4DI3A

Crystal structure of a 2:1 complex of treponema pallidum tatp(t) (tp0957) bound to tatt (tp0956)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
273
structure length
273
Chain Sequence
DADFTRVFTEEDDLDLVAQSLPLVLKVYEALHLQNPAHRGLSLAVGRLYIMYANAFVQTPAQYLPEDEFEAQNEAYSRARKLYLRGARYALSSLETAYPGFTREVFSGDEQRLHKVLSRCTRVDVGTLYWVGTGYVAAFALTPLGSALPDTVHAAVMMLERACDLWPSYQEGAVWNVLTKFYAAAPESFGGGMEKAHTAFEHLTRYCSAHDPDHHITYADALCIPLNNRAGFDEALDRALAIDPESVPHNKLLVILSQKRARWLKAHVQDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TatP(T) (Tp0957)
publication title Structural and Thermodynamic Characterization of the Interaction between Two Periplasmic Treponema pallidum Lipoproteins that are Components of a TPR-Protein-Associated TRAP Transporter (TPAT).
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum
total genus 110
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16811 TAtT TRAP transporter T-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.920 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4di3A00
4DI4A 3U64A 4DI3A
chains in the Genus database with same CATH superfamily
2AJAA 4Q94A 1EF1C 2GRRB 4C0MA 3PUJA 4WNGA 4R7LA 2RFAA 4YVOA 4GA1A 4UUCA 1Y6IA 2WXLA 3L9TA 1HX8A 3CEQA 2AWIA 5ENQD 3W9FA 3GZ1A 1H2UA 5C1DA 3PE3A 3ZVVA 3TWXA 3UM3A 2KCKA 3FULA 3DSVA 2R59A 3IEGA 3S7DA 5KCMA 3S2AA 4BSZB 4HRNA 1LD8A 4HFGA 4GA2A 5BPPA 4G11A 3EUVA 4PS7A 1U3DA 4G23A 3MJWA 3PH0C 3ASGA 3CVXA 3FUFA 4FC8A 4XIFA 3PZ3A 3B7BA 4K0RA 5C2YA 3ZIMA 1X81A 2C0MA 4HVBA 3FUJA 3PZ1A 4FJYA 3FU6A 1K3ZD 3ABLE 3P1UA 1WAO1 1H0AA 4OYSA 4B94A 1KLXA 4HQDA 1TNBA 3G2SA 5FQ4A 2WXOA 1X5BA 3E32A 3G2UA 5AQBA 5ENPD 5ENRD 2ETBA 4TXPA 3LKUA 3NQPA 3RRUA 4BESA 3ISMC 3ZRHA 4A55A 4DUIA 4JPSA 2UY1B 2LSVA 4CEMA 4GCNA 4EQFA 2WVIA 3QB2A 3PUKA 4AOFA 4NURA 1AWCB 5CMWA 4U8HA 2R17C 4GTVA 4LNUD 3FUDA 2J8SD 3BU8A 3VLFA 3SBSA 3Q7FA 4GZ5A 4C9BB 5ENNA 2LNIA 3JUIA 3ZPJA 2WXMA 1TYQG 2XGOA 1QZ2A 5BXUA 3CHSA 3V2XA 2MYOA 2XQ0A 3ZW3A 1TN6A 2YQ8A 3CHOA 2XGSA 2MRIA 4RVBA 3DEOA 3FTUA 5EDSA 2AW6A 5AN8A 4W9RA 4I2WA 4GTTA 2QFCA 3KEZA 4NQ0A 3TXNA 3Q5MA 3JXJA 5FINA 2VQ2A 3UKRG 2MOWA 1JPLA 3UT4A 2A4ZA 1ELRA 1MX6A 3CR3A 4N2SA 1OUVA 3Q78A 1YA0A 2XS1A 4APOA 5D2MC 1BI8B 5EYLA 3QWVA 3ONLA 4U0ZA 3PVLA 5EX0A 4GZDA 4N3CA 3FUMA 4BT8A 3J5PA 4MBGA 2IO3C 4J8EA 4DX2A 1INZA 5CRUA 4FJZA 1GW6A 2OCCE 1DCEA 4A3TA 1IQUA 3ABKE 3NZUA 4URKA 2VYIA 3HRAA 3FTSA 3OXLA 5AYWD 4DX1A 3UM2A 1KZOA 2AXZA 4LG6A 1NI1A 1ZB1A 4HI8A 1S70B 4CGWA 1OXJA 3ZUVB 1SVXA 1N0RA 4H7XA 4XEIG 2PL2A 1TEZA 2IY0C 5D66A 2IOLA 3V31A 5G04C 3E33A 2H6HA 4EPZA 4U7EB 3CIAA 1FPPA 1HXIA 3X2QE 1BLXB 1EDUA 3LY7A 2XZTG 1OCRE 3FWVA 3BQOA 2WQ7A 2RKKA 1O1RA 3KAEA 2F0YA 4QFVA 4DLOA 2HM8A 5A6CA 2X6FA 4I43A 3ZYLA 3LS8A 4HOQA 4G24A 2P9UG 4L2YA 5BT1A 1FCHA 3CHMA 4CDRA 2V0PA 2I1JA 4GMLA 3V30A 4I17A 2DYRE 3B7RL 4TV3A 4WWPA 4BY6A 3MKQB 3CLJA 4JHRA 3JQ1A 2VGXA 3VTXA 2V4HC 3D9HA 2P9NG 3GW4A 1V54E 4XKCA 5AARA 4EHMA 3ESKA 4BFRA 4F3VA 4JC8A 4DRXE 4FADA 5FWQA 3KSLA 5AQ7A 4KVMA 5CMYA 4H7YA 3U9WA 3APCA 3UIOC 5CERB 4K03A 5JMND 5T3RA 3LY8A 4PUCA 2RFMA 3UKUG 4JW1A 4UQXA 2YHCA 4AIFA 1AP7A 2RG8A 3AS8A 1XNFA 5CECB 2WXPA 3ZFWA 3FP3A 3QAQA 3FUIA 1HE8A 4RG6A 2NC9A 4IN3B 3G2TA 3QWPA 5KWDA 3SF4A 3CQCB 2P9SG 3K9IA 4IULA 1S64A 1DNPA 4HRLA 5EX3A 2CFZA 3UT7A 3DPDA 4J8SA 2PZIA 5KNHD 1FT1A 4BEPA 4UWGA 3ONKA 3ZEFA 5A7DB 3UI2A 2F8XK 4B8CB 1L5JA 4G25A 4FA6A 3FTXA 3QARA 4GB9A 3SHFA 3DWLG 3C98A 4OAVB 4FP7A 4M3OA 5JA4D 4UWFA 5CEAA 2WPVA 4I9EA 5KBAA 5FTPA 1QQEA 4FU3A 4XZ4A 4FHJA 3LJ3A 3SBTB 3D9KA 2KCLA 3EIJA 3MYVA 3CSTA 3TG4A 4K5CA 3CHPA 1OWNA 4U0SA 1IYGA 2NSZA 1KZPA 5CCMA 3UUXA 4RLYA 2V4LA 4HS2A 1WY6A 3NZSA 4Z68A 3L22A 3ASDA 3UINC 4B89A 1TJCA 4QQIA 3RAUA 5IY5E 4YVQC 1N4SA 3WXXA 4EZKA 3RO3A 4AY6A 3ZXPA 3O4ZA 2B6CA 3OAWA 3UTMA 3UQ3A 2X6KA 2KM4A 3PNTB 3EHQA 3APFA 3FTZA 4ZFHA 2DVWA 2XPIA 3MX3A 4HOTA 3SFZA 4U07A 2C0LA 1N4QA 1O1SA 3UM0A 3CK8A 2BKGA 2R05A 3U3WA 3AG3E 2WXKA 4X8QA 4BTAA 4FHKA 1JCSA 2ZU6B 3AG4E 2AVPA 2R03A 3P2BA 3Q75A 4HOUA 4JVSA 1ELWA 3FEYA 3FU0A 3C3OA 1Y8MA 3CKBA 3KS2A 5B1BE 1MJ0A 3QKYA 4KZ0A 4AVXA 3L13A 3T8KA 3BEEA 2ETCA 3SI5A 1Z3XA 1A17A 3TWWA 5CRVA 3FU3A 1NFIE 3ZNGA 3CQGB 4UI9K 2IONA 1E8XA 3QC1A 2XCCA 3TWTA 4N39A 4CGVA 1U3CA 2EILE 1N95A 3R7QA 1MX2A 4I6EA 2Y0BG 4AY5A 1YMPA 3IXEA 1QBQA 2YHEA 1K8KG 2I6HA 2OV8A 1BPOA 3L82A 2LAIA 4BTBA 2P9KG 3BUAA 4N5QA 2DIWA 4GMJA 4J7WA 2L6JA 2QC9A 3UIPC 2WQ6A 4FLHA 3ZXSA 1S63A 1NA3A 2P9PG 4GU5A 4JA9A 3C72A 1Z3YA 3GZ2A 5LCWC 2R2LA 4BSXA 2VSOE 4UQZA 1RW2A 4ANWA 3D9IA 1JUQA 3Q7AA 2QYUA 4M7CA 4RG9A 5LOZA 4DX6D 4ANUA 3APDA 1E90A 4L7TA 3HG0D 5EYPF 3KSQA 1G3NB 2KBXA 4WWNA 3ABME 3AU5A 2L0IA 1UJKA 3ZYQA 2HYZA 4DK5A 3FUEA 5CHEE 1BI7B 3SFXA 4AEZC 1HG5A 4G1TA 4ILHB 2UWJG 5AIJA 1MQSA 2AXVA 4L23A 1ZBPA 2XENA 3EDTB 3L16A 2XZDG 3I5PA 5LFAA 3LY9A 4Q96A 2IU1A 2PM7A 4DLQA 5EIDA 4CYMD 3NF1A 3BG1B 4OVUA 2DBAA 3EU5A 1FVHA 2A5EA 4Q69A 1SZ9A 3IKOB 3LJNA 2FO1E 2I2OA 2IFUA 4BWRA 2Y3AA 4G26A 3RRMB 3DSXA 3EHRA 4HXIA 3FH5A 2PQNA 3NOCD 2VSYA 4KZCA 2J4BA 3FY4A 2VGXB 1H6KA 3SQVA 3FUKA 3U4TA 1UN9A 4U8YD 3JUEA 1D8DA 2DZNA 5AJDA 4AM9A 3CGHA 3MKRA 3LCAA 3RRNB 3UX4A 3WG7E 5BV1A 4XI0A 1VDYA 2X6JA 5AQ9A 3NBNB 2V5QC 4AP2A 5D0QD 1PY1A 4DX7D 4UI9J 5M72A 3T9KA 2ILRA 3G2VA 5D0OD 2X6HA 4G8LA 4OAUC 5T4YA 5HQ8A 2DCPA 1DVPA 3B7TA 2NXPA 1TNYA 3EJNA 1KPSB 1SA4A 3C5RA 5EN5D 3ASHA 1TR4A 3ZYKA 1D9SA 3FH7A 1MHQA 2J07A 4IRUA 3PEUB 2IOSA 2H6GA 3D9JA 1E8ZA 1SZAA 1BD8A 5E75A 2EIME 3QWWA 4U0UA 5FZQA 2WXFA 4LNBA 5ENOD 4WWOA 4BX8A 5FT9A 3HXBA 4J0UA 1IHGA 4Y6CA 4G2VA 3PS6A 3ULQA 5FJYA 3ZU7B 2M63A 4TRQA 4CDMA 2ZGDA 3GZSA 1OCCE 1HS6A 1W3BA 3ZKJA 5BNWA 4KMOA 2P2CP 3DBSA 4A3VA 2FF4A 1H6OA 3QK0A 4AXHA 1LF8A 2L0TB 3RIBA 3MZLB 2IJGX 4GYWA 4EBAG 4RQIA 4TXRA 4HB5A 5KJLA 2OVBA 3LVQE 2XEVA 3ZHEA 3T5XA 1TNOA 1UN8A 2FBNA 3HXDA 3NAWA 3AJIA 4HLLA 3OXGA 3PRZA 3ASOE 1MX4A 3HXEA 3DXMG 1HG2A 2YNQA 3MGBA 3Q9UC 2J4DA 1HFAA 3CK9A 3EHMA 3HVEA 4FLBA 2L6BA 2OEVA 4DJAA 4O60A 3OTNA 4GTPA 4TUMA 1OWLA 3LYAA 3ZYMA 2ZIRA 4KBQA 3TWRA 3AU4A 3OXFA 1OCOE 3MA5A 5HRYA 4HLEA 3KD7A 3TJPA 3QDNA 4I1MA 2VGYA 2Q7FA 1SW6A 2KZTA 5HS0A 3MEKA 3HXCA 4HNAD 2KC7A 2V5FA 2GRNB 3R9AB 2ONDA 3ASNE 4F1SA 3D9LA 3D9PA 4CDNA 4GTQA 1WDYA 4UWHA 1HH8A 5JJTA 4JL0A 4LRZA 4YDYA 4I1OB 4B0ZA 2Y69E 5ARGA 2ZISA 2FO7A 3AG1E 3UMVA 2GROB 5EILA 2H6IA 1TN8A 3Q47B 4ABNA 3URZA 2E2EA 3CV0A 2CFUA 4L1BA 4U8VD 1H19A 5G05J 2CHWA 2GW1A 2J49A 2GRQB 1MYOA 2F8YA 5AENA 4GYOA 3GYZA 2J9QA 2XGMA 4F7AA 3L54A 3CSFA 2RD0A 4GTMA 1EYHA 4WNEA 3ENEA 2DYSE 3NB2A 2CHZA 4GAAA 4XE0A 4GA0A 4JZYA 4WNFA 2WB2A 2OOEA 1N94A 3FDHA 4PH4B 2P58C 3B95A 2VSNA 3SGHA 3ZN3A 3J5QB 4U04A 2MHKA 4O1PA 1JCRA 3W9GA 3AS4A 2EIJE 1IXVA 2PNNA 1N54A 3JXIA 1H6PA 4KYOB 4Y6WA 4MLPA 3SZ7A 1ZU2A 3CVVA 3VTYA 2BF0X 2XPZA 4V3IA 2WXNA 1H2VC 2LXLA 3TWQA 4F53A 3B7UX 4J8FA 2KCVA 3MV2B 1BU9A 4E85A 5ENTD 2DZOA 3CK7A 2BTDA 3PE4A 3PZDA 4LERA 2CHXA 3HHMA 2I1KA 2WXJA 4MS6A 5ITZF 2EIKE 2P9IG 2Y4TA 4EZLA 1N0QA 3IHVA 4ACKA 4YDOA 3DSSA 4NRHB 5ANRA 3BG0B 2OEWA 3O48A 5CBNA 5LP0A 3RKVA 2A5UA 2GRPB 2OVFA 1NZNA 3D9OA 4L9PA 3TG5A 4A1SA 4O6FA 3PDNA 5FQ7A 1D8EA 4L2LA 1PAQA 1DCQA 4MKTA 5H7PA 3QOUA 5E76A 3UM1A 1E7UA 1UOHA 2IO2C 1B89A 1UJJA 1OWPA 3IBEA 4I9CA 2LAHA 5J90A 3CVUA 4JD2G 5JHAA 2EQXA 4JXTA 3CVWA 4I2ZA 4MRUA 3HXFA 2ETAA 4JEHA 1UW4B 3MCXA 2FEZA 1NL4A 4UWKA 1A5EA 3R7RA 3TWSA 5ARFA 1RZ4A 3TWUA 2XEEA 4GCOA 4I6GA 3RU0A 3L6AA 3CHQA 3DRAA 2CG2A 2XS8A 1E8YA 4JEUA 3ULEG 3VLDA 1U2VG 1OT8A 3B7SA 4BETA 4IYPA 3UT8A 4BX9A 4CT0A 1N11A 2BEDA 1E7VA 1JWFA 4LNGA 4BT9A 5FQ8A 4GTOA 4HI9A 2ZGGA 3RO2A 2WMNA 3EHNA 5A23A 4JHJA 2H6FA 5ENSD 4HORA 3SFYA 5DBKA 2JEKA 4HRMB 1OWMA 4BERA 3TXMA 3FTYA 4PS3A 3Q79A 5KJNA 3U66A 4N5CA 2VTBA 4PDXA 4GPKA 4EECA 4I1AA 5KJKA 3E30A 1OY3D 1FT2A 3F6QA 1DC2A 4KXKB 3FTWA 2IF4A 4UQYA 4GPMA 4HOSA 5G04J 3ZHEB 2GRLA 3DXKG 3PEVB 3B13A 1OWOA 4ANVA 4WAFA 3Q73A 2VSXE 2WMOA 3L08A 4EBAA 3KEAA 1EPUA 3C3RA 2WXGA 1E8WA 3E34A 3HVEB 4K5BA 4OVVA 3Q9NC 5JHBA 3CVLA 3Q4AB 1KT1A 3QNKA 4GTRA 4C48B 4TUUA 3AAAC 4HBDA 4E6HA 4F6RD 2WQHA 3DEPA 4YDEA 3T5VA 2Y1LE 4ILGA 2VGEA 2B0OE 3NOGD 4AJWA 5CCLA 3EU9A 5BV0A 2P9LG 1P5QA 4DPRA 2KZTB 2IEJA 2I9CA 2LXMA 1XGWA 2JLBA 5CEDB 5AAOA 4UWLA 1QYMA 4A63B 2QZAA 4AV7A 4GZCA 4JA7A 5BUZA 2LSUA 2HR2A 3S7FA 2GRMA 3DSWA 1TNUA 3FUHA 1IHBA 1HZ4A 3FUNA 2JABA 2GGFA 4F1PA 5EIBE 5FZRA 4NIKA 1S0PA 5LX8A 1KT0A 2R5SA 2J08A 1HF8A 2UY1A 4ME2A 1LD7A 1TJFA 5KJMA 1UG3A 4ANXA 5JJ6A 4J8YA 4ATZD 2AXUA 4YDWA 4N3BA 4LEUA 4WNDA 4DI3A 3EIQC 3MV3B 4P29A 2CG3A 3JYSA 4XX5A 3PZ4A 4LUNU 3CVPA 4UI9C 4GZ6A 4KVOA 5KNGA 4ACLA 1SQMA 4N2QA 3DPYA 4XKBA 3IHYA 1Z5SC 2R02A 1V55E 5EKQD 1H2TC 1NA0A 3G2WA 3LVRE 3PZ2A 4C0EA 2FI7A 2YINA 4LCTA 3R9MA 1O5MA 2X6IA 4DI4A 1QNFA 5BXOA 4CT4A 2XHEA 3LPZA 3ML8A 2LUHA 3JQ0A 3L17A 5FZSA 5HI7A 1K1AA 3AS5A 3ASFA 2HO1A 4FULA 4K5AB 1K1BA 5ANLA 1ELKA 3FH8A 1JWGA 4ATGA 4B8AA 3RJVA 1SA5A 4G8KA 3Q15A 4TXQA 1IQRA 3U64A 4GTSA 3PREA 3JCKC 4NACA 3S7JA 2BUGA 2NYJA 2KXPC 4EZJA 5B3SE 3Q49B 4WUYA 4I6JA 2J09A 4U95D 2X3MA 2XPYA 2WXRA 2PQRA 3E4BA 2KATA 3RSEG 1N9AA 5JJ7A 3I4RB 3TWVA 2DWZA 1PC2A 3LEWA 3HYMB 1YCSB 3ML9A 3V79K 3SY2A 4ILIA 2X38A 3ZGQA 2XEHA 1LTXA 3FHEA 1YYHA 3C3QA 3I4GA 3SO8A 4JHKA 4CRWA 2FULA 2F37A 1HO8A 3CVNA 2QY7A 3AG2E 3D3MA 4B93B 5FQ6A 4N3AA 1TNZA 2C2LA 3SNXA 4PS8A 3FEXA 1IKND 3S7BA 1MZCA 4APFA 3IV0A 3FTVA 4XI9A 3VLEA 4DX5D 3CKCA 3I3NA 3CVQA 5B1AE 2XRYA 5HKPA 4A1GA 4GZ3A 4JB8P 3LDZA 4CZ2D 2QYJA 4ZHBA 5CBOA 2WXIA 5DIZA 2L9BA 2XRZA 2LO6A 1HU3A 3DSUA 3TL5A 1Z6TA 3T8MA 2EINE 4RSYA 2IQCA 1OCZE 3RK6A 3FFLA 3HIZA 3MKQA 3UXGA 3ESLA 2WXQA 4KT6B 5AQAA 3SD5A 4YNDA 3D9MA 3D9NA 2WXHA 4LSZE 1JCQA 4GYYA 3TGOA 1WM5A 5AJLA 3PNLB 4J6IA 2PM6A 3LXUX 3CHRA 5G2NA 3E37A 5T8IA 4D10C 2VJ8A 1WG0A 4U63A 1E96B 3V2OA 2ZXWE 2HE0A 3CVYA 4CCAA 1N4RA 2Y4UA 1NP7A 3TAXA 4O1OA 2WM9A 5J08A 1TN7A 1N4PA 5FIOA 2E0IA 4GMRA 2XCBA 5BW8C 3UPVA 3FU5A 5LCWJ 1FVFA 2V8SE 3QJZA 4J8DA 1O1TA 4U96D 2VTBB 1N52A 5G05C 3HDXA 3N71A 2BKKB 1Q2ZA 5G55A 3ULYA 3DSTA
chains in the Genus database with same CATH topology
1L5JA 3QWWA 5KJNA 3U66A 4G25A 4U0UA 5FZQA 4Q94A 3FTXA 4FA6A 3QARA 1EF1C 2WXFA 4GB9A 3SHFA 3C98A 4WWOA 4N5CA 2VTBA 4C0MA 3PUJA 4WNGA 4BX8A 4PDXA 4R7LA 4FP7A 5FT9A 4M3OA 4J0UA 4YVOA 1IHGA 4GA1A 1Y6IA 2WXLA 4UWFA 4Y6CA 4EECA 4GPKA 4G2VA 2WPVA 3PS6A 1HX8A 3ULQA 4I9EA 3CEQA 2AWIA 5FJYA 4I1AA 2M63A 5FTPA 5KJKA 1QQEA 4FU3A 4XZ4A 4TRQA 4FHJA 4CDMA 3GZ1A 3GZSA 3LJ3A 4KXKB 1HS6A 1H2UA 3PE3A 3ZVVA 3SBTB 5C1DA 3D9KA 3FTWA 2KCKA 3FULA 2IF4A 1W3BA 4UQYA 2KCLA 3EIJA 5G04J 3ZHEB 2GRLA 5BNWA 4HOSA 4KMOA 2R59A 3IEGA 3PEVB 3B13A 3MYVA 1OWOA 3DBSA 3S7DA 5KCMA 3S2AA 4ANVA 4WAFA 2VSXE 2WMOA 3L08A 4A3VA 2FF4A 4EBAA 3CSTA 3QK0A 4AXHA 1LF8A 2L0TB 1EPUA 3RIBA 2WXGA 3MZLB 3TG4A 1E8WA 3CHPA 3HVEB 1OWNA 4HFGA 4U0SA 2IJGX 2NSZA 4GA2A 4GYWA 4EBAG 1IYGA 4OVVA 5KJLA 5BPPA 5CCMA 2OVBA 4G11A 3LVQE 3UUXA 2XEVA 5JHBA 3ZHEA 3T5XA 3CVLA 3Q4AB 1UN8A 2FBNA 2V4LA 4HS2A 1KT1A 1U3DA 3QNKA 1WY6A 4PS7A 4G23A 3OXGA 3PRZA 3MJWA 3NZSA 3L22A 3PH0C 3ASDA 1HG2A 3ASGA 3CVXA 2YNQA 3FUFA 1TJCA 3MGBA 4FC8A 4TUUA 4XIFA 4B89A 4YVQC 4E6HA 2J4DA 4K0RA 1HFAA 3CK9A 3EHMA 3HVEA 5C2YA 3ZIMA 4FLBA 3WXXA 2WQHA 4EZKA 3RO3A 2C0MA 4HVBA 3FUJA 4AY6A 4FJYA 4DJAA 3T5VA 3O4ZA 3FU6A 4ILGA 3OAWA 3P1UA 1WAO1 1H0AA 4OYSA 3OTNA 4AJWA 4B94A 1KLXA 1OWLA 3UQ3A 5CCLA 3G2SA 2X6KA 5FQ4A 5BV0A 2WXOA 2KM4A 1P5QA 3LYAA 3PNTB 1X5BA 3APFA 3ZYMA 4DPRA 2KZTB 3FTZA 3G2UA 2I9CA 2XPIA 4KBQA 1XGWA 2JLBA 3MX3A 4HOTA 3SFZA 3LKUA 3AU4A 3OXFA 3NQPA 4U07A 2C0LA 4UWLA 3RRUA 3MA5A 3ZRHA 4HLEA 3KD7A 3TJPA 4A55A 3QDNA 4AV7A 3CK8A 4JPSA 4GZCA 4JA7A 2UY1B 4I1MA 2VGYA 2LSVA 2LSUA 2Q7FA 5BUZA 2HR2A 3S7FA 2GRMA 3U3WA 4CEMA 2WXKA 4GCNA 3FUHA 4EQFA 2KZTA 2WVIA 3MEKA 3QB2A 4BTAA 1HZ4A 4FHKA 3FUNA 2ZU6B 3PUKA 2KC7A 2V5FA 2AVPA 3P2BA 4JVSA 4HOUA 2GGFA 4AOFA 1ELWA 5FZRA 1S0PA 5LX8A 4NURA 5CMWA 3R9AB 1KT0A 4U8HA 3FEYA 2R5SA 2ONDA 2R17C 3FU0A 2J08A 1Y8MA 3CKBA 1HF8A 3KS2A 4F1SA 3FUDA 2UY1A 3QKYA 4KZ0A 3D9LA 3VLFA 4ME2A 3SBSA 3D9PA 4AVXA 1TJFA 4GZ5A 5ENNA 4C9BB 2LNIA 5KJMA 1UG3A 4CDNA 3JUIA 3L13A 4ANXA 3ZPJA 2WXMA 3BEEA 1HH8A 4UWHA 5JJ6A 3SI5A 5JJTA 1Z3XA 2XGOA 1A17A 4JL0A 2AXUA 4LRZA 4N3BA 1QZ2A 3FU3A 4LEUA 4I1OB 4WNDA 4B0ZA 4DI3A 3CHSA 3CQGB 3EIQC 3MV3B 5ARGA 4P29A 4UI9K 2CG3A 3JYSA 2IONA 4XX5A 1E8XA 3QC1A 2FO7A 2XCCA 4LUNU 2XQ0A 3CVPA 3ZW3A 4UI9C 4GZ6A 4N39A 2YQ8A 3CHOA 4KVOA 4CGVA 2XGSA 4ACLA 1SQMA 4N2QA 1U3CA 3UMVA 4XKBA 3IHYA 3R7QA 2MRIA 3Q47B 5EKQD 4RVBA 4I6EA 1H2TC 4ABNA 1NA0A 2E2EA 3URZA 3CV0A 2CFUA 4L1BA 4AY5A 1H19A 3FTUA 5G05J 5EDSA 3G2WA 2CHWA 3LVRE 2GW1A 4C0EA 2FI7A 2J49A 2YINA 4LCTA 2AW6A 4W9RA 5AENA 2X6IA 4GYOA 4I2WA 4DI4A 1QNFA 3GYZA 2J9QA 2YHEA 2XGMA 4CT4A 4F7AA 3L54A 2I6HA 2OV8A 3CSFA 2RD0A 2XHEA 1BPOA 2QFCA 3KEZA 2LAIA 4NQ0A 4BTBA 3TXNA 1EYHA 3Q5MA 4WNEA 3LPZA 2DIWA 2VQ2A 4GMJA 2L6JA 3ENEA 3ML8A 2CHZA 2MOWA 2WQ6A 1JPLA 3UT4A 3JQ0A 4GAAA 3L17A 4FLHA 2A4ZA 4XE0A 5FZSA 1ELRA 5HI7A 3ZXSA 4GA0A 1NA3A 3CR3A 4N2SA 1OUVA 4GU5A 4JZYA 3AS5A 4WNFA 2WB2A 2OOEA 4JA9A 3ASFA 1YA0A 2HO1A 1Z3YA 4FULA 4APOA 3GZ2A 3QWVA 3ONLA 3FDHA 5ANLA 5LCWC 1ELKA 4U0ZA 4BSXA 3PVLA 3FH8A 5EX0A 4PH4B 2P58C 1JWGA 2VSNA 4GZDA 2VSOE 4UQZA 3SGHA 4ANWA 3D9IA 1JUQA 3ZN3A 4ATGA 4B8AA 4N3CA 3RJVA 4U04A 4RG9A 2MHKA 5LOZA 3FUMA 4ANUA 3Q15A 4BT8A 1IQRA 3U64A 3PREA 3JCKC 4J8EA 3AS4A 1INZA 4NACA 3APDA 1E90A 1N54A 4L7TA 3S7JA 4FJZA 2BUGA 4EZJA 1GW6A 3Q49B 4WUYA 4KYOB 4WWNA 4A3TA 4Y6WA 1IQUA 3NZUA 4I6JA 3AU5A 2L0IA 1UJKA 2J09A 4MLPA 3SZ7A 2VYIA 3ZYQA 4URKA 1ZU2A 3FTSA 3OXLA 5AYWD 3VTYA 3CVVA 2BF0X 2HYZA 2X3MA 2XPZA 4V3IA 4DK5A 2WXNA 2XPYA 2WXRA 3FUEA 1H2VC 2AXZA 5CHEE 2PQRA 4AEZC 3E4BA 4CGWA 4F53A 2KATA 1HG5A 3B7UX 4G1TA 4J8FA 4ILHB 2KCVA 2UWJG 3MV2B 5AIJA 5JJ7A 3I4RB 1MQSA 2AXVA 4L23A 4E85A 1ZBPA 1PC2A 3CK7A 4H7XA 3LEWA 3EDTB 3L16A 3HYMB 2PL2A 3I5PA 1TEZA 5LFAA 2BTDA 3ML9A 3LY9A 4Q96A 3PE4A 2IOLA 3PZDA 4LERA 2IU1A 2PM7A 5G04C 2CHXA 4DLQA 4EPZA 3NF1A 3CIAA 3BG1B 4ILIA 2X38A 3ZGQA 3HHMA 4OVUA 1HXIA 2I1KA 2WXJA 4MS6A 3FHEA 2DBAA 2Y4TA 1EDUA 3LY7A 1FVHA 3I4GA 4EZLA 3FWVA 3IHVA 4Q69A 4JHKA 4ACKA 2WQ7A 4CRWA 2FULA 1SZ9A 3IKOB 4NRHB 5ANRA 3KAEA 3BG0B 1HO8A 3CVNA 2I2OA 2QY7A 3O48A 2IFUA 4QFVA 3D3MA 4BWRA 4DLOA 2HM8A 2Y3AA 4G26A 5FQ6A 3RRMB 5LP0A 4N3AA 2C2LA 3RKVA 3SNXA 4PS8A 5A6CA 2X6FA 4HXIA 2A5UA 3FEXA 3FH5A 3S7BA 3IV0A 4APFA 2PQNA 2OVFA 4I43A 3FTVA 3ZYLA 1NZNA 2VSYA 3D9OA 3LS8A 4HOQA 4G24A 3TG5A 4KZCA 4XI9A 2J4BA 3FY4A 2VGXB 4L2YA 4O6FA 3VLEA 3PDNA 4A1SA 1H6KA 1FCHA 5BT1A 3CHMA 3FUKA 3CKCA 3I3NA 3CVQA 4CDRA 2V0PA 2I1JA 3U4TA 1UN9A 2XRYA 4GMLA 5FQ7A 4L2LA 1PAQA 4MKTA 4A1GA 4I17A 4GZ3A 4TV3A 3B7RL 3QOUA 5AJDA 5E76A 4AM9A 3CGHA 4WWPA 4BY6A 1E7UA 3MKRA 3LCAA 3LDZA 3MKQB 3RRNB 3UX4A 3CLJA 4JHRA 5BV1A 3JQ1A 2VGXA 1B89A 1UJJA 2WXIA 5DIZA 2L9BA 2XRZA 3VTXA 2LO6A 1OWPA 3IBEA 4XI0A 1VDYA 2X6JA 3GW4A 4I9CA 4XKCA 1HU3A 3TL5A 3ESKA 2LAHA 4BFRA 4F3VA 1Z6TA 4JC8A 5J90A 3T8MA 3CVUA 4RSYA 2IQCA 5JHAA 4FADA 3RK6A 2EQXA 5FWQA 4AP2A 5D0QD 4KVMA 5CMYA 1PY1A 4JXTA 3FFLA 4H7YA 3U9WA 3APCA 3HIZA 4UI9J 3CVWA 3MKQA 5M72A 3ESLA 4I2ZA 2WXQA 4KT6B 4MRUA 3SD5A 4YNDA 3D9MA 3D9NA 4K03A 4JEHA 5T3RA 3LY8A 1UW4B 2ILRA 3G2VA 3MCXA 2FEZA 4PUCA 5D0OD 4UWKA 2X6HA 3R7RA 4JW1A 4UQXA 5ARFA 5T4YA 5HQ8A 2YHCA 4AIFA 2WXHA 2RG8A 3AS8A 1XNFA 4GYYA 3TGOA 1WM5A 2WXPA 4GCOA 4I6GA 2DCPA 1DVPA 3B7TA 3PNLB 5AJLA 3RU0A 3L6AA 3CHQA 2CG2A 3ZFWA 3FP3A 3QAQA 3FUIA 2NXPA 1HE8A 1E8YA 4JEUA 4J6IA 3VLDA 2PM6A 3LXUX 3B7SA 3CHRA 2NC9A 4RG6A 5G2NA 4IN3B 5T8IA 4D10C 4IYPA 2VJ8A 3EJNA 3G2TA 3QWPA 4U63A 3UT8A 1E96B 4BX9A 4CT0A 3SF4A 3CQCB 1E7VA 3K9IA 4IULA 3CVYA 1JWFA 1DNPA 4CCAA 2Y4UA 1NP7A 3TAXA 4BT9A 2WM9A 3ASHA 5J08A 5FQ8A 2E0IA 2XCBA 5BW8C 3ZYKA 3UPVA 5EX3A 3FU5A 3RO2A 2CFZA 2WMNA 3EHNA 3UT7A 3DPDA 3FH7A 4J8SA 5A23A 5LCWJ 1FVFA 1MHQA 2J07A 2PZIA 2V8SE 3QJZA 4IRUA 3PEUB 4J8DA 4JHJA 2IOSA 2VTBB 1N52A 5G05C 4UWGA 3ONKA 4HORA 3D9JA 5DBKA 2JEKA 3HDXA 1E8ZA 3N71A 1SZAA 3ZEFA 5A7DB 5E75A 1OWMA 3TXMA 3FTYA 4PS3A 5G55A 4B8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI4 A;  3U64 A;  4DI3 A; 
#chains in the Genus database with same CATH topology
 2AJA A;  4Q94 A;  1EF1 C;  2GRR B;  4C0M A;  3PUJ A;  4WNG A;  4R7L A;  2RFA A;  4YVO A;  4GA1 A;  4UUC A;  1Y6I A;  2WXL A;  3L9T A;  1HX8 A;  3CEQ A;  2AWI A;  5ENQ D;  3W9F A;  3GZ1 A;  1H2U A;  5C1D A;  3PE3 A;  3ZVV A;  3TWX A;  3UM3 A;  2KCK A;  3FUL A;  3DSV A;  2R59 A;  3IEG A;  3S7D A;  5KCM A;  3S2A A;  4BSZ B;  4HRN A;  1LD8 A;  4HFG A;  4GA2 A;  5BPP A;  4G11 A;  3EUV A;  4PS7 A;  1U3D A;  4G23 A;  3MJW A;  3PH0 C;  3ASG A;  3CVX A;  3FUF A;  4FC8 A;  4XIF A;  3PZ3 A;  3B7B A;  4K0R A;  5C2Y A;  3ZIM A;  1X81 A;  2C0M A;  4HVB A;  3FUJ A;  3PZ1 A;  4FJY A;  3FU6 A;  1K3Z D;  3ABL E;  3P1U A;  1WAO 1;  1H0A A;  4OYS A;  4B94 A;  1KLX A;  4HQD A;  1TNB A;  3G2S A;  5FQ4 A;  2WXO A;  1X5B A;  3E32 A;  3G2U A;  5AQB A;  5ENP D;  5ENR D;  2ETB A;  4TXP A;  3LKU A;  3NQP A;  3RRU A;  4BES A;  3ISM C;  3ZRH A;  4A55 A;  4DUI A;  4JPS A;  2UY1 B;  2LSV A;  4CEM A;  4GCN A;  4EQF A;  2WVI A;  3QB2 A;  3PUK A;  4AOF A;  4NUR A;  1AWC B;  5CMW A;  4U8H A;  2R17 C;  4GTV A;  4LNU D;  3FUD A;  2J8S D;  3BU8 A;  3VLF A;  3SBS A;  3Q7F A;  4GZ5 A;  4C9B B;  5ENN A;  2LNI A;  3JUI A;  3ZPJ A;  2WXM A;  1TYQ G;  2XGO A;  1QZ2 A;  5BXU A;  3CHS A;  3V2X A;  2MYO A;  2XQ0 A;  3ZW3 A;  1TN6 A;  2YQ8 A;  3CHO A;  2XGS A;  2MRI A;  4RVB A;  3DEO A;  3FTU A;  5EDS A;  2AW6 A;  5AN8 A;  4W9R A;  4I2W A;  4GTT A;  2QFC A;  3KEZ A;  4NQ0 A;  3TXN A;  3Q5M A;  3JXJ A;  5FIN A;  2VQ2 A;  3UKR G;  2MOW A;  1JPL A;  3UT4 A;  2A4Z A;  1ELR A;  1MX6 A;  3CR3 A;  4N2S A;  1OUV A;  3Q78 A;  1YA0 A;  2XS1 A;  4APO A;  5D2M C;  1BI8 B;  5EYL A;  3QWV A;  3ONL A;  4U0Z A;  3PVL A;  5EX0 A;  4GZD A;  4N3C A;  3FUM A;  4BT8 A;  3J5P A;  4MBG A;  2IO3 C;  4J8E A;  4DX2 A;  1INZ A;  5CRU A;  4FJZ A;  1GW6 A;  2OCC E;  1DCE A;  4A3T A;  1IQU A;  3ABK E;  3NZU A;  4URK A;  2VYI A;  3HRA A;  3FTS A;  3OXL A;  5AYW D;  4DX1 A;  3UM2 A;  1KZO A;  2AXZ A;  4LG6 A;  1NI1 A;  1ZB1 A;  4HI8 A;  1S70 B;  4CGW A;  1OXJ A;  3ZUV B;  1SVX A;  1N0R A;  4H7X A;  4XEI G;  2PL2 A;  1TEZ A;  2IY0 C;  5D66 A;  2IOL A;  3V31 A;  5G04 C;  3E33 A;  2H6H A;  4EPZ A;  4U7E B;  3CIA A;  1FPP A;  1HXI A;  3X2Q E;  1BLX B;  1EDU A;  3LY7 A;  2XZT G;  1OCR E;  3FWV A;  3BQO A;  2WQ7 A;  2RKK A;  1O1R A;  3KAE A;  2F0Y A;  4QFV A;  4DLO A;  2HM8 A;  5A6C A;  2X6F A;  4I43 A;  3ZYL A;  3LS8 A;  4HOQ A;  4G24 A;  2P9U G;  4L2Y A;  5BT1 A;  1FCH A;  3CHM A;  4CDR A;  2V0P A;  2I1J A;  4GML A;  3V30 A;  4I17 A;  2DYR E;  3B7R L;  4TV3 A;  4WWP A;  4BY6 A;  3MKQ B;  3CLJ A;  4JHR A;  3JQ1 A;  2VGX A;  3VTX A;  2V4H C;  3D9H A;  2P9N G;  3GW4 A;  1V54 E;  4XKC A;  5AAR A;  4EHM A;  3ESK A;  4BFR A;  4F3V A;  4JC8 A;  4DRX E;  4FAD A;  5FWQ A;  3KSL A;  5AQ7 A;  4KVM A;  5CMY A;  4H7Y A;  3U9W A;  3APC A;  3UIO C;  5CER B;  4K03 A;  5JMN D;  5T3R A;  3LY8 A;  4PUC A;  2RFM A;  3UKU G;  4JW1 A;  4UQX A;  2YHC A;  4AIF A;  1AP7 A;  2RG8 A;  3AS8 A;  1XNF A;  5CEC B;  2WXP A;  3ZFW A;  3FP3 A;  3QAQ A;  3FUI A;  1HE8 A;  4RG6 A;  2NC9 A;  4IN3 B;  3G2T A;  3QWP A;  5KWD A;  3SF4 A;  3CQC B;  2P9S G;  3K9I A;  4IUL A;  1S64 A;  1DNP A;  4HRL A;  5EX3 A;  2CFZ A;  3UT7 A;  3DPD A;  4J8S A;  2PZI A;  5KNH D;  1FT1 A;  4BEP A;  4UWG A;  3ONK A;  3ZEF A;  5A7D B;  3UI2 A;  2F8X K;  4B8C B;  1L5J A;  4G25 A;  4FA6 A;  3FTX A;  3QAR A;  4GB9 A;  3SHF A;  3DWL G;  3C98 A;  4OAV B;  4FP7 A;  4M3O A;  5JA4 D;  4UWF A;  5CEA A;  2WPV A;  4I9E A;  5KBA A;  5FTP A;  1QQE A;  4FU3 A;  4XZ4 A;  4FHJ A;  3LJ3 A;  3SBT B;  3D9K A;  2KCL A;  3EIJ A;  3MYV A;  3CST A;  3TG4 A;  4K5C A;  3CHP A;  1OWN A;  4U0S A;  1IYG A;  2NSZ A;  1KZP A;  5CCM A;  3UUX A;  4RLY A;  2V4L A;  4HS2 A;  1WY6 A;  3NZS A;  4Z68 A;  3L22 A;  3ASD A;  3UIN C;  4B89 A;  1TJC A;  4QQI A;  3RAU A;  5IY5 E;  4YVQ C;  1N4S A;  3WXX A;  4EZK A;  3RO3 A;  4AY6 A;  3ZXP A;  3O4Z A;  2B6C A;  3OAW A;  3UTM A;  3UQ3 A;  2X6K A;  2KM4 A;  3PNT B;  3EHQ A;  3APF A;  3FTZ A;  4ZFH A;  2DVW A;  2XPI A;  3MX3 A;  4HOT A;  3SFZ A;  4U07 A;  2C0L A;  1N4Q A;  1O1S A;  3UM0 A;  3CK8 A;  2BKG A;  2R05 A;  3U3W A;  3AG3 E;  2WXK A;  4X8Q A;  4BTA A;  4FHK A;  1JCS A;  2ZU6 B;  3AG4 E;  2AVP A;  2R03 A;  3P2B A;  3Q75 A;  4HOU A;  4JVS A;  1ELW A;  3FEY A;  3FU0 A;  3C3O A;  1Y8M A;  3CKB A;  3KS2 A;  5B1B E;  1MJ0 A;  3QKY A;  4KZ0 A;  4AVX A;  3L13 A;  3T8K A;  3BEE A;  2ETC A;  3SI5 A;  1Z3X A;  1A17 A;  3TWW A;  5CRV A;  3FU3 A;  1NFI E;  3ZNG A;  3CQG B;  4UI9 K;  2ION A;  1E8X A;  3QC1 A;  2XCC A;  3TWT A;  4N39 A;  4CGV A;  1U3C A;  2EIL E;  1N95 A;  3R7Q A;  1MX2 A;  4I6E A;  2Y0B G;  4AY5 A;  1YMP A;  3IXE A;  1QBQ A;  2YHE A;  1K8K G;  2I6H A;  2OV8 A;  1BPO A;  3L82 A;  2LAI A;  4BTB A;  2P9K G;  3BUA A;  4N5Q A;  2DIW A;  4GMJ A;  4J7W A;  2L6J A;  2QC9 A;  3UIP C;  2WQ6 A;  4FLH A;  3ZXS A;  1S63 A;  1NA3 A;  2P9P G;  4GU5 A;  4JA9 A;  3C72 A;  1Z3Y A;  3GZ2 A;  5LCW C;  2R2L A;  4BSX A;  2VSO E;  4UQZ A;  1RW2 A;  4ANW A;  3D9I A;  1JUQ A;  3Q7A A;  2QYU A;  4M7C A;  4RG9 A;  5LOZ A;  4DX6 D;  4ANU A;  3APD A;  1E90 A;  4L7T A;  3HG0 D;  5EYP F;  3KSQ A;  1G3N B;  2KBX A;  4WWN A;  3ABM E;  3AU5 A;  2L0I A;  1UJK A;  3ZYQ A;  2HYZ A;  4DK5 A;  3FUE A;  5CHE E;  1BI7 B;  3SFX A;  4AEZ C;  1HG5 A;  4G1T A;  4ILH B;  2UWJ G;  5AIJ A;  1MQS A;  2AXV A;  4L23 A;  1ZBP A;  2XEN A;  3EDT B;  3L16 A;  2XZD G;  3I5P A;  5LFA A;  3LY9 A;  4Q96 A;  2IU1 A;  2PM7 A;  4DLQ A;  5EID A;  4CYM D;  3NF1 A;  3BG1 B;  4OVU A;  2DBA A;  3EU5 A;  1FVH A;  2A5E A;  4Q69 A;  1SZ9 A;  3IKO B;  3LJN A;  2FO1 E;  2I2O A;  2IFU A;  4BWR A;  2Y3A A;  4G26 A;  3RRM B;  3DSX A;  3EHR A;  4HXI A;  3FH5 A;  2PQN A;  3NOC D;  2VSY A;  4KZC A;  2J4B A;  3FY4 A;  2VGX B;  1H6K A;  3SQV A;  3FUK A;  3U4T A;  1UN9 A;  4U8Y D;  3JUE A;  1D8D A;  2DZN A;  5AJD A;  4AM9 A;  3CGH A;  3MKR A;  3LCA A;  3RRN B;  3UX4 A;  3WG7 E;  5BV1 A;  4XI0 A;  1VDY A;  2X6J A;  5AQ9 A;  3NBN B;  2V5Q C;  4AP2 A;  5D0Q D;  1PY1 A;  4DX7 D;  4UI9 J;  5M72 A;  3T9K A;  2ILR A;  3G2V A;  5D0O D;  2X6H A;  4G8L A;  4OAU C;  5T4Y A;  5HQ8 A;  2DCP A;  1DVP A;  3B7T A;  2NXP A;  1TNY A;  3EJN A;  1KPS B;  1SA4 A;  3C5R A;  5EN5 D;  3ASH A;  1TR4 A;  3ZYK A;  1D9S A;  3FH7 A;  1MHQ A;  2J07 A;  4IRU A;  3PEU B;  2IOS A;  2H6G A;  3D9J A;  1E8Z A;  1SZA A;  1BD8 A;  5E75 A;  2EIM E;  3QWW A;  4U0U A;  5FZQ A;  2WXF A;  4LNB A;  5ENO D;  4WWO A;  4BX8 A;  5FT9 A;  3HXB A;  4J0U A;  1IHG A;  4Y6C A;  4G2V A;  3PS6 A;  3ULQ A;  5FJY A;  3ZU7 B;  2M63 A;  4TRQ A;  4CDM A;  2ZGD A;  3GZS A;  1OCC E;  1HS6 A;  1W3B A;  3ZKJ A;  5BNW A;  4KMO A;  2P2C P;  3DBS A;  4A3V A;  2FF4 A;  1H6O A;  3QK0 A;  4AXH A;  1LF8 A;  2L0T B;  3RIB A;  3MZL B;  2IJG X;  4GYW A;  4EBA G;  4RQI A;  4TXR A;  4HB5 A;  5KJL A;  2OVB A;  3LVQ E;  2XEV A;  3ZHE A;  3T5X A;  1TNO A;  1UN8 A;  2FBN A;  3HXD A;  3NAW A;  3AJI A;  4HLL A;  3OXG A;  3PRZ A;  3ASO E;  1MX4 A;  3HXE A;  3DXM G;  1HG2 A;  2YNQ A;  3MGB A;  3Q9U C;  2J4D A;  1HFA A;  3CK9 A;  3EHM A;  3HVE A;  4FLB A;  2L6B A;  2OEV A;  4DJA A;  4O60 A;  3OTN A;  4GTP A;  4TUM A;  1OWL A;  3LYA A;  3ZYM A;  2ZIR A;  4KBQ A;  3TWR A;  3AU4 A;  3OXF A;  1OCO E;  3MA5 A;  5HRY A;  4HLE A;  3KD7 A;  3TJP A;  3QDN A;  4I1M A;  2VGY A;  2Q7F A;  1SW6 A;  2KZT A;  5HS0 A;  3MEK A;  3HXC A;  4HNA D;  2KC7 A;  2V5F A;  2GRN B;  3R9A B;  2OND A;  3ASN E;  4F1S A;  3D9L A;  3D9P A;  4CDN A;  4GTQ A;  1WDY A;  4UWH A;  1HH8 A;  5JJT A;  4JL0 A;  4LRZ A;  4YDY A;  4I1O B;  4B0Z A;  2Y69 E;  5ARG A;  2ZIS A;  2FO7 A;  3AG1 E;  3UMV A;  2GRO B;  5EIL A;  2H6I A;  1TN8 A;  3Q47 B;  4ABN A;  3URZ A;  2E2E A;  3CV0 A;  2CFU A;  4L1B A;  4U8V D;  1H19 A;  5G05 J;  2CHW A;  2GW1 A;  2J49 A;  2GRQ B;  1MYO A;  2F8Y A;  5AEN A;  4GYO A;  3GYZ A;  2J9Q A;  2XGM A;  4F7A A;  3L54 A;  3CSF A;  2RD0 A;  4GTM A;  1EYH A;  4WNE A;  3ENE A;  2DYS E;  3NB2 A;  2CHZ A;  4GAA A;  4XE0 A;  4GA0 A;  4JZY A;  4WNF A;  2WB2 A;  2OOE A;  1N94 A;  3FDH A;  4PH4 B;  2P58 C;  3B95 A;  2VSN A;  3SGH A;  3ZN3 A;  3J5Q B;  4U04 A;  2MHK A;  4O1P A;  1JCR A;  3W9G A;  3AS4 A;  2EIJ E;  1IXV A;  2PNN A;  1N54 A;  3JXI A;  1H6P A;  4KYO B;  4Y6W A;  4MLP A;  3SZ7 A;  1ZU2 A;  3CVV A;  3VTY A;  2BF0 X;  2XPZ A;  4V3I A;  2WXN A;  1H2V C;  2LXL A;  3TWQ A;  4F53 A;  3B7U X;  4J8F A;  2KCV A;  3MV2 B;  1BU9 A;  4E85 A;  5ENT D;  2DZO A;  3CK7 A;  2BTD A;  3PE4 A;  3PZD A;  4LER A;  2CHX A;  3HHM A;  2I1K A;  2WXJ A;  4MS6 A;  5ITZ F;  2EIK E;  2P9I G;  2Y4T A;  4EZL A;  1N0Q A;  3IHV A;  4ACK A;  4YDO A;  3DSS A;  4NRH B;  5ANR A;  3BG0 B;  2OEW A;  3O48 A;  5CBN A;  5LP0 A;  3RKV A;  2A5U A;  2GRP B;  2OVF A;  1NZN A;  3D9O A;  4L9P A;  3TG5 A;  4A1S A;  4O6F A;  3PDN A;  5FQ7 A;  1D8E A;  4L2L A;  1PAQ A;  1DCQ A;  4MKT A;  5H7P A;  3QOU A;  5E76 A;  3UM1 A;  1E7U A;  1UOH A;  2IO2 C;  1B89 A;  1UJJ A;  1OWP A;  3IBE A;  4I9C A;  2LAH A;  5J90 A;  3CVU A;  4JD2 G;  5JHA A;  2EQX A;  4JXT A;  3CVW A;  4I2Z A;  4MRU A;  3HXF A;  2ETA A;  4JEH A;  1UW4 B;  3MCX A;  2FEZ A;  1NL4 A;  4UWK A;  1A5E A;  3R7R A;  3TWS A;  5ARF A;  1RZ4 A;  3TWU A;  2XEE A;  4GCO A;  4I6G A;  3RU0 A;  3L6A A;  3CHQ A;  3DRA A;  2CG2 A;  2XS8 A;  1E8Y A;  4JEU A;  3ULE G;  3VLD A;  1U2V G;  1OT8 A;  3B7S A;  4BET A;  4IYP A;  3UT8 A;  4BX9 A;  4CT0 A;  1N11 A;  2BED A;  1E7V A;  1JWF A;  4LNG A;  4BT9 A;  5FQ8 A;  4GTO A;  4HI9 A;  2ZGG A;  3RO2 A;  2WMN A;  3EHN A;  5A23 A;  4JHJ A;  2H6F A;  5ENS D;  4HOR A;  3SFY A;  5DBK A;  2JEK A;  4HRM B;  1OWM A;  4BER A;  3TXM A;  3FTY A;  4PS3 A;  3Q79 A;  5KJN A;  3U66 A;  4N5C A;  2VTB A;  4PDX A;  4GPK A;  4EEC A;  4I1A A;  5KJK A;  3E30 A;  1OY3 D;  1FT2 A;  3F6Q A;  1DC2 A;  4KXK B;  3FTW A;  2IF4 A;  4UQY A;  4GPM A;  4HOS A;  5G04 J;  3ZHE B;  2GRL A;  3DXK G;  3PEV B;  3B13 A;  1OWO A;  4ANV A;  4WAF A;  3Q73 A;  2VSX E;  2WMO A;  3L08 A;  4EBA A;  3KEA A;  1EPU A;  3C3R A;  2WXG A;  1E8W A;  3E34 A;  3HVE B;  4K5B A;  4OVV A;  3Q9N C;  5JHB A;  3CVL A;  3Q4A B;  1KT1 A;  3QNK A;  4GTR A;  4C48 B;  4TUU A;  3AAA C;  4HBD A;  4E6H A;  4F6R D;  2WQH A;  3DEP A;  4YDE A;  3T5V A;  2Y1L E;  4ILG A;  2VGE A;  2B0O E;  3NOG D;  4AJW A;  5CCL A;  3EU9 A;  5BV0 A;  2P9L G;  1P5Q A;  4DPR A;  2KZT B;  2IEJ A;  2I9C A;  2LXM A;  1XGW A;  2JLB A;  5CED B;  5AAO A;  4UWL A;  1QYM A;  4A63 B;  2QZA A;  4AV7 A;  4GZC A;  4JA7 A;  5BUZ A;  2LSU A;  2HR2 A;  3S7F A;  2GRM A;  3DSW A;  1TNU A;  3FUH A;  1IHB A;  1HZ4 A;  3FUN A;  2JAB A;  2GGF A;  4F1P A;  5EIB E;  5FZR A;  4NIK A;  1S0P A;  5LX8 A;  1KT0 A;  2R5S A;  2J08 A;  1HF8 A;  2UY1 A;  4ME2 A;  1LD7 A;  1TJF A;  5KJM A;  1UG3 A;  4ANX A;  5JJ6 A;  4J8Y A;  4ATZ D;  2AXU A;  4YDW A;  4N3B A;  4LEU A;  4WND A;  4DI3 A;  3EIQ C;  3MV3 B;  4P29 A;  2CG3 A;  3JYS A;  4XX5 A;  3PZ4 A;  4LUN U;  3CVP A;  4UI9 C;  4GZ6 A;  4KVO A;  5KNG A;  4ACL A;  1SQM A;  4N2Q A;  3DPY A;  4XKB A;  3IHY A;  1Z5S C;  2R02 A;  1V55 E;  5EKQ D;  1H2T C;  1NA0 A;  3G2W A;  3LVR E;  3PZ2 A;  4C0E A;  2FI7 A;  2YIN A;  4LCT A;  3R9M A;  1O5M A;  2X6I A;  4DI4 A;  1QNF A;  5BXO A;  4CT4 A;  2XHE A;  3LPZ A;  3ML8 A;  2LUH A;  3JQ0 A;  3L17 A;  5FZS A;  5HI7 A;  1K1A A;  3AS5 A;  3ASF A;  2HO1 A;  4FUL A;  4K5A B;  1K1B A;  5ANL A;  1ELK A;  3FH8 A;  1JWG A;  4ATG A;  4B8A A;  3RJV A;  1SA5 A;  4G8K A;  3Q15 A;  4TXQ A;  1IQR A;  3U64 A;  4GTS A;  3PRE A;  3JCK C;  4NAC A;  3S7J A;  2BUG A;  2NYJ A;  2KXP C;  4EZJ A;  5B3S E;  3Q49 B;  4WUY A;  4I6J A;  2J09 A;  4U95 D;  2X3M A;  2XPY A;  2WXR A;  2PQR A;  3E4B A;  2KAT A;  3RSE G;  1N9A A;  5JJ7 A;  3I4R B;  3TWV A;  2DWZ A;  1PC2 A;  3LEW A;  3HYM B;  1YCS B;  3ML9 A;  3V79 K;  3SY2 A;  4ILI A;  2X38 A;  3ZGQ A;  2XEH A;  1LTX A;  3FHE A;  1YYH A;  3C3Q A;  3I4G A;  3SO8 A;  4JHK A;  4CRW A;  2FUL A;  2F37 A;  1HO8 A;  3CVN A;  2QY7 A;  3AG2 E;  3D3M A;  4B93 B;  5FQ6 A;  4N3A A;  1TNZ A;  2C2L A;  3SNX A;  4PS8 A;  3FEX A;  1IKN D;  3S7B A;  1MZC A;  4APF A;  3IV0 A;  3FTV A;  4XI9 A;  3VLE A;  4DX5 D;  3CKC A;  3I3N A;  3CVQ A;  5B1A E;  2XRY A;  5HKP A;  4A1G A;  4GZ3 A;  4JB8 P;  3LDZ A;  4CZ2 D;  2QYJ A;  4ZHB A;  5CBO A;  2WXI A;  5DIZ A;  2L9B A;  2XRZ A;  2LO6 A;  1HU3 A;  3DSU A;  3TL5 A;  1Z6T A;  3T8M A;  2EIN E;  4RSY A;  2IQC A;  1OCZ E;  3RK6 A;  3FFL A;  3HIZ A;  3MKQ A;  3UXG A;  3ESL A;  2WXQ A;  4KT6 B;  5AQA A;  3SD5 A;  4YND A;  3D9M A;  3D9N A;  2WXH A;  4LSZ E;  1JCQ A;  4GYY A;  3TGO A;  1WM5 A;  5AJL A;  3PNL B;  4J6I A;  2PM6 A;  3LXU X;  3CHR A;  5G2N A;  3E37 A;  5T8I A;  4D10 C;  2VJ8 A;  1WG0 A;  4U63 A;  1E96 B;  3V2O A;  2ZXW E;  2HE0 A;  3CVY A;  4CCA A;  1N4R A;  2Y4U A;  1NP7 A;  3TAX A;  4O1O A;  2WM9 A;  5J08 A;  1TN7 A;  1N4P A;  5FIO A;  2E0I A;  4GMR A;  2XCB A;  5BW8 C;  3UPV A;  3FU5 A;  5LCW J;  1FVF A;  2V8S E;  3QJZ A;  4J8D A;  1O1T A;  4U96 D;  2VTB B;  1N52 A;  5G05 C;  3HDX A;  3N71 A;  2BKK B;  1Q2Z A;  5G55 A;  3ULY A;  3DST A; 
#chains in the Genus database with same CATH homology
 1L5J A;  3QWW A;  5KJN A;  3U66 A;  4G25 A;  4U0U A;  5FZQ A;  4Q94 A;  3FTX A;  4FA6 A;  3QAR A;  1EF1 C;  2WXF A;  4GB9 A;  3SHF A;  3C98 A;  4WWO A;  4N5C A;  2VTB A;  4C0M A;  3PUJ A;  4WNG A;  4BX8 A;  4PDX A;  4R7L A;  4FP7 A;  5FT9 A;  4M3O A;  4J0U A;  4YVO A;  1IHG A;  4GA1 A;  1Y6I A;  2WXL A;  4UWF A;  4Y6C A;  4EEC A;  4GPK A;  4G2V A;  2WPV A;  3PS6 A;  1HX8 A;  3ULQ A;  4I9E A;  3CEQ A;  2AWI A;  5FJY A;  4I1A A;  2M63 A;  5FTP A;  5KJK A;  1QQE A;  4FU3 A;  4XZ4 A;  4TRQ A;  4FHJ A;  4CDM A;  3GZ1 A;  3GZS A;  3LJ3 A;  4KXK B;  1HS6 A;  1H2U A;  3PE3 A;  3ZVV A;  3SBT B;  5C1D A;  3D9K A;  3FTW A;  2KCK A;  3FUL A;  2IF4 A;  1W3B A;  4UQY A;  2KCL A;  3EIJ A;  5G04 J;  3ZHE B;  2GRL A;  5BNW A;  4HOS A;  4KMO A;  2R59 A;  3IEG A;  3PEV B;  3B13 A;  3MYV A;  1OWO A;  3DBS A;  3S7D A;  5KCM A;  3S2A A;  4ANV A;  4WAF A;  2VSX E;  2WMO A;  3L08 A;  4A3V A;  2FF4 A;  4EBA A;  3CST A;  3QK0 A;  4AXH A;  1LF8 A;  2L0T B;  1EPU A;  3RIB A;  2WXG A;  3MZL B;  3TG4 A;  1E8W A;  3CHP A;  3HVE B;  1OWN A;  4HFG A;  4U0S A;  2IJG X;  2NSZ A;  4GA2 A;  4GYW A;  4EBA G;  1IYG A;  4OVV A;  5KJL A;  5BPP A;  5CCM A;  2OVB A;  4G11 A;  3LVQ E;  3UUX A;  2XEV A;  5JHB A;  3ZHE A;  3T5X A;  3CVL A;  3Q4A B;  1UN8 A;  2FBN A;  2V4L A;  4HS2 A;  1KT1 A;  1U3D A;  3QNK A;  1WY6 A;  4PS7 A;  4G23 A;  3OXG A;  3PRZ A;  3MJW A;  3NZS A;  3L22 A;  3PH0 C;  3ASD A;  1HG2 A;  3ASG A;  3CVX A;  2YNQ A;  3FUF A;  1TJC A;  3MGB A;  4FC8 A;  4TUU A;  4XIF A;  4B89 A;  4YVQ C;  4E6H A;  2J4D A;  4K0R A;  1HFA A;  3CK9 A;  3EHM A;  3HVE A;  5C2Y A;  3ZIM A;  4FLB A;  3WXX A;  2WQH A;  4EZK A;  3RO3 A;  2C0M A;  4HVB A;  3FUJ A;  4AY6 A;  4FJY A;  4DJA A;  3T5V A;  3O4Z A;  3FU6 A;  4ILG A;  3OAW A;  3P1U A;  1WAO 1;  1H0A A;  4OYS A;  3OTN A;  4AJW A;  4B94 A;  1KLX A;  1OWL A;  3UQ3 A;  5CCL A;  3G2S A;  2X6K A;  5FQ4 A;  5BV0 A;  2WXO A;  2KM4 A;  1P5Q A;  3LYA A;  3PNT B;  1X5B A;  3APF A;  3ZYM A;  4DPR A;  2KZT B;  3FTZ A;  3G2U A;  2I9C A;  2XPI A;  4KBQ A;  1XGW A;  2JLB A;  3MX3 A;  4HOT A;  3SFZ A;  3LKU A;  3AU4 A;  3OXF A;  3NQP A;  4U07 A;  2C0L A;  4UWL A;  3RRU A;  3MA5 A;  3ZRH A;  4HLE A;  3KD7 A;  3TJP A;  4A55 A;  3QDN A;  4AV7 A;  3CK8 A;  4JPS A;  4GZC A;  4JA7 A;  2UY1 B;  4I1M A;  2VGY A;  2LSV A;  2LSU A;  2Q7F A;  5BUZ A;  2HR2 A;  3S7F A;  2GRM A;  3U3W A;  4CEM A;  2WXK A;  4GCN A;  3FUH A;  4EQF A;  2KZT A;  2WVI A;  3MEK A;  3QB2 A;  4BTA A;  1HZ4 A;  4FHK A;  3FUN A;  2ZU6 B;  3PUK A;  2KC7 A;  2V5F A;  2AVP A;  3P2B A;  4JVS A;  4HOU A;  2GGF A;  4AOF A;  1ELW A;  5FZR A;  1S0P A;  5LX8 A;  4NUR A;  5CMW A;  3R9A B;  1KT0 A;  4U8H A;  3FEY A;  2R5S A;  2OND A;  2R17 C;  3FU0 A;  2J08 A;  1Y8M A;  3CKB A;  1HF8 A;  3KS2 A;  4F1S A;  3FUD A;  2UY1 A;  3QKY A;  4KZ0 A;  3D9L A;  3VLF A;  4ME2 A;  3SBS A;  3D9P A;  4AVX A;  1TJF A;  4GZ5 A;  5ENN A;  4C9B B;  2LNI A;  5KJM A;  1UG3 A;  4CDN A;  3JUI A;  3L13 A;  4ANX A;  3ZPJ A;  2WXM A;  3BEE A;  1HH8 A;  4UWH A;  5JJ6 A;  3SI5 A;  5JJT A;  1Z3X A;  2XGO A;  1A17 A;  4JL0 A;  2AXU A;  4LRZ A;  4N3B A;  1QZ2 A;  3FU3 A;  4LEU A;  4I1O B;  4WND A;  4B0Z A;  4DI3 A;  3CHS A;  3CQG B;  3EIQ C;  3MV3 B;  5ARG A;  4P29 A;  4UI9 K;  2CG3 A;  3JYS A;  2ION A;  4XX5 A;  1E8X A;  3QC1 A;  2FO7 A;  2XCC A;  4LUN U;  2XQ0 A;  3CVP A;  3ZW3 A;  4UI9 C;  4GZ6 A;  4N39 A;  2YQ8 A;  3CHO A;  4KVO A;  4CGV A;  2XGS A;  4ACL A;  1SQM A;  4N2Q A;  1U3C A;  3UMV A;  4XKB A;  3IHY A;  3R7Q A;  2MRI A;  3Q47 B;  5EKQ D;  4RVB A;  4I6E A;  1H2T C;  4ABN A;  1NA0 A;  2E2E A;  3URZ A;  3CV0 A;  2CFU A;  4L1B A;  4AY5 A;  1H19 A;  3FTU A;  5G05 J;  5EDS A;  3G2W A;  2CHW A;  3LVR E;  2GW1 A;  4C0E A;  2FI7 A;  2J49 A;  2YIN A;  4LCT A;  2AW6 A;  4W9R A;  5AEN A;  2X6I A;  4GYO A;  4I2W A;  4DI4 A;  1QNF A;  3GYZ A;  2J9Q A;  2YHE A;  2XGM A;  4CT4 A;  4F7A A;  3L54 A;  2I6H A;  2OV8 A;  3CSF A;  2RD0 A;  2XHE A;  1BPO A;  2QFC A;  3KEZ A;  2LAI A;  4NQ0 A;  4BTB A;  3TXN A;  1EYH A;  3Q5M A;  4WNE A;  3LPZ A;  2DIW A;  2VQ2 A;  4GMJ A;  2L6J A;  3ENE A;  3ML8 A;  2CHZ A;  2MOW A;  2WQ6 A;  1JPL A;  3UT4 A;  3JQ0 A;  4GAA A;  3L17 A;  4FLH A;  2A4Z A;  4XE0 A;  5FZS A;  1ELR A;  5HI7 A;  3ZXS A;  4GA0 A;  1NA3 A;  3CR3 A;  4N2S A;  1OUV A;  4GU5 A;  4JZY A;  3AS5 A;  4WNF A;  2WB2 A;  2OOE A;  4JA9 A;  3ASF A;  1YA0 A;  2HO1 A;  1Z3Y A;  4FUL A;  4APO A;  3GZ2 A;  3QWV A;  3ONL A;  3FDH A;  5ANL A;  5LCW C;  1ELK A;  4U0Z A;  4BSX A;  3PVL A;  3FH8 A;  5EX0 A;  4PH4 B;  2P58 C;  1JWG A;  2VSN A;  4GZD A;  2VSO E;  4UQZ A;  3SGH A;  4ANW A;  3D9I A;  1JUQ A;  3ZN3 A;  4ATG A;  4B8A A;  4N3C A;  3RJV A;  4U04 A;  4RG9 A;  2MHK A;  5LOZ A;  3FUM A;  4ANU A;  3Q15 A;  4BT8 A;  1IQR A;  3U64 A;  3PRE A;  3JCK C;  4J8E A;  3AS4 A;  1INZ A;  4NAC A;  3APD A;  1E90 A;  1N54 A;  4L7T A;  3S7J A;  4FJZ A;  2BUG A;  4EZJ A;  1GW6 A;  3Q49 B;  4WUY A;  4KYO B;  4WWN A;  4A3T A;  4Y6W A;  1IQU A;  3NZU A;  4I6J A;  3AU5 A;  2L0I A;  1UJK A;  2J09 A;  4MLP A;  3SZ7 A;  2VYI A;  3ZYQ A;  4URK A;  1ZU2 A;  3FTS A;  3OXL A;  5AYW D;  3VTY A;  3CVV A;  2BF0 X;  2HYZ A;  2X3M A;  2XPZ A;  4V3I A;  4DK5 A;  2WXN A;  2XPY A;  2WXR A;  3FUE A;  1H2V C;  2AXZ A;  5CHE E;  2PQR A;  4AEZ C;  3E4B A;  4CGW A;  4F53 A;  2KAT A;  1HG5 A;  3B7U X;  4G1T A;  4J8F A;  4ILH B;  2KCV A;  2UWJ G;  3MV2 B;  5AIJ A;  5JJ7 A;  3I4R B;  1MQS A;  2AXV A;  4L23 A;  4E85 A;  1ZBP A;  1PC2 A;  3CK7 A;  4H7X A;  3LEW A;  3EDT B;  3L16 A;  3HYM B;  2PL2 A;  3I5P A;  1TEZ A;  5LFA A;  2BTD A;  3ML9 A;  3LY9 A;  4Q96 A;  3PE4 A;  2IOL A;  3PZD A;  4LER A;  2IU1 A;  2PM7 A;  5G04 C;  2CHX A;  4DLQ A;  4EPZ A;  3NF1 A;  3CIA A;  3BG1 B;  4ILI A;  2X38 A;  3ZGQ A;  3HHM A;  4OVU A;  1HXI A;  2I1K A;  2WXJ A;  4MS6 A;  3FHE A;  2DBA A;  2Y4T A;  1EDU A;  3LY7 A;  1FVH A;  3I4G A;  4EZL A;  3FWV A;  3IHV A;  4Q69 A;  4JHK A;  4ACK A;  2WQ7 A;  4CRW A;  2FUL A;  1SZ9 A;  3IKO B;  4NRH B;  5ANR A;  3KAE A;  3BG0 B;  1HO8 A;  3CVN A;  2I2O A;  2QY7 A;  3O48 A;  2IFU A;  4QFV A;  3D3M A;  4BWR A;  4DLO A;  2HM8 A;  2Y3A A;  4G26 A;  5FQ6 A;  3RRM B;  5LP0 A;  4N3A A;  2C2L A;  3RKV A;  3SNX A;  4PS8 A;  5A6C A;  2X6F A;  4HXI A;  2A5U A;  3FEX A;  3FH5 A;  3S7B A;  3IV0 A;  4APF A;  2PQN A;  2OVF A;  4I43 A;  3FTV A;  3ZYL A;  1NZN A;  2VSY A;  3D9O A;  3LS8 A;  4HOQ A;  4G24 A;  3TG5 A;  4KZC A;  4XI9 A;  2J4B A;  3FY4 A;  2VGX B;  4L2Y A;  4O6F A;  3VLE A;  3PDN A;  4A1S A;  1H6K A;  1FCH A;  5BT1 A;  3CHM A;  3FUK A;  3CKC A;  3I3N A;  3CVQ A;  4CDR A;  2V0P A;  2I1J A;  3U4T A;  1UN9 A;  2XRY A;  4GML A;  5FQ7 A;  4L2L A;  1PAQ A;  4MKT A;  4A1G A;  4I17 A;  4GZ3 A;  4TV3 A;  3B7R L;  3QOU A;  5AJD A;  5E76 A;  4AM9 A;  3CGH A;  4WWP A;  4BY6 A;  1E7U A;  3MKR A;  3LCA A;  3LDZ A;  3MKQ B;  3RRN B;  3UX4 A;  3CLJ A;  4JHR A;  5BV1 A;  3JQ1 A;  2VGX A;  1B89 A;  1UJJ A;  2WXI A;  5DIZ A;  2L9B A;  2XRZ A;  3VTX A;  2LO6 A;  1OWP A;  3IBE A;  4XI0 A;  1VDY A;  2X6J A;  3GW4 A;  4I9C A;  4XKC A;  1HU3 A;  3TL5 A;  3ESK A;  2LAH A;  4BFR A;  4F3V A;  1Z6T A;  4JC8 A;  5J90 A;  3T8M A;  3CVU A;  4RSY A;  2IQC A;  5JHA A;  4FAD A;  3RK6 A;  2EQX A;  5FWQ A;  4AP2 A;  5D0Q D;  4KVM A;  5CMY A;  1PY1 A;  4JXT A;  3FFL A;  4H7Y A;  3U9W A;  3APC A;  3HIZ A;  4UI9 J;  3CVW A;  3MKQ A;  5M72 A;  3ESL A;  4I2Z A;  2WXQ A;  4KT6 B;  4MRU A;  3SD5 A;  4YND A;  3D9M A;  3D9N A;  4K03 A;  4JEH A;  5T3R A;  3LY8 A;  1UW4 B;  2ILR A;  3G2V A;  3MCX A;  2FEZ A;  4PUC A;  5D0O D;  4UWK A;  2X6H A;  3R7R A;  4JW1 A;  4UQX A;  5ARF A;  5T4Y A;  5HQ8 A;  2YHC A;  4AIF A;  2WXH A;  2RG8 A;  3AS8 A;  1XNF A;  4GYY A;  3TGO A;  1WM5 A;  2WXP A;  4GCO A;  4I6G A;  2DCP A;  1DVP A;  3B7T A;  3PNL B;  5AJL A;  3RU0 A;  3L6A A;  3CHQ A;  2CG2 A;  3ZFW A;  3FP3 A;  3QAQ A;  3FUI A;  2NXP A;  1HE8 A;  1E8Y A;  4JEU A;  4J6I A;  3VLD A;  2PM6 A;  3LXU X;  3B7S A;  3CHR A;  2NC9 A;  4RG6 A;  5G2N A;  4IN3 B;  5T8I A;  4D10 C;  4IYP A;  2VJ8 A;  3EJN A;  3G2T A;  3QWP A;  4U63 A;  3UT8 A;  1E96 B;  4BX9 A;  4CT0 A;  3SF4 A;  3CQC B;  1E7V A;  3K9I A;  4IUL A;  3CVY A;  1JWF A;  1DNP A;  4CCA A;  2Y4U A;  1NP7 A;  3TAX A;  4BT9 A;  2WM9 A;  3ASH A;  5J08 A;  5FQ8 A;  2E0I A;  2XCB A;  5BW8 C;  3ZYK A;  3UPV A;  5EX3 A;  3FU5 A;  3RO2 A;  2CFZ A;  2WMN A;  3EHN A;  3UT7 A;  3DPD A;  3FH7 A;  4J8S A;  5A23 A;  5LCW J;  1FVF A;  1MHQ A;  2J07 A;  2PZI A;  2V8S E;  3QJZ A;  4IRU A;  3PEU B;  4J8D A;  4JHJ A;  2IOS A;  2VTB B;  1N52 A;  5G05 C;  4UWG A;  3ONK A;  4HOR A;  3D9J A;  5DBK A;  2JEK A;  3HDX A;  1E8Z A;  3N71 A;  1SZA A;  3ZEF A;  5A7D B;  5E75 A;  1OWM A;  3TXM A;  3FTY A;  4PS3 A;  5G55 A;  4B8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...