2KM4A

Solution structure of rtt103 ctd interacting domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
b'AFSSEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAKGQKIIQFQDSFGKVAAEVLGRINQEFPRDLKKKLSRVVNILKERNIFSKQVVNDIERSLAAALEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of Ty1 transposition protein 103
publication title Cooperative interaction of transcription termination factors with the RNA polymerase II C-terminal domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription regulator
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2km4A00
5LP0A 5CMWA 3ZYMA 1SZ9A 5CMYA 1DVPA 3G2UA 1JPLA 2BF0X 2DCPA 1UJKA 2V8SE 3RRUA 3ZYQA 1JUQA 4JXTA 1PY1A 2L0IA 3ONKA 2DIWA 3ONLA 3D9KA 1MHQA 1INZA 3D9IA 1H0AA 3LDZA 4NACA 1HF8A 1XGWA 3D9OA 3D9NA 1ELKA 3ZYKA 4FLBA 1HFAA 3D9MA 1UJJA 2LO6A 1EYHA 4AVXA 2KM4A 3ZYLA 4GZDA 3G2SA 2MOWA 1SZAA 3CLJA 1HG5A 1EDUA 3D9JA 5LOZA 4HFGA 4Q94A 2L0TB 5J08A 3G2WA 4Q96A 1VDYA 1HG2A 1JWGA 3G2VA 1HX8A 1LF8A 2QY7A 3G2TA 3D9LA 4FU3A 4GZCA 1JWFA 1X5BA 3D9PA
chains in the Genus database with same CATH superfamily
3CVUA 3ML9A 4PS8A 4GTRA 4LG6A 1QQEA 3JUEA 4LERA 1E8ZA 4V3IA 2FO1E 2E2EA 2WXPA 2XCBA 4GPMA 1NZNA 3APCA 4OYSA 5BT1A 4Q96A 5H7PA 5LOZA 2BTDA 2LXMA 2YNQA 4YDYA 4P29A 4HNAD 1AWCB 3DEPA 1WY6A 3QWPA 2V5FA 3LYAA 2J4DA 4J0UA 4HS2A 2V4HC 5G05C 4KZCA 3LKUA 4JW1A 4I2ZA 4BTBA 4UWKA 3CVQA 5ENOD 3HXFA 4HXIA 4HOSA 1FPPA 5D66A 3MYVA 4GCOA 3DPDA 3TWXA 4G8KA 4LNUD 5AJLA 3FH7A 2XPYA 4GZ6A 3JXJA 3ASFA 4MBGA 2X6HA 3SBTB 3UIPC 4WNFA 4ME2A 1OWLA 5LFAA 5A7DB 1BI7B 2FULA 4XI9A 1OCOE 3UM1A 5IY5E 5J08A 2CHXA 3UUXA 3UQ3A 4UQZA 4ILHB 3U3WA 3I3NA 3GZ1A 1N4PA 2GRPB 2LNIA 1OWMA 2VYIA 2XGSA 4UI9C 5ITZF 3TWRA 2DBAA 1E8WA 2R03A 4GA1A 3AG4E 1N4SA 5FZSA 1OT8A 1NI1A 3S2AA 4DX5D 2IOLA 3GW4A 2QYUA 3LJNA 4XE0A 3UM0A 1XGWA 4HOQA 5KJKA 3C3OA 4AY5A 1QYMA 3PDNA 2OVFA 4A3VA 1TNZA 2R2LA 3ZXSA 3APFA 5FWQA 3SY2A 2X6KA 1FCHA 4O60A 3VLFA 5JJTA 1X81A 2J4BA 3TXNA 1NA0A 4CDNA 3L6AA 1FT1A 2CHWA 3J5QB 3TG4A 3OTNA 2RFAA 1OXJA 3AAAC 3CK9A 4J8YA 1ELRA 3SHFA 4HB5A 4C48B 2QYJA 1MX6A 3C3RA 2WXRA 1RZ4A 3E30A 2P2CP 3PZ3A 2P9LG 3CHOA 3D9LA 4WWNA 2BEDA 3FUHA 4LNBA 2H6HA 5CERB 4KMOA 4HLLA 5AJDA 3ZHEA 3TWSA 5ENTD 1OCRE 2RFMA 4JZYA 2J08A 2I1KA 3RU0A 1YYHA 2DWZA 2WXFA 3OXGA 2OCCE 4JVSA 4DI4A 1U2VG 3UM2A 2FO7A 5FZQA 5LCWJ 2KZTB 2X6IA 4N3BA 3CVPA 3HVEB 3ESLA 3U64A 4JPSA 1OCCE 2KM4A 2WM9A 3QDNA 3WXXA 1HS6A 1UN9A 4UWHA 1Y8MA 4GTQA 1VDYA 3BG1B 2IOSA 1U3DA 2GW1A 2FI7A 3FTUA 1WM5A 1UJKA 2WXOA 4FC8A 3D9IA 1N9AA 3V2OA 3D9NA 2BUGA 1H2TC 3ZIMA 2X6JA 3DPYA 1IQUA 1E7UA 2B6CA 2ETBA 1TN7A 2FBNA 3CVYA 3HHMA 3C72A 2V8SE 4EHMA 2V4LA 1O1TA 3D9KA 1O5MA 1B89A 1E8YA 4FLBA 4IULA 3JXIA 2DYSE 3GZ2A 5ENSD 5FTPA 3Q49B 4CRWA 3CK7A 2KATA 2WXIA 2BKGA 4MS6A 1E90A 2VJ8A 4I1AA 2LSVA 4FJYA 3KEZA 1H2VC 1H2UA 3IV0A 3CK8A 3LPZA 3NBNB 4BY6A 4ANWA 3W9GA 5G04C 2Y4TA 1UN8A 4H7XA 4Y6WA 5AYWD 4N3AA 2AW6A 2BKKB 2WMOA 3FUFA 4GTPA 2XRZA 5ENNA 2AVPA 5BNWA 2CG3A 4DLQA 4FP7A 3VLEA 4BTAA 1Q2ZA 3OXLA 3ABKE 5CMWA 2I6HA 1TNBA 4URKA 2DCPA 2F8YA 4NIKA 2AXVA 3PEUB 5KCMA 4FLHA 4L2LA 4YVQC 3L13A 3D9HA 3FUIA 2EIME 4JEHA 2X3MA 2WXKA 3LJ3A 1PC2A 3FTZA 5HKPA 2IO3C 3LDZA 2LO6A 4AVXA 2HR2A 2XRYA 3CIAA 4HRLA 3UX4A 4AV7A 1D8DA 3NF1A 5EYPF 3IXEA 2X38A 1TNUA 4JEUA 3RRNB 2J07A 4AY6A 4G25A 3TXMA 3ZPJA 4BEPA 3FUMA 5JA4D 3B7TA 1OUVA 1FVFA 4U7EB 3L08A 3TWVA 1P5QA 3AJIA 3FEXA 1MX2A 1HG2A 2XS8A 1ZBPA 3D9PA 5CCMA 1N54A 2VQ2A 3NZSA 3DSSA 3QOUA 3UINC 1UW4B 4A55A 4W9RA 3ULEG 4I1MA 3LVRE 4YNDA 4TUMA 5DBKA 1E7VA 4DX2A 3D3MA 4EZKA 3J5PA 2J9QA 3QAQA 1HXIA 3ZXPA 4TUUA 4B0ZA 2P9NG 4YDWA 3ZRHA 3FWVA 4JL0A 1H6PA 3LCAA 3T9KA 4AJWA 3VTXA 3IHVA 2WVIA 5EX3A 3SI5A 3ZU7B 2LXLA 3TAXA 4XEIG 1TJFA 2VGYA 1K8KG 3TGOA 4KVOA 5KJMA 4ILGA 3TWQA 5JMND 1TNYA 1UG3A 3PUKA 2YHCA 2VGXA 3TG5A 1Z5SC 3ONKA 3QK0A 3KSQA 3EHMA 4RLYA 2J09A 4B8CB 3V79K 3SF4A 4Q69A 3R7QA 2QC9A 4CDMA 2P9PG 4L23A 3CHRA 3P2BA 2R02A 4XZ4A 4GZ3A 1QZ2A 2WXNA 2H6GA 4B89A 2NXPA 3ZFWA 2IQCA 3PE4A 4G23A 4PH4B 4FJZA 2Y1LE 4OVUA 1K1BA 5M72A 4DX7D 3ZKJA 5D0QD 1IYGA 1KPSB 3FH5A 4GAAA 1DCQA 3CKBA 3C3QA 1U3CA 4LEUA 3LY7A 5CRUA 3DSVA 2OEVA 4TV3A 2Y0BG 5E76A 5B1BE 5A23A 5EDSA 4I2WA 1JCQA 2QFCA 1WAO1 4KVMA 2H6IA 4O1OA 4GPKA 1O1SA 3PZ4A 4UI9K 3BU8A 5G55A 4KBQA 4HFGA 4D10C 1IHGA 4AXHA 3CQGB 1JCSA 4RG9A 2FEZA 3AG2E 3FH8A 2MHKA 4GYWA 4WNGA 1RW2A 2H6FA 3ASGA 3EIQC 4BSXA 3DSWA 4HOTA 2XQ0A 3CVLA 2WQ7A 5KJLA 4I6JA 3B7RL 3NQPA 3I5PA 1IKND 3MZLB 1SZ9A 5DIZA 2IO2C 3RO3A 4IRUA 3TL5A 3FTVA 4GTTA 3PREA 2PQNA 3IEGA 4EBAG 4A1SA 4EQFA 3PVLA 5CHEE 1N0QA 3UMVA 1NP7A 4QFVA 3TJPA 1LD8A 2UY1A 1OCZE 1QBQA 3HDXA 3UM3A 2ZGGA 2IF4A 4WWOA 4AM9A 1HG5A 2L6BA 3R9MA 3QARA 3PS6A 1X5BA 5ARFA 1AP7A 4H7YA 4MLPA 5AQ9A 4GCNA 5LX8A 2CFUA 1TN8A 2PZIA 3URZA 2VSXE 5ENPD 3MV3B 1TR4A 5D0OD 3B7SA 3JUIA 5KJNA 4PUCA 2DZOA 2A5EA 5FQ7A 3Q9NC 2JLBA 1MJ0A 5BPPA 1IQRA 4UWLA 3LS8A 2Y3AA 4BT9A 3EUVA 4M7CA 3CEQA 4N5CA 3NZUA 1YCSB 3QWWA 5EILA 5LP0A 3CVXA 3ASDA 3RK6A 3G2UA 5CECB 4BETA 3RRMB 1E96B 1KZOA 4Y6CA 1TN6A 3CSTA 3L54A 3E32A 3DXMG 4EPZA 3ZVVA 5BV0A 1TJCA 4FU3A 5BXOA 3PH0C 4B8AA 1NL4A 2CHZA 3HXBA 4C9BB 3EJNA 3HIZA 4DI3A 2V0PA 3ZYLA 5KNHD 4TXQA 3MGBA 3UI2A 4APOA 3BEEA 2MRIA 3ASOE 3E34A 3SD5A 1H19A 3QC1A 1OWPA 4OAUC 2V5QC 1D9SA 3DBSA 3V2XA 2P9KG 2C2LA 3O4ZA 3U66A 4ANUA 4J8SA 4GTMA 5HQ8A 3C5RA 3EU5A 3L22A 1BU9A 3SBSA 2RG8A 1WDYA 3UPVA 1TYQG 1MX4A 4GA2A 5AQAA 3FUKA 3DSXA 4JB8P 4ATZD 5HI7A 4JHRA 3ML8A 4Q94A 5EIDA 2ZISA 5G04J 2UWJG 4MKTA 2IONA 2VGXB 2XZTG 5FQ4A 4U63A 4JXTA 1S63A 1KT0A 4A1GA 4N2QA 3S7JA 2JEKA 1HFAA 2A4ZA 4JHJA 1HZ4A 3L9TA 4U95D 4JD2G 1XNFA 2KXPC 4CCAA 4A63B 3Q75A 4F3VA 3HRAA 3ZW3A 3BG0B 4LCTA 3RSEG 1TEZA 5ARGA 4DLOA 3PZ2A 2R05A 4A3TA 3UKUG 4ANVA 4YVOA 5FIOA 3DWLG 1HH8A 1TNOA 2VSOE 4GZCA 3JQ1A 4FA6A 2J49A 3AS4A 3KAEA 4HLEA 4J8EA 1IXVA 1PAQA 3FTWA 1D8EA 3FTYA 5FINA 3NAWA 5EKQD 1SW6A 4LRZA 4GB9A 3LXUX 3G2TA 2Q7FA 1JWFA 5AIJA 5JJ6A 2VSNA 3AU4A 4B94A 3U9WA 3ONLA 4ATGA 5FQ8A 4KYOB 4BWRA 4HI8A 3IHYA 5FZRA 4RG6A 1DCEA 2CFZA 2VSYA 3QB2A 3ZYKA 4CT4A 2CG2A 3LVQE 3RKVA 1H6KA 4FHJA 4RQIA 4N2SA 3SQVA 3ENEA 3CVNA 3CV0A 3PNTB 2GRRB 2I9CA 3PE3A 2DZNA 3W9FA 1JPLA 4U07A 4GA0A 2AJAA 1PY1A 2L6JA 3RJVA 1Z6TA 2YHEA 3ASNE 2KCVA 2HO1A 2ETCA 3G2VA 3FFLA 2AXUA 2UY1B 2XHEA 4L7TA 4WNDA 1INZA 1E8XA 4O1PA 5C1DA 4GYYA 4WAFA 1N95A 2WMNA 4LNGA 5C2YA 3HG0D 3FUNA 3VTYA 2OVBA 1Y6IA 1NA3A 4C0EA 5KWDA 3MKQB 4K5CA 1KT1A 5AQ7A 4ANXA 1ZB1A 3O48A 4PS7A 1O1RA 4J8FA 4HORA 3CHPA 2WQ6A 2VGEA 2GRNB 4GTVA 4F53A 1YMPA 3FU5A 3CSFA 4G2VA 4DJAA 3CR3A 1NFIE 1LD7A 3CQCB 3Q9UC 3EHRA 2GRQB 3PEVB 5JHBA 3FUDA 3Q7FA 1Z3XA 3EIJA 2IU1A 3UTMA 1N11A 3RRUA 1SQMA 2R5SA 2ZGDA 3SNXA 1S64A 1MHQA 3AS8A 1GW6A 4IN3B 3PZDA 3FUEA 3V31A 2YQ8A 3DSTA 3ESKA 3RAUA 4U0UA 3LY9A 5G05J 3UXGA 4FHKA 2P9IG 3CKCA 2DYRE 4F1SA 3EHQA 1Z3YA 1N52A 3ASHA 3B95A 3FEYA 2FF4A 4I6GA 1BLXB 2P9SG 3E33A 3NOGD 4WNEA 2ETAA 2LSUA 4BSZB 1V54E 3E4BA 3UKRG 5AN8A 4J6IA 5JHAA 2R17C 3S7FA 5J90A 5D2MC 2F8XK 3CGHA 3FUJA 4CEMA 2NSZA 2QY7A 3SFXA 2EQXA 1W3BA 3EHNA 3N71A 4KXKB 1G3NB 2GRLA 3JQ0A 3Q15A 5FT9A 3GZSA 1UJJA 1K1AA 2EIJE 3RO2A 2PM7A 3S7DA 3UIOC 4BFRA 1DNPA 4UI9J 2KC7A 4R7LA 4LSZE 4OVVA 3UT4A 5CBOA 4K03A 2ZXWE 4M3OA 3X2QE 1L5JA 1A5EA 4L1BA 3PNLB 4N5QA 2P58C 3B7BA 4HRMB 2MOWA 3NOCD 3CLJA 2IY0C 1BD8A 4GU5A 1DC2A 4U04A 4BX9A 2WXLA 3QJZA 4WUYA 4AP2A 3CHQA 3T8MA 2Y69E 4G8LA 4U96D 2Y4UA 2XPIA 4FULA 4PS3A 4DK5A 4J8DA 1N94A 3SFYA 1JUQA 4F6RD 4FADA 4C0MA 2ZU6B 3FU3A 1ELKA 5ANRA 4PDXA 5CEAA 4HVBA 3QNKA 3JYSA 5EX0A 4ZHBA 4CT0A 1KZPA 2C0MA 3SZ7A 4HI9A 3LY8A 2HM8A 3WG7E 5E75A 2ZIRA 4BERA 1FVHA 3HXDA 3IBEA 3K9IA 2XS1A 3MKQA 2XEVA 3T5XA 2WXQA 1IHBA 2RD0A 2R59A 2XGMA 3C98A 4JHKA 5CRVA 5AENA 4RVBA 3PZ1A 3AS5A 3LEWA 2LAIA 4G11A 3TWWA 4GMJA 4I6EA 3ABME 3D9MA 4GYOA 4CGWA 3AG1E 3FU6A 4K5AB 4TRQA 3FTSA 2KBXA 3FY4A 1JWGA 1LF8A 3R7RA 3VLDA 3S7BA 4QQIA 3RIBA 3CHSA 1SA5A 4U8YD 2L9BA 2MYOA 2DIWA 4WWPA 4NACA 3UT7A 2LUHA 2ILRA 3CHMA 3F6QA 3HXCA 2A5UA 2NYJA 1K3ZD 4XI0A 3TWUA 4UUCA 2QZAA 4JA7A 3ZYMA 4CGVA 3PUJA 4HOUA 2WXHA 3FHEA 3SO8A 4ZFHA 4G1TA 4I1OB 3MKRA 2I2OA 3IKOB 3FULA 3HXEA 4LUNU 2GROB 2XEEA 5ENRD 1KLXA 3L82A 3MA5A 1EF1C 2HYZA 1DVPA 3Q7AA 2OV8A 4TXRA 3PRZA 3E37A 2WB2A 3CVVA 2XCCA 3UT8A 2EILE 4UQYA 2VTBB 2ONDA 1BPOA 2IEJA 1FT2A 2WPVA 5LCWC 4NURA 2XGOA 5G2NA 5KNGA 3CVWA 3I4GA 2WXMA 4B93B 1ELWA 3MJWA 3EU9A 2OOEA 2GGFA 1HU3A 4NRHB 3B13A 5CBNA 3ZGQA 4EBAA 4L2YA 1EDUA 3OXFA 2J8SD 1WG0A 3DEOA 2PNNA 4IYPA 2P9UG 2PM6A 4I9CA 3MX3A 3I4RB 3D9OA 3QKYA 3QWVA 5BW8C 2B0OE 4JA9A 4ABNA 4ACKA 3D9JA 4EECA 3EDTB 2YINA 5HRYA 2OEWA 4XKBA 3ABLE 5EYLA 3FP3A 2PL2A 4DPRA 2RKKA 5B3SE 4N39A 4XIFA 4DX1A 3NB2A 3V30A 4APFA 2JABA 2XZDG 1YA0A 4GTSA 3TWTA 4GTOA 3ZEFA 5ANLA 4UWGA 5AARA 2L0TB 3G2WA 3MEKA 3JCKC 5ENQD 1UOHA 4AEZC 3BUAA 4BT8A 4X8QA 4F7AA 4RSYA 2KCKA 3Q79A 1SA4A 3BQOA 3P1UA 3T8KA 2EIKE 4AOFA 3G2SA 1MZCA 3Q4AB 3ZUVB 4NQ0A 3R9AB 4CDRA 1N0RA 3ULQA 1S70B 3APDA 2M63A 5T4YA 4YDOA 1S0PA 2HE0A 4I43A 5HS0A 5BUZA 4J7WA 4HBDA 4YDEA 3T5VA 3DRAA 2XPZA 2F0YA 3DXKG 5AQBA 5CEDB 4BX8A 3GYZA 1MYOA 4AIFA 1H0AA 2PQRA 4CYMD 1QNFA 2NC9A 3MV2B 3Q78A 4EZJA 3SFZA 1BI8B 4XKCA 3DSUA 4G26A 3Q47B 4DUIA 2E0IA 4G24A 3Q5MA 1H6OA 4HRNA 3ISMC 4ILIA 1OWOA 2L0IA 4U0SA 2XEHA 1ZU2A 1SVXA 2I1JA 2C0LA 3ZNGA 4DRXE 5CCLA 2EINE 3SGHA 3L17A 4GMLA 1HX8A 2WQHA 4JC8A 1MQSA 4UQXA 2IJGX 1LTXA 4ACLA 5A6CA 3HYMB 1A17A 2IFUA 1HE8A 2KZTA 3KS2A 4HQDA 5EIBE 3HVEA 4N3CA 3ULYA 1EYHA 4MRUA 3MCXA 1N4QA 4GMRA 2X6FA 4O6FA 4Z68A 4EZLA 4KT6B 1OY3D 4E6HA 3U4TA 3L16A 3AU5A 4E85A 2VTBA 5BXUA 2DVWA 4U8HA 2WXGA 4XX5A 4I17A 3KD7A 2LAHA 5FJYA 5FQ6A 5T8IA 5B1AE 1OWNA 4TXPA 1EPUA 1SZAA 2GRMA 2AXZA 3Q73A 3AG3E 4CZ2D 5AAOA 3FDHA 5JJ7A 4I9EA 4UWFA 1V55E 2F37A 2AWIA 4KZ0A 4U0ZA 3KSLA 3OAWA 4OAVB 3FU0A 4K0RA 4BESA 1HO8A 3B7UX 5EN5D 5T3RA 2WXJA 3ZN3A 5CMYA 2BF0X 3ZYQA 5KBAA 4L9PA 4GZ5A 5BV1A 1HF8A 1N4RA 4DX6D 3KEAA 2XENA 4GZDA 3FTXA 1JCRA 4K5BA 2KCLA 4U8VD 4F1PA 3ZHEB
chains in the Genus database with same CATH topology
2C0MA 4JEUA 3RRNB 3ML9A 3SZ7A 4PS8A 3CVUA 3L22A 2J07A 3SBSA 1QQEA 3LY8A 4LERA 4AY6A 1E8ZA 4V3IA 2HM8A 4G25A 2RG8A 3UPVA 5E75A 3TXMA 3ZPJA 2E2EA 1FVHA 4GA2A 3IBEA 2WXPA 2XCBA 3K9IA 3MKQA 1NZNA 3APCA 3FUKA 2XEVA 4OYSA 3T5XA 3FUMA 5HI7A 3B7TA 2WXQA 1OUVA 5BT1A 1FVFA 4JHRA 3L08A 3ML8A 4Q94A 1P5QA 2RD0A 3FEXA 4Q96A 1HG2A 2R59A 2XGMA 1ZBPA 3C98A 5LOZA 3D9PA 4JHKA 2UWJG 5G04J 5CCMA 1N54A 2BTDA 4MKTA 2IONA 2VGXB 2YNQA 2VQ2A 5FQ4A 3NZSA 4U63A 5AENA 3QOUA 4RVBA 4P29A 4JXTA 3AS5A 3LEWA 2LAIA 1UW4B 1KT0A 4A1GA 4A55A 4N2QA 4G11A 3S7JA 4GMJA 2JEKA 1WY6A 3QWPA 4I6EA 4W9RA 1HFAA 2A4ZA 3D9MA 4GYOA 2V5FA 4I1MA 1HZ4A 4JHJA 4CGWA 3FU6A 1XNFA 3LYAA 4CCAA 2J4DA 3LVRE 4J0UA 4TRQA 4HS2A 4YNDA 5DBKA 3FTSA 1E7VA 3FY4A 1JWGA 1LF8A 5G05C 3R7RA 3D3MA 4EZKA 4KZCA 3LKUA 4F3VA 2J9QA 4JW1A 3QAQA 1HXIA 4I2ZA 3VLDA 4TUUA 3S7BA 3RIBA 4B0ZA 3CHSA 3ZW3A 3ZRHA 4BTBA 3FWVA 4JL0A 2L9BA 3BG0B 4LCTA 2DIWA 3LCAA 4UWKA 4WWPA 4AJWA 4NACA 3VTXA 3UT7A 1TEZA 3IHVA 2WVIA 2ILRA 5ARGA 3CHMA 3CVQA 5EX3A 3SI5A 4DLOA 4A3TA 3TAXA 2A5UA 4ANVA 4YVOA 1HH8A 2VSOE 4HXIA 4GZCA 3JQ1A 4XI0A 4FA6A 4HOSA 2J49A 3MYVA 4GCOA 3DPDA 4CGVA 4JA7A 3ZYMA 3PUJA 4HOUA 1TJFA 3AS4A 5AJLA 2WXHA 3FH7A 2XPYA 3FHEA 4GZ6A 4G1TA 3KAEA 4I1OB 3MKRA 4HLEA 2I2OA 2VGYA 3ASFA 4J8EA 3IKOB 2X6HA 3SBTB 4WNFA 1PAQA 3FTWA 3FULA 4ME2A 3FTYA 4LUNU 1OWLA 5LFAA 3TGOA 5A7DB 5EKQD 4KVOA 2FULA 4LRZA 5KJMA 4GB9A 1KLXA 4XI9A 3LXUX 4ILGA 3MA5A 3G2TA 2Q7FA 1JWFA 5J08A 2CHXA 5AIJA 5JJ6A 1EF1C 2HYZA 1DVPA 3UUXA 2OV8A 2VSNA 3AU4A 4B94A 1UG3A 3PUKA 2YHCA 3U9WA 3UQ3A 4UQZA 2VGXA 3TG5A 4ILHB 3ONKA 3ONLA 3U3WA 3I3NA 3QK0A 4ATGA 5FQ8A 3GZ1A 4KYOB 3PRZA 4BWRA 3EHMA 2J09A 4B8CB 3SF4A 2LNIA 5FZRA 3IHYA 1OWMA 2WB2A 2VYIA 3CVVA 2XCCA 4Q69A 3R7QA 2XGSA 4RG6A 4UI9C 3UT8A 2CFZA 2DBAA 1E8WA 4GA1A 4UQYA 2VSYA 2VTBB 3QB2A 3ZYKA 4CDMA 4L23A 2ONDA 3CHRA 3P2BA 1BPOA 5FZSA 4CT4A 3S2AA 2CG2A 2WPVA 4XZ4A 3LVQE 3RKVA 4NURA 5LCWC 2XGOA 5G2NA 2IOLA 3GW4A 3CVWA 1H6KA 4FHJA 3I4GA 2WXMA 4GZ3A 1ELWA 1QZ2A 2WXNA 3MJWA 2OOEA 2GGFA 1HU3A 4NRHB 4XE0A 4N2SA 3B13A 1XGWA 4B89A 4HOQA 3ZGQA 4EBAA 5KJKA 2NXPA 3ZFWA 2IQCA 4AY5A 4L2YA 3PE4A 3PDNA 2OVFA 1EDUA 3ENEA 3CVNA 4A3VA 3OXFA 4G23A 3CV0A 4PH4B 3PNTB 4IYPA 4FJZA 2I9CA 3ZXSA 3PE3A 3APFA 5FWQA 4OVUA 5M72A 1JPLA 2PM6A 4U07A 4I9CA 2X6KA 4GA0A 1PY1A 5D0QD 1IYGA 2L6JA 1FCHA 3MX3A 3I4RB 3RJVA 3D9OA 3QKYA 3QWVA 1Z6TA 5BW8C 3VLFA 5JJTA 3FH5A 2J4BA 3TXNA 1NA0A 2YHEA 4GAAA 4JA9A 4ABNA 4CDNA 2KCVA 3L6AA 4ACKA 3CKBA 2HO1A 3D9JA 5BNWA 1U3CA 4LEUA 4EECA 3EDTB 3LY7A 2CHWA 3G2VA 3TG4A 2YINA 3OTNA 4XKBA 4TV3A 3FP3A 2PL2A 4DPRA 3CK9A 3FFLA 1ELRA 4N39A 2AXUA 4XIFA 2UY1B 3SHFA 2XHEA 5E76A 5A23A 5EDSA 4APFA 4I2WA 2QFCA 1WAO1 4L7TA 4KVMA 4WNDA 4GPKA 1INZA 1E8XA 4UI9K 1YA0A 5C1DA 2WXRA 4GYYA 4WAFA 5G55A 4KBQA 3ZEFA 5ANLA 4UWGA 2WMNA 4HFGA 2L0TB 3G2WA 3MEKA 5C2YA 4D10C 1IHGA 3VTYA 3CQGB 3CHOA 3FUNA 4AXHA 3D9LA 2OVBA 3JCKC 4WWNA 1Y6IA 4RG9A 3FUHA 4AEZC 1NA3A 4C0EA 2FEZA 3MKQB 3FH8A 4KMOA 1KT1A 4BT8A 4F7AA 2MHKA 4RSYA 2KCKA 5AJDA 4ANXA 4GYWA 3ZHEA 4WNGA 3ASGA 3O48A 4PS7A 3EIQC 3P1UA 4BSXA 4JZYA 4HOTA 2J08A 2I1KA 2XQ0A 3CVLA 3RU0A 4J8FA 4AOFA 2WQ7A 4HORA 3CHPA 3G2SA 3B7RL 3NQPA 4I6JA 5KJLA 3Q4AB 3I5PA 2WQ6A 2WXFA 4F53A 3OXGA 4NQ0A 4JVSA 3R9AB 4DI4A 4CDRA 3FU5A 2FO7A 3MZLB 5FZQA 1SZ9A 5LCWJ 5DIZA 2KZTB 2X6IA 3CSFA 4G2VA 4N3BA 3RO3A 4DJAA 3CVPA 3ULQA 3CR3A 3HVEB 4IRUA 3TL5A 3ESLA 3FTVA 3CQCB 3U64A 3PEVB 3APDA 4JPSA 5JHBA 2M63A 5T4YA 3FUDA 2KM4A 2PQNA 3IEGA 3PREA 1S0PA 2WM9A 3QDNA 3WXXA 1HS6A 1UN9A 4UWHA 1Y8MA 4A1SA 4EBAG 1Z3XA 4I43A 3EIJA 4EQFA 1VDYA 5BUZA 3PVLA 3BG1B 2IOSA 5CHEE 2IU1A 1U3DA 3T5VA 2GW1A 2XPZA 3UMVA 2FI7A 1NP7A 3FTUA 1WM5A 4BX8A 1UJKA 3GYZA 3RRUA 1SQMA 2R5SA 4QFVA 3SNXA 3TJPA 2WXOA 1MHQA 4FC8A 3D9IA 1H0AA 2PQRA 4AIFA 2UY1A 3AS8A 1QNFA 2NC9A 3D9NA 1GW6A 3HDXA 4IN3B 2BUGA 1H2TC 3MV2B 3ZIMA 4EZJA 2IF4A 4WWOA 2X6JA 3FUEA 3PZDA 1HG5A 3SFZA 4AM9A 3QARA 2YQ8A 3ESKA 4XKCA 1IQUA 4U0UA 3LY9A 1E7UA 4G26A 3Q47B 3PS6A 5G05J 1X5BA 4FHKA 5ARFA 4H7YA 4MLPA 2E0IA 2FBNA 3CKCA 4GCNA 3CVYA 3HHMA 4G24A 2V8SE 4F1SA 3Q5MA 5LX8A 2CFUA 4ILIA 1OWOA 2V4LA 2L0IA 3D9KA 4U0SA 1Z3YA 2PZIA 3URZA 4CT0A 2VSXE 1N52A 1B89A 1E8YA 3MV3B 1ZU2A 5D0OD 3ASHA 3B7SA 4FLBA 3FEYA 2FF4A 2I1JA 3JUIA 4I6GA 4IULA 2C0LA 5CCLA 3GZ2A 4WNEA 3SGHA 5FTPA 3L17A 5KJNA 3Q49B 4GMLA 4PUCA 1HX8A 2LSUA 2WQHA 4JC8A 3CK7A 4CRWA 1MQSA 2KATA 2WXIA 3E4BA 2IJGX 4UQXA 5FQ7A 2JLBA 4MS6A 4ACLA 1IQRA 5BPPA 4UWLA 5A6CA 3HYMB 1A17A 1E90A 2IFUA 3LS8A 1HE8A 2KZTA 2VJ8A 2Y3AA 3KS2A 4J6IA 5JHAA 4BT9A 2R17C 3HVEA 4N3CA 4I1AA 2LSVA 4FJYA 3KEZA 1EYHA 3S7FA 5J90A 1H2VC 4MRUA 1H2UA 3IV0A 3CEQA 3MCXA 3CGHA 3FUJA 4O6FA 2X6FA 3CK8A 4N5CA 3LPZA 4CEMA 4BY6A 4KT6B 4EZLA 2NSZA 3NZUA 3QWWA 4E6HA 2QY7A 3U4TA 3L16A 4ANWA 5G04C 2Y4TA 5LP0A 3CVXA 3ASDA 1UN8A 4H7XA 2EQXA 3AU5A 4Y6WA 5AYWD 3RK6A 3G2UA 4E85A 4N3AA 2VTBA 2AW6A 1W3BA 3EHNA 3N71A 4KXKB 2WMOA 4U8HA 3FUFA 2WXGA 1E96B 2GRLA 4XX5A 3RRMB 3JQ0A 4I17A 3KD7A 2XRZA 2LAHA 5FJYA 5ENNA 5FQ6A 4Y6CA 5T8IA 3Q15A 3L54A 3CSTA 1OWNA 5FT9A 3GZSA 1UJJA 2AVPA 1EPUA 2CG3A 3RO2A 2PM7A 3S7DA 4DLQA 1SZAA 2GRMA 4FP7A 3VLEA 2AXZA 4BTAA 1DNPA 4UI9J 3ZVVA 4BFRA 4EPZA 5BV0A 1TJCA 4FU3A 3OXLA 2KC7A 3PH0C 4B8AA 5CMWA 4R7LA 3FDHA 4OVVA 3UT4A 2I6HA 5JJ7A 2CHZA 4URKA 4K03A 2DCPA 4M3OA 4C9BB 1L5JA 3EJNA 4I9EA 2AXVA 4UWFA 3PEUB 4L1BA 5KCMA 3HIZA 4FLHA 4DI3A 2V0PA 3PNLB 4L2LA 2AWIA 4KZ0A 4YVQC 2P58C 3L13A 4U0ZA 3ZYLA 2MOWA 3OAWA 3CLJA 3FU0A 3FUIA 4K0RA 3MGBA 4GU5A 4U04A 4BX9A 4JEHA 4APOA 2WXLA 1HO8A 3B7UX 3BEEA 3QJZA 5T3RA 2X3MA 4WUYA 2WXJA 2MRIA 2WXKA 3CHQA 4AP2A 3T8MA 3LJ3A 3SD5A 2Y4UA 1PC2A 1H19A 3QC1A 3ZN3A 2XPIA 5CMYA 4FULA 3FTZA 4PS3A 1OWPA 2BF0X 3ZYQA 4J8DA 4DK5A 1JUQA 4FADA 4C0MA 4GZ5A 3LDZA 5BV1A 2ZU6B 3FU3A 1HF8A 1ELKA 5ANRA 4PDXA 2LO6A 3DBSA 4HVBA 4AVXA 2HR2A 4GZDA 2C2LA 3O4ZA 3FTXA 3U66A 4ANUA 2XRYA 3CIAA 3UX4A 4AV7A 4J8SA 3QNKA 3JYSA 3NF1A 5EX0A 2KCLA 5HQ8A 3ZHEB 2X38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LP0 A;  5CMW A;  3ZYM A;  1SZ9 A;  5CMY A;  1DVP A;  3G2U A;  1JPL A;  2BF0 X;  2DCP A;  1UJK A;  2V8S E;  3RRU A;  3ZYQ A;  1JUQ A;  4JXT A;  1PY1 A;  2L0I A;  3ONK A;  2DIW A;  3ONL A;  3D9K A;  1MHQ A;  1INZ A;  3D9I A;  1H0A A;  3LDZ A;  4NAC A;  1HF8 A;  1XGW A;  3D9O A;  3D9N A;  1ELK A;  3ZYK A;  4FLB A;  1HFA A;  3D9M A;  1UJJ A;  2LO6 A;  1EYH A;  4AVX A;  2KM4 A;  3ZYL A;  4GZD A;  3G2S A;  2MOW A;  1SZA A;  3CLJ A;  1HG5 A;  1EDU A;  3D9J A;  5LOZ A;  4HFG A;  4Q94 A;  2L0T B;  5J08 A;  3G2W A;  4Q96 A;  1VDY A;  1HG2 A;  1JWG A;  3G2V A;  1HX8 A;  1LF8 A;  2QY7 A;  3G2T A;  3D9L A;  4FU3 A;  4GZC A;  1JWF A;  1X5B A;  3D9P A; 
#chains in the Genus database with same CATH topology
 3CVU A;  3ML9 A;  4PS8 A;  4GTR A;  4LG6 A;  1QQE A;  3JUE A;  4LER A;  1E8Z A;  4V3I A;  2FO1 E;  2E2E A;  2WXP A;  2XCB A;  4GPM A;  1NZN A;  3APC A;  4OYS A;  5BT1 A;  4Q96 A;  5H7P A;  5LOZ A;  2BTD A;  2LXM A;  2YNQ A;  4YDY A;  4P29 A;  4HNA D;  1AWC B;  3DEP A;  1WY6 A;  3QWP A;  2V5F A;  3LYA A;  2J4D A;  4J0U A;  4HS2 A;  2V4H C;  5G05 C;  4KZC A;  3LKU A;  4JW1 A;  4I2Z A;  4BTB A;  4UWK A;  3CVQ A;  5ENO D;  3HXF A;  4HXI A;  4HOS A;  1FPP A;  5D66 A;  3MYV A;  4GCO A;  3DPD A;  3TWX A;  4G8K A;  4LNU D;  5AJL A;  3FH7 A;  2XPY A;  4GZ6 A;  3JXJ A;  3ASF A;  4MBG A;  2X6H A;  3SBT B;  3UIP C;  4WNF A;  4ME2 A;  1OWL A;  5LFA A;  5A7D B;  1BI7 B;  2FUL A;  4XI9 A;  1OCO E;  3UM1 A;  5IY5 E;  5J08 A;  2CHX A;  3UUX A;  3UQ3 A;  4UQZ A;  4ILH B;  3U3W A;  3I3N A;  3GZ1 A;  1N4P A;  2GRP B;  2LNI A;  1OWM A;  2VYI A;  2XGS A;  4UI9 C;  5ITZ F;  3TWR A;  2DBA A;  1E8W A;  2R03 A;  4GA1 A;  3AG4 E;  1N4S A;  5FZS A;  1OT8 A;  1NI1 A;  3S2A A;  4DX5 D;  2IOL A;  3GW4 A;  2QYU A;  3LJN A;  4XE0 A;  3UM0 A;  1XGW A;  4HOQ A;  5KJK A;  3C3O A;  4AY5 A;  1QYM A;  3PDN A;  2OVF A;  4A3V A;  1TNZ A;  2R2L A;  3ZXS A;  3APF A;  5FWQ A;  3SY2 A;  2X6K A;  1FCH A;  4O60 A;  3VLF A;  5JJT A;  1X81 A;  2J4B A;  3TXN A;  1NA0 A;  4CDN A;  3L6A A;  1FT1 A;  2CHW A;  3J5Q B;  3TG4 A;  3OTN A;  2RFA A;  1OXJ A;  3AAA C;  3CK9 A;  4J8Y A;  1ELR A;  3SHF A;  4HB5 A;  4C48 B;  2QYJ A;  1MX6 A;  3C3R A;  2WXR A;  1RZ4 A;  3E30 A;  2P2C P;  3PZ3 A;  2P9L G;  3CHO A;  3D9L A;  4WWN A;  2BED A;  3FUH A;  4LNB A;  2H6H A;  5CER B;  4KMO A;  4HLL A;  5AJD A;  3ZHE A;  3TWS A;  5ENT D;  1OCR E;  2RFM A;  4JZY A;  2J08 A;  2I1K A;  3RU0 A;  1YYH A;  2DWZ A;  2WXF A;  3OXG A;  2OCC E;  4JVS A;  4DI4 A;  1U2V G;  3UM2 A;  2FO7 A;  5FZQ A;  5LCW J;  2KZT B;  2X6I A;  4N3B A;  3CVP A;  3HVE B;  3ESL A;  3U64 A;  4JPS A;  1OCC E;  2KM4 A;  2WM9 A;  3QDN A;  3WXX A;  1HS6 A;  1UN9 A;  4UWH A;  1Y8M A;  4GTQ A;  1VDY A;  3BG1 B;  2IOS A;  1U3D A;  2GW1 A;  2FI7 A;  3FTU A;  1WM5 A;  1UJK A;  2WXO A;  4FC8 A;  3D9I A;  1N9A A;  3V2O A;  3D9N A;  2BUG A;  1H2T C;  3ZIM A;  2X6J A;  3DPY A;  1IQU A;  1E7U A;  2B6C A;  2ETB A;  1TN7 A;  2FBN A;  3CVY A;  3HHM A;  3C72 A;  2V8S E;  4EHM A;  2V4L A;  1O1T A;  3D9K A;  1O5M A;  1B89 A;  1E8Y A;  4FLB A;  4IUL A;  3JXI A;  2DYS E;  3GZ2 A;  5ENS D;  5FTP A;  3Q49 B;  4CRW A;  3CK7 A;  2KAT A;  2WXI A;  2BKG A;  4MS6 A;  1E90 A;  2VJ8 A;  4I1A A;  2LSV A;  4FJY A;  3KEZ A;  1H2V C;  1H2U A;  3IV0 A;  3CK8 A;  3LPZ A;  3NBN B;  4BY6 A;  4ANW A;  3W9G A;  5G04 C;  2Y4T A;  1UN8 A;  4H7X A;  4Y6W A;  5AYW D;  4N3A A;  2AW6 A;  2BKK B;  2WMO A;  3FUF A;  4GTP A;  2XRZ A;  5ENN A;  2AVP A;  5BNW A;  2CG3 A;  4DLQ A;  4FP7 A;  3VLE A;  4BTA A;  1Q2Z A;  3OXL A;  3ABK E;  5CMW A;  2I6H A;  1TNB A;  4URK A;  2DCP A;  2F8Y A;  4NIK A;  2AXV A;  3PEU B;  5KCM A;  4FLH A;  4L2L A;  4YVQ C;  3L13 A;  3D9H A;  3FUI A;  2EIM E;  4JEH A;  2X3M A;  2WXK A;  3LJ3 A;  1PC2 A;  3FTZ A;  5HKP A;  2IO3 C;  3LDZ A;  2LO6 A;  4AVX A;  2HR2 A;  2XRY A;  3CIA A;  4HRL A;  3UX4 A;  4AV7 A;  1D8D A;  3NF1 A;  5EYP F;  3IXE A;  2X38 A;  1TNU A;  4JEU A;  3RRN B;  2J07 A;  4AY6 A;  4G25 A;  3TXM A;  3ZPJ A;  4BEP A;  3FUM A;  5JA4 D;  3B7T A;  1OUV A;  1FVF A;  4U7E B;  3L08 A;  3TWV A;  1P5Q A;  3AJI A;  3FEX A;  1MX2 A;  1HG2 A;  2XS8 A;  1ZBP A;  3D9P A;  5CCM A;  1N54 A;  2VQ2 A;  3NZS A;  3DSS A;  3QOU A;  3UIN C;  1UW4 B;  4A55 A;  4W9R A;  3ULE G;  4I1M A;  3LVR E;  4YND A;  4TUM A;  5DBK A;  1E7V A;  4DX2 A;  3D3M A;  4EZK A;  3J5P A;  2J9Q A;  3QAQ A;  1HXI A;  3ZXP A;  4TUU A;  4B0Z A;  2P9N G;  4YDW A;  3ZRH A;  3FWV A;  4JL0 A;  1H6P A;  3LCA A;  3T9K A;  4AJW A;  3VTX A;  3IHV A;  2WVI A;  5EX3 A;  3SI5 A;  3ZU7 B;  2LXL A;  3TAX A;  4XEI G;  1TJF A;  2VGY A;  1K8K G;  3TGO A;  4KVO A;  5KJM A;  4ILG A;  3TWQ A;  5JMN D;  1TNY A;  1UG3 A;  3PUK A;  2YHC A;  2VGX A;  3TG5 A;  1Z5S C;  3ONK A;  3QK0 A;  3KSQ A;  3EHM A;  4RLY A;  2J09 A;  4B8C B;  3V79 K;  3SF4 A;  4Q69 A;  3R7Q A;  2QC9 A;  4CDM A;  2P9P G;  4L23 A;  3CHR A;  3P2B A;  2R02 A;  4XZ4 A;  4GZ3 A;  1QZ2 A;  2WXN A;  2H6G A;  4B89 A;  2NXP A;  3ZFW A;  2IQC A;  3PE4 A;  4G23 A;  4PH4 B;  4FJZ A;  2Y1L E;  4OVU A;  1K1B A;  5M72 A;  4DX7 D;  3ZKJ A;  5D0Q D;  1IYG A;  1KPS B;  3FH5 A;  4GAA A;  1DCQ A;  3CKB A;  3C3Q A;  1U3C A;  4LEU A;  3LY7 A;  5CRU A;  3DSV A;  2OEV A;  4TV3 A;  2Y0B G;  5E76 A;  5B1B E;  5A23 A;  5EDS A;  4I2W A;  1JCQ A;  2QFC A;  1WAO 1;  4KVM A;  2H6I A;  4O1O A;  4GPK A;  1O1S A;  3PZ4 A;  4UI9 K;  3BU8 A;  5G55 A;  4KBQ A;  4HFG A;  4D10 C;  1IHG A;  4AXH A;  3CQG B;  1JCS A;  4RG9 A;  2FEZ A;  3AG2 E;  3FH8 A;  2MHK A;  4GYW A;  4WNG A;  1RW2 A;  2H6F A;  3ASG A;  3EIQ C;  4BSX A;  3DSW A;  4HOT A;  2XQ0 A;  3CVL A;  2WQ7 A;  5KJL A;  4I6J A;  3B7R L;  3NQP A;  3I5P A;  1IKN D;  3MZL B;  1SZ9 A;  5DIZ A;  2IO2 C;  3RO3 A;  4IRU A;  3TL5 A;  3FTV A;  4GTT A;  3PRE A;  2PQN A;  3IEG A;  4EBA G;  4A1S A;  4EQF A;  3PVL A;  5CHE E;  1N0Q A;  3UMV A;  1NP7 A;  4QFV A;  3TJP A;  1LD8 A;  2UY1 A;  1OCZ E;  1QBQ A;  3HDX A;  3UM3 A;  2ZGG A;  2IF4 A;  4WWO A;  4AM9 A;  1HG5 A;  2L6B A;  3R9M A;  3QAR A;  3PS6 A;  1X5B A;  5ARF A;  1AP7 A;  4H7Y A;  4MLP A;  5AQ9 A;  4GCN A;  5LX8 A;  2CFU A;  1TN8 A;  2PZI A;  3URZ A;  2VSX E;  5ENP D;  3MV3 B;  1TR4 A;  5D0O D;  3B7S A;  3JUI A;  5KJN A;  4PUC A;  2DZO A;  2A5E A;  5FQ7 A;  3Q9N C;  2JLB A;  1MJ0 A;  5BPP A;  1IQR A;  4UWL A;  3LS8 A;  2Y3A A;  4BT9 A;  3EUV A;  4M7C A;  3CEQ A;  4N5C A;  3NZU A;  1YCS B;  3QWW A;  5EIL A;  5LP0 A;  3CVX A;  3ASD A;  3RK6 A;  3G2U A;  5CEC B;  4BET A;  3RRM B;  1E96 B;  1KZO A;  4Y6C A;  1TN6 A;  3CST A;  3L54 A;  3E32 A;  3DXM G;  4EPZ A;  3ZVV A;  5BV0 A;  1TJC A;  4FU3 A;  5BXO A;  3PH0 C;  4B8A A;  1NL4 A;  2CHZ A;  3HXB A;  4C9B B;  3EJN A;  3HIZ A;  4DI3 A;  2V0P A;  3ZYL A;  5KNH D;  4TXQ A;  3MGB A;  3UI2 A;  4APO A;  3BEE A;  2MRI A;  3ASO E;  3E34 A;  3SD5 A;  1H19 A;  3QC1 A;  1OWP A;  4OAU C;  2V5Q C;  1D9S A;  3DBS A;  3V2X A;  2P9K G;  2C2L A;  3O4Z A;  3U66 A;  4ANU A;  4J8S A;  4GTM A;  5HQ8 A;  3C5R A;  3EU5 A;  3L22 A;  1BU9 A;  3SBS A;  2RG8 A;  1WDY A;  3UPV A;  1TYQ G;  1MX4 A;  4GA2 A;  5AQA A;  3FUK A;  3DSX A;  4JB8 P;  4ATZ D;  5HI7 A;  4JHR A;  3ML8 A;  4Q94 A;  5EID A;  2ZIS A;  5G04 J;  2UWJ G;  4MKT A;  2ION A;  2VGX B;  2XZT G;  5FQ4 A;  4U63 A;  4JXT A;  1S63 A;  1KT0 A;  4A1G A;  4N2Q A;  3S7J A;  2JEK A;  1HFA A;  2A4Z A;  4JHJ A;  1HZ4 A;  3L9T A;  4U95 D;  4JD2 G;  1XNF A;  2KXP C;  4CCA A;  4A63 B;  3Q75 A;  4F3V A;  3HRA A;  3ZW3 A;  3BG0 B;  4LCT A;  3RSE G;  1TEZ A;  5ARG A;  4DLO A;  3PZ2 A;  2R05 A;  4A3T A;  3UKU G;  4ANV A;  4YVO A;  5FIO A;  3DWL G;  1HH8 A;  1TNO A;  2VSO E;  4GZC A;  3JQ1 A;  4FA6 A;  2J49 A;  3AS4 A;  3KAE A;  4HLE A;  4J8E A;  1IXV A;  1PAQ A;  3FTW A;  1D8E A;  3FTY A;  5FIN A;  3NAW A;  5EKQ D;  1SW6 A;  4LRZ A;  4GB9 A;  3LXU X;  3G2T A;  2Q7F A;  1JWF A;  5AIJ A;  5JJ6 A;  2VSN A;  3AU4 A;  4B94 A;  3U9W A;  3ONL A;  4ATG A;  5FQ8 A;  4KYO B;  4BWR A;  4HI8 A;  3IHY A;  5FZR A;  4RG6 A;  1DCE A;  2CFZ A;  2VSY A;  3QB2 A;  3ZYK A;  4CT4 A;  2CG2 A;  3LVQ E;  3RKV A;  1H6K A;  4FHJ A;  4RQI A;  4N2S A;  3SQV A;  3ENE A;  3CVN A;  3CV0 A;  3PNT B;  2GRR B;  2I9C A;  3PE3 A;  2DZN A;  3W9F A;  1JPL A;  4U07 A;  4GA0 A;  2AJA A;  1PY1 A;  2L6J A;  3RJV A;  1Z6T A;  2YHE A;  3ASN E;  2KCV A;  2HO1 A;  2ETC A;  3G2V A;  3FFL A;  2AXU A;  2UY1 B;  2XHE A;  4L7T A;  4WND A;  1INZ A;  1E8X A;  4O1P A;  5C1D A;  4GYY A;  4WAF A;  1N95 A;  2WMN A;  4LNG A;  5C2Y A;  3HG0 D;  3FUN A;  3VTY A;  2OVB A;  1Y6I A;  1NA3 A;  4C0E A;  5KWD A;  3MKQ B;  4K5C A;  1KT1 A;  5AQ7 A;  4ANX A;  1ZB1 A;  3O48 A;  4PS7 A;  1O1R A;  4J8F A;  4HOR A;  3CHP A;  2WQ6 A;  2VGE A;  2GRN B;  4GTV A;  4F53 A;  1YMP A;  3FU5 A;  3CSF A;  4G2V A;  4DJA A;  3CR3 A;  1NFI E;  1LD7 A;  3CQC B;  3Q9U C;  3EHR A;  2GRQ B;  3PEV B;  5JHB A;  3FUD A;  3Q7F A;  1Z3X A;  3EIJ A;  2IU1 A;  3UTM A;  1N11 A;  3RRU A;  1SQM A;  2R5S A;  2ZGD A;  3SNX A;  1S64 A;  1MHQ A;  3AS8 A;  1GW6 A;  4IN3 B;  3PZD A;  3FUE A;  3V31 A;  2YQ8 A;  3DST A;  3ESK A;  3RAU A;  4U0U A;  3LY9 A;  5G05 J;  3UXG A;  4FHK A;  2P9I G;  3CKC A;  2DYR E;  4F1S A;  3EHQ A;  1Z3Y A;  1N52 A;  3ASH A;  3B95 A;  3FEY A;  2FF4 A;  4I6G A;  1BLX B;  2P9S G;  3E33 A;  3NOG D;  4WNE A;  2ETA A;  2LSU A;  4BSZ B;  1V54 E;  3E4B A;  3UKR G;  5AN8 A;  4J6I A;  5JHA A;  2R17 C;  3S7F A;  5J90 A;  5D2M C;  2F8X K;  3CGH A;  3FUJ A;  4CEM A;  2NSZ A;  2QY7 A;  3SFX A;  2EQX A;  1W3B A;  3EHN A;  3N71 A;  4KXK B;  1G3N B;  2GRL A;  3JQ0 A;  3Q15 A;  5FT9 A;  3GZS A;  1UJJ A;  1K1A A;  2EIJ E;  3RO2 A;  2PM7 A;  3S7D A;  3UIO C;  4BFR A;  1DNP A;  4UI9 J;  2KC7 A;  4R7L A;  4LSZ E;  4OVV A;  3UT4 A;  5CBO A;  4K03 A;  2ZXW E;  4M3O A;  3X2Q E;  1L5J A;  1A5E A;  4L1B A;  3PNL B;  4N5Q A;  2P58 C;  3B7B A;  4HRM B;  2MOW A;  3NOC D;  3CLJ A;  2IY0 C;  1BD8 A;  4GU5 A;  1DC2 A;  4U04 A;  4BX9 A;  2WXL A;  3QJZ A;  4WUY A;  4AP2 A;  3CHQ A;  3T8M A;  2Y69 E;  4G8L A;  4U96 D;  2Y4U A;  2XPI A;  4FUL A;  4PS3 A;  4DK5 A;  4J8D A;  1N94 A;  3SFY A;  1JUQ A;  4F6R D;  4FAD A;  4C0M A;  2ZU6 B;  3FU3 A;  1ELK A;  5ANR A;  4PDX A;  5CEA A;  4HVB A;  3QNK A;  3JYS A;  5EX0 A;  4ZHB A;  4CT0 A;  1KZP A;  2C0M A;  3SZ7 A;  4HI9 A;  3LY8 A;  2HM8 A;  3WG7 E;  5E75 A;  2ZIR A;  4BER A;  1FVH A;  3HXD A;  3IBE A;  3K9I A;  2XS1 A;  3MKQ A;  2XEV A;  3T5X A;  2WXQ A;  1IHB A;  2RD0 A;  2R59 A;  2XGM A;  3C98 A;  4JHK A;  5CRV A;  5AEN A;  4RVB A;  3PZ1 A;  3AS5 A;  3LEW A;  2LAI A;  4G11 A;  3TWW A;  4GMJ A;  4I6E A;  3ABM E;  3D9M A;  4GYO A;  4CGW A;  3AG1 E;  3FU6 A;  4K5A B;  4TRQ A;  3FTS A;  2KBX A;  3FY4 A;  1JWG A;  1LF8 A;  3R7R A;  3VLD A;  3S7B A;  4QQI A;  3RIB A;  3CHS A;  1SA5 A;  4U8Y D;  2L9B A;  2MYO A;  2DIW A;  4WWP A;  4NAC A;  3UT7 A;  2LUH A;  2ILR A;  3CHM A;  3F6Q A;  3HXC A;  2A5U A;  2NYJ A;  1K3Z D;  4XI0 A;  3TWU A;  4UUC A;  2QZA A;  4JA7 A;  3ZYM A;  4CGV A;  3PUJ A;  4HOU A;  2WXH A;  3FHE A;  3SO8 A;  4ZFH A;  4G1T A;  4I1O B;  3MKR A;  2I2O A;  3IKO B;  3FUL A;  3HXE A;  4LUN U;  2GRO B;  2XEE A;  5ENR D;  1KLX A;  3L82 A;  3MA5 A;  1EF1 C;  2HYZ A;  1DVP A;  3Q7A A;  2OV8 A;  4TXR A;  3PRZ A;  3E37 A;  2WB2 A;  3CVV A;  2XCC A;  3UT8 A;  2EIL E;  4UQY A;  2VTB B;  2OND A;  1BPO A;  2IEJ A;  1FT2 A;  2WPV A;  5LCW C;  4NUR A;  2XGO A;  5G2N A;  5KNG A;  3CVW A;  3I4G A;  2WXM A;  4B93 B;  1ELW A;  3MJW A;  3EU9 A;  2OOE A;  2GGF A;  1HU3 A;  4NRH B;  3B13 A;  5CBN A;  3ZGQ A;  4EBA A;  4L2Y A;  1EDU A;  3OXF A;  2J8S D;  1WG0 A;  3DEO A;  2PNN A;  4IYP A;  2P9U G;  2PM6 A;  4I9C A;  3MX3 A;  3I4R B;  3D9O A;  3QKY A;  3QWV A;  5BW8 C;  2B0O E;  4JA9 A;  4ABN A;  4ACK A;  3D9J A;  4EEC A;  3EDT B;  2YIN A;  5HRY A;  2OEW A;  4XKB A;  3ABL E;  5EYL A;  3FP3 A;  2PL2 A;  4DPR A;  2RKK A;  5B3S E;  4N39 A;  4XIF A;  4DX1 A;  3NB2 A;  3V30 A;  4APF A;  2JAB A;  2XZD G;  1YA0 A;  4GTS A;  3TWT A;  4GTO A;  3ZEF A;  5ANL A;  4UWG A;  5AAR A;  2L0T B;  3G2W A;  3MEK A;  3JCK C;  5ENQ D;  1UOH A;  4AEZ C;  3BUA A;  4BT8 A;  4X8Q A;  4F7A A;  4RSY A;  2KCK A;  3Q79 A;  1SA4 A;  3BQO A;  3P1U A;  3T8K A;  2EIK E;  4AOF A;  3G2S A;  1MZC A;  3Q4A B;  3ZUV B;  4NQ0 A;  3R9A B;  4CDR A;  1N0R A;  3ULQ A;  1S70 B;  3APD A;  2M63 A;  5T4Y A;  4YDO A;  1S0P A;  2HE0 A;  4I43 A;  5HS0 A;  5BUZ A;  4J7W A;  4HBD A;  4YDE A;  3T5V A;  3DRA A;  2XPZ A;  2F0Y A;  3DXK G;  5AQB A;  5CED B;  4BX8 A;  3GYZ A;  1MYO A;  4AIF A;  1H0A A;  2PQR A;  4CYM D;  1QNF A;  2NC9 A;  3MV2 B;  3Q78 A;  4EZJ A;  3SFZ A;  1BI8 B;  4XKC A;  3DSU A;  4G26 A;  3Q47 B;  4DUI A;  2E0I A;  4G24 A;  3Q5M A;  1H6O A;  4HRN A;  3ISM C;  4ILI A;  1OWO A;  2L0I A;  4U0S A;  2XEH A;  1ZU2 A;  1SVX A;  2I1J A;  2C0L A;  3ZNG A;  4DRX E;  5CCL A;  2EIN E;  3SGH A;  3L17 A;  4GML A;  1HX8 A;  2WQH A;  4JC8 A;  1MQS A;  4UQX A;  2IJG X;  1LTX A;  4ACL A;  5A6C A;  3HYM B;  1A17 A;  2IFU A;  1HE8 A;  2KZT A;  3KS2 A;  4HQD A;  5EIB E;  3HVE A;  4N3C A;  3ULY A;  1EYH A;  4MRU A;  3MCX A;  1N4Q A;  4GMR A;  2X6F A;  4O6F A;  4Z68 A;  4EZL A;  4KT6 B;  1OY3 D;  4E6H A;  3U4T A;  3L16 A;  3AU5 A;  4E85 A;  2VTB A;  5BXU A;  2DVW A;  4U8H A;  2WXG A;  4XX5 A;  4I17 A;  3KD7 A;  2LAH A;  5FJY A;  5FQ6 A;  5T8I A;  5B1A E;  1OWN A;  4TXP A;  1EPU A;  1SZA A;  2GRM A;  2AXZ A;  3Q73 A;  3AG3 E;  4CZ2 D;  5AAO A;  3FDH A;  5JJ7 A;  4I9E A;  4UWF A;  1V55 E;  2F37 A;  2AWI A;  4KZ0 A;  4U0Z A;  3KSL A;  3OAW A;  4OAV B;  3FU0 A;  4K0R A;  4BES A;  1HO8 A;  3B7U X;  5EN5 D;  5T3R A;  2WXJ A;  3ZN3 A;  5CMY A;  2BF0 X;  3ZYQ A;  5KBA A;  4L9P A;  4GZ5 A;  5BV1 A;  1HF8 A;  1N4R A;  4DX6 D;  3KEA A;  2XEN A;  4GZD A;  3FTX A;  1JCR A;  4K5B A;  2KCL A;  4U8V D;  4F1P A;  3ZHE B; 
#chains in the Genus database with same CATH homology
 2C0M A;  4JEU A;  3RRN B;  3ML9 A;  3SZ7 A;  4PS8 A;  3CVU A;  3L22 A;  2J07 A;  3SBS A;  1QQE A;  3LY8 A;  4LER A;  4AY6 A;  1E8Z A;  4V3I A;  2HM8 A;  4G25 A;  2RG8 A;  3UPV A;  5E75 A;  3TXM A;  3ZPJ A;  2E2E A;  1FVH A;  4GA2 A;  3IBE A;  2WXP A;  2XCB A;  3K9I A;  3MKQ A;  1NZN A;  3APC A;  3FUK A;  2XEV A;  4OYS A;  3T5X A;  3FUM A;  5HI7 A;  3B7T A;  2WXQ A;  1OUV A;  5BT1 A;  1FVF A;  4JHR A;  3L08 A;  3ML8 A;  4Q94 A;  1P5Q A;  2RD0 A;  3FEX A;  4Q96 A;  1HG2 A;  2R59 A;  2XGM A;  1ZBP A;  3C98 A;  5LOZ A;  3D9P A;  4JHK A;  2UWJ G;  5G04 J;  5CCM A;  1N54 A;  2BTD A;  4MKT A;  2ION A;  2VGX B;  2YNQ A;  2VQ2 A;  5FQ4 A;  3NZS A;  4U63 A;  5AEN A;  3QOU A;  4RVB A;  4P29 A;  4JXT A;  3AS5 A;  3LEW A;  2LAI A;  1UW4 B;  1KT0 A;  4A1G A;  4A55 A;  4N2Q A;  4G11 A;  3S7J A;  4GMJ A;  2JEK A;  1WY6 A;  3QWP A;  4I6E A;  4W9R A;  1HFA A;  2A4Z A;  3D9M A;  4GYO A;  2V5F A;  4I1M A;  1HZ4 A;  4JHJ A;  4CGW A;  3FU6 A;  1XNF A;  3LYA A;  4CCA A;  2J4D A;  3LVR E;  4J0U A;  4TRQ A;  4HS2 A;  4YND A;  5DBK A;  3FTS A;  1E7V A;  3FY4 A;  1JWG A;  1LF8 A;  5G05 C;  3R7R A;  3D3M A;  4EZK A;  4KZC A;  3LKU A;  4F3V A;  2J9Q A;  4JW1 A;  3QAQ A;  1HXI A;  4I2Z A;  3VLD A;  4TUU A;  3S7B A;  3RIB A;  4B0Z A;  3CHS A;  3ZW3 A;  3ZRH A;  4BTB A;  3FWV A;  4JL0 A;  2L9B A;  3BG0 B;  4LCT A;  2DIW A;  3LCA A;  4UWK A;  4WWP A;  4AJW A;  4NAC A;  3VTX A;  3UT7 A;  1TEZ A;  3IHV A;  2WVI A;  2ILR A;  5ARG A;  3CHM A;  3CVQ A;  5EX3 A;  3SI5 A;  4DLO A;  4A3T A;  3TAX A;  2A5U A;  4ANV A;  4YVO A;  1HH8 A;  2VSO E;  4HXI A;  4GZC A;  3JQ1 A;  4XI0 A;  4FA6 A;  4HOS A;  2J49 A;  3MYV A;  4GCO A;  3DPD A;  4CGV A;  4JA7 A;  3ZYM A;  3PUJ A;  4HOU A;  1TJF A;  3AS4 A;  5AJL A;  2WXH A;  3FH7 A;  2XPY A;  3FHE A;  4GZ6 A;  4G1T A;  3KAE A;  4I1O B;  3MKR A;  4HLE A;  2I2O A;  2VGY A;  3ASF A;  4J8E A;  3IKO B;  2X6H A;  3SBT B;  4WNF A;  1PAQ A;  3FTW A;  3FUL A;  4ME2 A;  3FTY A;  4LUN U;  1OWL A;  5LFA A;  3TGO A;  5A7D B;  5EKQ D;  4KVO A;  2FUL A;  4LRZ A;  5KJM A;  4GB9 A;  1KLX A;  4XI9 A;  3LXU X;  4ILG A;  3MA5 A;  3G2T A;  2Q7F A;  1JWF A;  5J08 A;  2CHX A;  5AIJ A;  5JJ6 A;  1EF1 C;  2HYZ A;  1DVP A;  3UUX A;  2OV8 A;  2VSN A;  3AU4 A;  4B94 A;  1UG3 A;  3PUK A;  2YHC A;  3U9W A;  3UQ3 A;  4UQZ A;  2VGX A;  3TG5 A;  4ILH B;  3ONK A;  3ONL A;  3U3W A;  3I3N A;  3QK0 A;  4ATG A;  5FQ8 A;  3GZ1 A;  4KYO B;  3PRZ A;  4BWR A;  3EHM A;  2J09 A;  4B8C B;  3SF4 A;  2LNI A;  5FZR A;  3IHY A;  1OWM A;  2WB2 A;  2VYI A;  3CVV A;  2XCC A;  4Q69 A;  3R7Q A;  2XGS A;  4RG6 A;  4UI9 C;  3UT8 A;  2CFZ A;  2DBA A;  1E8W A;  4GA1 A;  4UQY A;  2VSY A;  2VTB B;  3QB2 A;  3ZYK A;  4CDM A;  4L23 A;  2OND A;  3CHR A;  3P2B A;  1BPO A;  5FZS A;  4CT4 A;  3S2A A;  2CG2 A;  2WPV A;  4XZ4 A;  3LVQ E;  3RKV A;  4NUR A;  5LCW C;  2XGO A;  5G2N A;  2IOL A;  3GW4 A;  3CVW A;  1H6K A;  4FHJ A;  3I4G A;  2WXM A;  4GZ3 A;  1ELW A;  1QZ2 A;  2WXN A;  3MJW A;  2OOE A;  2GGF A;  1HU3 A;  4NRH B;  4XE0 A;  4N2S A;  3B13 A;  1XGW A;  4B89 A;  4HOQ A;  3ZGQ A;  4EBA A;  5KJK A;  2NXP A;  3ZFW A;  2IQC A;  4AY5 A;  4L2Y A;  3PE4 A;  3PDN A;  2OVF A;  1EDU A;  3ENE A;  3CVN A;  4A3V A;  3OXF A;  4G23 A;  3CV0 A;  4PH4 B;  3PNT B;  4IYP A;  4FJZ A;  2I9C A;  3ZXS A;  3PE3 A;  3APF A;  5FWQ A;  4OVU A;  5M72 A;  1JPL A;  2PM6 A;  4U07 A;  4I9C A;  2X6K A;  4GA0 A;  1PY1 A;  5D0Q D;  1IYG A;  2L6J A;  1FCH A;  3MX3 A;  3I4R B;  3RJV A;  3D9O A;  3QKY A;  3QWV A;  1Z6T A;  5BW8 C;  3VLF A;  5JJT A;  3FH5 A;  2J4B A;  3TXN A;  1NA0 A;  2YHE A;  4GAA A;  4JA9 A;  4ABN A;  4CDN A;  2KCV A;  3L6A A;  4ACK A;  3CKB A;  2HO1 A;  3D9J A;  5BNW A;  1U3C A;  4LEU A;  4EEC A;  3EDT B;  3LY7 A;  2CHW A;  3G2V A;  3TG4 A;  2YIN A;  3OTN A;  4XKB A;  4TV3 A;  3FP3 A;  2PL2 A;  4DPR A;  3CK9 A;  3FFL A;  1ELR A;  4N39 A;  2AXU A;  4XIF A;  2UY1 B;  3SHF A;  2XHE A;  5E76 A;  5A23 A;  5EDS A;  4APF A;  4I2W A;  2QFC A;  1WAO 1;  4L7T A;  4KVM A;  4WND A;  4GPK A;  1INZ A;  1E8X A;  4UI9 K;  1YA0 A;  5C1D A;  2WXR A;  4GYY A;  4WAF A;  5G55 A;  4KBQ A;  3ZEF A;  5ANL A;  4UWG A;  2WMN A;  4HFG A;  2L0T B;  3G2W A;  3MEK A;  5C2Y A;  4D10 C;  1IHG A;  3VTY A;  3CQG B;  3CHO A;  3FUN A;  4AXH A;  3D9L A;  2OVB A;  3JCK C;  4WWN A;  1Y6I A;  4RG9 A;  3FUH A;  4AEZ C;  1NA3 A;  4C0E A;  2FEZ A;  3MKQ B;  3FH8 A;  4KMO A;  1KT1 A;  4BT8 A;  4F7A A;  2MHK A;  4RSY A;  2KCK A;  5AJD A;  4ANX A;  4GYW A;  3ZHE A;  4WNG A;  3ASG A;  3O48 A;  4PS7 A;  3EIQ C;  3P1U A;  4BSX A;  4JZY A;  4HOT A;  2J08 A;  2I1K A;  2XQ0 A;  3CVL A;  3RU0 A;  4J8F A;  4AOF A;  2WQ7 A;  4HOR A;  3CHP A;  3G2S A;  3B7R L;  3NQP A;  4I6J A;  5KJL A;  3Q4A B;  3I5P A;  2WQ6 A;  2WXF A;  4F53 A;  3OXG A;  4NQ0 A;  4JVS A;  3R9A B;  4DI4 A;  4CDR A;  3FU5 A;  2FO7 A;  3MZL B;  5FZQ A;  1SZ9 A;  5LCW J;  5DIZ A;  2KZT B;  2X6I A;  3CSF A;  4G2V A;  4N3B A;  3RO3 A;  4DJA A;  3CVP A;  3ULQ A;  3CR3 A;  3HVE B;  4IRU A;  3TL5 A;  3ESL A;  3FTV A;  3CQC B;  3U64 A;  3PEV B;  3APD A;  4JPS A;  5JHB A;  2M63 A;  5T4Y A;  3FUD A;  2KM4 A;  2PQN A;  3IEG A;  3PRE A;  1S0P A;  2WM9 A;  3QDN A;  3WXX A;  1HS6 A;  1UN9 A;  4UWH A;  1Y8M A;  4A1S A;  4EBA G;  1Z3X A;  4I43 A;  3EIJ A;  4EQF A;  1VDY A;  5BUZ A;  3PVL A;  3BG1 B;  2IOS A;  5CHE E;  2IU1 A;  1U3D A;  3T5V A;  2GW1 A;  2XPZ A;  3UMV A;  2FI7 A;  1NP7 A;  3FTU A;  1WM5 A;  4BX8 A;  1UJK A;  3GYZ A;  3RRU A;  1SQM A;  2R5S A;  4QFV A;  3SNX A;  3TJP A;  2WXO A;  1MHQ A;  4FC8 A;  3D9I A;  1H0A A;  2PQR A;  4AIF A;  2UY1 A;  3AS8 A;  1QNF A;  2NC9 A;  3D9N A;  1GW6 A;  3HDX A;  4IN3 B;  2BUG A;  1H2T C;  3MV2 B;  3ZIM A;  4EZJ A;  2IF4 A;  4WWO A;  2X6J A;  3FUE A;  3PZD A;  1HG5 A;  3SFZ A;  4AM9 A;  3QAR A;  2YQ8 A;  3ESK A;  4XKC A;  1IQU A;  4U0U A;  3LY9 A;  1E7U A;  4G26 A;  3Q47 B;  3PS6 A;  5G05 J;  1X5B A;  4FHK A;  5ARF A;  4H7Y A;  4MLP A;  2E0I A;  2FBN A;  3CKC A;  4GCN A;  3CVY A;  3HHM A;  4G24 A;  2V8S E;  4F1S A;  3Q5M A;  5LX8 A;  2CFU A;  4ILI A;  1OWO A;  2V4L A;  2L0I A;  3D9K A;  4U0S A;  1Z3Y A;  2PZI A;  3URZ A;  4CT0 A;  2VSX E;  1N52 A;  1B89 A;  1E8Y A;  3MV3 B;  1ZU2 A;  5D0O D;  3ASH A;  3B7S A;  4FLB A;  3FEY A;  2FF4 A;  2I1J A;  3JUI A;  4I6G A;  4IUL A;  2C0L A;  5CCL A;  3GZ2 A;  4WNE A;  3SGH A;  5FTP A;  3L17 A;  5KJN A;  3Q49 B;  4GML A;  4PUC A;  1HX8 A;  2LSU A;  2WQH A;  4JC8 A;  3CK7 A;  4CRW A;  1MQS A;  2KAT A;  2WXI A;  3E4B A;  2IJG X;  4UQX A;  5FQ7 A;  2JLB A;  4MS6 A;  4ACL A;  1IQR A;  5BPP A;  4UWL A;  5A6C A;  3HYM B;  1A17 A;  1E90 A;  2IFU A;  3LS8 A;  1HE8 A;  2KZT A;  2VJ8 A;  2Y3A A;  3KS2 A;  4J6I A;  5JHA A;  4BT9 A;  2R17 C;  3HVE A;  4N3C A;  4I1A A;  2LSV A;  4FJY A;  3KEZ A;  1EYH A;  3S7F A;  5J90 A;  1H2V C;  4MRU A;  1H2U A;  3IV0 A;  3CEQ A;  3MCX A;  3CGH A;  3FUJ A;  4O6F A;  2X6F A;  3CK8 A;  4N5C A;  3LPZ A;  4CEM A;  4BY6 A;  4KT6 B;  4EZL A;  2NSZ A;  3NZU A;  3QWW A;  4E6H A;  2QY7 A;  3U4T A;  3L16 A;  4ANW A;  5G04 C;  2Y4T A;  5LP0 A;  3CVX A;  3ASD A;  1UN8 A;  4H7X A;  2EQX A;  3AU5 A;  4Y6W A;  5AYW D;  3RK6 A;  3G2U A;  4E85 A;  4N3A A;  2VTB A;  2AW6 A;  1W3B A;  3EHN A;  3N71 A;  4KXK B;  2WMO A;  4U8H A;  3FUF A;  2WXG A;  1E96 B;  2GRL A;  4XX5 A;  3RRM B;  3JQ0 A;  4I17 A;  3KD7 A;  2XRZ A;  2LAH A;  5FJY A;  5ENN A;  5FQ6 A;  4Y6C A;  5T8I A;  3Q15 A;  3L54 A;  3CST A;  1OWN A;  5FT9 A;  3GZS A;  1UJJ A;  2AVP A;  1EPU A;  2CG3 A;  3RO2 A;  2PM7 A;  3S7D A;  4DLQ A;  1SZA A;  2GRM A;  4FP7 A;  3VLE A;  2AXZ A;  4BTA A;  1DNP A;  4UI9 J;  3ZVV A;  4BFR A;  4EPZ A;  5BV0 A;  1TJC A;  4FU3 A;  3OXL A;  2KC7 A;  3PH0 C;  4B8A A;  5CMW A;  4R7L A;  3FDH A;  4OVV A;  3UT4 A;  2I6H A;  5JJ7 A;  2CHZ A;  4URK A;  4K03 A;  2DCP A;  4M3O A;  4C9B B;  1L5J A;  3EJN A;  4I9E A;  2AXV A;  4UWF A;  3PEU B;  4L1B A;  5KCM A;  3HIZ A;  4FLH A;  4DI3 A;  2V0P A;  3PNL B;  4L2L A;  2AWI A;  4KZ0 A;  4YVQ C;  2P58 C;  3L13 A;  4U0Z A;  3ZYL A;  2MOW A;  3OAW A;  3CLJ A;  3FU0 A;  3FUI A;  4K0R A;  3MGB A;  4GU5 A;  4U04 A;  4BX9 A;  4JEH A;  4APO A;  2WXL A;  1HO8 A;  3B7U X;  3BEE A;  3QJZ A;  5T3R A;  2X3M A;  4WUY A;  2WXJ A;  2MRI A;  2WXK A;  3CHQ A;  4AP2 A;  3T8M A;  3LJ3 A;  3SD5 A;  2Y4U A;  1PC2 A;  1H19 A;  3QC1 A;  3ZN3 A;  2XPI A;  5CMY A;  4FUL A;  3FTZ A;  4PS3 A;  1OWP A;  2BF0 X;  3ZYQ A;  4J8D A;  4DK5 A;  1JUQ A;  4FAD A;  4C0M A;  4GZ5 A;  3LDZ A;  5BV1 A;  2ZU6 B;  3FU3 A;  1HF8 A;  1ELK A;  5ANR A;  4PDX A;  2LO6 A;  3DBS A;  4HVB A;  4AVX A;  2HR2 A;  4GZD A;  2C2L A;  3O4Z A;  3FTX A;  3U66 A;  4ANU A;  2XRY A;  3CIA A;  3UX4 A;  4AV7 A;  4J8S A;  3QNK A;  3JYS A;  3NF1 A;  5EX0 A;  2KCL A;  5HQ8 A;  3ZHE B;  2X38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...