2PL2A

Crystal structure of ttc0263: a thermophilic tpr protein in thermus thermophilus hb27
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
194
structure length
194
Chain Sequence
AEQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALYRQAEDRERGKGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQALALEDTPEIRSALAELYLSMGRLDEALAQYAKALEQAPKDLDLRVRYASALLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Hypothetical conserved protein TTC0263
publication title Crystal structure of TTC0263, a thermophilic TPR protein from Thermus thermophilus HB27.
pubmed rcsb
source organism Thermus thermophilus
total genus 76
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13176 TPR_7 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pl2A00
5CCLA 2LSUA 3RO3A 3CK7A 2FI7A 4HOSA 4Y6WA 1ZBPA 1ELWA 4GZ3A 4AY6A 4I2ZA 3BEEA 2PQRA 4I17A 3PE4A 4I2WA 2WPVA 3LY7A 5FJYA 3EDTB 4UI9J 3QWWA 5G04J 3GZ1A 4UQZA 2LNIA 4BT9A 2VGXA 3O48A 4HOTA 2Y4UA 4NQ0A 4CGWA 4UI9C 3ZHEB 1OUVA 2JLBA 5G04C 2FEZA 2C2LA 5KJMA 4J8EA 4N3BA 3SZ7A 1KLXA 4H7XA 3ASHA 2PL2A 3ESKA 4WNEA 3LY8A 2GW1A 3QOUA 2XCCA 3CKBA 4RG9A 1ZU2A 2AVPA 4BTBA 4B94A 5M72A 3Q15A 2FF4A 4BT8A 2XGMA 1KT1A 1P5QA 5CHEE 3MV3B 3KAEA 3PE3A 1TJCA 3FWVA 5FTPA 3FP3A 4XIFA 4XI0A 5ARGA 4EQFA 1ELRA 3CVNA 3TGOA 3GYZA 3RJVA 4UQYA 3U4TA 3MEKA 3ZPJA 4JHRA 3UUXA 4G26A 4GZ5A 1QZ2A 3ZHEA 3KS2A 2R5SA 4GYWA 5KJKA 3OXFA 4AM9A 3CK8A 4ME2A 4CDRA 4GPKA 5FZSA 2IF4A 4WNGA 2KCVA 5ARFA 2Y4TA 1IHGA 4W9RA 4U04A 3RKVA 2QFCA 4I9EA 3RO2A 2YQ8A 4U0ZA 2PZIA 3LCAA 1KT0A 5G05J 4IN3B 4GYYA 4GCNA 3S7FA 4APOA 3TAXA 4GCOA 4G24A 3JYSA 2VSNA 4BWRA 4GA1A 3S7JA 3CEQA 3FFLA 1XNFA 3LKUA 3R9AB 5DIZA 4WNDA 5BNWA 4YVOA 5G05C 3RIBA 5JJ6A 5FZQA 2XEVA 3MKRA 2KATA 4U0UA 5FT9A 2PQNA 4KBQA 4G2VA 3VTXA 4U0SA 1PC2A 3N71A 4NRHB 4YNDA 4GA2A 4GYOA 2VSYA 2XCBA 3SF4A 4BTAA 1WAO1 5BW8C 3UQ3A 4G23A 2I6HA 2WQHA 5A6CA 5JJTA 2BUGA 1WM5A 4WNFA 5D0OD 2KCKA 4A1SA 1W3BA 3RU0A 5EKQD 5BT1A 3CK9A 4HORA 3LPZA 4J8DA 2FO7A 3MV2B 4G25A 2DBAA 4N3AA 4JA7A 1A17A 2J9QA 2OOEA 2UY1B 3MA5A 4F3VA 4JL0A 4CGVA 5HQ8A 3QWVA 2VYIA 3URZA 4N2QA 3S7DA 2VGYA 4H7YA 4J8FA 5AYWD 1FCHA 1HZ4A 5C1DA 3QDNA 2HR2A 4N5CA 2KCLA 4KYOB 3TG5A 3ZN3A 4HOUA 3ZGQA 4I1AA 2HYZA 4YVQC 2C0MA 3LY9A 2V5FA 1NZNA 3CVPA 4XI9A 1NA3A 3AS8A 4UQXA 3LYAA 5DBKA 4G1TA 4N39A 2XGSA 2HO1A 3ASDA 1HXIA 3AS5A 3PDNA 3ZFWA 3Q4AB 4JA9A 2UY1A 1QQEA 3IEGA 5EX0A 4N3CA 2XPIA 4HOQA 1B89A 5JJ7A 4AIFA 2L6JA 4LEUA 3K9IA 3WXXA 3ULQA 3QKYA 3E4BA 4AY5A 2MHKA 3CVLA 3OXGA 5EX3A 2LSVA 3NF1A 4O6FA 2ONDA 3HYMB 3VTYA 2YHCA 1E96B 1YA0A 5LCWJ 2KC7A 4Y6CA 4RG6A 5FZRA 3GZ2A 4ABNA 2XGOA 4U07A 1IYGA 2Q7FA 3Q49B 4UI9K 5HI7A 4J0UA 4WUYA 4GZ6A 3TG4A 5KJLA 5LCWC 5D0QD 3CKCA 5KJNA 1NA0A 3AS4A 2FBNA 3KD7A 2C0LA 3UPVA 3U3WA 4I9CA 2IFUA 4N2SA 5CCMA 2VQ2A 4KXKB 5A7DB 2E2EA 2P58C 3OXLA 3CV0A 2UWJG 2VGXB 2NC9A 1Y8MA 3CVQA 3S7BA 3GW4A 3ASFA 3Q47B 1HH8A 3QWPA 3Q5MA 3ASGA 4GA0A
chains in the Genus database with same CATH superfamily
4CCAA 3KSQA 2OVFA 3CK7A 5ENTD 2FI7A 3FTXA 5H7PA 4NIKA 1ZBPA 1ELWA 4X8QA 4FJYA 2WXRA 2ZXWE 3FUHA 1QYMA 4IRUA 4JVSA 3QC1A 5EYPF 3GZ1A 3PZ2A 4UQZA 3AU5A 4L1BA 2IY0C 4BT9A 3CVYA 2CHXA 4ILIA 1MX6A 2DYRE 4TUMA 4XE0A 1UW4B 2M63A 3TWXA 3O48A 1IXVA 2Y4UA 4B89A 3B7RL 3FUNA 5B1BE 3BU8A 4XEIG 1MX4A 4DLOA 2QZAA 2WMNA 4UI9C 3ZHEB 3EHNA 5G04C 4HI8A 1HG5A 4BEPA 3PZ4A 1N0QA 3FUIA 4M7CA 5KJMA 4N3BA 1KPSB 3UXGA 2PL2A 3ESKA 3LY8A 4Q96A 3ISMC 3KEZA 3G2UA 4GU5A 3MKQA 2RG8A 2X6IA 4N5QA 3Q15A 2FF4A 4BT8A 3NZUA 3D9IA 2VSOE 2CG3A 4JZYA 1FVHA 1P5QA 3MV3B 1V55E 5CMYA 1TJCA 3J5QB 5FTPA 1JPLA 1SZAA 5ENSD 4DUIA 1DNPA 4XI0A 1ELRA 3CVNA 4KMOA 2Y1LE 3FEYA 3MEKA 4GTOA 3W9GA 3UUXA 3QAQA 2F8YA 1QZ2A 3PUKA 3KS2A 5AQAA 2WXOA 3IHYA 2R05A 3ZIMA 5KJKA 3Q78A 2BEDA 1TNUA 4ME2A 3ONLA 3CHSA 3ZNGA 3SD5A 2LXMA 3UT4A 3C5RA 4AJWA 4U8YD 1H6OA 2YNQA 1IHGA 3ZXPA 3SBSA 4W9RA 1KZOA 3RKVA 3C3RA 4JEUA 3AU4A 4I9EA 3RRMB 1E8WA 3RO2A 4OAUC 2JABA 3UX4A 2PZIA 1KT0A 3OTNA 3CQCB 4DX2A 2XQ0A 2LAIA 5G05J 1LF8A 3ABME 3DSXA 4IN3B 4GCNA 3TAXA 3JYSA 2VSNA 1UG3A 3UTMA 3V79K 3LKUA 2WQ6A 1E8ZA 1N0RA 2B0OE 1ELKA 4A3TA 3MKRA 3EHRA 5FIOA 4KBQA 4BERA 1N52A 4CYMD 3EU5A 4TXQA 4IULA 1JCRA 1NFIE 3D9LA 3SF4A 4YDOA 4HVBA 4GTVA 4GTMA 4I43A 2WQHA 5A6CA 3ZEFA 2EIKE 4BX8A 2EIJE 4I1MA 3NOGD 3Q7AA 3I4RB 3DXMG 2BUGA 4WNFA 3DSTA 2VTBA 3CHOA 5D0OD 4A1SA 1JCSA 3C3QA 1Z6TA 5JA4D 2ZGDA 5AIJA 3ZXSA 1A5EA 1BI7B 3JUIA 1TJFA 2XRYA 1OWPA 3QB2A 1LTXA 1FVFA 1TYQG 1A17A 3MA5A 3E32A 4CGVA 3AG2E 3ULYA 3EU9A 3SNXA 4EBAA 4JPSA 4HFGA 3FUEA 3DBSA 1FCHA 3HXBA 1HZ4A 3FDHA 1EF1C 1QBQA 5C1DA 3ZKJA 4O1PA 1TEZA 4GPMA 5ENQD 1HU3A 1IHBA 1OCZE 2P2CP 2H6GA 4B0ZA 3JQ1A 4LG6A 3ZN3A 3FUFA 3RRUA 2HYZA 4YVQC 2KZTB 1OY3D 4YDYA 2H6IA 2V5FA 3QNKA 3CVPA 5T4YA 4UQXA 4G1TA 4N39A 3L17A 4JHJA 4JA9A 1BD8A 2UY1A 1QQEA 5AN8A 2QYUA 3DSWA 2J09A 3V31A 3T9KA 5C2YA 1ZB1A 1DCEA 4EZKA 1S63A 4TRQA 1UOHA 2X38A 1HS6A 2NYJA 5B3SE 3L82A 3WXXA 1TR4A 3E4BA 3Q7FA 3CSTA 3G2TA 3UKUG 2OCCE 3PZ3A 3VTYA 3NBNB 4DI4A 1Z5SC 1X5BA 1NP7A 3P2BA 1E96B 1E90A 3FU3A 4RG6A 3EJNA 4G11A 3R7QA 1IYGA 2XS8A 4I6JA 3LXUX 4FHJA 3Q49B 3ZW3A 4J0UA 3T8MA 1VDYA 4NACA 3IV0A 5CERB 2HE0A 4MBGA 4GMJA 3TG4A 5KJLA 3AS4A 2CHZA 2WXQA 3KD7A 3U3WA 4KVMA 1D8EA 5CCMA 1TN8A 3PVLA 3PNLB 4KXKB 3ENEA 4KT6B 3UINC 3IHVA 4JXTA 3L9TA 2VGXB 2P9NG 5CRVA 1QNFA 2CFUA 2Y69E 4HLLA 4OVVA 1S64A 4AVXA 4ANXA 1V54E 3Q5MA 1N54A 3ASGA 1BPOA 4GA0A 4MS6A 4WWNA 2LSUA 3RO3A 4OAVB 3MCXA 1JWFA 4HOSA 4GZ3A 4XX5A 2AXUA 4RQIA 4I2ZA 4LNUD 3BEEA 4ANWA 5CEDB 2PQRA 4CEMA 3OAWA 3QWWA 1OCOE 1H0AA 2LNIA 3D9OA 3F6QA 1OWOA 3ZUVB 4E6HA 4FLBA 4CGWA 5CEAA 1OUVA 3BQOA 3UM1A 4BX9A 3PH0C 1N11A 3C3OA 2LUHA 3BG1B 2GW1A 4BESA 4HRMB 3QOUA 3CGHA 3EHMA 3D9NA 2XCCA 1N4RA 3UM3A 2WXMA 4Q69A 4EPZA 1AP7A 2XEHA 3KEAA 3MGBA 1TN6A 5CHEE 3FP3A 4XKCA 2H6FA 1FT1A 3DEPA 5CECB 1Z3XA 4F1SA 4JHRA 5AJLA 4G26A 4GZ5A 4FULA 3ZHEA 4FA6A 2R5SA 3IXEA 4LSZE 5KCMA 4A63B 4HRLA 4JEHA 3CVXA 5EILA 4CDNA 3JQ0A 2DYSE 2F0YA 4L7TA 3ASNE 5EIDA 2KCVA 5ARFA 4BFRA 2Y4TA 4I6EA 4U04A 2YHEA 1O1SA 1G3NB 2B6CA 4DK5A 4U0ZA 3Q9UC 4L2YA 4URKA 3CQGB 2DZNA 5JHBA 2L6BA 3B95A 4GYYA 4EHMA 3S7FA 5KNGA 4GCOA 4GA1A 2AXZA 2XHEA 3B13A 2LXLA 3FFLA 4I1OB 5DIZA 2X6HA 1BLXB 3UKRG 1EPUA 1OWMA 5BNWA 4YVOA 5G05C 4K5BA 2ETBA 3QARA 5FT9A 3I5PA 4UWKA 4LERA 3B7SA 3VTXA 2CHWA 2LO6A 4GAAA 3N71A 4FJZA 4QQIA 3L54A 4P29A 1H6KA 2XCBA 5ANRA 3SFZA 2WB2A 4BTAA 4GZDA 4A1GA 3CVWA 1TNOA 3UQ3A 3O4ZA 3DXKG 4U7EB 3MYVA 4GMLA 3FH7A 1WM5A 2XEEA 1MZCA 3UT8A 4HORA 3LPZA 3D9MA 4G8LA 3TXNA 3PEUB 2FO7A 4XKBA 4ILHB 4F3VA 4JL0A 3DPYA 4J7WA 4ILGA 2L9BA 4BETA 2ILRA 3URZA 2PM6A 4MKTA 4H7YA 4J8FA 2IOSA 4TUUA 2GROB 3FEXA 2EIME 3CHMA 5AAOA 5G2NA 2OVBA 4ATGA 3QDNA 2HR2A 5AENA 2WXFA 4ACKA 2P9UG 1SA4A 3G2VA 1SVXA 4C0MA 3KSLA 3CVUA 2DVWA 4F1PA 2QY7A 4A55A 3LY9A 4GTQA 1HX8A 3NZSA 2V8SE 1U3DA 1MHQA 3AS8A 4XI9A 1L5JA 3QK0A 3MKQB 2H6HA 3ZFWA 3TL5A 3IEGA 1HG2A 1OT8A 4Z68A 4JHKA 2VJ8A 3MJWA 4QFVA 2OEWA 4LEUA 3T8KA 3B7BA 3ULQA 1BU9A 4L2LA 3HDXA 4AY5A 2MHKA 3CVLA 3OXGA 4PH4B 5EX3A 2LSVA 3NF1A 4ANUA 2ONDA 2DZOA 5CRUA 4GTTA 1AWCB 3CHQA 5EN5D 2WQ7A 4KZCA 3B7UX 2WXLA 1YA0A 2WXKA 4Y6CA 1N94A 2KZTA 1NL4A 5HRYA 4C0EA 2I1JA 1H2TC 4U07A 3VLFA 5FQ4A 3HVEA 4UI9K 3TWQA 4WUYA 5HKPA 1OCCE 2V0PA 4GZ6A 2KBXA 1K3ZD 1NA0A 4DX6D 2FBNA 4FLHA 4I9CA 4G8KA 2IFUA 2F8XK 4N2SA 5T8IA 5A7DB 4ZFHA 2E2EA 3BUAA 3MZLB 3D3MA 3LVQE 5AARA 1N9AA 3APFA 3FUDA 3AAAC 2UWJG 2NC9A 5BXUA 1Y8MA 3CVQA 3S7BA 5EDSA 2R2LA 3SO8A 3E37A 2MOWA 4PS7A 3PUJA 3LDZA 4AP2A 3FTSA 4FP7A 3L22A 3HG0D 4C9BB 4DJAA 1HH8A 3QWPA 3ZU7B 3RAUA 2RFAA 2WXJA 3SQVA 2FULA 4GB9A 1E7UA 2X3MA 4PUCA 3ONKA 1H2VC 4U63A 1N95A 5LFAA 2OEVA 2Y0BG 4HQDA 5IY5E 2RD0A 4I17A 4EZJA 2IU1A 5FJYA 3ZVVA 2GGFA 1U3CA 5LP0A 1HO8A 2MRIA 3X2QE 3U9WA 4WWOA 3Q73A 2X6FA 4L9PA 2VGXA 1TNZA 3UI2A 2ZU6B 4O1OA 4NQ0A 2BTDA 4UWGA 1INZA 4J6IA 4ZHBA 4DLQA 2L0IA 2FEZA 2C2LA 1IKND 4B93B 4WAFA 2IQCA 4H7XA 4WNEA 1Z3YA 1E8XA 2IO2C 3EIJA 5EYLA 1WG0A 1IQRA 4DX1A 2KXPC 3CKBA 4RG9A 2KM4A 4BTBA 5M72A 4K0RA 1OWNA 3PS6A 2A5UA 1KT1A 4U8VD 4CDMA 3KAEA 3PE3A 3FWVA 3CR3A 4XIFA 2GRRB 3TGOA 3RJVA 3FTYA 4UUCA 4F6RD 3ZYLA 3CVVA 4LCTA 3ZPJA 1UJKA 3T5VA 1DC2A 4BY6A 4GYWA 4PDXA 4I6GA 3OXFA 3ML8A 4AXHA 4AM9A 3LJNA 4UWLA 4J8SA 4CDRA 2MYOA 2AJAA 4GPKA 2RKKA 1OCRE 5FZSA 2XZDG 4YDEA 3FTZA 2IF4A 1OWLA 4WNGA 2EILE 1PAQA 3HIZA 3EUVA 1UN9A 3QJZA 5ANLA 4HNAD 2QFCA 4RVBA 5CBOA 1Y6IA 2YQ8A 3IBEA 3FUKA 4MLPA 4FHKA 3LCAA 5T3RA 4GTRA 4HLEA 3WG7E 3HXEA 3E33A 2GRNB 2AWIA 4R7LA 1HF8A 4HI9A 4BWRA 3S7JA 5FINA 3CEQA 2I9CA 2I2OA 4DX7D 3R9AB 1LD7A 4WNDA 3PEVB 5HS0A 1EYHA 3DEOA 3RIBA 5JJ6A 2XEVA 3HHMA 2R03A 4U0UA 2KATA 2PQNA 5BUZA 4DPRA 1PC2A 3D9JA 2I1KA 2A5EA 3ULEG 3UM2A 1GW6A 3S2AA 3AJIA 4GYOA 3P1UA 3UT7A 1YYHA 2XPYA 1WAO1 5BW8C 1DCQA 4K5CA 3FHEA 2KCKA 5ENNA 1W3BA 3RU0A 5EKQD 3G2SA 3HXDA 5ENRD 1SW6A 4J8DA 5AJDA 3D9PA 3MV2B 3Q9NC 1O5MA 3UIOC 5D2MC 4JA7A 2OOEA 3LVRE 3APDA 1Q2ZA 5HQ8A 2P9KG 4RLYA 4V3IA 2GRMA 1O1RA 4N2QA 3S7DA 2J08A 3DSSA 2VGYA 4U96D 1N4PA 1OXJA 3UIPC 2P9LG 3L6AA 3FU6A 3HRAA 4N5CA 3JXIA 4AV7A 5JMND 4KYOB 2J07A 3LS8A 4LNGA 3ZGQA 4I1AA 3RK6A 3I3NA 1EDUA 2DIWA 2R59A 1N4QA 1NZNA 3PRZA 3LYAA 2XPZA 3AG4E 3ASDA 3W9FA 3PDNA 3D9KA 2NXPA 2JEKA 5EX0A 4N3CA 4HOQA 1B89A 4MRUA 2NSZA 2ETAA 4LUNU 3K9IA 2WVIA 2X6KA 1H19A 4AOFA 4DRXE 1H6PA 4BSXA 2YHCA 4APFA 1K1BA 4B8AA 3L08A 5LCWJ 1BI8B 3C72A 5A23A 3SHFA 4DI3A 3GZ2A 4KVOA 4ABNA 2X6JA 2R17C 3Q79A 2Q7FA 5HI7A 4L23A 3FTUA 1HE8A 2BF0X 5KNHD 1TNYA 4NURA 2J49A 1MJ0A 5E75A 3CKCA 1MQSA 3AG3E 3HXCA 3UPVA 2EQXA 4GZCA 5B1AE 5ITZF 3G2WA 2XS1A 3TXMA 3OXLA 3C98A 1D8DA 1UJJA 3LEWA 3R7RA 3ASOE 3GW4A 3SGHA 3T5XA 3D9HA 3FTWA 2F37A 3DPDA 2WXHA 3LJ3A 5BXOA 1UN8A 5CCLA 2WXGA 3CHRA 5BPPA 4JB8P 1JWGA 4Y6WA 3NB2A 3CLJA 4AY6A 1YMPA 2WMOA 2IO3C 3IKOB 3PE4A 2QC9A 5J08A 4I2WA 1WY6A 2WPVA 3LY7A 1O1TA 3EDTB 1S0PA 4UI9J 5G04J 3CHPA 4GTSA 4AEZC 3EIQC 1SQMA 3TWWA 4HOTA 5AQBA 3UM0A 5CMWA 2OV8A 3FULA 1E8YA 4JW1A 2JLBA 1KZPA 3U66A 4HB5A 3E34A 2ZGGA 4J8EA 4ATZD 5AQ9A 3SZ7A 3FUJA 4LNBA 1KLXA 2AW6A 3ASHA 2GRLA 3AG1E 2J8SD 2FO1E 1E7VA 4J8YA 3FU0A 5ENPD 1HFAA 2P9IG 3DWLG 1ZU2A 2AVPA 4DX5D 3SI5A 3SBTB 4B94A 2ZISA 4Q94A 5FWQA 1TNBA 3ZYKA 2XGMA 2RFMA 2QYJA 1N4SA 5E76A 3B7TA 5ARGA 4EQFA 2XRZA 3GYZA 2J4BA 4UQYA 3U4TA 2LAHA 2V4LA 2A4ZA 3U64A 3CIAA 3FY4A 3CK8A 3APCA 4LRZA 4FU3A 3EHQA 1DVPA 2PM7A 3TWTA 4BSZB 5CBNA 4E85A 2IJGX 1RZ4A 4HRNA 4TXRA 2IONA 2J4DA 3V2OA 1YCSB 3PREA 5LOZA 2R02A 1JUQA 3NQPA 2WXPA 2GRQB 3FUMA 2VTBB 4B8CB 2VSXE 3TWUA 4APOA 4U95D 4G24A 3HVEB 4UWHA 5G55A 3R9MA 1U2VG 1TN7A 4OYSA 4JD2G 3UMVA 1XNFA 3FTVA 2P9PG 4UWFA 2VGEA 3NAWA 5FZQA 2BKKB 3Q75A 3E30A 4G2VA 4U0SA 5FQ6A 5FQ8A 4NRHB 2V5QC 4YNDA 4GA2A 3ZYMA 2VSYA 3PNTB 3FH8A 2DCPA 3DSUA 2XENA 2L0TB 4G23A 2I6HA 1X81A 4YDWA 1D9SA 4CT4A 5JJTA 3RRNB 2P9SG 3SY2A 1XGWA 3DSVA 3VLDA 3BG0B 3TJPA 5BT1A 3CK9A 1K1AA 4K03A 4WWPA 4G25A 1RW2A 1FPPA 2DBAA 5FQ7A 4N3AA 3PZ1A 2J9QA 2UY1B 4C48B 3SFXA 3QWVA 4HS2A 1FT2A 2VYIA 4XZ4A 3SFYA 5JHAA 3FU5A 3ABKE 3DRAA 2CFZA 4F53A 4ACLA 5KBAA 3PZDA 4TXPA 3TWVA 5AYWD 4TV3A 3ML9A 4ANVA 3ESLA 4EECA 4K5AB 3JUEA 1NI1A 5D66A 2AXVA 3ZRHA 2KCLA 1SA5A 1WDYA 4PS3A 3TG5A 4KZ0A 4FC8A 1LD8A 2E0IA 2V4HC 1IQUA 4HOUA 2IOLA 2C0MA 4U8HA 4OVUA 3HXFA 1NA3A 5DBKA 2XGSA 2HO1A 4IYPA 1HXIA 3AS5A 1PY1A 3Q4AB 5J90A 2CG2A 4EZLA 3MX3A 3I4GA 2HM8A 2GRPB 4JC8A 4HXIA 2XPIA 2ZIRA 3V30A 4A3VA 5JJ7A 2WXIA 4AIFA 3V2XA 4PS8A 4EBAG 2L6JA 3QKYA 3TWRA 2WM9A 4O6FA 3HYMB 3FH5A 3L16A 4RSYA 4GTPA 4D10C 3J5PA 1H2UA 2PNNA 3RSEG 2WXNA 2KC7A 2EINE 5EIBE 5FZRA 2DWZA 3GZSA 2XGOA 2ETCA 5BV1A 1SZ9A 4M3OA 3VLEA 2YINA 4CRWA 4O60A 5BV0A 4F7AA 5LCWC 5D0QD 5KJNA 2Y3AA 3CSFA 5KWDA 2C0LA 4GMRA 2VQ2A 4CZ2D 5ENOD 4HBDA 3JXJA 1JCQA 2P58C 3ABLE 3CV0A 2BKGA 4CT0A 5AQ7A 1MX2A 3TWSA 3JCKC 5LX8A 3L13A 3ASFA 3ZYQA 1K8KG 3Q47B 4FADA 3NOCD 1MYOA 1S70B 2XZTG 2IEJA
chains in the Genus database with same CATH topology
4CCAA 1UN8A 4MS6A 2OVFA 4WWNA 5CCLA 2FULA 2LSUA 2WXGA 3CHRA 3RO3A 5BPPA 3MCXA 4GB9A 3CK7A 1JWFA 2FI7A 1JWGA 3FTXA 4HOSA 1E7UA 2X3MA 4Y6WA 1ZBPA 3CLJA 1ELWA 4PUCA 3ONKA 4FJYA 1H2VC 2WXRA 4GZ3A 4U63A 4XX5A 4AY6A 2AXUA 5LFAA 4I2ZA 3BEEA 3FUHA 4ANWA 2WMOA 2RD0A 2PQRA 4I17A 3IKOB 3PE4A 4IRUA 4JVSA 5J08A 4I2WA 4EZJA 2IU1A 1WY6A 3QC1A 4CEMA 3OAWA 2WPVA 3LY7A 5FJYA 3ZVVA 3EDTB 1S0PA 4UI9J 3QWWA 5G04J 2GGFA 3GZ1A 1H0AA 4UQZA 3AU5A 3CHPA 4L1BA 1U3CA 2LNIA 5LP0A 1HO8A 2MRIA 4BT9A 2CHXA 3D9OA 3CVYA 4ILIA 4XE0A 3U9WA 4AEZC 4WWOA 3EIQC 1SQMA 1UW4B 2M63A 1OWOA 2X6FA 2VGXA 3O48A 4HOTA 4E6HA 2ZU6B 5CMWA 2OV8A 2Y4UA 4FLBA 4NQ0A 3B7RL 2BTDA 3FUNA 4B89A 4UWGA 3FULA 4CGWA 1INZA 4J6IA 4DLOA 1E8YA 2WMNA 4JW1A 4UI9C 3ZHEB 1OUVA 2JLBA 4DLQA 3EHNA 2L0IA 2FEZA 5G04C 2C2LA 1HG5A 4BX9A 3U66A 3FUIA 4WAFA 3PH0C 5KJMA 4J8EA 4N3BA 3SZ7A 3FUJA 2IQCA 1KLXA 2AW6A 3ASHA 2PL2A 3ESKA 4H7XA 4WNEA 3LY8A 4Q96A 2GRLA 1Z3YA 3BG1B 1E8XA 2GW1A 3KEZA 3G2UA 1E7VA 3EIJA 3FU0A 4GU5A 3MKQA 3QOUA 1IQRA 3CGHA 2RG8A 3EHMA 1HFAA 2X6IA 3D9NA 2XCCA 3CKBA 4RG9A 1ZU2A 2KM4A 2AVPA 3SI5A 4BTBA 3SBTB 4B94A 5M72A 3Q15A 4Q94A 5FWQA 2WXMA 2FF4A 4K0RA 4BT8A 4EPZA 1OWNA 4Q69A 3NZUA 3D9IA 3MGBA 3PS6A 3ZYKA 2VSOE 2XGMA 2CG3A 4JZYA 1FVHA 2A5UA 1KT1A 1P5QA 5CHEE 4CDMA 3MV3B 3KAEA 5CMYA 3PE3A 1TJCA 3FWVA 5FTPA 1JPLA 3CR3A 1SZAA 3FP3A 4XIFA 3B7TA 1DNPA 4XI0A 5E76A 1ELRA 3CVNA 5ARGA 4EQFA 3TGOA 3GYZA 3RJVA 2XRZA 2J4BA 4UQYA 4XKCA 3FTYA 4KMOA 3U4TA 2LAHA 2V4LA 3FEYA 3MEKA 4LCTA 3ZYLA 3CVVA 1Z3XA 2A4ZA 3ZPJA 4F1SA 1UJKA 3U64A 4JHRA 5AJLA 3UUXA 3QAQA 4G26A 4GZ5A 3T5VA 1QZ2A 4FULA 3ZHEA 3PUKA 3KS2A 3CIAA 3FY4A 4FA6A 2R5SA 4BY6A 2WXOA 4GYWA 4PDXA 3IHYA 5KCMA 3ZIMA 5KJKA 4I6GA 3OXFA 3ML8A 4AXHA 4AM9A 4UWLA 3CK8A 4JEHA 3CVXA 4J8SA 4ME2A 3ONLA 4CDRA 3CHSA 3JQ0A 4CDNA 3SD5A 3APCA 4LRZA 4GPKA 5FZSA 4FU3A 4L7TA 3FTZA 2IF4A 1OWLA 4WNGA 3UT4A 2KCVA 5ARFA 4BFRA 2PM7A 1DVPA 4AJWA 1PAQA 2Y4TA 3HIZA 2YNQA 4I6EA 1IHGA 3SBSA 4W9RA 1UN9A 4U04A 2YHEA 3QJZA 5ANLA 3RKVA 2QFCA 4E85A 2IJGX 4RVBA 4JEUA 3AU4A 2IONA 2J4DA 4I9EA 3RRMB 4DK5A 1E8WA 1Y6IA 3RO2A 2YQ8A 3IBEA 3FUKA 3PREA 4U0ZA 5LOZA 1JUQA 3NQPA 4L2YA 3UX4A 2PZIA 4MLPA 4FHKA 3LCAA 2WXPA 4URKA 3CQGB 5T3RA 1KT0A 3OTNA 3CQCB 4HLEA 3FUMA 2XQ0A 2LAIA 5JHBA 5G05J 2VTBB 2AWIA 4R7LA 1LF8A 1HF8A 4IN3B 4GYYA 2VSXE 4GCNA 4B8CB 3S7FA 4APOA 3TAXA 4GCOA 4G24A 3HVEB 3JYSA 4UWHA 2VSNA 5G55A 1UG3A 4BWRA 4GA1A 2AXZA 2XHEA 3S7JA 3B13A 4OYSA 3CEQA 2I9CA 3FFLA 2I2OA 3UMVA 1XNFA 3FTVA 4I1OB 3LKUA 3R9AB 5DIZA 2WQ6A 2X6HA 4WNDA 1E8ZA 3PEVB 1EPUA 1OWMA 5LX8A 5BNWA 4UWFA 4YVOA 1EYHA 5G05C 1ELKA 3RIBA 5JJ6A 4A3TA 2XEVA 5FZQA 3QARA 3HHMA 3I5PA 2KATA 3MKRA 4U0UA 4UWKA 5FT9A 4LERA 2PQNA 4KBQA 5BUZA 3B7SA 4G2VA 4DPRA 3VTXA 2CHWA 1N52A 4U0SA 1PC2A 2LO6A 3D9JA 5FQ6A 5FQ8A 4GAAA 3N71A 4FJZA 4IULA 2I1KA 4NRHB 3L54A 4P29A 1GW6A 4YNDA 3S2AA 4GA2A 1H6KA 3ZYMA 4GYOA 2VSYA 2XCBA 5ANRA 3SFZA 2WB2A 3D9LA 3FH8A 3P1UA 3PNTB 3SF4A 4GZDA 4BTAA 4A1GA 2DCPA 3UT7A 2XPYA 3CVWA 1WAO1 4HVBA 5BW8C 3UQ3A 3O4ZA 2L0TB 4G23A 2I6HA 4I43A 2WQHA 5A6CA 3ZEFA 4BX8A 3MYVA 4I1MA 4CT4A 4GMLA 3I4RB 3FH7A 5JJTA 3RRNB 2BUGA 1WM5A 3FHEA 4WNFA 2VTBA 3CHOA 1XGWA 5D0OD 2KCKA 3VLDA 5ENNA 4A1SA 1Z6TA 3BG0B 5AIJA 1W3BA 3TJPA 3UT8A 3RU0A 3ZXSA 5EKQD 5BT1A 3CK9A 3G2SA 4HORA 3LPZA 4J8DA 3D9MA 3TXNA 3JUIA 5AJDA 4K03A 4WWPA 1TJFA 3PEUB 2FO7A 2XRYA 3D9PA 3MV2B 1OWPA 4G25A 3QB2A 2DBAA 5FQ7A 1FVFA 4N3AA 4JA7A 1A17A 2UY1B 2J9QA 2OOEA 3MA5A 4XKBA 3LVRE 4ILHB 3APDA 4F3VA 4JL0A 4CGVA 5HQ8A 3QWVA 4HS2A 2VYIA 4ILGA 4V3IA 4XZ4A 2L9BA 3SNXA 5JHAA 3FU5A 2GRMA 4JPSA 4EBAA 2ILRA 2CFZA 4HFGA 3URZA 4N2QA 4F53A 2PM6A 3FUEA 4MKTA 3S7DA 2J08A 3PZDA 2VGYA 4ACLA 4H7YA 4J8FA 2IOSA 3DBSA 5AYWD 1FCHA 4TUUA 1HZ4A 3FEXA 4TV3A 3L6AA 3FDHA 1EF1C 3ML9A 3CHMA 5C1DA 4ANVA 3ESLA 5G2NA 4EECA 2OVBA 4ATGA 3QDNA 3FU6A 2HR2A 2AXVA 5AENA 1TEZA 4N5CA 3ZRHA 2KCLA 2WXFA 4ACKA 1HU3A 4AV7A 4PS3A 3G2VA 4KYOB 3TG5A 4B0ZA 4KZ0A 4FC8A 4C0MA 3JQ1A 3CVUA 2J07A 3LS8A 2E0IA 1IQUA 3ZN3A 2QY7A 3FUFA 4HOUA 3ZGQA 3RRUA 4I1AA 4A55A 2IOLA 2HYZA 4YVQC 3RK6A 2C0MA 3LY9A 2KZTB 4U8HA 1HX8A 3NZSA 4OVUA 3I3NA 1EDUA 1U3DA 2V8SE 2DIWA 2V5FA 3LJ3A 3QNKA 2R59A 1NZNA 1MHQA 3CVPA 1NA3A 3AS8A 3PRZA 4UQXA 4XI9A 5T4YA 3LYAA 5DBKA 1L5JA 3QK0A 4G1TA 4N39A 2XGSA 3L17A 2HO1A 3MKQB 4IYPA 4JHJA 2XPZA 3ASDA 1HXIA 3AS5A 3PDNA 1PY1A 3ZFWA 3Q4AB 4JA9A 3D9KA 5J90A 2UY1A 2CG2A 2NXPA 4EZLA 2JEKA 1QQEA 3MX3A 3TL5A 3I4GA 3IEGA 2HM8A 1HG2A 4JC8A 4HXIA 5EX0A 2J09A 4N3CA 2XPIA 4HOQA 1B89A 5C2YA 4JHKA 4A3VA 5JJ7A 4EZKA 2WXIA 4MRUA 4AIFA 2NSZA 4TRQA 2VJ8A 2X38A 3MJWA 4PS8A 4EBAG 1HS6A 2L6JA 4QFVA 4LUNU 4LEUA 3K9IA 3WXXA 3ULQA 3QKYA 4L2LA 2WVIA 3E4BA 3HDXA 4AY5A 2MHKA 3CVLA 3OXGA 4PH4B 5EX3A 2LSVA 2WM9A 3NF1A 4ANUA 4O6FA 2ONDA 2X6KA 3CSTA 3G2TA 3HYMB 3FH5A 1H19A 4AOFA 3CHQA 2WQ7A 3L16A 3VTYA 4RSYA 4DI4A 4KZCA 2YHCA 4BSXA 3B7UX 4APFA 2WXLA 1X5BA 4B8AA 1NP7A 3P2BA 4D10C 1E96B 1YA0A 1H2UA 3L08A 5LCWJ 1E90A 2WXKA 2KC7A 2WXNA 3FU3A 4Y6CA 3SHFA 5A23A 4RG6A 3EJNA 5FZRA 4G11A 2KZTA 3R7QA 4DI3A 3GZ2A 3GZSA 4KVOA 4C0EA 4ABNA 2X6JA 2XGOA 2I1JA 1H2TC 4U07A 1IYGA 4I6JA 3VLFA 3LXUX 2R17C 4FHJA 5FQ4A 2Q7FA 3Q49B 3HVEA 4UI9K 5HI7A 4L23A 5BV1A 3ZW3A 1SZ9A 3FTUA 4J0UA 4WUYA 3T8MA 1HE8A 1VDYA 2BF0X 3IV0A 4M3OA 2V0PA 4NACA 3VLEA 4GZ6A 2YINA 4CRWA 4NURA 2J49A 5BV0A 4GMJA 3TG4A 4F7AA 5KJLA 5D0QD 3CKCA 5E75A 5KJNA 5LCWC 2Y3AA 1MQSA 1NA0A 2CHZA 3AS4A 2FBNA 3CSFA 2WXQA 3KD7A 2C0LA 3UPVA 4KVMA 3U3WA 4FLHA 4I9CA 2IFUA 2EQXA 4GZCA 4N2SA 5CCMA 2VQ2A 3PVLA 3PNLB 5T8IA 4KXKB 5A7DB 3ENEA 3G2WA 2E2EA 4KT6B 2P58C 3OXLA 3TXMA 3MZLB 3D3MA 3IHVA 3C98A 1UJJA 3LVQE 3LEWA 3R7RA 4JXTA 3CV0A 3APFA 3FUDA 2VGXB 2UWJG 4CT0A 2NC9A 1QNFA 1Y8MA 2CFUA 3CVQA 3S7BA 5EDSA 2MOWA 4PS7A 3JCKC 3PUJA 3GW4A 3LDZA 3L13A 3SGHA 4AP2A 3ASFA 3FTSA 3T5XA 3ZYQA 4FP7A 3L22A 3Q47B 4OVVA 4C9BB 4DJAA 1HH8A 3FTWA 3QWPA 4FADA 3DPDA 4AVXA 4ANXA 2WXHA 3Q5MA 1N54A 3ASGA 1BPOA 4GA0A 2WXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCL A;  2LSU A;  3RO3 A;  3CK7 A;  2FI7 A;  4HOS A;  4Y6W A;  1ZBP A;  1ELW A;  4GZ3 A;  4AY6 A;  4I2Z A;  3BEE A;  2PQR A;  4I17 A;  3PE4 A;  4I2W A;  2WPV A;  3LY7 A;  5FJY A;  3EDT B;  4UI9 J;  3QWW A;  5G04 J;  3GZ1 A;  4UQZ A;  2LNI A;  4BT9 A;  2VGX A;  3O48 A;  4HOT A;  2Y4U A;  4NQ0 A;  4CGW A;  4UI9 C;  3ZHE B;  1OUV A;  2JLB A;  5G04 C;  2FEZ A;  2C2L A;  5KJM A;  4J8E A;  4N3B A;  3SZ7 A;  1KLX A;  4H7X A;  3ASH A;  2PL2 A;  3ESK A;  4WNE A;  3LY8 A;  2GW1 A;  3QOU A;  2XCC A;  3CKB A;  4RG9 A;  1ZU2 A;  2AVP A;  4BTB A;  4B94 A;  5M72 A;  3Q15 A;  2FF4 A;  4BT8 A;  2XGM A;  1KT1 A;  1P5Q A;  5CHE E;  3MV3 B;  3KAE A;  3PE3 A;  1TJC A;  3FWV A;  5FTP A;  3FP3 A;  4XIF A;  4XI0 A;  5ARG A;  4EQF A;  1ELR A;  3CVN A;  3TGO A;  3GYZ A;  3RJV A;  4UQY A;  3U4T A;  3MEK A;  3ZPJ A;  4JHR A;  3UUX A;  4G26 A;  4GZ5 A;  1QZ2 A;  3ZHE A;  3KS2 A;  2R5S A;  4GYW A;  5KJK A;  3OXF A;  4AM9 A;  3CK8 A;  4ME2 A;  4CDR A;  4GPK A;  5FZS A;  2IF4 A;  4WNG A;  2KCV A;  5ARF A;  2Y4T A;  1IHG A;  4W9R A;  4U04 A;  3RKV A;  2QFC A;  4I9E A;  3RO2 A;  2YQ8 A;  4U0Z A;  2PZI A;  3LCA A;  1KT0 A;  5G05 J;  4IN3 B;  4GYY A;  4GCN A;  3S7F A;  4APO A;  3TAX A;  4GCO A;  4G24 A;  3JYS A;  2VSN A;  4BWR A;  4GA1 A;  3S7J A;  3CEQ A;  3FFL A;  1XNF A;  3LKU A;  3R9A B;  5DIZ A;  4WND A;  5BNW A;  4YVO A;  5G05 C;  3RIB A;  5JJ6 A;  5FZQ A;  2XEV A;  3MKR A;  2KAT A;  4U0U A;  5FT9 A;  2PQN A;  4KBQ A;  4G2V A;  3VTX A;  4U0S A;  1PC2 A;  3N71 A;  4NRH B;  4YND A;  4GA2 A;  4GYO A;  2VSY A;  2XCB A;  3SF4 A;  4BTA A;  1WAO 1;  5BW8 C;  3UQ3 A;  4G23 A;  2I6H A;  2WQH A;  5A6C A;  5JJT A;  2BUG A;  1WM5 A;  4WNF A;  5D0O D;  2KCK A;  4A1S A;  1W3B A;  3RU0 A;  5EKQ D;  5BT1 A;  3CK9 A;  4HOR A;  3LPZ A;  4J8D A;  2FO7 A;  3MV2 B;  4G25 A;  2DBA A;  4N3A A;  4JA7 A;  1A17 A;  2J9Q A;  2OOE A;  2UY1 B;  3MA5 A;  4F3V A;  4JL0 A;  4CGV A;  5HQ8 A;  3QWV A;  2VYI A;  3URZ A;  4N2Q A;  3S7D A;  2VGY A;  4H7Y A;  4J8F A;  5AYW D;  1FCH A;  1HZ4 A;  5C1D A;  3QDN A;  2HR2 A;  4N5C A;  2KCL A;  4KYO B;  3TG5 A;  3ZN3 A;  4HOU A;  3ZGQ A;  4I1A A;  2HYZ A;  4YVQ C;  2C0M A;  3LY9 A;  2V5F A;  1NZN A;  3CVP A;  4XI9 A;  1NA3 A;  3AS8 A;  4UQX A;  3LYA A;  5DBK A;  4G1T A;  4N39 A;  2XGS A;  2HO1 A;  3ASD A;  1HXI A;  3AS5 A;  3PDN A;  3ZFW A;  3Q4A B;  4JA9 A;  2UY1 A;  1QQE A;  3IEG A;  5EX0 A;  4N3C A;  2XPI A;  4HOQ A;  1B89 A;  5JJ7 A;  4AIF A;  2L6J A;  4LEU A;  3K9I A;  3WXX A;  3ULQ A;  3QKY A;  3E4B A;  4AY5 A;  2MHK A;  3CVL A;  3OXG A;  5EX3 A;  2LSV A;  3NF1 A;  4O6F A;  2OND A;  3HYM B;  3VTY A;  2YHC A;  1E96 B;  1YA0 A;  5LCW J;  2KC7 A;  4Y6C A;  4RG6 A;  5FZR A;  3GZ2 A;  4ABN A;  2XGO A;  4U07 A;  1IYG A;  2Q7F A;  3Q49 B;  4UI9 K;  5HI7 A;  4J0U A;  4WUY A;  4GZ6 A;  3TG4 A;  5KJL A;  5LCW C;  5D0Q D;  3CKC A;  5KJN A;  1NA0 A;  3AS4 A;  2FBN A;  3KD7 A;  2C0L A;  3UPV A;  3U3W A;  4I9C A;  2IFU A;  4N2S A;  5CCM A;  2VQ2 A;  4KXK B;  5A7D B;  2E2E A;  2P58 C;  3OXL A;  3CV0 A;  2UWJ G;  2VGX B;  2NC9 A;  1Y8M A;  3CVQ A;  3S7B A;  3GW4 A;  3ASF A;  3Q47 B;  1HH8 A;  3QWP A;  3Q5M A;  3ASG A;  4GA0 A; 
#chains in the Genus database with same CATH topology
 4CCA A;  3KSQ A;  2OVF A;  3CK7 A;  5ENT D;  2FI7 A;  3FTX A;  5H7P A;  4NIK A;  1ZBP A;  1ELW A;  4X8Q A;  4FJY A;  2WXR A;  2ZXW E;  3FUH A;  1QYM A;  4IRU A;  4JVS A;  3QC1 A;  5EYP F;  3GZ1 A;  3PZ2 A;  4UQZ A;  3AU5 A;  4L1B A;  2IY0 C;  4BT9 A;  3CVY A;  2CHX A;  4ILI A;  1MX6 A;  2DYR E;  4TUM A;  4XE0 A;  1UW4 B;  2M63 A;  3TWX A;  3O48 A;  1IXV A;  2Y4U A;  4B89 A;  3B7R L;  3FUN A;  5B1B E;  3BU8 A;  4XEI G;  1MX4 A;  4DLO A;  2QZA A;  2WMN A;  4UI9 C;  3ZHE B;  3EHN A;  5G04 C;  4HI8 A;  1HG5 A;  4BEP A;  3PZ4 A;  1N0Q A;  3FUI A;  4M7C A;  5KJM A;  4N3B A;  1KPS B;  3UXG A;  2PL2 A;  3ESK A;  3LY8 A;  4Q96 A;  3ISM C;  3KEZ A;  3G2U A;  4GU5 A;  3MKQ A;  2RG8 A;  2X6I A;  4N5Q A;  3Q15 A;  2FF4 A;  4BT8 A;  3NZU A;  3D9I A;  2VSO E;  2CG3 A;  4JZY A;  1FVH A;  1P5Q A;  3MV3 B;  1V55 E;  5CMY A;  1TJC A;  3J5Q B;  5FTP A;  1JPL A;  1SZA A;  5ENS D;  4DUI A;  1DNP A;  4XI0 A;  1ELR A;  3CVN A;  4KMO A;  2Y1L E;  3FEY A;  3MEK A;  4GTO A;  3W9G A;  3UUX A;  3QAQ A;  2F8Y A;  1QZ2 A;  3PUK A;  3KS2 A;  5AQA A;  2WXO A;  3IHY A;  2R05 A;  3ZIM A;  5KJK A;  3Q78 A;  2BED A;  1TNU A;  4ME2 A;  3ONL A;  3CHS A;  3ZNG A;  3SD5 A;  2LXM A;  3UT4 A;  3C5R A;  4AJW A;  4U8Y D;  1H6O A;  2YNQ A;  1IHG A;  3ZXP A;  3SBS A;  4W9R A;  1KZO A;  3RKV A;  3C3R A;  4JEU A;  3AU4 A;  4I9E A;  3RRM B;  1E8W A;  3RO2 A;  4OAU C;  2JAB A;  3UX4 A;  2PZI A;  1KT0 A;  3OTN A;  3CQC B;  4DX2 A;  2XQ0 A;  2LAI A;  5G05 J;  1LF8 A;  3ABM E;  3DSX A;  4IN3 B;  4GCN A;  3TAX A;  3JYS A;  2VSN A;  1UG3 A;  3UTM A;  3V79 K;  3LKU A;  2WQ6 A;  1E8Z A;  1N0R A;  2B0O E;  1ELK A;  4A3T A;  3MKR A;  3EHR A;  5FIO A;  4KBQ A;  4BER A;  1N52 A;  4CYM D;  3EU5 A;  4TXQ A;  4IUL A;  1JCR A;  1NFI E;  3D9L A;  3SF4 A;  4YDO A;  4HVB A;  4GTV A;  4GTM A;  4I43 A;  2WQH A;  5A6C A;  3ZEF A;  2EIK E;  4BX8 A;  2EIJ E;  4I1M A;  3NOG D;  3Q7A A;  3I4R B;  3DXM G;  2BUG A;  4WNF A;  3DST A;  2VTB A;  3CHO A;  5D0O D;  4A1S A;  1JCS A;  3C3Q A;  1Z6T A;  5JA4 D;  2ZGD A;  5AIJ A;  3ZXS A;  1A5E A;  1BI7 B;  3JUI A;  1TJF A;  2XRY A;  1OWP A;  3QB2 A;  1LTX A;  1FVF A;  1TYQ G;  1A17 A;  3MA5 A;  3E32 A;  4CGV A;  3AG2 E;  3ULY A;  3EU9 A;  3SNX A;  4EBA A;  4JPS A;  4HFG A;  3FUE A;  3DBS A;  1FCH A;  3HXB A;  1HZ4 A;  3FDH A;  1EF1 C;  1QBQ A;  5C1D A;  3ZKJ A;  4O1P A;  1TEZ A;  4GPM A;  5ENQ D;  1HU3 A;  1IHB A;  1OCZ E;  2P2C P;  2H6G A;  4B0Z A;  3JQ1 A;  4LG6 A;  3ZN3 A;  3FUF A;  3RRU A;  2HYZ A;  4YVQ C;  2KZT B;  1OY3 D;  4YDY A;  2H6I A;  2V5F A;  3QNK A;  3CVP A;  5T4Y A;  4UQX A;  4G1T A;  4N39 A;  3L17 A;  4JHJ A;  4JA9 A;  1BD8 A;  2UY1 A;  1QQE A;  5AN8 A;  2QYU A;  3DSW A;  2J09 A;  3V31 A;  3T9K A;  5C2Y A;  1ZB1 A;  1DCE A;  4EZK A;  1S63 A;  4TRQ A;  1UOH A;  2X38 A;  1HS6 A;  2NYJ A;  5B3S E;  3L82 A;  3WXX A;  1TR4 A;  3E4B A;  3Q7F A;  3CST A;  3G2T A;  3UKU G;  2OCC E;  3PZ3 A;  3VTY A;  3NBN B;  4DI4 A;  1Z5S C;  1X5B A;  1NP7 A;  3P2B A;  1E96 B;  1E90 A;  3FU3 A;  4RG6 A;  3EJN A;  4G11 A;  3R7Q A;  1IYG A;  2XS8 A;  4I6J A;  3LXU X;  4FHJ A;  3Q49 B;  3ZW3 A;  4J0U A;  3T8M A;  1VDY A;  4NAC A;  3IV0 A;  5CER B;  2HE0 A;  4MBG A;  4GMJ A;  3TG4 A;  5KJL A;  3AS4 A;  2CHZ A;  2WXQ A;  3KD7 A;  3U3W A;  4KVM A;  1D8E A;  5CCM A;  1TN8 A;  3PVL A;  3PNL B;  4KXK B;  3ENE A;  4KT6 B;  3UIN C;  3IHV A;  4JXT A;  3L9T A;  2VGX B;  2P9N G;  5CRV A;  1QNF A;  2CFU A;  2Y69 E;  4HLL A;  4OVV A;  1S64 A;  4AVX A;  4ANX A;  1V54 E;  3Q5M A;  1N54 A;  3ASG A;  1BPO A;  4GA0 A;  4MS6 A;  4WWN A;  2LSU A;  3RO3 A;  4OAV B;  3MCX A;  1JWF A;  4HOS A;  4GZ3 A;  4XX5 A;  2AXU A;  4RQI A;  4I2Z A;  4LNU D;  3BEE A;  4ANW A;  5CED B;  2PQR A;  4CEM A;  3OAW A;  3QWW A;  1OCO E;  1H0A A;  2LNI A;  3D9O A;  3F6Q A;  1OWO A;  3ZUV B;  4E6H A;  4FLB A;  4CGW A;  5CEA A;  1OUV A;  3BQO A;  3UM1 A;  4BX9 A;  3PH0 C;  1N11 A;  3C3O A;  2LUH A;  3BG1 B;  2GW1 A;  4BES A;  4HRM B;  3QOU A;  3CGH A;  3EHM A;  3D9N A;  2XCC A;  1N4R A;  3UM3 A;  2WXM A;  4Q69 A;  4EPZ A;  1AP7 A;  2XEH A;  3KEA A;  3MGB A;  1TN6 A;  5CHE E;  3FP3 A;  4XKC A;  2H6F A;  1FT1 A;  3DEP A;  5CEC B;  1Z3X A;  4F1S A;  4JHR A;  5AJL A;  4G26 A;  4GZ5 A;  4FUL A;  3ZHE A;  4FA6 A;  2R5S A;  3IXE A;  4LSZ E;  5KCM A;  4A63 B;  4HRL A;  4JEH A;  3CVX A;  5EIL A;  4CDN A;  3JQ0 A;  2DYS E;  2F0Y A;  4L7T A;  3ASN E;  5EID A;  2KCV A;  5ARF A;  4BFR A;  2Y4T A;  4I6E A;  4U04 A;  2YHE A;  1O1S A;  1G3N B;  2B6C A;  4DK5 A;  4U0Z A;  3Q9U C;  4L2Y A;  4URK A;  3CQG B;  2DZN A;  5JHB A;  2L6B A;  3B95 A;  4GYY A;  4EHM A;  3S7F A;  5KNG A;  4GCO A;  4GA1 A;  2AXZ A;  2XHE A;  3B13 A;  2LXL A;  3FFL A;  4I1O B;  5DIZ A;  2X6H A;  1BLX B;  3UKR G;  1EPU A;  1OWM A;  5BNW A;  4YVO A;  5G05 C;  4K5B A;  2ETB A;  3QAR A;  5FT9 A;  3I5P A;  4UWK A;  4LER A;  3B7S A;  3VTX A;  2CHW A;  2LO6 A;  4GAA A;  3N71 A;  4FJZ A;  4QQI A;  3L54 A;  4P29 A;  1H6K A;  2XCB A;  5ANR A;  3SFZ A;  2WB2 A;  4BTA A;  4GZD A;  4A1G A;  3CVW A;  1TNO A;  3UQ3 A;  3O4Z A;  3DXK G;  4U7E B;  3MYV A;  4GML A;  3FH7 A;  1WM5 A;  2XEE A;  1MZC A;  3UT8 A;  4HOR A;  3LPZ A;  3D9M A;  4G8L A;  3TXN A;  3PEU B;  2FO7 A;  4XKB A;  4ILH B;  4F3V A;  4JL0 A;  3DPY A;  4J7W A;  4ILG A;  2L9B A;  4BET A;  2ILR A;  3URZ A;  2PM6 A;  4MKT A;  4H7Y A;  4J8F A;  2IOS A;  4TUU A;  2GRO B;  3FEX A;  2EIM E;  3CHM A;  5AAO A;  5G2N A;  2OVB A;  4ATG A;  3QDN A;  2HR2 A;  5AEN A;  2WXF A;  4ACK A;  2P9U G;  1SA4 A;  3G2V A;  1SVX A;  4C0M A;  3KSL A;  3CVU A;  2DVW A;  4F1P A;  2QY7 A;  4A55 A;  3LY9 A;  4GTQ A;  1HX8 A;  3NZS A;  2V8S E;  1U3D A;  1MHQ A;  3AS8 A;  4XI9 A;  1L5J A;  3QK0 A;  3MKQ B;  2H6H A;  3ZFW A;  3TL5 A;  3IEG A;  1HG2 A;  1OT8 A;  4Z68 A;  4JHK A;  2VJ8 A;  3MJW A;  4QFV A;  2OEW A;  4LEU A;  3T8K A;  3B7B A;  3ULQ A;  1BU9 A;  4L2L A;  3HDX A;  4AY5 A;  2MHK A;  3CVL A;  3OXG A;  4PH4 B;  5EX3 A;  2LSV A;  3NF1 A;  4ANU A;  2OND A;  2DZO A;  5CRU A;  4GTT A;  1AWC B;  3CHQ A;  5EN5 D;  2WQ7 A;  4KZC A;  3B7U X;  2WXL A;  1YA0 A;  2WXK A;  4Y6C A;  1N94 A;  2KZT A;  1NL4 A;  5HRY A;  4C0E A;  2I1J A;  1H2T C;  4U07 A;  3VLF A;  5FQ4 A;  3HVE A;  4UI9 K;  3TWQ A;  4WUY A;  5HKP A;  1OCC E;  2V0P A;  4GZ6 A;  2KBX A;  1K3Z D;  1NA0 A;  4DX6 D;  2FBN A;  4FLH A;  4I9C A;  4G8K A;  2IFU A;  2F8X K;  4N2S A;  5T8I A;  5A7D B;  4ZFH A;  2E2E A;  3BUA A;  3MZL B;  3D3M A;  3LVQ E;  5AAR A;  1N9A A;  3APF A;  3FUD A;  3AAA C;  2UWJ G;  2NC9 A;  5BXU A;  1Y8M A;  3CVQ A;  3S7B A;  5EDS A;  2R2L A;  3SO8 A;  3E37 A;  2MOW A;  4PS7 A;  3PUJ A;  3LDZ A;  4AP2 A;  3FTS A;  4FP7 A;  3L22 A;  3HG0 D;  4C9B B;  4DJA A;  1HH8 A;  3QWP A;  3ZU7 B;  3RAU A;  2RFA A;  2WXJ A;  3SQV A;  2FUL A;  4GB9 A;  1E7U A;  2X3M A;  4PUC A;  3ONK A;  1H2V C;  4U63 A;  1N95 A;  5LFA A;  2OEV A;  2Y0B G;  4HQD A;  5IY5 E;  2RD0 A;  4I17 A;  4EZJ A;  2IU1 A;  5FJY A;  3ZVV A;  2GGF A;  1U3C A;  5LP0 A;  1HO8 A;  2MRI A;  3X2Q E;  3U9W A;  4WWO A;  3Q73 A;  2X6F A;  4L9P A;  2VGX A;  1TNZ A;  3UI2 A;  2ZU6 B;  4O1O A;  4NQ0 A;  2BTD A;  4UWG A;  1INZ A;  4J6I A;  4ZHB A;  4DLQ A;  2L0I A;  2FEZ A;  2C2L A;  1IKN D;  4B93 B;  4WAF A;  2IQC A;  4H7X A;  4WNE A;  1Z3Y A;  1E8X A;  2IO2 C;  3EIJ A;  5EYL A;  1WG0 A;  1IQR A;  4DX1 A;  2KXP C;  3CKB A;  4RG9 A;  2KM4 A;  4BTB A;  5M72 A;  4K0R A;  1OWN A;  3PS6 A;  2A5U A;  1KT1 A;  4U8V D;  4CDM A;  3KAE A;  3PE3 A;  3FWV A;  3CR3 A;  4XIF A;  2GRR B;  3TGO A;  3RJV A;  3FTY A;  4UUC A;  4F6R D;  3ZYL A;  3CVV A;  4LCT A;  3ZPJ A;  1UJK A;  3T5V A;  1DC2 A;  4BY6 A;  4GYW A;  4PDX A;  4I6G A;  3OXF A;  3ML8 A;  4AXH A;  4AM9 A;  3LJN A;  4UWL A;  4J8S A;  4CDR A;  2MYO A;  2AJA A;  4GPK A;  2RKK A;  1OCR E;  5FZS A;  2XZD G;  4YDE A;  3FTZ A;  2IF4 A;  1OWL A;  4WNG A;  2EIL E;  1PAQ A;  3HIZ A;  3EUV A;  1UN9 A;  3QJZ A;  5ANL A;  4HNA D;  2QFC A;  4RVB A;  5CBO A;  1Y6I A;  2YQ8 A;  3IBE A;  3FUK A;  4MLP A;  4FHK A;  3LCA A;  5T3R A;  4GTR A;  4HLE A;  3WG7 E;  3HXE A;  3E33 A;  2GRN B;  2AWI A;  4R7L A;  1HF8 A;  4HI9 A;  4BWR A;  3S7J A;  5FIN A;  3CEQ A;  2I9C A;  2I2O A;  4DX7 D;  3R9A B;  1LD7 A;  4WND A;  3PEV B;  5HS0 A;  1EYH A;  3DEO A;  3RIB A;  5JJ6 A;  2XEV A;  3HHM A;  2R03 A;  4U0U A;  2KAT A;  2PQN A;  5BUZ A;  4DPR A;  1PC2 A;  3D9J A;  2I1K A;  2A5E A;  3ULE G;  3UM2 A;  1GW6 A;  3S2A A;  3AJI A;  4GYO A;  3P1U A;  3UT7 A;  1YYH A;  2XPY A;  1WAO 1;  5BW8 C;  1DCQ A;  4K5C A;  3FHE A;  2KCK A;  5ENN A;  1W3B A;  3RU0 A;  5EKQ D;  3G2S A;  3HXD A;  5ENR D;  1SW6 A;  4J8D A;  5AJD A;  3D9P A;  3MV2 B;  3Q9N C;  1O5M A;  3UIO C;  5D2M C;  4JA7 A;  2OOE A;  3LVR E;  3APD A;  1Q2Z A;  5HQ8 A;  2P9K G;  4RLY A;  4V3I A;  2GRM A;  1O1R A;  4N2Q A;  3S7D A;  2J08 A;  3DSS A;  2VGY A;  4U96 D;  1N4P A;  1OXJ A;  3UIP C;  2P9L G;  3L6A A;  3FU6 A;  3HRA A;  4N5C A;  3JXI A;  4AV7 A;  5JMN D;  4KYO B;  2J07 A;  3LS8 A;  4LNG A;  3ZGQ A;  4I1A A;  3RK6 A;  3I3N A;  1EDU A;  2DIW A;  2R59 A;  1N4Q A;  1NZN A;  3PRZ A;  3LYA A;  2XPZ A;  3AG4 E;  3ASD A;  3W9F A;  3PDN A;  3D9K A;  2NXP A;  2JEK A;  5EX0 A;  4N3C A;  4HOQ A;  1B89 A;  4MRU A;  2NSZ A;  2ETA A;  4LUN U;  3K9I A;  2WVI A;  2X6K A;  1H19 A;  4AOF A;  4DRX E;  1H6P A;  4BSX A;  2YHC A;  4APF A;  1K1B A;  4B8A A;  3L08 A;  5LCW J;  1BI8 B;  3C72 A;  5A23 A;  3SHF A;  4DI3 A;  3GZ2 A;  4KVO A;  4ABN A;  2X6J A;  2R17 C;  3Q79 A;  2Q7F A;  5HI7 A;  4L23 A;  3FTU A;  1HE8 A;  2BF0 X;  5KNH D;  1TNY A;  4NUR A;  2J49 A;  1MJ0 A;  5E75 A;  3CKC A;  1MQS A;  3AG3 E;  3HXC A;  3UPV A;  2EQX A;  4GZC A;  5B1A E;  5ITZ F;  3G2W A;  2XS1 A;  3TXM A;  3OXL A;  3C98 A;  1D8D A;  1UJJ A;  3LEW A;  3R7R A;  3ASO E;  3GW4 A;  3SGH A;  3T5X A;  3D9H A;  3FTW A;  2F37 A;  3DPD A;  2WXH A;  3LJ3 A;  5BXO A;  1UN8 A;  5CCL A;  2WXG A;  3CHR A;  5BPP A;  4JB8 P;  1JWG A;  4Y6W A;  3NB2 A;  3CLJ A;  4AY6 A;  1YMP A;  2WMO A;  2IO3 C;  3IKO B;  3PE4 A;  2QC9 A;  5J08 A;  4I2W A;  1WY6 A;  2WPV A;  3LY7 A;  1O1T A;  3EDT B;  1S0P A;  4UI9 J;  5G04 J;  3CHP A;  4GTS A;  4AEZ C;  3EIQ C;  1SQM A;  3TWW A;  4HOT A;  5AQB A;  3UM0 A;  5CMW A;  2OV8 A;  3FUL A;  1E8Y A;  4JW1 A;  2JLB A;  1KZP A;  3U66 A;  4HB5 A;  3E34 A;  2ZGG A;  4J8E A;  4ATZ D;  5AQ9 A;  3SZ7 A;  3FUJ A;  4LNB A;  1KLX A;  2AW6 A;  3ASH A;  2GRL A;  3AG1 E;  2J8S D;  2FO1 E;  1E7V A;  4J8Y A;  3FU0 A;  5ENP D;  1HFA A;  2P9I G;  3DWL G;  1ZU2 A;  2AVP A;  4DX5 D;  3SI5 A;  3SBT B;  4B94 A;  2ZIS A;  4Q94 A;  5FWQ A;  1TNB A;  3ZYK A;  2XGM A;  2RFM A;  2QYJ A;  1N4S A;  5E76 A;  3B7T A;  5ARG A;  4EQF A;  2XRZ A;  3GYZ A;  2J4B A;  4UQY A;  3U4T A;  2LAH A;  2V4L A;  2A4Z A;  3U64 A;  3CIA A;  3FY4 A;  3CK8 A;  3APC A;  4LRZ A;  4FU3 A;  3EHQ A;  1DVP A;  2PM7 A;  3TWT A;  4BSZ B;  5CBN A;  4E85 A;  2IJG X;  1RZ4 A;  4HRN A;  4TXR A;  2ION A;  2J4D A;  3V2O A;  1YCS B;  3PRE A;  5LOZ A;  2R02 A;  1JUQ A;  3NQP A;  2WXP A;  2GRQ B;  3FUM A;  2VTB B;  4B8C B;  2VSX E;  3TWU A;  4APO A;  4U95 D;  4G24 A;  3HVE B;  4UWH A;  5G55 A;  3R9M A;  1U2V G;  1TN7 A;  4OYS A;  4JD2 G;  3UMV A;  1XNF A;  3FTV A;  2P9P G;  4UWF A;  2VGE A;  3NAW A;  5FZQ A;  2BKK B;  3Q75 A;  3E30 A;  4G2V A;  4U0S A;  5FQ6 A;  5FQ8 A;  4NRH B;  2V5Q C;  4YND A;  4GA2 A;  3ZYM A;  2VSY A;  3PNT B;  3FH8 A;  2DCP A;  3DSU A;  2XEN A;  2L0T B;  4G23 A;  2I6H A;  1X81 A;  4YDW A;  1D9S A;  4CT4 A;  5JJT A;  3RRN B;  2P9S G;  3SY2 A;  1XGW A;  3DSV A;  3VLD A;  3BG0 B;  3TJP A;  5BT1 A;  3CK9 A;  1K1A A;  4K03 A;  4WWP A;  4G25 A;  1RW2 A;  1FPP A;  2DBA A;  5FQ7 A;  4N3A A;  3PZ1 A;  2J9Q A;  2UY1 B;  4C48 B;  3SFX A;  3QWV A;  4HS2 A;  1FT2 A;  2VYI A;  4XZ4 A;  3SFY A;  5JHA A;  3FU5 A;  3ABK E;  3DRA A;  2CFZ A;  4F53 A;  4ACL A;  5KBA A;  3PZD A;  4TXP A;  3TWV A;  5AYW D;  4TV3 A;  3ML9 A;  4ANV A;  3ESL A;  4EEC A;  4K5A B;  3JUE A;  1NI1 A;  5D66 A;  2AXV A;  3ZRH A;  2KCL A;  1SA5 A;  1WDY A;  4PS3 A;  3TG5 A;  4KZ0 A;  4FC8 A;  1LD8 A;  2E0I A;  2V4H C;  1IQU A;  4HOU A;  2IOL A;  2C0M A;  4U8H A;  4OVU A;  3HXF A;  1NA3 A;  5DBK A;  2XGS A;  2HO1 A;  4IYP A;  1HXI A;  3AS5 A;  1PY1 A;  3Q4A B;  5J90 A;  2CG2 A;  4EZL A;  3MX3 A;  3I4G A;  2HM8 A;  2GRP B;  4JC8 A;  4HXI A;  2XPI A;  2ZIR A;  3V30 A;  4A3V A;  5JJ7 A;  2WXI A;  4AIF A;  3V2X A;  4PS8 A;  4EBA G;  2L6J A;  3QKY A;  3TWR A;  2WM9 A;  4O6F A;  3HYM B;  3FH5 A;  3L16 A;  4RSY A;  4GTP A;  4D10 C;  3J5P A;  1H2U A;  2PNN A;  3RSE G;  2WXN A;  2KC7 A;  2EIN E;  5EIB E;  5FZR A;  2DWZ A;  3GZS A;  2XGO A;  2ETC A;  5BV1 A;  1SZ9 A;  4M3O A;  3VLE A;  2YIN A;  4CRW A;  4O60 A;  5BV0 A;  4F7A A;  5LCW C;  5D0Q D;  5KJN A;  2Y3A A;  3CSF A;  5KWD A;  2C0L A;  4GMR A;  2VQ2 A;  4CZ2 D;  5ENO D;  4HBD A;  3JXJ A;  1JCQ A;  2P58 C;  3ABL E;  3CV0 A;  2BKG A;  4CT0 A;  5AQ7 A;  1MX2 A;  3TWS A;  3JCK C;  5LX8 A;  3L13 A;  3ASF A;  3ZYQ A;  1K8K G;  3Q47 B;  4FAD A;  3NOC D;  1MYO A;  1S70 B;  2XZT G;  2IEJ A; 
#chains in the Genus database with same CATH homology
 4CCA A;  1UN8 A;  4MS6 A;  2OVF A;  4WWN A;  5CCL A;  2FUL A;  2LSU A;  2WXG A;  3CHR A;  3RO3 A;  5BPP A;  3MCX A;  4GB9 A;  3CK7 A;  1JWF A;  2FI7 A;  1JWG A;  3FTX A;  4HOS A;  1E7U A;  2X3M A;  4Y6W A;  1ZBP A;  3CLJ A;  1ELW A;  4PUC A;  3ONK A;  4FJY A;  1H2V C;  2WXR A;  4GZ3 A;  4U63 A;  4XX5 A;  4AY6 A;  2AXU A;  5LFA A;  4I2Z A;  3BEE A;  3FUH A;  4ANW A;  2WMO A;  2RD0 A;  2PQR A;  4I17 A;  3IKO B;  3PE4 A;  4IRU A;  4JVS A;  5J08 A;  4I2W A;  4EZJ A;  2IU1 A;  1WY6 A;  3QC1 A;  4CEM A;  3OAW A;  2WPV A;  3LY7 A;  5FJY A;  3ZVV A;  3EDT B;  1S0P A;  4UI9 J;  3QWW A;  5G04 J;  2GGF A;  3GZ1 A;  1H0A A;  4UQZ A;  3AU5 A;  3CHP A;  4L1B A;  1U3C A;  2LNI A;  5LP0 A;  1HO8 A;  2MRI A;  4BT9 A;  2CHX A;  3D9O A;  3CVY A;  4ILI A;  4XE0 A;  3U9W A;  4AEZ C;  4WWO A;  3EIQ C;  1SQM A;  1UW4 B;  2M63 A;  1OWO A;  2X6F A;  2VGX A;  3O48 A;  4HOT A;  4E6H A;  2ZU6 B;  5CMW A;  2OV8 A;  2Y4U A;  4FLB A;  4NQ0 A;  3B7R L;  2BTD A;  3FUN A;  4B89 A;  4UWG A;  3FUL A;  4CGW A;  1INZ A;  4J6I A;  4DLO A;  1E8Y A;  2WMN A;  4JW1 A;  4UI9 C;  3ZHE B;  1OUV A;  2JLB A;  4DLQ A;  3EHN A;  2L0I A;  2FEZ A;  5G04 C;  2C2L A;  1HG5 A;  4BX9 A;  3U66 A;  3FUI A;  4WAF A;  3PH0 C;  5KJM A;  4J8E A;  4N3B A;  3SZ7 A;  3FUJ A;  2IQC A;  1KLX A;  2AW6 A;  3ASH A;  2PL2 A;  3ESK A;  4H7X A;  4WNE A;  3LY8 A;  4Q96 A;  2GRL A;  1Z3Y A;  3BG1 B;  1E8X A;  2GW1 A;  3KEZ A;  3G2U A;  1E7V A;  3EIJ A;  3FU0 A;  4GU5 A;  3MKQ A;  3QOU A;  1IQR A;  3CGH A;  2RG8 A;  3EHM A;  1HFA A;  2X6I A;  3D9N A;  2XCC A;  3CKB A;  4RG9 A;  1ZU2 A;  2KM4 A;  2AVP A;  3SI5 A;  4BTB A;  3SBT B;  4B94 A;  5M72 A;  3Q15 A;  4Q94 A;  5FWQ A;  2WXM A;  2FF4 A;  4K0R A;  4BT8 A;  4EPZ A;  1OWN A;  4Q69 A;  3NZU A;  3D9I A;  3MGB A;  3PS6 A;  3ZYK A;  2VSO E;  2XGM A;  2CG3 A;  4JZY A;  1FVH A;  2A5U A;  1KT1 A;  1P5Q A;  5CHE E;  4CDM A;  3MV3 B;  3KAE A;  5CMY A;  3PE3 A;  1TJC A;  3FWV A;  5FTP A;  1JPL A;  3CR3 A;  1SZA A;  3FP3 A;  4XIF A;  3B7T A;  1DNP A;  4XI0 A;  5E76 A;  1ELR A;  3CVN A;  5ARG A;  4EQF A;  3TGO A;  3GYZ A;  3RJV A;  2XRZ A;  2J4B A;  4UQY A;  4XKC A;  3FTY A;  4KMO A;  3U4T A;  2LAH A;  2V4L A;  3FEY A;  3MEK A;  4LCT A;  3ZYL A;  3CVV A;  1Z3X A;  2A4Z A;  3ZPJ A;  4F1S A;  1UJK A;  3U64 A;  4JHR A;  5AJL A;  3UUX A;  3QAQ A;  4G26 A;  4GZ5 A;  3T5V A;  1QZ2 A;  4FUL A;  3ZHE A;  3PUK A;  3KS2 A;  3CIA A;  3FY4 A;  4FA6 A;  2R5S A;  4BY6 A;  2WXO A;  4GYW A;  4PDX A;  3IHY A;  5KCM A;  3ZIM A;  5KJK A;  4I6G A;  3OXF A;  3ML8 A;  4AXH A;  4AM9 A;  4UWL A;  3CK8 A;  4JEH A;  3CVX A;  4J8S A;  4ME2 A;  3ONL A;  4CDR A;  3CHS A;  3JQ0 A;  4CDN A;  3SD5 A;  3APC A;  4LRZ A;  4GPK A;  5FZS A;  4FU3 A;  4L7T A;  3FTZ A;  2IF4 A;  1OWL A;  4WNG A;  3UT4 A;  2KCV A;  5ARF A;  4BFR A;  2PM7 A;  1DVP A;  4AJW A;  1PAQ A;  2Y4T A;  3HIZ A;  2YNQ A;  4I6E A;  1IHG A;  3SBS A;  4W9R A;  1UN9 A;  4U04 A;  2YHE A;  3QJZ A;  5ANL A;  3RKV A;  2QFC A;  4E85 A;  2IJG X;  4RVB A;  4JEU A;  3AU4 A;  2ION A;  2J4D A;  4I9E A;  3RRM B;  4DK5 A;  1E8W A;  1Y6I A;  3RO2 A;  2YQ8 A;  3IBE A;  3FUK A;  3PRE A;  4U0Z A;  5LOZ A;  1JUQ A;  3NQP A;  4L2Y A;  3UX4 A;  2PZI A;  4MLP A;  4FHK A;  3LCA A;  2WXP A;  4URK A;  3CQG B;  5T3R A;  1KT0 A;  3OTN A;  3CQC B;  4HLE A;  3FUM A;  2XQ0 A;  2LAI A;  5JHB A;  5G05 J;  2VTB B;  2AWI A;  4R7L A;  1LF8 A;  1HF8 A;  4IN3 B;  4GYY A;  2VSX E;  4GCN A;  4B8C B;  3S7F A;  4APO A;  3TAX A;  4GCO A;  4G24 A;  3HVE B;  3JYS A;  4UWH A;  2VSN A;  5G55 A;  1UG3 A;  4BWR A;  4GA1 A;  2AXZ A;  2XHE A;  3S7J A;  3B13 A;  4OYS A;  3CEQ A;  2I9C A;  3FFL A;  2I2O A;  3UMV A;  1XNF A;  3FTV A;  4I1O B;  3LKU A;  3R9A B;  5DIZ A;  2WQ6 A;  2X6H A;  4WND A;  1E8Z A;  3PEV B;  1EPU A;  1OWM A;  5LX8 A;  5BNW A;  4UWF A;  4YVO A;  1EYH A;  5G05 C;  1ELK A;  3RIB A;  5JJ6 A;  4A3T A;  2XEV A;  5FZQ A;  3QAR A;  3HHM A;  3I5P A;  2KAT A;  3MKR A;  4U0U A;  4UWK A;  5FT9 A;  4LER A;  2PQN A;  4KBQ A;  5BUZ A;  3B7S A;  4G2V A;  4DPR A;  3VTX A;  2CHW A;  1N52 A;  4U0S A;  1PC2 A;  2LO6 A;  3D9J A;  5FQ6 A;  5FQ8 A;  4GAA A;  3N71 A;  4FJZ A;  4IUL A;  2I1K A;  4NRH B;  3L54 A;  4P29 A;  1GW6 A;  4YND A;  3S2A A;  4GA2 A;  1H6K A;  3ZYM A;  4GYO A;  2VSY A;  2XCB A;  5ANR A;  3SFZ A;  2WB2 A;  3D9L A;  3FH8 A;  3P1U A;  3PNT B;  3SF4 A;  4GZD A;  4BTA A;  4A1G A;  2DCP A;  3UT7 A;  2XPY A;  3CVW A;  1WAO 1;  4HVB A;  5BW8 C;  3UQ3 A;  3O4Z A;  2L0T B;  4G23 A;  2I6H A;  4I43 A;  2WQH A;  5A6C A;  3ZEF A;  4BX8 A;  3MYV A;  4I1M A;  4CT4 A;  4GML A;  3I4R B;  3FH7 A;  5JJT A;  3RRN B;  2BUG A;  1WM5 A;  3FHE A;  4WNF A;  2VTB A;  3CHO A;  1XGW A;  5D0O D;  2KCK A;  3VLD A;  5ENN A;  4A1S A;  1Z6T A;  3BG0 B;  5AIJ A;  1W3B A;  3TJP A;  3UT8 A;  3RU0 A;  3ZXS A;  5EKQ D;  5BT1 A;  3CK9 A;  3G2S A;  4HOR A;  3LPZ A;  4J8D A;  3D9M A;  3TXN A;  3JUI A;  5AJD A;  4K03 A;  4WWP A;  1TJF A;  3PEU B;  2FO7 A;  2XRY A;  3D9P A;  3MV2 B;  1OWP A;  4G25 A;  3QB2 A;  2DBA A;  5FQ7 A;  1FVF A;  4N3A A;  4JA7 A;  1A17 A;  2UY1 B;  2J9Q A;  2OOE A;  3MA5 A;  4XKB A;  3LVR E;  4ILH B;  3APD A;  4F3V A;  4JL0 A;  4CGV A;  5HQ8 A;  3QWV A;  4HS2 A;  2VYI A;  4ILG A;  4V3I A;  4XZ4 A;  2L9B A;  3SNX A;  5JHA A;  3FU5 A;  2GRM A;  4JPS A;  4EBA A;  2ILR A;  2CFZ A;  4HFG A;  3URZ A;  4N2Q A;  4F53 A;  2PM6 A;  3FUE A;  4MKT A;  3S7D A;  2J08 A;  3PZD A;  2VGY A;  4ACL A;  4H7Y A;  4J8F A;  2IOS A;  3DBS A;  5AYW D;  1FCH A;  4TUU A;  1HZ4 A;  3FEX A;  4TV3 A;  3L6A A;  3FDH A;  1EF1 C;  3ML9 A;  3CHM A;  5C1D A;  4ANV A;  3ESL A;  5G2N A;  4EEC A;  2OVB A;  4ATG A;  3QDN A;  3FU6 A;  2HR2 A;  2AXV A;  5AEN A;  1TEZ A;  4N5C A;  3ZRH A;  2KCL A;  2WXF A;  4ACK A;  1HU3 A;  4AV7 A;  4PS3 A;  3G2V A;  4KYO B;  3TG5 A;  4B0Z A;  4KZ0 A;  4FC8 A;  4C0M A;  3JQ1 A;  3CVU A;  2J07 A;  3LS8 A;  2E0I A;  1IQU A;  3ZN3 A;  2QY7 A;  3FUF A;  4HOU A;  3ZGQ A;  3RRU A;  4I1A A;  4A55 A;  2IOL A;  2HYZ A;  4YVQ C;  3RK6 A;  2C0M A;  3LY9 A;  2KZT B;  4U8H A;  1HX8 A;  3NZS A;  4OVU A;  3I3N A;  1EDU A;  1U3D A;  2V8S E;  2DIW A;  2V5F A;  3LJ3 A;  3QNK A;  2R59 A;  1NZN A;  1MHQ A;  3CVP A;  1NA3 A;  3AS8 A;  3PRZ A;  4UQX A;  4XI9 A;  5T4Y A;  3LYA A;  5DBK A;  1L5J A;  3QK0 A;  4G1T A;  4N39 A;  2XGS A;  3L17 A;  2HO1 A;  3MKQ B;  4IYP A;  4JHJ A;  2XPZ A;  3ASD A;  1HXI A;  3AS5 A;  3PDN A;  1PY1 A;  3ZFW A;  3Q4A B;  4JA9 A;  3D9K A;  5J90 A;  2UY1 A;  2CG2 A;  2NXP A;  4EZL A;  2JEK A;  1QQE A;  3MX3 A;  3TL5 A;  3I4G A;  3IEG A;  2HM8 A;  1HG2 A;  4JC8 A;  4HXI A;  5EX0 A;  2J09 A;  4N3C A;  2XPI A;  4HOQ A;  1B89 A;  5C2Y A;  4JHK A;  4A3V A;  5JJ7 A;  4EZK A;  2WXI A;  4MRU A;  4AIF A;  2NSZ A;  4TRQ A;  2VJ8 A;  2X38 A;  3MJW A;  4PS8 A;  4EBA G;  1HS6 A;  2L6J A;  4QFV A;  4LUN U;  4LEU A;  3K9I A;  3WXX A;  3ULQ A;  3QKY A;  4L2L A;  2WVI A;  3E4B A;  3HDX A;  4AY5 A;  2MHK A;  3CVL A;  3OXG A;  4PH4 B;  5EX3 A;  2LSV A;  2WM9 A;  3NF1 A;  4ANU A;  4O6F A;  2OND A;  2X6K A;  3CST A;  3G2T A;  3HYM B;  3FH5 A;  1H19 A;  4AOF A;  3CHQ A;  2WQ7 A;  3L16 A;  3VTY A;  4RSY A;  4DI4 A;  4KZC A;  2YHC A;  4BSX A;  3B7U X;  4APF A;  2WXL A;  1X5B A;  4B8A A;  1NP7 A;  3P2B A;  4D10 C;  1E96 B;  1YA0 A;  1H2U A;  3L08 A;  5LCW J;  1E90 A;  2WXK A;  2KC7 A;  2WXN A;  3FU3 A;  4Y6C A;  3SHF A;  5A23 A;  4RG6 A;  3EJN A;  5FZR A;  4G11 A;  2KZT A;  3R7Q A;  4DI3 A;  3GZ2 A;  3GZS A;  4KVO A;  4C0E A;  4ABN A;  2X6J A;  2XGO A;  2I1J A;  1H2T C;  4U07 A;  1IYG A;  4I6J A;  3VLF A;  3LXU X;  2R17 C;  4FHJ A;  5FQ4 A;  2Q7F A;  3Q49 B;  3HVE A;  4UI9 K;  5HI7 A;  4L23 A;  5BV1 A;  3ZW3 A;  1SZ9 A;  3FTU A;  4J0U A;  4WUY A;  3T8M A;  1HE8 A;  1VDY A;  2BF0 X;  3IV0 A;  4M3O A;  2V0P A;  4NAC A;  3VLE A;  4GZ6 A;  2YIN A;  4CRW A;  4NUR A;  2J49 A;  5BV0 A;  4GMJ A;  3TG4 A;  4F7A A;  5KJL A;  5D0Q D;  3CKC A;  5E75 A;  5KJN A;  5LCW C;  2Y3A A;  1MQS A;  1NA0 A;  2CHZ A;  3AS4 A;  2FBN A;  3CSF A;  2WXQ A;  3KD7 A;  2C0L A;  3UPV A;  4KVM A;  3U3W A;  4FLH A;  4I9C A;  2IFU A;  2EQX A;  4GZC A;  4N2S A;  5CCM A;  2VQ2 A;  3PVL A;  3PNL B;  5T8I A;  4KXK B;  5A7D B;  3ENE A;  3G2W A;  2E2E A;  4KT6 B;  2P58 C;  3OXL A;  3TXM A;  3MZL B;  3D3M A;  3IHV A;  3C98 A;  1UJJ A;  3LVQ E;  3LEW A;  3R7R A;  4JXT A;  3CV0 A;  3APF A;  3FUD A;  2VGX B;  2UWJ G;  4CT0 A;  2NC9 A;  1QNF A;  1Y8M A;  2CFU A;  3CVQ A;  3S7B A;  5EDS A;  2MOW A;  4PS7 A;  3JCK C;  3PUJ A;  3GW4 A;  3LDZ A;  3L13 A;  3SGH A;  4AP2 A;  3ASF A;  3FTS A;  3T5X A;  3ZYQ A;  4FP7 A;  3L22 A;  3Q47 B;  4OVV A;  4C9B B;  4DJA A;  1HH8 A;  3FTW A;  3QWP A;  4FAD A;  3DPD A;  4AVX A;  4ANX A;  2WXH A;  3Q5M A;  1N54 A;  3ASG A;  1BPO A;  4GA0 A;  2WXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...