2P58C

Structure of the yersinia pestis type iii secretion system needle protein yscf in complex with its chaperones ysce/yscg
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
112
structure length
112
Chain Sequence
YKLNVLLAEIALIGTGNHYHEEANCIAEWLHLKGEEEAVQLIRLSSLMNRGDYASALQQGNKLAYPDLEPWLALCEYRLGLGSALESRLNRLARSQDPRIQTFVNGMREQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/chaperone
molecule keywords Putative type III secretion protein YscE
publication title Structural characterization of the Yersinia pestis type III secretion system needle protein YscF in complex with its heterodimeric chaperone YscE/YscG.
pubmed doi rcsb
source organism Yersinia pestis
total genus 46
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09477 Type_III_YscG Bacterial type II secretion system chaperone protein (type_III_yscG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2p58C00
4YNDA 4H7YA 2HO1A 3MEKA 3LKUA 1OUVA 3JYSA 4W9RA 3QKYA 3Q47B 5M72A 4WUYA 4BT9A 1ELRA 2FEZA 2KCVA 1XNFA 4GPKA 3S7BA 4GA1A 2KCLA 5CCMA 4YVQC 4NRHB 4EQFA 2AVPA 5JJ6A 5A7DB 3CVNA 4ABNA 4BTBA 3UUXA 4GA0A 4GYOA 3CK8A 4HOSA 1TJCA 3BEEA 4N3BA 2PL2A 4CGWA 4JA9A 2XCCA 5CHEE 1Y8MA 3RKVA 1P5QA 4GYYA 2YHCA 2Y4UA 1NA0A 5HQ8A 3LY8A 5BW8C 3KD7A 1HXIA 2YQ8A 3CEQA 5BNWA 1HZ4A 2HYZA 3UQ3A 3MV3B 4Y6WA 4U07A 3CKCA 4A1SA 2V5FA 4GYWA 3CV0A 2XGSA 5KJNA 1B89A 2FBNA 2BUGA 1YA0A 1ZU2A 4WNGA 3Q4AB 3TGOA 1ZBPA 3RO3A 3TG4A 1A17A 4WNEA 3QWVA 4UI9K 2UY1B 3SF4A 1WAO1 3S7JA 3UPVA 3CVQA 3GYZA 5KJMA 2ONDA 4I2WA 4GCNA 5LCWJ 4H7XA 2XCBA 4JA7A 2LNIA 5AYWD 3PE3A 4BTAA 4GZ3A 5G05J 2Q7FA 4N3CA 4CGVA 4G25A 3MV2B 3OXLA 3ZHEB 4BWRA 3CK9A 1FCHA 3OXFA 4I9EA 3N71A 4UQYA 5KJKA 2R5SA 3LY9A 4I9CA 1IHGA 2KATA 4UI9J 2XEVA 3VTXA 2VSNA 4JL0A 5HI7A 4APOA 3ASGA 2VGXA 5D0OD 3O48A 5DBKA 4G26A 3K9IA 4GCOA 2LSVA 5EX3A 4WNDA 3LY7A 2HR2A 1PC2A 5G04C 4Y6CA 2MHKA 2PQNA 4AY5A 4U0UA 4YVOA 3WXXA 2QFCA 5FZSA 3KS2A 3GZ1A 1W3BA 5JJ7A 3E4BA 2C0MA 2GW1A 3IEGA 4F3VA 5FTPA 4U0SA 1HH8A 4IN3B 3U3WA 1KT0A 4AY6A 4AM9A 4J8DA 3ASHA 4BT8A 3QWPA 1NZNA 2KCKA 4B94A 1IYGA 3ASFA 1WM5A 3MA5A 3QOUA 3ZN3A 2I6HA 3GW4A 3ZFWA 4JHRA 2IFUA 2PZIA 4I2ZA 5G05C 2KC7A 5ARFA 4G23A 2DBAA 2FO7A 4I17A 2XGMA 3ZGQA 1KLXA 4KYOB 3URZA 5FJYA 5A6CA 2Y4TA 5EX0A 3RIBA 4UI9C 4XI9A 2JLBA 3ULQA 5BT1A 2VGYA 2VYIA 3EDTB 2PQRA 3CVPA 5ARGA 2OOEA 4LEUA 4UQXA 2VSYA 3RJVA 4KXKB 3ZPJA 1KT1A 2WQHA 3CVLA 1E96B 2IF4A 5FZQA 3AS4A 2E2EA 2J9QA 3Q15A 5FT9A 2FF4A 2L6JA 4O6FA 3Q5MA 3S7DA 3ASDA 4UQZA 3LYAA 3FP3A 3Q49B 3KAEA 3FFLA 3LCAA 2XPIA 4N3AA 4J8EA 3RO2A 2UY1A 4GZ6A 2C2LA 4AIFA 3QWWA 4N2QA 2XGOA 3S7FA 3SZ7A 3LPZA 1ELWA 2NC9A 5FZRA 4G1TA 2C0LA 4I1AA 3RU0A 5D0QD 1NA3A 2VQ2A 2VGXB 5LCWC 3OXGA 2P58C 3PDNA 3CKBA 5G04J 3GZ2A 4U04A 3ESKA 3R9AB 5EKQD 3ZHEA 2WPVA 4HOTA 3AS8A 3QDNA 4HORA 3HYMB 4G24A 4NQ0A 1QQEA 2LSUA 5C1DA 3U4TA 4N39A 5KJLA 4J8FA 4CDRA 5JJTA 4HOUA 3CK7A 4XI0A 2FI7A 3TAXA 3PE4A 4XIFA 4U0ZA 4HOQA 4WNFA 3AS5A 4GZ5A 1QZ2A 5DIZA 4N2SA 4J0UA 3FWVA 5CCLA 4RG9A 3TG5A 3NF1A 4KBQA 4ME2A 4N5CA 3VTYA 4G2VA 2UWJG 4RG6A 4GA2A 3MKRA
chains in the Genus database with same CATH superfamily
2J8SD 4H7YA 3D9KA 4OAVB 4RVBA 1MJ0A 3LKUA 4W9RA 3I5PA 3Q47B 5M72A 3ZEFA 4BT9A 5EILA 3T5VA 5D2MC 3EJNA 5KNHD 3FEXA 1OWOA 2QY7A 2AVPA 3AG4E 1XGWA 5A7DB 4N5QA 2IOLA 1UW4B 4ABNA 2RG8A 1QNFA 2LAIA 3CK8A 4HOSA 3RAUA 3TWSA 1TJCA 2P9SG 2VTBB 2P2CP 4N3BA 4ANWA 1FVHA 1TR4A 4CGWA 4JZYA 4JA9A 5JHBA 4GYYA 4L2LA 4ANUA 2GROB 3NOCD 3SBTB 5BW8C 3T8MA 5J08A 2YQ8A 1TNUA 3CEQA 3ABLE 4EBAA 4GTVA 2M63A 5AIJA 3MV3B 5EIDA 3MKQA 4OVUA 2L6BA 4U07A 4TXPA 2V5FA 3EIJA 2L0IA 1N4QA 4L23A 2XGSA 5KJNA 2FBNA 3UT7A 1YA0A 3FDHA 1D9SA 3RO3A 2KM4A 1LD8A 4V3IA 2HE0A 1A17A 4WNEA 3SF4A 1HFAA 3ZXSA 4UUCA 3CVQA 1NI1A 3GYZA 5KJMA 4GB9A 2H6IA 3SO8A 4M3OA 2JEKA 3MGBA 3APDA 2CHZA 1UJKA 2R59A 4EECA 4JA7A 2CG3A 4GTQA 3PZ2A 4CCAA 4A1GA 2ZU6B 4GZ3A 1S63A 2BF0X 5BV0A 4NIKA 3ZHEB 5AAOA 5FQ7A 4HS2A 4I9EA 5ENTD 1D8DA 4U96D 3LXUX 3ZU7B 1RZ4A 3DSVA 3HXCA 4NURA 5ANRA 5ENSD 4LNUD 1E90A 3HIZA 2KATA 4UI9J 3UI2A 3VTXA 4HLEA 2DVWA 3D9MA 4FHKA 3V2OA 2VGXA 3O48A 3BQOA 1EDUA 3SNXA 3IXEA 3AU4A 1DC2A 1X5BA 2F8YA 1ELKA 2LSVA 1AWCB 3TXNA 5EX3A 5CMYA 4U63A 4WNDA 4MKTA 2HR2A 4Y6CA 3B7SA 2PQNA 1H19A 4U0UA 3CLJA 1S0PA 2X38A 5HKPA 5JJ7A 4BSZB 2NXPA 2PM7A 4ANVA 3Q9UC 2DWZA 4UWHA 5FTPA 4PH4B 2WXQA 3W9GA 4I1OB 1TN8A 4AP2A 3UKRG 3IBEA 4HBDA 5ANLA 5BUZA 3ASHA 4IYPA 1NZNA 1WDYA 5FQ8A 3V31A 5AARA 1K1BA 1EYHA 1E7UA 3MA5A 3ZN3A 1MYOA 2OVFA 5KNGA 3ESLA 2A4ZA 2PZIA 5G05C 2DBAA 3SY2A 2MYOA 3FUHA 2P9LG 2V0PA 1RW2A 3UT4A 4GTTA 3TWQA 2BTDA 4O60A 3URZA 4JEUA 3BG1B 4LERA 4ACLA 5EX0A 4DX6D 3G2VA 4BFRA 2V8SE 3E33A 4GMLA 2VGYA 2RD0A 2WMNA 3SFZA 3CHSA 2DYSE 3LEWA 2IEJA 2XZDG 1KT1A 3L08A 1IXVA 5FZQA 4BESA 4J8SA 3AS4A 2E2EA 5D66A 2LXMA 4LRZA 3EUVA 2A5EA 3UIPC 2L6JA 4O6FA 3Q5MA 3ML8A 2Y69E 3LVQE 3ZIMA 4C9BB 2XPIA 4N3AA 3I4RB 5T3RA 3ZXPA 4F1PA 3RO2A 5CERB 1MX4A 1OWPA 3ZW3A 1Y6IA 2F8XK 1MX2A 2UY1A 3QWWA 4O1PA 3WG7E 1S70B 4K5BA 4LSZE 2QC9A 2NSZA 4U8YD 3RU0A 1NA3A 2VGXB 4I6GA 3U9WA 3PDNA 3PUKA 2WXOA 1SQMA 3UT8A 1BU9A 3EHMA 2GRNB 4FC8A 4HOTA 3CSTA 3AS8A 4DX5D 5JHAA 3ABME 1IHBA 3HYMB 4BEPA 2DZNA 2LSUA 4EZLA 4CDRA 4UWKA 3CK7A 4AJWA 3UM0A 5IY5E 3QNKA 5JMND 1N0RA 3C3RA 4WNFA 3D9LA 5DIZA 1UN8A 4J0UA 4JW1A 5CCLA 3PVLA 4TV3A 3TG5A 4GMRA 3EHRA 4UWGA 4ME2A 2UWJG 2YHEA 3PZ4A 4GA2A 2VJ8A 4DX1A 2RKKA 2Y3AA 1N4PA 1IKND 3DXKG 3DWLG 2ETAA 1WY6A 3TWXA 1ELRA 2KCVA 1N0QA 1U3DA 4GPKA 3S7BA 1TNYA 4YVQC 5J90A 4NRHB 4HXIA 4EQFA 3BUAA 2LXLA 5JJ6A 4ILGA 1SA5A 4FA6A 4G11A 4DK5A 4BTBA 3T5XA 1QBQA 2ETBA 3F6QA 2PL2A 2PM6A 2WXHA 1Z5SC 1NL4A 5CHEE 3HXBA 1TNBA 1X81A 3S2AA 3ZRHA 3LY8A 5ENRD 3UTMA 4CDNA 3B7UX 1Z3XA 5ENOD 1HZ4A 3ASNE 2HYZA 3L16A 3PH0C 4Y6WA 3DPDA 4A1SA 3CKCA 4XKCA 1A5EA 2CFUA 4IRUA 1HE8A 2OCCE 3EU9A 1B89A 4RSYA 5CRUA 3VLDA 4WNGA 1TN6A 3AG3E 3Q4AB 1O5MA 2WXPA 2QYUA 3TG4A 3QWVA 2UY1B 3AG2E 2MRIA 2KZTA 4GTRA 4GCNA 1LF8A 3FUKA 2AXUA 1PY1A 4IULA 2LO6A 2VGEA 4QQIA 3HDXA 5HRYA 3CR3A 1HX8A 2X6IA 2I1JA 5E75A 4HRNA 2KBXA 4ATZD 3NQPA 2WVIA 2Q7FA 3SFXA 4FLHA 1IQRA 3OXLA 3ISMC 2HM8A 4BWRA 1FCHA 4CT0A 4LNBA 2KXPC 3ZVVA 1MX6A 1IQUA 2WXKA 3FUEA 3RK6A 2R5SA 1Z3YA 3LY9A 5LFAA 2F0YA 3G2UA 2OEWA 4I6EA 3FUMA 5CECB 3C3OA 3ASGA 3PS6A 3D9JA 2V4HC 1MHQA 2EILE 3C5RA 1TN7A 2AXVA 3P1UA 3K9IA 3V2XA 1EF1C 1V54E 5G04C 4YVOA 3PZ3A 5FZSA 4KVOA 3MJWA 3U66A 1FT2A 3GZ1A 3KSLA 5FWQA 3FU5A 3P2BA 4F3VA 4JVSA 3Q73A 4RLYA 3ZUVB 2GRPB 4KZCA 2YNQA 4FU3A 2WM9A 2XPZA 4G8KA 2MOWA 3UX4A 3EHNA 1K3ZD 3ULEG 4AY6A 1O1SA 4J8DA 2H6FA 4BT8A 3QWPA 3CVXA 3ASFA 1WM5A 3PRZA 2I6HA 1LTXA 3ZFWA 5LP0A 3CVYA 4I2ZA 3CHPA 3D9PA 5ARFA 3KEAA 1PAQA 3TWRA 2XGMA 3E32A 3ZGQA 2BKGA 4J7WA 5B1AE 1H2VC 5A6CA 3FTYA 2WQ7A 3AU5A 2AWIA 2B0OE 4UI9C 4AOFA 3NZSA 2JLBA 1INZA 2RFMA 5BT1A 1N52A 2PQRA 1OCCE 3CIAA 5ARGA 4ZFHA 1FPPA 4LEUA 1N54A 2ZGGA 3JQ0A 2KZTB 2NYJA 1S64A 1E96B 2B6CA 3I3NA 2OEVA 3FUFA 3HHMA 2BEDA 2I9CA 3CVUA 5ENQD 4C48B 2J4DA 3UM3A 1E8ZA 2R02A 4J8YA 5B3SE 3QJZA 4I1MA 3AJIA 3CHQA 3EU5A 3KAEA 3LVRE 3FFLA 2XPYA 2ZGDA 4J8EA 5CBOA 1JWGA 3APCA 3HG0D 1OWNA 1JWFA 4TXRA 5T8IA 2XGOA 3S7FA 4X8QA 3PZ1A 4P29A 4PS3A 1UOHA 4JHJA 3OAWA 4OYSA 5LCWC 4LG6A 3ENEA 4R7LA 2GRRB 1OT8A 3B13A 4DX2A 1H6KA 1ZB1A 1O1RA 3FH7A 4BY6A 1N95A 4DJAA 4JXTA 4HORA 4G24A 2ZIRA 5C1DA 5FQ4A 4MBGA 2EQXA 4WAFA 5JJTA 4HOUA 1H6PA 4G8LA 5BPPA 4DLOA 3FTVA 3D9OA 4XI0A 3TAXA 4URKA 3Q78A 4HOQA 4HQDA 4GZ5A 1QZ2A 4B93B 2J07A 3FWVA 1BI8B 2WXIA 3DSUA 3UMVA 4KBQA 3RRNB 2J49A 3VTYA 1JPLA 2XHEA 4B89A 5KCMA 4RG6A 3ONKA 3PNTB 2P9UG 3L9TA 1BI7B 2HO1A 1OWMA 3EHQA 1OUVA 3CHRA 5ITZF 3G2WA 2X6HA 2XQ0A 4GZDA 1OCRE 1JCQA 1SVXA 4AXHA 2CG2A 4GU5A 5CCMA 1TYQG 3PEUB 2BKKB 2ETCA 2CHWA 3CVNA 2WXJA 4F6RD 4TRQA 4GA0A 4CRWA 1KZOA 2XS8A 3BEEA 4LNGA 5BXOA 1Y8MA 3DRAA 3SFYA 2I2OA 2YHCA 4I6JA 5ENPD 3KD7A 5ENNA 1HXIA 3ABKE 4FJZA 3LJ3A 4APFA 3JUEA 5BNWA 1HG5A 3UQ3A 4HRMB 4K03A 1N94A 4FJYA 1E8XA 1WG0A 4GYWA 3Q79A 4F53A 5T4YA 2WMOA 4CYMD 4U7EB 3HXFA 4CT4A 2CFZA 3I4GA 4EHMA 1ZBPA 3U64A 2ZXWE 4AV7A 1KZPA 1HO8A 3S7JA 4A55A 3UPVA 2WB2A 2CHXA 3SD5A 1YCSB 4H7XA 3DPYA 4JEHA 4L2YA 5EIBE 1HU3A 3JXJA 4DI4A 3ZNGA 2LNIA 2V4LA 3CGHA 4HNAD 1K8KG 3PE3A 3NAWA 4BTAA 5AQ7A 4JHKA 3B7RL 3RSEG 4U8HA 3RRMB 4CGVA 3FUNA 3MV2B 5G2NA 5AJDA 3SQVA 3OXFA 3Q9NC 1BLXB 2VSXE 3N71A 4UQYA 2X3MA 3PZDA 1H2TC 3TJPA 3FY4A 3GZSA 4HRLA 2IONA 3LDZA 4U8VD 2XEVA 2ZISA 4HI9A 1YYHA 4JL0A 5HI7A 2IU1A 3O4ZA 4TXQA 4L9PA 3FUIA 1E8WA 3CVWA 4MS6A 5D0OD 1V55E 4G26A 3HRAA 4GCOA 4GMJA 2P9NG 4DLQA 4K5AB 4GTOA 3L6AA 4ANXA 2ILRA 5B1BE 3MCXA 4EZJA 3AAAC 1KPSB 2A5UA 5A23A 3TWVA 3DXMG 1H6OA 4Q94A 3L17A 4AY5A 1NP7A 3FU6A 3WXXA 1E8YA 1JUQA 4BERA 2IO3C 3QK0A 1QYMA 3DSSA 2R05A 3KS2A 5EDSA 3R7QA 1D8EA 3E4BA 2GW1A 3IEGA 1SZ9A 4K0RA 4IN3B 3U3WA 2AW6A 2XEHA 3HXEA 1KT0A 3IHVA 4F1SA 4E6HA 4AM9A 2H6HA 2KCKA 3KSQA 4B94A 4KZ0A 3BU8A 3QOUA 3GW4A 1G3NB 3PNLB 4JHRA 3DSWA 2IFUA 4KMOA 4L7TA 5FINA 4DRXE 1DCEA 3R9MA 3CHOA 3DSXA 2FO7A 3D9NA 1KLXA 4O1OA 4OVVA 2XRYA 4FULA 4GAAA 3DSTA 2XRZA 3JCKC 1SZAA 5FJYA 2XS1A 3FULA 5LOZA 3RIBA 3UM2A 2GRQB 4AVXA 4PDXA 3ULQA 4HFGA 1OCZE 3EDTB 3TWTA 3FTZA 4PS7A 2IY0C 1DCQA 2VSYA 3RJVA 5EYLA 2L0TB 4KXKB 3ZPJA 4E85A 2WQHA 4A3TA 4PUCA 4FADA 1OY3D 3KEZA 2R2LA 2GRLA 4FLBA 5AQAA 2IJGX 3VLEA 5FT9A 4AEZC 3ASDA 3IV0A 4XE0A 4UQZA 3LYAA 3FP3A 3Q49B 4JD2G 3ZYQA 2EIJE 3L22A 4GZ6A 1VDYA 2C2LA 5HS0A 3SZ7A 3PREA 2WXRA 5CBNA 3L54A 2NC9A 3ML9A 5FZRA 2C0LA 3V79K 3NBNB 4WWNA 4JB8P 3HVEB 3SBSA 4KVMA 1Z6TA 5G04J 1N4RA 4U04A 3ESKA 1U3CA 4Q69A 3B7BA 5KJLA 3J5PA 5KWDA 4EZKA 3TXMA 2X6JA 4UWFA 5EN5D 2FI7A 3PE4A 5AQBA 3B95A 4ATGA 4K5CA 4YDOA 4RG9A 1H2UA 3NF1A 1JCSA 1E7VA 4I43A 4M7CA 3C98A 2AJAA 2QYJA 4TUMA 4Q96A 3E34A 4C0MA 1DVPA 3MKRA 2X6FA 3D9IA 1SW6A 4YNDA 3FTSA 2L9BA 4HB5A 3MEKA 3Q7AA 4EBAG 4UWLA 3EIQC 3JYSA 3QKYA 3QARA 4XX5A 4WUYA 2WQ6A 2FEZA 2I1KA 2R03A 5KBAA 1XNFA 1O1TA 2J08A 2QZAA 4GA1A 1AP7A 2KCLA 1OCOE 5AQ9A 5G55A 4GTSA 3JUIA 3DEPA 1GW6A 3UKUG 3W9FA 3UUXA 3QAQA 3IHYA 4GYOA 3CHMA 1BD8A 5CRVA 5AN8A 4XKBA 2IQCA 2XCCA 3RKVA 1P5QA 1MQSA 3ASOE 4MLPA 2Y4UA 1NA0A 1FVFA 5HQ8A 4XZ4A 1TNOA 3UXGA 3G2SA 4A3VA 3FTWA 2F37A 3NB2A 4MRUA 3PEVB 2E0IA 3D3MA 1BPOA 1UG3A 3CSFA 4FHJA 5LX8A 3CV0A 3FU0A 3J5QB 3ZKJA 4DX7D 2DCPA 3FHEA 3SHFA 4FP7A 3V30A 2BUGA 1OWLA 5C2YA 4A63B 1ZU2A 3CQGB 3TGOA 3SGHA 4UI9K 2LUHA 5FIOA 3R7RA 2WXGA 1WAO1 2IOSA 3FUJA 2ONDA 4I2WA 5LCWJ 5EYPF 2XCBA 2P9KG 5AYWD 3MKQB 4EPZA 1HF8A 3PUJA 5G05J 2J4BA 4CZ2D 3APFA 4N3CA 4HLLA 4G25A 4B8CB 3CK9A 2WXMA 2PNNA 3ONLA 3UINC 2P9IG 4DUIA 5KJKA 2EIME 1OXJA 4U95D 3TWUA 4I9CA 1IHGA 2OVBA 2XENA 3T8KA 2VSNA 3BG0B 4APOA 1H0AA 3MX3A 3ZYMA 2V5QC 3QC1A 2EIKE 3FTUA 4LCTA 5DBKA 3UIOC 1JCRA 3G2TA 3SI5A 3HXDA 2OV8A 1LD7A 3E37A 5CMWA 3T9KA 1HS6A 2Y1LE 4WWOA 3LY7A 5H7PA 3E30A 1PC2A 2MHKA 4BX8A 4YDEA 2XZTG 2RFAA 2QFCA 1W3BA 2J09A 2IO2C 2JABA 2C0MA 5CEDB 3B7TA 3L82A 3X2QE 2GGFA 1N9AA 4BSXA 4GTPA 4U0SA 1HH8A 4PS8A 4GPMA 5FQ6A 4B8AA 3QB2A 3Q7FA 4CEMA 2WXNA 4B0ZA 1IYGA 1TJFA 1N4SA 5E76A 2DZOA 5BXUA 4L1BA 3AG1E 4KT6B 1YMPA 2KC7A 3NOGD 4G23A 4I17A 1EPUA 4QFVA 4KYOB 3VLFA 3CQCB 3L13A 3LS8A 4BETA 3MYVA 4Z68A 2Y4TA 4BX9A 4ACKA 2YINA 4F7AA 5CEAA 3ZYLA 4HVBA 4XI9A 4ILHB 2VTBA 3RRUA 1Q2ZA 2VYIA 2AXZA 3NZUA 3CVPA 2OOEA 3LJNA 3FH8A 4UQXA 3Q75A 2DIWA 2XEEA 3CVLA 3CVVA 2IF4A 1SA4A 3TL5A 4ZHBA 4GTMA 3HVEA 2J9QA 4WWPA 1TNZA 3Q15A 4HI8A 3ZYKA 2FF4A 4ILIA 2R17C 3OTNA 3S7DA 1UN9A 4D10C 4XEIG 4GZCA 3FU3A 1UJJA 4RQIA 3JQ1A 3LCAA 2FULA 2VSOE 4YDWA 2P9PG 4OAUC 4AIFA 2EINE 4NACA 2WXLA 4N2QA 5AJLA 3FTXA 1N11A 3LPZA 1ELWA 1L5JA 2X6KA 4G1TA 4I1AA 4YDYA 4CDMA 4JPSA 5D0QD 3C72A 3JXIA 2LAHA 1MZCA 2VQ2A 4TUUA 4C0EA 3MZLB 3ULYA 3OXGA 2P58C 3CKBA 2WXFA 3GZ2A 4J6IA 1U2VG 3IKOB 3R9AB 5EKQD 3FH5A 3ZHEA 1TEZA 1K1AA 4DPRA 2WPVA 2Y0BG 3QDNA 5BV1A 3UM1A 1DNPA 4DI3A 1FT1A 1QQEA 4NQ0A 3U4TA 4N39A 4LUNU 4J8FA 3FUDA 3TWWA 4XIFA 4U0ZA 5AENA 3AS5A 2FO1E 4N2SA 3FEYA 3C3QA 1NFIE 2H6GA 3DEOA 4JC8A 1HG2A 3DBSA 4N5CA 4G2VA 2DYRE 5JA4D 2GRMA 3D9HA
chains in the Genus database with same CATH topology
4YNDA 3FTSA 4H7YA 3D9KA 4RVBA 2HO1A 2Y3AA 2L9BA 3MEKA 1OWMA 4EBAG 4UWLA 3EIQC 3LKUA 1OUVA 3CHRA 3JYSA 4W9RA 3I5PA 3QKYA 3Q47B 5M72A 3QARA 3G2WA 3ZEFA 2X6HA 2XQ0A 1WY6A 4XX5A 4WUYA 4BT9A 2WQ6A 4GZDA 1ELRA 3T5VA 2FEZA 2I1KA 3EJNA 2KCVA 3FEXA 1XNFA 4AXHA 1U3DA 4GPKA 1OWOA 2CG2A 4GU5A 2J08A 3S7BA 4GA1A 2QY7A 2KCLA 5CCMA 5G55A 4YVQC 5J90A 4NRHB 4HXIA 4EQFA 3PEUB 2AVPA 3JUIA 5JJ6A 1XGWA 4ILGA 5A7DB 2IOLA 2CHWA 1UW4B 3CVNA 4G11A 1GW6A 4FA6A 4ABNA 2WXJA 2RG8A 4BTBA 3UUXA 4DK5A 1QNFA 3QAQA 2LAIA 4TRQA 4GA0A 3T5XA 3IHYA 4GYOA 4CRWA 3CK8A 4HOSA 1TJCA 2VTBB 3CHMA 3BEEA 4N3BA 4ANWA 1FVHA 2PL2A 2PM6A 2WXHA 4XKBA 4CGWA 4JZYA 4JA9A 2IQCA 2XCCA 5CHEE 1Y8MA 3RKVA 1P5QA 1MQSA 4MLPA 5JHBA 2I2OA 4GYYA 2YHCA 2Y4UA 1NA0A 1FVFA 4L2LA 3S2AA 3ZRHA 4ANUA 5HQ8A 4XZ4A 3LY8A 3SBTB 4I6JA 5BW8C 3KD7A 3T8MA 5ENNA 5J08A 4CDNA 3B7UX 1HXIA 1Z3XA 2YQ8A 4FJZA 3LJ3A 4APFA 3CEQA 3G2SA 4A3VA 3FTWA 4EBAA 5BNWA 1HZ4A 4MRUA 1HG5A 2M63A 3PEVB 5AIJA 2HYZA 3UQ3A 3MV3B 3L16A 3PH0C 4FJYA 3MKQA 4K03A 2E0IA 3D3MA 3DPDA 1BPOA 1UG3A 3CSFA 3CKCA 4OVUA 1E8XA 4U07A 4XKCA 4A1SA 2CFUA 2V5FA 4FHJA 4GYWA 5LX8A 3EIJA 3CV0A 3FU0A 4F53A 4IRUA 1HE8A 2L0IA 5T4YA 4L23A 2XGSA 5KJNA 2DCPA 1B89A 3FHEA 3SHFA 2WMOA 4FP7A 2FBNA 3UT7A 2BUGA 4RSYA 1OWLA 5C2YA 3VLDA 1YA0A 1ZU2A 4WNGA 3FDHA 4CT4A 2CFZA 3I4GA 3CQGB 3Q4AB 2WXPA 1ZBPA 3TGOA 3RO3A 2KM4A 3U64A 4V3IA 3TG4A 1A17A 4WNEA 3QWVA 3SGHA 4UI9K 4AV7A 2UY1B 3R7RA 3SF4A 1HFAA 2WXGA 1WAO1 2IOSA 3ZXSA 1HO8A 3S7JA 4A55A 3UPVA 3CVQA 2WB2A 2MRIA 3FUJA 2KZTA 3GYZA 2CHXA 5KJMA 3SD5A 2ONDA 4GB9A 4I2WA 4GCNA 5LCWJ 1LF8A 3FUKA 2AXUA 4H7XA 4JEHA 4M3OA 4L2YA 2XCBA 1PY1A 2JEKA 3MGBA 4IULA 3APDA 2CHZA 1UJKA 1HU3A 2LO6A 2R59A 4EECA 4DI4A 4JA7A 2CG3A 3HDXA 2LNIA 2V4LA 5AYWD 3CR3A 3MKQB 3CGHA 4EPZA 1HX8A 2X6IA 4CCAA 3PE3A 2I1JA 5E75A 4A1GA 1HF8A 2ZU6B 4BTAA 3PUJA 4GZ3A 4JHKA 3B7RL 3NQPA 4U8HA 2J4BA 5G05J 3RRMB 3APFA 2WVIA 2Q7FA 2BF0X 4N3CA 4FLHA 4CGVA 5BV0A 1IQRA 4G25A 3FUNA 3MV2B 5G2NA 3OXLA 2HM8A 3ZHEB 4B8CB 3CK9A 2WXMA 5AJDA 5FQ7A 4BWRA 1FCHA 3ONLA 3OXFA 4HS2A 4I9EA 4CT0A 2VSXE 3N71A 4UQYA 2X3MA 3PZDA 3ZVVA 1IQUA 1H2TC 2WXKA 3FUEA 3RK6A 3LXUX 3TJPA 3FY4A 5KJKA 2R5SA 3GZSA 1Z3YA 2IONA 3LY9A 4NURA 5LFAA 5ANRA 3LDZA 4I9CA 1E90A 1IHGA 2KATA 2OVBA 2XEVA 3G2UA 3HIZA 4UI9J 3VTXA 2VSNA 4JL0A 3BG0B 5HI7A 2IU1A 4APOA 4HLEA 1H0AA 3O4ZA 4I6EA 3FUMA 3MX3A 3ZYMA 3ASGA 3QC1A 3PS6A 3D9MA 3FTUA 3D9JA 3FUIA 4FHKA 4LCTA 1E8WA 3CVWA 4MS6A 2VGXA 5D0OD 3O48A 1MHQA 5DBKA 3G2TA 2AXVA 4G26A 3P1UA 3K9IA 3SI5A 4GCOA 4GMJA 2OV8A 1EDUA 4DLQA 3SNXA 1EF1C 3L6AA 4ANXA 5CMWA 3AU4A 1X5BA 2ILRA 1HS6A 1ELKA 3MCXA 4EZJA 2LSVA 4WWOA 3TXNA 5EX3A 5CMYA 4U63A 4WNDA 3LY7A 2A5UA 4MKTA 2HR2A 5A23A 1PC2A 5G04C 4Y6CA 2MHKA 3B7SA 2PQNA 4Q94A 3L17A 4AY5A 1H19A 1NP7A 3FU6A 4U0UA 4BX8A 4YVOA 3WXXA 1E8YA 1JUQA 3QK0A 2QFCA 5FZSA 3CLJA 4KVOA 3MJWA 3U66A 1S0PA 3KS2A 5EDSA 2X38A 3GZ1A 3R7QA 1W3BA 2J09A 5FWQA 5JJ7A 3FU5A 3E4BA 2C0MA 2GW1A 2NXPA 2PM7A 3IEGA 3P2BA 4ANVA 3B7TA 4Y6WA 4F3VA 4JVSA 1SZ9A 2GGFA 4BSXA 4K0RA 4UWHA 5FTPA 4PH4B 4U0SA 1HH8A 2WXQA 4KZCA 4PS8A 4IN3B 4I1OB 3U3WA 2AW6A 2YNQA 4FU3A 2WM9A 2XPZA 4AP2A 2MOWA 5FQ6A 1KT0A 3EHNA 3UX4A 3IHVA 4B8AA 4F1SA 4AY6A 4E6HA 3IBEA 3QB2A 4AM9A 4J8DA 5ANLA 5BUZA 3ASHA 4IYPA 4BT8A 3QWPA 1NZNA 2WXNA 4B0ZA 2KCKA 5FQ8A 4B94A 4CEMA 4KZ0A 3ASFA 3CVXA 1IYGA 1WM5A 1TJFA 3PRZA 1EYHA 1E7UA 5E76A 3MA5A 3QOUA 3ZN3A 2I6HA 2OVFA 3GW4A 3ESLA 3ZFWA 3PNLB 4JHRA 4L1BA 2A4ZA 4KT6B 5LP0A 2IFUA 2PZIA 4I2ZA 3CHPA 4KMOA 3D9PA 4L7TA 5G05C 2KC7A 5ARFA 4G23A 2DBAA 1PAQA 3CHOA 2FO7A 4I17A 3FUHA 2XGMA 2V0PA 3ZGQA 1EPUA 3D9NA 4QFVA 3UT4A 1KLXA 4KYOB 3VLFA 1H2VC 4OVVA 2XRYA 4FULA 4GAAA 3CQCB 2XRZA 2BTDA 3JCKC 1SZAA 4JEUA 5FJYA 3URZA 3BG1B 3L13A 3LS8A 5A6CA 4LERA 3MYVA 4ACLA 3FTYA 3FULA 5LOZA 2WQ7A 2Y4TA 4BX9A 4ACKA 2YINA 3AU5A 5EX0A 3RIBA 4F7AA 2AWIA 3ZYLA 4UI9C 4AOFA 3G2VA 3NZSA 4HVBA 4XI9A 4ILHB 4BFRA 4AVXA 2VTBA 2JLBA 4PDXA 2V8SE 3ULQA 4HFGA 1INZA 3RRUA 4GMLA 5BT1A 1N52A 2VGYA 2AXZA 2VYIA 3EDTB 2PQRA 3NZUA 3FTZA 3CIAA 3CVPA 5ARGA 4PS7A 2RD0A 2OOEA 4LEUA 3FH8A 4UQXA 1N54A 2WMNA 2VSYA 3RJVA 3SFZA 3CHSA 2DIWA 3LEWA 2L0TB 3JQ0A 4KXKB 2KZTB 3ZPJA 4E85A 1KT1A 3L08A 2WQHA 3CVLA 4A3TA 3CVVA 1E96B 2IF4A 4PUCA 3TL5A 4FADA 3I3NA 5FZQA 4J8SA 3AS4A 2E2EA 3FUFA 3HVEA 3HHMA 2J9QA 3KEZA 4WWPA 2GRLA 4FLBA 3Q15A 3ZYKA 2IJGX 4LRZA 3VLEA 5FT9A 2FF4A 4ILIA 2I9CA 3CVUA 2R17C 2L6JA 4O6FA 2J4DA 3Q5MA 4AEZC 1E8ZA 3ML8A 3OTNA 3S7DA 3ASDA 3IV0A 1UN9A 4D10C 4XE0A 3QJZA 4UQZA 3LYAA 4GZCA 3FU3A 3LVQE 3FP3A 1UJJA 3CHQA 4I1MA 3ZIMA 3Q49B 4C9BB 3KAEA 3LVRE 3FFLA 3JQ1A 3LCAA 2XPIA 3ZYQA 2XPYA 4N3AA 2FULA 4J8EA 3I4RB 3L22A 5T3RA 2VSOE 3RO2A 1JWGA 1OWPA 3APCA 1Y6IA 3ZW3A 2UY1A 4GZ6A 1VDYA 2C2LA 4AIFA 1OWNA 1JWFA 4NACA 2WXLA 3QWWA 4N2QA 5AJLA 3FTXA 5T8IA 2XGOA 3S7FA 3SZ7A 3LPZA 3PREA 2WXRA 1ELWA 3L54A 2NC9A 3ML9A 4P29A 5FZRA 1L5JA 2X6KA 4G1TA 2C0LA 2NSZA 4PS3A 4I1AA 3RU0A 4CDMA 4JPSA 5D0QD 4JHJA 3OAWA 1NA3A 2LAHA 2VQ2A 4TUUA 2VGXB 4OYSA 4WWNA 4C0EA 5LCWC 3HVEB 3MZLB 3SBSA 4I6GA 3OXGA 2P58C 3PDNA 4KVMA 3U9WA 3CKBA 1Z6TA 3PUKA 2WXOA 5G04J 2WXFA 1SQMA 3ENEA 4R7LA 3UT8A 3GZ2A 4J6IA 4U04A 3B13A 3ESKA 1H6KA 3IKOB 3R9AB 3EHMA 5EKQD 3FH7A 3FH5A 4BY6A 1U3CA 4Q69A 4FC8A 3ZHEA 1TEZA 4DPRA 2WPVA 3CSTA 4DJAA 4HOTA 3AS8A 3QDNA 4JXTA 5JHAA 5BV1A 4HORA 1DNPA 3HYMB 4G24A 4DI3A 4NQ0A 1QQEA 2LSUA 5C1DA 3U4TA 4N39A 4LUNU 5FQ4A 5KJLA 4EZLA 2EQXA 4J8FA 3TXMA 4WAFA 4EZKA 4CDRA 4UWKA 5JJTA 2X6JA 4HOUA 5BPPA 3CK7A 3FUDA 4AJWA 4DLOA 3FTVA 3D9OA 4UWFA 4XI0A 2FI7A 3TAXA 3PE4A 4URKA 4XIFA 3QNKA 4U0ZA 4HOQA 4WNFA 5AENA 3AS5A 3D9LA 4ATGA 4GZ5A 1QZ2A 5DIZA 4N2SA 1UN8A 2J07A 4J0UA 4JW1A 3FWVA 3FEYA 5CCLA 4RG9A 3PVLA 4TV3A 3TG5A 2WXIA 1H2UA 4JC8A 4UWGA 1HG2A 3UMVA 3NF1A 3DBSA 4KBQA 1E7VA 4ME2A 3RRNB 4N5CA 2J49A 4I43A 3VTYA 1JPLA 2XHEA 4B89A 4G2VA 5KCMA 2GRMA 3C98A 2UWJG 2YHEA 4RG6A 3ONKA 4Q96A 3PNTB 1DVPA 2VJ8A 3MKRA 4GA2A 2X6FA 4C0MA 3D9IA 3CVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YND A;  4H7Y A;  2HO1 A;  3MEK A;  3LKU A;  1OUV A;  3JYS A;  4W9R A;  3QKY A;  3Q47 B;  5M72 A;  4WUY A;  4BT9 A;  1ELR A;  2FEZ A;  2KCV A;  1XNF A;  4GPK A;  3S7B A;  4GA1 A;  2KCL A;  5CCM A;  4YVQ C;  4NRH B;  4EQF A;  2AVP A;  5JJ6 A;  5A7D B;  3CVN A;  4ABN A;  4BTB A;  3UUX A;  4GA0 A;  4GYO A;  3CK8 A;  4HOS A;  1TJC A;  3BEE A;  4N3B A;  2PL2 A;  4CGW A;  4JA9 A;  2XCC A;  5CHE E;  1Y8M A;  3RKV A;  1P5Q A;  4GYY A;  2YHC A;  2Y4U A;  1NA0 A;  5HQ8 A;  3LY8 A;  5BW8 C;  3KD7 A;  1HXI A;  2YQ8 A;  3CEQ A;  5BNW A;  1HZ4 A;  2HYZ A;  3UQ3 A;  3MV3 B;  4Y6W A;  4U07 A;  3CKC A;  4A1S A;  2V5F A;  4GYW A;  3CV0 A;  2XGS A;  5KJN A;  1B89 A;  2FBN A;  2BUG A;  1YA0 A;  1ZU2 A;  4WNG A;  3Q4A B;  3TGO A;  1ZBP A;  3RO3 A;  3TG4 A;  1A17 A;  4WNE A;  3QWV A;  4UI9 K;  2UY1 B;  3SF4 A;  1WAO 1;  3S7J A;  3UPV A;  3CVQ A;  3GYZ A;  5KJM A;  2OND A;  4I2W A;  4GCN A;  5LCW J;  4H7X A;  2XCB A;  4JA7 A;  2LNI A;  5AYW D;  3PE3 A;  4BTA A;  4GZ3 A;  5G05 J;  2Q7F A;  4N3C A;  4CGV A;  4G25 A;  3MV2 B;  3OXL A;  3ZHE B;  4BWR A;  3CK9 A;  1FCH A;  3OXF A;  4I9E A;  3N71 A;  4UQY A;  5KJK A;  2R5S A;  3LY9 A;  4I9C A;  1IHG A;  2KAT A;  4UI9 J;  2XEV A;  3VTX A;  2VSN A;  4JL0 A;  5HI7 A;  4APO A;  3ASG A;  2VGX A;  5D0O D;  3O48 A;  5DBK A;  4G26 A;  3K9I A;  4GCO A;  2LSV A;  5EX3 A;  4WND A;  3LY7 A;  2HR2 A;  1PC2 A;  5G04 C;  4Y6C A;  2MHK A;  2PQN A;  4AY5 A;  4U0U A;  4YVO A;  3WXX A;  2QFC A;  5FZS A;  3KS2 A;  3GZ1 A;  1W3B A;  5JJ7 A;  3E4B A;  2C0M A;  2GW1 A;  3IEG A;  4F3V A;  5FTP A;  4U0S A;  1HH8 A;  4IN3 B;  3U3W A;  1KT0 A;  4AY6 A;  4AM9 A;  4J8D A;  3ASH A;  4BT8 A;  3QWP A;  1NZN A;  2KCK A;  4B94 A;  1IYG A;  3ASF A;  1WM5 A;  3MA5 A;  3QOU A;  3ZN3 A;  2I6H A;  3GW4 A;  3ZFW A;  4JHR A;  2IFU A;  2PZI A;  4I2Z A;  5G05 C;  2KC7 A;  5ARF A;  4G23 A;  2DBA A;  2FO7 A;  4I17 A;  2XGM A;  3ZGQ A;  1KLX A;  4KYO B;  3URZ A;  5FJY A;  5A6C A;  2Y4T A;  5EX0 A;  3RIB A;  4UI9 C;  4XI9 A;  2JLB A;  3ULQ A;  5BT1 A;  2VGY A;  2VYI A;  3EDT B;  2PQR A;  3CVP A;  5ARG A;  2OOE A;  4LEU A;  4UQX A;  2VSY A;  3RJV A;  4KXK B;  3ZPJ A;  1KT1 A;  2WQH A;  3CVL A;  1E96 B;  2IF4 A;  5FZQ A;  3AS4 A;  2E2E A;  2J9Q A;  3Q15 A;  5FT9 A;  2FF4 A;  2L6J A;  4O6F A;  3Q5M A;  3S7D A;  3ASD A;  4UQZ A;  3LYA A;  3FP3 A;  3Q49 B;  3KAE A;  3FFL A;  3LCA A;  2XPI A;  4N3A A;  4J8E A;  3RO2 A;  2UY1 A;  4GZ6 A;  2C2L A;  4AIF A;  3QWW A;  4N2Q A;  2XGO A;  3S7F A;  3SZ7 A;  3LPZ A;  1ELW A;  2NC9 A;  5FZR A;  4G1T A;  2C0L A;  4I1A A;  3RU0 A;  5D0Q D;  1NA3 A;  2VQ2 A;  2VGX B;  5LCW C;  3OXG A;  2P58 C;  3PDN A;  3CKB A;  5G04 J;  3GZ2 A;  4U04 A;  3ESK A;  3R9A B;  5EKQ D;  3ZHE A;  2WPV A;  4HOT A;  3AS8 A;  3QDN A;  4HOR A;  3HYM B;  4G24 A;  4NQ0 A;  1QQE A;  2LSU A;  5C1D A;  3U4T A;  4N39 A;  5KJL A;  4J8F A;  4CDR A;  5JJT A;  4HOU A;  3CK7 A;  4XI0 A;  2FI7 A;  3TAX A;  3PE4 A;  4XIF A;  4U0Z A;  4HOQ A;  4WNF A;  3AS5 A;  4GZ5 A;  1QZ2 A;  5DIZ A;  4N2S A;  4J0U A;  3FWV A;  5CCL A;  4RG9 A;  3TG5 A;  3NF1 A;  4KBQ A;  4ME2 A;  4N5C A;  3VTY A;  4G2V A;  2UWJ G;  4RG6 A;  4GA2 A;  3MKR A; 
#chains in the Genus database with same CATH topology
 2J8S D;  4H7Y A;  3D9K A;  4OAV B;  4RVB A;  1MJ0 A;  3LKU A;  4W9R A;  3I5P A;  3Q47 B;  5M72 A;  3ZEF A;  4BT9 A;  5EIL A;  3T5V A;  5D2M C;  3EJN A;  5KNH D;  3FEX A;  1OWO A;  2QY7 A;  2AVP A;  3AG4 E;  1XGW A;  5A7D B;  4N5Q A;  2IOL A;  1UW4 B;  4ABN A;  2RG8 A;  1QNF A;  2LAI A;  3CK8 A;  4HOS A;  3RAU A;  3TWS A;  1TJC A;  2P9S G;  2VTB B;  2P2C P;  4N3B A;  4ANW A;  1FVH A;  1TR4 A;  4CGW A;  4JZY A;  4JA9 A;  5JHB A;  4GYY A;  4L2L A;  4ANU A;  2GRO B;  3NOC D;  3SBT B;  5BW8 C;  3T8M A;  5J08 A;  2YQ8 A;  1TNU A;  3CEQ A;  3ABL E;  4EBA A;  4GTV A;  2M63 A;  5AIJ A;  3MV3 B;  5EID A;  3MKQ A;  4OVU A;  2L6B A;  4U07 A;  4TXP A;  2V5F A;  3EIJ A;  2L0I A;  1N4Q A;  4L23 A;  2XGS A;  5KJN A;  2FBN A;  3UT7 A;  1YA0 A;  3FDH A;  1D9S A;  3RO3 A;  2KM4 A;  1LD8 A;  4V3I A;  2HE0 A;  1A17 A;  4WNE A;  3SF4 A;  1HFA A;  3ZXS A;  4UUC A;  3CVQ A;  1NI1 A;  3GYZ A;  5KJM A;  4GB9 A;  2H6I A;  3SO8 A;  4M3O A;  2JEK A;  3MGB A;  3APD A;  2CHZ A;  1UJK A;  2R59 A;  4EEC A;  4JA7 A;  2CG3 A;  4GTQ A;  3PZ2 A;  4CCA A;  4A1G A;  2ZU6 B;  4GZ3 A;  1S63 A;  2BF0 X;  5BV0 A;  4NIK A;  3ZHE B;  5AAO A;  5FQ7 A;  4HS2 A;  4I9E A;  5ENT D;  1D8D A;  4U96 D;  3LXU X;  3ZU7 B;  1RZ4 A;  3DSV A;  3HXC A;  4NUR A;  5ANR A;  5ENS D;  4LNU D;  1E90 A;  3HIZ A;  2KAT A;  4UI9 J;  3UI2 A;  3VTX A;  4HLE A;  2DVW A;  3D9M A;  4FHK A;  3V2O A;  2VGX A;  3O48 A;  3BQO A;  1EDU A;  3SNX A;  3IXE A;  3AU4 A;  1DC2 A;  1X5B A;  2F8Y A;  1ELK A;  2LSV A;  1AWC B;  3TXN A;  5EX3 A;  5CMY A;  4U63 A;  4WND A;  4MKT A;  2HR2 A;  4Y6C A;  3B7S A;  2PQN A;  1H19 A;  4U0U A;  3CLJ A;  1S0P A;  2X38 A;  5HKP A;  5JJ7 A;  4BSZ B;  2NXP A;  2PM7 A;  4ANV A;  3Q9U C;  2DWZ A;  4UWH A;  5FTP A;  4PH4 B;  2WXQ A;  3W9G A;  4I1O B;  1TN8 A;  4AP2 A;  3UKR G;  3IBE A;  4HBD A;  5ANL A;  5BUZ A;  3ASH A;  4IYP A;  1NZN A;  1WDY A;  5FQ8 A;  3V31 A;  5AAR A;  1K1B A;  1EYH A;  1E7U A;  3MA5 A;  3ZN3 A;  1MYO A;  2OVF A;  5KNG A;  3ESL A;  2A4Z A;  2PZI A;  5G05 C;  2DBA A;  3SY2 A;  2MYO A;  3FUH A;  2P9L G;  2V0P A;  1RW2 A;  3UT4 A;  4GTT A;  3TWQ A;  2BTD A;  4O60 A;  3URZ A;  4JEU A;  3BG1 B;  4LER A;  4ACL A;  5EX0 A;  4DX6 D;  3G2V A;  4BFR A;  2V8S E;  3E33 A;  4GML A;  2VGY A;  2RD0 A;  2WMN A;  3SFZ A;  3CHS A;  2DYS E;  3LEW A;  2IEJ A;  2XZD G;  1KT1 A;  3L08 A;  1IXV A;  5FZQ A;  4BES A;  4J8S A;  3AS4 A;  2E2E A;  5D66 A;  2LXM A;  4LRZ A;  3EUV A;  2A5E A;  3UIP C;  2L6J A;  4O6F A;  3Q5M A;  3ML8 A;  2Y69 E;  3LVQ E;  3ZIM A;  4C9B B;  2XPI A;  4N3A A;  3I4R B;  5T3R A;  3ZXP A;  4F1P A;  3RO2 A;  5CER B;  1MX4 A;  1OWP A;  3ZW3 A;  1Y6I A;  2F8X K;  1MX2 A;  2UY1 A;  3QWW A;  4O1P A;  3WG7 E;  1S70 B;  4K5B A;  4LSZ E;  2QC9 A;  2NSZ A;  4U8Y D;  3RU0 A;  1NA3 A;  2VGX B;  4I6G A;  3U9W A;  3PDN A;  3PUK A;  2WXO A;  1SQM A;  3UT8 A;  1BU9 A;  3EHM A;  2GRN B;  4FC8 A;  4HOT A;  3CST A;  3AS8 A;  4DX5 D;  5JHA A;  3ABM E;  1IHB A;  3HYM B;  4BEP A;  2DZN A;  2LSU A;  4EZL A;  4CDR A;  4UWK A;  3CK7 A;  4AJW A;  3UM0 A;  5IY5 E;  3QNK A;  5JMN D;  1N0R A;  3C3R A;  4WNF A;  3D9L A;  5DIZ A;  1UN8 A;  4J0U A;  4JW1 A;  5CCL A;  3PVL A;  4TV3 A;  3TG5 A;  4GMR A;  3EHR A;  4UWG A;  4ME2 A;  2UWJ G;  2YHE A;  3PZ4 A;  4GA2 A;  2VJ8 A;  4DX1 A;  2RKK A;  2Y3A A;  1N4P A;  1IKN D;  3DXK G;  3DWL G;  2ETA A;  1WY6 A;  3TWX A;  1ELR A;  2KCV A;  1N0Q A;  1U3D A;  4GPK A;  3S7B A;  1TNY A;  4YVQ C;  5J90 A;  4NRH B;  4HXI A;  4EQF A;  3BUA A;  2LXL A;  5JJ6 A;  4ILG A;  1SA5 A;  4FA6 A;  4G11 A;  4DK5 A;  4BTB A;  3T5X A;  1QBQ A;  2ETB A;  3F6Q A;  2PL2 A;  2PM6 A;  2WXH A;  1Z5S C;  1NL4 A;  5CHE E;  3HXB A;  1TNB A;  1X81 A;  3S2A A;  3ZRH A;  3LY8 A;  5ENR D;  3UTM A;  4CDN A;  3B7U X;  1Z3X A;  5ENO D;  1HZ4 A;  3ASN E;  2HYZ A;  3L16 A;  3PH0 C;  4Y6W A;  3DPD A;  4A1S A;  3CKC A;  4XKC A;  1A5E A;  2CFU A;  4IRU A;  1HE8 A;  2OCC E;  3EU9 A;  1B89 A;  4RSY A;  5CRU A;  3VLD A;  4WNG A;  1TN6 A;  3AG3 E;  3Q4A B;  1O5M A;  2WXP A;  2QYU A;  3TG4 A;  3QWV A;  2UY1 B;  3AG2 E;  2MRI A;  2KZT A;  4GTR A;  4GCN A;  1LF8 A;  3FUK A;  2AXU A;  1PY1 A;  4IUL A;  2LO6 A;  2VGE A;  4QQI A;  3HDX A;  5HRY A;  3CR3 A;  1HX8 A;  2X6I A;  2I1J A;  5E75 A;  4HRN A;  2KBX A;  4ATZ D;  3NQP A;  2WVI A;  2Q7F A;  3SFX A;  4FLH A;  1IQR A;  3OXL A;  3ISM C;  2HM8 A;  4BWR A;  1FCH A;  4CT0 A;  4LNB A;  2KXP C;  3ZVV A;  1MX6 A;  1IQU A;  2WXK A;  3FUE A;  3RK6 A;  2R5S A;  1Z3Y A;  3LY9 A;  5LFA A;  2F0Y A;  3G2U A;  2OEW A;  4I6E A;  3FUM A;  5CEC B;  3C3O A;  3ASG A;  3PS6 A;  3D9J A;  2V4H C;  1MHQ A;  2EIL E;  3C5R A;  1TN7 A;  2AXV A;  3P1U A;  3K9I A;  3V2X A;  1EF1 C;  1V54 E;  5G04 C;  4YVO A;  3PZ3 A;  5FZS A;  4KVO A;  3MJW A;  3U66 A;  1FT2 A;  3GZ1 A;  3KSL A;  5FWQ A;  3FU5 A;  3P2B A;  4F3V A;  4JVS A;  3Q73 A;  4RLY A;  3ZUV B;  2GRP B;  4KZC A;  2YNQ A;  4FU3 A;  2WM9 A;  2XPZ A;  4G8K A;  2MOW A;  3UX4 A;  3EHN A;  1K3Z D;  3ULE G;  4AY6 A;  1O1S A;  4J8D A;  2H6F A;  4BT8 A;  3QWP A;  3CVX A;  3ASF A;  1WM5 A;  3PRZ A;  2I6H A;  1LTX A;  3ZFW A;  5LP0 A;  3CVY A;  4I2Z A;  3CHP A;  3D9P A;  5ARF A;  3KEA A;  1PAQ A;  3TWR A;  2XGM A;  3E32 A;  3ZGQ A;  2BKG A;  4J7W A;  5B1A E;  1H2V C;  5A6C A;  3FTY A;  2WQ7 A;  3AU5 A;  2AWI A;  2B0O E;  4UI9 C;  4AOF A;  3NZS A;  2JLB A;  1INZ A;  2RFM A;  5BT1 A;  1N52 A;  2PQR A;  1OCC E;  3CIA A;  5ARG A;  4ZFH A;  1FPP A;  4LEU A;  1N54 A;  2ZGG A;  3JQ0 A;  2KZT B;  2NYJ A;  1S64 A;  1E96 B;  2B6C A;  3I3N A;  2OEV A;  3FUF A;  3HHM A;  2BED A;  2I9C A;  3CVU A;  5ENQ D;  4C48 B;  2J4D A;  3UM3 A;  1E8Z A;  2R02 A;  4J8Y A;  5B3S E;  3QJZ A;  4I1M A;  3AJI A;  3CHQ A;  3EU5 A;  3KAE A;  3LVR E;  3FFL A;  2XPY A;  2ZGD A;  4J8E A;  5CBO A;  1JWG A;  3APC A;  3HG0 D;  1OWN A;  1JWF A;  4TXR A;  5T8I A;  2XGO A;  3S7F A;  4X8Q A;  3PZ1 A;  4P29 A;  4PS3 A;  1UOH A;  4JHJ A;  3OAW A;  4OYS A;  5LCW C;  4LG6 A;  3ENE A;  4R7L A;  2GRR B;  1OT8 A;  3B13 A;  4DX2 A;  1H6K A;  1ZB1 A;  1O1R A;  3FH7 A;  4BY6 A;  1N95 A;  4DJA A;  4JXT A;  4HOR A;  4G24 A;  2ZIR A;  5C1D A;  5FQ4 A;  4MBG A;  2EQX A;  4WAF A;  5JJT A;  4HOU A;  1H6P A;  4G8L A;  5BPP A;  4DLO A;  3FTV A;  3D9O A;  4XI0 A;  3TAX A;  4URK A;  3Q78 A;  4HOQ A;  4HQD A;  4GZ5 A;  1QZ2 A;  4B93 B;  2J07 A;  3FWV A;  1BI8 B;  2WXI A;  3DSU A;  3UMV A;  4KBQ A;  3RRN B;  2J49 A;  3VTY A;  1JPL A;  2XHE A;  4B89 A;  5KCM A;  4RG6 A;  3ONK A;  3PNT B;  2P9U G;  3L9T A;  1BI7 B;  2HO1 A;  1OWM A;  3EHQ A;  1OUV A;  3CHR A;  5ITZ F;  3G2W A;  2X6H A;  2XQ0 A;  4GZD A;  1OCR E;  1JCQ A;  1SVX A;  4AXH A;  2CG2 A;  4GU5 A;  5CCM A;  1TYQ G;  3PEU B;  2BKK B;  2ETC A;  2CHW A;  3CVN A;  2WXJ A;  4F6R D;  4TRQ A;  4GA0 A;  4CRW A;  1KZO A;  2XS8 A;  3BEE A;  4LNG A;  5BXO A;  1Y8M A;  3DRA A;  3SFY A;  2I2O A;  2YHC A;  4I6J A;  5ENP D;  3KD7 A;  5ENN A;  1HXI A;  3ABK E;  4FJZ A;  3LJ3 A;  4APF A;  3JUE A;  5BNW A;  1HG5 A;  3UQ3 A;  4HRM B;  4K03 A;  1N94 A;  4FJY A;  1E8X A;  1WG0 A;  4GYW A;  3Q79 A;  4F53 A;  5T4Y A;  2WMO A;  4CYM D;  4U7E B;  3HXF A;  4CT4 A;  2CFZ A;  3I4G A;  4EHM A;  1ZBP A;  3U64 A;  2ZXW E;  4AV7 A;  1KZP A;  1HO8 A;  3S7J A;  4A55 A;  3UPV A;  2WB2 A;  2CHX A;  3SD5 A;  1YCS B;  4H7X A;  3DPY A;  4JEH A;  4L2Y A;  5EIB E;  1HU3 A;  3JXJ A;  4DI4 A;  3ZNG A;  2LNI A;  2V4L A;  3CGH A;  4HNA D;  1K8K G;  3PE3 A;  3NAW A;  4BTA A;  5AQ7 A;  4JHK A;  3B7R L;  3RSE G;  4U8H A;  3RRM B;  4CGV A;  3FUN A;  3MV2 B;  5G2N A;  5AJD A;  3SQV A;  3OXF A;  3Q9N C;  1BLX B;  2VSX E;  3N71 A;  4UQY A;  2X3M A;  3PZD A;  1H2T C;  3TJP A;  3FY4 A;  3GZS A;  4HRL A;  2ION A;  3LDZ A;  4U8V D;  2XEV A;  2ZIS A;  4HI9 A;  1YYH A;  4JL0 A;  5HI7 A;  2IU1 A;  3O4Z A;  4TXQ A;  4L9P A;  3FUI A;  1E8W A;  3CVW A;  4MS6 A;  5D0O D;  1V55 E;  4G26 A;  3HRA A;  4GCO A;  4GMJ A;  2P9N G;  4DLQ A;  4K5A B;  4GTO A;  3L6A A;  4ANX A;  2ILR A;  5B1B E;  3MCX A;  4EZJ A;  3AAA C;  1KPS B;  2A5U A;  5A23 A;  3TWV A;  3DXM G;  1H6O A;  4Q94 A;  3L17 A;  4AY5 A;  1NP7 A;  3FU6 A;  3WXX A;  1E8Y A;  1JUQ A;  4BER A;  2IO3 C;  3QK0 A;  1QYM A;  3DSS A;  2R05 A;  3KS2 A;  5EDS A;  3R7Q A;  1D8E A;  3E4B A;  2GW1 A;  3IEG A;  1SZ9 A;  4K0R A;  4IN3 B;  3U3W A;  2AW6 A;  2XEH A;  3HXE A;  1KT0 A;  3IHV A;  4F1S A;  4E6H A;  4AM9 A;  2H6H A;  2KCK A;  3KSQ A;  4B94 A;  4KZ0 A;  3BU8 A;  3QOU A;  3GW4 A;  1G3N B;  3PNL B;  4JHR A;  3DSW A;  2IFU A;  4KMO A;  4L7T A;  5FIN A;  4DRX E;  1DCE A;  3R9M A;  3CHO A;  3DSX A;  2FO7 A;  3D9N A;  1KLX A;  4O1O A;  4OVV A;  2XRY A;  4FUL A;  4GAA A;  3DST A;  2XRZ A;  3JCK C;  1SZA A;  5FJY A;  2XS1 A;  3FUL A;  5LOZ A;  3RIB A;  3UM2 A;  2GRQ B;  4AVX A;  4PDX A;  3ULQ A;  4HFG A;  1OCZ E;  3EDT B;  3TWT A;  3FTZ A;  4PS7 A;  2IY0 C;  1DCQ A;  2VSY A;  3RJV A;  5EYL A;  2L0T B;  4KXK B;  3ZPJ A;  4E85 A;  2WQH A;  4A3T A;  4PUC A;  4FAD A;  1OY3 D;  3KEZ A;  2R2L A;  2GRL A;  4FLB A;  5AQA A;  2IJG X;  3VLE A;  5FT9 A;  4AEZ C;  3ASD A;  3IV0 A;  4XE0 A;  4UQZ A;  3LYA A;  3FP3 A;  3Q49 B;  4JD2 G;  3ZYQ A;  2EIJ E;  3L22 A;  4GZ6 A;  1VDY A;  2C2L A;  5HS0 A;  3SZ7 A;  3PRE A;  2WXR A;  5CBN A;  3L54 A;  2NC9 A;  3ML9 A;  5FZR A;  2C0L A;  3V79 K;  3NBN B;  4WWN A;  4JB8 P;  3HVE B;  3SBS A;  4KVM A;  1Z6T A;  5G04 J;  1N4R A;  4U04 A;  3ESK A;  1U3C A;  4Q69 A;  3B7B A;  5KJL A;  3J5P A;  5KWD A;  4EZK A;  3TXM A;  2X6J A;  4UWF A;  5EN5 D;  2FI7 A;  3PE4 A;  5AQB A;  3B95 A;  4ATG A;  4K5C A;  4YDO A;  4RG9 A;  1H2U A;  3NF1 A;  1JCS A;  1E7V A;  4I43 A;  4M7C A;  3C98 A;  2AJA A;  2QYJ A;  4TUM A;  4Q96 A;  3E34 A;  4C0M A;  1DVP A;  3MKR A;  2X6F A;  3D9I A;  1SW6 A;  4YND A;  3FTS A;  2L9B A;  4HB5 A;  3MEK A;  3Q7A A;  4EBA G;  4UWL A;  3EIQ C;  3JYS A;  3QKY A;  3QAR A;  4XX5 A;  4WUY A;  2WQ6 A;  2FEZ A;  2I1K A;  2R03 A;  5KBA A;  1XNF A;  1O1T A;  2J08 A;  2QZA A;  4GA1 A;  1AP7 A;  2KCL A;  1OCO E;  5AQ9 A;  5G55 A;  4GTS A;  3JUI A;  3DEP A;  1GW6 A;  3UKU G;  3W9F A;  3UUX A;  3QAQ A;  3IHY A;  4GYO A;  3CHM A;  1BD8 A;  5CRV A;  5AN8 A;  4XKB A;  2IQC A;  2XCC A;  3RKV A;  1P5Q A;  1MQS A;  3ASO E;  4MLP A;  2Y4U A;  1NA0 A;  1FVF A;  5HQ8 A;  4XZ4 A;  1TNO A;  3UXG A;  3G2S A;  4A3V A;  3FTW A;  2F37 A;  3NB2 A;  4MRU A;  3PEV B;  2E0I A;  3D3M A;  1BPO A;  1UG3 A;  3CSF A;  4FHJ A;  5LX8 A;  3CV0 A;  3FU0 A;  3J5Q B;  3ZKJ A;  4DX7 D;  2DCP A;  3FHE A;  3SHF A;  4FP7 A;  3V30 A;  2BUG A;  1OWL A;  5C2Y A;  4A63 B;  1ZU2 A;  3CQG B;  3TGO A;  3SGH A;  4UI9 K;  2LUH A;  5FIO A;  3R7R A;  2WXG A;  1WAO 1;  2IOS A;  3FUJ A;  2OND A;  4I2W A;  5LCW J;  5EYP F;  2XCB A;  2P9K G;  5AYW D;  3MKQ B;  4EPZ A;  1HF8 A;  3PUJ A;  5G05 J;  2J4B A;  4CZ2 D;  3APF A;  4N3C A;  4HLL A;  4G25 A;  4B8C B;  3CK9 A;  2WXM A;  2PNN A;  3ONL A;  3UIN C;  2P9I G;  4DUI A;  5KJK A;  2EIM E;  1OXJ A;  4U95 D;  3TWU A;  4I9C A;  1IHG A;  2OVB A;  2XEN A;  3T8K A;  2VSN A;  3BG0 B;  4APO A;  1H0A A;  3MX3 A;  3ZYM A;  2V5Q C;  3QC1 A;  2EIK E;  3FTU A;  4LCT A;  5DBK A;  3UIO C;  1JCR A;  3G2T A;  3SI5 A;  3HXD A;  2OV8 A;  1LD7 A;  3E37 A;  5CMW A;  3T9K A;  1HS6 A;  2Y1L E;  4WWO A;  3LY7 A;  5H7P A;  3E30 A;  1PC2 A;  2MHK A;  4BX8 A;  4YDE A;  2XZT G;  2RFA A;  2QFC A;  1W3B A;  2J09 A;  2IO2 C;  2JAB A;  2C0M A;  5CED B;  3B7T A;  3L82 A;  3X2Q E;  2GGF A;  1N9A A;  4BSX A;  4GTP A;  4U0S A;  1HH8 A;  4PS8 A;  4GPM A;  5FQ6 A;  4B8A A;  3QB2 A;  3Q7F A;  4CEM A;  2WXN A;  4B0Z A;  1IYG A;  1TJF A;  1N4S A;  5E76 A;  2DZO A;  5BXU A;  4L1B A;  3AG1 E;  4KT6 B;  1YMP A;  2KC7 A;  3NOG D;  4G23 A;  4I17 A;  1EPU A;  4QFV A;  4KYO B;  3VLF A;  3CQC B;  3L13 A;  3LS8 A;  4BET A;  3MYV A;  4Z68 A;  2Y4T A;  4BX9 A;  4ACK A;  2YIN A;  4F7A A;  5CEA A;  3ZYL A;  4HVB A;  4XI9 A;  4ILH B;  2VTB A;  3RRU A;  1Q2Z A;  2VYI A;  2AXZ A;  3NZU A;  3CVP A;  2OOE A;  3LJN A;  3FH8 A;  4UQX A;  3Q75 A;  2DIW A;  2XEE A;  3CVL A;  3CVV A;  2IF4 A;  1SA4 A;  3TL5 A;  4ZHB A;  4GTM A;  3HVE A;  2J9Q A;  4WWP A;  1TNZ A;  3Q15 A;  4HI8 A;  3ZYK A;  2FF4 A;  4ILI A;  2R17 C;  3OTN A;  3S7D A;  1UN9 A;  4D10 C;  4XEI G;  4GZC A;  3FU3 A;  1UJJ A;  4RQI A;  3JQ1 A;  3LCA A;  2FUL A;  2VSO E;  4YDW A;  2P9P G;  4OAU C;  4AIF A;  2EIN E;  4NAC A;  2WXL A;  4N2Q A;  5AJL A;  3FTX A;  1N11 A;  3LPZ A;  1ELW A;  1L5J A;  2X6K A;  4G1T A;  4I1A A;  4YDY A;  4CDM A;  4JPS A;  5D0Q D;  3C72 A;  3JXI A;  2LAH A;  1MZC A;  2VQ2 A;  4TUU A;  4C0E A;  3MZL B;  3ULY A;  3OXG A;  2P58 C;  3CKB A;  2WXF A;  3GZ2 A;  4J6I A;  1U2V G;  3IKO B;  3R9A B;  5EKQ D;  3FH5 A;  3ZHE A;  1TEZ A;  1K1A A;  4DPR A;  2WPV A;  2Y0B G;  3QDN A;  5BV1 A;  3UM1 A;  1DNP A;  4DI3 A;  1FT1 A;  1QQE A;  4NQ0 A;  3U4T A;  4N39 A;  4LUN U;  4J8F A;  3FUD A;  3TWW A;  4XIF A;  4U0Z A;  5AEN A;  3AS5 A;  2FO1 E;  4N2S A;  3FEY A;  3C3Q A;  1NFI E;  2H6G A;  3DEO A;  4JC8 A;  1HG2 A;  3DBS A;  4N5C A;  4G2V A;  2DYR E;  5JA4 D;  2GRM A;  3D9H A; 
#chains in the Genus database with same CATH homology
 4YND A;  3FTS A;  4H7Y A;  3D9K A;  4RVB A;  2HO1 A;  2Y3A A;  2L9B A;  3MEK A;  1OWM A;  4EBA G;  4UWL A;  3EIQ C;  3LKU A;  1OUV A;  3CHR A;  3JYS A;  4W9R A;  3I5P A;  3QKY A;  3Q47 B;  5M72 A;  3QAR A;  3G2W A;  3ZEF A;  2X6H A;  2XQ0 A;  1WY6 A;  4XX5 A;  4WUY A;  4BT9 A;  2WQ6 A;  4GZD A;  1ELR A;  3T5V A;  2FEZ A;  2I1K A;  3EJN A;  2KCV A;  3FEX A;  1XNF A;  4AXH A;  1U3D A;  4GPK A;  1OWO A;  2CG2 A;  4GU5 A;  2J08 A;  3S7B A;  4GA1 A;  2QY7 A;  2KCL A;  5CCM A;  5G55 A;  4YVQ C;  5J90 A;  4NRH B;  4HXI A;  4EQF A;  3PEU B;  2AVP A;  3JUI A;  5JJ6 A;  1XGW A;  4ILG A;  5A7D B;  2IOL A;  2CHW A;  1UW4 B;  3CVN A;  4G11 A;  1GW6 A;  4FA6 A;  4ABN A;  2WXJ A;  2RG8 A;  4BTB A;  3UUX A;  4DK5 A;  1QNF A;  3QAQ A;  2LAI A;  4TRQ A;  4GA0 A;  3T5X A;  3IHY A;  4GYO A;  4CRW A;  3CK8 A;  4HOS A;  1TJC A;  2VTB B;  3CHM A;  3BEE A;  4N3B A;  4ANW A;  1FVH A;  2PL2 A;  2PM6 A;  2WXH A;  4XKB A;  4CGW A;  4JZY A;  4JA9 A;  2IQC A;  2XCC A;  5CHE E;  1Y8M A;  3RKV A;  1P5Q A;  1MQS A;  4MLP A;  5JHB A;  2I2O A;  4GYY A;  2YHC A;  2Y4U A;  1NA0 A;  1FVF A;  4L2L A;  3S2A A;  3ZRH A;  4ANU A;  5HQ8 A;  4XZ4 A;  3LY8 A;  3SBT B;  4I6J A;  5BW8 C;  3KD7 A;  3T8M A;  5ENN A;  5J08 A;  4CDN A;  3B7U X;  1HXI A;  1Z3X A;  2YQ8 A;  4FJZ A;  3LJ3 A;  4APF A;  3CEQ A;  3G2S A;  4A3V A;  3FTW A;  4EBA A;  5BNW A;  1HZ4 A;  4MRU A;  1HG5 A;  2M63 A;  3PEV B;  5AIJ A;  2HYZ A;  3UQ3 A;  3MV3 B;  3L16 A;  3PH0 C;  4FJY A;  3MKQ A;  4K03 A;  2E0I A;  3D3M A;  3DPD A;  1BPO A;  1UG3 A;  3CSF A;  3CKC A;  4OVU A;  1E8X A;  4U07 A;  4XKC A;  4A1S A;  2CFU A;  2V5F A;  4FHJ A;  4GYW A;  5LX8 A;  3EIJ A;  3CV0 A;  3FU0 A;  4F53 A;  4IRU A;  1HE8 A;  2L0I A;  5T4Y A;  4L23 A;  2XGS A;  5KJN A;  2DCP A;  1B89 A;  3FHE A;  3SHF A;  2WMO A;  4FP7 A;  2FBN A;  3UT7 A;  2BUG A;  4RSY A;  1OWL A;  5C2Y A;  3VLD A;  1YA0 A;  1ZU2 A;  4WNG A;  3FDH A;  4CT4 A;  2CFZ A;  3I4G A;  3CQG B;  3Q4A B;  2WXP A;  1ZBP A;  3TGO A;  3RO3 A;  2KM4 A;  3U64 A;  4V3I A;  3TG4 A;  1A17 A;  4WNE A;  3QWV A;  3SGH A;  4UI9 K;  4AV7 A;  2UY1 B;  3R7R A;  3SF4 A;  1HFA A;  2WXG A;  1WAO 1;  2IOS A;  3ZXS A;  1HO8 A;  3S7J A;  4A55 A;  3UPV A;  3CVQ A;  2WB2 A;  2MRI A;  3FUJ A;  2KZT A;  3GYZ A;  2CHX A;  5KJM A;  3SD5 A;  2OND A;  4GB9 A;  4I2W A;  4GCN A;  5LCW J;  1LF8 A;  3FUK A;  2AXU A;  4H7X A;  4JEH A;  4M3O A;  4L2Y A;  2XCB A;  1PY1 A;  2JEK A;  3MGB A;  4IUL A;  3APD A;  2CHZ A;  1UJK A;  1HU3 A;  2LO6 A;  2R59 A;  4EEC A;  4DI4 A;  4JA7 A;  2CG3 A;  3HDX A;  2LNI A;  2V4L A;  5AYW D;  3CR3 A;  3MKQ B;  3CGH A;  4EPZ A;  1HX8 A;  2X6I A;  4CCA A;  3PE3 A;  2I1J A;  5E75 A;  4A1G A;  1HF8 A;  2ZU6 B;  4BTA A;  3PUJ A;  4GZ3 A;  4JHK A;  3B7R L;  3NQP A;  4U8H A;  2J4B A;  5G05 J;  3RRM B;  3APF A;  2WVI A;  2Q7F A;  2BF0 X;  4N3C A;  4FLH A;  4CGV A;  5BV0 A;  1IQR A;  4G25 A;  3FUN A;  3MV2 B;  5G2N A;  3OXL A;  2HM8 A;  3ZHE B;  4B8C B;  3CK9 A;  2WXM A;  5AJD A;  5FQ7 A;  4BWR A;  1FCH A;  3ONL A;  3OXF A;  4HS2 A;  4I9E A;  4CT0 A;  2VSX E;  3N71 A;  4UQY A;  2X3M A;  3PZD A;  3ZVV A;  1IQU A;  1H2T C;  2WXK A;  3FUE A;  3RK6 A;  3LXU X;  3TJP A;  3FY4 A;  5KJK A;  2R5S A;  3GZS A;  1Z3Y A;  2ION A;  3LY9 A;  4NUR A;  5LFA A;  5ANR A;  3LDZ A;  4I9C A;  1E90 A;  1IHG A;  2KAT A;  2OVB A;  2XEV A;  3G2U A;  3HIZ A;  4UI9 J;  3VTX A;  2VSN A;  4JL0 A;  3BG0 B;  5HI7 A;  2IU1 A;  4APO A;  4HLE A;  1H0A A;  3O4Z A;  4I6E A;  3FUM A;  3MX3 A;  3ZYM A;  3ASG A;  3QC1 A;  3PS6 A;  3D9M A;  3FTU A;  3D9J A;  3FUI A;  4FHK A;  4LCT A;  1E8W A;  3CVW A;  4MS6 A;  2VGX A;  5D0O D;  3O48 A;  1MHQ A;  5DBK A;  3G2T A;  2AXV A;  4G26 A;  3P1U A;  3K9I A;  3SI5 A;  4GCO A;  4GMJ A;  2OV8 A;  1EDU A;  4DLQ A;  3SNX A;  1EF1 C;  3L6A A;  4ANX A;  5CMW A;  3AU4 A;  1X5B A;  2ILR A;  1HS6 A;  1ELK A;  3MCX A;  4EZJ A;  2LSV A;  4WWO A;  3TXN A;  5EX3 A;  5CMY A;  4U63 A;  4WND A;  3LY7 A;  2A5U A;  4MKT A;  2HR2 A;  5A23 A;  1PC2 A;  5G04 C;  4Y6C A;  2MHK A;  3B7S A;  2PQN A;  4Q94 A;  3L17 A;  4AY5 A;  1H19 A;  1NP7 A;  3FU6 A;  4U0U A;  4BX8 A;  4YVO A;  3WXX A;  1E8Y A;  1JUQ A;  3QK0 A;  2QFC A;  5FZS A;  3CLJ A;  4KVO A;  3MJW A;  3U66 A;  1S0P A;  3KS2 A;  5EDS A;  2X38 A;  3GZ1 A;  3R7Q A;  1W3B A;  2J09 A;  5FWQ A;  5JJ7 A;  3FU5 A;  3E4B A;  2C0M A;  2GW1 A;  2NXP A;  2PM7 A;  3IEG A;  3P2B A;  4ANV A;  3B7T A;  4Y6W A;  4F3V A;  4JVS A;  1SZ9 A;  2GGF A;  4BSX A;  4K0R A;  4UWH A;  5FTP A;  4PH4 B;  4U0S A;  1HH8 A;  2WXQ A;  4KZC A;  4PS8 A;  4IN3 B;  4I1O B;  3U3W A;  2AW6 A;  2YNQ A;  4FU3 A;  2WM9 A;  2XPZ A;  4AP2 A;  2MOW A;  5FQ6 A;  1KT0 A;  3EHN A;  3UX4 A;  3IHV A;  4B8A A;  4F1S A;  4AY6 A;  4E6H A;  3IBE A;  3QB2 A;  4AM9 A;  4J8D A;  5ANL A;  5BUZ A;  3ASH A;  4IYP A;  4BT8 A;  3QWP A;  1NZN A;  2WXN A;  4B0Z A;  2KCK A;  5FQ8 A;  4B94 A;  4CEM A;  4KZ0 A;  3ASF A;  3CVX A;  1IYG A;  1WM5 A;  1TJF A;  3PRZ A;  1EYH A;  1E7U A;  5E76 A;  3MA5 A;  3QOU A;  3ZN3 A;  2I6H A;  2OVF A;  3GW4 A;  3ESL A;  3ZFW A;  3PNL B;  4JHR A;  4L1B A;  2A4Z A;  4KT6 B;  5LP0 A;  2IFU A;  2PZI A;  4I2Z A;  3CHP A;  4KMO A;  3D9P A;  4L7T A;  5G05 C;  2KC7 A;  5ARF A;  4G23 A;  2DBA A;  1PAQ A;  3CHO A;  2FO7 A;  4I17 A;  3FUH A;  2XGM A;  2V0P A;  3ZGQ A;  1EPU A;  3D9N A;  4QFV A;  3UT4 A;  1KLX A;  4KYO B;  3VLF A;  1H2V C;  4OVV A;  2XRY A;  4FUL A;  4GAA A;  3CQC B;  2XRZ A;  2BTD A;  3JCK C;  1SZA A;  4JEU A;  5FJY A;  3URZ A;  3BG1 B;  3L13 A;  3LS8 A;  5A6C A;  4LER A;  3MYV A;  4ACL A;  3FTY A;  3FUL A;  5LOZ A;  2WQ7 A;  2Y4T A;  4BX9 A;  4ACK A;  2YIN A;  3AU5 A;  5EX0 A;  3RIB A;  4F7A A;  2AWI A;  3ZYL A;  4UI9 C;  4AOF A;  3G2V A;  3NZS A;  4HVB A;  4XI9 A;  4ILH B;  4BFR A;  4AVX A;  2VTB A;  2JLB A;  4PDX A;  2V8S E;  3ULQ A;  4HFG A;  1INZ A;  3RRU A;  4GML A;  5BT1 A;  1N52 A;  2VGY A;  2AXZ A;  2VYI A;  3EDT B;  2PQR A;  3NZU A;  3FTZ A;  3CIA A;  3CVP A;  5ARG A;  4PS7 A;  2RD0 A;  2OOE A;  4LEU A;  3FH8 A;  4UQX A;  1N54 A;  2WMN A;  2VSY A;  3RJV A;  3SFZ A;  3CHS A;  2DIW A;  3LEW A;  2L0T B;  3JQ0 A;  4KXK B;  2KZT B;  3ZPJ A;  4E85 A;  1KT1 A;  3L08 A;  2WQH A;  3CVL A;  4A3T A;  3CVV A;  1E96 B;  2IF4 A;  4PUC A;  3TL5 A;  4FAD A;  3I3N A;  5FZQ A;  4J8S A;  3AS4 A;  2E2E A;  3FUF A;  3HVE A;  3HHM A;  2J9Q A;  3KEZ A;  4WWP A;  2GRL A;  4FLB A;  3Q15 A;  3ZYK A;  2IJG X;  4LRZ A;  3VLE A;  5FT9 A;  2FF4 A;  4ILI A;  2I9C A;  3CVU A;  2R17 C;  2L6J A;  4O6F A;  2J4D A;  3Q5M A;  4AEZ C;  1E8Z A;  3ML8 A;  3OTN A;  3S7D A;  3ASD A;  3IV0 A;  1UN9 A;  4D10 C;  4XE0 A;  3QJZ A;  4UQZ A;  3LYA A;  4GZC A;  3FU3 A;  3LVQ E;  3FP3 A;  1UJJ A;  3CHQ A;  4I1M A;  3ZIM A;  3Q49 B;  4C9B B;  3KAE A;  3LVR E;  3FFL A;  3JQ1 A;  3LCA A;  2XPI A;  3ZYQ A;  2XPY A;  4N3A A;  2FUL A;  4J8E A;  3I4R B;  3L22 A;  5T3R A;  2VSO E;  3RO2 A;  1JWG A;  1OWP A;  3APC A;  1Y6I A;  3ZW3 A;  2UY1 A;  4GZ6 A;  1VDY A;  2C2L A;  4AIF A;  1OWN A;  1JWF A;  4NAC A;  2WXL A;  3QWW A;  4N2Q A;  5AJL A;  3FTX A;  5T8I A;  2XGO A;  3S7F A;  3SZ7 A;  3LPZ A;  3PRE A;  2WXR A;  1ELW A;  3L54 A;  2NC9 A;  3ML9 A;  4P29 A;  5FZR A;  1L5J A;  2X6K A;  4G1T A;  2C0L A;  2NSZ A;  4PS3 A;  4I1A A;  3RU0 A;  4CDM A;  4JPS A;  5D0Q D;  4JHJ A;  3OAW A;  1NA3 A;  2LAH A;  2VQ2 A;  4TUU A;  2VGX B;  4OYS A;  4WWN A;  4C0E A;  5LCW C;  3HVE B;  3MZL B;  3SBS A;  4I6G A;  3OXG A;  2P58 C;  3PDN A;  4KVM A;  3U9W A;  3CKB A;  1Z6T A;  3PUK A;  2WXO A;  5G04 J;  2WXF A;  1SQM A;  3ENE A;  4R7L A;  3UT8 A;  3GZ2 A;  4J6I A;  4U04 A;  3B13 A;  3ESK A;  1H6K A;  3IKO B;  3R9A B;  3EHM A;  5EKQ D;  3FH7 A;  3FH5 A;  4BY6 A;  1U3C A;  4Q69 A;  4FC8 A;  3ZHE A;  1TEZ A;  4DPR A;  2WPV A;  3CST A;  4DJA A;  4HOT A;  3AS8 A;  3QDN A;  4JXT A;  5JHA A;  5BV1 A;  4HOR A;  1DNP A;  3HYM B;  4G24 A;  4DI3 A;  4NQ0 A;  1QQE A;  2LSU A;  5C1D A;  3U4T A;  4N39 A;  4LUN U;  5FQ4 A;  5KJL A;  4EZL A;  2EQX A;  4J8F A;  3TXM A;  4WAF A;  4EZK A;  4CDR A;  4UWK A;  5JJT A;  2X6J A;  4HOU A;  5BPP A;  3CK7 A;  3FUD A;  4AJW A;  4DLO A;  3FTV A;  3D9O A;  4UWF A;  4XI0 A;  2FI7 A;  3TAX A;  3PE4 A;  4URK A;  4XIF A;  3QNK A;  4U0Z A;  4HOQ A;  4WNF A;  5AEN A;  3AS5 A;  3D9L A;  4ATG A;  4GZ5 A;  1QZ2 A;  5DIZ A;  4N2S A;  1UN8 A;  2J07 A;  4J0U A;  4JW1 A;  3FWV A;  3FEY A;  5CCL A;  4RG9 A;  3PVL A;  4TV3 A;  3TG5 A;  2WXI A;  1H2U A;  4JC8 A;  4UWG A;  1HG2 A;  3UMV A;  3NF1 A;  3DBS A;  4KBQ A;  1E7V A;  4ME2 A;  3RRN B;  4N5C A;  2J49 A;  4I43 A;  3VTY A;  1JPL A;  2XHE A;  4B89 A;  4G2V A;  5KCM A;  2GRM A;  3C98 A;  2UWJ G;  2YHE A;  4RG6 A;  3ONK A;  4Q96 A;  3PNT B;  1DVP A;  2VJ8 A;  3MKR A;  4GA2 A;  2X6F A;  4C0M A;  3D9I A;  3CVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...