4DI3A

Crystal structure of a 2:1 complex of treponema pallidum tatp(t) (tp0957) bound to tatt (tp0956)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
273
structure length
273
Chain Sequence
DADFTRVFTEEDDLDLVAQSLPLVLKVYEALHLQNPAHRGLSLAVGRLYIMYANAFVQTPAQYLPEDEFEAQNEAYSRARKLYLRGARYALSSLETAYPGFTREVFSGDEQRLHKVLSRCTRVDVGTLYWVGTGYVAAFALTPLGSALPDTVHAAVMMLERACDLWPSYQEGAVWNVLTKFYAAAPESFGGGMEKAHTAFEHLTRYCSAHDPDHHITYADALCIPLNNRAGFDEALDRALAIDPESVPHNKLLVILSQKRARWLKAHVQDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TatP(T) (Tp0957)
publication title Structural and Thermodynamic Characterization of the Interaction between Two Periplasmic Treponema pallidum Lipoproteins that are Components of a TPR-Protein-Associated TRAP Transporter (TPAT).
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum
molecule tags Transport protein
total genus 110
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16811 TAtT TRAP transporter T-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.920 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4di3A00
3U64A 4DI3A 4DI4A
chains in the Genus database with same CATH superfamily
3NF1A 3UKUG 1HXIA 3EHQA 4CZ2D 3I5PA 4HI9A 1MJ0A 2J07A 3FTXA 4NRHB 1YMPA 1NZNA 1S64A 4FJZA 4WWOA 3C98A 3PEVB 2RFMA 5FZQA 2I6HA 3KSLA 4YVOA 3L54A 3FU6A 3FU3A 5LFAA 3MEKA 4HOTA 4J8FA 5LCWC 5B1AE 3MZLB 5DIZA 5JJ6A 4J8EA 3L6AA 1Z3XA 3FH5A 5G2NA 4GZDA 2WXNA 2RG8A 4RG6A 4B89A 1OXJA 4CDRA 3AS5A 3GYZA 2I9CA 2PNNA 3HHMA 3ZU7B 2CHWA 3HVEA 4ILHB 1N9AA 1N4PA 4DI3A 3OTNA 2FEZA 4FLBA 5FQ4A 3CVXA 3CSTA 4A3VA 3DRAA 5E75A 3LS8A 4CGWA 5EIDA 3G2UA 1BI7B 4GMRA 1QNFA 3CHOA 3Q9NC 4GTRA 4DX2A 2AXUA 2XGOA 3L82A 4K5CA 4JZYA 3VTYA 1K3ZD 3HYMB 4A1GA 3Q9UC 3IXEA 5H7PA 4HI8A 4C0EA 4XKBA 4A1SA 5EYLA 4N3BA 3AS4A 1H6KA 4CRWA 2UY1B 2DYRE 4Y6WA 4DLOA 4U8VD 5BT1A 4JXTA 3HXFA 3RU0A 4PH4B 4IULA 4AIFA 1O1RA 2LUHA 1E8ZA 3AS8A 5CECB 4EQFA 1IHGA 4UUCA 5JJTA 1MHQA 4KVOA 1K1BA 3CHRA 3W9FA 5EX0A 2XGSA 4UWKA 2WVIA 1O1SA 4ABNA 1OWLA 3BUAA 2XS8A 3LY8A 3ZKJA 2EIKE 2RKKA 1HX8A 4GU5A 3E37A 1RW2A 3U4TA 1XNFA 3PUKA 2ZGDA 3RK6A 3ZGQA 3DSSA 5D2MC 2GRMA 3ASOE 4NURA 2HM8A 1EF1C 2X38A 4AM9A 3HG0D 1KT0A 3CHQA 2WXMA 3FTVA 5ENOD 3F6QA 3R9AB 3LEWA 3HXEA 4F7AA 4DK5A 3E34A 4PS7A 3R9MA 3RRMB 4YDYA 3FUIA 3Q15A 3MJWA 5G05J 4CEMA 1QYMA 2J9QA 2GGFA 3ZYLA 4EPZA 1SZAA 4UI9J 3UM1A 1NA3A 3D9LA 4WNFA 3C3QA 3ZYMA 1UG3A 1U3DA 2X6IA 3EHNA 4EZKA 1OT8A 3TJPA 1N95A 2VGXA 4Q94A 4G8KA 3SZ7A 5EN5D 3G2WA 3NQPA 3SQVA 4FJYA 2PM6A 4I9EA 3TAXA 3TWRA 4KMOA 4FADA 3IBEA 5KJMA 3FEYA 3UKRG 4BETA 4NACA 4RLYA 3Q49B 4TUMA 3UT8A 3LPZA 4ACLA 1UN9A 3EIQC 1TJFA 2KBXA 3P1UA 2DZOA 4XIFA 1TNOA 4E6HA 5CBNA 2ZU6B 2I1KA 1IQUA 4M7CA 3GZ1A 3ZN3A 4AEZC 2L0IA 4C9BB 3QC1A 4YDWA 3UMVA 4BERA 3QKYA 1JPLA 5FZSA 4K5AB 2VTBB 4D10C 2R5SA 5C1DA 1E90A 2X3MA 3CVPA 3ENEA 3JXIA 3FTYA 3S7BA 3LXUX 3FUHA 1ELRA 3U66A 3NAWA 4L23A 4JD2G 3FTSA 3T8KA 3D9KA 5G05C 3B7SA 5CEDB 2NSZA 4H7YA 4EBAA 3DXKG 4GZ6A 3PEUB 1HF8A 3RKVA 1UJJA 3QNKA 3ASHA 1TN6A 5CMWA 3ONLA 2YNQA 2ILRA 2WXPA 2LSUA 5KJKA 3SFZA 3S2AA 1WG0A 3O48A 1MQSA 3QOUA 2NYJA 3QK0A 3PE3A 2RD0A 3PH0C 2A4ZA 3CLJA 5DBKA 2GW1A 2EILE 1PAQA 1OWOA 4Y6CA 3V30A 4GZ5A 3HIZA 2CG2A 5AQAA 3UT4A 3QB2A 4EBAG 1U3CA 3FFLA 1N4RA 2Y1LE 4ILIA 4URKA 1EYHA 2CG3A 2X6KA 4G24A 1JUQA 2WPVA 4HOQA 4FULA 2H6GA 3LJNA 2IONA 3SBTB 5LOZA 1IQRA 3EU5A 3TWTA 4DUIA 3CVVA 4BTAA 1E8XA 1NP7A 3CK8A 3E32A 3HXCA 2V4HC 2VGEA 5T4YA 4LUNU 2X6FA 5EDSA 4N3CA 5ENTD 3TXNA 4I6GA 3ML9A 5FINA 1KPSB 2XEEA 3SHFA 2QYUA 2WXKA 1O1TA 3UI2A 3ZYKA 3CVYA 2IO3C 1N0RA 4A63B 4X8QA 2R2LA 3TGOA 3FU5A 1L5JA 2UWJG 3D9OA 4GZ3A 5LCWJ 3N71A 3ABLE 4JEUA 3SBSA 4U0SA 5CRUA 3VLFA 1EDUA 1Y6IA 4G2VA 4YVQC 1QBQA 3KD7A 4U8YD 4C0MA 5LX8A 1D8DA 2IF4A 2Y4UA 3PRZA 4GA0A 1BLXB 2WMOA 3I3NA 1GW6A 3C5RA 3FHEA 2ZISA 2XEVA 3URZA 3G2TA 3L17A 4RVBA 3SF4A 1X5BA 4N2QA 2AVPA 1RZ4A 4JHRA 4LNBA 2OEVA 1S70B 3ESKA 3V2OA 4V3IA 3SI5A 5BNWA 4I6EA 2QC9A 2VSXE 3RRUA 2KCVA 3FUFA 3QWWA 2JABA 3K9IA 5FJYA 3JUEA 2GRLA 3PZ4A 4KVMA 1LTXA 3PZ3A 4YNDA 1WY6A 3ZPJA 3R7RA 1G3NB 3ZRHA 1LF8A 4WNEA 3TG5A 3FUEA 3DEOA 4GA2A 4G26A 2RFAA 4O6FA 4M3OA 4EZLA 3CSFA 2CHZA 3BEEA 5ENPD 3ULQA 3B7TA 3U64A 1V55E 3TL5A 3CGHA 3T5VA 2WXFA 4U0ZA 2IJGX 2DVWA 3E33A 4JA9A 5BXUA 1NA0A 2F0YA 4I17A 2DYSE 3PZDA 2FF4A 1HFAA 3ZEFA 2I2OA 3B7RL 4JB8P 3ZW3A 3RRNB 4DPRA 2M63A 3L08A 4F53A 4ZHBA 1IYGA 5CCLA 2WM9A 1UJKA 4NQ0A 4TXPA 4K5BA 3RAUA 4MS6A 1S63A 4DI4A 5AENA 3CEQA 2WB2A 3LY7A 4F3VA 3NOGD 5AIJA 2VQ2A 2YHEA 3IV0A 2P9SG 2QZAA 3SGHA 1NI1A 3WG7E 3V2XA 4BSXA 1FT2A 2IY0C 2OVBA 3GW4A 4U7EB 4MBGA 5CMYA 2V5FA 3T9KA 2J4DA 4GCNA 3MGBA 5CEAA 2F8XK 2WXHA 4Z68A 3BG1B 1SW6A 3Q75A 2IO2C 3JXJA 3RJVA 4N3AA 3Q7AA 3ZHEB 1TN8A 3TWXA 3Q4AB 1H2TC 5B1BE 4BTBA 3Q78A 4K03A 3NB2A 3DSXA 4I1AA 3LVRE 1E7UA 4XZ4A 3SNXA 3RIBA 2P9UG 1DCQA 5ENQD 4GTTA 4LNUD 5FWQA 4BESA 1Q2ZA 3B13A 3ZXSA 2LNIA 4GMJA 2AWIA 3TXMA 2BKKB 4LERA 3S7JA 2XCCA 3NZSA 1D9SA 4DX6D 3AAAC 4LRZA 3KEZA 4A3TA 4BY6A 4UWHA 2BTDA 2CFZA 2VTBA 3VLDA 5FTPA 3PDNA 3Q7FA 3QJZA 3NBNB 4J6IA 2PQRA 3PVLA 4FLHA 4U63A 2JEKA 1IKND 3ZYQA 4ANXA 3ML8A 2R03A 1SVXA 3JQ1A 1TNZA 2WXQA 4B8CB 2H6FA 1N0QA 4L7TA 1FCHA 3UX4A 3L16A 2QFCA 4GYWA 3PS6A 5KJLA 2BF0X 4XEIG 3JQ0A 2XHEA 3GZSA 4WUYA 1B89A 3UUXA 1OCRE 4ILGA 3DPDA 1N4QA 1TEZA 1INZA 4LSZE 3TWSA 1HG5A 1TN7A 3QARA 4CYMD 5KNGA 3ZXPA 1WAO1 1OWNA 3CHSA 4IRUA 3UINC 4BT9A 5FIOA 4G11A 2I1JA 2XQ0A 5ANLA 1FT1A 4UQZA 4GA1A 2KATA 1TNYA 4I9CA 3CVLA 5BW8C 4OVVA 3UM3A 4J0UA 3ABKE 5JA4D 2V8SE 3EU9A 2X6HA 3D9HA 2HO1A 5BUZA 5ENSD 4GTPA 3RO2A 3FTZA 3CQGB 4QFVA 4JVSA 2KXPC 4L2YA 5AJLA 2A5EA 2XZDG 1QQEA 4AY6A 3CVQA 3TWUA 2V5QC 1LD7A 4DLQA 4HORA 2FO7A 4APOA 3ASNE 3FUNA 2XRYA 3UT7A 3DBSA 3UIOC 5IY5E 2VGYA 4U07A 4UI9K 2PM7A 2OOEA 3FULA 2L6JA 3V31A 4Q69A 1K8KG 3CVNA 2Y4TA 5KCMA 1A17A 4HNAD 2LXLA 4LEUA 1H6OA 2J09A 3FTUA 3JYSA 3EJNA 1BD8A 3Q47B 3FEXA 4N2SA 2ZIRA 3SFXA 4PS3A 1MX6A 2YQ8A 5BV0A 3S7DA 3ESLA 5CHEE 2J08A 1MZCA 4WNDA 3U9WA 2QY7A 4GTMA 1DVPA 3G2SA 3AG2E 3ABME 2KCKA 3APFA 1TYQG 4CT4A 3RSEG 4GCOA 3DSUA 2P58C 2C0MA 4HVBA 3ULYA 2XEHA 4Q96A 4HRLA 4FA6A 4OYSA 4G23A 5ANRA 5JHAA 2DZNA 3D9IA 2JLBA 3PUJA 4IN3B 1E96B 5ITZF 2WXIA 4MRUA 2R02A 4TXQA 5AAOA 1JCSA 2FO1E 3AU5A 5JHBA 1YA0A 3J5QB 2FULA 1X81A 3SFYA 4FHJA 4XI0A 2XS1A 4P29A 4F1PA 5KJNA 1A5EA 1NFIE 3HXBA 3VTXA 4HFGA 1UW4B 4ME2A 2E2EA 1P5QA 3UPVA 3CVWA 3UQ3A 2GROB 2IQCA 4H7XA 1SA5A 2L0TB 5C2YA 3FU0A 5D66A 2H6HA 1H6PA 4RG9A 1OCCE 3BQOA 4KYOB 4ACKA 3APCA 3Q73A 3E4BA 2NXPA 4EHMA 4N5CA 4GTOA 3TG4A 3PZ2A 4I2WA 3CV0A 2HE0A 2P9PG 2YHCA 4GPMA 1FVHA 3KEAA 2IFUA 3UIPC 4NIKA 5EKQD 1IHBA 1HS6A 1EPUA 2VYIA 2B6CA 1E7VA 4G25A 2C0LA 1FVFA 4EZJA 5AARA 3KAEA 4MKTA 2YINA 2GRNB 4PS8A 3MA5A 1TR4A 1BI8B 1H2VC 3DPYA 3QWVA 1HO8A 2B0OE 2OVFA 1HZ4A 3D9PA 3OAWA 3IEGA 1S0PA 3IHVA 3UXGA 2OEWA 3C3OA 3APDA 5CERB 4I1OB 2AXZA 3B7UX 1AP7A 4OAVB 1HU3A 3IKOB 3ZHEA 5JJ7A 5J90A 2P9KG 1MYOA 2X6JA 4EECA 2F8YA 2L9BA 4PDXA 5AQ9A 2J8SD 4HOSA 1OUVA 1Z5SC 4B0ZA 1AWCB 3L13A 4QQIA 3EUVA 4JHJA 1YCSB 3ONKA 5AQ7A 2C2LA 4APFA 3AJIA 3HXDA 4HB5A 1ELWA 4XKCA 4FP7A 3MV3B 4CT0A 2EIJE 4KZ0A 2AJAA 3X2QE 4BSZB 3CQCB 4GMLA 1H2UA 4YDOA 4O1PA 5CBOA 3S7FA 3DSTA 1WDYA 3WXXA 5AQBA 3MX3A 3MKRA 3FUKA 4JPSA 4WNGA 2IEJA 3ASFA 4J8DA 4B8AA 2LAIA 3E30A 4HRNA 1NL4A 2XCBA 2QYJA 1JCRA 3LKUA 1ZU2A 4KBQA 4ATZD 3FUDA 1PC2A 3W9GA 4HLLA 4UQXA 5HS0A 4B93B 4K0RA 5G04C 1XGWA 4U96D 5ARFA 3GZ2A 4JW1A 1W3BA 3L22A 5A23A 4I43A 5EX3A 2Y3AA 3AG4E 4CDMA 3EHRA 5CCMA 3EHMA 4L9PA 2WQ6A 3FUJA 2J49A 5EYPF 1SQMA 2PL2A 4AP2A 1TJCA 1PY1A 5HKPA 4I2ZA 5BXOA 2EIME 4W9RA 3L9TA 4GAAA 5ARGA 4HBDA 2KC7A 1KT1A 4J8SA 4AOFA 3HDXA 1DCEA 3FWVA 2ETAA 5FQ6A 3NZUA 3I4RB 2GRRB 3CR3A 4DJAA 4ANVA 4U0UA 2OCCE 4ZFHA 1UOHA 2PQNA 2R05A 2WQ7A 2XPYA 4U95D 4BX8A 1SZ9A 3O4ZA 5M72A 1HE8A 2DWZA 3MKQA 4N5QA 5FQ8A 1LD8A 2AXVA 3LJ3A 2VSOE 5FZRA 4ATGA 2J4BA 4J8YA 4XX5A 1E8YA 4JEHA 2VSNA 2Q7FA 4E85A 3AG3E 4AVXA 4LNGA 2WMNA 4B94A 2LXMA 3DWLG 2CHXA 4DX1A 2L6BA 3C3RA 5CRVA 2LAHA 4TV3A 3ASDA 2MYOA 4PUCA 1IXVA 4FHKA 2Y0BG 2A5UA 2V4LA 1JWGA 5D0OD 1JWFA 4BFRA 3FP3A 3EIJA 2IOLA 3MYVA 4HLEA 3V79K 5ENRD 5D0QD 2VJ8A 4L1BA 4GPKA 4WWPA 4C48B 1O5MA 4CGVA 3U3WA 3T5XA 3HVEB 4DRXE 1TNUA 4AV7A 1OWPA 3TWVA 4GTVA 4CCAA 1HH8A 4IYPA 1N11A 5EILA 2EQXA 2LSVA 2MOWA 2Y69E 5HQ8A 1HG2A 3ULEG 3CKCA 2XRZA 2KZTA 3CKBA 2BUGA 3DXMG 4BEPA 4F1SA 2FI7A 2ZGGA 3FH8A 2P9NG 2E0IA 5KBAA 3FH7A 3D9JA 1ZB1A 1Z3YA 4CDNA 3KSQA 1N52A 2XENA 4OVUA 3JUIA 3UM0A 3QAQA 4JL0A 2AW6A 5J08A 4YDEA 3FTWA 3D9MA 2WXLA 2H6IA 3SY2A 3CHPA 2OV8A 3MKQB 4I1MA 4TRQA 5A7DB 3T8MA 5AYWD 1SA4A 4AY5A 3G2VA 4A55A 4KXKB 4OAUC 3AG1E 3ASGA 5AJDA 3CK7A 5E76A 5JMND 4G8LA 3LYAA 2GRPB 2BKGA 1Y8MA 1OCZE 5AN8A 5HI7A 3CVUA 4BWRA 3MV2B 2MRIA 3NOCD 4JHKA 4UWLA 4J7WA 3D9NA 2PZIA 2CFUA 4LCTA 2MHKA 4WAFA 5KNHD 4KT6B 3QDNA 4LG6A 4BT8A 1KZOA 4MLPA 3OXGA 3FDHA 5LP0A 2NC9A 5A6CA 4UI9C 1BPOA 2XGMA 4UWGA 1ZBPA 2IOSA 3LY9A 3CHMA 2EINE 3PNLB 4GTQA 3RO3A 3ZNGA 1TNBA 4JA7A 2F37A 2HYZA 3LVQE 4RSYA 3ZVVA 4HRMB 1ELKA 3PE4A 3TWQA 2P2CP 1QZ2A 2ETCA 5T3RA 2IU1A 3HRAA 4N39A 3Q79A 4GZCA 2DBAA 5BPPA 3PZ1A 4DX7D 4GYOA 1N4SA 3I4GA 3R7QA 1MX2A 5G55A 2KZTB 2ONDA 1VDYA 3B7BA 4U8HA 2WXOA 2VGXB 3Q5MA 4UWFA 3LDZA 4GTSA 3BU8A 1FPPA 2FBNA 3ZFWA 3OXFA 4WWNA 1H19A 2DIWA 3CK9A 4HOUA 3LCAA 1V54E 2KCLA 2XZTG 3CIAA 1BU9A 5BV1A 1WM5A 1Z6TA 4ANUA 2P9LG 4JC8A 4F6RD 3SD5A 3FUMA 3KS2A 3TWWA 4UQYA 3DSWA 4HS2A 4FC8A 3B95A 3JCKC 3P2BA 2V0PA 1N54A 3ISMC 4RQIA 2DCPA 2BEDA 4GB9A 3VLEA 4TUUA 1OCOE 3PREA 5FT9A 5ENNA 2P9IG 5T8IA 3UTMA 4TXRA 4U04A 4ANWA 1H0AA 2WXRA 4L2LA 2WQHA 3OXLA 4O60A 1N94A 3AU4A 1KLXA 2ETBA 4I6JA 3MCXA 1OWMA 2WXJA 3DSVA 5G04J 1D8EA 3C72A 4AJWA 4HQDA 4HXIA 2LO6A 3BG0B 3SO8A 1DC2A 1YYHA 2GRQB 3EDTB 3DEPA 4R7LA 2KM4A 4FU3A 1E8WA 1MX4A 3QWPA 3PNTB 3J5PA 5B3SE 3ZIMA 2UY1A 3FY4A 5HRYA 2R59A 5EIBE 4G1TA 1UN8A 5FQ7A 1DNPA 3ZUVB 1U2VG 2R17C 3D3MA 2XPIA 4KZCA 2XPZA 1K1AA 1OY3D 2VSYA 4XI9A 1KZPA 4BX9A 4AXHA 4XE0A 4O1OA 3IHYA 2WXGA 4GYYA 1JCQA 2ZXWE 5KWDA 4DX5D 3UM2A 2HR2A
chains in the Genus database with same CATH topology
3NF1A 4U07A 4ATGA 4UI9K 2PM7A 2OOEA 3FULA 1HXIA 2J4BA 3I5PA 2L6JA 4XX5A 3CVVA 4BTAA 1E8XA 1E8YA 1NP7A 2J07A 2VSNA 4JEHA 3CK8A 3FTXA 2Q7FA 4Q69A 4NRHB 4E85A 3CVNA 2Y4TA 5KCMA 1A17A 1NZNA 4AVXA 5T4YA 4FJZA 2WMNA 4B94A 4WWOA 3C98A 4LEUA 4LUNU 3PEVB 2J09A 2CHXA 2X6FA 3FTUA 5FZQA 5EDSA 4N3CA 3JYSA 3TXNA 3EJNA 3Q47B 2I6HA 4I6GA 3FEXA 4YVOA 2LAHA 3ML9A 3L54A 4TV3A 4N2SA 3FU6A 3ASDA 3FU3A 3SHFA 5LFAA 3MEKA 4HOTA 2WXKA 4PS3A 4J8FA 4PUCA 2YQ8A 3ZYKA 5LCWC 3MZLB 5DIZA 5JJ6A 4FHKA 4J8EA 3L6AA 3ESLA 3S7DA 1Z3XA 3FH5A 5G2NA 5BV0A 2A5UA 4GZDA 5CHEE 2J08A 3CVYA 2V4LA 2WXNA 2RG8A 4RG6A 4WNDA 4B89A 3TGOA 3U9WA 4CDRA 1JWGA 3FU5A 5D0OD 1JWFA 1L5JA 2QY7A 2UWJG 3AS5A 4BFRA 1DVPA 3D9OA 3FP3A 3G2SA 3GYZA 4GZ3A 3EIJA 5LCWJ 2IOLA 3N71A 2I9CA 3MYVA 3HHMA 4JEUA 3SBSA 2CHWA 4HLEA 3HVEA 4U0SA 3VLFA 4ILHB 2KCKA 1EDUA 5D0QD 3APFA 1Y6IA 2VJ8A 4G2VA 4YVQC 4L1BA 4CT4A 3KD7A 4C0MA 5LX8A 4GPKA 4GCOA 4DI3A 3OTNA 2FEZA 4FLBA 4WWPA 5FQ4A 3CVXA 2Y4UA 2IF4A 3CSTA 3PRZA 4GA0A 2P58C 2WMOA 3I3NA 4CGVA 1GW6A 3U3WA 3T5XA 3HVEB 2C0MA 4A3VA 3FHEA 4HVBA 4AV7A 1OWPA 5E75A 4Q96A 3LS8A 4CGWA 4FA6A 4CCAA 2XEVA 3URZA 1HH8A 3G2TA 4IYPA 3G2UA 2EQXA 3L17A 4RVBA 4OYSA 4G23A 5ANRA 3SF4A 5JHAA 2LSVA 1X5BA 2JLBA 3D9IA 3PUJA 1QNFA 3CHOA 2MOWA 5HQ8A 1HG2A 4IN3B 1E96B 4N2QA 2AVPA 2WXIA 2AXUA 3CKCA 2XRZA 4JHRA 2XGOA 3ESKA 4MRUA 4JZYA 2KZTA 4V3IA 3CKBA 3SI5A 2BUGA 3VTYA 5BNWA 4F1SA 3HYMB 2FI7A 4I6EA 3FH8A 4A1GA 2E0IA 3FH7A 3AU5A 4C0EA 4XKBA 4A1SA 5JHBA 2VSXE 1YA0A 3RRUA 3D9JA 2FULA 2KCVA 1Z3YA 3FUFA 4N3BA 4CDNA 1N52A 3QWWA 3AS4A 1H6KA 4FHJA 3K9IA 5FJYA 4CRWA 4XI0A 2UY1B 4OVUA 4DLOA 4P29A 4Y6WA 3JUIA 5KJNA 5BT1A 3VTXA 3QAQA 4JL0A 4JXTA 3RU0A 4PH4B 2AW6A 2GRLA 4IULA 5J08A 4KVMA 4HFGA 1UW4B 4YNDA 1WY6A 3FTWA 4AIFA 3ZPJA 3D9MA 4ME2A 3R7RA 1E8ZA 2WXLA 2E2EA 3AS8A 3ZRHA 1LF8A 4EQFA 1P5QA 1IHGA 4WNEA 3TG5A 3FUEA 5JJTA 4GA2A 1MHQA 3UPVA 4KVOA 3CVWA 4G26A 4O6FA 3UQ3A 2IQCA 3CHPA 3CHRA 4H7XA 4M3OA 5EX0A 4EZLA 2XGSA 4UWKA 2WVIA 2OV8A 3CSFA 2L0TB 3MKQB 5C2YA 4I1MA 3FU0A 2CHZA 4TRQA 3BEEA 5A7DB 3T8MA 5AYWD 4ABNA 3ULQA 3B7TA 4RG9A 1OWLA 3U64A 4KYOB 4AY5A 3G2VA 3LY8A 4KXKB 4ACKA 4A55A 3TL5A 3APCA 3E4BA 2NXPA 3CGHA 3ASGA 3T5VA 2WXFA 4U0ZA 1HX8A 2IJGX 4JA9A 1NA0A 4GU5A 3CK7A 4N5CA 5AJDA 3TG4A 4I2WA 3CV0A 4I17A 3U4TA 3PZDA 1XNFA 2YHCA 1FVHA 3PUKA 5E76A 2FF4A 2IFUA 3LYAA 3RK6A 1HFAA 3ZEFA 2I2OA 3B7RL 1Y8MA 5EKQD 3ZGQA 3ZW3A 3RRNB 5HI7A 4DPRA 3CVUA 2M63A 3L08A 4BWRA 1HS6A 3MV2B 1EPUA 2VYIA 2GRMA 2MRIA 4NURA 4JHKA 4F53A 1IYGA 2HM8A 1EF1C 2X38A 4UWLA 5CCLA 4AM9A 3D9NA 2WM9A 1E7VA 1UJKA 1KT0A 2CFUA 2PZIA 3CHQA 4G25A 2C0LA 4NQ0A 4LCTA 1FVFA 2MHKA 2WXMA 4WAFA 3FTVA 4EZJA 3R9AB 4MS6A 4KT6B 3QDNA 3KAEA 4DI4A 3LEWA 4MKTA 5AENA 2YINA 4BT8A 3CEQA 2WB2A 4F7AA 3LY7A 4F3VA 4PS8A 3MA5A 4MLPA 4DK5A 3OXGA 3FDHA 5LP0A 1H2VC 2NC9A 5AIJA 5A6CA 2VQ2A 4PS7A 4UI9C 3QWVA 2YHEA 1BPOA 3IV0A 2XGMA 4UWGA 3RRMB 1ZBPA 3SGHA 2IOSA 3LY9A 3CHMA 4BSXA 1HO8A 3FUIA 2OVFA 1HZ4A 3D9PA 2OVBA 3GW4A 3IEGA 3OAWA 3MJWA 2V5FA 1S0PA 3Q15A 3PNLB 3IHVA 5CMYA 2J4DA 5G05J 3RO3A 4CEMA 2J9QA 4GCNA 2GGFA 3APDA 3ZYLA 3MGBA 4EPZA 1SZAA 4UI9J 4I1OB 4JA7A 2AXZA 2HYZA 2WXHA 3B7UX 3LVQE 3BG1B 4RSYA 3ZVVA 1NA3A 1ELKA 3D9LA 4WNFA 3PE4A 1HU3A 3IKOB 3ZHEA 5JJ7A 5J90A 2X6JA 3ZYMA 1UG3A 4EECA 1U3DA 2X6IA 2L9BA 1QZ2A 4PDXA 3EHNA 4EZKA 5T3RA 2IU1A 3TJPA 4N39A 4GZCA 2VGXA 2DBAA 3RJVA 4HOSA 5BPPA 4N3AA 4Q94A 3ZHEB 3SZ7A 4GYOA 1OUVA 3G2WA 3I4GA 3R7QA 4B0ZA 3NQPA 3L13A 3Q4AB 5G55A 1H2TC 2KZTB 4BTBA 4FJYA 2ONDA 1VDYA 4K03A 2PM6A 4I9EA 4U8HA 4I1AA 2WXOA 4JHJA 2VGXB 3TAXA 3Q5MA 4KMOA 4UWFA 3LVRE 3ONKA 3LDZA 1E7UA 4XZ4A 4FADA 2C2LA 4APFA 3IBEA 2FBNA 3ZFWA 5KJMA 3OXFA 4WWNA 1H19A 2DIWA 3CK9A 3RIBA 4HOUA 3SNXA 3FEYA 3LCAA 2KCLA 1ELWA 4XKCA 5FWQA 4NACA 3Q49B 4FP7A 3B13A 3MV3B 3ZXSA 4CT0A 3UT8A 2LNIA 3LPZA 2AWIA 4GMJA 4KZ0A 3TXMA 4ACLA 1UN9A 4LERA 3EIQC 1TJFA 3CIAA 3S7JA 2XCCA 3NZSA 3P1UA 5BV1A 3CQCB 4LRZA 3KEZA 4GMLA 4XIFA 4A3TA 4BY6A 1H2UA 1WM5A 4UWHA 1Z6TA 4E6HA 2BTDA 4ANUA 2CFZA 2ZU6B 3S7FA 2VTBA 3VLDA 4JC8A 5FTPA 3PDNA 3SD5A 2I1KA 3FUMA 1IQUA 3QJZA 3GZ1A 4J6IA 3ZN3A 4AEZC 3WXXA 2L0IA 2PQRA 3KS2A 4C9BB 3QC1A 3PVLA 3UMVA 3QKYA 4FLHA 4U63A 3MX3A 3MKRA 3FUKA 1JPLA 2JEKA 4UQYA 4JPSA 3ZYQA 5FZSA 4WNGA 4ANXA 3ML8A 3ASFA 4HS2A 4J8DA 2VTBB 4FC8A 4D10C 3JCKC 3P2BA 4B8AA 2R5SA 2V0PA 2LAIA 3JQ1A 5C1DA 1N54A 2WXQA 4B8CB 2DCPA 4L7TA 1FCHA 1E90A 4GB9A 3UX4A 2X3MA 4TUUA 3PREA 2XCBA 3L16A 5FT9A 3VLEA 3CVPA 3ENEA 2QFCA 4GYWA 3PS6A 5ENNA 5KJLA 2BF0X 3FTYA 3LKUA 5T8IA 1ZU2A 3LXUX 3FUHA 3S7BA 1ELRA 3JQ0A 3U66A 4KBQA 2XHEA 4L23A 3GZSA 3FTSA 4U04A 3FUDA 3D9KA 4WUYA 3B7SA 5G05C 1PC2A 1B89A 4UQXA 3UUXA 2NSZA 4K0RA 4ANWA 4H7YA 1H0AA 2WXRA 5G04C 1XGWA 4ILGA 5ARFA 4EBAA 4GZ6A 4L2LA 2WQHA 3PEUB 3DPDA 3OXLA 3GZ2A 1HF8A 4JW1A 3AU4A 1TEZA 1W3BA 3RKVA 1KLXA 3L22A 1INZA 5A23A 1UJJA 3QNKA 4I6JA 3ASHA 3MCXA 4I43A 1HG5A 2Y3AA 5EX3A 1OWMA 5CMWA 4CDMA 3ONLA 2WXJA 3QARA 5CCMA 3EHMA 1WAO1 2WQ6A 2YNQA 5G04J 2ILRA 3FUJA 2WXPA 1OWNA 2J49A 3CHSA 4IRUA 4AJWA 4BT9A 4HXIA 4G11A 2I1JA 2LSUA 2XQ0A 5ANLA 5KJKA 4UQZA 2LO6A 4GA1A 3SFZA 1SQMA 3BG0B 3S2AA 2PL2A 4AP2A 1TJCA 2KATA 4I9CA 1PY1A 3CVLA 5BW8C 3EDTB 3O48A 4OVVA 4R7LA 4I2ZA 1MQSA 2KM4A 4FU3A 4J0UA 3QOUA 4W9RA 1E8WA 3QWPA 3QK0A 3PNTB 3PE3A 4GAAA 5ARGA 2KC7A 1KT1A 4J8SA 4AOFA 2RD0A 3PH0C 3ZIMA 2A4ZA 2V8SE 3CLJA 5DBKA 2X6HA 2GW1A 3HDXA 2UY1A 3FY4A 1PAQA 2R59A 1OWOA 3FWVA 4Y6CA 2HO1A 4G1TA 1UN8A 5FQ7A 5BUZA 5FQ6A 1DNPA 4GZ5A 3HIZA 2R17C 3D3MA 3I4RB 2CG2A 3NZUA 3RO2A 3CR3A 4DJAA 3FTZA 3UT4A 4ANVA 4U0UA 3QB2A 3CQGB 4QFVA 4JVSA 2PQNA 4EBAG 2WQ7A 1U3CA 3FFLA 2XPIA 4KZCA 4L2YA 5AJLA 4URKA 4ILIA 1EYHA 2XPYA 1QQEA 4AY6A 4BX8A 2CG3A 2XPZA 1SZ9A 2X6KA 3CVQA 2VSYA 4G24A 3O4ZA 5M72A 1HE8A 1JUQA 4XI9A 3MKQA 4BX9A 4AXHA 4DLQA 5FQ8A 4HORA 4XE0A 2AXVA 2FO7A 4APOA 2WPVA 3IHYA 2WXGA 3LJ3A 4HOQA 3FUNA 4FULA 4GYYA 2IONA 2VSOE 2XRYA 3UT7A 3SBTB 3DBSA 5LOZA 1IQRA 5FZRA 2VGYA 2HR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U64 A;  4DI3 A;  4DI4 A; 
#chains in the Genus database with same CATH topology
 3NF1 A;  3UKU G;  1HXI A;  3EHQ A;  4CZ2 D;  3I5P A;  4HI9 A;  1MJ0 A;  2J07 A;  3FTX A;  4NRH B;  1YMP A;  1NZN A;  1S64 A;  4FJZ A;  4WWO A;  3C98 A;  3PEV B;  2RFM A;  5FZQ A;  2I6H A;  3KSL A;  4YVO A;  3L54 A;  3FU6 A;  3FU3 A;  5LFA A;  3MEK A;  4HOT A;  4J8F A;  5LCW C;  5B1A E;  3MZL B;  5DIZ A;  5JJ6 A;  4J8E A;  3L6A A;  1Z3X A;  3FH5 A;  5G2N A;  4GZD A;  2WXN A;  2RG8 A;  4RG6 A;  4B89 A;  1OXJ A;  4CDR A;  3AS5 A;  3GYZ A;  2I9C A;  2PNN A;  3HHM A;  3ZU7 B;  2CHW A;  3HVE A;  4ILH B;  1N9A A;  1N4P A;  4DI3 A;  3OTN A;  2FEZ A;  4FLB A;  5FQ4 A;  3CVX A;  3CST A;  4A3V A;  3DRA A;  5E75 A;  3LS8 A;  4CGW A;  5EID A;  3G2U A;  1BI7 B;  4GMR A;  1QNF A;  3CHO A;  3Q9N C;  4GTR A;  4DX2 A;  2AXU A;  2XGO A;  3L82 A;  4K5C A;  4JZY A;  3VTY A;  1K3Z D;  3HYM B;  4A1G A;  3Q9U C;  3IXE A;  5H7P A;  4HI8 A;  4C0E A;  4XKB A;  4A1S A;  5EYL A;  4N3B A;  3AS4 A;  1H6K A;  4CRW A;  2UY1 B;  2DYR E;  4Y6W A;  4DLO A;  4U8V D;  5BT1 A;  4JXT A;  3HXF A;  3RU0 A;  4PH4 B;  4IUL A;  4AIF A;  1O1R A;  2LUH A;  1E8Z A;  3AS8 A;  5CEC B;  4EQF A;  1IHG A;  4UUC A;  5JJT A;  1MHQ A;  4KVO A;  1K1B A;  3CHR A;  3W9F A;  5EX0 A;  2XGS A;  4UWK A;  2WVI A;  1O1S A;  4ABN A;  1OWL A;  3BUA A;  2XS8 A;  3LY8 A;  3ZKJ A;  2EIK E;  2RKK A;  1HX8 A;  4GU5 A;  3E37 A;  1RW2 A;  3U4T A;  1XNF A;  3PUK A;  2ZGD A;  3RK6 A;  3ZGQ A;  3DSS A;  5D2M C;  2GRM A;  3ASO E;  4NUR A;  2HM8 A;  1EF1 C;  2X38 A;  4AM9 A;  3HG0 D;  1KT0 A;  3CHQ A;  2WXM A;  3FTV A;  5ENO D;  3F6Q A;  3R9A B;  3LEW A;  3HXE A;  4F7A A;  4DK5 A;  3E34 A;  4PS7 A;  3R9M A;  3RRM B;  4YDY A;  3FUI A;  3Q15 A;  3MJW A;  5G05 J;  4CEM A;  1QYM A;  2J9Q A;  2GGF A;  3ZYL A;  4EPZ A;  1SZA A;  4UI9 J;  3UM1 A;  1NA3 A;  3D9L A;  4WNF A;  3C3Q A;  3ZYM A;  1UG3 A;  1U3D A;  2X6I A;  3EHN A;  4EZK A;  1OT8 A;  3TJP A;  1N95 A;  2VGX A;  4Q94 A;  4G8K A;  3SZ7 A;  5EN5 D;  3G2W A;  3NQP A;  3SQV A;  4FJY A;  2PM6 A;  4I9E A;  3TAX A;  3TWR A;  4KMO A;  4FAD A;  3IBE A;  5KJM A;  3FEY A;  3UKR G;  4BET A;  4NAC A;  4RLY A;  3Q49 B;  4TUM A;  3UT8 A;  3LPZ A;  4ACL A;  1UN9 A;  3EIQ C;  1TJF A;  2KBX A;  3P1U A;  2DZO A;  4XIF A;  1TNO A;  4E6H A;  5CBN A;  2ZU6 B;  2I1K A;  1IQU A;  4M7C A;  3GZ1 A;  3ZN3 A;  4AEZ C;  2L0I A;  4C9B B;  3QC1 A;  4YDW A;  3UMV A;  4BER A;  3QKY A;  1JPL A;  5FZS A;  4K5A B;  2VTB B;  4D10 C;  2R5S A;  5C1D A;  1E90 A;  2X3M A;  3CVP A;  3ENE A;  3JXI A;  3FTY A;  3S7B A;  3LXU X;  3FUH A;  1ELR A;  3U66 A;  3NAW A;  4L23 A;  4JD2 G;  3FTS A;  3T8K A;  3D9K A;  5G05 C;  3B7S A;  5CED B;  2NSZ A;  4H7Y A;  4EBA A;  3DXK G;  4GZ6 A;  3PEU B;  1HF8 A;  3RKV A;  1UJJ A;  3QNK A;  3ASH A;  1TN6 A;  5CMW A;  3ONL A;  2YNQ A;  2ILR A;  2WXP A;  2LSU A;  5KJK A;  3SFZ A;  3S2A A;  1WG0 A;  3O48 A;  1MQS A;  3QOU A;  2NYJ A;  3QK0 A;  3PE3 A;  2RD0 A;  3PH0 C;  2A4Z A;  3CLJ A;  5DBK A;  2GW1 A;  2EIL E;  1PAQ A;  1OWO A;  4Y6C A;  3V30 A;  4GZ5 A;  3HIZ A;  2CG2 A;  5AQA A;  3UT4 A;  3QB2 A;  4EBA G;  1U3C A;  3FFL A;  1N4R A;  2Y1L E;  4ILI A;  4URK A;  1EYH A;  2CG3 A;  2X6K A;  4G24 A;  1JUQ A;  2WPV A;  4HOQ A;  4FUL A;  2H6G A;  3LJN A;  2ION A;  3SBT B;  5LOZ A;  1IQR A;  3EU5 A;  3TWT A;  4DUI A;  3CVV A;  4BTA A;  1E8X A;  1NP7 A;  3CK8 A;  3E32 A;  3HXC A;  2V4H C;  2VGE A;  5T4Y A;  4LUN U;  2X6F A;  5EDS A;  4N3C A;  5ENT D;  3TXN A;  4I6G A;  3ML9 A;  5FIN A;  1KPS B;  2XEE A;  3SHF A;  2QYU A;  2WXK A;  1O1T A;  3UI2 A;  3ZYK A;  3CVY A;  2IO3 C;  1N0R A;  4A63 B;  4X8Q A;  2R2L A;  3TGO A;  3FU5 A;  1L5J A;  2UWJ G;  3D9O A;  4GZ3 A;  5LCW J;  3N71 A;  3ABL E;  4JEU A;  3SBS A;  4U0S A;  5CRU A;  3VLF A;  1EDU A;  1Y6I A;  4G2V A;  4YVQ C;  1QBQ A;  3KD7 A;  4U8Y D;  4C0M A;  5LX8 A;  1D8D A;  2IF4 A;  2Y4U A;  3PRZ A;  4GA0 A;  1BLX B;  2WMO A;  3I3N A;  1GW6 A;  3C5R A;  3FHE A;  2ZIS A;  2XEV A;  3URZ A;  3G2T A;  3L17 A;  4RVB A;  3SF4 A;  1X5B A;  4N2Q A;  2AVP A;  1RZ4 A;  4JHR A;  4LNB A;  2OEV A;  1S70 B;  3ESK A;  3V2O A;  4V3I A;  3SI5 A;  5BNW A;  4I6E A;  2QC9 A;  2VSX E;  3RRU A;  2KCV A;  3FUF A;  3QWW A;  2JAB A;  3K9I A;  5FJY A;  3JUE A;  2GRL A;  3PZ4 A;  4KVM A;  1LTX A;  3PZ3 A;  4YND A;  1WY6 A;  3ZPJ A;  3R7R A;  1G3N B;  3ZRH A;  1LF8 A;  4WNE A;  3TG5 A;  3FUE A;  3DEO A;  4GA2 A;  4G26 A;  2RFA A;  4O6F A;  4M3O A;  4EZL A;  3CSF A;  2CHZ A;  3BEE A;  5ENP D;  3ULQ A;  3B7T A;  3U64 A;  1V55 E;  3TL5 A;  3CGH A;  3T5V A;  2WXF A;  4U0Z A;  2IJG X;  2DVW A;  3E33 A;  4JA9 A;  5BXU A;  1NA0 A;  2F0Y A;  4I17 A;  2DYS E;  3PZD A;  2FF4 A;  1HFA A;  3ZEF A;  2I2O A;  3B7R L;  4JB8 P;  3ZW3 A;  3RRN B;  4DPR A;  2M63 A;  3L08 A;  4F53 A;  4ZHB A;  1IYG A;  5CCL A;  2WM9 A;  1UJK A;  4NQ0 A;  4TXP A;  4K5B A;  3RAU A;  4MS6 A;  1S63 A;  4DI4 A;  5AEN A;  3CEQ A;  2WB2 A;  3LY7 A;  4F3V A;  3NOG D;  5AIJ A;  2VQ2 A;  2YHE A;  3IV0 A;  2P9S G;  2QZA A;  3SGH A;  1NI1 A;  3WG7 E;  3V2X A;  4BSX A;  1FT2 A;  2IY0 C;  2OVB A;  3GW4 A;  4U7E B;  4MBG A;  5CMY A;  2V5F A;  3T9K A;  2J4D A;  4GCN A;  3MGB A;  5CEA A;  2F8X K;  2WXH A;  4Z68 A;  3BG1 B;  1SW6 A;  3Q75 A;  2IO2 C;  3JXJ A;  3RJV A;  4N3A A;  3Q7A A;  3ZHE B;  1TN8 A;  3TWX A;  3Q4A B;  1H2T C;  5B1B E;  4BTB A;  3Q78 A;  4K03 A;  3NB2 A;  3DSX A;  4I1A A;  3LVR E;  1E7U A;  4XZ4 A;  3SNX A;  3RIB A;  2P9U G;  1DCQ A;  5ENQ D;  4GTT A;  4LNU D;  5FWQ A;  4BES A;  1Q2Z A;  3B13 A;  3ZXS A;  2LNI A;  4GMJ A;  2AWI A;  3TXM A;  2BKK B;  4LER A;  3S7J A;  2XCC A;  3NZS A;  1D9S A;  4DX6 D;  3AAA C;  4LRZ A;  3KEZ A;  4A3T A;  4BY6 A;  4UWH A;  2BTD A;  2CFZ A;  2VTB A;  3VLD A;  5FTP A;  3PDN A;  3Q7F A;  3QJZ A;  3NBN B;  4J6I A;  2PQR A;  3PVL A;  4FLH A;  4U63 A;  2JEK A;  1IKN D;  3ZYQ A;  4ANX A;  3ML8 A;  2R03 A;  1SVX A;  3JQ1 A;  1TNZ A;  2WXQ A;  4B8C B;  2H6F A;  1N0Q A;  4L7T A;  1FCH A;  3UX4 A;  3L16 A;  2QFC A;  4GYW A;  3PS6 A;  5KJL A;  2BF0 X;  4XEI G;  3JQ0 A;  2XHE A;  3GZS A;  4WUY A;  1B89 A;  3UUX A;  1OCR E;  4ILG A;  3DPD A;  1N4Q A;  1TEZ A;  1INZ A;  4LSZ E;  3TWS A;  1HG5 A;  1TN7 A;  3QAR A;  4CYM D;  5KNG A;  3ZXP A;  1WAO 1;  1OWN A;  3CHS A;  4IRU A;  3UIN C;  4BT9 A;  5FIO A;  4G11 A;  2I1J A;  2XQ0 A;  5ANL A;  1FT1 A;  4UQZ A;  4GA1 A;  2KAT A;  1TNY A;  4I9C A;  3CVL A;  5BW8 C;  4OVV A;  3UM3 A;  4J0U A;  3ABK E;  5JA4 D;  2V8S E;  3EU9 A;  2X6H A;  3D9H A;  2HO1 A;  5BUZ A;  5ENS D;  4GTP A;  3RO2 A;  3FTZ A;  3CQG B;  4QFV A;  4JVS A;  2KXP C;  4L2Y A;  5AJL A;  2A5E A;  2XZD G;  1QQE A;  4AY6 A;  3CVQ A;  3TWU A;  2V5Q C;  1LD7 A;  4DLQ A;  4HOR A;  2FO7 A;  4APO A;  3ASN E;  3FUN A;  2XRY A;  3UT7 A;  3DBS A;  3UIO C;  5IY5 E;  2VGY A;  4U07 A;  4UI9 K;  2PM7 A;  2OOE A;  3FUL A;  2L6J A;  3V31 A;  4Q69 A;  1K8K G;  3CVN A;  2Y4T A;  5KCM A;  1A17 A;  4HNA D;  2LXL A;  4LEU A;  1H6O A;  2J09 A;  3FTU A;  3JYS A;  3EJN A;  1BD8 A;  3Q47 B;  3FEX A;  4N2S A;  2ZIR A;  3SFX A;  4PS3 A;  1MX6 A;  2YQ8 A;  5BV0 A;  3S7D A;  3ESL A;  5CHE E;  2J08 A;  1MZC A;  4WND A;  3U9W A;  2QY7 A;  4GTM A;  1DVP A;  3G2S A;  3AG2 E;  3ABM E;  2KCK A;  3APF A;  1TYQ G;  4CT4 A;  3RSE G;  4GCO A;  3DSU A;  2P58 C;  2C0M A;  4HVB A;  3ULY A;  2XEH A;  4Q96 A;  4HRL A;  4FA6 A;  4OYS A;  4G23 A;  5ANR A;  5JHA A;  2DZN A;  3D9I A;  2JLB A;  3PUJ A;  4IN3 B;  1E96 B;  5ITZ F;  2WXI A;  4MRU A;  2R02 A;  4TXQ A;  5AAO A;  1JCS A;  2FO1 E;  3AU5 A;  5JHB A;  1YA0 A;  3J5Q B;  2FUL A;  1X81 A;  3SFY A;  4FHJ A;  4XI0 A;  2XS1 A;  4P29 A;  4F1P A;  5KJN A;  1A5E A;  1NFI E;  3HXB A;  3VTX A;  4HFG A;  1UW4 B;  4ME2 A;  2E2E A;  1P5Q A;  3UPV A;  3CVW A;  3UQ3 A;  2GRO B;  2IQC A;  4H7X A;  1SA5 A;  2L0T B;  5C2Y A;  3FU0 A;  5D66 A;  2H6H A;  1H6P A;  4RG9 A;  1OCC E;  3BQO A;  4KYO B;  4ACK A;  3APC A;  3Q73 A;  3E4B A;  2NXP A;  4EHM A;  4N5C A;  4GTO A;  3TG4 A;  3PZ2 A;  4I2W A;  3CV0 A;  2HE0 A;  2P9P G;  2YHC A;  4GPM A;  1FVH A;  3KEA A;  2IFU A;  3UIP C;  4NIK A;  5EKQ D;  1IHB A;  1HS6 A;  1EPU A;  2VYI A;  2B6C A;  1E7V A;  4G25 A;  2C0L A;  1FVF A;  4EZJ A;  5AAR A;  3KAE A;  4MKT A;  2YIN A;  2GRN B;  4PS8 A;  3MA5 A;  1TR4 A;  1BI8 B;  1H2V C;  3DPY A;  3QWV A;  1HO8 A;  2B0O E;  2OVF A;  1HZ4 A;  3D9P A;  3OAW A;  3IEG A;  1S0P A;  3IHV A;  3UXG A;  2OEW A;  3C3O A;  3APD A;  5CER B;  4I1O B;  2AXZ A;  3B7U X;  1AP7 A;  4OAV B;  1HU3 A;  3IKO B;  3ZHE A;  5JJ7 A;  5J90 A;  2P9K G;  1MYO A;  2X6J A;  4EEC A;  2F8Y A;  2L9B A;  4PDX A;  5AQ9 A;  2J8S D;  4HOS A;  1OUV A;  1Z5S C;  4B0Z A;  1AWC B;  3L13 A;  4QQI A;  3EUV A;  4JHJ A;  1YCS B;  3ONK A;  5AQ7 A;  2C2L A;  4APF A;  3AJI A;  3HXD A;  4HB5 A;  1ELW A;  4XKC A;  4FP7 A;  3MV3 B;  4CT0 A;  2EIJ E;  4KZ0 A;  2AJA A;  3X2Q E;  4BSZ B;  3CQC B;  4GML A;  1H2U A;  4YDO A;  4O1P A;  5CBO A;  3S7F A;  3DST A;  1WDY A;  3WXX A;  5AQB A;  3MX3 A;  3MKR A;  3FUK A;  4JPS A;  4WNG A;  2IEJ A;  3ASF A;  4J8D A;  4B8A A;  2LAI A;  3E30 A;  4HRN A;  1NL4 A;  2XCB A;  2QYJ A;  1JCR A;  3LKU A;  1ZU2 A;  4KBQ A;  4ATZ D;  3FUD A;  1PC2 A;  3W9G A;  4HLL A;  4UQX A;  5HS0 A;  4B93 B;  4K0R A;  5G04 C;  1XGW A;  4U96 D;  5ARF A;  3GZ2 A;  4JW1 A;  1W3B A;  3L22 A;  5A23 A;  4I43 A;  5EX3 A;  2Y3A A;  3AG4 E;  4CDM A;  3EHR A;  5CCM A;  3EHM A;  4L9P A;  2WQ6 A;  3FUJ A;  2J49 A;  5EYP F;  1SQM A;  2PL2 A;  4AP2 A;  1TJC A;  1PY1 A;  5HKP A;  4I2Z A;  5BXO A;  2EIM E;  4W9R A;  3L9T A;  4GAA A;  5ARG A;  4HBD A;  2KC7 A;  1KT1 A;  4J8S A;  4AOF A;  3HDX A;  1DCE A;  3FWV A;  2ETA A;  5FQ6 A;  3NZU A;  3I4R B;  2GRR B;  3CR3 A;  4DJA A;  4ANV A;  4U0U A;  2OCC E;  4ZFH A;  1UOH A;  2PQN A;  2R05 A;  2WQ7 A;  2XPY A;  4U95 D;  4BX8 A;  1SZ9 A;  3O4Z A;  5M72 A;  1HE8 A;  2DWZ A;  3MKQ A;  4N5Q A;  5FQ8 A;  1LD8 A;  2AXV A;  3LJ3 A;  2VSO E;  5FZR A;  4ATG A;  2J4B A;  4J8Y A;  4XX5 A;  1E8Y A;  4JEH A;  2VSN A;  2Q7F A;  4E85 A;  3AG3 E;  4AVX A;  4LNG A;  2WMN A;  4B94 A;  2LXM A;  3DWL G;  2CHX A;  4DX1 A;  2L6B A;  3C3R A;  5CRV A;  2LAH A;  4TV3 A;  3ASD A;  2MYO A;  4PUC A;  1IXV A;  4FHK A;  2Y0B G;  2A5U A;  2V4L A;  1JWG A;  5D0O D;  1JWF A;  4BFR A;  3FP3 A;  3EIJ A;  2IOL A;  3MYV A;  4HLE A;  3V79 K;  5ENR D;  5D0Q D;  2VJ8 A;  4L1B A;  4GPK A;  4WWP A;  4C48 B;  1O5M A;  4CGV A;  3U3W A;  3T5X A;  3HVE B;  4DRX E;  1TNU A;  4AV7 A;  1OWP A;  3TWV A;  4GTV A;  4CCA A;  1HH8 A;  4IYP A;  1N11 A;  5EIL A;  2EQX A;  2LSV A;  2MOW A;  2Y69 E;  5HQ8 A;  1HG2 A;  3ULE G;  3CKC A;  2XRZ A;  2KZT A;  3CKB A;  2BUG A;  3DXM G;  4BEP A;  4F1S A;  2FI7 A;  2ZGG A;  3FH8 A;  2P9N G;  2E0I A;  5KBA A;  3FH7 A;  3D9J A;  1ZB1 A;  1Z3Y A;  4CDN A;  3KSQ A;  1N52 A;  2XEN A;  4OVU A;  3JUI A;  3UM0 A;  3QAQ A;  4JL0 A;  2AW6 A;  5J08 A;  4YDE A;  3FTW A;  3D9M A;  2WXL A;  2H6I A;  3SY2 A;  3CHP A;  2OV8 A;  3MKQ B;  4I1M A;  4TRQ A;  5A7D B;  3T8M A;  5AYW D;  1SA4 A;  4AY5 A;  3G2V A;  4A55 A;  4KXK B;  4OAU C;  3AG1 E;  3ASG A;  5AJD A;  3CK7 A;  5E76 A;  5JMN D;  4G8L A;  3LYA A;  2GRP B;  2BKG A;  1Y8M A;  1OCZ E;  5AN8 A;  5HI7 A;  3CVU A;  4BWR A;  3MV2 B;  2MRI A;  3NOC D;  4JHK A;  4UWL A;  4J7W A;  3D9N A;  2PZI A;  2CFU A;  4LCT A;  2MHK A;  4WAF A;  5KNH D;  4KT6 B;  3QDN A;  4LG6 A;  4BT8 A;  1KZO A;  4MLP A;  3OXG A;  3FDH A;  5LP0 A;  2NC9 A;  5A6C A;  4UI9 C;  1BPO A;  2XGM A;  4UWG A;  1ZBP A;  2IOS A;  3LY9 A;  3CHM A;  2EIN E;  3PNL B;  4GTQ A;  3RO3 A;  3ZNG A;  1TNB A;  4JA7 A;  2F37 A;  2HYZ A;  3LVQ E;  4RSY A;  3ZVV A;  4HRM B;  1ELK A;  3PE4 A;  3TWQ A;  2P2C P;  1QZ2 A;  2ETC A;  5T3R A;  2IU1 A;  3HRA A;  4N39 A;  3Q79 A;  4GZC A;  2DBA A;  5BPP A;  3PZ1 A;  4DX7 D;  4GYO A;  1N4S A;  3I4G A;  3R7Q A;  1MX2 A;  5G55 A;  2KZT B;  2OND A;  1VDY A;  3B7B A;  4U8H A;  2WXO A;  2VGX B;  3Q5M A;  4UWF A;  3LDZ A;  4GTS A;  3BU8 A;  1FPP A;  2FBN A;  3ZFW A;  3OXF A;  4WWN A;  1H19 A;  2DIW A;  3CK9 A;  4HOU A;  3LCA A;  1V54 E;  2KCL A;  2XZT G;  3CIA A;  1BU9 A;  5BV1 A;  1WM5 A;  1Z6T A;  4ANU A;  2P9L G;  4JC8 A;  4F6R D;  3SD5 A;  3FUM A;  3KS2 A;  3TWW A;  4UQY A;  3DSW A;  4HS2 A;  4FC8 A;  3B95 A;  3JCK C;  3P2B A;  2V0P A;  1N54 A;  3ISM C;  4RQI A;  2DCP A;  2BED A;  4GB9 A;  3VLE A;  4TUU A;  1OCO E;  3PRE A;  5FT9 A;  5ENN A;  2P9I G;  5T8I A;  3UTM A;  4TXR A;  4U04 A;  4ANW A;  1H0A A;  2WXR A;  4L2L A;  2WQH A;  3OXL A;  4O60 A;  1N94 A;  3AU4 A;  1KLX A;  2ETB A;  4I6J A;  3MCX A;  1OWM A;  2WXJ A;  3DSV A;  5G04 J;  1D8E A;  3C72 A;  4AJW A;  4HQD A;  4HXI A;  2LO6 A;  3BG0 B;  3SO8 A;  1DC2 A;  1YYH A;  2GRQ B;  3EDT B;  3DEP A;  4R7L A;  2KM4 A;  4FU3 A;  1E8W A;  1MX4 A;  3QWP A;  3PNT B;  3J5P A;  5B3S E;  3ZIM A;  2UY1 A;  3FY4 A;  5HRY A;  2R59 A;  5EIB E;  4G1T A;  1UN8 A;  5FQ7 A;  1DNP A;  3ZUV B;  1U2V G;  2R17 C;  3D3M A;  2XPI A;  4KZC A;  2XPZ A;  1K1A A;  1OY3 D;  2VSY A;  4XI9 A;  1KZP A;  4BX9 A;  4AXH A;  4XE0 A;  4O1O A;  3IHY A;  2WXG A;  4GYY A;  1JCQ A;  2ZXW E;  5KWD A;  4DX5 D;  3UM2 A;  2HR2 A; 
#chains in the Genus database with same CATH homology
 3NF1 A;  4U07 A;  4ATG A;  4UI9 K;  2PM7 A;  2OOE A;  3FUL A;  1HXI A;  2J4B A;  3I5P A;  2L6J A;  4XX5 A;  3CVV A;  4BTA A;  1E8X A;  1E8Y A;  1NP7 A;  2J07 A;  2VSN A;  4JEH A;  3CK8 A;  3FTX A;  2Q7F A;  4Q69 A;  4NRH B;  4E85 A;  3CVN A;  2Y4T A;  5KCM A;  1A17 A;  1NZN A;  4AVX A;  5T4Y A;  4FJZ A;  2WMN A;  4B94 A;  4WWO A;  3C98 A;  4LEU A;  4LUN U;  3PEV B;  2J09 A;  2CHX A;  2X6F A;  3FTU A;  5FZQ A;  5EDS A;  4N3C A;  3JYS A;  3TXN A;  3EJN A;  3Q47 B;  2I6H A;  4I6G A;  3FEX A;  4YVO A;  2LAH A;  3ML9 A;  3L54 A;  4TV3 A;  4N2S A;  3FU6 A;  3ASD A;  3FU3 A;  3SHF A;  5LFA A;  3MEK A;  4HOT A;  2WXK A;  4PS3 A;  4J8F A;  4PUC A;  2YQ8 A;  3ZYK A;  5LCW C;  3MZL B;  5DIZ A;  5JJ6 A;  4FHK A;  4J8E A;  3L6A A;  3ESL A;  3S7D A;  1Z3X A;  3FH5 A;  5G2N A;  5BV0 A;  2A5U A;  4GZD A;  5CHE E;  2J08 A;  3CVY A;  2V4L A;  2WXN A;  2RG8 A;  4RG6 A;  4WND A;  4B89 A;  3TGO A;  3U9W A;  4CDR A;  1JWG A;  3FU5 A;  5D0O D;  1JWF A;  1L5J A;  2QY7 A;  2UWJ G;  3AS5 A;  4BFR A;  1DVP A;  3D9O A;  3FP3 A;  3G2S A;  3GYZ A;  4GZ3 A;  3EIJ A;  5LCW J;  2IOL A;  3N71 A;  2I9C A;  3MYV A;  3HHM A;  4JEU A;  3SBS A;  2CHW A;  4HLE A;  3HVE A;  4U0S A;  3VLF A;  4ILH B;  2KCK A;  1EDU A;  5D0Q D;  3APF A;  1Y6I A;  2VJ8 A;  4G2V A;  4YVQ C;  4L1B A;  4CT4 A;  3KD7 A;  4C0M A;  5LX8 A;  4GPK A;  4GCO A;  4DI3 A;  3OTN A;  2FEZ A;  4FLB A;  4WWP A;  5FQ4 A;  3CVX A;  2Y4U A;  2IF4 A;  3CST A;  3PRZ A;  4GA0 A;  2P58 C;  2WMO A;  3I3N A;  4CGV A;  1GW6 A;  3U3W A;  3T5X A;  3HVE B;  2C0M A;  4A3V A;  3FHE A;  4HVB A;  4AV7 A;  1OWP A;  5E75 A;  4Q96 A;  3LS8 A;  4CGW A;  4FA6 A;  4CCA A;  2XEV A;  3URZ A;  1HH8 A;  3G2T A;  4IYP A;  3G2U A;  2EQX A;  3L17 A;  4RVB A;  4OYS A;  4G23 A;  5ANR A;  3SF4 A;  5JHA A;  2LSV A;  1X5B A;  2JLB A;  3D9I A;  3PUJ A;  1QNF A;  3CHO A;  2MOW A;  5HQ8 A;  1HG2 A;  4IN3 B;  1E96 B;  4N2Q A;  2AVP A;  2WXI A;  2AXU A;  3CKC A;  2XRZ A;  4JHR A;  2XGO A;  3ESK A;  4MRU A;  4JZY A;  2KZT A;  4V3I A;  3CKB A;  3SI5 A;  2BUG A;  3VTY A;  5BNW A;  4F1S A;  3HYM B;  2FI7 A;  4I6E A;  3FH8 A;  4A1G A;  2E0I A;  3FH7 A;  3AU5 A;  4C0E A;  4XKB A;  4A1S A;  5JHB A;  2VSX E;  1YA0 A;  3RRU A;  3D9J A;  2FUL A;  2KCV A;  1Z3Y A;  3FUF A;  4N3B A;  4CDN A;  1N52 A;  3QWW A;  3AS4 A;  1H6K A;  4FHJ A;  3K9I A;  5FJY A;  4CRW A;  4XI0 A;  2UY1 B;  4OVU A;  4DLO A;  4P29 A;  4Y6W A;  3JUI A;  5KJN A;  5BT1 A;  3VTX A;  3QAQ A;  4JL0 A;  4JXT A;  3RU0 A;  4PH4 B;  2AW6 A;  2GRL A;  4IUL A;  5J08 A;  4KVM A;  4HFG A;  1UW4 B;  4YND A;  1WY6 A;  3FTW A;  4AIF A;  3ZPJ A;  3D9M A;  4ME2 A;  3R7R A;  1E8Z A;  2WXL A;  2E2E A;  3AS8 A;  3ZRH A;  1LF8 A;  4EQF A;  1P5Q A;  1IHG A;  4WNE A;  3TG5 A;  3FUE A;  5JJT A;  4GA2 A;  1MHQ A;  3UPV A;  4KVO A;  3CVW A;  4G26 A;  4O6F A;  3UQ3 A;  2IQC A;  3CHP A;  3CHR A;  4H7X A;  4M3O A;  5EX0 A;  4EZL A;  2XGS A;  4UWK A;  2WVI A;  2OV8 A;  3CSF A;  2L0T B;  3MKQ B;  5C2Y A;  4I1M A;  3FU0 A;  2CHZ A;  4TRQ A;  3BEE A;  5A7D B;  3T8M A;  5AYW D;  4ABN A;  3ULQ A;  3B7T A;  4RG9 A;  1OWL A;  3U64 A;  4KYO B;  4AY5 A;  3G2V A;  3LY8 A;  4KXK B;  4ACK A;  4A55 A;  3TL5 A;  3APC A;  3E4B A;  2NXP A;  3CGH A;  3ASG A;  3T5V A;  2WXF A;  4U0Z A;  1HX8 A;  2IJG X;  4JA9 A;  1NA0 A;  4GU5 A;  3CK7 A;  4N5C A;  5AJD A;  3TG4 A;  4I2W A;  3CV0 A;  4I17 A;  3U4T A;  3PZD A;  1XNF A;  2YHC A;  1FVH A;  3PUK A;  5E76 A;  2FF4 A;  2IFU A;  3LYA A;  3RK6 A;  1HFA A;  3ZEF A;  2I2O A;  3B7R L;  1Y8M A;  5EKQ D;  3ZGQ A;  3ZW3 A;  3RRN B;  5HI7 A;  4DPR A;  3CVU A;  2M63 A;  3L08 A;  4BWR A;  1HS6 A;  3MV2 B;  1EPU A;  2VYI A;  2GRM A;  2MRI A;  4NUR A;  4JHK A;  4F53 A;  1IYG A;  2HM8 A;  1EF1 C;  2X38 A;  4UWL A;  5CCL A;  4AM9 A;  3D9N A;  2WM9 A;  1E7V A;  1UJK A;  1KT0 A;  2CFU A;  2PZI A;  3CHQ A;  4G25 A;  2C0L A;  4NQ0 A;  4LCT A;  1FVF A;  2MHK A;  2WXM A;  4WAF A;  3FTV A;  4EZJ A;  3R9A B;  4MS6 A;  4KT6 B;  3QDN A;  3KAE A;  4DI4 A;  3LEW A;  4MKT A;  5AEN A;  2YIN A;  4BT8 A;  3CEQ A;  2WB2 A;  4F7A A;  3LY7 A;  4F3V A;  4PS8 A;  3MA5 A;  4MLP A;  4DK5 A;  3OXG A;  3FDH A;  5LP0 A;  1H2V C;  2NC9 A;  5AIJ A;  5A6C A;  2VQ2 A;  4PS7 A;  4UI9 C;  3QWV A;  2YHE A;  1BPO A;  3IV0 A;  2XGM A;  4UWG A;  3RRM B;  1ZBP A;  3SGH A;  2IOS A;  3LY9 A;  3CHM A;  4BSX A;  1HO8 A;  3FUI A;  2OVF A;  1HZ4 A;  3D9P A;  2OVB A;  3GW4 A;  3IEG A;  3OAW A;  3MJW A;  2V5F A;  1S0P A;  3Q15 A;  3PNL B;  3IHV A;  5CMY A;  2J4D A;  5G05 J;  3RO3 A;  4CEM A;  2J9Q A;  4GCN A;  2GGF A;  3APD A;  3ZYL A;  3MGB A;  4EPZ A;  1SZA A;  4UI9 J;  4I1O B;  4JA7 A;  2AXZ A;  2HYZ A;  2WXH A;  3B7U X;  3LVQ E;  3BG1 B;  4RSY A;  3ZVV A;  1NA3 A;  1ELK A;  3D9L A;  4WNF A;  3PE4 A;  1HU3 A;  3IKO B;  3ZHE A;  5JJ7 A;  5J90 A;  2X6J A;  3ZYM A;  1UG3 A;  4EEC A;  1U3D A;  2X6I A;  2L9B A;  1QZ2 A;  4PDX A;  3EHN A;  4EZK A;  5T3R A;  2IU1 A;  3TJP A;  4N39 A;  4GZC A;  2VGX A;  2DBA A;  3RJV A;  4HOS A;  5BPP A;  4N3A A;  4Q94 A;  3ZHE B;  3SZ7 A;  4GYO A;  1OUV A;  3G2W A;  3I4G A;  3R7Q A;  4B0Z A;  3NQP A;  3L13 A;  3Q4A B;  5G55 A;  1H2T C;  2KZT B;  4BTB A;  4FJY A;  2OND A;  1VDY A;  4K03 A;  2PM6 A;  4I9E A;  4U8H A;  4I1A A;  2WXO A;  4JHJ A;  2VGX B;  3TAX A;  3Q5M A;  4KMO A;  4UWF A;  3LVR E;  3ONK A;  3LDZ A;  1E7U A;  4XZ4 A;  4FAD A;  2C2L A;  4APF A;  3IBE A;  2FBN A;  3ZFW A;  5KJM A;  3OXF A;  4WWN A;  1H19 A;  2DIW A;  3CK9 A;  3RIB A;  4HOU A;  3SNX A;  3FEY A;  3LCA A;  2KCL A;  1ELW A;  4XKC A;  5FWQ A;  4NAC A;  3Q49 B;  4FP7 A;  3B13 A;  3MV3 B;  3ZXS A;  4CT0 A;  3UT8 A;  2LNI A;  3LPZ A;  2AWI A;  4GMJ A;  4KZ0 A;  3TXM A;  4ACL A;  1UN9 A;  4LER A;  3EIQ C;  1TJF A;  3CIA A;  3S7J A;  2XCC A;  3NZS A;  3P1U A;  5BV1 A;  3CQC B;  4LRZ A;  3KEZ A;  4GML A;  4XIF A;  4A3T A;  4BY6 A;  1H2U A;  1WM5 A;  4UWH A;  1Z6T A;  4E6H A;  2BTD A;  4ANU A;  2CFZ A;  2ZU6 B;  3S7F A;  2VTB A;  3VLD A;  4JC8 A;  5FTP A;  3PDN A;  3SD5 A;  2I1K A;  3FUM A;  1IQU A;  3QJZ A;  3GZ1 A;  4J6I A;  3ZN3 A;  4AEZ C;  3WXX A;  2L0I A;  2PQR A;  3KS2 A;  4C9B B;  3QC1 A;  3PVL A;  3UMV A;  3QKY A;  4FLH A;  4U63 A;  3MX3 A;  3MKR A;  3FUK A;  1JPL A;  2JEK A;  4UQY A;  4JPS A;  3ZYQ A;  5FZS A;  4WNG A;  4ANX A;  3ML8 A;  3ASF A;  4HS2 A;  4J8D A;  2VTB B;  4FC8 A;  4D10 C;  3JCK C;  3P2B A;  4B8A A;  2R5S A;  2V0P A;  2LAI A;  3JQ1 A;  5C1D A;  1N54 A;  2WXQ A;  4B8C B;  2DCP A;  4L7T A;  1FCH A;  1E90 A;  4GB9 A;  3UX4 A;  2X3M A;  4TUU A;  3PRE A;  2XCB A;  3L16 A;  5FT9 A;  3VLE A;  3CVP A;  3ENE A;  2QFC A;  4GYW A;  3PS6 A;  5ENN A;  5KJL A;  2BF0 X;  3FTY A;  3LKU A;  5T8I A;  1ZU2 A;  3LXU X;  3FUH A;  3S7B A;  1ELR A;  3JQ0 A;  3U66 A;  4KBQ A;  2XHE A;  4L23 A;  3GZS A;  3FTS A;  4U04 A;  3FUD A;  3D9K A;  4WUY A;  3B7S A;  5G05 C;  1PC2 A;  1B89 A;  4UQX A;  3UUX A;  2NSZ A;  4K0R A;  4ANW A;  4H7Y A;  1H0A A;  2WXR A;  5G04 C;  1XGW A;  4ILG A;  5ARF A;  4EBA A;  4GZ6 A;  4L2L A;  2WQH A;  3PEU B;  3DPD A;  3OXL A;  3GZ2 A;  1HF8 A;  4JW1 A;  3AU4 A;  1TEZ A;  1W3B A;  3RKV A;  1KLX A;  3L22 A;  1INZ A;  5A23 A;  1UJJ A;  3QNK A;  4I6J A;  3ASH A;  3MCX A;  4I43 A;  1HG5 A;  2Y3A A;  5EX3 A;  1OWM A;  5CMW A;  4CDM A;  3ONL A;  2WXJ A;  3QAR A;  5CCM A;  3EHM A;  1WAO 1;  2WQ6 A;  2YNQ A;  5G04 J;  2ILR A;  3FUJ A;  2WXP A;  1OWN A;  2J49 A;  3CHS A;  4IRU A;  4AJW A;  4BT9 A;  4HXI A;  4G11 A;  2I1J A;  2LSU A;  2XQ0 A;  5ANL A;  5KJK A;  4UQZ A;  2LO6 A;  4GA1 A;  3SFZ A;  1SQM A;  3BG0 B;  3S2A A;  2PL2 A;  4AP2 A;  1TJC A;  2KAT A;  4I9C A;  1PY1 A;  3CVL A;  5BW8 C;  3EDT B;  3O48 A;  4OVV A;  4R7L A;  4I2Z A;  1MQS A;  2KM4 A;  4FU3 A;  4J0U A;  3QOU A;  4W9R A;  1E8W A;  3QWP A;  3QK0 A;  3PNT B;  3PE3 A;  4GAA A;  5ARG A;  2KC7 A;  1KT1 A;  4J8S A;  4AOF A;  2RD0 A;  3PH0 C;  3ZIM A;  2A4Z A;  2V8S E;  3CLJ A;  5DBK A;  2X6H A;  2GW1 A;  3HDX A;  2UY1 A;  3FY4 A;  1PAQ A;  2R59 A;  1OWO A;  3FWV A;  4Y6C A;  2HO1 A;  4G1T A;  1UN8 A;  5FQ7 A;  5BUZ A;  5FQ6 A;  1DNP A;  4GZ5 A;  3HIZ A;  2R17 C;  3D3M A;  3I4R B;  2CG2 A;  3NZU A;  3RO2 A;  3CR3 A;  4DJA A;  3FTZ A;  3UT4 A;  4ANV A;  4U0U A;  3QB2 A;  3CQG B;  4QFV A;  4JVS A;  2PQN A;  4EBA G;  2WQ7 A;  1U3C A;  3FFL A;  2XPI A;  4KZC A;  4L2Y A;  5AJL A;  4URK A;  4ILI A;  1EYH A;  2XPY A;  1QQE A;  4AY6 A;  4BX8 A;  2CG3 A;  2XPZ A;  1SZ9 A;  2X6K A;  3CVQ A;  2VSY A;  4G24 A;  3O4Z A;  5M72 A;  1HE8 A;  1JUQ A;  4XI9 A;  3MKQ A;  4BX9 A;  4AXH A;  4DLQ A;  5FQ8 A;  4HOR A;  4XE0 A;  2AXV A;  2FO7 A;  4APO A;  2WPV A;  3IHY A;  2WXG A;  3LJ3 A;  4HOQ A;  3FUN A;  4FUL A;  4GYY A;  2ION A;  2VSO E;  2XRY A;  3UT7 A;  3SBT B;  3DBS A;  5LOZ A;  1IQR A;  5FZR A;  2VGY A;  2HR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...