OCZ E;  5CEA A;  4F1P A;  2DVW A;  1TNZ A;  3OXG A;  5G04 J;  3G2V A;  1IQU A;  4GMR A;  4ANW A;  4CEM A;  3I4R B;  3CVW A;  2WXI A;  2LNI A;  2PL2 A;  3ZKJ A;  4I17 A;  4J7W A;  4BTB A;  3EHN A;  3FEX A;  1TEZ A;  5G04 C;  1SVX A;  2GRQ B;  3VLF A;  4AP2 A;  3EIQ C;  4GA2 A;  2WXN A;  5EDS A;  2KXP C;  4H7Y A;  3K9I A;  5BUZ A;  3GZ2 A;  1BPO A;  5FQ6 A;  4A3T A;  1JUQ A;  1TYQ G;  1HF8 A;  3MCX A;  3QWP A;  3IKO B;  1OCO E;  1H6P A;  1YA0 A;  4IN3 B;  3QOU A;  4UWH A;  3EHQ A;  5D66 A;  3Q15 A;  1EF1 C;  1G3N B;  1NA0 A;  4A1S A;  1BI8 B;  3ASH A;  4LER A;  3NAW A;  1HE8 A;  3UUX A;  1NI1 A;  1RZ4 A;  1PY1 A;  2I9C A;  1Z5S C;  5FWQ A;  1NZN A;  3FU6 A;  4XKB A;  1O1T A;  4F7A A;  3FTU A;  3Q5M A;  5C1D A;  1H6K A;  4YVO A;  1Y6I A;  2RKK A;  5T8I A;  3BU8 A;  3FH5 A;  1HG2 A;  4GAA A;  5JJ7 A;  3QDN A;  4HQD A;  3QB2 A;  3UXG A;  2GW1 A;  2OVF A;  3G2T A;  3QWV A;  1L5J A;  1P5Q A;  2IFU A;  1D9S A;  5CMW A;  2HR2 A;  2WQ7 A;  5T4Y A;  3EU9 A;  3J5Q B;  1GW6 A;  1S70 B;  1MQS A;  4ANU A;  1E7V A;  2PQR A;  1HFA A;  1X81 A;  3W9G A;  2DCP A;  2HO1 A;  2DIW A;  5E76 A;  2FEZ A;  2AXZ A;  2WXH A;  1QNF A;  1ZBP A;  3FUM A;  3GW4 A;  3P2B A;  1FPP A;  4XZ4 A;  1H6O A;  5C2Y A;  4ACK A;  4XE0 A;  1QBQ A;  3TAX A;  4JEU A;  3UMV A;  2IEJ A;  3PZD A;  3ZIM A;  3EHR A;  2IO2 C;  3C3O A;  4RG6 A;  4K5C A;  4I6E A;  5KCM A;  3PEU B;  3V2O A;  4DX1 A;  1SW6 A;  4J6I A;  4K5A B;  3ABM E;  4HRL A;  3DWL G;  4WUY A;  4Q69 A;  4GPM A;  2WM9 A;  1E7U A;  2C2L A;  4U0Z A;  5EX0 A;  2FO1 E;  2H6H A;  3JQ0 A;  3MEK A;  2VGE A;  2GRN B;  3L54 A;  4OVV A;  3URZ A;  3UT8 A;  1TJC A;  3FTY A;  2XGO A;  4MRU A;  2BF0 X;  4ILH B;  1UN9 A;  3FTX A;  4J8D A;  3L6A A;  4DUI A;  5ARF A;  2WXJ A;  5CED B;  1V55 E;  4XEI G;  3Q9U C;  2FI7 A;  3UTM A;  3QJZ A;  2OND A;  5FIN A;  4YDE A;  2H6G A;  4UWF A;  2IQC A;  4I1O B;  3FDH A;  3NF1 A;  1UW4 B;  3ENE A;  1DCQ A;  2R59 A;  2FO7 A;  2F37 A;  4GZC A;  4Y6W A;  3LDZ A;  3TG5 A;  1WDY A;  1H2V C;  4HOU A;  1MX4 A;  2E2E A;  4N2Q A;  3CKC A;  4HRN A;  3ZPJ A;  3Q47 B;  2VSO E;  1Z3Y A;  4B89 A;  4JHR A;  3FEY A;  3PEV B;  4TXQ A;  5B3S E;  1HX8 A;  3D9P A;  3DSW A;  3SBT B;  4A3V A;  3ZRH A;  5EX3 A;  4GYY A;  2VSN A;  5FT9 A;  2P9P G;  2F8X K;  1Z3X A;  4KZ0 A;  3DSU A;  4G25 A;  4Q96 A;  4GML A;  3O48 A;  3PRE A;  1WAO 1;  1UJK A;  3U4T A;  3AS8 A;  3CVV A;  1N0Q A;  3SBS A;  4GTQ A;  5HRY A;  3CQC B;  3I3N A;  4W9R A;  2PM7 A;  3QAQ A;  4N3C A;  5HKP A;  3RRU A;  3HIZ A;  3GZS A;  4KYO B;  4NUR A;  4KZC A;  4J8S A;  2A5U A;  2ETA A;  4B93 B;  4C0E A;  1YYH A;  3CR3 A;  3CHM A;  4BT9 A;  3LPZ A;  3B7B A;  4CDN A;  1JWG A;  3ASO E;  3IXE A;  4L23 A;  4CYM D;  4HOR A;  1DCE A;  3D9L A;  4K0R A;  4I6G A;  4JL0 A;  2CHX A;  4PUC A;  3TGO A;  3ZYQ A;  3TWW A;  1QYM A;  3ZUV B;  2L0I A;  5AEN A;  5ENQ D;  3FTS A;  1IHG A;  5FZS A;  3D3M A;  5AYW D;  2R17 C;  2XPZ A;  3E30 A;  1AP7 A;  1JCR A;  3SZ7 A;  3U64 A;  3ZNG A;  3CVQ A;  3QWW A;  1N0R A;  2VGX A;  3LYA A;  3FUE A;  3ESL A;  2WQ6 A;  3WG7 E;  4DI3 A;  4WNE A;  2H6I A;  3Q73 A;  2CHW A;  4BSX A;  4FUL A;  1HU3 A;  3R7R A;  2XRZ A;  2R02 A;  3IEG A;  3HXC A;  3ZVV A;  3SD5 A;  2BUG A;  3VTY A;  4TUM A;  3AG3 E;  3QK0 A;  4UWK A;  3HXF A;  4AY6 A;  2XS1 A;  4FC8 A;  5LCW J;  3ASF A;  2V5Q C;  2GRM A;  4OVU A;  4FA6 A;  4ATZ D;  5CER B;  4K03 A;  5AAO A;  4AIF A;  4KVM A;  4F1S A;  2EQX A;  4I1A A;  3CVX A;  5T3R A;  3T5X A;  2CFZ A;  1A17 A;  3UM1 A;  2VTB A;  4A1G A;  1Z6T A;  5LCW C;  2LXM A;  1W3B A;  4FLB A;  4E85 A;  1SA5 A;  4IYP A;  4JEH A;  1XGW A;  3D9J A;  3D9I A;  4RQI A;  1OCC E;  3DSV A;  3CVN A;  3CLJ A;  4G1T A;  5J90 A;  4TV3 A;  2V8S E;  1INZ A;  3LEW A;  4U8H A;  5JHA A;  4APF A;  2ETB A;  1S0P A;  4G26 A;  3TG4 A;  2WVI A;  3T9K A;  2KAT A;  2C0L A;  3I4G A;  4UI9 K;  1K8K G;  2EIJ E;  2IY0 C;  2VGX B;  3PZ1 A;  5JMN D;  3LY8 A;  1QQE A;  4PS7 A;  1DVP A;  3JCK C;  3ZEF A;  3RKV A;  4U63 A;  1O1R A;  4LSZ E;  3B13 A;  3U9W A;  5D0Q D;  2WXP A;  5KNG A;  4GTS A;  2CG3 A;  3LXU X;  5ENT D;  2BKK B;  2ZU6 B;  4L7T A;  1ELR A;  4BSZ B;  5LX8 A;  3V31 A;  1U3C A;  3KEA A;  4FHJ A;  1WG0 A;  3L08 A;  2LSU A;  4GZ6 A;  2X6H A;  3JYS A;  4RG9 A;  3KSQ A;  3P1U A;  3UIN C;  5BXO A;  1JPL A;  2B0O E;  2XGS A;  3X2Q E;  1WM5 A;  1N54 A;  2KC7 A;  2V4L A;  2VTB B;  4BY6 A;  4WND A;  3RK6 A;  1ZU2 A;  3ZXS A;  3HG0 D;  5G05 J;  2HYZ A;  2Y4U A;  2OCC E;  1PAQ A;  2YHC A;  3BG1 B;  2WMN A;  4BES A;  4AEZ C;  5CBO A;  3E32 A;  4AY5 A;  1OWO A;  3TWX A;  3EJN A;  3HXE A;  4CZ2 D;  2XHE A;  1B89 A;  4TUU A;  2V0P A;  2J4D A;  4HLL A;  5JHB A;  1IHB A;  2XS8 A;  4JA9 A;  4MBG A;  5G05 C;  3HXD A;  4N39 A;  3S7D A;  2MYO A;  5A23 A;  3LY7 A;  4XX5 A;  2J8S D;  4EBA A;  4YND A;  3UT4 A;  4ATG A;  4WWP A;  3NOG D;  5ITZ F;  5FIO A;  1OY3 D;  3ZYL A;  2P9K G;  3DEO A;  5D0O D;  1LD7 A;  4HLE A;  4ANV A;  3UKR G;  5FQ8 A;  3BQO A;  2OOE A;  3Q78 A;  3AG2 E;  4EBA G;  3UI2 A;  5LFA A;  5CCM A;  1MJ0 A;  1N4Q A;  4UUC A;  3HVE A;  3TJP A;  3NQP A;  4GTP A;  1N4R A;  3UIP C;  5ENP D;  5AN8 A;  4URK A;  3CK9 A;  4JB8 P;  2X38 A;  5IY5 E;  2P58 C;  4APO A;  3J5P A;  4FHK A;  4KBQ A;  4GZ3 A;  4H7X A;  2IO3 C;  3ULY A;  4EZJ A;  5LOZ A;  3ZU7 B;  1H2T C;  3PE4 A;  5AQ7 A;  1TJF A;  3PNL B;  4L2L A;  2QFC A;  1O5M A;  3SO8 A;  2IOL A;  3KS2 A;  4IRU A;  5FZQ A;  2AW6 A;  3MV3 B;  4BT8 A;  3FP3 A;  3L22 A;  4JHK A;  3T8K A;  5FTP A;  2OV8 A;  1JCQ A;  5DBK A;  3UX4 A;  3LCA A;  2H6F A;  4I1M A;  4MKT A;  1TN7 A;  3C98 A;  3DPD A;  5KNH D;  2X3M A;  2FUL A;  3V2X A;  2JEK A;  3CVP A;  2VQ2 A;  1U2V G;  4JD2 G;  4FU3 A;  3CST A;  4A55 A;  2YIN A;  5H7P A;  1H0A A;  4DPR A;  2XEN A;  3ESK A;  4L9P A;  5JJT A;  4ILG A;  2XEE A;  4WNF A;  5EYL A;  4DK5 A;  5KJM A;  3PE3 A;  3U3W A;  3UIO C;  4LEU A;  3PNT B;  3CHO A;  1SZ9 A;  4UQX A;  3HVE B;  1LD8 A;  2C0M A;  3C72 A;  3DST A;  3ZXP A;  3ML9 A;  2WXK A;  3CHR A;  2X6K A;  1U3D A;  3DSS A;  2E0I A;  3PZ3 A;  3RO2 A;  2MOW A;  3R7Q A;  5FQ7 A;  1JWF A;  3Q7F A;  3GYZ A;  2UWJ G;  4E6H A;  4UWL A;  3GZ1 A;  4I2W A;  3CK8 A;  2FF4 A;  4G11 A;  3CHS A;  3NZU A;  3B7R L;  4NRH B;  2XCB A;  3AG1 E;  4U0U A;  1N11 A;  3RJV A;  3CIA A;  5ANL A;  2OEV A;  2QC9 A;  5KWD A;  4Z68 A;  4L2Y A;  2I2O A;  4HNA D;  5KJL A;  3G2S A;  2NXP A;  4GPK A;  2CHZ A;  2I1J A;  3SNX A;  1SA4 A;  3W9F A;  2IF4 A;  5BW8 C;  2WXR A;  3UPV A;  3B7T A;  3LJ3 A;  4DX5 D;  2RG8 A;  1FVF A;  2VYI A;  1Q2Z A;  5ARG A;  2EIM E;  2R05 A;  2WXF A;  4F6R D;  4J8Y A;  4AJW A;  5CBN A;  4XI9 A;  3D9O A;  3APF A;  3FFL A;  1FT2 A;  3HDX A;  4AV7 A;  3O4Z A;  2XQ0 A;  2ZIS A;  3N71 A;  4G24 A;  3FTW A;  2BED A;  5CHE E;  1QZ2 A;  4JW1 A;  2DYR E;  3CHQ A;  1O1S A;  3KD7 A;  3ZW3 A;  3FUK A;  3CVL A;  5EIB E;  4P29 A;  4R7L A;  4IUL A;  1ELW A;  3E4B A;  3FUH A;  3APC A;  3ML8 A;  3OXF A;  5AIJ A;  4DX7 D;  2P2C P;  3QNK A;  3B7S A;  4UQZ A;  1LF8 A;  3I5P A;  3SHF A;  2Y4T A;  3CV0 A;  2P9N G;  4QQI A;  3QAR A;  4BEP A;  3ULE G;  1FT1 A;  3JXJ A;  3L16 A;  3HHM A;  1D8D A;  1HG5 A;  2EIL E;  4YVQ C;  4TRQ A;  2GGF A;  4N5Q A;  3APD A;  4C48 B;  3SF4 A;  2HM8 A;  4DLO A;  4XIF A;  2GRP B;  2AXV A;  4B8C B;  3U66 A;  4CT0 A;  1OXJ A;  1OCR E;  4WWO A;  1ZB1 A;  3C5R A;  3TWU A;  3PRZ A;  3SQV A;  4EHM A;  3RAU A;  3DRA A;  4EQF A;  4CRW A;  4FJZ A;  3EDT B;  4RVB A;  5FJY A;  3DPY A;  1E8X A;  3RRN B;  4O60 A;  3FUL A;  4AXH A;  3R9A B;  3SFZ A;  3ZHE A;  1HH8 A;  1AWC B;  3E33 A;  4OYS A;  3ABL E;  1Y8M A;  1EPU A;  3ONK A;  3JUE A;  4HFG A;  3WXX A;  5BPP A;  4CGW A;  5DIZ A;  4PH4 B;  4ANX A;  1MX6 A;  2YNQ A;  1KT1 A;  1HO8 A;  2LAH A;  3FH7 A;  4D10 C;  3PH0 C;  4DJA A;  2ETC A;  4GYW A;  2F8Y A;  2IOS A;  2NSZ A;  1DC2 A;  3L82 A;  3D9M A;  4I9C A;  1KZP A;  4PS3 A;  4U0S A;  5AAR A;  2A4Z A;  2DZN A;  4U7E B;  4N3B A;  3FU5 A;  1FVH A;  3B95 A;  1D8E A;  5M72 A;  5JJ6 A;  1BU9 A;  3UM0 A;  3BUA A;  3PDN A;  3VLD A;  4KMO A;  1TR4 A;  5JA4 D;  1LTX A;  4HS2 A;  2GRR B;  4GTT A;  4WWN A;  4N3A A;  3NOC D;  4HVB A;  3JXI A;  4U8Y D;  1IQR A;  3G2W A;  2AVP A;  2LXL A;  3RU0 A;  4GB9 A;  3ASN E;  2LO6 A;  4LCT A;  4ACL A;  5EYP F;  2LSV A;  4HOS A;  1TNY A;  4NQ0 A;  4ZFH A;  2Y69 E;  2DWZ A;  3AG4 E;  2J4B A;  4BWR A;  2NYJ A;  5FZR A;  1OWN A;  3ASG A;  3NZS A;  3PZ2 A;  1VDY A;  4V3I A;  1E8W A;  3MV2 B;  2IJG X;  4KXK B;  3LVR E;  4N5C A;  1UOH A;  4G2V A;  5B1A E;  3T8M A;  3S2A A;  5EIL A;  3V30 A;  2ZIR A;  3Q79 A;  3OXL A;  4CCA A;  1KT0 A;  3SFX A;  3LKU A;  2Y3A A;  1X5B A;  3S7J A;  3FUJ A;  4N2S A;  4LNB A;  2XEV A;  4JXT A;  1BI7 B;  1NA3 A;  4B0Z A;  4J0U A; 
#chains in the Genus database with same CATH homology
 4GML A;  2YIN A;  3O48 A;  3PRE A;  4BX9 A;  1WAO 1;  2IU1 A;  5AJD A;  4DI4 A;  2ILR A;  3CHP A;  1UJK A;  1UJJ A;  1FCH A;  1H0A A;  3U4T A;  2RD0 A;  3AS8 A;  3MA5 A;  4DPR A;  3CVV A;  3ESK A;  3OTN A;  5JJT A;  2YQ8 A;  2DBA A;  3SBS A;  4C0M A;  3T5V A;  4ILG A;  2X6F A;  4WAF A;  4WNF A;  4DK5 A;  5KJM A;  4GU5 A;  3PE3 A;  4HXI A;  2UY1 B;  1OWM A;  4FLH A;  4KZ0 A;  3U3W A;  4BX8 A;  5BV0 A;  3CQC B;  3I3N A;  5CCL A;  4LEU A;  3RRM B;  3S7F A;  4W9R A;  3PNT B;  2FBN A;  3CHO A;  1SZ9 A;  4GMJ A;  4U04 A;  4UQX A;  3HVE B;  4WNG A;  3KAE A;  2PM7 A;  2C0M A;  1XNF A;  3L13 A;  3QAQ A;  4N3C A;  4GZ5 A;  4F53 A;  3ML9 A;  3JQ1 A;  3RRU A;  3HIZ A;  4CGV A;  3ULQ A;  2XRY A;  3GZS A;  3ONL A;  3FWV A;  4KYO B;  4NUR A;  3AU4 A;  2WXK A;  3CHR A;  2X6K A;  1U3D A;  4KZC A;  4J8S A;  2A5U A;  4MS6 A;  2J09 A;  2VGY A;  3D9K A;  2E0I A;  3RO2 A;  3IBE A;  3AS5 A;  2MOW A;  3ZFW A;  4C0E A;  3R7Q A;  5FQ7 A;  1JWF A;  5FQ4 A;  2BTD A;  4Q94 A;  3GYZ A;  2UWJ G;  4E6H A;  3CR3 A;  3CHM A;  2WXO A;  3MX3 A;  4UWL A;  3TXN A;  4BT9 A;  3GZ1 A;  4KT6 B;  4I2W A;  3L17 A;  3LPZ A;  3PUJ A;  1N52 A;  3CK8 A;  4CDN A;  1JWG A;  1EYH A;  2J08 A;  4AVX A;  3G2U A;  4L23 A;  4JVS A;  2FF4 A;  4G11 A;  4HOR A;  5G55 A;  3D9L A;  3LY9 A;  1UG3 A;  2KM4 A;  3CHS A;  3NZU A;  3B7R L;  4K0R A;  4I6G A;  4JL0 A;  4NRH B;  2XCB A;  4CDR A;  5KJN A;  2CHX A;  4J8F A;  4I9E A;  4U0U A;  3RJV A;  4PUC A;  4EZK A;  3TGO A;  3CIA A;  1HZ4 A;  2CFU A;  2M63 A;  4PS8 A;  3S7B A;  3ZYQ A;  5ANL A;  3MJW A;  5BNW A;  2L0I A;  4L2Y A;  1H2U A;  2I2O A;  3CK7 A;  3PS6 A;  3LS8 A;  3MKQ B;  3TXM A;  5AEN A;  5ENN A;  4FP7 A;  3FTS A;  5KJK A;  1IHG A;  5FZS A;  3VLE A;  5KJL A;  3D3M A;  5AYW D;  2R17 C;  3G2S A;  2NXP A;  4GPK A;  2XPZ A;  1DNP A;  2PZI A;  3FU3 A;  4B94 A;  2CHZ A;  2I1J A;  3ZHE B;  1NP7 A;  3SNX A;  3SZ7 A;  3EHM A;  3U64 A;  2IF4 A;  4GCO A;  2WQH A;  3CVQ A;  4XKC A;  3CEQ A;  3QWW A;  4I43 A;  5BW8 C;  4DLQ A;  5E75 A;  2WXR A;  3DBS A;  3QKY A;  3CVY A;  3CSF A;  3UPV A;  2VGX A;  3LYA A;  3MYV A;  3B7U X;  3FUE A;  3IV0 A;  4JHJ A;  1SQM A;  3ESL A;  4UQY A;  3PUK A;  2WQ6 A;  4DI3 A;  4WNE A;  4NAC A;  3B7T A;  2CHW A;  3LJ3 A;  2RG8 A;  4BSX A;  4FUL A;  1HU3 A;  4RSY A;  3R7R A;  2XRZ A;  1FVF A;  2VYI A;  5EKQ D;  3MGB A;  5ARG A;  3ZN3 A;  5J08 A;  2PM6 A;  2WXF A;  3IEG A;  4ME2 A;  5G04 J;  3OXG A;  2L0T B;  3ZVV A;  4AJW A;  3G2V A;  4JPS A;  4XI9 A;  3SD5 A;  1IQU A;  2BUG A;  2AXU A;  4ANW A;  3VTY A;  3I4R B;  3D9O A;  4C9B B;  4CEM A;  3APF A;  2L6J A;  3FFL A;  2I6H A;  3QK0 A;  4UWK A;  2KCV A;  3CVW A;  4AM9 A;  2WXI A;  2LNI A;  2WXG A;  2WXL A;  4AY6 A;  2PL2 A;  1SZA A;  4I17 A;  1EDU A;  4HOT A;  4FC8 A;  4BTB A;  3HDX A;  3EHN A;  5LCW J;  3ASF A;  2VSX E;  2GRM A;  2VSY A;  4OVU A;  4AV7 A;  4FA6 A;  3FEX A;  3O4Z A;  1TEZ A;  5LP0 A;  5HQ8 A;  2XQ0 A;  4K03 A;  4AIF A;  4KVM A;  3ZYM A;  5G04 C;  3VLF A;  3N71 A;  4AP2 A;  3EIQ C;  2YHE A;  4GA2 A;  1E90 A;  2WPV A;  2WXN A;  4G24 A;  5EDS A;  4F1S A;  3FTW A;  4H7Y A;  2EQX A;  3K9I A;  5BUZ A;  3GZ2 A;  4I1A A;  1BPO A;  5FQ6 A;  5T3R A;  5ANR A;  3T5X A;  2WXQ A;  4L1B A;  3CVX A;  4A3T A;  2CFZ A;  1A17 A;  5BV1 A;  5CHE E;  4A1G A;  2VTB A;  1QZ2 A;  1Z6T A;  4JW1 A;  2XGM A;  3CHQ A;  1JUQ A;  5LCW C;  1W3B A;  3KD7 A;  4FLB A;  4E85 A;  3ZW3 A;  1HF8 A;  3MCX A;  1OUV A;  4UI9 J;  3FUK A;  3QWP A;  3IKO B;  3CVL A;  4IYP A;  1MHQ A;  4P29 A;  4JEH A;  4BTA A;  5A6C A;  4R7L A;  2VJ8 A;  1YA0 A;  1ELW A;  1XGW A;  3BG0 B;  3D9J A;  3D9I A;  4IUL A;  4IN3 B;  3E4B A;  3CVN A;  3CLJ A;  4G1T A;  5J90 A;  4TV3 A;  2KCL A;  4GA1 A;  3QOU A;  2V8S E;  4UWH A;  3FUH A;  1INZ A;  3TL5 A;  3LEW A;  4U8H A;  5JHA A;  3Q15 A;  1EF1 C;  1NA0 A;  3APC A;  4APF A;  3ML8 A;  3OXF A;  3UT7 A;  5AIJ A;  1S0P A;  4G26 A;  4UI9 C;  3TG4 A;  4A1S A;  3QNK A;  3FUF A;  2WVI A;  2AWI A;  3AU5 A;  3ASH A;  3B7S A;  4LER A;  1HE8 A;  3UUX A;  4LUN U;  2KAT A;  2JLB A;  3CVU A;  1PY1 A;  1OWP A;  2I9C A;  2C0L A;  3I4G A;  1HS6 A;  4UQZ A;  1LF8 A;  4UI9 K;  5FWQ A;  1NZN A;  3FU6 A;  4BFR A;  4XKB A;  4EEC A;  3I5P A;  4F7A A;  3FH8 A;  3FTU A;  3Q5M A;  5C1D A;  3ASD A;  3AS4 A;  2X6I A;  1H6K A;  2VGX B;  4YVO A;  1Y6I A;  3SHF A;  4AOF A;  2Y4T A;  5T8I A;  3LY8 A;  2XPI A;  3CV0 A;  1QQE A;  1HG2 A;  3FH5 A;  4GAA A;  1E8Y A;  1DVP A;  3QDN A;  4PS7 A;  3JCK C;  3ZEF A;  3QB2 A;  2GW1 A;  4G23 A;  3QAR A;  2OVF A;  3G2T A;  3RKV A;  3QWV A;  4U63 A;  2Q7F A;  3IHV A;  1IYG A;  1L5J A;  3B13 A;  3U9W A;  1P5Q A;  3PVL A;  5D0Q D;  2IFU A;  5CMW A;  2HR2 A;  3IHY A;  2WQ7 A;  2WXP A;  3L16 A;  5T4Y A;  3HHM A;  4GCN A;  1HG5 A;  3QC1 A;  2CG3 A;  2J07 A;  3UQ3 A;  4YVQ C;  2OVB A;  4TRQ A;  2GGF A;  3FTV A;  3LXU X;  3APD A;  4I6J A;  1GW6 A;  2ZU6 B;  3SF4 A;  3Q49 B;  1MQS A;  2HM8 A;  1ELR A;  1E7V A;  4L7T A;  3ZGQ A;  4ANU A;  4GZD A;  4I2Z A;  3CGH A;  3EIJ A;  5A7D B;  4DLO A;  2PQR A;  4XIF A;  1HFA A;  5LX8 A;  5JJ7 A;  2AXV A;  1U3C A;  2PQN A;  4B8C B;  3MKR A;  4CT0 A;  2DCP A;  2HO1 A;  4FHJ A;  3U66 A;  2DIW A;  3L08 A;  2LSU A;  4GZ6 A;  4WWO A;  3MZL B;  4GA0 A;  2MRI A;  2X6H A;  5E76 A;  3JYS A;  2FEZ A;  2AXZ A;  4RG9 A;  2CG2 A;  4EPZ A;  3P1U A;  2WXH A;  1QNF A;  3PRZ A;  1JPL A;  1ZBP A;  2X6J A;  4O6F A;  3Q4A B;  2XGS A;  1WM5 A;  5HI7 A;  3FUM A;  3GW4 A;  3P2B A;  4EQF A;  2J49 A;  4XZ4 A;  4CRW A;  4FJZ A;  1N54 A;  2KC7 A;  3EDT B;  4RVB A;  2V4L A;  5FJY A;  2VTB B;  4BY6 A;  5C2Y A;  4WND A;  3RK6 A;  1E8X A;  1ZU2 A;  3ZXS A;  4ACK A;  2R5S A;  5G05 J;  4XE0 A;  3RRN B;  3FUL A;  4AXH A;  2HYZ A;  2Y4U A;  3R9A B;  3SFZ A;  3ZHE A;  1HH8 A;  4JEU A;  3TAX A;  1PAQ A;  2YHC A;  3UMV A;  3BG1 B;  2WMN A;  4AEZ C;  4OYS A;  3PZD A;  4PDX A;  1Y8M A;  1EPU A;  3ONK A;  4HFG A;  3ZIM A;  4AY5 A;  1OWO A;  2L9B A;  3WXX A;  5BPP A;  4CGW A;  1UN8 A;  3EJN A;  3FUD A;  2XHE A;  4F3V A;  5DIZ A;  1OWL A;  4PH4 B;  1B89 A;  4TUU A;  4ANX A;  2V0P A;  2J4D A;  4RG6 A;  2YNQ A;  5JHB A;  4I6E A;  1KT1 A;  5CMY A;  5KCM A;  1ELK A;  3PEU B;  4JA9 A;  5G05 C;  5BT1 A;  2WXM A;  2KZT A;  1HO8 A;  4CT4 A;  4J6I A;  4N39 A;  2LAH A;  3FH7 A;  4D10 C;  3PH0 C;  4DJA A;  2V5F A;  3FUN A;  4GYW A;  3S7D A;  5A23 A;  3LY7 A;  2IOS A;  2LAI A;  2NSZ A;  4WUY A;  4Q69 A;  4ABN A;  4XX5 A;  2QY7 A;  3D9M A;  4I9C A;  4EBA A;  2WM9 A;  4YND A;  1E7U A;  2C2L A;  3D9N A;  4U0Z A;  3UT4 A;  4ATG A;  5EX0 A;  4PS3 A;  4WWP A;  4M3O A;  3JQ0 A;  2GRL A;  4U0S A;  3ZYL A;  2I1K A;  3MEK A;  2A4Z A;  3L54 A;  4OVV A;  3URZ A;  5D0O D;  4N3B A;  3BEE A;  2ION A;  4J8E A;  3UT8 A;  1TJC A;  4CDM A;  4FAD A;  3FU5 A;  4HLE A;  3FTY A;  4ANV A;  2XGO A;  4MRU A;  2WB2 A;  2BF0 X;  1FVH A;  4ILH B;  5FQ8 A;  4XI0 A;  1UN9 A;  3FU0 A;  2XCC A;  3FTZ A;  5M72 A;  5JJ6 A;  2OOE A;  4EBA G;  3VTX A;  2UY1 A;  3FTX A;  4J8D A;  5LFA A;  3PDN A;  3VLD A;  5CCM A;  4KMO A;  4HS2 A;  3HYM B;  4QFV A;  3L6A A;  5ARF A;  2NC9 A;  1WY6 A;  3FY4 A;  3HVE A;  3TJP A;  3NQP A;  4N3A A;  4WWN A;  2WXJ A;  4HOQ A;  4HVB A;  3CQG B;  1KLX A;  3JUI A;  4URK A;  1IQR A;  2FI7 A;  1H19 A;  1HXI A;  2AVP A;  3CK9 A;  3G2W A;  2X38 A;  3LVQ E;  1PC2 A;  3QJZ A;  2OND A;  2P58 C;  3RU0 A;  4GB9 A;  4UWF A;  4APO A;  2IQC A;  4I1O B;  3FDH A;  3NF1 A;  2LO6 A;  4FHK A;  4KBQ A;  4GZ3 A;  4H7X A;  3RO3 A;  4LCT A;  4ACL A;  3SGH A;  3FHE A;  4EZJ A;  5LOZ A;  1UW4 B;  5G2N A;  2KCK A;  2LSV A;  2MHK A;  3ENE A;  1H2T C;  4HOS A;  4JC8 A;  3PE4 A;  2R59 A;  4B8A A;  2FO7 A;  2J9Q A;  4GZC A;  4NQ0 A;  1TJF A;  4Y6W A;  3PNL B;  4L2L A;  4JZY A;  2QFC A;  3LDZ A;  3TG5 A;  1H2V C;  4HOU A;  1E8Z A;  2WMO A;  2J4B A;  2E2E A;  3SI5 A;  4MLP A;  2IOL A;  3CKC A;  3KS2 A;  4BWR A;  4N2Q A;  4IRU A;  3ZPJ A;  3Q47 B;  4UWG A;  4FJY A;  2VSO E;  3CKB A;  3KEZ A;  5FZR A;  5FZQ A;  1OWN A;  2AW6 A;  3MV3 B;  1Z3Y A;  3ASG A;  3NZS A;  4BT8 A;  3FP3 A;  3L22 A;  4JHK A;  4JHR A;  4B89 A;  1VDY A;  4EZL A;  3OAW A;  5FTP A;  4V3I A;  3FUI A;  2OV8 A;  1E8W A;  3FEY A;  3PEV B;  3MV2 B;  4ILI A;  2IJG X;  4JA7 A;  1E96 B;  4KXK B;  5AJL A;  3MKQ A;  3LVR E;  5DBK A;  3UX4 A;  4N5C A;  3LCA A;  4Y6C A;  2XPY A;  3RIB A;  4G2V A;  1HX8 A;  3D9P A;  4I1M A;  4MKT A;  2KZT B;  3SBT B;  3C98 A;  3DPD A;  3S2A A;  3T8M A;  4A3V A;  3ZRH A;  3OXL A;  4CCA A;  4GYO A;  2X3M A;  2FUL A;  5EX3 A;  1KT0 A;  2JEK A;  3ZYK A;  3CVP A;  2Y3A A;  3LKU A;  1X5B A;  2VQ2 A;  4GYY A;  4LRZ A;  3S7J A;  2VSN A;  3FUJ A;  4N2S A;  4FU3 A;  4U07 A;  2XEV A;  3CST A;  5FT9 A;  4JXT A;  1NA3 A;  4KVO A;  4A55 A;  1Z3X A;  4J0U A;  4B0Z A;  4G25 A;  4Q96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...