2P58C

Structure of the yersinia pestis type iii secretion system needle protein yscf in complex with its chaperones ysce/yscg
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
112
structure length
112
Chain Sequence
YKLNVLLAEIALIGTGNHYHEEANCIAEWLHLKGEEEAVQLIRLSSLMNRGDYASALQQGNKLAYPDLEPWLALCEYRLGLGSALESRLNRLARSQDPRIQTFVNGMREQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative type III secretion protein YscE
publication title Structural characterization of the Yersinia pestis type III secretion system needle protein YscF in complex with its heterodimeric chaperone YscE/YscG.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein/chaperone
total genus 46
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09477 Type_III_YscG Bacterial type II secretion system chaperone protein (type_III_yscG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2p58C00
2KCVA 3RO3A 4HOSA 2AVPA 4YNDA 1KT0A 3CVNA 1WAO1 3LY7A 2WQHA 4AY6A 5FJYA 4BWRA 2VSYA 4U0UA 5FZQA 4G1TA 2Y4TA 3CV0A 2VGYA 5EX0A 2XEVA 3CK9A 4I1AA 5FT9A 5D0QD 5KJLA 3ZHEB 2FEZA 2KC7A 3GYZA 4Y6CA 1P5QA 5HQ8A 4XIFA 4GZ6A 4U0SA 2IF4A 4G24A 3CK7A 3SZ7A 1ELWA 5C1DA 4YVOA 4UQZA 5A7DB 3S7BA 3RU0A 4XI0A 3TAXA 3UPVA 3BEEA 4W9RA 3FWVA 4HORA 3AS5A 3CVQA 3U4TA 3S7DA 5AYWD 3QWVA 4J0UA 2I6HA 2FO7A 3SF4A 2XCCA 3VTYA 4BTAA 4N39A 5LCWC 3FP3A 4N3AA 3QKYA 4APOA 5BW8C 2VGXA 4RG6A 2WPVA 2VQ2A 5ARGA 2XGOA 3TGOA 5CHEE 3CVPA 4HOTA 4GZ3A 3ASFA 4BTBA 4GCNA 1ZBPA 4GYOA 4G25A 1Y8MA 2PQNA 3QDNA 4WUYA 3HYMB 3ZFWA 3N71A 3R9AB 5HI7A 3OXGA 2UY1A 1TJCA 2ONDA 2PZIA 3Q4AB 4GYYA 4GA0A 1XNFA 2XCBA 3URZA 4NQ0A 4H7XA 3AS4A 2FI7A 4GZ5A 1HZ4A 4I9EA 3CK8A 1W3BA 2C0MA 4JA9A 4H7YA 3LCAA 4I2WA 4NRHB 2GW1A 3LPZA 2VGXB 4ME2A 3JYSA 5CCMA 5G04J 4GA1A 2HYZA 3LKUA 4O6FA 1QQEA 1QZ2A 1OUVA 4I2ZA 3O48A 1E96B 2LSUA 5A6CA 1IHGA 2KATA 2JLBA 2VYIA 3LY8A 2V5FA 2XGSA 2QFCA 3RKVA 4J8DA 2UY1B 3MEKA 4J8FA 3GZ2A 5FZRA 4HOQA 3GZ1A 3OXLA 3Q5MA 5G05J 4N2QA 3CVLA 5BNWA 2XPIA 3S7JA 3EDTB 3CEQA 3QWPA 5JJ6A 3OXFA 3MV3B 4WNFA 4I9CA 3CKCA 3KS2A 4KYOB 3FFLA 4BT9A 4AIFA 2J9QA 3ULQA 5JJTA 2PL2A 3PE4A 4F3VA 3PE3A 4GCOA 3RIBA 4XI9A 3TG4A 4KXKB 2OOEA 4WNEA 4N2SA 1NA3A 3E4BA 4AM9A 1NA0A 5KJKA 3IEGA 3LY9A 4G2VA 5G04C 4UI9J 3KAEA 2IFUA 4N5CA 2XGMA 4GYWA 3ASHA 3QOUA 4G26A 5KJNA 4GPKA 3WXXA 3Q47B 1KLXA 1ZU2A 4HOUA 4UQXA 4B94A 5DBKA 1PC2A 4WNDA 4G23A 4RG9A 4U0ZA 3TG5A 4A1SA 3ESKA 4WNGA 4N3CA 4UQYA 5ARFA 2BUGA 2LNIA 1ELRA 1NZNA 2P58C 5G05C 2C2LA 2FBNA 4LEUA 4N3BA 4CGWA 2KCLA 4JHRA 3GW4A 1A17A 4CGVA 3PDNA 5BT1A 1IYGA 4AY5A 4JL0A 4EQFA 2Y4UA 4U07A 2YQ8A 2HO1A 2LSVA 3K9IA 3Q15A 3MV2B 2FF4A 4GA2A 1HH8A 3RO2A 4JA7A 5JJ7A 2KCKA 5CCLA 3S7FA 1FCHA 3VTXA 5M72A 1YA0A 4UI9K 4IN3B 5EKQD 4U04A 3UQ3A 2HR2A 3MA5A 2Q7FA 2C0LA 4YVQC 5D0OD 2UWJG 3ZGQA 5DIZA 3NF1A 3ASDA 2VSNA 3CKBA 2YHCA 4UI9C 2E2EA 3ZPJA 4BT8A 3QWWA 3RJVA 3ZHEA 4J8EA 2NC9A 5FZSA 3ASGA 1B89A 2DBAA 4I17A 5EX3A 3AS8A 1WM5A 4ABNA 5FTPA 3Q49B 4KBQA 3U3WA 1HXIA 3ZN3A 4CDRA 1KT1A 2R5SA 2PQRA 3KD7A 4Y6WA 2L6JA 5KJMA 3MKRA 5LCWJ 3UUXA 2MHKA 3LYAA
chains in the Genus database with same CATH superfamily
2KCVA 4KVOA 2CFUA 5CRVA 3U66A 4YNDA 4CCAA 3CVNA 3EHMA 1WAO1 4Q69A 1UOHA 4AY6A 2XPZA 4GZDA 3MZLB 5FZQA 4G1TA 3KSLA 3ZRHA 3HRAA 2GRNB 2J4BA 4FADA 4B0ZA 4HNAD 4L9PA 2AJAA 1IKND 3PUJA 1E8ZA 3TWTA 5AQ9A 3ML9A 3CSFA 3DEOA 4ACLA 2F37A 4Z68A 3HXCA 4E6HA 3DSTA 3W9GA 4C0EA 4GMRA 5ENPD 1OCCE 3JQ1A 1BU9A 3L82A 5B1AE 3D9PA 4L2YA 3RK6A 2ILRA 5C1DA 2IOLA 4YVOA 2HE0A 2FO1E 4YDEA 5BUZA 4XKBA 3TWWA 2VSOE 2I2OA 5LX8A 3E33A 4AEZC 4DX6D 3ZYLA 4HORA 1BLXB 4HI9A 4OVVA 1MQSA 3AS5A 1HE8A 5FQ4A 3S7DA 3CIAA 3QWVA 3QB2A 2I6HA 2EIKE 4HS2A 2FO7A 5H7PA 3IXEA 4DLQA 5JHAA 1O1SA 3LDZA 3FTVA 1N52A 4BTAA 3AAAC 4N39A 3SBTB 2R59A 1EYHA 5J90A 4ATZD 3O4ZA 4ZFHA 3I3NA 3R9MA 2VGXA 3MKQB 5ARGA 3SNXA 5CHEE 3ASFA 4UWKA 2B0OE 4U95D 2ZU6B 1PAQA 2PQNA 1QBQA 1OCZE 3MX3A 5KCMA 2PM6A 3V2OA 3LXUX 4EBAG 1JCRA 2ETBA 4ANXA 3UM0A 3W9FA 4CT0A 2J07A 3DSWA 4GA0A 3FU5A 3FDHA 2J8SD 3X2QE 1HZ4A 1X5BA 1N0QA 4CT4A 2V4HC 1W3BA 3CK8A 3G2UA 3QC1A 4UWFA 1DCQA 3DSUA 4PS3A 3V79K 4H7YA 3FTSA 4FLBA 1SZ9A 3R7RA 3FUIA 4HB5A 3JCKC 3T8KA 1FT2A 2WMNA 4F6RD 3JYSA 5CCMA 3FU6A 1LF8A 3LKUA 4O6FA 4WWNA 5ENNA 3RAUA 3DBSA 1G3NB 3KEAA 4EZLA 3ML8A 3IKOB 2KATA 2DYRE 4RQIA 1HO8A 3SFYA 3UXGA 5EILA 4EZKA 4J8DA 2X6IA 3TL5A 2A4ZA 5CRUA 4J8FA 3GZ2A 2R05A 2H6HA 4HOQA 4JD2G 5CMWA 1OWMA 3Q5MA 2J09A 5T8IA 2Y3AA 2IY0C 5BNWA 2XPIA 3L54A 2H6FA 4X8QA 3DWLG 3EDTB 3CEQA 5JJ6A 4DK5A 3APCA 3OXFA 3UI2A 3CQGB 3KS2A 5G55A 3L08A 2GRLA 2IOSA 5AQBA 2J9QA 4B89A 4LCTA 3UINC 4TXPA 1PY1A 1Q2ZA 3ONLA 2PL2A 3PE4A 1S64A 3GZSA 3CVVA 3EIJA 4AP2A 2R17C 2V4LA 1H6OA 3EU9A 3CGHA 1TNOA 2OEWA 3IEGA 5ENRD 4GTTA 5ITZF 2GRRB 5G04C 3ZW3A 5AQAA 5IY5E 2XGMA 3FTWA 2M63A 2BKKB 3ZNGA 4G26A 4GPKA 3FTYA 4UQXA 2B6CA 4AV7A 1PC2A 1E7VA 2WXFA 3FTXA 3FU0A 4KT6B 4L7TA 4JW1A 2BUGA 3ABME 3C3RA 5AAOA 1H2TC 5C2YA 1NZNA 2QYJA 2P58C 2WXOA 5G05C 1IQRA 2C2LA 2FBNA 3ESLA 4N3BA 4IULA 2KCLA 2ETAA 3GW4A 4GTQA 1MZCA 4LRZA 3V2XA 4JL0A 5BV1A 2Y4UA 3ABKE 4U07A 3CSTA 4I6JA 4QQIA 2NXPA 3RO2A 4B93B 1WY6A 2YHEA 3MCXA 3CQCB 2WXIA 1FCHA 3ZXSA 3VTXA 5JA4D 4YDYA 4U96D 2F0YA 4RSYA 2F8XK 3JUEA 3FH7A 3UQ3A 4LSZE 2Q7FA 4YVQC 1N9AA 1JCQA 2EINE 2UWJG 1DVPA 5DIZA 3FH8A 4AJWA 3UM1A 4GTOA 2BKGA 2AW6A 3CKBA 1MX2A 4LNUD 4KVMA 2E2EA 3ZPJA 2VTBB 3D9JA 3ZHEA 4URKA 3ASGA 5EX3A 5FQ8A 2J49A 4HRNA 5CEAA 1H19A 4KBQA 5T3RA 1OWOA 1D8EA 4U7EB 4ANUA 1KPSB 2OV8A 3KD7A 3Q7FA 2P2CP 3MKRA 5LCWJ 3HVEB 3C5RA 1Z3XA 3U9WA 1OWLA 2R03A 1KT0A 2WQHA 5FJYA 2A5EA 4U0UA 3TXMA 3SFXA 1JCSA 2XEHA 2VGYA 5EX0A 3HXEA 2BEDA 3CK9A 3R7QA 3ZKJA 2WXPA 4Q96A 3ASNE 4IRUA 2FEZA 2KC7A 4XKCA 3GYZA 5JHBA 5HQ8A 3RRNB 3L17A 4XIFA 4GAAA 4I1OB 4GZ6A 3FULA 3SQVA 3AG3E 1KZPA 3TJPA 4G24A 2IJGX 5CBNA 3CK7A 1SZAA 4JHKA 4FA6A 2QYUA 3VLEA 1TNBA 3V31A 3ZU7B 5A7DB 5HRYA 3FUEA 4NURA 2WXGA 1N4QA 3UPVA 3B13A 4U8HA 1RZ4A 3ZYMA 4FULA 5CERB 4TXQA 3TXNA 4EECA 4D10C 3SI5A 3KSQA 1GW6A 4HI8A 4Q94A 1D9SA 3CVQA 2V5QC 5AYWD 1Y6IA 4J0UA 3AU4A 3U64A 4RVBA 4PUCA 4RLYA 1DCEA 4N3AA 4J7WA 4G8LA 4LNBA 3VLFA 4APOA 2WXLA 2XRYA 2ZXWE 1H6PA 4GYOA 4G25A 2ZGDA 3HXBA 4JHJA 1TNUA 3VLDA 3QDNA 4ANVA 3G2SA 5FQ6A 2LUHA 3PZ2A 3SBSA 3N71A 1SVXA 1N4PA 5HI7A 3OXGA 1SW6A 2UY1A 5EYPF 4F1PA 3Q4AB 2KXPC 4GYYA 4GPMA 2XCBA 3DPDA 4GB9A 3URZA 3IHYA 4GZ5A 4I9EA 4GTPA 4J6IA 1MJ0A 2H6IA 2J4DA 5AARA 4I2WA 3CVUA 3PVLA 2GW1A 1IQUA 1E8XA 2LAIA 3PNLB 5CMYA 3C3OA 3SY2A 3FUMA 5KNHD 1L5JA 3UIPC 1QQEA 1K3ZD 2Y1LE 3FUDA 4M3OA 3O48A 1U3DA 3FH5A 2MOWA 3IBEA 4K5CA 2LXLA 4CEMA 3FU3A 3ZYKA 2V5FA 4JC8A 5BXUA 2PM7A 2JABA 5D2MC 1N54A 3NAWA 4G8KA 3FTUA 4DX2A 4N2QA 1E7UA 3LS8A 3UKUG 2PNNA 3LVQE 3FY4A 2ZGGA 3CVLA 2WQ7A 1ELKA 2R02A 4GTVA 3S7JA 1JPLA 3L9TA 4EHMA 4TV3A 5E76A 2WXRA 1NL4A 3J5PA 4OVUA 4WNFA 4BFRA 3FFLA 4A55A 1EPUA 3TWQA 4BT9A 4F1SA 5LFAA 3ULQA 3UIOC 1Z3YA 3B7SA 1BPOA 1IHBA 3PE3A 1LD8A 4ZHBA 3RIBA 5B1BE 3TG4A 2RFAA 3BQOA 5ANRA 2XHEA 2L9BA 1U2VG 3E4BA 1OXJA 4L23A 4DJAA 4G2VA 3NZUA 2P9IG 3KAEA 2OVFA 3EUVA 4GMJA 3ASHA 3QOUA 1LTXA 1D8DA 2YINA 4MBGA 4FHJA 1KLXA 1ZU2A 4HOUA 3ULYA 5B3SE 3Q78A 2KBXA 4RG9A 2WXQA 4U0ZA 1OWPA 2WXKA 3D9LA 5CBOA 4N3CA 1SA4A 4TUMA 3RRUA 5HS0A 5ENSD 3CHPA 3NOCD 5FIOA 3BG1B 3FEYA 3PREA 2LNIA 2KZTB 2V8SE 2H6GA 3EHRA 3PZ1A 3JQ0A 3ONKA 3BG0B 4HLEA 3PDNA 1EDUA 4DPRA 3FHEA 2XRZA 3UM2A 4FP7A 1WDYA 4O1PA 5CECB 1HH8A 4JA7A 2IEJA 4B8CB 2KCKA 3FEXA 3S7FA 3UX4A 5M72A 1SQMA 4MRUA 2EIME 4UI9K 1OCOE 1TN7A 4OYSA 2A5UA 1HFAA 3MA5A 5D0OD 3CHRA 3TWRA 2X6FA 3CHOA 3QAQA 3P1UA 5JMND 2BTDA 3TWUA 5BPPA 3B7UX 5FWQA 4I17A 3AS8A 3UT4A 3D3MA 3U3WA 2YNQA 4HQDA 1OWNA 4JEHA 4MLPA 3NZSA 3JUIA 1FPPA 4E85A 1MX6A 4LUNU 3C3QA 2L6JA 2OCCE 1H6KA 1UN9A 2RG8A 3LYAA 3HXFA 5G2NA 3UTMA 3RO3A 3D9KA 4HOSA 3ZYQA 2AVPA 4BX9A 3TWVA 3C98A 3LY7A 4U8VD 4BWRA 4UUCA 1JUQA 1NFIE 2VSYA 4DLOA 2Y4TA 3CV0A 4PDXA 2EIJE 5FT9A 4JZYA 2GRPB 4PH4B 1HU3A 1K1BA 5D0QD 1V55E 5KJLA 4BETA 2HM8A 5CEDB 1P5QA 2X38A 3MKQA 4EBAA 2BF0X 3HHMA 2WXNA 4ILHB 5LP0A 2OEVA 1MYOA 1OCRE 2IF4A 3IHVA 4BERA 2NSZA 3SZ7A 1ELWA 2ETCA 3I4GA 2XPYA 2WXHA 3CHMA 4UQZA 5A23A 5BXOA 1UW4B 3NBNB 3D9NA 3E32A 4XI0A 3TAXA 3BEEA 3Q79A 2X6KA 2P9UG 3U4TA 4BY6A 1O1RA 3Q9UC 3SF4A 2XCCA 3VTYA 4BEPA 2GGFA 5LCWC 3FP3A 3QKYA 4ANWA 5BW8C 4MS6A 1BI7B 1A5EA 2VQ2A 2WPVA 3TGOA 4F7AA 1AWCB 3CVPA 4HOTA 4GZ3A 2P9KG 3PNTB 4BTBA 2VGEA 3CVXA 1ZBPA 1UJJA 1Y8MA 3UM3A 3B95A 4C9BB 1YYHA 4WUYA 3RSEG 3HYMB 5EIDA 2DYSE 2ZISA 3ZVVA 1TJCA 2CG3A 2PZIA 2X6JA 3AS4A 3AG1E 2FI7A 4CDMA 1H2UA 3G2TA 3AG2E 4BSXA 3QNKA 4NRHB 3MGBA 2KM4A 3FUKA 5ENQD 2DZNA 4APFA 2VGXB 4GTSA 4L1BA 4GA1A 5AJLA 2WQ6A 4U8YD 3SGHA 1QZ2A 3QJZA 3EIQC 3HXDA 1NI1A 3T8MA 4KZ0A 1E96B 1N0RA 2WXMA 5A6CA 4I43A 2WMOA 2WVIA 2DCPA 3FUFA 4UWGA 2VYIA 3LY8A 3TWXA 2XGSA 3RKVA 2Y69E 2AXZA 2IQCA 2L0IA 5ANLA 2X3MA 3CLJA 3GZ1A 1N94A 4AOFA 3AG4E 4BX8A 3Q75A 1E8WA 4QFVA 4FLHA 4O1OA 1BD8A 4CYMD 3PEUB 4R7LA 1KZOA 3MV3B 2L6BA 3CVWA 3Q9NC 3C72A 3RRMB 2I1JA 4JPSA 3J5QB 4F53A 3LJNA 4I1MA 4I6GA 4G11A 2DIWA 4GZCA 3LJ3A 1TYQG 4XI9A 4KXKB 2OOEA 4CZ2D 4WNEA 4DI4A 1HF8A 4AVXA 4U63A 4DX7D 3PRZA 1NA0A 5KJKA 2I9CA 4LNGA 3E30A 4UI9J 4BESA 4FU3A 4N5CA 2IFUA 2L0TB 1O5MA 4DX5D 3DXKG 3EHNA 3ZXPA 2IO3C 4WNDA 2WB2A 3TG5A 4A1SA 3CR3A 4A1GA 3ESKA 4WNGA 4FJYA 4UQYA 5ARFA 2RD0A 1NP7A 5E75A 3L6AA 4HFGA 1YMPA 1JWGA 1TNYA 4LEUA 4CGWA 1TN8A 3OTNA 3DSVA 2VTBA 1HX8A 1HG2A 5BT1A 4WWOA 3MJWA 4J8YA 4C48B 4AY5A 4EQFA 3ASOE 2YQ8A 4PS7A 2LSVA 1HG5A 3K9IA 4GU5A 2XQ0A 3KEZA 3MV2B 2CHWA 2FF4A 1TR4A 2FULA 3Q73A 3ZIMA 3JXJA 4ILGA 5CCLA 1LD7A 2E0IA 1JWFA 2OVBA 3HVEA 5AIJA 1S70B 3G2WA 4FC8A 4ATGA 4U04A 3MYVA 1FVFA 2HR2A 2C0LA 2XS1A 3ULEG 3SHFA 5AENA 3I4RB 3NF1A 3ASDA 2XZDG 5EIBE 1QYMA 2NYJA 4HLLA 4BT8A 3QWWA 2DWZA 4J8SA 1N4RA 3L13A 2DBAA 1WM5A 3Q49B 1HXIA 5EYLA 3ZN3A 1TNZA 2R5SA 4FJZA 2PQRA 4KZCA 3D9IA 5KJMA 2JEKA 4OAVB 1N95A 2I1KA 3UUXA 2MHKA 4WAFA 3DRAA 2IU1A 2MRIA 5ENOD 4GMLA 3CHSA 2VSXE 4A63B 4B8AA 3ZUVB 2R2LA 2MYOA 4DUIA 4CRWA 4JB8P 1UJKA 5EN5D 3NB2A 2XEVA 4I1AA 1SA5A 1MX4A 1VDYA 3APDA 3ZHEB 3PEVB 1O1TA 2EQXA 4BSZB 5ENTD 1TEZA 4Y6CA 3PZ3A 3OAWA 4U0SA 1INZA 2WXJA 4M7CA 3L22A 2EILE 2IO2C 2XENA 3PZ4A 5KNGA 3IV0A 2AXVA 3AU5A 2VJ8A 4N5QA 4KMOA 4A3TA 4C0MA 3S7BA 1X81A 3PS6A 3RU0A 1FT1A 2XEEA 3QK0A 4UWLA 3JXIA 3BUAA 3UT7A 4W9RA 3FWVA 4HBDA 4LERA 2GRMA 3B7RL 4ACKA 3NOGD 1S0PA 4K0RA 2AWIA 4TUUA 1V54E 2CG2A 4RG6A 3WG7E 2XGOA 4TXRA 1N11A 3FUJA 3QARA 4GCNA 2J08A 4EPZA 1AP7A 1ZB1A 3ZFWA 3APFA 3R9AB 2ONDA 4K5BA 2LAHA 3G2VA 3UKRG 1XNFA 2IONA 4JVSA 5LOZA 1EF1C 4CDNA 4NQ0A 4H7XA 3BU8A 4HXIA 5J08A 3ABLE 2F8YA 2C0MA 3B7TA 4JA9A 4DI3A 3LCAA 1YCSB 4IYPA 3CHQA 3F6QA 4JEUA 3LPZA 5EDSA 4ME2A 5G04J 2HYZA 4XEIG 3ENEA 2CHZA 2P9PG 1OUVA 4I2ZA 4XE0A 1UG3A 3DXMG 3HG0D 5AN8A 2CHXA 4PS8A 2LSUA 1IHGA 4JXTA 2JLBA 1Z6TA 3PUKA 2QFCA 1E90A 2LO6A 2UY1B 3MEKA 4P29A 5FZRA 3T9KA 3D9OA 3OXLA 3E37A 3LEWA 5G05J 3DSXA 3T5XA 1DNPA 3V30A 1DC2A 1OT8A 3B7BA 4OAUC 4YDOA 4O60A 3SD5A 4K03A 2QZAA 3ISMC 3QWPA 4XZ4A 2P9NG 4V3IA 2GRQB 1OY3D 1E8YA 1UN8A 1U3CA 3T5VA 4I9CA 2DZOA 3CKCA 2KZTA 4KYOB 5FINA 1IXVA 4NACA 4AIFA 3DEPA 1K1AA 5JJTA 3CVYA 4F3VA 4GCOA 4DRXE 2QY7A 4FHKA 2Y0BG 4DX1A 4N2SA 5KBAA 1NA3A 1XGWA 4AXHA 2RFMA 4AM9A 3LY9A 1HS6A 2LXMA 3FUNA 2GROB 2CFZA 4GYWA 2ZIRA 5KJNA 3WXXA 3L16A 3Q47B 4UWHA 4B94A 5DBKA 4HRMB 3FUHA 4G23A 5AQ7A 4GTRA 1H2VC 3I5PA 4K5AB 3SFZA 4ILIA 2XS8A 3HIZA 2X6HA 2DVWA 3UT8A 2V0PA 3TWSA 1ELRA 1N4SA 4YDWA 3D9HA 5HKPA 3D9MA 4EZJA 2XZTG 4TRQA 4JHRA 2RKKA 2P9LG 1A17A 5FQ7A 4CGVA 5D66A 2WM9A 2P9SG 1IYGA 3FTZA 1QNFA 4I6EA 1BI8B 2HO1A 3Q15A 4HVBA 4GTMA 5T4YA 3ZEFA 3UMVA 4GA2A 4NIKA 3NQPA 5JJ7A 1RW2A 4MKTA 1K8KG 4L2LA 5BV0A 3P2BA 1YA0A 5AJDA 4IN3B 5EKQD 3AJIA 4XX5A 1MHQA 3E34A 1WG0A 3DSSA 3ZGQA 1H0AA 4A3VA 2VSNA 4UI9C 2YHCA 4HRLA 5KWDA 1TN6A 3RJVA 3S2AA 4J8EA 2NC9A 3PZDA 5FZSA 3HDXA 1B89A 3LVRE 3EHQA 4ABNA 5FTPA 1Z5SC 3SO8A 4CDRA 1KT1A 4WWPA 3EJNA 3EU5A 3DPYA 3Q7AA 1S63A 3PH0C 1FVHA 1TJFA 4Y6WA 4LG6A 2QC9A 2AXUA
chains in the Genus database with same CATH topology
5G2NA 2KCVA 4KVOA 1OWLA 4GMLA 3RO3A 3CHSA 3D9KA 4HOSA 3ZYQA 2CFUA 2AVPA 2VSXE 4BX9A 3U66A 4YNDA 1KT0A 3C98A 4B8AA 3CVNA 3EHMA 4CCAA 1WAO1 3LY7A 4Q69A 2WQHA 4AY6A 2XPZA 5FJYA 4BWRA 4GZDA 1JUQA 2VSYA 3MZLB 4U0UA 3TXMA 5FZQA 4CRWA 4DLOA 4G1TA 3ZRHA 2Y4TA 1UJKA 3CV0A 2VGYA 2J4BA 5EX0A 3R7QA 2XEVA 3CK9A 4I1AA 4B0ZA 4PDXA 4FADA 2WXPA 1VDYA 4JZYA 5FT9A 4PH4B 1HU3A 4Q96A 3PUJA 5D0QD 3APDA 1E8ZA 5KJLA 3ZHEB 3PEVB 2EQXA 2HM8A 4IRUA 2FEZA 3CSFA 3ML9A 1TEZA 2KC7A 4XKCA 4ACLA 3GYZA 5JHBA 4Y6CA 1P5QA 2X38A 3MKQA 4EBAA 5HQ8A 3RRNB 2BF0X 3HHMA 2WXNA 4E6HA 3L17A 4ILHB 4XIFA 4GAAA 4C0EA 5LP0A 3OAWA 4I1OB 4GZ6A 3FULA 2IF4A 4U0SA 1INZA 3IHVA 2WXJA 2NSZA 3JQ1A 3TJPA 3L22A 4G24A 2IJGX 3CK7A 3SZ7A 3D9PA 1ELWA 1SZAA 4L2YA 3RK6A 2ILRA 4JHKA 4FA6A 2IOLA 5C1DA 3I4GA 2XPYA 2WXHA 3IV0A 2AXVA 4YVOA 3VLEA 3AU5A 2VJ8A 3CHMA 4KMOA 4UQZA 4A3TA 5A23A 5BUZA 4XKBA 5A7DB 4C0MA 1UW4B 3S7BA 2VSOE 3PS6A 3D9NA 3FUEA 3RU0A 4NURA 3QK0A 2WXGA 4XI0A 4UWLA 3TAXA 3UPVA 2I2OA 3B13A 3BEEA 4U8HA 5LX8A 3UT7A 4AEZC 3ZYMA 4FULA 4W9RA 3FWVA 3ZYLA 3TXNA 4EECA 4D10C 3SI5A 4HORA 4OVVA 1GW6A 1MQSA 4Q94A 4LERA 2X6KA 3AS5A 3CVQA 1HE8A 2GRMA 3U4TA 3B7RL 5FQ4A 3S7DA 3CIAA 5AYWD 4BY6A 1Y6IA 3QWVA 4J0UA 3QB2A 2I6HA 4HS2A 2FO7A 3SF4A 3AU4A 3U64A 4ACKA 4DLQA 5JHAA 3LDZA 3FTVA 2XCCA 1N52A 3VTYA 4BTAA 2GGFA 4RVBA 4N39A 3SBTB 1S0PA 2R59A 4K0RA 1EYHA 5LCWC 5J90A 2AWIA 4PUCA 4TUUA 3O4ZA 3FP3A 4N3AA 3QKYA 3VLFA 4APOA 3I3NA 4ANWA 5BW8C 2WXLA 2CG2A 2XRYA 2VGXA 4RG6A 4MS6A 3MKQB 2WPVA 2VQ2A 2XGOA 5ARGA 3TGOA 3SNXA 5CHEE 4F7AA 3CVPA 4HOTA 3FUJA 4GZ3A 3ASFA 4UWKA 3PNTB 4BTBA 3QARA 3CVXA 4GCNA 1ZBPA 2J08A 4GYOA 1UJJA 1Y8MA 2ZU6B 4G25A 4EPZA 1PAQA 2PQNA 4JHJA 4C9BB 3MX3A 5KCMA 3VLDA 3QDNA 4WUYA 4ANVA 2PM6A 3G2SA 3HYMB 5FQ6A 5A6CA 3SBSA 3LXUX 3ZFWA 4EBAG 3N71A 3APFA 3R9AB 5HI7A 3OXGA 2UY1A 4ANXA 3ZVVA 1TJCA 2CG3A 2ONDA 2PZIA 3Q4AB 4CT0A 2LAHA 3G2VA 4GYYA 2J07A 4GA0A 1XNFA 2IONA 2XCBA 3DPDA 3FU5A 3FDHA 1EF1C 4GB9A 4JVSA 5LOZA 3URZA 4CDNA 4NQ0A 2X6JA 4H7XA 3AS4A 3IHYA 2FI7A 4GZ5A 1HZ4A 1X5BA 4CDMA 4I9EA 4HXIA 1H2UA 4CT4A 5J08A 3CK8A 1W3BA 3G2UA 3QC1A 4UWFA 2C0MA 3B7TA 4J6IA 4PS3A 4JA9A 2J4DA 4H7YA 3G2TA 4DI3A 3FTSA 3LCAA 4FLBA 4IYPA 3QNKA 4I2WA 4BSXA 3CVUA 4NRHB 3MGBA 2KM4A 1SZ9A 3FUKA 3PVLA 3FUIA 3CHQA 3R7RA 2GW1A 4JEUA 1IQUA 3JCKC 1E8XA 3LPZA 5EDSA 4APFA 2WMNA 2VGXB 2LAIA 3JYSA 3PNLB 4ME2A 5CMYA 4L1BA 5G04J 5CCMA 3FUMA 4GA1A 2HYZA 3FU6A 1LF8A 5AJLA 2WQ6A 1L5JA 3LKUA 4O6FA 1QQEA 4WWNA 3ENEA 2CHZA 3SGHA 1QZ2A 1OUVA 5ENNA 3QJZA 3EIQC 3DBSA 4I2ZA 3FUDA 4M3OA 4XE0A 1UG3A 3T8MA 3O48A 1U3DA 4KZ0A 4EZLA 3ML8A 1E96B 3FH5A 2WXMA 3IKOB 2MOWA 3IBEA 2CHXA 2LSUA 4JXTA 1IHGA 2KATA 2WMOA 2WVIA 4I43A 2DCPA 4PS8A 4CEMA 2JLBA 3FUFA 3FU3A 4UWGA 1Z6TA 2VYIA 3LY8A 3PUKA 3ZYKA 2V5FA 1HO8A 2XGSA 2QFCA 4JC8A 3RKVA 4EZKA 2AXZA 1E90A 4J8DA 2IQCA 2L0IA 2LO6A 5ANLA 2X6IA 2UY1B 2A4ZA 2PM7A 3TL5A 3MEKA 4J8FA 4P29A 3GZ2A 5FZRA 1N54A 2X3MA 3CLJA 4HOQA 3D9OA 3GZ1A 3OXLA 4AOFA 4BX8A 5CMWA 1OWMA 3Q5MA 3LEWA 5G05J 3FTUA 4N2QA 1E8WA 1E7UA 3LS8A 2J09A 3T5XA 1DNPA 4QFVA 5T8IA 3LVQE 3FY4A 2Y3AA 3CVLA 5BNWA 2WQ7A 2XPIA 1ELKA 4FLHA 3L54A 3SD5A 4K03A 3S7JA 1JPLA 3EDTB 3CEQA 3QWPA 4TV3A 4XZ4A 5E76A 5JJ6A 2WXRA 3APCA 3OXFA 3PEUB 4V3IA 4DK5A 1E8YA 4R7LA 3MV3B 4OVUA 1UN8A 4WNFA 3CQGB 1U3CA 3T5VA 3CVWA 4I9CA 3CKCA 4BFRA 2KZTA 3KS2A 4KYOB 3FFLA 4A55A 4NACA 1EPUA 3L08A 5G55A 4BT9A 2GRLA 3RRMB 2I1JA 4AIFA 2IOSA 4F1SA 4JPSA 2J9QA 5LFAA 4B89A 4LCTA 4F53A 3ULQA 1Z3YA 1PY1A 5JJTA 3B7SA 4I1MA 4I6GA 3CVYA 1BPOA 3ONLA 2PL2A 4G11A 3PE4A 4F3VA 2DIWA 3PE3A 4GZCA 3GZSA 3LJ3A 4GCOA 3RIBA 4XI9A 2QY7A 4FHKA 3TG4A 3CVVA 4KXKB 2OOEA 5ANRA 4DI4A 4WNEA 4N2SA 1NA3A 2XHEA 3EIJA 1XGWA 2L9BA 4AXHA 1HF8A 3E4BA 4AM9A 4AVXA 4U63A 4AP2A 2R17C 2V4LA 3CGHA 1NA0A 3PRZA 2I9CA 5KJKA 3IEGA 3LY9A 1HS6A 4L23A 3FUNA 4DJAA 4G2VA 5G04C 3ZW3A 4UI9J 3NZUA 3KAEA 4FU3A 2CFZA 2IFUA 2OVFA 2XGMA 3FTWA 4GMJA 2M63A 4GYWA 3ASHA 4N5CA 3QOUA 4G26A 2L0TB 5KJNA 4GPKA 2YINA 3WXXA 3FTYA 3L16A 3EHNA 4FHJA 3Q47B 1KLXA 1ZU2A 4HOUA 4UQXA 4AV7A 4UWHA 4B94A 5DBKA 1PC2A 3FUHA 1E7VA 4WNDA 4G23A 4RG9A 2WB2A 2WXQA 4U0ZA 1OWPA 2WXKA 3TG5A 4A1SA 1H2VC 3CR3A 3ESKA 3D9LA 4WNGA 4A1GA 3I5PA 2WXFA 4N3CA 3FTXA 3FU0A 4FJYA 4KT6B 4UQYA 3SFZA 5ARFA 4L7TA 2RD0A 3RRUA 4ILIA 4JW1A 1NP7A 3CHPA 3HIZA 2BUGA 2X6HA 5E75A 3UT8A 3BG1B 3FEYA 3L6AA 3PREA 4HFGA 2V0PA 1H2TC 2LNIA 2KZTB 1ELRA 1JWGA 5C2YA 1NZNA 2V8SE 2P58C 2WXOA 1IQRA 2C2LA 2FBNA 5G05C 4LEUA 3ESLA 4N3BA 4IULA 4CGWA 3D9MA 3OTNA 4EZJA 2VTBA 3JQ0A 3ONKA 3BG0B 4HLEA 2KCLA 1HX8A 4JHRA 4TRQA 3GW4A 1HG2A 1A17A 5FQ7A 4CGVA 3PDNA 5BT1A 1EDUA 2WM9A 4DPRA 1IYGA 4WWOA 3MJWA 4LRZA 3FHEA 2XRZA 4AY5A 4FP7A 4JL0A 3FTZA 4EQFA 1QNFA 5BV1A 2Y4UA 4I6EA 4U07A 2YQ8A 4PS7A 2HO1A 2LSVA 1HG5A 3K9IA 4GU5A 3Q15A 4HVBA 2XQ0A 3KEZA 3MV2B 2CHWA 5T4YA 3CSTA 4I6JA 3ZEFA 2FF4A 3UMVA 2NXPA 4GA2A 1HH8A 2FULA 3ZIMA 3RO2A 4ILGA 4JA7A 1WY6A 3NQPA 5JJ7A 2YHEA 4B8CB 2KCKA 3MCXA 3CQCB 3FEXA 3S7FA 5CCLA 2E0IA 1JWFA 2OVBA 2WXIA 3HVEA 1FCHA 5AIJA 3ZXSA 3VTXA 4MKTA 3UX4A 5M72A 4L2LA 5BV0A 1SQMA 4MRUA 4RSYA 3P2BA 1YA0A 3G2WA 4FC8A 5AJDA 3FH7A 4IN3B 4UI9K 5EKQD 4ATGA 4U04A 3MYVA 1FVFA 3UQ3A 4OYSA 2A5UA 2HR2A 1HFAA 3MA5A 1MHQA 4XX5A 2Q7FA 2C0LA 4YVQC 5D0OD 2UWJG 3ZGQA 3SHFA 1DVPA 5DIZA 1H0AA 3FH8A 4A3VA 4AJWA 3CHRA 5AENA 3I4RB 3NF1A 3ASDA 2VSNA 2X6FA 2AW6A 2YHCA 3CKBA 4UI9C 4KVMA 2E2EA 3ZPJA 4BT8A 3CHOA 3QWWA 3QAQA 3RJVA 2VTBB 3S2AA 3P1UA 2BTDA 3D9JA 3ZHEA 4J8EA 4URKA 2NC9A 3PZDA 5BPPA 5FZSA 4J8SA 3B7UX 3HDXA 3L13A 3ASGA 1B89A 2DBAA 5FWQA 4I17A 3LVRE 5EX3A 5FQ8A 3AS8A 2J49A 3UT4A 1WM5A 4ABNA 5FTPA 3Q49B 3D3MA 1H19A 4KBQA 2YNQA 1HXIA 3U3WA 3ZN3A 4CDRA 1KT1A 4WWPA 4MLPA 1OWNA 4JEHA 3EJNA 3NZSA 3JUIA 5T3RA 1OWOA 2R5SA 4E85A 4ANUA 2OV8A 3PH0C 4FJZA 2PQRA 4KZCA 1FVHA 1TJFA 3KD7A 4LUNU 4Y6WA 2L6JA 3D9IA 5KJMA 2JEKA 3MKRA 5LCWJ 3HVEB 2I1KA 3UUXA 2MHKA 2AXUA 1H6KA 4WAFA 1UN9A 1Z3XA 2IU1A 3U9WA 2RG8A 2MRIA 3LYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCV A;  3RO3 A;  4HOS A;  2AVP A;  4YND A;  1KT0 A;  3CVN A;  1WAO 1;  3LY7 A;  2WQH A;  4AY6 A;  5FJY A;  4BWR A;  2VSY A;  4U0U A;  5FZQ A;  4G1T A;  2Y4T A;  3CV0 A;  2VGY A;  5EX0 A;  2XEV A;  3CK9 A;  4I1A A;  5FT9 A;  5D0Q D;  5KJL A;  3ZHE B;  2FEZ A;  2KC7 A;  3GYZ A;  4Y6C A;  1P5Q A;  5HQ8 A;  4XIF A;  4GZ6 A;  4U0S A;  2IF4 A;  4G24 A;  3CK7 A;  3SZ7 A;  1ELW A;  5C1D A;  4YVO A;  4UQZ A;  5A7D B;  3S7B A;  3RU0 A;  4XI0 A;  3TAX A;  3UPV A;  3BEE A;  4W9R A;  3FWV A;  4HOR A;  3AS5 A;  3CVQ A;  3U4T A;  3S7D A;  5AYW D;  3QWV A;  4J0U A;  2I6H A;  2FO7 A;  3SF4 A;  2XCC A;  3VTY A;  4BTA A;  4N39 A;  5LCW C;  3FP3 A;  4N3A A;  3QKY A;  4APO A;  5BW8 C;  2VGX A;  4RG6 A;  2WPV A;  2VQ2 A;  5ARG A;  2XGO A;  3TGO A;  5CHE E;  3CVP A;  4HOT A;  4GZ3 A;  3ASF A;  4BTB A;  4GCN A;  1ZBP A;  4GYO A;  4G25 A;  1Y8M A;  2PQN A;  3QDN A;  4WUY A;  3HYM B;  3ZFW A;  3N71 A;  3R9A B;  5HI7 A;  3OXG A;  2UY1 A;  1TJC A;  2OND A;  2PZI A;  3Q4A B;  4GYY A;  4GA0 A;  1XNF A;  2XCB A;  3URZ A;  4NQ0 A;  4H7X A;  3AS4 A;  2FI7 A;  4GZ5 A;  1HZ4 A;  4I9E A;  3CK8 A;  1W3B A;  2C0M A;  4JA9 A;  4H7Y A;  3LCA A;  4I2W A;  4NRH B;  2GW1 A;  3LPZ A;  2VGX B;  4ME2 A;  3JYS A;  5CCM A;  5G04 J;  4GA1 A;  2HYZ A;  3LKU A;  4O6F A;  1QQE A;  1QZ2 A;  1OUV A;  4I2Z A;  3O48 A;  1E96 B;  2LSU A;  5A6C A;  1IHG A;  2KAT A;  2JLB A;  2VYI A;  3LY8 A;  2V5F A;  2XGS A;  2QFC A;  3RKV A;  4J8D A;  2UY1 B;  3MEK A;  4J8F A;  3GZ2 A;  5FZR A;  4HOQ A;  3GZ1 A;  3OXL A;  3Q5M A;  5G05 J;  4N2Q A;  3CVL A;  5BNW A;  2XPI A;  3S7J A;  3EDT B;  3CEQ A;  3QWP A;  5JJ6 A;  3OXF A;  3MV3 B;  4WNF A;  4I9C A;  3CKC A;  3KS2 A;  4KYO B;  3FFL A;  4BT9 A;  4AIF A;  2J9Q A;  3ULQ A;  5JJT A;  2PL2 A;  3PE4 A;  4F3V A;  3PE3 A;  4GCO A;  3RIB A;  4XI9 A;  3TG4 A;  4KXK B;  2OOE A;  4WNE A;  4N2S A;  1NA3 A;  3E4B A;  4AM9 A;  1NA0 A;  5KJK A;  3IEG A;  3LY9 A;  4G2V A;  5G04 C;  4UI9 J;  3KAE A;  2IFU A;  4N5C A;  2XGM A;  4GYW A;  3ASH A;  3QOU A;  4G26 A;  5KJN A;  4GPK A;  3WXX A;  3Q47 B;  1KLX A;  1ZU2 A;  4HOU A;  4UQX A;  4B94 A;  5DBK A;  1PC2 A;  4WND A;  4G23 A;  4RG9 A;  4U0Z A;  3TG5 A;  4A1S A;  3ESK A;  4WNG A;  4N3C A;  4UQY A;  5ARF A;  2BUG A;  2LNI A;  1ELR A;  1NZN A;  2P58 C;  5G05 C;  2C2L A;  2FBN A;  4LEU A;  4N3B A;  4CGW A;  2KCL A;  4JHR A;  3GW4 A;  1A17 A;  4CGV A;  3PDN A;  5BT1 A;  1IYG A;  4AY5 A;  4JL0 A;  4EQF A;  2Y4U A;  4U07 A;  2YQ8 A;  2HO1 A;  2LSV A;  3K9I A;  3Q15 A;  3MV2 B;  2FF4 A;  4GA2 A;  1HH8 A;  3RO2 A;  4JA7 A;  5JJ7 A;  2KCK A;  5CCL A;  3S7F A;  1FCH A;  3VTX A;  5M72 A;  1YA0 A;  4UI9 K;  4IN3 B;  5EKQ D;  4U04 A;  3UQ3 A;  2HR2 A;  3MA5 A;  2Q7F A;  2C0L A;  4YVQ C;  5D0O D;  2UWJ G;  3ZGQ A;  5DIZ A;  3NF1 A;  3ASD A;  2VSN A;  3CKB A;  2YHC A;  4UI9 C;  2E2E A;  3ZPJ A;  4BT8 A;  3QWW A;  3RJV A;  3ZHE A;  4J8E A;  2NC9 A;  5FZS A;  3ASG A;  1B89 A;  2DBA A;  4I17 A;  5EX3 A;  3AS8 A;  1WM5 A;  4ABN A;  5FTP A;  3Q49 B;  4KBQ A;  3U3W A;  1HXI A;  3ZN3 A;  4CDR A;  1KT1 A;  2R5S A;  2PQR A;  3KD7 A;  4Y6W A;  2L6J A;  5KJM A;  3MKR A;  5LCW J;  3UUX A;  2MHK A;  3LYA A; 
#chains in the Genus database with same CATH topology
 2KCV A;  4KVO A;  2CFU A;  5CRV A;  3U66 A;  4YND A;  4CCA A;  3CVN A;  3EHM A;  1WAO 1;  4Q69 A;  1UOH A;  4AY6 A;  2XPZ A;  4GZD A;  3MZL B;  5FZQ A;  4G1T A;  3KSL A;  3ZRH A;  3HRA A;  2GRN B;  2J4B A;  4FAD A;  4B0Z A;  4HNA D;  4L9P A;  2AJA A;  1IKN D;  3PUJ A;  1E8Z A;  3TWT A;  5AQ9 A;  3ML9 A;  3CSF A;  3DEO A;  4ACL A;  2F37 A;  4Z68 A;  3HXC A;  4E6H A;  3DST A;  3W9G A;  4C0E A;  4GMR A;  5ENP D;  1OCC E;  3JQ1 A;  1BU9 A;  3L82 A;  5B1A E;  3D9P A;  4L2Y A;  3RK6 A;  2ILR A;  5C1D A;  2IOL A;  4YVO A;  2HE0 A;  2FO1 E;  4YDE A;  5BUZ A;  4XKB A;  3TWW A;  2VSO E;  2I2O A;  5LX8 A;  3E33 A;  4AEZ C;  4DX6 D;  3ZYL A;  4HOR A;  1BLX B;  4HI9 A;  4OVV A;  1MQS A;  3AS5 A;  1HE8 A;  5FQ4 A;  3S7D A;  3CIA A;  3QWV A;  3QB2 A;  2I6H A;  2EIK E;  4HS2 A;  2FO7 A;  5H7P A;  3IXE A;  4DLQ A;  5JHA A;  1O1S A;  3LDZ A;  3FTV A;  1N52 A;  4BTA A;  3AAA C;  4N39 A;  3SBT B;  2R59 A;  1EYH A;  5J90 A;  4ATZ D;  3O4Z A;  4ZFH A;  3I3N A;  3R9M A;  2VGX A;  3MKQ B;  5ARG A;  3SNX A;  5CHE E;  3ASF A;  4UWK A;  2B0O E;  4U95 D;  2ZU6 B;  1PAQ A;  2PQN A;  1QBQ A;  1OCZ E;  3MX3 A;  5KCM A;  2PM6 A;  3V2O A;  3LXU X;  4EBA G;  1JCR A;  2ETB A;  4ANX A;  3UM0 A;  3W9F A;  4CT0 A;  2J07 A;  3DSW A;  4GA0 A;  3FU5 A;  3FDH A;  2J8S D;  3X2Q E;  1HZ4 A;  1X5B A;  1N0Q A;  4CT4 A;  2V4H C;  1W3B A;  3CK8 A;  3G2U A;  3QC1 A;  4UWF A;  1DCQ A;  3DSU A;  4PS3 A;  3V79 K;  4H7Y A;  3FTS A;  4FLB A;  1SZ9 A;  3R7R A;  3FUI A;  4HB5 A;  3JCK C;  3T8K A;  1FT2 A;  2WMN A;  4F6R D;  3JYS A;  5CCM A;  3FU6 A;  1LF8 A;  3LKU A;  4O6F A;  4WWN A;  5ENN A;  3RAU A;  3DBS A;  1G3N B;  3KEA A;  4EZL A;  3ML8 A;  3IKO B;  2KAT A;  2DYR E;  4RQI A;  1HO8 A;  3SFY A;  3UXG A;  5EIL A;  4EZK A;  4J8D A;  2X6I A;  3TL5 A;  2A4Z A;  5CRU A;  4J8F A;  3GZ2 A;  2R05 A;  2H6H A;  4HOQ A;  4JD2 G;  5CMW A;  1OWM A;  3Q5M A;  2J09 A;  5T8I A;  2Y3A A;  2IY0 C;  5BNW A;  2XPI A;  3L54 A;  2H6F A;  4X8Q A;  3DWL G;  3EDT B;  3CEQ A;  5JJ6 A;  4DK5 A;  3APC A;  3OXF A;  3UI2 A;  3CQG B;  3KS2 A;  5G55 A;  3L08 A;  2GRL A;  2IOS A;  5AQB A;  2J9Q A;  4B89 A;  4LCT A;  3UIN C;  4TXP A;  1PY1 A;  1Q2Z A;  3ONL A;  2PL2 A;  3PE4 A;  1S64 A;  3GZS A;  3CVV A;  3EIJ A;  4AP2 A;  2R17 C;  2V4L A;  1H6O A;  3EU9 A;  3CGH A;  1TNO A;  2OEW A;  3IEG A;  5ENR D;  4GTT A;  5ITZ F;  2GRR B;  5G04 C;  3ZW3 A;  5AQA A;  5IY5 E;  2XGM A;  3FTW A;  2M63 A;  2BKK B;  3ZNG A;  4G26 A;  4GPK A;  3FTY A;  4UQX A;  2B6C A;  4AV7 A;  1PC2 A;  1E7V A;  2WXF A;  3FTX A;  3FU0 A;  4KT6 B;  4L7T A;  4JW1 A;  2BUG A;  3ABM E;  3C3R A;  5AAO A;  1H2T C;  5C2Y A;  1NZN A;  2QYJ A;  2P58 C;  2WXO A;  5G05 C;  1IQR A;  2C2L A;  2FBN A;  3ESL A;  4N3B A;  4IUL A;  2KCL A;  2ETA A;  3GW4 A;  4GTQ A;  1MZC A;  4LRZ A;  3V2X A;  4JL0 A;  5BV1 A;  2Y4U A;  3ABK E;  4U07 A;  3CST A;  4I6J A;  4QQI A;  2NXP A;  3RO2 A;  4B93 B;  1WY6 A;  2YHE A;  3MCX A;  3CQC B;  2WXI A;  1FCH A;  3ZXS A;  3VTX A;  5JA4 D;  4YDY A;  4U96 D;  2F0Y A;  4RSY A;  2F8X K;  3JUE A;  3FH7 A;  3UQ3 A;  4LSZ E;  2Q7F A;  4YVQ C;  1N9A A;  1JCQ A;  2EIN E;  2UWJ G;  1DVP A;  5DIZ A;  3FH8 A;  4AJW A;  3UM1 A;  4GTO A;  2BKG A;  2AW6 A;  3CKB A;  1MX2 A;  4LNU D;  4KVM A;  2E2E A;  3ZPJ A;  2VTB B;  3D9J A;  3ZHE A;  4URK A;  3ASG A;  5EX3 A;  5FQ8 A;  2J49 A;  4HRN A;  5CEA A;  1H19 A;  4KBQ A;  5T3R A;  1OWO A;  1D8E A;  4U7E B;  4ANU A;  1KPS B;  2OV8 A;  3KD7 A;  3Q7F A;  2P2C P;  3MKR A;  5LCW J;  3HVE B;  3C5R A;  1Z3X A;  3U9W A;  1OWL A;  2R03 A;  1KT0 A;  2WQH A;  5FJY A;  2A5E A;  4U0U A;  3TXM A;  3SFX A;  1JCS A;  2XEH A;  2VGY A;  5EX0 A;  3HXE A;  2BED A;  3CK9 A;  3R7Q A;  3ZKJ A;  2WXP A;  4Q96 A;  3ASN E;  4IRU A;  2FEZ A;  2KC7 A;  4XKC A;  3GYZ A;  5JHB A;  5HQ8 A;  3RRN B;  3L17 A;  4XIF A;  4GAA A;  4I1O B;  4GZ6 A;  3FUL A;  3SQV A;  3AG3 E;  1KZP A;  3TJP A;  4G24 A;  2IJG X;  5CBN A;  3CK7 A;  1SZA A;  4JHK A;  4FA6 A;  2QYU A;  3VLE A;  1TNB A;  3V31 A;  3ZU7 B;  5A7D B;  5HRY A;  3FUE A;  4NUR A;  2WXG A;  1N4Q A;  3UPV A;  3B13 A;  4U8H A;  1RZ4 A;  3ZYM A;  4FUL A;  5CER B;  4TXQ A;  3TXN A;  4EEC A;  4D10 C;  3SI5 A;  3KSQ A;  1GW6 A;  4HI8 A;  4Q94 A;  1D9S A;  3CVQ A;  2V5Q C;  5AYW D;  1Y6I A;  4J0U A;  3AU4 A;  3U64 A;  4RVB A;  4PUC A;  4RLY A;  1DCE A;  4N3A A;  4J7W A;  4G8L A;  4LNB A;  3VLF A;  4APO A;  2WXL A;  2XRY A;  2ZXW E;  1H6P A;  4GYO A;  4G25 A;  2ZGD A;  3HXB A;  4JHJ A;  1TNU A;  3VLD A;  3QDN A;  4ANV A;  3G2S A;  5FQ6 A;  2LUH A;  3PZ2 A;  3SBS A;  3N71 A;  1SVX A;  1N4P A;  5HI7 A;  3OXG A;  1SW6 A;  2UY1 A;  5EYP F;  4F1P A;  3Q4A B;  2KXP C;  4GYY A;  4GPM A;  2XCB A;  3DPD A;  4GB9 A;  3URZ A;  3IHY A;  4GZ5 A;  4I9E A;  4GTP A;  4J6I A;  1MJ0 A;  2H6I A;  2J4D A;  5AAR A;  4I2W A;  3CVU A;  3PVL A;  2GW1 A;  1IQU A;  1E8X A;  2LAI A;  3PNL B;  5CMY A;  3C3O A;  3SY2 A;  3FUM A;  5KNH D;  1L5J A;  3UIP C;  1QQE A;  1K3Z D;  2Y1L E;  3FUD A;  4M3O A;  3O48 A;  1U3D A;  3FH5 A;  2MOW A;  3IBE A;  4K5C A;  2LXL A;  4CEM A;  3FU3 A;  3ZYK A;  2V5F A;  4JC8 A;  5BXU A;  2PM7 A;  2JAB A;  5D2M C;  1N54 A;  3NAW A;  4G8K A;  3FTU A;  4DX2 A;  4N2Q A;  1E7U A;  3LS8 A;  3UKU G;  2PNN A;  3LVQ E;  3FY4 A;  2ZGG A;  3CVL A;  2WQ7 A;  1ELK A;  2R02 A;  4GTV A;  3S7J A;  1JPL A;  3L9T A;  4EHM A;  4TV3 A;  5E76 A;  2WXR A;  1NL4 A;  3J5P A;  4OVU A;  4WNF A;  4BFR A;  3FFL A;  4A55 A;  1EPU A;  3TWQ A;  4BT9 A;  4F1S A;  5LFA A;  3ULQ A;  3UIO C;  1Z3Y A;  3B7S A;  1BPO A;  1IHB A;  3PE3 A;  1LD8 A;  4ZHB A;  3RIB A;  5B1B E;  3TG4 A;  2RFA A;  3BQO A;  5ANR A;  2XHE A;  2L9B A;  1U2V G;  3E4B A;  1OXJ A;  4L23 A;  4DJA A;  4G2V A;  3NZU A;  2P9I G;  3KAE A;  2OVF A;  3EUV A;  4GMJ A;  3ASH A;  3QOU A;  1LTX A;  1D8D A;  2YIN A;  4MBG A;  4FHJ A;  1KLX A;  1ZU2 A;  4HOU A;  3ULY A;  5B3S E;  3Q78 A;  2KBX A;  4RG9 A;  2WXQ A;  4U0Z A;  1OWP A;  2WXK A;  3D9L A;  5CBO A;  4N3C A;  1SA4 A;  4TUM A;  3RRU A;  5HS0 A;  5ENS D;  3CHP A;  3NOC D;  5FIO A;  3BG1 B;  3FEY A;  3PRE A;  2LNI A;  2KZT B;  2V8S E;  2H6G A;  3EHR A;  3PZ1 A;  3JQ0 A;  3ONK A;  3BG0 B;  4HLE A;  3PDN A;  1EDU A;  4DPR A;  3FHE A;  2XRZ A;  3UM2 A;  4FP7 A;  1WDY A;  4O1P A;  5CEC B;  1HH8 A;  4JA7 A;  2IEJ A;  4B8C B;  2KCK A;  3FEX A;  3S7F A;  3UX4 A;  5M72 A;  1SQM A;  4MRU A;  2EIM E;  4UI9 K;  1OCO E;  1TN7 A;  4OYS A;  2A5U A;  1HFA A;  3MA5 A;  5D0O D;  3CHR A;  3TWR A;  2X6F A;  3CHO A;  3QAQ A;  3P1U A;  5JMN D;  2BTD A;  3TWU A;  5BPP A;  3B7U X;  5FWQ A;  4I17 A;  3AS8 A;  3UT4 A;  3D3M A;  3U3W A;  2YNQ A;  4HQD A;  1OWN A;  4JEH A;  4MLP A;  3NZS A;  3JUI A;  1FPP A;  4E85 A;  1MX6 A;  4LUN U;  3C3Q A;  2L6J A;  2OCC E;  1H6K A;  1UN9 A;  2RG8 A;  3LYA A;  3HXF A;  5G2N A;  3UTM A;  3RO3 A;  3D9K A;  4HOS A;  3ZYQ A;  2AVP A;  4BX9 A;  3TWV A;  3C98 A;  3LY7 A;  4U8V D;  4BWR A;  4UUC A;  1JUQ A;  1NFI E;  2VSY A;  4DLO A;  2Y4T A;  3CV0 A;  4PDX A;  2EIJ E;  5FT9 A;  4JZY A;  2GRP B;  4PH4 B;  1HU3 A;  1K1B A;  5D0Q D;  1V55 E;  5KJL A;  4BET A;  2HM8 A;  5CED B;  1P5Q A;  2X38 A;  3MKQ A;  4EBA A;  2BF0 X;  3HHM A;  2WXN A;  4ILH B;  5LP0 A;  2OEV A;  1MYO A;  1OCR E;  2IF4 A;  3IHV A;  4BER A;  2NSZ A;  3SZ7 A;  1ELW A;  2ETC A;  3I4G A;  2XPY A;  2WXH A;  3CHM A;  4UQZ A;  5A23 A;  5BXO A;  1UW4 B;  3NBN B;  3D9N A;  3E32 A;  4XI0 A;  3TAX A;  3BEE A;  3Q79 A;  2X6K A;  2P9U G;  3U4T A;  4BY6 A;  1O1R A;  3Q9U C;  3SF4 A;  2XCC A;  3VTY A;  4BEP A;  2GGF A;  5LCW C;  3FP3 A;  3QKY A;  4ANW A;  5BW8 C;  4MS6 A;  1BI7 B;  1A5E A;  2VQ2 A;  2WPV A;  3TGO A;  4F7A A;  1AWC B;  3CVP A;  4HOT A;  4GZ3 A;  2P9K G;  3PNT B;  4BTB A;  2VGE A;  3CVX A;  1ZBP A;  1UJJ A;  1Y8M A;  3UM3 A;  3B95 A;  4C9B B;  1YYH A;  4WUY A;  3RSE G;  3HYM B;  5EID A;  2DYS E;  2ZIS A;  3ZVV A;  1TJC A;  2CG3 A;  2PZI A;  2X6J A;  3AS4 A;  3AG1 E;  2FI7 A;  4CDM A;  1H2U A;  3G2T A;  3AG2 E;  4BSX A;  3QNK A;  4NRH B;  3MGB A;  2KM4 A;  3FUK A;  5ENQ D;  2DZN A;  4APF A;  2VGX B;  4GTS A;  4L1B A;  4GA1 A;  5AJL A;  2WQ6 A;  4U8Y D;  3SGH A;  1QZ2 A;  3QJZ A;  3EIQ C;  3HXD A;  1NI1 A;  3T8M A;  4KZ0 A;  1E96 B;  1N0R A;  2WXM A;  5A6C A;  4I43 A;  2WMO A;  2WVI A;  2DCP A;  3FUF A;  4UWG A;  2VYI A;  3LY8 A;  3TWX A;  2XGS A;  3RKV A;  2Y69 E;  2AXZ A;  2IQC A;  2L0I A;  5ANL A;  2X3M A;  3CLJ A;  3GZ1 A;  1N94 A;  4AOF A;  3AG4 E;  4BX8 A;  3Q75 A;  1E8W A;  4QFV A;  4FLH A;  4O1O A;  1BD8 A;  4CYM D;  3PEU B;  4R7L A;  1KZO A;  3MV3 B;  2L6B A;  3CVW A;  3Q9N C;  3C72 A;  3RRM B;  2I1J A;  4JPS A;  3J5Q B;  4F53 A;  3LJN A;  4I1M A;  4I6G A;  4G11 A;  2DIW A;  4GZC A;  3LJ3 A;  1TYQ G;  4XI9 A;  4KXK B;  2OOE A;  4CZ2 D;  4WNE A;  4DI4 A;  1HF8 A;  4AVX A;  4U63 A;  4DX7 D;  3PRZ A;  1NA0 A;  5KJK A;  2I9C A;  4LNG A;  3E30 A;  4UI9 J;  4BES A;  4FU3 A;  4N5C A;  2IFU A;  2L0T B;  1O5M A;  4DX5 D;  3DXK G;  3EHN A;  3ZXP A;  2IO3 C;  4WND A;  2WB2 A;  3TG5 A;  4A1S A;  3CR3 A;  4A1G A;  3ESK A;  4WNG A;  4FJY A;  4UQY A;  5ARF A;  2RD0 A;  1NP7 A;  5E75 A;  3L6A A;  4HFG A;  1YMP A;  1JWG A;  1TNY A;  4LEU A;  4CGW A;  1TN8 A;  3OTN A;  3DSV A;  2VTB A;  1HX8 A;  1HG2 A;  5BT1 A;  4WWO A;  3MJW A;  4J8Y A;  4C48 B;  4AY5 A;  4EQF A;  3ASO E;  2YQ8 A;  4PS7 A;  2LSV A;  1HG5 A;  3K9I A;  4GU5 A;  2XQ0 A;  3KEZ A;  3MV2 B;  2CHW A;  2FF4 A;  1TR4 A;  2FUL A;  3Q73 A;  3ZIM A;  3JXJ A;  4ILG A;  5CCL A;  1LD7 A;  2E0I A;  1JWF A;  2OVB A;  3HVE A;  5AIJ A;  1S70 B;  3G2W A;  4FC8 A;  4ATG A;  4U04 A;  3MYV A;  1FVF A;  2HR2 A;  2C0L A;  2XS1 A;  3ULE G;  3SHF A;  5AEN A;  3I4R B;  3NF1 A;  3ASD A;  2XZD G;  5EIB E;  1QYM A;  2NYJ A;  4HLL A;  4BT8 A;  3QWW A;  2DWZ A;  4J8S A;  1N4R A;  3L13 A;  2DBA A;  1WM5 A;  3Q49 B;  1HXI A;  5EYL A;  3ZN3 A;  1TNZ A;  2R5S A;  4FJZ A;  2PQR A;  4KZC A;  3D9I A;  5KJM A;  2JEK A;  4OAV B;  1N95 A;  2I1K A;  3UUX A;  2MHK A;  4WAF A;  3DRA A;  2IU1 A;  2MRI A;  5ENO D;  4GML A;  3CHS A;  2VSX E;  4A63 B;  4B8A A;  3ZUV B;  2R2L A;  2MYO A;  4DUI A;  4CRW A;  4JB8 P;  1UJK A;  5EN5 D;  3NB2 A;  2XEV A;  4I1A A;  1SA5 A;  1MX4 A;  1VDY A;  3APD A;  3ZHE B;  3PEV B;  1O1T A;  2EQX A;  4BSZ B;  5ENT D;  1TEZ A;  4Y6C A;  3PZ3 A;  3OAW A;  4U0S A;  1INZ A;  2WXJ A;  4M7C A;  3L22 A;  2EIL E;  2IO2 C;  2XEN A;  3PZ4 A;  5KNG A;  3IV0 A;  2AXV A;  3AU5 A;  2VJ8 A;  4N5Q A;  4KMO A;  4A3T A;  4C0M A;  3S7B A;  1X81 A;  3PS6 A;  3RU0 A;  1FT1 A;  2XEE A;  3QK0 A;  4UWL A;  3JXI A;  3BUA A;  3UT7 A;  4W9R A;  3FWV A;  4HBD A;  4LER A;  2GRM A;  3B7R L;  4ACK A;  3NOG D;  1S0P A;  4K0R A;  2AWI A;  4TUU A;  1V54 E;  2CG2 A;  4RG6 A;  3WG7 E;  2XGO A;  4TXR A;  1N11 A;  3FUJ A;  3QAR A;  4GCN A;  2J08 A;  4EPZ A;  1AP7 A;  1ZB1 A;  3ZFW A;  3APF A;  3R9A B;  2OND A;  4K5B A;  2LAH A;  3G2V A;  3UKR G;  1XNF A;  2ION A;  4JVS A;  5LOZ A;  1EF1 C;  4CDN A;  4NQ0 A;  4H7X A;  3BU8 A;  4HXI A;  5J08 A;  3ABL E;  2F8Y A;  2C0M A;  3B7T A;  4JA9 A;  4DI3 A;  3LCA A;  1YCS B;  4IYP A;  3CHQ A;  3F6Q A;  4JEU A;  3LPZ A;  5EDS A;  4ME2 A;  5G04 J;  2HYZ A;  4XEI G;  3ENE A;  2CHZ A;  2P9P G;  1OUV A;  4I2Z A;  4XE0 A;  1UG3 A;  3DXM G;  3HG0 D;  5AN8 A;  2CHX A;  4PS8 A;  2LSU A;  1IHG A;  4JXT A;  2JLB A;  1Z6T A;  3PUK A;  2QFC A;  1E90 A;  2LO6 A;  2UY1 B;  3MEK A;  4P29 A;  5FZR A;  3T9K A;  3D9O A;  3OXL A;  3E37 A;  3LEW A;  5G05 J;  3DSX A;  3T5X A;  1DNP A;  3V30 A;  1DC2 A;  1OT8 A;  3B7B A;  4OAU C;  4YDO A;  4O60 A;  3SD5 A;  4K03 A;  2QZA A;  3ISM C;  3QWP A;  4XZ4 A;  2P9N G;  4V3I A;  2GRQ B;  1OY3 D;  1E8Y A;  1UN8 A;  1U3C A;  3T5V A;  4I9C A;  2DZO A;  3CKC A;  2KZT A;  4KYO B;  5FIN A;  1IXV A;  4NAC A;  4AIF A;  3DEP A;  1K1A A;  5JJT A;  3CVY A;  4F3V A;  4GCO A;  4DRX E;  2QY7 A;  4FHK A;  2Y0B G;  4DX1 A;  4N2S A;  5KBA A;  1NA3 A;  1XGW A;  4AXH A;  2RFM A;  4AM9 A;  3LY9 A;  1HS6 A;  2LXM A;  3FUN A;  2GRO B;  2CFZ A;  4GYW A;  2ZIR A;  5KJN A;  3WXX A;  3L16 A;  3Q47 B;  4UWH A;  4B94 A;  5DBK A;  4HRM B;  3FUH A;  4G23 A;  5AQ7 A;  4GTR A;  1H2V C;  3I5P A;  4K5A B;  3SFZ A;  4ILI A;  2XS8 A;  3HIZ A;  2X6H A;  2DVW A;  3UT8 A;  2V0P A;  3TWS A;  1ELR A;  1N4S A;  4YDW A;  3D9H A;  5HKP A;  3D9M A;  4EZJ A;  2XZT G;  4TRQ A;  4JHR A;  2RKK A;  2P9L G;  1A17 A;  5FQ7 A;  4CGV A;  5D66 A;  2WM9 A;  2P9S G;  1IYG A;  3FTZ A;  1QNF A;  4I6E A;  1BI8 B;  2HO1 A;  3Q15 A;  4HVB A;  4GTM A;  5T4Y A;  3ZEF A;  3UMV A;  4GA2 A;  4NIK A;  3NQP A;  5JJ7 A;  1RW2 A;  4MKT A;  1K8K G;  4L2L A;  5BV0 A;  3P2B A;  1YA0 A;  5AJD A;  4IN3 B;  5EKQ D;  3AJI A;  4XX5 A;  1MHQ A;  3E34 A;  1WG0 A;  3DSS A;  3ZGQ A;  1H0A A;  4A3V A;  2VSN A;  4UI9 C;  2YHC A;  4HRL A;  5KWD A;  1TN6 A;  3RJV A;  3S2A A;  4J8E A;  2NC9 A;  3PZD A;  5FZS A;  3HDX A;  1B89 A;  3LVR E;  3EHQ A;  4ABN A;  5FTP A;  1Z5S C;  3SO8 A;  4CDR A;  1KT1 A;  4WWP A;  3EJN A;  3EU5 A;  3DPY A;  3Q7A A;  1S63 A;  3PH0 C;  1FVH A;  1TJF A;  4Y6W A;  4LG6 A;  2QC9 A;  2AXU A; 
#chains in the Genus database with same CATH homology
 5G2N A;  2KCV A;  4KVO A;  1OWL A;  4GML A;  3RO3 A;  3CHS A;  3D9K A;  4HOS A;  3ZYQ A;  2CFU A;  2AVP A;  2VSX E;  4BX9 A;  3U66 A;  4YND A;  1KT0 A;  3C98 A;  4B8A A;  3CVN A;  3EHM A;  4CCA A;  1WAO 1;  3LY7 A;  4Q69 A;  2WQH A;  4AY6 A;  2XPZ A;  5FJY A;  4BWR A;  4GZD A;  1JUQ A;  2VSY A;  3MZL B;  4U0U A;  3TXM A;  5FZQ A;  4CRW A;  4DLO A;  4G1T A;  3ZRH A;  2Y4T A;  1UJK A;  3CV0 A;  2VGY A;  2J4B A;  5EX0 A;  3R7Q A;  2XEV A;  3CK9 A;  4I1A A;  4B0Z A;  4PDX A;  4FAD A;  2WXP A;  1VDY A;  4JZY A;  5FT9 A;  4PH4 B;  1HU3 A;  4Q96 A;  3PUJ A;  5D0Q D;  3APD A;  1E8Z A;  5KJL A;  3ZHE B;  3PEV B;  2EQX A;  2HM8 A;  4IRU A;  2FEZ A;  3CSF A;  3ML9 A;  1TEZ A;  2KC7 A;  4XKC A;  4ACL A;  3GYZ A;  5JHB A;  4Y6C A;  1P5Q A;  2X38 A;  3MKQ A;  4EBA A;  5HQ8 A;  3RRN B;  2BF0 X;  3HHM A;  2WXN A;  4E6H A;  3L17 A;  4ILH B;  4XIF A;  4GAA A;  4C0E A;  5LP0 A;  3OAW A;  4I1O B;  4GZ6 A;  3FUL A;  2IF4 A;  4U0S A;  1INZ A;  3IHV A;  2WXJ A;  2NSZ A;  3JQ1 A;  3TJP A;  3L22 A;  4G24 A;  2IJG X;  3CK7 A;  3SZ7 A;  3D9P A;  1ELW A;  1SZA A;  4L2Y A;  3RK6 A;  2ILR A;  4JHK A;  4FA6 A;  2IOL A;  5C1D A;  3I4G A;  2XPY A;  2WXH A;  3IV0 A;  2AXV A;  4YVO A;  3VLE A;  3AU5 A;  2VJ8 A;  3CHM A;  4KMO A;  4UQZ A;  4A3T A;  5A23 A;  5BUZ A;  4XKB A;  5A7D B;  4C0M A;  1UW4 B;  3S7B A;  2VSO E;  3PS6 A;  3D9N A;  3FUE A;  3RU0 A;  4NUR A;  3QK0 A;  2WXG A;  4XI0 A;  4UWL A;  3TAX A;  3UPV A;  2I2O A;  3B13 A;  3BEE A;  4U8H A;  5LX8 A;  3UT7 A;  4AEZ C;  3ZYM A;  4FUL A;  4W9R A;  3FWV A;  3ZYL A;  3TXN A;  4EEC A;  4D10 C;  3SI5 A;  4HOR A;  4OVV A;  1GW6 A;  1MQS A;  4Q94 A;  4LER A;  2X6K A;  3AS5 A;  3CVQ A;  1HE8 A;  2GRM A;  3U4T A;  3B7R L;  5FQ4 A;  3S7D A;  3CIA A;  5AYW D;  4BY6 A;  1Y6I A;  3QWV A;  4J0U A;  3QB2 A;  2I6H A;  4HS2 A;  2FO7 A;  3SF4 A;  3AU4 A;  3U64 A;  4ACK A;  4DLQ A;  5JHA A;  3LDZ A;  3FTV A;  2XCC A;  1N52 A;  3VTY A;  4BTA A;  2GGF A;  4RVB A;  4N39 A;  3SBT B;  1S0P A;  2R59 A;  4K0R A;  1EYH A;  5LCW C;  5J90 A;  2AWI A;  4PUC A;  4TUU A;  3O4Z A;  3FP3 A;  4N3A A;  3QKY A;  3VLF A;  4APO A;  3I3N A;  4ANW A;  5BW8 C;  2WXL A;  2CG2 A;  2XRY A;  2VGX A;  4RG6 A;  4MS6 A;  3MKQ B;  2WPV A;  2VQ2 A;  2XGO A;  5ARG A;  3TGO A;  3SNX A;  5CHE E;  4F7A A;  3CVP A;  4HOT A;  3FUJ A;  4GZ3 A;  3ASF A;  4UWK A;  3PNT B;  4BTB A;  3QAR A;  3CVX A;  4GCN A;  1ZBP A;  2J08 A;  4GYO A;  1UJJ A;  1Y8M A;  2ZU6 B;  4G25 A;  4EPZ A;  1PAQ A;  2PQN A;  4JHJ A;  4C9B B;  3MX3 A;  5KCM A;  3VLD A;  3QDN A;  4WUY A;  4ANV A;  2PM6 A;  3G2S A;  3HYM B;  5FQ6 A;  5A6C A;  3SBS A;  3LXU X;  3ZFW A;  4EBA G;  3N71 A;  3APF A;  3R9A B;  5HI7 A;  3OXG A;  2UY1 A;  4ANX A;  3ZVV A;  1TJC A;  2CG3 A;  2OND A;  2PZI A;  3Q4A B;  4CT0 A;  2LAH A;  3G2V A;  4GYY A;  2J07 A;  4GA0 A;  1XNF A;  2ION A;  2XCB A;  3DPD A;  3FU5 A;  3FDH A;  1EF1 C;  4GB9 A;  4JVS A;  5LOZ A;  3URZ A;  4CDN A;  4NQ0 A;  2X6J A;  4H7X A;  3AS4 A;  3IHY A;  2FI7 A;  4GZ5 A;  1HZ4 A;  1X5B A;  4CDM A;  4I9E A;  4HXI A;  1H2U A;  4CT4 A;  5J08 A;  3CK8 A;  1W3B A;  3G2U A;  3QC1 A;  4UWF A;  2C0M A;  3B7T A;  4J6I A;  4PS3 A;  4JA9 A;  2J4D A;  4H7Y A;  3G2T A;  4DI3 A;  3FTS A;  3LCA A;  4FLB A;  4IYP A;  3QNK A;  4I2W A;  4BSX A;  3CVU A;  4NRH B;  3MGB A;  2KM4 A;  1SZ9 A;  3FUK A;  3PVL A;  3FUI A;  3CHQ A;  3R7R A;  2GW1 A;  4JEU A;  1IQU A;  3JCK C;  1E8X A;  3LPZ A;  5EDS A;  4APF A;  2WMN A;  2VGX B;  2LAI A;  3JYS A;  3PNL B;  4ME2 A;  5CMY A;  4L1B A;  5G04 J;  5CCM A;  3FUM A;  4GA1 A;  2HYZ A;  3FU6 A;  1LF8 A;  5AJL A;  2WQ6 A;  1L5J A;  3LKU A;  4O6F A;  1QQE A;  4WWN A;  3ENE A;  2CHZ A;  3SGH A;  1QZ2 A;  1OUV A;  5ENN A;  3QJZ A;  3EIQ C;  3DBS A;  4I2Z A;  3FUD A;  4M3O A;  4XE0 A;  1UG3 A;  3T8M A;  3O48 A;  1U3D A;  4KZ0 A;  4EZL A;  3ML8 A;  1E96 B;  3FH5 A;  2WXM A;  3IKO B;  2MOW A;  3IBE A;  2CHX A;  2LSU A;  4JXT A;  1IHG A;  2KAT A;  2WMO A;  2WVI A;  4I43 A;  2DCP A;  4PS8 A;  4CEM A;  2JLB A;  3FUF A;  3FU3 A;  4UWG A;  1Z6T A;  2VYI A;  3LY8 A;  3PUK A;  3ZYK A;  2V5F A;  1HO8 A;  2XGS A;  2QFC A;  4JC8 A;  3RKV A;  4EZK A;  2AXZ A;  1E90 A;  4J8D A;  2IQC A;  2L0I A;  2LO6 A;  5ANL A;  2X6I A;  2UY1 B;  2A4Z A;  2PM7 A;  3TL5 A;  3MEK A;  4J8F A;  4P29 A;  3GZ2 A;  5FZR A;  1N54 A;  2X3M A;  3CLJ A;  4HOQ A;  3D9O A;  3GZ1 A;  3OXL A;  4AOF A;  4BX8 A;  5CMW A;  1OWM A;  3Q5M A;  3LEW A;  5G05 J;  3FTU A;  4N2Q A;  1E8W A;  1E7U A;  3LS8 A;  2J09 A;  3T5X A;  1DNP A;  4QFV A;  5T8I A;  3LVQ E;  3FY4 A;  2Y3A A;  3CVL A;  5BNW A;  2WQ7 A;  2XPI A;  1ELK A;  4FLH A;  3L54 A;  3SD5 A;  4K03 A;  3S7J A;  1JPL A;  3EDT B;  3CEQ A;  3QWP A;  4TV3 A;  4XZ4 A;  5E76 A;  5JJ6 A;  2WXR A;  3APC A;  3OXF A;  3PEU B;  4V3I A;  4DK5 A;  1E8Y A;  4R7L A;  3MV3 B;  4OVU A;  1UN8 A;  4WNF A;  3CQG B;  1U3C A;  3T5V A;  3CVW A;  4I9C A;  3CKC A;  4BFR A;  2KZT A;  3KS2 A;  4KYO B;  3FFL A;  4A55 A;  4NAC A;  1EPU A;  3L08 A;  5G55 A;  4BT9 A;  2GRL A;  3RRM B;  2I1J A;  4AIF A;  2IOS A;  4F1S A;  4JPS A;  2J9Q A;  5LFA A;  4B89 A;  4LCT A;  4F53 A;  3ULQ A;  1Z3Y A;  1PY1 A;  5JJT A;  3B7S A;  4I1M A;  4I6G A;  3CVY A;  1BPO A;  3ONL A;  2PL2 A;  4G11 A;  3PE4 A;  4F3V A;  2DIW A;  3PE3 A;  4GZC A;  3GZS A;  3LJ3 A;  4GCO A;  3RIB A;  4XI9 A;  2QY7 A;  4FHK A;  3TG4 A;  3CVV A;  4KXK B;  2OOE A;  5ANR A;  4DI4 A;  4WNE A;  4N2S A;  1NA3 A;  2XHE A;  3EIJ A;  1XGW A;  2L9B A;  4AXH A;  1HF8 A;  3E4B A;  4AM9 A;  4AVX A;  4U63 A;  4AP2 A;  2R17 C;  2V4L A;  3CGH A;  1NA0 A;  3PRZ A;  2I9C A;  5KJK A;  3IEG A;  3LY9 A;  1HS6 A;  4L23 A;  3FUN A;  4DJA A;  4G2V A;  5G04 C;  3ZW3 A;  4UI9 J;  3NZU A;  3KAE A;  4FU3 A;  2CFZ A;  2IFU A;  2OVF A;  2XGM A;  3FTW A;  4GMJ A;  2M63 A;  4GYW A;  3ASH A;  4N5C A;  3QOU A;  4G26 A;  2L0T B;  5KJN A;  4GPK A;  2YIN A;  3WXX A;  3FTY A;  3L16 A;  3EHN A;  4FHJ A;  3Q47 B;  1KLX A;  1ZU2 A;  4HOU A;  4UQX A;  4AV7 A;  4UWH A;  4B94 A;  5DBK A;  1PC2 A;  3FUH A;  1E7V A;  4WND A;  4G23 A;  4RG9 A;  2WB2 A;  2WXQ A;  4U0Z A;  1OWP A;  2WXK A;  3TG5 A;  4A1S A;  1H2V C;  3CR3 A;  3ESK A;  3D9L A;  4WNG A;  4A1G A;  3I5P A;  2WXF A;  4N3C A;  3FTX A;  3FU0 A;  4FJY A;  4KT6 B;  4UQY A;  3SFZ A;  5ARF A;  4L7T A;  2RD0 A;  3RRU A;  4ILI A;  4JW1 A;  1NP7 A;  3CHP A;  3HIZ A;  2BUG A;  2X6H A;  5E75 A;  3UT8 A;  3BG1 B;  3FEY A;  3L6A A;  3PRE A;  4HFG A;  2V0P A;  1H2T C;  2LNI A;  2KZT B;  1ELR A;  1JWG A;  5C2Y A;  1NZN A;  2V8S E;  2P58 C;  2WXO A;  1IQR A;  2C2L A;  2FBN A;  5G05 C;  4LEU A;  3ESL A;  4N3B A;  4IUL A;  4CGW A;  3D9M A;  3OTN A;  4EZJ A;  2VTB A;  3JQ0 A;  3ONK A;  3BG0 B;  4HLE A;  2KCL A;  1HX8 A;  4JHR A;  4TRQ A;  3GW4 A;  1HG2 A;  1A17 A;  5FQ7 A;  4CGV A;  3PDN A;  5BT1 A;  1EDU A;  2WM9 A;  4DPR A;  1IYG A;  4WWO A;  3MJW A;  4LRZ A;  3FHE A;  2XRZ A;  4AY5 A;  4FP7 A;  4JL0 A;  3FTZ A;  4EQF A;  1QNF A;  5BV1 A;  2Y4U A;  4I6E A;  4U07 A;  2YQ8 A;  4PS7 A;  2HO1 A;  2LSV A;  1HG5 A;  3K9I A;  4GU5 A;  3Q15 A;  4HVB A;  2XQ0 A;  3KEZ A;  3MV2 B;  2CHW A;  5T4Y A;  3CST A;  4I6J A;  3ZEF A;  2FF4 A;  3UMV A;  2NXP A;  4GA2 A;  1HH8 A;  2FUL A;  3ZIM A;  3RO2 A;  4ILG A;  4JA7 A;  1WY6 A;  3NQP A;  5JJ7 A;  2YHE A;  4B8C B;  2KCK A;  3MCX A;  3CQC B;  3FEX A;  3S7F A;  5CCL A;  2E0I A;  1JWF A;  2OVB A;  2WXI A;  3HVE A;  1FCH A;  5AIJ A;  3ZXS A;  3VTX A;  4MKT A;  3UX4 A;  5M72 A;  4L2L A;  5BV0 A;  1SQM A;  4MRU A;  4RSY A;  3P2B A;  1YA0 A;  3G2W A;  4FC8 A;  5AJD A;  3FH7 A;  4IN3 B;  4UI9 K;  5EKQ D;  4ATG A;  4U04 A;  3MYV A;  1FVF A;  3UQ3 A;  4OYS A;  2A5U A;  2HR2 A;  1HFA A;  3MA5 A;  1MHQ A;  4XX5 A;  2Q7F A;  2C0L A;  4YVQ C;  5D0O D;  2UWJ G;  3ZGQ A;  3SHF A;  1DVP A;  5DIZ A;  1H0A A;  3FH8 A;  4A3V A;  4AJW A;  3CHR A;  5AEN A;  3I4R B;  3NF1 A;  3ASD A;  2VSN A;  2X6F A;  2AW6 A;  2YHC A;  3CKB A;  4UI9 C;  4KVM A;  2E2E A;  3ZPJ A;  4BT8 A;  3CHO A;  3QWW A;  3QAQ A;  3RJV A;  2VTB B;  3S2A A;  3P1U A;  2BTD A;  3D9J A;  3ZHE A;  4J8E A;  4URK A;  2NC9 A;  3PZD A;  5BPP A;  5FZS A;  4J8S A;  3B7U X;  3HDX A;  3L13 A;  3ASG A;  1B89 A;  2DBA A;  5FWQ A;  4I17 A;  3LVR E;  5EX3 A;  5FQ8 A;  3AS8 A;  2J49 A;  3UT4 A;  1WM5 A;  4ABN A;  5FTP A;  3Q49 B;  3D3M A;  1H19 A;  4KBQ A;  2YNQ A;  1HXI A;  3U3W A;  3ZN3 A;  4CDR A;  1KT1 A;  4WWP A;  4MLP A;  1OWN A;  4JEH A;  3EJN A;  3NZS A;  3JUI A;  5T3R A;  1OWO A;  2R5S A;  4E85 A;  4ANU A;  2OV8 A;  3PH0 C;  4FJZ A;  2PQR A;  4KZC A;  1FVH A;  1TJF A;  3KD7 A;  4LUN U;  4Y6W A;  2L6J A;  3D9I A;  5KJM A;  2JEK A;  3MKR A;  5LCW J;  3HVE B;  2I1K A;  3UUX A;  2MHK A;  2AXU A;  1H6K A;  4WAF A;  1UN9 A;  1Z3X A;  2IU1 A;  3U9W A;  2RG8 A;  2MRI A;  3LYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...