2KM4A

Solution structure of rtt103 ctd interacting domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
AFSSEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAKGQKIIQFQDSFGKVAAEVLGRINQEFPRDLKKKLSRVVNILKERNIFSKQVVNDIERSLAAALEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Regulator of Ty1 transposition protein 103
publication title Cooperative interaction of transcription termination factors with the RNA polymerase II C-terminal domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2km4A00
2BF0X 1UJKA 1XGWA 1JPLA 3CLJA 4GZDA 2QY7A 3D9PA 4AVXA 1HX8A 3D9MA 1SZ9A 4Q96A 3D9IA 3G2UA 3G2WA 3G2VA 1UJJA 1EDUA 5LOZA 2DCPA 2V8SE 2DIWA 3ZYQA 4JXTA 3D9LA 3D9JA 2L0TB 4NACA 4Q94A 1JWGA 4FLBA 3ZYLA 1HF8A 1SZAA 3ONKA 1INZA 3ONLA 1X5BA 2LO6A 1JWFA 4HFGA 5CMWA 1HG5A 1PY1A 1MHQA 4GZCA 5CMYA 3G2TA 1LF8A 3ZYMA 5LP0A 1VDYA 1JUQA 1ELKA 1EYHA 3ZYKA 2KM4A 1HG2A 1H0AA 3D9OA 3D9NA 3RRUA 3D9KA 2L0IA 4FU3A 1DVPA 3G2SA 1HFAA 3LDZA 2MOWA 5J08A
chains in the Genus database with same CATH superfamily
3LVQE 1TYQG 4ATZD 2V5FA 5M72A 2V8SE 4O6FA 1YYHA 2CHXA 2C2LA 3S7JA 4ACKA 4KBQA 3WXXA 2C0MA 2AXVA 3TWSA 4G1TA 2ILRA 4L2YA 5LCWJ 2GRLA 3FH5A 3FUEA 4Y6CA 2DZNA 4KYOB 2AXZA 4E85A 2DZOA 1Z3XA 3EHRA 4KVOA 2R2LA 4HORA 4BX9A 1HH8A 4I1OB 4E6HA 4I43A 5J08A 5JHAA 2HE0A 3FY4A 5B1AE 5LOZA 3RO3A 3O48A 3LCAA 4RQIA 2LO6A 1ZBPA 2VSYA 4Y6WA 3Q7AA 2GRRB 3TJPA 2R03A 4XE0A 3T5VA 4XEIG 4NIKA 4B93B 1UJKA 3EIQC 4CT4A 3KSLA 2GRNB 3R9MA 1EDUA 3CVWA 2XZTG 4TXRA 4HOQA 1TNOA 5FZQA 4GTTA 5FZRA 3SHFA 3E34A 2P9UG 2FO7A 2V4HC 3U9WA 2OV8A 2XRZA 3FTXA 3UM2A 2XGOA 3I5PA 1JPLA 4G2VA 3PZ3A 2OVFA 3ISMC 1WDYA 4G11A 3HXCA 2FO1E 1N0RA 2XEHA 2YQ8A 4ZHBA 5EX3A 2Y4UA 3ZW3A 5HI7A 5AJDA 5H7PA 1N4RA 1PAQA 4GAAA 2J07A 3JCKC 4AJWA 2VSNA 2XHEA 5ANLA 5JA4D 5FIOA 3JXJA 4MS6A 1WM5A 1A17A 5G04J 4TXQA 3PH0C 2L0IA 1OCRE 3DRAA 1EF1C 3FTWA 3KSQA 4DI3A 5EIDA 1LD8A 4GYOA 2DVWA 4KZCA 2WXPA 4GZ3A 4GYYA 4I6JA 5AQAA 3CEQA 4U7EB 2F8XK 4U0SA 4B8AA 4B89A 1O1SA 2HM8A 1H2VC 3ASOE 3TWWA 3C72A 2UY1B 5E75A 1LF8A 5ENSD 3FP3A 4H7YA 4DX2A 2DWZA 3QJZA 3BEEA 3L6AA 2J9QA 4MLPA 2CHWA 3MV3B 3ABLE 5KJLA 1DCQA 5J90A 4WWNA 4AY5A 4CZ2D 1BU9A 2J08A 3QWVA 1ZU2A 4FJYA 4RVBA 4F1PA 3C98A 4GPKA 3Q9NC 2WXNA 2CG3A 2QY7A 1TN7A 3ZYLA 2QYUA 3SFXA 1N11A 3GYZA 4FLBA 2VGEA 3AJIA 1KPSB 2LAHA 3ASGA 3CHSA 2NYJA 4WWOA 4MRUA 3ZHEB 4GA1A 4A1GA 3LKUA 1H2TC 2BF0X 3JYSA 3FUMA 5BW8C 1E8WA 1Y6IA 2F37A 3FTSA 4GCOA 4I9EA 2QFCA 4AV7A 3MGBA 1E90A 3UM3A 4ILIA 4JC8A 4UQYA 1LD7A 3ZYMA 1QYMA 3N71A 2KM4A 5JHBA 4WNDA 2GW1A 3L9TA 5ENRD 3D9MA 3EU9A 4XKBA 4L23A 1H19A 5EN5D 3FWVA 2XENA 1OCOE 3LEWA 3TWRA 4HOSA 3UT4A 2IEJA 2X38A 5KNHD 4ZFHA 2NSZA 4LEUA 1ZB1A 2WQ7A 4YVQC 3T8KA 1E8XA 4ILGA 3B7UX 2LXLA 5G55A 3I4RB 2BKKB 2ETBA 2WXLA 3QKYA 3L08A 3LY7A 2B6CA 3ASNE 4GTVA 4W9RA 1K1BA 4GB9A 1FCHA 1DVPA 3DWLG 4LCTA 4J0UA 1TN8A 4BSXA 2I9CA 2QZAA 3FEYA 4U95D 3MYVA 1JWFA 2F8YA 3G2TA 2JEKA 5AARA 4HVBA 1U3CA 1DNPA 5KCMA 1Y8MA 2FBNA 1FT2A 3Q78A 4J8SA 2Y69E 5D0QD 4FP7A 3SD5A 3LS8A 4GZ6A 3ZVVA 5DIZA 3U64A 5C1DA 1P5QA 5C2YA 1N4PA 5BUZA 4CDNA 2ZISA 4K5BA 2IF4A 2XS1A 4KXKB 4ABNA 4D10C 3NB2A 3MJWA 2X6IA 4ANWA 3UTMA 3SY2A 5JJ6A 2X3MA 3L82A 2BEDA 2XQ0A 3T5XA 3RSEG 2WQ6A 4JB8P 1V55E 2LUHA 2FULA 4X8QA 5AQ7A 2IU1A 3TWXA 2VGXB 3FTZA 4KVMA 4CGWA 4ATGA 2P9PG 3NOGD 5CMYA 3QWWA 3D9HA 1H6OA 2R5SA 4EECA 3ZUVB 4J6IA 3CR3A 5BV1A 2QYJA 3Q79A 3CVXA 3HVEA 4NACA 3BQOA 3HG0D 3RK6A 2Y3AA 4BY6A 3PVLA 4DPRA 3FU5A 3CHOA 2P9LG 4B94A 1WY6A 2IONA 1IYGA 4N39A 2PQRA 3Q5MA 4C9BB 1OXJA 1O5MA 3CQGB 4N2QA 5HRYA 3R7RA 4UQZA 1IQRA 3EHQA 4HI8A 1OCZE 2DYRE 1HG2A 3URZA 2AW6A 1HU3A 4AM9A 4TUMA 4F7AA 1QBQA 4J8YA 2XZDG 2VGYA 4HS2A 4N3AA 4UWLA 5D2MC 1NFIE 3Q7FA 3UI2A 2V5QC 4FHJA 1VDYA 1D8DA 3ULEG 2Y1LE 5KJKA 2EIME 2WXIA 2WPVA 2V0PA 1MQSA 2R59A 2ZIRA 4L9PA 3TL5A 2H6GA 4PS7A 3EIJA 2L0TB 3B95A 3B7BA 3CVPA 5AJLA 5FT9A 3UM0A 1H6PA 1MZCA 5BXOA 2LNIA 2VSOE 3JXIA 3LDZA 4EZLA 5T4YA 1UOHA 2I2OA 4LNUD 4HRMB 4B0ZA 4EBAA 2BUGA 4DLOA 3FU0A 2H6FA 5LFAA 4EBAG 4OYSA 4UWHA 4HFGA 1MHQA 2PL2A 3QC1A 4GZ5A 2CFUA 3OAWA 4A3VA 3TGOA 2ZGGA 3CVYA 2LXMA 3C3QA 5FQ7A 1ELWA 3ZYQA 3PS6A 4IRUA 3DPDA 3EHMA 4GMJA 4ANXA 4K5CA 4I2WA 4JL0A 4EZJA 4ME2A 2WXKA 3CSFA 4DX1A 1YA0A 2CFZA 3JQ0A 4C48B 4GZDA 2GRQB 1TNUA 1OWOA 2KZTA 3E4BA 4Q94A 1BPOA 1JWGA 3S2AA 2IOLA 2DYSE 3CQCB 4JEUA 2Q7FA 3LPZA 4FA6A 4RLYA 4F1SA 3FDHA 3FUNA 2ZXWE 4HLEA 1OUVA 3UKRG 4DUIA 2VTBA 4DLQA 1UJJA 2WXHA 3CVNA 2FI7A 3QK0A 1H2UA 2OEWA 4G23A 1UN8A 5T8IA 3RRUA 2ETCA 3UM1A 3U3WA 2R02A 3ZGQA 3HIZA 3HXDA 4GCNA 5JMND 1LTXA 5CBNA 2IO2C 2JLBA 2P58C 2Y0BG 3FTVA 3MKQA 3PE4A 2PM6A 4JD2G 3B13A 4IYPA 1SA5A 1U3DA 1HX8A 3ZIMA 1YCSB 3TAXA 2LSUA 1HF8A 3FU3A 1Z6TA 4JA9A 1HXIA 2ZU6B 3NZSA 1E8ZA 3D9NA 4JHKA 4FU3A 1UN9A 3V2XA 3G2SA 2L6JA 2ZGDA 1S70B 2VQ2A 5A7DB 4QQIA 4KZ0A 3EJNA 1QZ2A 3ONKA 5FJYA 3PEUB 3UT7A 3MCXA 1OCCE 2XCCA 3APCA 1O1RA 4L2LA 3QNKA 3SFYA 2OCCE 4BEPA 1XGWA 1XNFA 4IN3B 3HDXA 3FUFA 2XPZA 4GA0A 4M7CA 3FH8A 1TJFA 4CT0A 3MX3A 3PZDA 4JVSA 3FUDA 3JUIA 3C5RA 1TN6A 2DBAA 4C0MA 3O4ZA 4YDOA 1BD8A 4U8VD 3L16A 4JHJA 4BFRA 4OAUC 1JUQA 4U0UA 3FHEA 5CERB 3D9KA 3AG1E 5KWDA 5G2NA 4N3CA 4IULA 4WNFA 1JCRA 1D8EA 3AU5A 1N4QA 5ENNA 2GROB 4G25A 2J4BA 1FVFA 2V4LA 2XCBA 1K3ZD 3TWVA 5A6CA 1ELRA 4N5QA 5EILA 5BPPA 2RFAA 4JZYA 3S7BA 2LSVA 5FTPA 1S64A 4JHRA 4Q69A 2H6IA 3RKVA 3AS8A 4GTPA 3HRAA 1SZAA 2M63A 3DSWA 4JPSA 2XGSA 5E76A 1H0AA 3KEZA 1NA0A 3SI5A 3RU0A 1D9SA 3U4TA 4PH4B 3PE3A 4EPZA 3D9IA 2DCPA 1K1AA 4RG9A 3UIPC 4XI9A 3J5QB 4TRQA 3JUEA 3TWTA 4LUNU 3HYMB 1UW4B 3B7SA 3ZXSA 5EKQD 4HQDA 2GGFA 1HE8A 1H6KA 3FULA 2OOEA 5AN8A 4LNBA 2WMNA 3AG3E 4LG6A 3VLEA 3DSTA 3PREA 2C0LA 3Q4AB 4OAVB 2RKKA 2AWIA 4I1MA 1HZ4A 3CHMA 3WG7E 3FFLA 2WXFA 3ENEA 4BX8A 4GMRA 4CEMA 1NL4A 3CVUA 5CEAA 1NI1A 3NOCD 3E33A 2NC9A 3ZHEA 1OWLA 4TXPA 3RJVA 3EU5A 4G8KA 3E32A 2EQXA 2VYIA 3L13A 4BWRA 4U07A 3AS4A 3NZUA 3ABME 4GMLA 3NQPA 3FUKA 4L1BA 3CVVA 2YHEA 1YMPA 3L54A 3D9LA 3D9JA 3HVEB 1V54E 1HG5A 3KEAA 4UI9K 4HRNA 4BTAA 4LNGA 1TNZA 5CHEE 1MYOA 3F6QA 4U96D 3CK8A 5ENOD 4PS3A 3L17A 2VSXE 4GTRA 4GPMA 2NXPA 3APFA 5ENQD 4HLLA 3G2VA 3ZRHA 4ILHB 4K5AB 1HS6A 2PQNA 2X6HA 1BI7B 5LX8A 2E2EA 2RD0A 3P1UA 4HB5A 1Z3YA 2EIJE 2KCLA 5CRUA 2P9IG 3CIAA 3ZU7B 1Z5SC 1TNBA 1WG0A 3QOUA 1RW2A 3AG4E 3DBSA 4XI0A 5AQBA 2XPIA 3L22A 2LAIA 4JXTA 4UUCA 2A5UA 1IHBA 2IO3C 3VTYA 2HR2A 4YVOA 3ZYKA 2WXMA 3K9IA 3KAEA 3LY8A 3ABKE 3SFZA 1S0PA 3BG1B 4J7WA 3UUXA 4PUCA 4OVUA 4I1AA 1DCEA 3ZFWA 3UKUG 4U8YD 2HYZA 5JJTA 3AU4A 4HXIA 5HKPA 2WM9A 3DXMG 2MRIA 3KD7A 1HFAA 5ENPD 2KBXA 3RIBA 4JEHA 3MA5A 4BSZB 3SBTB 3SF4A 3RO2A 1KZOA 3W9FA 1FPPA 3MZLB 3Q9UC 4N3BA 3UXGA 1E7UA 4DJAA 3U66A 2MYOA 4BESA 4C0EA 3IEGA 3VLFA 4U63A 3E37A 4G24A 3ZKJA 1X5BA 4XX5A 3ESKA 5D66A 1TR4A 1FVHA 2AJAA 4AP2A 1ELKA 3HXEA 3SNXA 3EUVA 2WQHA 2KCVA 5DBKA 2AVPA 3G2WA 4CDRA 1E8YA 3MKRA 1DC2A 3PNLB 5G05C 2KZTB 3SGHA 3V2OA 2CG2A 3E30A 4I17A 3LJNA 1MX4A 4FULA 1FT1A 5EX0A 4I2ZA 3GZ1A 5CMWA 2UWJG 3NAWA 4BT9A 5AAOA 2VTBB 3IKOB 4GYWA 3ZEFA 1EYHA 4FADA 2XGMA 5IY5E 1JCQA 4DI4A 4XKCA 4HOUA 4F3VA 2MOWA 3UIOC 5B1BE 3DSXA 1AP7A 1SVXA 5HQ8A 4BETA 4MKTA 4G26A 1QQEA 4APFA 3DPYA 1PY1A 3S7FA 2A5EA 1A5EA 2J09A 3MKQB 3ULQA 3HHMA 4Q96A 3PUKA 5EYPF 4ACLA 2R17C 5ANRA 3CV0A 5CCLA 3TXMA 4KT6B 1KT1A 5AIJA 3VLDA 1IXVA 1N95A 2IFUA 1N4SA 2EINE 1OT8A 3BG0B 3UX4A 2P9SG 3PZ4A 5KJNA 3R9AB 3QB2A 4UI9C 2X6JA 3UT8A 4I9CA 1OY3D 5EYLA 3S7DA 4DRXE 3BUAA 2X6KA 3Q49B 1BLXB 2H6HA 5T3RA 2YINA 4EZKA 2KXPC 1W3BA 1K8KG 3IHVA 2E0IA 3ESLA 2WXJA 3SO8A 3FUJA 4GTSA 3IV0A 3DEOA 4UWKA 3VTXA 3ASDA 4FJZA 5LCWC 2EILE 4L7TA 4CRWA 4A3TA 1IKND 2I1JA 2OVBA 1N0QA 1AWCB 3CHPA 3ASFA 3B7TA 4F53A 1E96B 5LP0A 2IOSA 2XS8A 5CCMA 4GU5A 3TG4A 4U8HA 4JW1A 2WXRA 4FHKA 3CLJA 4I6GA 4RSYA 4AXHA 1SZ9A 5FZSA 2L6BA 4CYMD 4AY6A 2GRMA 3RRMB 3UPVA 4DX5D 2IJGX 1BI8B 3PDNA 4NURA 3LVRE 5CBOA 2WXOA 3MEKA 3CHRA 4N5CA 4B8CB 3GZ2A 2WB2A 3J5PA 3RRNB 4WAFA 5AENA 4G8LA 2OEVA 3PRZA 5AQ9A 3AG2E 1B89A 3TWUA 3CKBA 3ZXPA 3BU8A 1PC2A 2KC7A 2FEZA 1GW6A 3TXNA 3CVQA 4PS8A 2QC9A 3DSVA 1OWMA 4DX6D 5EIBE 3GZSA 3PEVB 3SBSA 5G04C 2BTDA 1G3NB 3PUJA 4A63B 4XIFA 1N9AA 3QDNA 4HI9A 2XRYA 2AXUA 4J8DA 3CK9A 5D0OD 4BERA 4CDMA 4NRHB 3R7QA 4EHMA 2F0YA 1MX6A 4NQ0A 3TWQA 3G2UA 4GTOA 3FTYA 2ETAA 4CGVA 4JA7A 3CK7A 3Q73A 4MBGA 4KMOA 3FH7A 3B7RL 4A1SA 2Y4TA 3OXLA 4PDXA 1U2VG 3IXEA 1SQMA 2UY1A 4FC8A 3I3NA 3Q15A 1EPUA 2J4DA 2IY0C 1L5JA 3DSSA 4LRZA 4ANVA 2WVIA 5JJ7A 2VJ8A 4K03A 5FQ4A 1UG3A 3I4GA 2PM7A 4N2SA 3D9PA 3KS2A 2XEVA 2WXQA 4O1OA 2PNNA 3LYAA 5CEDB 4YNDA 4TV3A 3OXFA 3ASHA 2XPYA 3W9GA 5ARGA 4APOA 3AAAC 4WNEA 1QNFA 4DX7D 2L9BA 3LJ3A 2DIWA 2RG8A 2WXGA 4O60A 1INZA 4TUUA 2YNQA 4WNGA 4URKA 2R05A 2I1KA 2BKGA 3AS5A 4HBDA 3D9OA 3ML9A 1OWNA 3T9KA 5ITZF 4GA2A 3NF1A 4EQFA 3QWPA 2WMOA 4BTBA 2P2CP 2IQCA 3Q75A 5FINA 3ZNGA 4A55A 3FTUA 5KNGA 3EHNA 3P2BA 3PZ2A 5CRVA 3V79K 3UINC 4Z68A 4YDEA 3JQ1A 3APDA 4XZ4A 3DEPA 5CECB 2B0OE 4ANUA 5BNWA 3ULYA 4UWGA 3EDTB 3HXFA 2MHKA 4AOFA 2J49A 4WWPA 3X2QE 3FEXA 4WUYA 1NZNA 3DXKG 3ONLA 5ARFA 4DK5A 4QFVA 2PZIA 4GTQA 3UMVA 1E7VA 4UQXA 2GRPB 3SZ7A 1OWPA 1MJ0A 1N54A 5ENTD 3SQVA 5AYWD 3CVLA 3UQ3A 2P9KG 5KJMA 3MV2B 3NBNB 2CHZA 5BT1A 4HRLA 3TG5A 4GZCA 4U0ZA 2FF4A 2EIKE 4HNAD 4LSZE 5BV0A 1S63A 3C3RA 1X81A 1NA3A 3D3MA 1MX2A 4RG6A 4K0RA 4V3IA 5G05J 3V31A 3FUHA 2KCKA 1SW6A 5KBAA 5FWQA 1N94A 2J8SD 5A23A 3Q47B 3IBEA 2JABA 3HXBA 3OTNA 1TEZA 3LY9A 4I6EA 4J8EA 1KLXA 4P29A 3QAQA 3PNTB 1JCSA 4U04A 2I6HA 1TJCA 1N52A 4O1PA 5EDSA 4LERA 2HO1A 3RAUA 1TNYA 3CSTA 4GTMA 3CGHA 2KATA 4OVVA 2YHCA 4CCAA 2VGXA 3ZPJA 4M3OA 3CKCA 2ONDA 4AIFA 5FQ6A 3QARA 5B3SE 3GW4A 3C3OA 2RFMA 4J8FA 4FLHA 4YDWA 5FQ8A 4HOTA 2X6FA 2P9NG 3OXGA 2XEEA 1SA4A 4AEZC 3T8MA 5BXUA 5HS0A 3ML8A 3V30A 1NP7A 1RZ4A 3FU6A 1Q2ZA 4AVXA 4BT8A 1IHGA 3ZN3A 4F6RD 1IQUA 3IHYA 3FUIA 1HO8A 3CHQA 3PZ1A 1KZPA 1KT0A 3DSUA 4H7XA 2A4ZA 4UI9J 4UWFA 3LXUX 4YDYA 4R7LA 1WAO1 1O1TA
chains in the Genus database with same CATH topology
3LVQE 2IU1A 3U4TA 2WXRA 4FHKA 3CLJA 4I6GA 4PH4B 4RSYA 3PE3A 4AXHA 1SZ9A 4EPZA 3D9IA 5FZSA 2VGXB 2V5FA 2DCPA 2V8SE 5M72A 4O6FA 4RG9A 3FTZA 4KVMA 4CGWA 4AY6A 2GRMA 4XI9A 2CHXA 3RRMB 2C2LA 3S7JA 4ACKA 4ATGA 3UPVA 4KBQA 5CMYA 4TRQA 3QWWA 4LUNU 3WXXA 3HYMB 2IJGX 2R5SA 4EECA 1UW4B 2C0MA 2AXVA 4J6IA 3CR3A 3B7SA 3PDNA 4NURA 3ZXSA 3LVRE 4G1TA 5EKQD 5BV1A 2GGFA 2WXOA 2ILRA 3HVEA 1HE8A 1H6KA 3CHRA 3MEKA 4N5CA 3CVXA 4L2YA 3FULA 2OOEA 3GZ2A 4B8CB 2WB2A 5LCWJ 2GRLA 2WMNA 3FH5A 3FUEA 4Y6CA 4NACA 4WAFA 3RRNB 3VLEA 3PRZA 5AENA 1B89A 4KYOB 3PREA 3RK6A 2AXZA 2C0LA 2Y3AA 3Q4AB 4E85A 3CKBA 2AWIA 1Z3XA 1PC2A 4KVOA 2KC7A 4HORA 2FEZA 1GW6A 3TXNA 4BY6A 3PVLA 4BX9A 1HH8A 4I1MA 3CVQA 4I1OB 1HZ4A 3CHMA 4DPRA 4PS8A 3FU5A 4E6HA 3FFLA 2WXFA 3CHOA 4I43A 3ENEA 5J08A 1OWMA 4B94A 5JHAA 1WY6A 2IONA 4BX8A 1IYGA 3FY4A 4N39A 2PQRA 4CEMA 3CVUA 3Q5MA 4C9BB 5LOZA 3CQGB 3RO3A 2NC9A 3ZHEA 3O48A 1OWLA 4N2QA 3LCAA 3GZSA 3RJVA 2LO6A 1ZBPA 3PEVB 2VSYA 3R7RA 4Y6WA 3SBSA 4UQZA 1IQRA 2EQXA 1HG2A 3URZA 2VYIA 2AW6A 1HU3A 3L13A 3TJPA 4AM9A 4BWRA 4U07A 3AS4A 5G04C 3NZUA 4XE0A 2BTDA 4GMLA 3PUJA 3T5VA 3NQPA 3FUKA 1UJKA 4F7AA 3EIQC 4L1BA 3CVVA 4CT4A 2YHEA 1EDUA 3CVWA 4XIFA 3L54A 3QDNA 3D9LA 3D9JA 4HOQA 2VGYA 3HVEB 5FZQA 5FZRA 4HS2A 3SHFA 2XRYA 4N3AA 4UWLA 2AXUA 4J8DA 1HG5A 2FO7A 3CK9A 4UI9K 5D0OD 4FHJA 1VDYA 4BTAA 5CHEE 3ZIMA 3U9WA 3CK8A 4PS3A 3L17A 2VSXE 4CDMA 2OV8A 5KJKA 4NRHB 2XRZA 2WXIA 3FTXA 3R7QA 2NXPA 2XGOA 3I5PA 1JPLA 3APFA 2WPVA 4NQ0A 2V0PA 4G2VA 1MQSA 2R59A 2OVFA 3G2UA 3G2VA 4ILHB 3TL5A 1HS6A 2PQNA 2X6HA 3ZRHA 3FTYA 5C1DA 4PS7A 3EIJA 2L0TB 4CGVA 4JA7A 5LX8A 3CK7A 2E2EA 2RD0A 3P1UA 4G11A 3CVPA 1Z3YA 4KMOA 3FH7A 5AJLA 5FT9A 2YQ8A 2KCLA 3B7RL 4A1SA 5EX3A 3CIAA 2Y4TA 2Y4UA 3OXLA 4PDXA 2LNIA 3QOUA 2VSOE 3LDZA 3ZW3A 1SQMA 4EZLA 5T4YA 2I2OA 3DBSA 5HI7A 4XI0A 5AJDA 2XPIA 2UY1A 1PAQA 4FC8A 2J07A 3JCKC 4GAAA 5BW8C 2VSNA 2XHEA 2BUGA 3L22A 5ANLA 4B0ZA 2LAIA 3I3NA 3Q15A 4JXTA 4DLOA 2A5UA 1EPUA 3FU0A 5LFAA 2J4DA 4EBAG 4OYSA 4MS6A 4UWHA 4HFGA 1L5JA 1WM5A 1A17A 1MHQA 2PL2A 3QC1A 4GZ5A 5G04J 2HR2A 3VTYA 4LRZA 4ANVA 4YVOA 3ZYKA 2CFUA 2WVIA 2WXMA 3K9IA 3OAWA 3PH0C 5JJ7A 2VJ8A 3KAEA 4A3VA 3LY8A 2L0IA 3SFZA 1S0PA 4K03A 3TGOA 5FQ4A 3BG1B 1UG3A 3I4GA 3CVYA 2PM7A 3UUXA 1EF1C 4N2SA 3D9PA 3FTWA 4PUCA 5FQ7A 3KS2A 4DI3A 1ELWA 3ZYQA 2XEVA 4OVUA 3PS6A 4GYOA 2WXQA 4I1AA 4IRUA 3ZFWA 3DPDA 4KZCA 2WXPA 3EHMA 4GMJA 3LYAA 4GZ3A 4ANXA 4GYYA 2HYZA 4I6JA 4YNDA 4TV3A 3CEQA 4I2WA 5JJTA 3AU4A 3OXFA 4JL0A 4HXIA 4U0SA 4B8AA 2WM9A 4EZJA 2MRIA 2WXKA 2XPYA 3ASHA 4ME2A 5ARGA 4B89A 4APOA 3CSFA 1YA0A 2CFZA 4WNEA 3KD7A 1HFAA 2HM8A 1H2VC 4EBAA 3JQ0A 4GZDA 1QNFA 3RIBA 2L9BA 3LJ3A 1OWOA 2DIWA 2KZTA 2RG8A 3E4BA 2WXGA 3MA5A 4JEHA 4Q94A 1BPOA 1JWGA 1INZA 2UY1B 3SBTB 3SF4A 3RO2A 4TUUA 3S2AA 2YNQA 3MZLB 2IOLA 4WNGA 3CQCB 4URKA 5E75A 1LF8A 4JEUA 2Q7FA 3LPZA 4FA6A 2I1KA 3FP3A 4N3BA 4H7YA 3AS5A 3QJZA 3BEEA 4F1SA 1E7UA 3D9OA 3ML9A 4DJAA 1OWNA 3FDHA 3FUNA 3L6AA 4HLEA 2J9QA 4MLPA 2CHWA 3U66A 3MV3B 1OUVA 4GA2A 3NF1A 4EQFA 2VTBA 4C0EA 3IEGA 4DLQA 5KJLA 3QWPA 1UJJA 2WXHA 2WMOA 3CVNA 4BTBA 3VLFA 2FI7A 4U63A 3QK0A 2IQCA 4G24A 4WWNA 5J90A 4AY5A 1H2UA 4A55A 1X5BA 4XX5A 3ESKA 2J08A 3FTUA 3QWVA 1FVHA 4G23A 4AP2A 1ZU2A 1UN8A 4FJYA 1ELKA 3EHNA 5T8IA 3P2BA 4RVBA 3RRUA 3C98A 4GPKA 3U3WA 3ZGQA 2WXNA 3SNXA 3HIZA 2CG3A 4GCNA 2QY7A 2WQHA 2KCVA 5DBKA 3ZYLA 2AVPA 3G2WA 4CDRA 3GYZA 4FLBA 2JLBA 1E8YA 3JQ1A 3MKRA 2P58C 3APDA 4XZ4A 3PNLB 5G05C 2KZTB 2LAHA 3ASGA 3CHSA 3FTVA 3MKQA 3PE4A 3SGHA 4ANUA 4WWOA 4MRUA 3ZHEB 2PM6A 5BNWA 4GA1A 4UWGA 3B13A 2CG2A 3EDTB 2MHKA 4IYPA 4I17A 4A1GA 2J49A 4WWPA 4AOFA 3LKUA 1H2TC 2BF0X 3JYSA 1U3DA 4FULA 1HX8A 3FUMA 5EX0A 1E8WA 1Y6IA 4GCOA 3FTSA 4I9EA 3FEXA 3GZ1A 4I2ZA 4WUYA 5CMWA 3TAXA 2QFCA 2UWJG 4BT9A 1NZNA 4AV7A 3MGBA 2VTBB 1E90A 2LSUA 1HF8A 4ILIA 4JC8A 4UQYA 3ONLA 3IKOB 4GYWA 3FU3A 1Z6TA 4JA9A 5ARFA 3ZEFA 4QFVA 4DK5A 3ZYMA 2PZIA 3N71A 1EYHA 1HXIA 2ZU6B 2KM4A 3NZSA 3UMVA 2XGMA 1E8ZA 4FADA 5JHBA 3D9NA 1E7VA 4WNDA 4UQXA 2GW1A 4JHKA 4FU3A 1UN9A 4DI4A 4XKCA 3G2SA 1OWPA 4HOUA 3SZ7A 4F3VA 2MOWA 1N54A 5AYWD 2L6JA 3CVLA 2VQ2A 5A7DB 3UQ3A 3D9MA 4XKBA 5KJMA 4L23A 1H19A 3MV2B 3FWVA 3EJNA 4KZ0A 3LEWA 4HOSA 1QZ2A 3UT4A 2CHZA 3ONKA 5BT1A 5HQ8A 4MKTA 4G26A 1QQEA 3TG5A 5FJYA 4APFA 3PEUB 1PY1A 2X38A 4GZCA 4U0ZA 3S7FA 3UT7A 3MCXA 2NSZA 4LEUA 2XCCA 3APCA 2FF4A 4YVQC 2WQ7A 2J09A 3MKQB 5BV0A 3ULQA 1E8XA 4L2LA 4ILGA 3QNKA 3HHMA 4Q96A 3PUKA 1NA3A 4ACLA 2R17C 1XGWA 3B7UX 3D3MA 5ANRA 1XNFA 3CV0A 5CCLA 4RG6A 3TXMA 4K0RA 4KT6B 4V3IA 3I4RB 5G05J 5G55A 4IN3B 3FUHA 3HDXA 3FUFA 1KT1A 2KCKA 5AIJA 5FWQA 3VLDA 2IFUA 2WXLA 3QKYA 2XPZA 4GA0A 3L08A 3LY7A 3FH8A 1TJFA 3BG0B 3UX4A 3MX3A 4CT0A 3PZDA 4JVSA 3Q47B 5A23A 3FUDA 3JUIA 4W9RA 4GB9A 3IBEA 1FCHA 2DBAA 5KJNA 1DVPA 3R9AB 4C0MA 3OTNA 3QB2A 1TEZA 3O4ZA 4UI9C 3LY9A 2X6JA 4LCTA 3UT8A 4J0UA 4I9CA 4I6EA 4J8EA 1KLXA 3S7DA 4P29A 4BSXA 2I9CA 3QAQA 3PNTB 2X6KA 4U04A 2I6HA 1TJCA 3FEYA 3Q49B 1N52A 5T3RA 5EDSA 3MYVA 2YINA 1JWFA 3L16A 4LERA 4EZKA 1W3BA 3G2TA 4JHJA 2JEKA 4BFRA 2HO1A 3IHVA 1JUQA 4HVBA 2E0IA 1U3CA 4U0UA 3FHEA 1DNPA 5KCMA 3ESLA 3CSTA 1Y8MA 3D9KA 3CGHA 2WXJA 2FBNA 2KATA 4OVVA 2YHCA 3FUJA 5G2NA 4CCAA 4N3CA 2VGXA 3ZPJA 4J8SA 3IV0A 4M3OA 3CKCA 4IULA 4WNFA 5D0QD 4UWKA 3VTXA 2ONDA 4FP7A 3SD5A 3LS8A 3AU5A 4AIFA 4GZ6A 5ENNA 4AJWA 5DIZA 4G25A 2J4BA 3ASDA 3U64A 5FQ6A 3QARA 4FJZA 3ZVVA 1FVFA 1P5QA 5C2YA 2V4LA 2XCBA 3GW4A 5LCWC 4J8FA 4FLHA 5A6CA 5FQ8A 4HOTA 1ELRA 2X6FA 5BUZA 3OXGA 4CDNA 4AEZC 2IF4A 3T8MA 4KXKB 4ABNA 4L7TA 3ML8A 4D10C 4CRWA 1NP7A 3FU6A 4A3TA 5BPPA 2I1JA 2OVBA 4JZYA 3MJWA 4AVXA 2X6IA 3S7BA 4BT8A 2LSVA 5FTPA 1IHGA 4ANWA 4JHRA 4Q69A 3ZN3A 3CHPA 1IQUA 3ASFA 3RKVA 3B7TA 3IHYA 5JJ6A 3AS8A 2X3MA 3FUIA 1HO8A 1SZAA 2XQ0A 3CHQA 3T5XA 4F53A 2M63A 1E96B 1KT0A 4JPSA 5LP0A 2WQ6A 2IOSA 2XGSA 4H7XA 5CCMA 5E76A 1H0AA 2A4ZA 3KEZA 2FULA 4GU5A 1NA0A 4UI9J 3SI5A 4UWFA 3LXUX 3TG4A 4U8HA 4R7LA 3RU0A 1WAO1 4JW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BF0 X;  1UJK A;  1XGW A;  1JPL A;  3CLJ A;  4GZD A;  2QY7 A;  3D9P A;  4AVX A;  1HX8 A;  3D9M A;  1SZ9 A;  4Q96 A;  3D9I A;  3G2U A;  3G2W A;  3G2V A;  1UJJ A;  1EDU A;  5LOZ A;  2DCP A;  2V8S E;  2DIW A;  3ZYQ A;  4JXT A;  3D9L A;  3D9J A;  2L0T B;  4NAC A;  4Q94 A;  1JWG A;  4FLB A;  3ZYL A;  1HF8 A;  1SZA A;  3ONK A;  1INZ A;  3ONL A;  1X5B A;  2LO6 A;  1JWF A;  4HFG A;  5CMW A;  1HG5 A;  1PY1 A;  1MHQ A;  4GZC A;  5CMY A;  3G2T A;  1LF8 A;  3ZYM A;  5LP0 A;  1VDY A;  1JUQ A;  1ELK A;  1EYH A;  3ZYK A;  2KM4 A;  1HG2 A;  1H0A A;  3D9O A;  3D9N A;  3RRU A;  3D9K A;  2L0I A;  4FU3 A;  1DVP A;  3G2S A;  1HFA A;  3LDZ A;  2MOW A;  5J08 A; 
#chains in the Genus database with same CATH topology
 3LVQ E;  1TYQ G;  4ATZ D;  2V5F A;  5M72 A;  2V8S E;  4O6F A;  1YYH A;  2CHX A;  2C2L A;  3S7J A;  4ACK A;  4KBQ A;  3WXX A;  2C0M A;  2AXV A;  3TWS A;  4G1T A;  2ILR A;  4L2Y A;  5LCW J;  2GRL A;  3FH5 A;  3FUE A;  4Y6C A;  2DZN A;  4KYO B;  2AXZ A;  4E85 A;  2DZO A;  1Z3X A;  3EHR A;  4KVO A;  2R2L A;  4HOR A;  4BX9 A;  1HH8 A;  4I1O B;  4E6H A;  4I43 A;  5J08 A;  5JHA A;  2HE0 A;  3FY4 A;  5B1A E;  5LOZ A;  3RO3 A;  3O48 A;  3LCA A;  4RQI A;  2LO6 A;  1ZBP A;  2VSY A;  4Y6W A;  3Q7A A;  2GRR B;  3TJP A;  2R03 A;  4XE0 A;  3T5V A;  4XEI G;  4NIK A;  4B93 B;  1UJK A;  3EIQ C;  4CT4 A;  3KSL A;  2GRN B;  3R9M A;  1EDU A;  3CVW A;  2XZT G;  4TXR A;  4HOQ A;  1TNO A;  5FZQ A;  4GTT A;  5FZR A;  3SHF A;  3E34 A;  2P9U G;  2FO7 A;  2V4H C;  3U9W A;  2OV8 A;  2XRZ A;  3FTX A;  3UM2 A;  2XGO A;  3I5P A;  1JPL A;  4G2V A;  3PZ3 A;  2OVF A;  3ISM C;  1WDY A;  4G11 A;  3HXC A;  2FO1 E;  1N0R A;  2XEH A;  2YQ8 A;  4ZHB A;  5EX3 A;  2Y4U A;  3ZW3 A;  5HI7 A;  5AJD A;  5H7P A;  1N4R A;  1PAQ A;  4GAA A;  2J07 A;  3JCK C;  4AJW A;  2VSN A;  2XHE A;  5ANL A;  5JA4 D;  5FIO A;  3JXJ A;  4MS6 A;  1WM5 A;  1A17 A;  5G04 J;  4TXQ A;  3PH0 C;  2L0I A;  1OCR E;  3DRA A;  1EF1 C;  3FTW A;  3KSQ A;  4DI3 A;  5EID A;  1LD8 A;  4GYO A;  2DVW A;  4KZC A;  2WXP A;  4GZ3 A;  4GYY A;  4I6J A;  5AQA A;  3CEQ A;  4U7E B;  2F8X K;  4U0S A;  4B8A A;  4B89 A;  1O1S A;  2HM8 A;  1H2V C;  3ASO E;  3TWW A;  3C72 A;  2UY1 B;  5E75 A;  1LF8 A;  5ENS D;  3FP3 A;  4H7Y A;  4DX2 A;  2DWZ A;  3QJZ A;  3BEE A;  3L6A A;  2J9Q A;  4MLP A;  2CHW A;  3MV3 B;  3ABL E;  5KJL A;  1DCQ A;  5J90 A;  4WWN A;  4AY5 A;  4CZ2 D;  1BU9 A;  2J08 A;  3QWV A;  1ZU2 A;  4FJY A;  4RVB A;  4F1P A;  3C98 A;  4GPK A;  3Q9N C;  2WXN A;  2CG3 A;  2QY7 A;  1TN7 A;  3ZYL A;  2QYU A;  3SFX A;  1N11 A;  3GYZ A;  4FLB A;  2VGE A;  3AJI A;  1KPS B;  2LAH A;  3ASG A;  3CHS A;  2NYJ A;  4WWO A;  4MRU A;  3ZHE B;  4GA1 A;  4A1G A;  3LKU A;  1H2T C;  2BF0 X;  3JYS A;  3FUM A;  5BW8 C;  1E8W A;  1Y6I A;  2F37 A;  3FTS A;  4GCO A;  4I9E A;  2QFC A;  4AV7 A;  3MGB A;  1E90 A;  3UM3 A;  4ILI A;  4JC8 A;  4UQY A;  1LD7 A;  3ZYM A;  1QYM A;  3N71 A;  2KM4 A;  5JHB A;  4WND A;  2GW1 A;  3L9T A;  5ENR D;  3D9M A;  3EU9 A;  4XKB A;  4L23 A;  1H19 A;  5EN5 D;  3FWV A;  2XEN A;  1OCO E;  3LEW A;  3TWR A;  4HOS A;  3UT4 A;  2IEJ A;  2X38 A;  5KNH D;  4ZFH A;  2NSZ A;  4LEU A;  1ZB1 A;  2WQ7 A;  4YVQ C;  3T8K A;  1E8X A;  4ILG A;  3B7U X;  2LXL A;  5G55 A;  3I4R B;  2BKK B;  2ETB A;  2WXL A;  3QKY A;  3L08 A;  3LY7 A;  2B6C A;  3ASN E;  4GTV A;  4W9R A;  1K1B A;  4GB9 A;  1FCH A;  1DVP A;  3DWL G;  4LCT A;  4J0U A;  1TN8 A;  4BSX A;  2I9C A;  2QZA A;  3FEY A;  4U95 D;  3MYV A;  1JWF A;  2F8Y A;  3G2T A;  2JEK A;  5AAR A;  4HVB A;  1U3C A;  1DNP A;  5KCM A;  1Y8M A;  2FBN A;  1FT2 A;  3Q78 A;  4J8S A;  2Y69 E;  5D0Q D;  4FP7 A;  3SD5 A;  3LS8 A;  4GZ6 A;  3ZVV A;  5DIZ A;  3U64 A;  5C1D A;  1P5Q A;  5C2Y A;  1N4P A;  5BUZ A;  4CDN A;  2ZIS A;  4K5B A;  2IF4 A;  2XS1 A;  4KXK B;  4ABN A;  4D10 C;  3NB2 A;  3MJW A;  2X6I A;  4ANW A;  3UTM A;  3SY2 A;  5JJ6 A;  2X3M A;  3L82 A;  2BED A;  2XQ0 A;  3T5X A;  3RSE G;  2WQ6 A;  4JB8 P;  1V55 E;  2LUH A;  2FUL A;  4X8Q A;  5AQ7 A;  2IU1 A;  3TWX A;  2VGX B;  3FTZ A;  4KVM A;  4CGW A;  4ATG A;  2P9P G;  3NOG D;  5CMY A;  3QWW A;  3D9H A;  1H6O A;  2R5S A;  4EEC A;  3ZUV B;  4J6I A;  3CR3 A;  5BV1 A;  2QYJ A;  3Q79 A;  3CVX A;  3HVE A;  4NAC A;  3BQO A;  3HG0 D;  3RK6 A;  2Y3A A;  4BY6 A;  3PVL A;  4DPR A;  3FU5 A;  3CHO A;  2P9L G;  4B94 A;  1WY6 A;  2ION A;  1IYG A;  4N39 A;  2PQR A;  3Q5M A;  4C9B B;  1OXJ A;  1O5M A;  3CQG B;  4N2Q A;  5HRY A;  3R7R A;  4UQZ A;  1IQR A;  3EHQ A;  4HI8 A;  1OCZ E;  2DYR E;  1HG2 A;  3URZ A;  2AW6 A;  1HU3 A;  4AM9 A;  4TUM A;  4F7A A;  1QBQ A;  4J8Y A;  2XZD G;  2VGY A;  4HS2 A;  4N3A A;  4UWL A;  5D2M C;  1NFI E;  3Q7F A;  3UI2 A;  2V5Q C;  4FHJ A;  1VDY A;  1D8D A;  3ULE G;  2Y1L E;  5KJK A;  2EIM E;  2WXI A;  2WPV A;  2V0P A;  1MQS A;  2R59 A;  2ZIR A;  4L9P A;  3TL5 A;  2H6G A;  4PS7 A;  3EIJ A;  2L0T B;  3B95 A;  3B7B A;  3CVP A;  5AJL A;  5FT9 A;  3UM0 A;  1H6P A;  1MZC A;  5BXO A;  2LNI A;  2VSO E;  3JXI A;  3LDZ A;  4EZL A;  5T4Y A;  1UOH A;  2I2O A;  4LNU D;  4HRM B;  4B0Z A;  4EBA A;  2BUG A;  4DLO A;  3FU0 A;  2H6F A;  5LFA A;  4EBA G;  4OYS A;  4UWH A;  4HFG A;  1MHQ A;  2PL2 A;  3QC1 A;  4GZ5 A;  2CFU A;  3OAW A;  4A3V A;  3TGO A;  2ZGG A;  3CVY A;  2LXM A;  3C3Q A;  5FQ7 A;  1ELW A;  3ZYQ A;  3PS6 A;  4IRU A;  3DPD A;  3EHM A;  4GMJ A;  4ANX A;  4K5C A;  4I2W A;  4JL0 A;  4EZJ A;  4ME2 A;  2WXK A;  3CSF A;  4DX1 A;  1YA0 A;  2CFZ A;  3JQ0 A;  4C48 B;  4GZD A;  2GRQ B;  1TNU A;  1OWO A;  2KZT A;  3E4B A;  4Q94 A;  1BPO A;  1JWG A;  3S2A A;  2IOL A;  2DYS E;  3CQC B;  4JEU A;  2Q7F A;  3LPZ A;  4FA6 A;  4RLY A;  4F1S A;  3FDH A;  3FUN A;  2ZXW E;  4HLE A;  1OUV A;  3UKR G;  4DUI A;  2VTB A;  4DLQ A;  1UJJ A;  2WXH A;  3CVN A;  2FI7 A;  3QK0 A;  1H2U A;  2OEW A;  4G23 A;  1UN8 A;  5T8I A;  3RRU A;  2ETC A;  3UM1 A;  3U3W A;  2R02 A;  3ZGQ A;  3HIZ A;  3HXD A;  4GCN A;  5JMN D;  1LTX A;  5CBN A;  2IO2 C;  2JLB A;  2P58 C;  2Y0B G;  3FTV A;  3MKQ A;  3PE4 A;  2PM6 A;  4JD2 G;  3B13 A;  4IYP A;  1SA5 A;  1U3D A;  1HX8 A;  3ZIM A;  1YCS B;  3TAX A;  2LSU A;  1HF8 A;  3FU3 A;  1Z6T A;  4JA9 A;  1HXI A;  2ZU6 B;  3NZS A;  1E8Z A;  3D9N A;  4JHK A;  4FU3 A;  1UN9 A;  3V2X A;  3G2S A;  2L6J A;  2ZGD A;  1S70 B;  2VQ2 A;  5A7D B;  4QQI A;  4KZ0 A;  3EJN A;  1QZ2 A;  3ONK A;  5FJY A;  3PEU B;  3UT7 A;  3MCX A;  1OCC E;  2XCC A;  3APC A;  1O1R A;  4L2L A;  3QNK A;  3SFY A;  2OCC E;  4BEP A;  1XGW A;  1XNF A;  4IN3 B;  3HDX A;  3FUF A;  2XPZ A;  4GA0 A;  4M7C A;  3FH8 A;  1TJF A;  4CT0 A;  3MX3 A;  3PZD A;  4JVS A;  3FUD A;  3JUI A;  3C5R A;  1TN6 A;  2DBA A;  4C0M A;  3O4Z A;  4YDO A;  1BD8 A;  4U8V D;  3L16 A;  4JHJ A;  4BFR A;  4OAU C;  1JUQ A;  4U0U A;  3FHE A;  5CER B;  3D9K A;  3AG1 E;  5KWD A;  5G2N A;  4N3C A;  4IUL A;  4WNF A;  1JCR A;  1D8E A;  3AU5 A;  1N4Q A;  5ENN A;  2GRO B;  4G25 A;  2J4B A;  1FVF A;  2V4L A;  2XCB A;  1K3Z D;  3TWV A;  5A6C A;  1ELR A;  4N5Q A;  5EIL A;  5BPP A;  2RFA A;  4JZY A;  3S7B A;  2LSV A;  5FTP A;  1S64 A;  4JHR A;  4Q69 A;  2H6I A;  3RKV A;  3AS8 A;  4GTP A;  3HRA A;  1SZA A;  2M63 A;  3DSW A;  4JPS A;  2XGS A;  5E76 A;  1H0A A;  3KEZ A;  1NA0 A;  3SI5 A;  3RU0 A;  1D9S A;  3U4T A;  4PH4 B;  3PE3 A;  4EPZ A;  3D9I A;  2DCP A;  1K1A A;  4RG9 A;  3UIP C;  4XI9 A;  3J5Q B;  4TRQ A;  3JUE A;  3TWT A;  4LUN U;  3HYM B;  1UW4 B;  3B7S A;  3ZXS A;  5EKQ D;  4HQD A;  2GGF A;  1HE8 A;  1H6K A;  3FUL A;  2OOE A;  5AN8 A;  4LNB A;  2WMN A;  3AG3 E;  4LG6 A;  3VLE A;  3DST A;  3PRE A;  2C0L A;  3Q4A B;  4OAV B;  2RKK A;  2AWI A;  4I1M A;  1HZ4 A;  3CHM A;  3WG7 E;  3FFL A;  2WXF A;  3ENE A;  4BX8 A;  4GMR A;  4CEM A;  1NL4 A;  3CVU A;  5CEA A;  1NI1 A;  3NOC D;  3E33 A;  2NC9 A;  3ZHE A;  1OWL A;  4TXP A;  3RJV A;  3EU5 A;  4G8K A;  3E32 A;  2EQX A;  2VYI A;  3L13 A;  4BWR A;  4U07 A;  3AS4 A;  3NZU A;  3ABM E;  4GML A;  3NQP A;  3FUK A;  4L1B A;  3CVV A;  2YHE A;  1YMP A;  3L54 A;  3D9L A;  3D9J A;  3HVE B;  1V54 E;  1HG5 A;  3KEA A;  4UI9 K;  4HRN A;  4BTA A;  4LNG A;  1TNZ A;  5CHE E;  1MYO A;  3F6Q A;  4U96 D;  3CK8 A;  5ENO D;  4PS3 A;  3L17 A;  2VSX E;  4GTR A;  4GPM A;  2NXP A;  3APF A;  5ENQ D;  4HLL A;  3G2V A;  3ZRH A;  4ILH B;  4K5A B;  1HS6 A;  2PQN A;  2X6H A;  1BI7 B;  5LX8 A;  2E2E A;  2RD0 A;  3P1U A;  4HB5 A;  1Z3Y A;  2EIJ E;  2KCL A;  5CRU A;  2P9I G;  3CIA A;  3ZU7 B;  1Z5S C;  1TNB A;  1WG0 A;  3QOU A;  1RW2 A;  3AG4 E;  3DBS A;  4XI0 A;  5AQB A;  2XPI A;  3L22 A;  2LAI A;  4JXT A;  4UUC A;  2A5U A;  1IHB A;  2IO3 C;  3VTY A;  2HR2 A;  4YVO A;  3ZYK A;  2WXM A;  3K9I A;  3KAE A;  3LY8 A;  3ABK E;  3SFZ A;  1S0P A;  3BG1 B;  4J7W A;  3UUX A;  4PUC A;  4OVU A;  4I1A A;  1DCE A;  3ZFW A;  3UKU G;  4U8Y D;  2HYZ A;  5JJT A;  3AU4 A;  4HXI A;  5HKP A;  2WM9 A;  3DXM G;  2MRI A;  3KD7 A;  1HFA A;  5ENP D;  2KBX A;  3RIB A;  4JEH A;  3MA5 A;  4BSZ B;  3SBT B;  3SF4 A;  3RO2 A;  1KZO A;  3W9F A;  1FPP A;  3MZL B;  3Q9U C;  4N3B A;  3UXG A;  1E7U A;  4DJA A;  3U66 A;  2MYO A;  4BES A;  4C0E A;  3IEG A;  3VLF A;  4U63 A;  3E37 A;  4G24 A;  3ZKJ A;  1X5B A;  4XX5 A;  3ESK A;  5D66 A;  1TR4 A;  1FVH A;  2AJA A;  4AP2 A;  1ELK A;  3HXE A;  3SNX A;  3EUV A;  2WQH A;  2KCV A;  5DBK A;  2AVP A;  3G2W A;  4CDR A;  1E8Y A;  3MKR A;  1DC2 A;  3PNL B;  5G05 C;  2KZT B;  3SGH A;  3V2O A;  2CG2 A;  3E30 A;  4I17 A;  3LJN A;  1MX4 A;  4FUL A;  1FT1 A;  5EX0 A;  4I2Z A;  3GZ1 A;  5CMW A;  2UWJ G;  3NAW A;  4BT9 A;  5AAO A;  2VTB B;  3IKO B;  4GYW A;  3ZEF A;  1EYH A;  4FAD A;  2XGM A;  5IY5 E;  1JCQ A;  4DI4 A;  4XKC A;  4HOU A;  4F3V A;  2MOW A;  3UIO C;  5B1B E;  3DSX A;  1AP7 A;  1SVX A;  5HQ8 A;  4BET A;  4MKT A;  4G26 A;  1QQE A;  4APF A;  3DPY A;  1PY1 A;  3S7F A;  2A5E A;  1A5E A;  2J09 A;  3MKQ B;  3ULQ A;  3HHM A;  4Q96 A;  3PUK A;  5EYP F;  4ACL A;  2R17 C;  5ANR A;  3CV0 A;  5CCL A;  3TXM A;  4KT6 B;  1KT1 A;  5AIJ A;  3VLD A;  1IXV A;  1N95 A;  2IFU A;  1N4S A;  2EIN E;  1OT8 A;  3BG0 B;  3UX4 A;  2P9S G;  3PZ4 A;  5KJN A;  3R9A B;  3QB2 A;  4UI9 C;  2X6J A;  3UT8 A;  4I9C A;  1OY3 D;  5EYL A;  3S7D A;  4DRX E;  3BUA A;  2X6K A;  3Q49 B;  1BLX B;  2H6H A;  5T3R A;  2YIN A;  4EZK A;  2KXP C;  1W3B A;  1K8K G;  3IHV A;  2E0I A;  3ESL A;  2WXJ A;  3SO8 A;  3FUJ A;  4GTS A;  3IV0 A;  3DEO A;  4UWK A;  3VTX A;  3ASD A;  4FJZ A;  5LCW C;  2EIL E;  4L7T A;  4CRW A;  4A3T A;  1IKN D;  2I1J A;  2OVB A;  1N0Q A;  1AWC B;  3CHP A;  3ASF A;  3B7T A;  4F53 A;  1E96 B;  5LP0 A;  2IOS A;  2XS8 A;  5CCM A;  4GU5 A;  3TG4 A;  4U8H A;  4JW1 A;  2WXR A;  4FHK A;  3CLJ A;  4I6G A;  4RSY A;  4AXH A;  1SZ9 A;  5FZS A;  2L6B A;  4CYM D;  4AY6 A;  2GRM A;  3RRM B;  3UPV A;  4DX5 D;  2IJG X;  1BI8 B;  3PDN A;  4NUR A;  3LVR E;  5CBO A;  2WXO A;  3MEK A;  3CHR A;  4N5C A;  4B8C B;  3GZ2 A;  2WB2 A;  3J5P A;  3RRN B;  4WAF A;  5AEN A;  4G8L A;  2OEV A;  3PRZ A;  5AQ9 A;  3AG2 E;  1B89 A;  3TWU A;  3CKB A;  3ZXP A;  3BU8 A;  1PC2 A;  2KC7 A;  2FEZ A;  1GW6 A;  3TXN A;  3CVQ A;  4PS8 A;  2QC9 A;  3DSV A;  1OWM A;  4DX6 D;  5EIB E;  3GZS A;  3PEV B;  3SBS A;  5G04 C;  2BTD A;  1G3N B;  3PUJ A;  4A63 B;  4XIF A;  1N9A A;  3QDN A;  4HI9 A;  2XRY A;  2AXU A;  4J8D A;  3CK9 A;  5D0O D;  4BER A;  4CDM A;  4NRH B;  3R7Q A;  4EHM A;  2F0Y A;  1MX6 A;  4NQ0 A;  3TWQ A;  3G2U A;  4GTO A;  3FTY A;  2ETA A;  4CGV A;  4JA7 A;  3CK7 A;  3Q73 A;  4MBG A;  4KMO A;  3FH7 A;  3B7R L;  4A1S A;  2Y4T A;  3OXL A;  4PDX A;  1U2V G;  3IXE A;  1SQM A;  2UY1 A;  4FC8 A;  3I3N A;  3Q15 A;  1EPU A;  2J4D A;  2IY0 C;  1L5J A;  3DSS A;  4LRZ A;  4ANV A;  2WVI A;  5JJ7 A;  2VJ8 A;  4K03 A;  5FQ4 A;  1UG3 A;  3I4G A;  2PM7 A;  4N2S A;  3D9P A;  3KS2 A;  2XEV A;  2WXQ A;  4O1O A;  2PNN A;  3LYA A;  5CED B;  4YND A;  4TV3 A;  3OXF A;  3ASH A;  2XPY A;  3W9G A;  5ARG A;  4APO A;  3AAA C;  4WNE A;  1QNF A;  4DX7 D;  2L9B A;  3LJ3 A;  2DIW A;  2RG8 A;  2WXG A;  4O60 A;  1INZ A;  4TUU A;  2YNQ A;  4WNG A;  4URK A;  2R05 A;  2I1K A;  2BKG A;  3AS5 A;  4HBD A;  3D9O A;  3ML9 A;  1OWN A;  3T9K A;  5ITZ F;  4GA2 A;  3NF1 A;  4EQF A;  3QWP A;  2WMO A;  4BTB A;  2P2C P;  2IQC A;  3Q75 A;  5FIN A;  3ZNG A;  4A55 A;  3FTU A;  5KNG A;  3EHN A;  3P2B A;  3PZ2 A;  5CRV A;  3V79 K;  3UIN C;  4Z68 A;  4YDE A;  3JQ1 A;  3APD A;  4XZ4 A;  3DEP A;  5CEC B;  2B0O E;  4ANU A;  5BNW A;  3ULY A;  4UWG A;  3EDT B;  3HXF A;  2MHK A;  4AOF A;  2J49 A;  4WWP A;  3X2Q E;  3FEX A;  4WUY A;  1NZN A;  3DXK G;  3ONL A;  5ARF A;  4DK5 A;  4QFV A;  2PZI A;  4GTQ A;  3UMV A;  1E7V A;  4UQX A;  2GRP B;  3SZ7 A;  1OWP A;  1MJ0 A;  1N54 A;  5ENT D;  3SQV A;  5AYW D;  3CVL A;  3UQ3 A;  2P9K G;  5KJM A;  3MV2 B;  3NBN B;  2CHZ A;  5BT1 A;  4HRL A;  3TG5 A;  4GZC A;  4U0Z A;  2FF4 A;  2EIK E;  4HNA D;  4LSZ E;  5BV0 A;  1S63 A;  3C3R A;  1X81 A;  1NA3 A;  3D3M A;  1MX2 A;  4RG6 A;  4K0R A;  4V3I A;  5G05 J;  3V31 A;  3FUH A;  2KCK A;  1SW6 A;  5KBA A;  5FWQ A;  1N94 A;  2J8S D;  5A23 A;  3Q47 B;  3IBE A;  2JAB A;  3HXB A;  3OTN A;  1TEZ A;  3LY9 A;  4I6E A;  4J8E A;  1KLX A;  4P29 A;  3QAQ A;  3PNT B;  1JCS A;  4U04 A;  2I6H A;  1TJC A;  1N52 A;  4O1P A;  5EDS A;  4LER A;  2HO1 A;  3RAU A;  1TNY A;  3CST A;  4GTM A;  3CGH A;  2KAT A;  4OVV A;  2YHC A;  4CCA A;  2VGX A;  3ZPJ A;  4M3O A;  3CKC A;  2OND A;  4AIF A;  5FQ6 A;  3QAR A;  5B3S E;  3GW4 A;  3C3O A;  2RFM A;  4J8F A;  4FLH A;  4YDW A;  5FQ8 A;  4HOT A;  2X6F A;  2P9N G;  3OXG A;  2XEE A;  1SA4 A;  4AEZ C;  3T8M A;  5BXU A;  5HS0 A;  3ML8 A;  3V30 A;  1NP7 A;  1RZ4 A;  3FU6 A;  1Q2Z A;  4AVX A;  4BT8 A;  1IHG A;  3ZN3 A;  4F6R D;  1IQU A;  3IHY A;  3FUI A;  1HO8 A;  3CHQ A;  3PZ1 A;  1KZP A;  1KT0 A;  3DSU A;  4H7X A;  2A4Z A;  4UI9 J;  4UWF A;  3LXU X;  4YDY A;  4R7L A;  1WAO 1;  1O1T A; 
#chains in the Genus database with same CATH homology
 3LVQ E;  2IU1 A;  3U4T A;  2WXR A;  4FHK A;  3CLJ A;  4I6G A;  4PH4 B;  4RSY A;  3PE3 A;  4AXH A;  1SZ9 A;  4EPZ A;  3D9I A;  5FZS A;  2VGX B;  2V5F A;  2DCP A;  2V8S E;  5M72 A;  4O6F A;  4RG9 A;  3FTZ A;  4KVM A;  4CGW A;  4AY6 A;  2GRM A;  4XI9 A;  2CHX A;  3RRM B;  2C2L A;  3S7J A;  4ACK A;  4ATG A;  3UPV A;  4KBQ A;  5CMY A;  4TRQ A;  3QWW A;  4LUN U;  3WXX A;  3HYM B;  2IJG X;  2R5S A;  4EEC A;  1UW4 B;  2C0M A;  2AXV A;  4J6I A;  3CR3 A;  3B7S A;  3PDN A;  4NUR A;  3ZXS A;  3LVR E;  4G1T A;  5EKQ D;  5BV1 A;  2GGF A;  2WXO A;  2ILR A;  3HVE A;  1HE8 A;  1H6K A;  3CHR A;  3MEK A;  4N5C A;  3CVX A;  4L2Y A;  3FUL A;  2OOE A;  3GZ2 A;  4B8C B;  2WB2 A;  5LCW J;  2GRL A;  2WMN A;  3FH5 A;  3FUE A;  4Y6C A;  4NAC A;  4WAF A;  3RRN B;  3VLE A;  3PRZ A;  5AEN A;  1B89 A;  4KYO B;  3PRE A;  3RK6 A;  2AXZ A;  2C0L A;  2Y3A A;  3Q4A B;  4E85 A;  3CKB A;  2AWI A;  1Z3X A;  1PC2 A;  4KVO A;  2KC7 A;  4HOR A;  2FEZ A;  1GW6 A;  3TXN A;  4BY6 A;  3PVL A;  4BX9 A;  1HH8 A;  4I1M A;  3CVQ A;  4I1O B;  1HZ4 A;  3CHM A;  4DPR A;  4PS8 A;  3FU5 A;  4E6H A;  3FFL A;  2WXF A;  3CHO A;  4I43 A;  3ENE A;  5J08 A;  1OWM A;  4B94 A;  5JHA A;  1WY6 A;  2ION A;  4BX8 A;  1IYG A;  3FY4 A;  4N39 A;  2PQR A;  4CEM A;  3CVU A;  3Q5M A;  4C9B B;  5LOZ A;  3CQG B;  3RO3 A;  2NC9 A;  3ZHE A;  3O48 A;  1OWL A;  4N2Q A;  3LCA A;  3GZS A;  3RJV A;  2LO6 A;  1ZBP A;  3PEV B;  2VSY A;  3R7R A;  4Y6W A;  3SBS A;  4UQZ A;  1IQR A;  2EQX A;  1HG2 A;  3URZ A;  2VYI A;  2AW6 A;  1HU3 A;  3L13 A;  3TJP A;  4AM9 A;  4BWR A;  4U07 A;  3AS4 A;  5G04 C;  3NZU A;  4XE0 A;  2BTD A;  4GML A;  3PUJ A;  3T5V A;  3NQP A;  3FUK A;  1UJK A;  4F7A A;  3EIQ C;  4L1B A;  3CVV A;  4CT4 A;  2YHE A;  1EDU A;  3CVW A;  4XIF A;  3L54 A;  3QDN A;  3D9L A;  3D9J A;  4HOQ A;  2VGY A;  3HVE B;  5FZQ A;  5FZR A;  4HS2 A;  3SHF A;  2XRY A;  4N3A A;  4UWL A;  2AXU A;  4J8D A;  1HG5 A;  2FO7 A;  3CK9 A;  4UI9 K;  5D0O D;  4FHJ A;  1VDY A;  4BTA A;  5CHE E;  3ZIM A;  3U9W A;  3CK8 A;  4PS3 A;  3L17 A;  2VSX E;  4CDM A;  2OV8 A;  5KJK A;  4NRH B;  2XRZ A;  2WXI A;  3FTX A;  3R7Q A;  2NXP A;  2XGO A;  3I5P A;  1JPL A;  3APF A;  2WPV A;  4NQ0 A;  2V0P A;  4G2V A;  1MQS A;  2R59 A;  2OVF A;  3G2U A;  3G2V A;  4ILH B;  3TL5 A;  1HS6 A;  2PQN A;  2X6H A;  3ZRH A;  3FTY A;  5C1D A;  4PS7 A;  3EIJ A;  2L0T B;  4CGV A;  4JA7 A;  5LX8 A;  3CK7 A;  2E2E A;  2RD0 A;  3P1U A;  4G11 A;  3CVP A;  1Z3Y A;  4KMO A;  3FH7 A;  5AJL A;  5FT9 A;  2YQ8 A;  2KCL A;  3B7R L;  4A1S A;  5EX3 A;  3CIA A;  2Y4T A;  2Y4U A;  3OXL A;  4PDX A;  2LNI A;  3QOU A;  2VSO E;  3LDZ A;  3ZW3 A;  1SQM A;  4EZL A;  5T4Y A;  2I2O A;  3DBS A;  5HI7 A;  4XI0 A;  5AJD A;  2XPI A;  2UY1 A;  1PAQ A;  4FC8 A;  2J07 A;  3JCK C;  4GAA A;  5BW8 C;  2VSN A;  2XHE A;  2BUG A;  3L22 A;  5ANL A;  4B0Z A;  2LAI A;  3I3N A;  3Q15 A;  4JXT A;  4DLO A;  2A5U A;  1EPU A;  3FU0 A;  5LFA A;  2J4D A;  4EBA G;  4OYS A;  4MS6 A;  4UWH A;  4HFG A;  1L5J A;  1WM5 A;  1A17 A;  1MHQ A;  2PL2 A;  3QC1 A;  4GZ5 A;  5G04 J;  2HR2 A;  3VTY A;  4LRZ A;  4ANV A;  4YVO A;  3ZYK A;  2CFU A;  2WVI A;  2WXM A;  3K9I A;  3OAW A;  3PH0 C;  5JJ7 A;  2VJ8 A;  3KAE A;  4A3V A;  3LY8 A;  2L0I A;  3SFZ A;  1S0P A;  4K03 A;  3TGO A;  5FQ4 A;  3BG1 B;  1UG3 A;  3I4G A;  3CVY A;  2PM7 A;  3UUX A;  1EF1 C;  4N2S A;  3D9P A;  3FTW A;  4PUC A;  5FQ7 A;  3KS2 A;  4DI3 A;  1ELW A;  3ZYQ A;  2XEV A;  4OVU A;  3PS6 A;  4GYO A;  2WXQ A;  4I1A A;  4IRU A;  3ZFW A;  3DPD A;  4KZC A;  2WXP A;  3EHM A;  4GMJ A;  3LYA A;  4GZ3 A;  4ANX A;  4GYY A;  2HYZ A;  4I6J A;  4YND A;  4TV3 A;  3CEQ A;  4I2W A;  5JJT A;  3AU4 A;  3OXF A;  4JL0 A;  4HXI A;  4U0S A;  4B8A A;  2WM9 A;  4EZJ A;  2MRI A;  2WXK A;  2XPY A;  3ASH A;  4ME2 A;  5ARG A;  4B89 A;  4APO A;  3CSF A;  1YA0 A;  2CFZ A;  4WNE A;  3KD7 A;  1HFA A;  2HM8 A;  1H2V C;  4EBA A;  3JQ0 A;  4GZD A;  1QNF A;  3RIB A;  2L9B A;  3LJ3 A;  1OWO A;  2DIW A;  2KZT A;  2RG8 A;  3E4B A;  2WXG A;  3MA5 A;  4JEH A;  4Q94 A;  1BPO A;  1JWG A;  1INZ A;  2UY1 B;  3SBT B;  3SF4 A;  3RO2 A;  4TUU A;  3S2A A;  2YNQ A;  3MZL B;  2IOL A;  4WNG A;  3CQC B;  4URK A;  5E75 A;  1LF8 A;  4JEU A;  2Q7F A;  3LPZ A;  4FA6 A;  2I1K A;  3FP3 A;  4N3B A;  4H7Y A;  3AS5 A;  3QJZ A;  3BEE A;  4F1S A;  1E7U A;  3D9O A;  3ML9 A;  4DJA A;  1OWN A;  3FDH A;  3FUN A;  3L6A A;  4HLE A;  2J9Q A;  4MLP A;  2CHW A;  3U66 A;  3MV3 B;  1OUV A;  4GA2 A;  3NF1 A;  4EQF A;  2VTB A;  4C0E A;  3IEG A;  4DLQ A;  5KJL A;  3QWP A;  1UJJ A;  2WXH A;  2WMO A;  3CVN A;  4BTB A;  3VLF A;  2FI7 A;  4U63 A;  3QK0 A;  2IQC A;  4G24 A;  4WWN A;  5J90 A;  4AY5 A;  1H2U A;  4A55 A;  1X5B A;  4XX5 A;  3ESK A;  2J08 A;  3FTU A;  3QWV A;  1FVH A;  4G23 A;  4AP2 A;  1ZU2 A;  1UN8 A;  4FJY A;  1ELK A;  3EHN A;  5T8I A;  3P2B A;  4RVB A;  3RRU A;  3C98 A;  4GPK A;  3U3W A;  3ZGQ A;  2WXN A;  3SNX A;  3HIZ A;  2CG3 A;  4GCN A;  2QY7 A;  2WQH A;  2KCV A;  5DBK A;  3ZYL A;  2AVP A;  3G2W A;  4CDR A;  3GYZ A;  4FLB A;  2JLB A;  1E8Y A;  3JQ1 A;  3MKR A;  2P58 C;  3APD A;  4XZ4 A;  3PNL B;  5G05 C;  2KZT B;  2LAH A;  3ASG A;  3CHS A;  3FTV A;  3MKQ A;  3PE4 A;  3SGH A;  4ANU A;  4WWO A;  4MRU A;  3ZHE B;  2PM6 A;  5BNW A;  4GA1 A;  4UWG A;  3B13 A;  2CG2 A;  3EDT B;  2MHK A;  4IYP A;  4I17 A;  4A1G A;  2J49 A;  4WWP A;  4AOF A;  3LKU A;  1H2T C;  2BF0 X;  3JYS A;  1U3D A;  4FUL A;  1HX8 A;  3FUM A;  5EX0 A;  1E8W A;  1Y6I A;  4GCO A;  3FTS A;  4I9E A;  3FEX A;  3GZ1 A;  4I2Z A;  4WUY A;  5CMW A;  3TAX A;  2QFC A;  2UWJ G;  4BT9 A;  1NZN A;  4AV7 A;  3MGB A;  2VTB B;  1E90 A;  2LSU A;  1HF8 A;  4ILI A;  4JC8 A;  4UQY A;  3ONL A;  3IKO B;  4GYW A;  3FU3 A;  1Z6T A;  4JA9 A;  5ARF A;  3ZEF A;  4QFV A;  4DK5 A;  3ZYM A;  2PZI A;  3N71 A;  1EYH A;  1HXI A;  2ZU6 B;  2KM4 A;  3NZS A;  3UMV A;  2XGM A;  1E8Z A;  4FAD A;  5JHB A;  3D9N A;  1E7V A;  4WND A;  4UQX A;  2GW1 A;  4JHK A;  4FU3 A;  1UN9 A;  4DI4 A;  4XKC A;  3G2S A;  1OWP A;  4HOU A;  3SZ7 A;  4F3V A;  2MOW A;  1N54 A;  5AYW D;  2L6J A;  3CVL A;  2VQ2 A;  5A7D B;  3UQ3 A;  3D9M A;  4XKB A;  5KJM A;  4L23 A;  1H19 A;  3MV2 B;  3FWV A;  3EJN A;  4KZ0 A;  3LEW A;  4HOS A;  1QZ2 A;  3UT4 A;  2CHZ A;  3ONK A;  5BT1 A;  5HQ8 A;  4MKT A;  4G26 A;  1QQE A;  3TG5 A;  5FJY A;  4APF A;  3PEU B;  1PY1 A;  2X38 A;  4GZC A;  4U0Z A;  3S7F A;  3UT7 A;  3MCX A;  2NSZ A;  4LEU A;  2XCC A;  3APC A;  2FF4 A;  4YVQ C;  2WQ7 A;  2J09 A;  3MKQ B;  5BV0 A;  3ULQ A;  1E8X A;  4L2L A;  4ILG A;  3QNK A;  3HHM A;  4Q96 A;  3PUK A;  1NA3 A;  4ACL A;  2R17 C;  1XGW A;  3B7U X;  3D3M A;  5ANR A;  1XNF A;  3CV0 A;  5CCL A;  4RG6 A;  3TXM A;  4K0R A;  4KT6 B;  4V3I A;  3I4R B;  5G05 J;  5G55 A;  4IN3 B;  3FUH A;  3HDX A;  3FUF A;  1KT1 A;  2KCK A;  5AIJ A;  5FWQ A;  3VLD A;  2IFU A;  2WXL A;  3QKY A;  2XPZ A;  4GA0 A;  3L08 A;  3LY7 A;  3FH8 A;  1TJF A;  3BG0 B;  3UX4 A;  3MX3 A;  4CT0 A;  3PZD A;  4JVS A;  3Q47 B;  5A23 A;  3FUD A;  3JUI A;  4W9R A;  4GB9 A;  3IBE A;  1FCH A;  2DBA A;  5KJN A;  1DVP A;  3R9A B;  4C0M A;  3OTN A;  3QB2 A;  1TEZ A;  3O4Z A;  4UI9 C;  3LY9 A;  2X6J A;  4LCT A;  3UT8 A;  4J0U A;  4I9C A;  4I6E A;  4J8E A;  1KLX A;  3S7D A;  4P29 A;  4BSX A;  2I9C A;  3QAQ A;  3PNT B;  2X6K A;  4U04 A;  2I6H A;  1TJC A;  3FEY A;  3Q49 B;  1N52 A;  5T3R A;  5EDS A;  3MYV A;  2YIN A;  1JWF A;  3L16 A;  4LER A;  4EZK A;  1W3B A;  3G2T A;  4JHJ A;  2JEK A;  4BFR A;  2HO1 A;  3IHV A;  1JUQ A;  4HVB A;  2E0I A;  1U3C A;  4U0U A;  3FHE A;  1DNP A;  5KCM A;  3ESL A;  3CST A;  1Y8M A;  3D9K A;  3CGH A;  2WXJ A;  2FBN A;  2KAT A;  4OVV A;  2YHC A;  3FUJ A;  5G2N A;  4CCA A;  4N3C A;  2VGX A;  3ZPJ A;  4J8S A;  3IV0 A;  4M3O A;  3CKC A;  4IUL A;  4WNF A;  5D0Q D;  4UWK A;  3VTX A;  2OND A;  4FP7 A;  3SD5 A;  3LS8 A;  3AU5 A;  4AIF A;  4GZ6 A;  5ENN A;  4AJW A;  5DIZ A;  4G25 A;  2J4B A;  3ASD A;  3U64 A;  5FQ6 A;  3QAR A;  4FJZ A;  3ZVV A;  1FVF A;  1P5Q A;  5C2Y A;  2V4L A;  2XCB A;  3GW4 A;  5LCW C;  4J8F A;  4FLH A;  5A6C A;  5FQ8 A;  4HOT A;  1ELR A;  2X6F A;  5BUZ A;  3OXG A;  4CDN A;  4AEZ C;  2IF4 A;  3T8M A;  4KXK B;  4ABN A;  4L7T A;  3ML8 A;  4D10 C;  4CRW A;  1NP7 A;  3FU6 A;  4A3T A;  5BPP A;  2I1J A;  2OVB A;  4JZY A;  3MJW A;  4AVX A;  2X6I A;  3S7B A;  4BT8 A;  2LSV A;  5FTP A;  1IHG A;  4ANW A;  4JHR A;  4Q69 A;  3ZN3 A;  3CHP A;  1IQU A;  3ASF A;  3RKV A;  3B7T A;  3IHY A;  5JJ6 A;  3AS8 A;  2X3M A;  3FUI A;  1HO8 A;  1SZA A;  2XQ0 A;  3CHQ A;  3T5X A;  4F53 A;  2M63 A;  1E96 B;  1KT0 A;  4JPS A;  5LP0 A;  2WQ6 A;  2IOS A;  2XGS A;  4H7X A;  5CCM A;  5E76 A;  1H0A A;  2A4Z A;  3KEZ A;  2FUL A;  4GU5 A;  1NA0 A;  4UI9 J;  3SI5 A;  4UWF A;  3LXU X;  3TG4 A;  4U8H A;  4R7L A;  3RU0 A;  1WAO 1;  4JW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...