1HXIA

An unexpected extended conformation for the third tpr motif of the peroxin pex5 from trypanosoma brucei
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
112
structure length
112
Chain Sequence
NNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
publication title An unexpected extended conformation for the third TPR motif of the peroxin PEX5 from Trypanosoma brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 39
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2001-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hxiA00
3CK7A 2XCBA 4GCNA 1YA0A 4NQ0A 2UY1B 3Q49B 2I6HA 4I2ZA 4JHRA 4U0UA 2FEZA 2C0MA 4I17A 3N71A 2GW1A 4RG9A 3SZ7A 4H7YA 2NC9A 3GZ2A 1ZU2A 2P58C 4GA0A 4GA2A 4GA1A 3LKUA 3Q47B 4U04A 2KC7A 2OOEA 2PQRA 1IHGA 5ARGA 4GYWA 3ZHEB 2VSYA 4UQZA 3VTXA 4AY6A 3WXXA 5CCMA 1TJCA 4GPKA 5FTPA 3ZPJA 3U3WA 3CVQA 5KJKA 3TG5A 3LY7A 4J0UA 1NZNA 4WNGA 3CKCA 4XI9A 4N5CA 4HOSA 5FZQA 3OXFA 5LCWC 3RU0A 4AIFA 4JA7A 5KJNA 3RO3A 5EKQD 3IEGA 1WAO1 5FZSA 2DBAA 3CKBA 4YVQC 2VQ2A 2YHCA 1HZ4A 2HYZA 3Q5MA 4J8FA 3SF4A 4G23A 2XGMA 4U0SA 3ZGQA 2KATA 4LEUA 3AS4A 3CVLA 3LCAA 4RG6A 3GYZA 3LY9A 4BWRA 1PC2A 3KAEA 3CV0A 2KCLA 5A6CA 4I9CA 3AS8A 5LCWJ 2FO7A 4N3CA 4EQFA 5FT9A 3KD7A 2FI7A 3ZHEA 5D0QD 1WM5A 3ULQA 3RKVA 4I2WA 4WNDA 3MV2B 2XGOA 4YNDA 5JJ7A 3ASGA 5C1DA 3FP3A 2WPVA 3ZFWA 4UQYA 5CHEE 4N2QA 2FBNA 2XPIA 1KT0A 2VYIA 3OXGA 4GZ5A 5G04C 1KLXA 3RIBA 1IYGA 4AY5A 5JJ6A 4G25A 3UUXA 2V5FA 4YVOA 2LNIA 1ELWA 3LPZA 2AVPA 4WNFA 5KJLA 4I1AA 2HO1A 4HOUA 5CCLA 4H7XA 4BT9A 3GZ1A 3QWPA 4U07A 1P5QA 4WUYA 3R9AB 3HYMB 4UI9K 3Q15A 3MV3B 2XGSA 4N3AA 4UQXA 4BTBA 3FWVA 3CK9A 5G04J 1OUVA 4A1SA 2IF4A 4CDRA 3CEQA 4XIFA 3PDNA 5G05C 3S7JA 3QOUA 4B94A 4KYOB 3ASDA 3MEKA 1ELRA 4N39A 2UY1A 5AYWD 3LYAA 3RO2A 4N3BA 1HH8A 2YQ8A 3UPVA 1KT1A 3ESKA 1ZBPA 3QKYA 4CGVA 1FCHA 4JL0A 4KXKB 3TGOA 1XNFA 3CVNA 3RJVA 5DIZA 3U4TA 2KCKA 5G05J 2QFCA 4GZ6A 3TG4A 5DBKA 5BW8C 3TAXA 3QDNA 4NRHB 4JA9A 5M72A 3K9IA 3E4BA 5D0OD 4UI9C 3PE3A 4GZ3A 3QWVA 3PE4A 2PQNA 2IFUA 3KS2A 3ASHA 3S7BA 3ASFA 1Y8MA 4G1TA 4G24A 5JJTA 3VTYA 3S7DA 4GYOA 4F3VA 5HI7A 2R5SA 4ME2A 2WQHA 2LSVA 2VGYA 3Q4AB 4BT8A 2Q7FA 3QWWA 4HOQA 4WNEA 4G26A 4I9EA 3JYSA 3AS5A 4G2VA 3ZN3A 1QZ2A 5EX3A 4UI9J 2VGXB 4HOTA 2L6JA 1HXIA 2C2LA 4XI0A 4J8DA 2KCVA 1W3BA 3CK8A 4GCOA 2JLBA 5KJMA 4HORA 2BUGA 3NF1A 1E96B 3MA5A 2FF4A 4O6FA 4W9RA 5BNWA 2VSNA 2MHKA 2J9QA 1A17A 2Y4TA 4GYYA 1B89A 1QQEA 1NA3A 3FFLA 5A7DB 2XCCA 4IN3B 5FJYA 4N2SA 2XEVA 2E2EA 3GW4A 3MKRA 4KBQA 5ARFA 4CGWA 2C0LA 3O48A 3CVPA 3EDTB 5FZRA 4Y6CA 2PL2A 5HQ8A 3LY8A 5EX0A 2UWJG 3URZA 3S7FA 2PZIA 4J8EA 4APOA 3BEEA 4Y6WA 5BT1A 1NA0A 4ABNA 2VGXA 2LSUA 3OXLA 4U0ZA 4BTAA 2HR2A 2Y4UA 3UQ3A 2ONDA 4AM9A
chains in the Genus database with same CATH superfamily
2L0IA 2R59A 3G2WA 4GCNA 3D9KA 3G2SA 1S64A 3L9TA 2R17C 4ATGA 2JEKA 4JHRA 4ACKA 4H7YA 3APDA 2P58C 3C3QA 4GA0A 3HXCA 4GA2A 2CFUA 4GA1A 2GRMA 3LKUA 3J5PA 2PQRA 3D3MA 3ZYKA 5AIJA 4UQZA 5CCMA 5FTPA 4BETA 2I1KA 3FU3A 3RAUA 2BKGA 3TG5A 4J0UA 4EZLA 1H2VC 3PZ4A 4IRUA 4WNGA 4JXTA 2Y1LE 3RU0A 2V5QC 4JA7A 3FUEA 5KJNA 3RO3A 5HS0A 2RFAA 2KXPC 4M3OA 5BXOA 4AEZC 4R7LA 1FPPA 2DBAA 4J8YA 1UG3A 2VQ2A 2Y0BG 2B6CA 3DEPA 3FU5A 3SF4A 2DCPA 2ZGDA 4TUUA 1WDYA 2XEEA 2J8SD 4LEUA 3CVLA 3LCAA 1KPSB 4RG6A 5CBNA 3GYZA 3L13A 2CFZA 3FUJA 1N4QA 4PS3A 2GRRB 3CV0A 4DJAA 3TXMA 2X38A 1EF1C 4K5BA 1INZA 3DSVA 3UM3A 4F7AA 3D9PA 2EILE 3U9WA 3ZHEA 1EPUA 3EHNA 5JJ7A 2EQXA 4B0ZA 3FEYA 3ZFWA 4BFRA 4UWLA 1SVXA 4N2QA 1K8KG 4UWGA 2XPIA 4GZ5A 1IYGA 4AY5A 3C98A 2QY7A 3PUJA 3S2AA 4TXRA 2V5FA 2AW6A 4U8HA 2PM7A 1IHBA 1GW6A 4DX1A 2HO1A 2V4HC 3BUAA 4HRNA 3JUEA 4H7XA 4MS6A 3LEWA 3UT4A 1KZPA 4DX2A 4CYMD 5BUZA 4Q69A 3KSQA 4F1PA 4OAUC 4EBAG 5G04J 3HXBA 4A1SA 2WXFA 2J07A 4CDRA 2DVWA 2WXPA 4XIFA 4ATZD 3B7TA 4JEUA 4U63A 4C9BB 3E32A 4JHJA 1ELRA 1N9AA 3B7UX 4JC8A 3VLEA 3IKOB 1HH8A 2BKKB 2YQ8A 1KT1A 2VGEA 3DPYA 4CGVA 1FCHA 2EIJE 4PH4B 2LUHA 4JL0A 4KXKB 3UTMA 3TWRA 3JXJA 4B8CB 5DIZA 3CVWA 3G2VA 3ZNGA 1JCRA 3LDZA 5BW8C 2WXMA 2IU1A 3L22A 3TWWA 2IQCA 3PNLB 1H6PA 2GGFA 2FO1E 3TAXA 3CLJA 1HG2A 5M72A 1LD7A 2IOSA 3RRNB 3DSSA 2P9LG 3PE3A 4GZ3A 3QWVA 4K03A 3ZW3A 2OV8A 2IFUA 3SQVA 2A5UA 1X81A 3S7BA 1S0PA 3ASFA 4G1TA 3UKUG 4G24A 3S7DA 4WWPA 4GTPA 1RW2A 5AENA 1QNFA 1TN8A 4ANWA 5AAOA 3R7QA 4BEPA 2KZTA 5AARA 3BQOA 4C0MA 2Y69E 4XI0A 4LRZA 3O4ZA 2EIKE 1Z3XA 3C3OA 4WAFA 2HM8A 4RLYA 1QYMA 3DWLG 3G2UA 4GAAA 2WMOA 3PZ3A 5BNWA 1MYOA 3CHQA 5J90A 4J6IA 2Y4TA 1OCCE 4GYYA 1QQEA 1OY3D 3QB2A 4LNUD 4RQIA 4RVBA 2GROB 4G8KA 5CBOA 3UMVA 1EDUA 4I43A 1Z3YA 3FUIA 2V8SE 1U2VG 3MKRA 3QAQA 3FTWA 3FTYA 5ARFA 1E8WA 3B95A 2C0LA 2ZU6B 2F8XK 3PVLA 3CVPA 4TRQA 2QZAA 3L6AA 3HXFA 5T8IA 4APFA 4CT0A 4XEIG 3LY8A 5HQ8A 5EX0A 1HO8A 3URZA 5BV1A 3L08A 3S7FA 3E37A 3E33A 4ZFHA 1OT8A 4APOA 4Q94A 3FH8A 5KCMA 3SO8A 4A55A 3PREA 2YHEA 3L54A 3PS6A 3B7BA 1G3NB 4BTAA 2HR2A 2I1JA 3DEOA 2XCBA 3QK0A 4AP2A 1YA0A 5AN8A 1DC2A 3AU4A 2YNQA 3EU5A 1MX4A 3C72A 3EU9A 1NL4A 3DSXA 4I2ZA 5EIDA 4HRMB 1H6OA 3FH7A 3HRAA 4I6GA 3SHFA 1BU9A 4RG9A 2DZNA 2XEHA 3W9FA 4WWNA 4U04A 1E8XA 2KC7A 5BPPA 2OOEA 4GMJA 1UN8A 3LXUX 1MX2A 3ZHEB 1OXJA 4AY6A 3WXXA 3TWXA 3CVXA 1FVHA 2QC9A 1OWNA 3ZPJA 2IOLA 3LVQE 5CMYA 3CKCA 4XI9A 4FU3A 3OXFA 3AAAC 3CQCB 4MKTA 4HXIA 5EKQD 3R7RA 5FIOA 4A3VA 3BG1B 1WAO1 1UN9A 5G2NA 4JPSA 5FZSA 4EZKA 1HZ4A 1N54A 3CHSA 1NFIE 1TNUA 4DPRA 4WWOA 3Q5MA 1N11A 2AXZA 2XGMA 3ZYLA 3QJZA 3D9HA 4ILGA 3U64A 1PC2A 1HX8A 5FQ6A 5FQ7A 5A6CA 4A1GA 2ZXWE 4I9CA 1E7VA 3AS8A 4ANXA 5LCWJ 4N3CA 4GMLA 5LP0A 4DX7D 2FI7A 5IY5E 4BESA 4DX6D 2B0OE 4I2WA 3MV2B 1LTXA 4HI8A 3ZXPA 1H6KA 4F6RD 3V79K 3UXGA 4IYPA 3FTZA 1TNBA 3B7SA 3SFZA 4XX5A 3PNTB 3IBEA 5T4YA 4YDYA 2VYIA 4L2LA 4G25A 4EECA 3AG2E 1ELWA 3LPZA 3D9MA 2OVBA 1E8ZA 2OEWA 1UJJA 4ANUA 4HLEA 1V54E 1KZOA 4GTTA 3GZ1A 3QWPA 3P2BA 3HXEA 4WUYA 3HYMB 2L9BA 1SA4A 3MV3B 4LNGA 1AWCB 3AG4E 4UQXA 5ENRD 2IF4A 3RK6A 1X5BA 4QQIA 1HU3A 2P2CP 1JPLA 3WG7E 2XQ0A 4NIKA 2X6HA 3PZ2A 4GTQA 4B94A 3MEKA 4LG6A 4OVUA 4AVXA 4GMRA 2V0PA 3JCKC 2QYJA 3DBSA 1H19A 5C2YA 1K1AA 4L23A 3RO2A 4B8AA 5AQBA 5CEAA 4N3BA 5FINA 3PEVB 4QFVA 3QNKA 5A23A 3FHEA 5EYLA 2KZTB 3ESKA 3QKYA 3TJPA 1WY6A 2HE0A 4U8VD 4UWKA 1E8YA 3D9JA 3CSTA 3CVNA 4FJZA 4GTOA 3U4TA 1O1RA 2KCKA 2H6HA 5G05J 4HVBA 1D8DA 5DBKA 1AP7A 3NAWA 3IXEA 5AQ9A 3NB2A 2IY0C 4AJWA 3FH5A 3K9IA 5D0OD 4UI9C 5T3RA 1NI1A 4HI9A 3PE4A 2F37A 3CR3A 4D10C 4GTSA 4DI3A 5CEDB 5AQ7A 4FC8A 1Y8MA 3LJ3A 4M7CA 3JQ1A 3OAWA 2ETBA 2ZGGA 1N4PA 4GYOA 4C48B 4OYSA 3AG3E 4ME2A 3SBTB 2WQHA 2IONA 2LSVA 3Q4AB 4BT8A 2LO6A 2WXNA 1JCSA 4WNEA 4IULA 1HE8A 5JMND 2XENA 4G2VA 3EUVA 5EX3A 3V2XA 3L16A 4ILIA 4XKCA 1JWFA 4AV7A 3ZU7B 2C2LA 2AWIA 2R05A 4J8DA 2A4ZA 1EYHA 2FULA 3T8KA 2LAIA 3DSTA 1ZB1A 3C5RA 1BI7B 2BUGA 3DRAA 2WXIA 4PDXA 3NBNB 1RZ4A 4K5CA 3ZEFA 2WXLA 3KEAA 2VSNA 1MJ0A 1PY1A 4HQDA 1HS6A 2J9QA 1A17A 3OTNA 3PZ1A 5CECB 3Q73A 5H7PA 5HKPA 2IO3C 1UJKA 1H2UA 3CHMA 2ILRA 4KBQA 4ACLA 2P9SG 3O48A 3EDTB 4MBGA 4Y6CA 3SNXA 3LJNA 5FQ4A 2RD0A 3L82A 4DX5D 5J08A 1TJFA 4J8EA 4MLPA 4EZJA 3BEEA 1DCQA 4F53A 1TN6A 3OXLA 3FY4A 3CVYA 4K5AB 3DSUA 5B1AE 3UQ3A 2ONDA 3CHPA 4X8QA 3CK7A 4NQ0A 4J7WA 4I6EA 3Q49B 2LXMA 4KVMA 3JQ0A 2P9NG 4KZCA 4DLOA 1UOHA 4U0UA 1FT1A 2C0MA 2GW1A 3SI5A 4U7EB 5KNHD 1ELKA 3SZ7A 3TWVA 2NC9A 2DZOA 1JUQA 2J08A 3MCXA 1TNYA 2JABA 1IHGA 3PZDA 4YDOA 2VSYA 3CQGB 4AXHA 1U3CA 1MHQA 3VTXA 2CHZA 2J09A 2P9IG 1BI8B 3U3WA 2KBXA 3FUNA 5KJKA 2QYUA 3ENEA 2WMNA 1SQMA 4ILHB 3SD5A 3AJIA 2MYOA 3EHMA 3FUHA 4AIFA 4B89A 4PS8A 1OCRE 3FUMA 4F1SA 4YVQC 2YHCA 4CDNA 3D9IA 1OCZE 2KM4A 5EN5D 4DRXE 2XS8A 4G23A 4U0SA 2KATA 3AS4A 5KWDA 3FUFA 4JD2G 2V4LA 3LY9A 4HLLA 3NQPA 4L7TA 4G8LA 3QC1A 1JCQA 2AXVA 3ISMC 5EILA 4EQFA 1N4RA 1FVFA 4EPZA 3HG0D 3SY2A 4A63B 1WM5A 3ULQA 4HBDA 3RKVA 5BV0A 4YNDA 5C1DA 1OWLA 3NZSA 2WPVA 2J4DA 2F8YA 1OWPA 1A5EA 4UQYA 2R03A 5CHEE 1V55E 1H0AA 2IEJA 1MQSA 3P1UA 4JHKA 4CZ2D 1YMPA 3EHQA 5G04C 4LERA 2A5EA 4XKBA 3UUXA 2PM6A 3TXNA 4CDMA 3PRZA 3Q79A 4NACA 2DYSE 4OVVA 2AVPA 4GB9A 1TEZA 4I1AA 5LOZA 4HOUA 5ANRA 3UX4A 2L6BA 2NSZA 1N0QA 4YDWA 5CCLA 2P9UG 1DNPA 5LFAA 3MZLB 2WM9A 5B1BE 1P5QA 2RG8A 3LVRE 5EYPF 4N3AA 4JW1A 4BTBA 3E30A 2MOWA 2WXGA 3FWVA 3T8MA 1TNOA 1D9SA 2WQ6A 1YYHA 4Q96A 3ML8A 3FEXA 3I4GA 3E34A 3R9MA 5KBAA 4KYOB 4GPMA 1MZCA 4BERA 3UIOC 4N39A 2XRYA 3UM1A 3FDHA 3EJNA 5AYWD 5JHAA 3LYAA 4TUMA 1N4SA 4JVSA 3FUKA 3FU6A 1QBQA 1WG0A 2NXPA 2RKKA 3Q75A 3RRMB 1N94A 3TGOA 2L0TB 4I6JA 3MJWA 3RJVA 5KNGA 4KVOA 3SFXA 3UIPC 1SW6A 5E75A 4A3TA 3FTSA 3HVEB 3FTVA 5EDSA 4NRHB 4JA9A 3ZVVA 2XHEA 3RRUA 4LUNU 5ENOD 2ETAA 2PQNA 1TNZA 1IXVA 2F0YA 3HXDA 3VTYA 3ONKA 3V30A 4FJYA 3MX3A 2VTBA 3X2QE 1K1BA 4CRWA 5AJDA 3Q7FA 4PUCA 2PNNA 3APCA 4UWHA 2Y3AA 3QWWA 4G26A 3AS5A 2WXHA 1QZ2A 3ZYMA 1N0RA 3ESLA 4HOTA 2L6JA 3TWSA 2X6KA 1HXIA 5ITZF 4CT4A 5CERB 2H6IA 3ZKJA 3CSFA 4FLBA 3C3RA 5KJMA 4HORA 3ZUVB 2H6FA 2H6GA 2VJ8A 1E96B 3MA5A 4GZDA 3PUKA 3DXKG 1FT2A 4W9RA 3J5QB 3FTXA 4FP7A 2GRPB 2R2LA 1NA3A 4GTRA 3I3NA 3UKRG 4BSXA 4HFGA 4U8YD 2XCCA 2P9KG 5ENPD 2I9CA 1O1TA 4ZHBA 5FJYA 3CVVA 4N2SA 2X6JA 2XRZA 3GZSA 1E90A 4L1BA 5ANLA 4URKA 4CGWA 1TYQG 2GRLA 3D9OA 2PL2A 2LXLA 2WXJA 1SZ9A 2PZIA 3KSLA 4XE0A 2WXOA 4Y6WA 3JXIA 4ABNA 2VGXA 3ZXSA 2LSUA 1HF8A 2DYRE 2ETCA 3U66A 3UM2A 3ASOE 4U0ZA 2Y4UA 3FUDA 3T9KA 3IHVA 4DK5A 2AJAA 3PH0C 2WXRA 4KZ0A 4L2YA 2UY1B 1O1SA 4HS2A 1JWGA 2I6HA 5HRYA 3MYVA 3MKQB 5ENNA 3CIAA 2FEZA 4I17A 3N71A 4CCAA 4JEHA 3LS8A 2BF0X 2WXQA 3CVUA 3GZ2A 3V2OA 3TWTA 1ZU2A 3CGHA 2GRQB 4GZCA 3Q47B 5ARGA 4GYWA 3SBSA 3V31A 1TJCA 4GPKA 3ABKE 3T5XA 2X6IA 3SGHA 3CVQA 3LY7A 2X3MA 4BX9A 1NZNA 1Y6IA 3HVEA 3EHRA 3T5VA 4N5CA 4HOSA 4GU5A 5FZQA 2WB2A 1TN7A 3CHOA 1OCOE 4UWFA 5LCWC 2OCCE 5CRVA 3IEGA 1DCEA 1PAQA 2YINA 2VSXE 3CKBA 3ULYA 3UT8A 3MGBA 1Q2ZA 1IQUA 2HYZA 4J8FA 4NURA 4B93B 2J4BA 4AOFA 3ZGQA 5FQ8A 1MX6A 3VLFA 1K3ZD 1IKND 4BWRA 4PS7A 2J49A 3DSWA 3KAEA 2WVIA 5JHBA 2KCLA 4GTMA 3UI2A 1XGWA 1YCSB 4TV3A 4JB8P 5CMWA 2FO7A 5FT9A 3KEZA 3KD7A 4TXPA 4U95D 5D0QD 4FA6A 3BG0B 4FADA 4XZ4A 4WNDA 2XGOA 4O60A 3ASGA 2CG2A 3FP3A 1OWOA 3Q9UC 2OEVA 3ABLE 2XZDG 2XS1A 4C0EA 3TWQA 2FBNA 4DLQA 1KT0A 1S70B 2XPZA 3FULA 3OXGA 3B13A 1KLXA 3RIBA 2LAHA 4BY6A 2XZTG 4HNAD 2MRIA 5JJ6A 3DXMG 4YVOA 2LNIA 3EIQC 4ANVA 1LD8A 3HHMA 4O1OA 3PEUB 4WNFA 5KJLA 1Z5SC 3HIZA 4UUCA 4RSYA 4EBAA 3Q7AA 3ML9A 1HG5A 4BT9A 4DI4A 4K0RA 4U07A 5D2MC 1SA5A 3ABME 3R9AB 4UI9K 3Q15A 2XGSA 3CK9A 1OUVA 4DUIA 4MRUA 3TL5A 4OAVB 1BLXB 1S63A 2BEDA 3CEQA 3UINC 4G11A 5ENQD 3PDNA 4HB5A 5G05C 4CEMA 3S7JA 3UT7A 2CHWA 3QOUA 1NP7A 1VDYA 3ASDA 4FLHA 2M63A 2VTBB 2UY1A 4FHKA 1D8EA 5E76A 4U96D 3APFA 4Z68A 4E85A 3Q9NC 3MKQA 3UPVA 2NYJA 5B3SE 3F6QA 5CRUA 1ZBPA 1E7UA 3FTUA 4HRLA 4KMOA 2EIME 1XNFA 4N5QA 5AQAA 2XPYA 3W9GA 2E0IA 2QFCA 2VSOE 4GZ6A 3TG4A 4FULA 1OWMA 3AU5A 3JUIA 3QDNA 4GTVA 3UM0A 3E4BA 3ONLA 1TR4A 5ENTD 5ENSD 3D9LA 1O5MA 3L17A 3G2TA 4I1OB 2R02A 3KS2A 3Q78A 4KT6B 3EIJA 3ASHA 5D66A 4E6HA 1N52A 5LX8A 5JJTA 1BD8A 4F3VA 5FWQA 2X6FA 5HI7A 4I1MA 3SFYA 1N95A 2R5SA 4V3IA 2VGYA 2DWZA 4O1PA 2Q7FA 4HOQA 3NOCD 1U3DA 4I9EA 3JYSA 4BX8A 3B7RL 3CHRA 4L9PA 3ZN3A 1LF8A 3AG1E 3NOGD 4UI9J 2VGXB 2AXUA 2RFMA 4J8SA 2ZIRA 2KCVA 1W3BA 3CK8A 5JA4D 4GCOA 2JLBA 1IQRA 4LCTA 3NF1A 2FF4A 4O6FA 2CG3A 2WQ7A 3NZUA 2MHKA 3ASNE 1HFAA 3IHYA 3VLDA 2GRNB 1B89A 5BXUA 4BSZB 2P9PG 2IJGX 3HDXA 3ULEG 1L5JA 3FFLA 5A7DB 4IN3B 1Z6TA 5EIBE 2XEVA 2E2EA 3GW4A 3BU8A 4FHJA 3RSEG 5AJLA 2I2OA 4EHMA 3D9NA 4P29A 2BTDA 1DVPA 2CHXA 2DIWA 3QARA 5FZRA 3TWUA 2OVFA 2UWJG 4TXQA 1H2TC 3FU0A 3ZRHA 3I4RB 3DPDA 2WXKA 4LNBA 5BT1A 1NA0A 4YDEA 3ZYQA 1BPOA 4LSZE 2EINE 3ZIMA 1SZAA 2ZISA 3I5PA 5G55A 4JZYA 1UW4B 3IV0A 2IO2C 4AM9A
chains in the Genus database with same CATH topology
3CHPA 3IHVA 2L0IA 3CK7A 4DK5A 2XCBA 2R59A 3PH0C 3QK0A 3G2WA 2WXRA 4GCNA 4AP2A 1YA0A 3D9KA 4NQ0A 4KZ0A 4L2YA 3G2SA 3AU4A 2YNQA 2UY1B 4I6EA 3Q49B 4HS2A 1JWGA 2I6HA 2R17C 4I2ZA 4KVMA 3JQ0A 4ATGA 4KZCA 4DLOA 2JEKA 4JHRA 4U0UA 3MYVA 3MKQB 5ENNA 3FH7A 3CIAA 4I6GA 2FEZA 2C0MA 4I17A 3N71A 3SHFA 2GW1A 3SI5A 4JEHA 3LS8A 4ACKA 4CCAA 2BF0X 4RG9A 1ELKA 3SZ7A 4H7YA 2WXQA 2NC9A 3APDA 3CVUA 3GZ2A 4WWNA 1ZU2A 1JUQA 2P58C 4GA0A 3CGHA 4GA2A 2CFUA 4GA1A 2GRMA 2J08A 3MCXA 3LKUA 3Q47B 1E8XA 2KC7A 4GZCA 2OOEA 2PQRA 4GMJA 1UN8A 3LXUX 3D3MA 1IHGA 5ARGA 3ZYKA 5AIJA 3PZDA 4GYWA 3ZHEB 3SBSA 2VSYA 3CQGB 4AXHA 1U3CA 4UQZA 1MHQA 3VTXA 3WXXA 5CCMA 4AY6A 1TJCA 3CVXA 5FTPA 4GPKA 1FVHA 2CHZA 2J09A 1OWNA 3T5XA 2I1KA 2X6IA 3FU3A 3SGHA 3FUNA 3ZPJA 3U3WA 3CVQA 5KJKA 3TG5A 3LY7A 2X3MA 3ENEA 4J0UA 2IOLA 4BX9A 1NZNA 1Y6IA 1H2VC 4EZLA 3HVEA 2WMNA 4IRUA 1SQMA 3LVQE 4ILHB 4WNGA 3CKCA 4XI9A 4FU3A 5CMYA 3T5VA 4N5CA 3SD5A 4GU5A 5FZQA 4JXTA 3OXFA 2WB2A 4HOSA 3CHOA 3EHMA 4UWFA 3CQCB 5LCWC 4MKTA 3RU0A 4HXIA 3FUHA 4AIFA 4JA7A 3FUEA 5KJNA 4B89A 3RO3A 5EKQD 4PS8A 3R7RA 3FUMA 4A3VA 3BG1B 4M3OA 3IEGA 1PAQA 2YINA 1WAO1 1UN9A 4AEZC 4F1SA 5G2NA 4JPSA 4R7LA 5FZSA 2DBAA 2VSXE 3CKBA 4YVQC 1UG3A 4EZKA 2VQ2A 2YHCA 3UT8A 3MGBA 4CDNA 1HZ4A 3D9IA 1IQUA 1N54A 3CHSA 4DPRA 2HYZA 4WWOA 3Q5MA 4J8FA 4NURA 2KM4A 3FU5A 3SF4A 2AXZA 2J4BA 2DCPA 4G23A 2XGMA 4U0SA 3ZYLA 4AOFA 3ZGQA 4TUUA 2KATA 3QJZA 4LEUA 5FQ8A 3AS4A 3CVLA 3FUFA 3LCAA 4RG6A 3GYZA 2V4LA 2CFZA 3L13A 3FUJA 3LY9A 3VLFA 4ILGA 3NQPA 4PS3A 4L7TA 4BWRA 4PS7A 3U64A 1PC2A 2J49A 3KAEA 1HX8A 2WVIA 3CV0A 2KCLA 5FQ6A 5JHBA 5FQ7A 4DJAA 3TXMA 2X38A 5A6CA 1EF1C 3QC1A 4A1GA 2AXVA 4I9CA 1E7VA 3AS8A 1XGWA 4TV3A 4ANXA 5LCWJ 5CMWA 2FO7A 4N3CA 1INZA 4EQFA 5FT9A 4GMLA 1FVFA 3KEZA 4F7AA 3D9PA 3KD7A 4EPZA 5LP0A 3U9WA 2FI7A 3ZHEA 5D0QD 4FA6A 3BG0B 4FADA 1WM5A 3ULQA 4XZ4A 3RKVA 4I2WA 4WNDA 3MV2B 2XGOA 1EPUA 5BV0A 3EHNA 4YNDA 5JJ7A 3ASGA 5C1DA 2CG2A 2EQXA 3FP3A 1OWOA 1OWLA 3NZSA 2WPVA 4B0ZA 2J4DA 3FEYA 1H6KA 3ZFWA 1OWPA 4BFRA 4UWLA 4UQYA 4C0EA 4IYPA 3FTZA 3B7SA 5CHEE 3SFZA 4N2QA 2FBNA 4XX5A 4DLQA 1H0AA 3IBEA 3PNTB 1MQSA 2XPIA 1KT0A 3P1UA 4JHKA 4UWGA 5T4YA 2VYIA 2XPZA 3FULA 3OXGA 4GZ5A 3B13A 1KLXA 4LERA 2LAHA 5G04C 3RIBA 1IYGA 4L2LA 4AY5A 3C98A 4BY6A 2QY7A 3PUJA 3S2AA 2MRIA 4XKBA 4G25A 5JJ6A 2PM6A 3UUXA 3TXNA 2V5FA 3PRZA 4CDMA 2AW6A 4EECA 4U8HA 4YVOA 2LNIA 2PM7A 3EIQC 1ELWA 4ANVA 3HHMA 4NACA 3LPZA 4OVVA 1GW6A 3D9MA 3PEUB 2AVPA 4WNFA 4U04A 4GB9A 2OVBA 1E8ZA 5KJLA 3HIZA 1TEZA 4RSYA 1UJJA 4I1AA 4EBAA 5LOZA 2HO1A 4HOUA 5ANRA 3UX4A 4ANUA 2NSZA 5CCLA 3ML9A 1HG5A 4HLEA 4H7XA 1DNPA 4MS6A 4BT9A 3GZ1A 5LFAA 3QWPA 3MZLB 2WM9A 4DI4A 4K0RA 3P2BA 4U07A 3LEWA 3UT4A 1P5QA 2RG8A 4WUYA 3R9AB 3HYMB 4UI9K 5BUZA 3Q15A 3LVRE 2L9BA 3MV3B 2XGSA 4Q69A 4N3AA 4JW1A 4UQXA 4BTBA 2MOWA 2WXGA 4EBAG 3FWVA 3T8MA 3CK9A 5G04J 1OUVA 2WQ6A 4MRUA 4A1SA 3TL5A 2WXFA 2IF4A 2J07A 4CDRA 3RK6A 4Q96A 2WXPA 3CEQA 3ML8A 3FEXA 4G11A 4XIFA 3PDNA 3I4GA 1X5BA 5G05C 4CEMA 3S7JA 1HU3A 1JPLA 3UT7A 3B7TA 2XQ0A 4JEUA 2X6HA 2CHWA 3QOUA 4U63A 1NP7A 4B94A 1VDYA 3ASDA 3MEKA 4KYOB 4FLHA 4OVUA 4C9BB 4AVXA 2M63A 4JHJA 1ELRA 2VTBB 4N39A 5BPPA 2UY1A 2V0PA 3JCKC 3B7UX 4FHKA 2XRYA 3DBSA 3FDHA 4JC8A 3EJNA 5E76A 1H19A 3LYAA 5AYWD 5C2YA 5JHAA 3APFA 4L23A 3RO2A 4JVSA 4B8AA 3VLEA 3IKOB 3FUKA 4E85A 4N3BA 3FU6A 1HH8A 3MKQA 2YQ8A 3PEVB 4QFVA 3UPVA 3QNKA 5A23A 2NXPA 3FHEA 1KT1A 2KZTB 3ESKA 1ZBPA 3QKYA 4CGVA 3RRMB 1FCHA 3TJPA 4PH4B 1WY6A 1E7UA 4JL0A 3FTUA 4KXKB 4KMOA 4UWKA 3TGOA 1E8YA 3D9JA 3CSTA 2L0TB 1XNFA 3CVNA 3MJWA 4FJZA 4I6JA 4B8CB 3RJVA 5DIZA 2XPYA 3U4TA 3CVWA 3G2VA 2KCKA 2E0IA 5G05J 2QFCA 4KVOA 2VSOE 4GZ6A 3LDZA 4HVBA 3TG4A 5DBKA 5BW8C 2WXMA 2IU1A 5E75A 3L22A 4A3TA 2IQCA 3PNLB 4FULA 2GGFA 3FTSA 1OWMA 3FTVA 3HVEB 3AU5A 5EDSA 3JUIA 3TAXA 3QDNA 4AJWA 3CLJA 4NRHB 1HG2A 4JA9A 5M72A 3FH5A 3K9IA 3ZVVA 3E4BA 3ONLA 5D0OD 2XHEA 4UI9C 3RRUA 2IOSA 3RRNB 3D9LA 3L17A 4LUNU 3G2TA 3PE3A 4GZ3A 3QWVA 5T3RA 4K03A 3ZW3A 2OV8A 4I1OB 3PE4A 2PQNA 2IFUA 3KS2A 3CR3A 4D10C 4KT6B 3EIJA 2A5UA 4DI3A 3ASHA 4FC8A 3S7BA 1S0PA 1Y8MA 3ASFA 4G1TA 4E6HA 3LJ3A 1N52A 4G24A 3JQ1A 5LX8A 5JJTA 3OAWA 3VTYA 3ONKA 3S7DA 4WWPA 4FJYA 4GYOA 4F3VA 5FWQA 3MX3A 2X6FA 5HI7A 4OYSA 2VTBA 4I1MA 2R5SA 4ME2A 3SBTB 5AENA 2WQHA 4CRWA 2IONA 4V3IA 2LSVA 5AJDA 1QNFA 2VGYA 3Q4AB 4PUCA 4UWHA 3APCA 4BT8A 2Q7FA 2LO6A 2Y3AA 3QWWA 2WXNA 4HOQA 4ANWA 4WNEA 4IULA 1HE8A 1U3DA 4G26A 4I9EA 3R7QA 3JYSA 4BX8A 3B7RL 3AS5A 3CHRA 4G2VA 3ZN3A 2WXHA 1LF8A 2KZTA 1QZ2A 5EX3A 3ZYMA 4UI9J 3ESLA 2VGXB 3L16A 4HOTA 2L6JA 2X6KA 1HXIA 4ILIA 4XKCA 1JWFA 4C0MA 2AXUA 4J8SA 4AV7A 2C2LA 2AWIA 4CT4A 4XI0A 4J8DA 2A4ZA 2KCVA 1EYHA 4LRZA 2FULA 1W3BA 3O4ZA 1Z3XA 3CSFA 3CK8A 4GCOA 2JLBA 4FLBA 2LAIA 1IQRA 4LCTA 5KJMA 4HORA 4WAFA 2BUGA 2HM8A 2WXIA 3NF1A 4PDXA 3G2UA 2VJ8A 1E96B 3MA5A 2FF4A 4GZDA 4O6FA 3PUKA 4GAAA 2WMOA 3ZEFA 2CG3A 4W9RA 5BNWA 2WQ7A 2WXLA 3FTXA 3NZUA 4FP7A 2VSNA 1PY1A 2MHKA 3CHQA 1HFAA 1HS6A 2J9QA 1A17A 3IHYA 4J6IA 2Y4TA 3VLDA 5J90A 3OTNA 4GYYA 1B89A 1QQEA 1NA3A 3QB2A 3I3NA 4RVBA 4BSXA 2IJGX 3HDXA 4HFGA 1L5JA 3FFLA 5A7DB 2XCCA 2I9CA 4IN3B 5FJYA 3CVVA 4N2SA 1Z6TA 3UMVA 1EDUA 2X6JA 4I43A 1Z3YA 3FUIA 2XRZA 2V8SE 1UJKA 2XEVA 2E2EA 3GZSA 3GW4A 4FHJA 1E90A 5AJLA 1H2UA 3MKRA 3CHMA 3FTWA 3QAQA 4L1BA 2I2OA 2ILRA 3FTYA 4KBQA 5ARFA 5ANLA 4ACLA 4URKA 1E8WA 4CGWA 3D9NA 2C0LA 2ZU6B 3O48A 4P29A 2BTDA 3PVLA 1DVPA 3CVPA 4TRQA 3L6AA 2CHXA 2DIWA 3EDTB 3QARA 5FZRA 2GRLA 2OVFA 5T8IA 4APFA 4CT0A 4Y6CA 3D9OA 3SNXA 2PL2A 5HQ8A 3LY8A 5EX0A 1HO8A 2UWJG 2WXJA 3L08A 3S7FA 3URZA 5BV1A 5FQ4A 1H2TC 1SZ9A 2PZIA 2RD0A 5J08A 1TJFA 4J8EA 3FU0A 3ZRHA 3I4RB 4MLPA 4XE0A 2WXOA 4APOA 4EZJA 3BEEA 4Q94A 4Y6WA 3DPDA 2WXKA 4F53A 5BT1A 1NA0A 3FH8A 5KCMA 4ABNA 2VGXA 3ZYQA 1BPOA 4A55A 3ZXSA 2LSUA 3PREA 3ZIMA 1HF8A 1SZAA 3OXLA 2YHEA 3FY4A 3L54A 3PS6A 3I5PA 5G55A 3U66A 3CVYA 4JZYA 4U0ZA 1UW4B 3IV0A 4BTAA 2HR2A 2Y4UA 3FUDA 2I1JA 3UQ3A 2ONDA 4AM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK7 A;  2XCB A;  4GCN A;  1YA0 A;  4NQ0 A;  2UY1 B;  3Q49 B;  2I6H A;  4I2Z A;  4JHR A;  4U0U A;  2FEZ A;  2C0M A;  4I17 A;  3N71 A;  2GW1 A;  4RG9 A;  3SZ7 A;  4H7Y A;  2NC9 A;  3GZ2 A;  1ZU2 A;  2P58 C;  4GA0 A;  4GA2 A;  4GA1 A;  3LKU A;  3Q47 B;  4U04 A;  2KC7 A;  2OOE A;  2PQR A;  1IHG A;  5ARG A;  4GYW A;  3ZHE B;  2VSY A;  4UQZ A;  3VTX A;  4AY6 A;  3WXX A;  5CCM A;  1TJC A;  4GPK A;  5FTP A;  3ZPJ A;  3U3W A;  3CVQ A;  5KJK A;  3TG5 A;  3LY7 A;  4J0U A;  1NZN A;  4WNG A;  3CKC A;  4XI9 A;  4N5C A;  4HOS A;  5FZQ A;  3OXF A;  5LCW C;  3RU0 A;  4AIF A;  4JA7 A;  5KJN A;  3RO3 A;  5EKQ D;  3IEG A;  1WAO 1;  5FZS A;  2DBA A;  3CKB A;  4YVQ C;  2VQ2 A;  2YHC A;  1HZ4 A;  2HYZ A;  3Q5M A;  4J8F A;  3SF4 A;  4G23 A;  2XGM A;  4U0S A;  3ZGQ A;  2KAT A;  4LEU A;  3AS4 A;  3CVL A;  3LCA A;  4RG6 A;  3GYZ A;  3LY9 A;  4BWR A;  1PC2 A;  3KAE A;  3CV0 A;  2KCL A;  5A6C A;  4I9C A;  3AS8 A;  5LCW J;  2FO7 A;  4N3C A;  4EQF A;  5FT9 A;  3KD7 A;  2FI7 A;  3ZHE A;  5D0Q D;  1WM5 A;  3ULQ A;  3RKV A;  4I2W A;  4WND A;  3MV2 B;  2XGO A;  4YND A;  5JJ7 A;  3ASG A;  5C1D A;  3FP3 A;  2WPV A;  3ZFW A;  4UQY A;  5CHE E;  4N2Q A;  2FBN A;  2XPI A;  1KT0 A;  2VYI A;  3OXG A;  4GZ5 A;  5G04 C;  1KLX A;  3RIB A;  1IYG A;  4AY5 A;  5JJ6 A;  4G25 A;  3UUX A;  2V5F A;  4YVO A;  2LNI A;  1ELW A;  3LPZ A;  2AVP A;  4WNF A;  5KJL A;  4I1A A;  2HO1 A;  4HOU A;  5CCL A;  4H7X A;  4BT9 A;  3GZ1 A;  3QWP A;  4U07 A;  1P5Q A;  4WUY A;  3R9A B;  3HYM B;  4UI9 K;  3Q15 A;  3MV3 B;  2XGS A;  4N3A A;  4UQX A;  4BTB A;  3FWV A;  3CK9 A;  5G04 J;  1OUV A;  4A1S A;  2IF4 A;  4CDR A;  3CEQ A;  4XIF A;  3PDN A;  5G05 C;  3S7J A;  3QOU A;  4B94 A;  4KYO B;  3ASD A;  3MEK A;  1ELR A;  4N39 A;  2UY1 A;  5AYW D;  3LYA A;  3RO2 A;  4N3B A;  1HH8 A;  2YQ8 A;  3UPV A;  1KT1 A;  3ESK A;  1ZBP A;  3QKY A;  4CGV A;  1FCH A;  4JL0 A;  4KXK B;  3TGO A;  1XNF A;  3CVN A;  3RJV A;  5DIZ A;  3U4T A;  2KCK A;  5G05 J;  2QFC A;  4GZ6 A;  3TG4 A;  5DBK A;  5BW8 C;  3TAX A;  3QDN A;  4NRH B;  4JA9 A;  5M72 A;  3K9I A;  3E4B A;  5D0O D;  4UI9 C;  3PE3 A;  4GZ3 A;  3QWV A;  3PE4 A;  2PQN A;  2IFU A;  3KS2 A;  3ASH A;  3S7B A;  3ASF A;  1Y8M A;  4G1T A;  4G24 A;  5JJT A;  3VTY A;  3S7D A;  4GYO A;  4F3V A;  5HI7 A;  2R5S A;  4ME2 A;  2WQH A;  2LSV A;  2VGY A;  3Q4A B;  4BT8 A;  2Q7F A;  3QWW A;  4HOQ A;  4WNE A;  4G26 A;  4I9E A;  3JYS A;  3AS5 A;  4G2V A;  3ZN3 A;  1QZ2 A;  5EX3 A;  4UI9 J;  2VGX B;  4HOT A;  2L6J A;  1HXI A;  2C2L A;  4XI0 A;  4J8D A;  2KCV A;  1W3B A;  3CK8 A;  4GCO A;  2JLB A;  5KJM A;  4HOR A;  2BUG A;  3NF1 A;  1E96 B;  3MA5 A;  2FF4 A;  4O6F A;  4W9R A;  5BNW A;  2VSN A;  2MHK A;  2J9Q A;  1A17 A;  2Y4T A;  4GYY A;  1B89 A;  1QQE A;  1NA3 A;  3FFL A;  5A7D B;  2XCC A;  4IN3 B;  5FJY A;  4N2S A;  2XEV A;  2E2E A;  3GW4 A;  3MKR A;  4KBQ A;  5ARF A;  4CGW A;  2C0L A;  3O48 A;  3CVP A;  3EDT B;  5FZR A;  4Y6C A;  2PL2 A;  5HQ8 A;  3LY8 A;  5EX0 A;  2UWJ G;  3URZ A;  3S7F A;  2PZI A;  4J8E A;  4APO A;  3BEE A;  4Y6W A;  5BT1 A;  1NA0 A;  4ABN A;  2VGX A;  2LSU A;  3OXL A;  4U0Z A;  4BTA A;  2HR2 A;  2Y4U A;  3UQ3 A;  2OND A;  4AM9 A; 
#chains in the Genus database with same CATH topology
 2L0I A;  2R59 A;  3G2W A;  4GCN A;  3D9K A;  3G2S A;  1S64 A;  3L9T A;  2R17 C;  4ATG A;  2JEK A;  4JHR A;  4ACK A;  4H7Y A;  3APD A;  2P58 C;  3C3Q A;  4GA0 A;  3HXC A;  4GA2 A;  2CFU A;  4GA1 A;  2GRM A;  3LKU A;  3J5P A;  2PQR A;  3D3M A;  3ZYK A;  5AIJ A;  4UQZ A;  5CCM A;  5FTP A;  4BET A;  2I1K A;  3FU3 A;  3RAU A;  2BKG A;  3TG5 A;  4J0U A;  4EZL A;  1H2V C;  3PZ4 A;  4IRU A;  4WNG A;  4JXT A;  2Y1L E;  3RU0 A;  2V5Q C;  4JA7 A;  3FUE A;  5KJN A;  3RO3 A;  5HS0 A;  2RFA A;  2KXP C;  4M3O A;  5BXO A;  4AEZ C;  4R7L A;  1FPP A;  2DBA A;  4J8Y A;  1UG3 A;  2VQ2 A;  2Y0B G;  2B6C A;  3DEP A;  3FU5 A;  3SF4 A;  2DCP A;  2ZGD A;  4TUU A;  1WDY A;  2XEE A;  2J8S D;  4LEU A;  3CVL A;  3LCA A;  1KPS B;  4RG6 A;  5CBN A;  3GYZ A;  3L13 A;  2CFZ A;  3FUJ A;  1N4Q A;  4PS3 A;  2GRR B;  3CV0 A;  4DJA A;  3TXM A;  2X38 A;  1EF1 C;  4K5B A;  1INZ A;  3DSV A;  3UM3 A;  4F7A A;  3D9P A;  2EIL E;  3U9W A;  3ZHE A;  1EPU A;  3EHN A;  5JJ7 A;  2EQX A;  4B0Z A;  3FEY A;  3ZFW A;  4BFR A;  4UWL A;  1SVX A;  4N2Q A;  1K8K G;  4UWG A;  2XPI A;  4GZ5 A;  1IYG A;  4AY5 A;  3C98 A;  2QY7 A;  3PUJ A;  3S2A A;  4TXR A;  2V5F A;  2AW6 A;  4U8H A;  2PM7 A;  1IHB A;  1GW6 A;  4DX1 A;  2HO1 A;  2V4H C;  3BUA A;  4HRN A;  3JUE A;  4H7X A;  4MS6 A;  3LEW A;  3UT4 A;  1KZP A;  4DX2 A;  4CYM D;  5BUZ A;  4Q69 A;  3KSQ A;  4F1P A;  4OAU C;  4EBA G;  5G04 J;  3HXB A;  4A1S A;  2WXF A;  2J07 A;  4CDR A;  2DVW A;  2WXP A;  4XIF A;  4ATZ D;  3B7T A;  4JEU A;  4U63 A;  4C9B B;  3E32 A;  4JHJ A;  1ELR A;  1N9A A;  3B7U X;  4JC8 A;  3VLE A;  3IKO B;  1HH8 A;  2BKK B;  2YQ8 A;  1KT1 A;  2VGE A;  3DPY A;  4CGV A;  1FCH A;  2EIJ E;  4PH4 B;  2LUH A;  4JL0 A;  4KXK B;  3UTM A;  3TWR A;  3JXJ A;  4B8C B;  5DIZ A;  3CVW A;  3G2V A;  3ZNG A;  1JCR A;  3LDZ A;  5BW8 C;  2WXM A;  2IU1 A;  3L22 A;  3TWW A;  2IQC A;  3PNL B;  1H6P A;  2GGF A;  2FO1 E;  3TAX A;  3CLJ A;  1HG2 A;  5M72 A;  1LD7 A;  2IOS A;  3RRN B;  3DSS A;  2P9L G;  3PE3 A;  4GZ3 A;  3QWV A;  4K03 A;  3ZW3 A;  2OV8 A;  2IFU A;  3SQV A;  2A5U A;  1X81 A;  3S7B A;  1S0P A;  3ASF A;  4G1T A;  3UKU G;  4G24 A;  3S7D A;  4WWP A;  4GTP A;  1RW2 A;  5AEN A;  1QNF A;  1TN8 A;  4ANW A;  5AAO A;  3R7Q A;  4BEP A;  2KZT A;  5AAR A;  3BQO A;  4C0M A;  2Y69 E;  4XI0 A;  4LRZ A;  3O4Z A;  2EIK E;  1Z3X A;  3C3O A;  4WAF A;  2HM8 A;  4RLY A;  1QYM A;  3DWL G;  3G2U A;  4GAA A;  2WMO A;  3PZ3 A;  5BNW A;  1MYO A;  3CHQ A;  5J90 A;  4J6I A;  2Y4T A;  1OCC E;  4GYY A;  1QQE A;  1OY3 D;  3QB2 A;  4LNU D;  4RQI A;  4RVB A;  2GRO B;  4G8K A;  5CBO A;  3UMV A;  1EDU A;  4I43 A;  1Z3Y A;  3FUI A;  2V8S E;  1U2V G;  3MKR A;  3QAQ A;  3FTW A;  3FTY A;  5ARF A;  1E8W A;  3B95 A;  2C0L A;  2ZU6 B;  2F8X K;  3PVL A;  3CVP A;  4TRQ A;  2QZA A;  3L6A A;  3HXF A;  5T8I A;  4APF A;  4CT0 A;  4XEI G;  3LY8 A;  5HQ8 A;  5EX0 A;  1HO8 A;  3URZ A;  5BV1 A;  3L08 A;  3S7F A;  3E37 A;  3E33 A;  4ZFH A;  1OT8 A;  4APO A;  4Q94 A;  3FH8 A;  5KCM A;  3SO8 A;  4A55 A;  3PRE A;  2YHE A;  3L54 A;  3PS6 A;  3B7B A;  1G3N B;  4BTA A;  2HR2 A;  2I1J A;  3DEO A;  2XCB A;  3QK0 A;  4AP2 A;  1YA0 A;  5AN8 A;  1DC2 A;  3AU4 A;  2YNQ A;  3EU5 A;  1MX4 A;  3C72 A;  3EU9 A;  1NL4 A;  3DSX A;  4I2Z A;  5EID A;  4HRM B;  1H6O A;  3FH7 A;  3HRA A;  4I6G A;  3SHF A;  1BU9 A;  4RG9 A;  2DZN A;  2XEH A;  3W9F A;  4WWN A;  4U04 A;  1E8X A;  2KC7 A;  5BPP A;  2OOE A;  4GMJ A;  1UN8 A;  3LXU X;  1MX2 A;  3ZHE B;  1OXJ A;  4AY6 A;  3WXX A;  3TWX A;  3CVX A;  1FVH A;  2QC9 A;  1OWN A;  3ZPJ A;  2IOL A;  3LVQ E;  5CMY A;  3CKC A;  4XI9 A;  4FU3 A;  3OXF A;  3AAA C;  3CQC B;  4MKT A;  4HXI A;  5EKQ D;  3R7R A;  5FIO A;  4A3V A;  3BG1 B;  1WAO 1;  1UN9 A;  5G2N A;  4JPS A;  5FZS A;  4EZK A;  1HZ4 A;  1N54 A;  3CHS A;  1NFI E;  1TNU A;  4DPR A;  4WWO A;  3Q5M A;  1N11 A;  2AXZ A;  2XGM A;  3ZYL A;  3QJZ A;  3D9H A;  4ILG A;  3U64 A;  1PC2 A;  1HX8 A;  5FQ6 A;  5FQ7 A;  5A6C A;  4A1G A;  2ZXW E;  4I9C A;  1E7V A;  3AS8 A;  4ANX A;  5LCW J;  4N3C A;  4GML A;  5LP0 A;  4DX7 D;  2FI7 A;  5IY5 E;  4BES A;  4DX6 D;  2B0O E;  4I2W A;  3MV2 B;  1LTX A;  4HI8 A;  3ZXP A;  1H6K A;  4F6R D;  3V79 K;  3UXG A;  4IYP A;  3FTZ A;  1TNB A;  3B7S A;  3SFZ A;  4XX5 A;  3PNT B;  3IBE A;  5T4Y A;  4YDY A;  2VYI A;  4L2L A;  4G25 A;  4EEC A;  3AG2 E;  1ELW A;  3LPZ A;  3D9M A;  2OVB A;  1E8Z A;  2OEW A;  1UJJ A;  4ANU A;  4HLE A;  1V54 E;  1KZO A;  4GTT A;  3GZ1 A;  3QWP A;  3P2B A;  3HXE A;  4WUY A;  3HYM B;  2L9B A;  1SA4 A;  3MV3 B;  4LNG A;  1AWC B;  3AG4 E;  4UQX A;  5ENR D;  2IF4 A;  3RK6 A;  1X5B A;  4QQI A;  1HU3 A;  2P2C P;  1JPL A;  3WG7 E;  2XQ0 A;  4NIK A;  2X6H A;  3PZ2 A;  4GTQ A;  4B94 A;  3MEK A;  4LG6 A;  4OVU A;  4AVX A;  4GMR A;  2V0P A;  3JCK C;  2QYJ A;  3DBS A;  1H19 A;  5C2Y A;  1K1A A;  4L23 A;  3RO2 A;  4B8A A;  5AQB A;  5CEA A;  4N3B A;  5FIN A;  3PEV B;  4QFV A;  3QNK A;  5A23 A;  3FHE A;  5EYL A;  2KZT B;  3ESK A;  3QKY A;  3TJP A;  1WY6 A;  2HE0 A;  4U8V D;  4UWK A;  1E8Y A;  3D9J A;  3CST A;  3CVN A;  4FJZ A;  4GTO A;  3U4T A;  1O1R A;  2KCK A;  2H6H A;  5G05 J;  4HVB A;  1D8D A;  5DBK A;  1AP7 A;  3NAW A;  3IXE A;  5AQ9 A;  3NB2 A;  2IY0 C;  4AJW A;  3FH5 A;  3K9I A;  5D0O D;  4UI9 C;  5T3R A;  1NI1 A;  4HI9 A;  3PE4 A;  2F37 A;  3CR3 A;  4D10 C;  4GTS A;  4DI3 A;  5CED B;  5AQ7 A;  4FC8 A;  1Y8M A;  3LJ3 A;  4M7C A;  3JQ1 A;  3OAW A;  2ETB A;  2ZGG A;  1N4P A;  4GYO A;  4C48 B;  4OYS A;  3AG3 E;  4ME2 A;  3SBT B;  2WQH A;  2ION A;  2LSV A;  3Q4A B;  4BT8 A;  2LO6 A;  2WXN A;  1JCS A;  4WNE A;  4IUL A;  1HE8 A;  5JMN D;  2XEN A;  4G2V A;  3EUV A;  5EX3 A;  3V2X A;  3L16 A;  4ILI A;  4XKC A;  1JWF A;  4AV7 A;  3ZU7 B;  2C2L A;  2AWI A;  2R05 A;  4J8D A;  2A4Z A;  1EYH A;  2FUL A;  3T8K A;  2LAI A;  3DST A;  1ZB1 A;  3C5R A;  1BI7 B;  2BUG A;  3DRA A;  2WXI A;  4PDX A;  3NBN B;  1RZ4 A;  4K5C A;  3ZEF A;  2WXL A;  3KEA A;  2VSN A;  1MJ0 A;  1PY1 A;  4HQD A;  1HS6 A;  2J9Q A;  1A17 A;  3OTN A;  3PZ1 A;  5CEC B;  3Q73 A;  5H7P A;  5HKP A;  2IO3 C;  1UJK A;  1H2U A;  3CHM A;  2ILR A;  4KBQ A;  4ACL A;  2P9S G;  3O48 A;  3EDT B;  4MBG A;  4Y6C A;  3SNX A;  3LJN A;  5FQ4 A;  2RD0 A;  3L82 A;  4DX5 D;  5J08 A;  1TJF A;  4J8E A;  4MLP A;  4EZJ A;  3BEE A;  1DCQ A;  4F53 A;  1TN6 A;  3OXL A;  3FY4 A;  3CVY A;  4K5A B;  3DSU A;  5B1A E;  3UQ3 A;  2OND A;  3CHP A;  4X8Q A;  3CK7 A;  4NQ0 A;  4J7W A;  4I6E A;  3Q49 B;  2LXM A;  4KVM A;  3JQ0 A;  2P9N G;  4KZC A;  4DLO A;  1UOH A;  4U0U A;  1FT1 A;  2C0M A;  2GW1 A;  3SI5 A;  4U7E B;  5KNH D;  1ELK A;  3SZ7 A;  3TWV A;  2NC9 A;  2DZO A;  1JUQ A;  2J08 A;  3MCX A;  1TNY A;  2JAB A;  1IHG A;  3PZD A;  4YDO A;  2VSY A;  3CQG B;  4AXH A;  1U3C A;  1MHQ A;  3VTX A;  2CHZ A;  2J09 A;  2P9I G;  1BI8 B;  3U3W A;  2KBX A;  3FUN A;  5KJK A;  2QYU A;  3ENE A;  2WMN A;  1SQM A;  4ILH B;  3SD5 A;  3AJI A;  2MYO A;  3EHM A;  3FUH A;  4AIF A;  4B89 A;  4PS8 A;  1OCR E;  3FUM A;  4F1S A;  4YVQ C;  2YHC A;  4CDN A;  3D9I A;  1OCZ E;  2KM4 A;  5EN5 D;  4DRX E;  2XS8 A;  4G23 A;  4U0S A;  2KAT A;  3AS4 A;  5KWD A;  3FUF A;  4JD2 G;  2V4L A;  3LY9 A;  4HLL A;  3NQP A;  4L7T A;  4G8L A;  3QC1 A;  1JCQ A;  2AXV A;  3ISM C;  5EIL A;  4EQF A;  1N4R A;  1FVF A;  4EPZ A;  3HG0 D;  3SY2 A;  4A63 B;  1WM5 A;  3ULQ A;  4HBD A;  3RKV A;  5BV0 A;  4YND A;  5C1D A;  1OWL A;  3NZS A;  2WPV A;  2J4D A;  2F8Y A;  1OWP A;  1A5E A;  4UQY A;  2R03 A;  5CHE E;  1V55 E;  1H0A A;  2IEJ A;  1MQS A;  3P1U A;  4JHK A;  4CZ2 D;  1YMP A;  3EHQ A;  5G04 C;  4LER A;  2A5E A;  4XKB A;  3UUX A;  2PM6 A;  3TXN A;  4CDM A;  3PRZ A;  3Q79 A;  4NAC A;  2DYS E;  4OVV A;  2AVP A;  4GB9 A;  1TEZ A;  4I1A A;  5LOZ A;  4HOU A;  5ANR A;  3UX4 A;  2L6B A;  2NSZ A;  1N0Q A;  4YDW A;  5CCL A;  2P9U G;  1DNP A;  5LFA A;  3MZL B;  2WM9 A;  5B1B E;  1P5Q A;  2RG8 A;  3LVR E;  5EYP F;  4N3A A;  4JW1 A;  4BTB A;  3E30 A;  2MOW A;  2WXG A;  3FWV A;  3T8M A;  1TNO A;  1D9S A;  2WQ6 A;  1YYH A;  4Q96 A;  3ML8 A;  3FEX A;  3I4G A;  3E34 A;  3R9M A;  5KBA A;  4KYO B;  4GPM A;  1MZC A;  4BER A;  3UIO C;  4N39 A;  2XRY A;  3UM1 A;  3FDH A;  3EJN A;  5AYW D;  5JHA A;  3LYA A;  4TUM A;  1N4S A;  4JVS A;  3FUK A;  3FU6 A;  1QBQ A;  1WG0 A;  2NXP A;  2RKK A;  3Q75 A;  3RRM B;  1N94 A;  3TGO A;  2L0T B;  4I6J A;  3MJW A;  3RJV A;  5KNG A;  4KVO A;  3SFX A;  3UIP C;  1SW6 A;  5E75 A;  4A3T A;  3FTS A;  3HVE B;  3FTV A;  5EDS A;  4NRH B;  4JA9 A;  3ZVV A;  2XHE A;  3RRU A;  4LUN U;  5ENO D;  2ETA A;  2PQN A;  1TNZ A;  1IXV A;  2F0Y A;  3HXD A;  3VTY A;  3ONK A;  3V30 A;  4FJY A;  3MX3 A;  2VTB A;  3X2Q E;  1K1B A;  4CRW A;  5AJD A;  3Q7F A;  4PUC A;  2PNN A;  3APC A;  4UWH A;  2Y3A A;  3QWW A;  4G26 A;  3AS5 A;  2WXH A;  1QZ2 A;  3ZYM A;  1N0R A;  3ESL A;  4HOT A;  2L6J A;  3TWS A;  2X6K A;  1HXI A;  5ITZ F;  4CT4 A;  5CER B;  2H6I A;  3ZKJ A;  3CSF A;  4FLB A;  3C3R A;  5KJM A;  4HOR A;  3ZUV B;  2H6F A;  2H6G A;  2VJ8 A;  1E96 B;  3MA5 A;  4GZD A;  3PUK A;  3DXK G;  1FT2 A;  4W9R A;  3J5Q B;  3FTX A;  4FP7 A;  2GRP B;  2R2L A;  1NA3 A;  4GTR A;  3I3N A;  3UKR G;  4BSX A;  4HFG A;  4U8Y D;  2XCC A;  2P9K G;  5ENP D;  2I9C A;  1O1T A;  4ZHB A;  5FJY A;  3CVV A;  4N2S A;  2X6J A;  2XRZ A;  3GZS A;  1E90 A;  4L1B A;  5ANL A;  4URK A;  4CGW A;  1TYQ G;  2GRL A;  3D9O A;  2PL2 A;  2LXL A;  2WXJ A;  1SZ9 A;  2PZI A;  3KSL A;  4XE0 A;  2WXO A;  4Y6W A;  3JXI A;  4ABN A;  2VGX A;  3ZXS A;  2LSU A;  1HF8 A;  2DYR E;  2ETC A;  3U66 A;  3UM2 A;  3ASO E;  4U0Z A;  2Y4U A;  3FUD A;  3T9K A;  3IHV A;  4DK5 A;  2AJA A;  3PH0 C;  2WXR A;  4KZ0 A;  4L2Y A;  2UY1 B;  1O1S A;  4HS2 A;  1JWG A;  2I6H A;  5HRY A;  3MYV A;  3MKQ B;  5ENN A;  3CIA A;  2FEZ A;  4I17 A;  3N71 A;  4CCA A;  4JEH A;  3LS8 A;  2BF0 X;  2WXQ A;  3CVU A;  3GZ2 A;  3V2O A;  3TWT A;  1ZU2 A;  3CGH A;  2GRQ B;  4GZC A;  3Q47 B;  5ARG A;  4GYW A;  3SBS A;  3V31 A;  1TJC A;  4GPK A;  3ABK E;  3T5X A;  2X6I A;  3SGH A;  3CVQ A;  3LY7 A;  2X3M A;  4BX9 A;  1NZN A;  1Y6I A;  3HVE A;  3EHR A;  3T5V A;  4N5C A;  4HOS A;  4GU5 A;  5FZQ A;  2WB2 A;  1TN7 A;  3CHO A;  1OCO E;  4UWF A;  5LCW C;  2OCC E;  5CRV A;  3IEG A;  1DCE A;  1PAQ A;  2YIN A;  2VSX E;  3CKB A;  3ULY A;  3UT8 A;  3MGB A;  1Q2Z A;  1IQU A;  2HYZ A;  4J8F A;  4NUR A;  4B93 B;  2J4B A;  4AOF A;  3ZGQ A;  5FQ8 A;  1MX6 A;  3VLF A;  1K3Z D;  1IKN D;  4BWR A;  4PS7 A;  2J49 A;  3DSW A;  3KAE A;  2WVI A;  5JHB A;  2KCL A;  4GTM A;  3UI2 A;  1XGW A;  1YCS B;  4TV3 A;  4JB8 P;  5CMW A;  2FO7 A;  5FT9 A;  3KEZ A;  3KD7 A;  4TXP A;  4U95 D;  5D0Q D;  4FA6 A;  3BG0 B;  4FAD A;  4XZ4 A;  4WND A;  2XGO A;  4O60 A;  3ASG A;  2CG2 A;  3FP3 A;  1OWO A;  3Q9U C;  2OEV A;  3ABL E;  2XZD G;  2XS1 A;  4C0E A;  3TWQ A;  2FBN A;  4DLQ A;  1KT0 A;  1S70 B;  2XPZ A;  3FUL A;  3OXG A;  3B13 A;  1KLX A;  3RIB A;  2LAH A;  4BY6 A;  2XZT G;  4HNA D;  2MRI A;  5JJ6 A;  3DXM G;  4YVO A;  2LNI A;  3EIQ C;  4ANV A;  1LD8 A;  3HHM A;  4O1O A;  3PEU B;  4WNF A;  5KJL A;  1Z5S C;  3HIZ A;  4UUC A;  4RSY A;  4EBA A;  3Q7A A;  3ML9 A;  1HG5 A;  4BT9 A;  4DI4 A;  4K0R A;  4U07 A;  5D2M C;  1SA5 A;  3ABM E;  3R9A B;  4UI9 K;  3Q15 A;  2XGS A;  3CK9 A;  1OUV A;  4DUI A;  4MRU A;  3TL5 A;  4OAV B;  1BLX B;  1S63 A;  2BED A;  3CEQ A;  3UIN C;  4G11 A;  5ENQ D;  3PDN A;  4HB5 A;  5G05 C;  4CEM A;  3S7J A;  3UT7 A;  2CHW A;  3QOU A;  1NP7 A;  1VDY A;  3ASD A;  4FLH A;  2M63 A;  2VTB B;  2UY1 A;  4FHK A;  1D8E A;  5E76 A;  4U96 D;  3APF A;  4Z68 A;  4E85 A;  3Q9N C;  3MKQ A;  3UPV A;  2NYJ A;  5B3S E;  3F6Q A;  5CRU A;  1ZBP A;  1E7U A;  3FTU A;  4HRL A;  4KMO A;  2EIM E;  1XNF A;  4N5Q A;  5AQA A;  2XPY A;  3W9G A;  2E0I A;  2QFC A;  2VSO E;  4GZ6 A;  3TG4 A;  4FUL A;  1OWM A;  3AU5 A;  3JUI A;  3QDN A;  4GTV A;  3UM0 A;  3E4B A;  3ONL A;  1TR4 A;  5ENT D;  5ENS D;  3D9L A;  1O5M A;  3L17 A;  3G2T A;  4I1O B;  2R02 A;  3KS2 A;  3Q78 A;  4KT6 B;  3EIJ A;  3ASH A;  5D66 A;  4E6H A;  1N52 A;  5LX8 A;  5JJT A;  1BD8 A;  4F3V A;  5FWQ A;  2X6F A;  5HI7 A;  4I1M A;  3SFY A;  1N95 A;  2R5S A;  4V3I A;  2VGY A;  2DWZ A;  4O1P A;  2Q7F A;  4HOQ A;  3NOC D;  1U3D A;  4I9E A;  3JYS A;  4BX8 A;  3B7R L;  3CHR A;  4L9P A;  3ZN3 A;  1LF8 A;  3AG1 E;  3NOG D;  4UI9 J;  2VGX B;  2AXU A;  2RFM A;  4J8S A;  2ZIR A;  2KCV A;  1W3B A;  3CK8 A;  5JA4 D;  4GCO A;  2JLB A;  1IQR A;  4LCT A;  3NF1 A;  2FF4 A;  4O6F A;  2CG3 A;  2WQ7 A;  3NZU A;  2MHK A;  3ASN E;  1HFA A;  3IHY A;  3VLD A;  2GRN B;  1B89 A;  5BXU A;  4BSZ B;  2P9P G;  2IJG X;  3HDX A;  3ULE G;  1L5J A;  3FFL A;  5A7D B;  4IN3 B;  1Z6T A;  5EIB E;  2XEV A;  2E2E A;  3GW4 A;  3BU8 A;  4FHJ A;  3RSE G;  5AJL A;  2I2O A;  4EHM A;  3D9N A;  4P29 A;  2BTD A;  1DVP A;  2CHX A;  2DIW A;  3QAR A;  5FZR A;  3TWU A;  2OVF A;  2UWJ G;  4TXQ A;  1H2T C;  3FU0 A;  3ZRH A;  3I4R B;  3DPD A;  2WXK A;  4LNB A;  5BT1 A;  1NA0 A;  4YDE A;  3ZYQ A;  1BPO A;  4LSZ E;  2EIN E;  3ZIM A;  1SZA A;  2ZIS A;  3I5P A;  5G55 A;  4JZY A;  1UW4 B;  3IV0 A;  2IO2 C;  4AM9 A; 
#chains in the Genus database with same CATH homology
 3CHP A;  3IHV A;  2L0I A;  3CK7 A;  4DK5 A;  2XCB A;  2R59 A;  3PH0 C;  3QK0 A;  3G2W A;  2WXR A;  4GCN A;  4AP2 A;  1YA0 A;  3D9K A;  4NQ0 A;  4KZ0 A;  4L2Y A;  3G2S A;  3AU4 A;  2YNQ A;  2UY1 B;  4I6E A;  3Q49 B;  4HS2 A;  1JWG A;  2I6H A;  2R17 C;  4I2Z A;  4KVM A;  3JQ0 A;  4ATG A;  4KZC A;  4DLO A;  2JEK A;  4JHR A;  4U0U A;  3MYV A;  3MKQ B;  5ENN A;  3FH7 A;  3CIA A;  4I6G A;  2FEZ A;  2C0M A;  4I17 A;  3N71 A;  3SHF A;  2GW1 A;  3SI5 A;  4JEH A;  3LS8 A;  4ACK A;  4CCA A;  2BF0 X;  4RG9 A;  1ELK A;  3SZ7 A;  4H7Y A;  2WXQ A;  2NC9 A;  3APD A;  3CVU A;  3GZ2 A;  4WWN A;  1ZU2 A;  1JUQ A;  2P58 C;  4GA0 A;  3CGH A;  4GA2 A;  2CFU A;  4GA1 A;  2GRM A;  2J08 A;  3MCX A;  3LKU A;  3Q47 B;  1E8X A;  2KC7 A;  4GZC A;  2OOE A;  2PQR A;  4GMJ A;  1UN8 A;  3LXU X;  3D3M A;  1IHG A;  5ARG A;  3ZYK A;  5AIJ A;  3PZD A;  4GYW A;  3ZHE B;  3SBS A;  2VSY A;  3CQG B;  4AXH A;  1U3C A;  4UQZ A;  1MHQ A;  3VTX A;  3WXX A;  5CCM A;  4AY6 A;  1TJC A;  3CVX A;  5FTP A;  4GPK A;  1FVH A;  2CHZ A;  2J09 A;  1OWN A;  3T5X A;  2I1K A;  2X6I A;  3FU3 A;  3SGH A;  3FUN A;  3ZPJ A;  3U3W A;  3CVQ A;  5KJK A;  3TG5 A;  3LY7 A;  2X3M A;  3ENE A;  4J0U A;  2IOL A;  4BX9 A;  1NZN A;  1Y6I A;  1H2V C;  4EZL A;  3HVE A;  2WMN A;  4IRU A;  1SQM A;  3LVQ E;  4ILH B;  4WNG A;  3CKC A;  4XI9 A;  4FU3 A;  5CMY A;  3T5V A;  4N5C A;  3SD5 A;  4GU5 A;  5FZQ A;  4JXT A;  3OXF A;  2WB2 A;  4HOS A;  3CHO A;  3EHM A;  4UWF A;  3CQC B;  5LCW C;  4MKT A;  3RU0 A;  4HXI A;  3FUH A;  4AIF A;  4JA7 A;  3FUE A;  5KJN A;  4B89 A;  3RO3 A;  5EKQ D;  4PS8 A;  3R7R A;  3FUM A;  4A3V A;  3BG1 B;  4M3O A;  3IEG A;  1PAQ A;  2YIN A;  1WAO 1;  1UN9 A;  4AEZ C;  4F1S A;  5G2N A;  4JPS A;  4R7L A;  5FZS A;  2DBA A;  2VSX E;  3CKB A;  4YVQ C;  1UG3 A;  4EZK A;  2VQ2 A;  2YHC A;  3UT8 A;  3MGB A;  4CDN A;  1HZ4 A;  3D9I A;  1IQU A;  1N54 A;  3CHS A;  4DPR A;  2HYZ A;  4WWO A;  3Q5M A;  4J8F A;  4NUR A;  2KM4 A;  3FU5 A;  3SF4 A;  2AXZ A;  2J4B A;  2DCP A;  4G23 A;  2XGM A;  4U0S A;  3ZYL A;  4AOF A;  3ZGQ A;  4TUU A;  2KAT A;  3QJZ A;  4LEU A;  5FQ8 A;  3AS4 A;  3CVL A;  3FUF A;  3LCA A;  4RG6 A;  3GYZ A;  2V4L A;  2CFZ A;  3L13 A;  3FUJ A;  3LY9 A;  3VLF A;  4ILG A;  3NQP A;  4PS3 A;  4L7T A;  4BWR A;  4PS7 A;  3U64 A;  1PC2 A;  2J49 A;  3KAE A;  1HX8 A;  2WVI A;  3CV0 A;  2KCL A;  5FQ6 A;  5JHB A;  5FQ7 A;  4DJA A;  3TXM A;  2X38 A;  5A6C A;  1EF1 C;  3QC1 A;  4A1G A;  2AXV A;  4I9C A;  1E7V A;  3AS8 A;  1XGW A;  4TV3 A;  4ANX A;  5LCW J;  5CMW A;  2FO7 A;  4N3C A;  1INZ A;  4EQF A;  5FT9 A;  4GML A;  1FVF A;  3KEZ A;  4F7A A;  3D9P A;  3KD7 A;  4EPZ A;  5LP0 A;  3U9W A;  2FI7 A;  3ZHE A;  5D0Q D;  4FA6 A;  3BG0 B;  4FAD A;  1WM5 A;  3ULQ A;  4XZ4 A;  3RKV A;  4I2W A;  4WND A;  3MV2 B;  2XGO A;  1EPU A;  5BV0 A;  3EHN A;  4YND A;  5JJ7 A;  3ASG A;  5C1D A;  2CG2 A;  2EQX A;  3FP3 A;  1OWO A;  1OWL A;  3NZS A;  2WPV A;  4B0Z A;  2J4D A;  3FEY A;  1H6K A;  3ZFW A;  1OWP A;  4BFR A;  4UWL A;  4UQY A;  4C0E A;  4IYP A;  3FTZ A;  3B7S A;  5CHE E;  3SFZ A;  4N2Q A;  2FBN A;  4XX5 A;  4DLQ A;  1H0A A;  3IBE A;  3PNT B;  1MQS A;  2XPI A;  1KT0 A;  3P1U A;  4JHK A;  4UWG A;  5T4Y A;  2VYI A;  2XPZ A;  3FUL A;  3OXG A;  4GZ5 A;  3B13 A;  1KLX A;  4LER A;  2LAH A;  5G04 C;  3RIB A;  1IYG A;  4L2L A;  4AY5 A;  3C98 A;  4BY6 A;  2QY7 A;  3PUJ A;  3S2A A;  2MRI A;  4XKB A;  4G25 A;  5JJ6 A;  2PM6 A;  3UUX A;  3TXN A;  2V5F A;  3PRZ A;  4CDM A;  2AW6 A;  4EEC A;  4U8H A;  4YVO A;  2LNI A;  2PM7 A;  3EIQ C;  1ELW A;  4ANV A;  3HHM A;  4NAC A;  3LPZ A;  4OVV A;  1GW6 A;  3D9M A;  3PEU B;  2AVP A;  4WNF A;  4U04 A;  4GB9 A;  2OVB A;  1E8Z A;  5KJL A;  3HIZ A;  1TEZ A;  4RSY A;  1UJJ A;  4I1A A;  4EBA A;  5LOZ A;  2HO1 A;  4HOU A;  5ANR A;  3UX4 A;  4ANU A;  2NSZ A;  5CCL A;  3ML9 A;  1HG5 A;  4HLE A;  4H7X A;  1DNP A;  4MS6 A;  4BT9 A;  3GZ1 A;  5LFA A;  3QWP A;  3MZL B;  2WM9 A;  4DI4 A;  4K0R A;  3P2B A;  4U07 A;  3LEW A;  3UT4 A;  1P5Q A;  2RG8 A;  4WUY A;  3R9A B;  3HYM B;  4UI9 K;  5BUZ A;  3Q15 A;  3LVR E;  2L9B A;  3MV3 B;  2XGS A;  4Q69 A;  4N3A A;  4JW1 A;  4UQX A;  4BTB A;  2MOW A;  2WXG A;  4EBA G;  3FWV A;  3T8M A;  3CK9 A;  5G04 J;  1OUV A;  2WQ6 A;  4MRU A;  4A1S A;  3TL5 A;  2WXF A;  2IF4 A;  2J07 A;  4CDR A;  3RK6 A;  4Q96 A;  2WXP A;  3CEQ A;  3ML8 A;  3FEX A;  4G11 A;  4XIF A;  3PDN A;  3I4G A;  1X5B A;  5G05 C;  4CEM A;  3S7J A;  1HU3 A;  1JPL A;  3UT7 A;  3B7T A;  2XQ0 A;  4JEU A;  2X6H A;  2CHW A;  3QOU A;  4U63 A;  1NP7 A;  4B94 A;  1VDY A;  3ASD A;  3MEK A;  4KYO B;  4FLH A;  4OVU A;  4C9B B;  4AVX A;  2M63 A;  4JHJ A;  1ELR A;  2VTB B;  4N39 A;  5BPP A;  2UY1 A;  2V0P A;  3JCK C;  3B7U X;  4FHK A;  2XRY A;  3DBS A;  3FDH A;  4JC8 A;  3EJN A;  5E76 A;  1H19 A;  3LYA A;  5AYW D;  5C2Y A;  5JHA A;  3APF A;  4L23 A;  3RO2 A;  4JVS A;  4B8A A;  3VLE A;  3IKO B;  3FUK A;  4E85 A;  4N3B A;  3FU6 A;  1HH8 A;  3MKQ A;  2YQ8 A;  3PEV B;  4QFV A;  3UPV A;  3QNK A;  5A23 A;  2NXP A;  3FHE A;  1KT1 A;  2KZT B;  3ESK A;  1ZBP A;  3QKY A;  4CGV A;  3RRM B;  1FCH A;  3TJP A;  4PH4 B;  1WY6 A;  1E7U A;  4JL0 A;  3FTU A;  4KXK B;  4KMO A;  4UWK A;  3TGO A;  1E8Y A;  3D9J A;  3CST A;  2L0T B;  1XNF A;  3CVN A;  3MJW A;  4FJZ A;  4I6J A;  4B8C B;  3RJV A;  5DIZ A;  2XPY A;  3U4T A;  3CVW A;  3G2V A;  2KCK A;  2E0I A;  5G05 J;  2QFC A;  4KVO A;  2VSO E;  4GZ6 A;  3LDZ A;  4HVB A;  3TG4 A;  5DBK A;  5BW8 C;  2WXM A;  2IU1 A;  5E75 A;  3L22 A;  4A3T A;  2IQC A;  3PNL B;  4FUL A;  2GGF A;  3FTS A;  1OWM A;  3FTV A;  3HVE B;  3AU5 A;  5EDS A;  3JUI A;  3TAX A;  3QDN A;  4AJW A;  3CLJ A;  4NRH B;  1HG2 A;  4JA9 A;  5M72 A;  3FH5 A;  3K9I A;  3ZVV A;  3E4B A;  3ONL A;  5D0O D;  2XHE A;  4UI9 C;  3RRU A;  2IOS A;  3RRN B;  3D9L A;  3L17 A;  4LUN U;  3G2T A;  3PE3 A;  4GZ3 A;  3QWV A;  5T3R A;  4K03 A;  3ZW3 A;  2OV8 A;  4I1O B;  3PE4 A;  2PQN A;  2IFU A;  3KS2 A;  3CR3 A;  4D10 C;  4KT6 B;  3EIJ A;  2A5U A;  4DI3 A;  3ASH A;  4FC8 A;  3S7B A;  1S0P A;  1Y8M A;  3ASF A;  4G1T A;  4E6H A;  3LJ3 A;  1N52 A;  4G24 A;  3JQ1 A;  5LX8 A;  5JJT A;  3OAW A;  3VTY A;  3ONK A;  3S7D A;  4WWP A;  4FJY A;  4GYO A;  4F3V A;  5FWQ A;  3MX3 A;  2X6F A;  5HI7 A;  4OYS A;  2VTB A;  4I1M A;  2R5S A;  4ME2 A;  3SBT B;  5AEN A;  2WQH A;  4CRW A;  2ION A;  4V3I A;  2LSV A;  5AJD A;  1QNF A;  2VGY A;  3Q4A B;  4PUC A;  4UWH A;  3APC A;  4BT8 A;  2Q7F A;  2LO6 A;  2Y3A A;  3QWW A;  2WXN A;  4HOQ A;  4ANW A;  4WNE A;  4IUL A;  1HE8 A;  1U3D A;  4G26 A;  4I9E A;  3R7Q A;  3JYS A;  4BX8 A;  3B7R L;  3AS5 A;  3CHR A;  4G2V A;  3ZN3 A;  2WXH A;  1LF8 A;  2KZT A;  1QZ2 A;  5EX3 A;  3ZYM A;  4UI9 J;  3ESL A;  2VGX B;  3L16 A;  4HOT A;  2L6J A;  2X6K A;  1HXI A;  4ILI A;  4XKC A;  1JWF A;  4C0M A;  2AXU A;  4J8S A;  4AV7 A;  2C2L A;  2AWI A;  4CT4 A;  4XI0 A;  4J8D A;  2A4Z A;  2KCV A;  1EYH A;  4LRZ A;  2FUL A;  1W3B A;  3O4Z A;  1Z3X A;  3CSF A;  3CK8 A;  4GCO A;  2JLB A;  4FLB A;  2LAI A;  1IQR A;  4LCT A;  5KJM A;  4HOR A;  4WAF A;  2BUG A;  2HM8 A;  2WXI A;  3NF1 A;  4PDX A;  3G2U A;  2VJ8 A;  1E96 B;  3MA5 A;  2FF4 A;  4GZD A;  4O6F A;  3PUK A;  4GAA A;  2WMO A;  3ZEF A;  2CG3 A;  4W9R A;  5BNW A;  2WQ7 A;  2WXL A;  3FTX A;  3NZU A;  4FP7 A;  2VSN A;  1PY1 A;  2MHK A;  3CHQ A;  1HFA A;  1HS6 A;  2J9Q A;  1A17 A;  3IHY A;  4J6I A;  2Y4T A;  3VLD A;  5J90 A;  3OTN A;  4GYY A;  1B89 A;  1QQE A;  1NA3 A;  3QB2 A;  3I3N A;  4RVB A;  4BSX A;  2IJG X;  3HDX A;  4HFG A;  1L5J A;  3FFL A;  5A7D B;  2XCC A;  2I9C A;  4IN3 B;  5FJY A;  3CVV A;  4N2S A;  1Z6T A;  3UMV A;  1EDU A;  2X6J A;  4I43 A;  1Z3Y A;  3FUI A;  2XRZ A;  2V8S E;  1UJK A;  2XEV A;  2E2E A;  3GZS A;  3GW4 A;  4FHJ A;  1E90 A;  5AJL A;  1H2U A;  3MKR A;  3CHM A;  3FTW A;  3QAQ A;  4L1B A;  2I2O A;  2ILR A;  3FTY A;  4KBQ A;  5ARF A;  5ANL A;  4ACL A;  4URK A;  1E8W A;  4CGW A;  3D9N A;  2C0L A;  2ZU6 B;  3O48 A;  4P29 A;  2BTD A;  3PVL A;  1DVP A;  3CVP A;  4TRQ A;  3L6A A;  2CHX A;  2DIW A;  3EDT B;  3QAR A;  5FZR A;  2GRL A;  2OVF A;  5T8I A;  4APF A;  4CT0 A;  4Y6C A;  3D9O A;  3SNX A;  2PL2 A;  5HQ8 A;  3LY8 A;  5EX0 A;  1HO8 A;  2UWJ G;  2WXJ A;  3L08 A;  3S7F A;  3URZ A;  5BV1 A;  5FQ4 A;  1H2T C;  1SZ9 A;  2PZI A;  2RD0 A;  5J08 A;  1TJF A;  4J8E A;  3FU0 A;  3ZRH A;  3I4R B;  4MLP A;  4XE0 A;  2WXO A;  4APO A;  4EZJ A;  3BEE A;  4Q94 A;  4Y6W A;  3DPD A;  2WXK A;  4F53 A;  5BT1 A;  1NA0 A;  3FH8 A;  5KCM A;  4ABN A;  2VGX A;  3ZYQ A;  1BPO A;  4A55 A;  3ZXS A;  2LSU A;  3PRE A;  3ZIM A;  1HF8 A;  1SZA A;  3OXL A;  2YHE A;  3FY4 A;  3L54 A;  3PS6 A;  3I5P A;  5G55 A;  3U66 A;  3CVY A;  4JZY A;  4U0Z A;  1UW4 B;  3IV0 A;  4BTA A;  2HR2 A;  2Y4U A;  3FUD A;  2I1J A;  3UQ3 A;  2OND A;  4AM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...