1HXIA

An unexpected extended conformation for the third tpr motif of the peroxin pex5 from trypanosoma brucei
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
112
structure length
112
Chain Sequence
NNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
publication title An unexpected extended conformation for the third TPR motif of the peroxin PEX5 from Trypanosoma brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
total genus 39
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2001-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hxiA00
2LNIA 2HO1A 3AS5A 5HQ8A 4N2SA 3MV3B 1KT0A 3ZPJA 2XGSA 5ARFA 1FCHA 3KS2A 2YHCA 5FZRA 5DBKA 5JJTA 3FP3A 2XCCA 3URZA 4GYOA 3UQ3A 4I17A 1KLXA 5FZQA 4U0UA 2UWJG 3ZN3A 3E4BA 3LKUA 4GYYA 3MEKA 4RG9A 4AM9A 4JA7A 4UI9C 1W3BA 3ESKA 4UI9J 4BT8A 2VSNA 3LPZA 4KYOB 2PL2A 3CVPA 3GYZA 2C0LA 3QWPA 4J8EA 1QQEA 2L6JA 2C0MA 3CVNA 4N3AA 1WM5A 5A6CA 4I2ZA 4HOTA 2PQNA 3QKYA 3AS4A 2GW1A 5G05J 5CCMA 4WUYA 3ASDA 4GA0A 3VTYA 2MHKA 4CGWA 2UY1A 5EX3A 2Y4TA 3GW4A 2HR2A 1ZU2A 3S7BA 3RJVA 2VSYA 3LCAA 1NZNA 4G25A 4GCNA 4HORA 4KXKB 4APOA 3MKRA 3TG5A 2KCKA 3Q4AB 2QFCA 3FWVA 3NF1A 2KCVA 3VTXA 3QDNA 4A1SA 4UI9K 4B94A 2R5SA 1Y8MA 3S7JA 4JHRA 3CVLA 4G23A 4WNGA 1ZBPA 3K9IA 3ASFA 3Q5MA 3GZ2A 1PC2A 1HZ4A 2KATA 5DIZA 1HXIA 4GZ3A 5KJLA 2JLBA 2FI7A 3RO3A 2J9QA 4RG6A 4CDRA 4UQYA 2XGMA 2VGXA 2VQ2A 4HOSA 3CEQA 4YVOA 3CK8A 5FTPA 4XI9A 3RU0A 1IHGA 4AY5A 3KD7A 2PQRA 2IF4A 4WNFA 5CHEE 4GPKA 1QZ2A 5JJ6A 1YA0A 3IEGA 3LY9A 3KAEA 3ZGQA 3TAXA 4G2VA 2DBAA 5BW8C 2FBNA 3TGOA 3OXLA 5EKQD 5ARGA 2Y4UA 4BTBA 4H7XA 3CVQA 4GZ6A 2WPVA 3Q47B 3HYMB 4I2WA 2XGOA 1P5QA 2I6HA 3Q15A 3AS8A 3ZHEB 2BUGA 3UPVA 4AIFA 4Y6WA 4J0UA 5BNWA 2LSVA 1B89A 4U07A 1XNFA 2OOEA 2Q7FA 4GCOA 3QWWA 3S7FA 5G04C 4YNDA 3UUXA 3PE4A 5G04J 5LCWC 4UQXA 4U04A 5LCWJ 3SZ7A 4G26A 4N3CA 5EX0A 4BWRA 3S7DA 4IN3B 3Q49B 4J8FA 4I9EA 1NA3A 1A17A 4BT9A 4YVQC 5FT9A 3CKCA 5C1DA 3LY8A 3O48A 5D0OD 2YQ8A 4N3BA 3BEEA 4JL0A 4WNDA 3CV0A 3N71A 4G24A 5D0QD 3TG4A 2FEZA 3U3WA 4GA1A 1NA0A 4XIFA 3EDTB 1OUVA 5KJMA 4AY6A 4EQFA 2XPIA 1TJCA 2XEVA 1E96B 4N39A 5HI7A 3ZFWA 4I9CA 2HYZA 3ULQA 4NQ0A 1KT1A 3RIBA 4GZ5A 5CCLA 5AYWD 5BT1A 3OXGA 2C2LA 3PE3A 4WNEA 5KJKA 4O6FA 1ELRA 3LYAA 3CK9A 4UQZA 3JYSA 3CK7A 2UY1B 2KCLA 2V5FA 3WXXA 3FFLA 4LEUA 2FO7A 2KC7A 4G1TA 5G05C 4NRHB 3RO2A 5KJNA 2E2EA 3QWVA 4H7YA 3SF4A 4CGVA 3MA5A 4BTAA 2XCBA 4GA2A 5JJ7A 3ASGA 4U0ZA 4GYWA 2LSUA 1ELWA 4F3VA 2ONDA 2NC9A 3RKVA 3OXFA 4I1AA 3LY7A 2P58C 2WQHA 3PDNA 4HOQA 2IFUA 4U0SA 5FZSA 4N5CA 4J8DA 3ZHEA 3GZ1A 5M72A 3U4TA 2FF4A 2VGYA 4XI0A 3QOUA 1HH8A 2PZIA 4HOUA 4ME2A 4Y6CA 4N2QA 1WAO1 1IYGA 2AVPA 4W9RA 2VYIA 3R9AB 4KBQA 4ABNA 3MV2B 3ASHA 5FJYA 2VGXB 5A7DB 3CKBA 4JA9A
chains in the Genus database with same CATH superfamily
3SO8A 4DJAA 4E85A 4V3IA 4OVUA 2DWZA 1KT0A 3C3OA 2KM4A 3P1UA 5FZRA 4HVBA 4CZ2D 5DBKA 5CMYA 2XCCA 3URZA 1Z3XA 3PH0C 4CDMA 4Q69A 5FZQA 3MEKA 2VTBB 4JA7A 4ZFHA 4HRNA 2F8XK 2QZAA 2P9SG 1JWFA 4IULA 3PZ4A 3FTZA 4J8EA 4CDNA 3TL5A 3UINC 2RKKA 4GAAA 4I6EA 3UTMA 1WM5A 4I2ZA 2PQNA 3AS4A 4K5CA 2GW1A 1K3ZD 1OWLA 3OAWA 3Q75A 5BXUA 2JEKA 4BFRA 4XEIG 1N0RA 1UG3A 4R7LA 1U2VG 2UY1A 2XPZA 4CT0A 2EQXA 3S7BA 2XRZA 5C2YA 3L13A 4Q96A 2VSYA 2LAHA 2DCPA 5LP0A 4KXKB 3UXGA 2KCKA 3T8MA 2WXNA 2I2OA 3NF1A 3VTXA 3G2VA 1OWOA 4B94A 1UW4B 3VLDA 2DYSE 2IEJA 3S7JA 4JHRA 1N94A 1N95A 3CVLA 1H6PA 5BUZA 3APFA 5G55A 4A1GA 1TEZA 3K9IA 1JCSA 2QY7A 3EU9A 1IQUA 3ZVVA 2KATA 3IHVA 3HVEA 4TXQA 1UJJA 2FI7A 2NXPA 3CGHA 3ONKA 2KXPC 2J8SD 2P9KG 2WXLA 4YVOA 2P9LG 4EZKA 3PNLB 2H6GA 3CK8A 3ZNGA 3FU3A 2GGFA 3TWRA 4HLEA 3J5PA 4ILHB 4P29A 3Q73A 3ZUVB 3RU0A 2PQRA 2P9IG 4AV7A 4BX9A 4PS8A 5CHEE 5KNHD 1TNYA 5JJ6A 1YA0A 3B7BA 3B95A 3KAEA 2IY0C 3Q78A 4GTVA 4TXPA 4U63A 2GRNB 5CRVA 3BUAA 1AWCB 3TGOA 4E6HA 3UM2A 4BTBA 3CVQA 1SA5A 3B13A 3EHMA 2PM7A 4DX1A 4LNBA 3D9KA 1P5QA 5ENNA 2I6HA 4QFVA 3APDA 1D8DA 3V79K 5KWDA 2XHEA 3B7TA 1TNUA 3MZLB 1N4SA 5A23A 4AP2A 3Q79A 2OOEA 2Q7FA 4XKCA 2GRPB 5G04C 5LCWJ 3SZ7A 4N3CA 1BU9A 2OVFA 4IN3B 1ELKA 1QBQA 2IONA 2ZISA 4HRMB 3C5RA 2PM6A 2DVWA 2RFAA 3HHMA 2J4BA 5IY5E 2YQ8A 1O5MA 4OYSA 4XX5A 4JL0A 2ETAA 3N71A 5JHBA 4IYPA 4NIKA 2J08A 2WMOA 3FEYA 4AXHA 3U3WA 3FEXA 3TXNA 2WXJA 5AQBA 1TJCA 2QYUA 1E96B 3ZFWA 4I9CA 3U66A 2HYZA 1QNFA 4NQ0A 2J4DA 1KT1A 3FH5A 4O60A 3GZSA 5ANRA 4FHJA 5J08A 2L0IA 3JCKC 2C2LA 4LCTA 4RLYA 3QNKA 1ELRA 5ENPD 3LYAA 4GU5A 1K1BA 1N11A 4JXTA 2RFMA 2AWIA 2XS1A 2KCLA 4TUMA 3R9MA 3SQVA 3DSVA 1UJKA 3WXXA 1OY3D 1QYMA 2VSOE 3FFLA 1N52A 2E2EA 3SF4A 4CGVA 1Y6IA 3MA5A 5JJ7A 4URKA 3AU5A 3D9HA 2LSUA 3ASNE 5FIOA 3HIZA 4I1AA 1JCRA 1BD8A 4ANUA 1SQMA 3ABLE 3GZ1A 2L6BA 1Q2ZA 3U4TA 3DPDA 2FF4A 3AG1E 4L2LA 4XI0A 1KZOA 2IQCA 2PZIA 2ZGGA 4JHKA 4L7TA 1OWNA 3J5QB 1RW2A 4DRXE 1TN6A 3ULEG 4HXIA 4BERA 2OEWA 3T9KA 4ABNA 3QARA 3V2OA 5E76A 3FTYA 5FJYA 3DSWA 3FUEA 4K5BA 4JA9A 3ZIMA 2NSZA 3QB2A 4KZCA 3FTVA 4I43A 3ZYKA 4GMJA 4O1PA 3MV3B 4DLOA 5ENRD 2GRRB 3DRAA 3EUVA 2XGSA 5ARFA 5JJTA 2Y1LE 3FP3A 4GYOA 4A55A 4L1BA 1KLXA 2XS8A 3ZN3A 4BETA 3E4BA 3LKUA 4GYYA 3UT8A 2BKKB 2X6IA 3EU5A 4ANVA 4RG9A 4AM9A 1W3BA 5LX8A 3ESKA 4UI9J 4KYOB 3RRUA 3HRAA 5E75A 5ENSD 5B1BE 3CVNA 4LNUD 3D9IA 3KSQA 3ULYA 3EJNA 2GROB 5EIDA 3DSTA 3C3RA 4UWFA 2V4HC 4MRUA 3DEOA 2CFZA 4WUYA 4ANXA 4PS7A 4JEUA 3FH8A 4GA0A 3VTYA 5EIBE 2MHKA 4CGWA 4J6IA 4LRZA 1OT8A 3SNXA 2Y4TA 3GW4A 4TUUA 3HG0D 3SGHA 3RJVA 4DUIA 2IOSA 3LCAA 1BLXB 1HG2A 5CRUA 3TG5A 3G2TA 4GTOA 3MYVA 4DI3A 1RZ4A 4UWGA 2XQ0A 5G2NA 3RAUA 2IJGX 5BXOA 3CHSA 2R59A 4GTQA 4HLLA 2NYJA 3FUMA 2GRQB 4JHJA 3UMVA 3EIJA 3R7RA 2FO1E 2WXRA 3DPYA 5CMWA 2R17C 2J09A 4YDWA 3Q5MA 3AJIA 3GZ2A 2YNQA 2GRMA 1MZCA 1HZ4A 5KCMA 5AJDA 5DIZA 1H0AA 4A3VA 3HXCA 1HXIA 5JHAA 3RO3A 2WQ6A 1FVFA 2KZTA 5FWQA 3SBSA 3LVQE 4CDRA 3LJNA 5H7PA 3LDZA 3C72A 3CEQA 4GZCA 2VGEA 3CHRA 5ENOD 3S2AA 4F1PA 2EIJE 1G3NB 3PEUB 4XI9A 2LUHA 4C0EA 2IF4A 3CVUA 4DX2A 3IV0A 5JMND 3LEWA 2KBXA 2WXKA 3SFXA 3UM0A 2DBAA 1KPSB 1N4RA 3T8KA 3MKQA 2FBNA 3OXLA 1O1SA 2WXIA 3UIPC 5CERB 1H6OA 5ARGA 4FULA 3HYMB 2XGOA 2AXVA 2CHZA 5KBAA 1VDYA 5BV1A 3CHPA 3ZHEB 3UPVA 4B0ZA 5FQ6A 4JW1A 2X6JA 1IKND 5BNWA 1K1AA 4HB5A 1B89A 4RSYA 4KMOA 3S7FA 4CYMD 1MQSA 4DX5D 2Y0BG 5EN5D 4XE0A 3UUXA 4UUCA 4GZDA 5LCWC 3FUNA 1OXJA 3UT7A 4G26A 5EX0A 1TNZA 3LXUX 3S7DA 3E32A 4I9EA 1FT2A 4TRQA 1NA3A 3FUHA 1A17A 4BT9A 4YVQC 4NACA 5FT9A 5ITZF 3CR3A 3CVYA 4U7EB 1SA4A 5AENA 5LOZA 2WXOA 4C0MA 4GMLA 3L9TA 1HO8A 1NI1A 2EINE 3CV0A 5D0QD 3HXFA 4UWHA 1N54A 3MJWA 3TG4A 3L6AA 1U3CA 1UN9A 1NL4A 1NA0A 1V54E 1HS6A 4XIFA 3V30A 1OUVA 4G8KA 5KJMA 2DYRE 3KEAA 3U9WA 3QC1A 3PZ1A 3ZYLA 2XEVA 4N39A 4MKTA 4HRLA 4PDXA 5CCLA 3NZSA 1DCEA 5AYWD 2OV8A 3O4ZA 1Z6TA 4TXRA 4BEPA 2WM9A 4O6FA 4JPSA 2I9CA 2XZTG 4K0RA 3V31A 3T5XA 5AARA 4MS6A 3CK7A 1E8ZA 2UY1B 2P9UG 1S63A 2H6HA 2KC7A 4QQIA 3QWVA 3LS8A 3ZXPA 1LF8A 4A63B 4BTAA 3NZUA 3CHQA 3D3MA 3ASGA 4U0ZA 2LO6A 1X5BA 4GYWA 5CEDB 3HXDA 1ELWA 1HE8A 3D9PA 1H2VC 3V2XA 3RKVA 2B0OE 3FUIA 1LD7A 1OWPA 2F37A 2X6HA 3D9JA 3L17A 4L23A 1INZA 4LUNU 2YHEA 3HVEB 1WAO1 2VYIA 1V55E 4KBQA 1BPOA 2RG8A 3CVXA 3ASHA 4HI8A 2VGYA 3QJZA 3F6QA 4UWKA 5D2MC 3G2SA 2XPYA 1E90A 4DI4A 2F0YA 3AS5A 5HQ8A 3PZ2A 3QAQA 3ZPJA 3HXEA 3JQ0A 5FQ7A 3IKOB 2YHCA 3APCA 1YYHA 3UQ3A 4I17A 2CG3A 2UWJG 3D9OA 5ENTD 4ACKA 1SW6A 4WWPA 1E7UA 4UI9C 4AEZC 4BT8A 2VSNA 3BG0B 3TWUA 2PL2A 5EYPF 3PVLA 3QWPA 3HDXA 4I1OB 3L82A 3TWXA 2C0MA 2MYOA 3CSFA 1HX8A 4N3AA 3CIAA 2MOWA 4JD2G 4JC8A 3DEPA 4U95D 5CCMA 2ETCA 3TWWA 4WWOA 3Q9NC 3CVWA 2A5EA 4J8SA 3ASDA 3I5PA 3ABKE 3D9NA 5CEAA 5EX3A 3CVVA 1TJFA 2HR2A 1OCOE 1ZU2A 4JEHA 4FA6A 3FUJA 3HXBA 4C9BB 3FU6A 1DNPA 4GTTA 1S0PA 3EIQC 1NZNA 4GCNA 4HORA 3MKRA 1E8XA 3D9LA 3LJ3A 2AJAA 4NURA 3Q4AB 2A4ZA 1MX4A 2QFCA 3BQOA 3TJPA 1SZAA 2M63A 1XGWA 2KCVA 2DZOA 1DVPA 2GRLA 1DCQA 2B6CA 2R5SA 4TV3A 2P2CP 1N9AA 1L5JA 3DSXA 5T4YA 1HFAA 4EHMA 3JXJA 3Q7FA 1Y8MA 2WVIA 4G23A 4WNGA 3JQ1A 3CHMA 4HNAD 3FTXA 3RK6A 3RRMB 5HS0A 3SFZA 3ONLA 4CCAA 1TYQG 1E8YA 4RG6A 4UQYA 2XGMA 4Z68A 2VGXA 2H6FA 4JZYA 5KNGA 2VSXE 5AN8A 1E8WA 3R7QA 1SVXA 1YCSB 1H2TC 3KEZA 4N5QA 1WG0A 1PAQA 3W9GA 3TXMA 4GTPA 4HQDA 4AY5A 3KD7A 4RQIA 4DX7D 4U8YD 1EYHA 1QZ2A 1UOHA 3PEVB 4I6GA 3IEGA 3LY9A 2E0IA 4D10C 4FP7A 3FY4A 3NBNB 2VTBA 5BW8C 2WQ7A 5EKQD 2Y4UA 4H7XA 1YMPA 4GZ6A 3NOCD 4EZJA 4GTRA 5EYLA 3UM3A 2WXFA 1IHBA 2HE0A 3Q15A 3UKRG 3ZYMA 3T5VA 4AIFA 2ILRA 4J0UA 1UN8A 2LSVA 4KZ0A 3E37A 4LG6A 4ANWA 4BX8A 4YDYA 1XNFA 4GCOA 1X81A 1MX2A 5FINA 4YNDA 3PE4A 5AIJA 2WB2A 4K03A 3PREA 4KVOA 2A5UA 5BV0A 3Q49B 5HKPA 2OEVA 5FQ8A 4GMRA 3NOGD 5HRYA 2CFUA 1Z5SC 3CKCA 3AG3E 1TN8A 2ZGDA 3FULA 3DXMG 2BKGA 3CLJA 3FU5A 2LXMA 2FULA 1K8KG 4N3BA 3SHFA 1HF8A 3BEEA 2JABA 4WNDA 3L16A 4G11A 2DZNA 4FLBA 5EILA 2AW6A 4F1SA 4GTMA 4HBDA 3FHEA 4B8AA 4YDOA 3WG7E 4DLQA 4GA1A 2V4LA 3DXKG 3B7RL 1JUQA 4ILGA 4OVVA 4EQFA 2XPIA 4GPMA 2H6IA 2CHXA 5HI7A 4FJYA 3EHQA 5AQ7A 3ULQA 3UI2A 2IO3C 4EBAG 5D66A 3PS6A 1OCRE 5BT1A 3PE3A 1SZ9A 2RD0A 2V5QC 4FJZA 3FH7A 3NQPA 3TWSA 3CK9A 4Q94A 1MHQA 2ZU6B 3ZRHA 3FTWA 3I4RB 2FO7A 5G05C 4G1TA 3SY2A 3RO2A 4PUCA 4OAUC 2XCBA 4EECA 2R05A 3ISMC 2F8YA 2OCCE 2J07A 2IO2C 1NFIE 2OVBA 4KT6B 4F3VA 2ONDA 1HG5A 4EPZA 3OXFA 5JA4D 5ENQD 3VLFA 5T3RA 3SFYA 2WQHA 3PDNA 4HOQA 1BI8B 4U0SA 5FZSA 4N5CA 3IBEA 4J8DA 2XEHA 1TNOA 1MJ0A 1OWMA 3QOUA 3PNTB 1HH8A 4HOUA 4ME2A 4Y6CA 4X8QA 2AVPA 1IYGA 4XKBA 4W9RA 3D9MA 5J90A 4OAVB 4U8HA 2KZTB 3BU8A 4CEMA 1E7VA 5CECB 3AG4E 5A7DB 3CKBA 1MYOA 5T8IA 2LNIA 3ZYQA 3ZW3A 2HO1A 4N2SA 5AQ9A 4ATGA 1EDUA 1TNBA 5CBNA 2V0PA 1GW6A 1FCHA 3KS2A 1O1TA 1FT1A 3Q7AA 1N4PA 3I3NA 2R02A 4U0UA 2X6KA 2EIKE 2XZDG 3L22A 3PZDA 1OCCE 1D9SA 3ASOE 3L08A 3UKUG 3MKQB 2IU1A 4FHKA 3X2QE 3UM1A 3LPZA 3CVPA 3GYZA 4L2YA 3ZKJA 1OCZE 5BPPA 3SBTB 1QQEA 2L6JA 3MGBA 3FTUA 2AXUA 5A6CA 2PNNA 4HOTA 3QKYA 4U96D 5AJLA 5G05J 3ZU7B 2P9NG 3DWLG 3SD5A 4DPRA 1A5EA 1D8EA 3DSSA 4ACLA 3VLEA 2LXLA 3RSEG 2XRYA 3TWQA 4UWLA 4BY6A 2ZXWE 4G25A 2EILE 1U3DA 4APOA 1DC2A 4CRWA 2Y69E 4ZHBA 2BEDA 4LERA 3FWVA 3PUJA 3QDNA 4A1SA 3EHNA 1ZB1A 3FTSA 4UI9K 4FADA 5LFAA 4B89A 3E34A 4EBAA 2DIWA 3FU0A 1JCQA 2XEEA 4L9PA 4B8CB 1ZBPA 3ASFA 2WXMA 3LVRE 4WAFA 5EDSA 1PC2A 3ML9A 4LSZE 2X3MA 1JWGA 4O1OA 3C3QA 2V8SE 4GZ3A 5KJLA 2JLBA 1TN7A 4B93B 2J49A 2J9QA 3ESLA 1EF1C 3E30A 5AQAA 2VQ2A 4DK5A 2Y3AA 4HOSA 4AOFA 4F6RD 4CT4A 4J8YA 4FC8A 3MX3A 1JPLA 5FTPA 4BESA 3UX4A 2WXPA 1LTXA 2BTDA 1IHGA 3JUIA 4BSXA 2R03A 4WNFA 4I1MA 4GPKA 4WWNA 3CHOA 3AAAC 3ZGQA 4IRUA 4G2VA 3TAXA 4F7AA 2IOLA 2I1KA 3G2UA 1H2UA 2X6FA 1WDYA 3JUEA 2WPVA 3Q47B 4I2WA 2ZIRA 1EPUA 3EHRA 3AS8A 4HS2A 1S64A 2BUGA 3NAWA 2ETBA 4Y6WA 4LNGA 3E33A 3DBSA 4MLPA 2QC9A 4F53A 3BG1B 2QYJA 2P9PG 3JXIA 4U07A 3AU4A 4FLHA 4JB8P 1LD8A 3QWWA 3I4GA 4HFGA 4PH4B 5G04J 4UQXA 2AXZA 4U04A 4JVSA 3ENEA 4RVBA 4BWRA 3DSUA 1IXVA 3RRNB 3ZEFA 4J8FA 3G2WA 2WMNA 4EZLA 3CQCB 1AP7A 2R2LA 4DX6D 5B3SE 1N4QA 3C98A 3ABME 5C1DA 3FUKA 3LY8A 3O48A 5D0OD 1H6KA 4J7WA 5B1AE 4ATZD 4G24A 4FU3A 4C48B 2FEZA 2I1JA 2CHWA 3L54A 3ZXSA 3IHYA 3CQGB 3EDTB 1O1RA 1H19A 1KZPA 3KSLA 3SI5A 4AY6A 3CSTA 4G8LA 4BSZB 1Z3YA 2EIME 5FQ4A 1S70B 3RIBA 4GZ5A 2YINA 2CG2A 3U64A 3NB2A 2VJ8A 3AG2E 1PY1A 3OXGA 2WXQA 3P2BA 4WNEA 5KJKA 4I6JA 3B7UX 5CBOA 2MRIA 4APFA 1IQRA 1N0QA 2X38A 3PUKA 4UQZA 3JYSA 4AVXA 3FDHA 2WXHA 4KVMA 4M7CA 4U8VD 3TWVA 2V5FA 5ANLA 4XZ4A 2XENA 2BF0X 4LEUA 4NRHB 1TR4A 5KJNA 4H7YA 1FPPA 3QK0A 4HI9A 4M3OA 3Q9UC 3TWTA 4AJWA 4GA2A 2HM8A 3PRZA 1MX6A 3FUDA 2NC9A 1NP7A 4YDEA 3LY7A 2P58C 2WXGA 4MBGA 2IFUA 3OTNA 3IXEA 3ZHEA 4ILIA 1HU3A 5M72A 3W9FA 1WY6A 3MCXA 2L0TB 1BI7B 4A3TA 3PZ3A 3FUFA 4K5AB 5AAOA 2L9BA 3ML8A 4PS3A 4N2QA 1FVHA 3R9AB 2LAIA 3B7SA 3MV2B 4GB9A 3UIOC 4GTSA 2VGXB 3UT4A 2C0LA
chains in the Genus database with same CATH topology
3QJZA 5T8IA 3ZIMA 2LNIA 4UWKA 4DJAA 3G2SA 3ZYQA 3ZW3A 4E85A 4V3IA 2NSZA 2XPYA 1E90A 4DI4A 2HO1A 3AS5A 3QB2A 4KZCA 5HQ8A 4N2SA 3FTVA 4OVUA 4I43A 3ZYKA 4ATGA 1EDUA 4GMJA 3MV3B 4DLOA 4JA9A 3QAQA 1KT0A 3ZPJA 2XGSA 3JQ0A 2KM4A 2V0PA 5ARFA 1GW6A 3IKOB 5FQ7A 1FCHA 3P1UA 3KS2A 2YHCA 5FZRA 4HVBA 3APCA 5DBKA 5CMYA 5JJTA 3FP3A 2XCCA 3URZA 4GYOA 4A55A 1Z3XA 3I3NA 3UQ3A 4L1BA 4I17A 1KLXA 3PH0C 4CDMA 4Q69A 5FZQA 4U0UA 2CG3A 2UWJG 2X6KA 3D9OA 3L22A 3ZN3A 3PZDA 3E4BA 3LKUA 4GYYA 3UT8A 4ACKA 3MEKA 2X6IA 2VTBB 4WWPA 4ANVA 4RG9A 4AM9A 1E7UA 3L08A 4JA7A 4UI9C 1W3BA 5LX8A 3MKQB 2IU1A 4FHKA 4AEZC 3ESKA 4UI9J 4BT8A 2VSNA 3BG0B 3LPZA 4KYOB 1JWFA 2PL2A 4IULA 3CVPA 3GYZA 3RRUA 4L2YA 3PVLA 5BPPA 3QWPA 3HDXA 3SBTB 4I1OB 3FTZA 4J8EA 5E75A 1QQEA 2L6JA 3MGBA 4CDNA 2C0MA 3CSFA 3CVNA 3D9IA 3FTUA 3TL5A 1HX8A 4GAAA 4I6EA 2AXUA 4N3AA 3CIAA 1WM5A 5A6CA 3EJNA 4I2ZA 4HOTA 2MOWA 2PQNA 3QKYA 3AS4A 4JC8A 2GW1A 1OWLA 4UWFA 5AJLA 5G05J 4MRUA 3OAWA 5CCMA 2CFZA 2JEKA 4BFRA 4WWOA 4WUYA 4ANXA 3CVWA 4J8SA 1UG3A 3ASDA 3I5PA 4JEUA 3FH8A 4PS7A 4R7LA 3SD5A 4GA0A 3VTYA 4DPRA 2MHKA 4CGWA 4J6IA 3D9NA 4ACLA 4LRZA 2UY1A 3SNXA 5EX3A 2Y4TA 2XPZA 3GW4A 3CVVA 1TJFA 2HR2A 4CT0A 1ZU2A 2EQXA 4JEHA 3VLEA 4TUUA 3S7BA 4FA6A 2XRZA 5C2YA 3FUJA 3SGHA 4C9BB 2XRYA 3FU6A 3RJVA 3L13A 1DNPA 4Q96A 2VSYA 1S0PA 4UWLA 2IOSA 2LAHA 3EIQC 2DCPA 3LCAA 1NZNA 4BY6A 4G25A 5LP0A 4GCNA 4HORA 1U3DA 4KXKB 4APOA 3MKRA 1E8XA 1HG2A 3TG5A 3G2TA 4CRWA 2KCKA 3D9LA 3LJ3A 3MYVA 4NURA 3Q4AB 4DI3A 4UWGA 2XQ0A 4LERA 3T8MA 2A4ZA 2WXNA 5G2NA 2QFCA 5KCMA 2IJGX 3FWVA 3TJPA 1SZAA 3PUJA 2I2OA 3NF1A 2M63A 1XGWA 2KCVA 3VTXA 3G2VA 3QDNA 4A1SA 1OWOA 3EHNA 1DVPA 2GRLA 3CHSA 3FTSA 4UI9K 4B94A 2R59A 4FADA 1UW4B 2R5SA 3VLDA 5LFAA 4TV3A 1L5JA 4B89A 3FUMA 4EBAA 2DIWA 3FU0A 4JHJA 3UMVA 3EIJA 5T4YA 1HFAA 3R7RA 1Y8MA 3S7JA 4JHRA 4B8CB 2WVIA 3CVLA 5BUZA 3APFA 2WXRA 4G23A 4WNGA 5CMWA 1ZBPA 2R17C 5G55A 4A1GA 2J09A 1TEZA 3K9IA 3ASFA 2WXMA 3Q5MA 2QY7A 3LVRE 4WAFA 3GZ2A 5EDSA 1PC2A 1IQUA 2GRMA 2YNQA 3ML9A 3ZVVA 1HZ4A 2KATA 2X3MA 3IHVA 3CHMA 3JQ1A 3FTXA 3HVEA 1H0AA 1JWGA 5AJDA 5DIZA 4A3VA 3RK6A 3RRMB 1HXIA 2V8SE 4GZ3A 3SFZA 5KJLA 2JLBA 3ONLA 1UJJA 2FI7A 2NXPA 3CGHA 5JHAA 3ONKA 4CCAA 3RO3A 2WQ6A 1FVFA 2KZTA 5FWQA 3SBSA 1E8YA 2J49A 2J9QA 3LVQE 4RG6A 3ESLA 4UQYA 4CDRA 1EF1C 2XGMA 2VGXA 4JZYA 2VSXE 3LDZA 2WXLA 2VQ2A 4DK5A 1E8WA 2Y3AA 4HOSA 3CEQA 4YVOA 3R7QA 4AOFA 4GZCA 4CT4A 4EZKA 4FC8A 3PNLB 3MX3A 1JPLA 3CHRA 1H2TC 3CK8A 3KEZA 3FU3A 2GGFA 5FTPA 4HLEA 3S2AA 3UX4A 2WXPA 1PAQA 3PEUB 4ILHB 4P29A 4XI9A 3TXMA 2BTDA 3RU0A 1IHGA 4AY5A 3KD7A 4C0EA 2PQRA 3JUIA 4BSXA 2IF4A 4AV7A 4BX9A 4PS8A 4WNFA 3CVUA 5CHEE 4I1MA 1EYHA 4GPKA 3IV0A 1QZ2A 4WWNA 3LEWA 3PEVB 5JJ6A 1YA0A 2WXKA 3CHOA 3IEGA 4I6GA 3LY9A 3KAEA 2E0IA 3ZGQA 3CKBA 4D10C 4FP7A 4IRUA 4G2VA 3TAXA 3FY4A 4F7AA 2IOLA 2DBAA 2VTBA 5BW8C 4U63A 2I1KA 3MKQA 2WQ7A 3G2UA 1H2UA 2X6FA 2FBNA 3TGOA 3OXLA 2WXIA 4E6HA 5EKQD 5ARGA 2Y4UA 4BTBA 4H7XA 3CVQA 3B13A 4GZ6A 3EHMA 2PM7A 2WPVA 4FULA 3Q47B 3HYMB 4I2WA 3D9KA 2XGOA 4EZJA 2AXVA 2CHZA 1P5QA 1VDYA 2I6HA 4QFVA 5ENNA 5BV1A 2WXFA 3CHPA 3Q15A 1EPUA 3AS8A 3ZYMA 4HS2A 3ZHEB 2BUGA 3UPVA 4B0ZA 3T5VA 5FQ6A 4AIFA 3APDA 4Y6WA 4JW1A 2X6JA 2ILRA 4J0UA 2XHEA 3B7TA 3DBSA 4MLPA 5BNWA 1UN8A 2LSVA 4KZ0A 3BG1B 3MZLB 4ANWA 4F53A 1B89A 4BX8A 5A23A 4U07A 4AP2A 1XNFA 2OOEA 3AU4A 4FLHA 4RSYA 2Q7FA 4GCOA 3QWWA 4KMOA 4XKCA 3I4GA 4HFGA 4PH4B 1MQSA 3S7FA 5G04C 4XE0A 4YNDA 3UUXA 3PE4A 5G04J 5AIJA 4GZDA 5LCWC 4UQXA 2AXZA 4U04A 4JVSA 2WB2A 3ENEA 3FUNA 4RVBA 3UT7A 5LCWJ 3SZ7A 4G26A 4N3CA 5EX0A 4BWRA 2OVFA 4K03A 3PREA 4KVOA 3RRNB 2A5UA 5BV0A 3LXUX 3S7DA 3ZEFA 4IN3B 3Q49B 4J8FA 4I9EA 3G2WA 5FQ8A 2WMNA 4TRQA 4EZLA 3CQCB 1ELKA 1NA3A 3FUHA 1A17A 2CFUA 3C98A 4BT9A 4YVQC 4NACA 5FT9A 2IONA 3CKCA 3CR3A 5C1DA 3CVYA 3FUKA 3LY8A 2PM6A 5AENA 3HHMA 3FULA 3O48A 5LOZA 3CLJA 2WXOA 3FU5A 5D0OD 2J4BA 1H6KA 2YQ8A 4C0MA 2FULA 4N3BA 4GMLA 4OYSA 3SHFA 1HF8A 3BEEA 4XX5A 1HO8A 4JL0A 4WNDA 3L16A 3CV0A 4G11A 3N71A 4G24A 5D0QD 5JHBA 4FU3A 4IYPA 4FLBA 4UWHA 1N54A 2J08A 2WMOA 3MJWA 3L6AA 3TG4A 2FEZA 2AW6A 4F1SA 2I1JA 2CHWA 3FHEA 1U3CA 3FEYA 4B8AA 1UN9A 4DLQA 4AXHA 3U3WA 4GA1A 3L54A 1NA0A 3ZXSA 2V4LA 3IHYA 3FEXA 1HS6A 4XIFA 3B7RL 3TXNA 3CQGB 1JUQA 3EDTB 1OUVA 4ILGA 1H19A 4OVVA 3SI5A 5KJMA 4AY6A 4EQFA 2XPIA 2WXJA 3CSTA 2CHXA 3U9WA 1TJCA 3QC1A 3ZYLA 2XEVA 1E96B 4N39A 5HI7A 3ZFWA 1Z3YA 4FJYA 4I9CA 4MKTA 3U66A 2HYZA 1QNFA 5FQ4A 4NQ0A 3ULQA 2J4DA 1KT1A 3FH5A 3GZSA 3RIBA 5ANRA 4GZ5A 2YINA 4EBAG 4PDXA 2CG2A 4FHJA 5CCLA 3NZSA 3PS6A 3U64A 5J08A 5AYWD 2VJ8A 2OV8A 3O4ZA 1PY1A 1Z6TA 5BT1A 2L0IA 3JCKC 3OXGA 2WXQA 2C2LA 3P2BA 2WM9A 3PE3A 4WNEA 5KJKA 1SZ9A 4I6JA 4LCTA 3QNKA 2RD0A 4O6FA 1ELRA 4JPSA 3B7UX 2I9CA 4K0RA 4FJZA 3FH7A 3LYAA 4GU5A 2MRIA 3NQPA 1IQRA 4APFA 3T5XA 3CK9A 4JXTA 4Q94A 2X38A 3PUKA 4UQZA 1MHQA 3JYSA 4MS6A 3CK7A 1E8ZA 2UY1B 2AWIA 4AVXA 3FDHA 2WXHA 4KVMA 2ZU6B 2KCLA 2V5FA 5ANLA 4XZ4A 3ZRHA 3FTWA 1UJKA 2BF0X 3I4RB 3WXXA 2VSOE 3FFLA 4LEUA 2FO7A 2KC7A 4G1TA 5G05C 4NRHB 1N52A 3RO2A 4PUCA 2E2EA 3LS8A 3QWVA 4H7YA 3SF4A 3QK0A 5KJNA 4CGVA 1Y6IA 1LF8A 4M3OA 3MA5A 4BTAA 2XCBA 4AJWA 3NZUA 4EECA 4GA2A 2HM8A 3PRZA 3CHQA 3D3MA 5JJ7A 3ASGA 2J07A 4U0ZA 3AU5A 2LO6A 4URKA 1X5BA 4GYWA 2LSUA 1ELWA 1HE8A 2OVBA 4KT6B 4F3VA 3D9PA 1H2VC 2ONDA 3HIZA 3FUDA 1HG5A 2NC9A 4EPZA 3RKVA 3OXFA 1NP7A 4I1AA 3LY7A 3VLFA 2P58C 5T3RA 4ANUA 3FUIA 2WXGA 2WQHA 3PDNA 1OWPA 4HOQA 2IFUA 4U0SA 3OTNA 1SQMA 5FZSA 4N5CA 3IBEA 4J8DA 3ZHEA 4ILIA 1HU3A 3GZ1A 5M72A 1WY6A 2X6HA 3U4TA 3D9JA 3MCXA 3DPDA 3L17A 4L23A 2FF4A 2L0TB 1INZA 4L2LA 4LUNU 4XI0A 4A3TA 1OWMA 3QOUA 2IQCA 3PNTB 1HH8A 2PZIA 3FUFA 2L9BA 4JHKA 4L7TA 1OWNA 2YHEA 3HVEB 4HOUA 4ME2A 4Y6CA 3ML8A 4PS3A 4N2QA 1WAO1 1IYGA 2AVPA 1FVHA 4XKBA 4W9RA 2VYIA 4HXIA 3R9AB 2LAIA 3D9MA 5J90A 3B7SA 4KBQA 4U8HA 4ABNA 3MV2B 1BPOA 2RG8A 2KZTB 3ASHA 3CVXA 3QARA 4GB9A 5E76A 3FTYA 5FJYA 4CEMA 3FUEA 1E7VA 2VGXB 3UT4A 5A7DB 2C0LA 2VGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNI A;  2HO1 A;  3AS5 A;  5HQ8 A;  4N2S A;  3MV3 B;  1KT0 A;  3ZPJ A;  2XGS A;  5ARF A;  1FCH A;  3KS2 A;  2YHC A;  5FZR A;  5DBK A;  5JJT A;  3FP3 A;  2XCC A;  3URZ A;  4GYO A;  3UQ3 A;  4I17 A;  1KLX A;  5FZQ A;  4U0U A;  2UWJ G;  3ZN3 A;  3E4B A;  3LKU A;  4GYY A;  3MEK A;  4RG9 A;  4AM9 A;  4JA7 A;  4UI9 C;  1W3B A;  3ESK A;  4UI9 J;  4BT8 A;  2VSN A;  3LPZ A;  4KYO B;  2PL2 A;  3CVP A;  3GYZ A;  2C0L A;  3QWP A;  4J8E A;  1QQE A;  2L6J A;  2C0M A;  3CVN A;  4N3A A;  1WM5 A;  5A6C A;  4I2Z A;  4HOT A;  2PQN A;  3QKY A;  3AS4 A;  2GW1 A;  5G05 J;  5CCM A;  4WUY A;  3ASD A;  4GA0 A;  3VTY A;  2MHK A;  4CGW A;  2UY1 A;  5EX3 A;  2Y4T A;  3GW4 A;  2HR2 A;  1ZU2 A;  3S7B A;  3RJV A;  2VSY A;  3LCA A;  1NZN A;  4G25 A;  4GCN A;  4HOR A;  4KXK B;  4APO A;  3MKR A;  3TG5 A;  2KCK A;  3Q4A B;  2QFC A;  3FWV A;  3NF1 A;  2KCV A;  3VTX A;  3QDN A;  4A1S A;  4UI9 K;  4B94 A;  2R5S A;  1Y8M A;  3S7J A;  4JHR A;  3CVL A;  4G23 A;  4WNG A;  1ZBP A;  3K9I A;  3ASF A;  3Q5M A;  3GZ2 A;  1PC2 A;  1HZ4 A;  2KAT A;  5DIZ A;  1HXI A;  4GZ3 A;  5KJL A;  2JLB A;  2FI7 A;  3RO3 A;  2J9Q A;  4RG6 A;  4CDR A;  4UQY A;  2XGM A;  2VGX A;  2VQ2 A;  4HOS A;  3CEQ A;  4YVO A;  3CK8 A;  5FTP A;  4XI9 A;  3RU0 A;  1IHG A;  4AY5 A;  3KD7 A;  2PQR A;  2IF4 A;  4WNF A;  5CHE E;  4GPK A;  1QZ2 A;  5JJ6 A;  1YA0 A;  3IEG A;  3LY9 A;  3KAE A;  3ZGQ A;  3TAX A;  4G2V A;  2DBA A;  5BW8 C;  2FBN A;  3TGO A;  3OXL A;  5EKQ D;  5ARG A;  2Y4U A;  4BTB A;  4H7X A;  3CVQ A;  4GZ6 A;  2WPV A;  3Q47 B;  3HYM B;  4I2W A;  2XGO A;  1P5Q A;  2I6H A;  3Q15 A;  3AS8 A;  3ZHE B;  2BUG A;  3UPV A;  4AIF A;  4Y6W A;  4J0U A;  5BNW A;  2LSV A;  1B89 A;  4U07 A;  1XNF A;  2OOE A;  2Q7F A;  4GCO A;  3QWW A;  3S7F A;  5G04 C;  4YND A;  3UUX A;  3PE4 A;  5G04 J;  5LCW C;  4UQX A;  4U04 A;  5LCW J;  3SZ7 A;  4G26 A;  4N3C A;  5EX0 A;  4BWR A;  3S7D A;  4IN3 B;  3Q49 B;  4J8F A;  4I9E A;  1NA3 A;  1A17 A;  4BT9 A;  4YVQ C;  5FT9 A;  3CKC A;  5C1D A;  3LY8 A;  3O48 A;  5D0O D;  2YQ8 A;  4N3B A;  3BEE A;  4JL0 A;  4WND A;  3CV0 A;  3N71 A;  4G24 A;  5D0Q D;  3TG4 A;  2FEZ A;  3U3W A;  4GA1 A;  1NA0 A;  4XIF A;  3EDT B;  1OUV A;  5KJM A;  4AY6 A;  4EQF A;  2XPI A;  1TJC A;  2XEV A;  1E96 B;  4N39 A;  5HI7 A;  3ZFW A;  4I9C A;  2HYZ A;  3ULQ A;  4NQ0 A;  1KT1 A;  3RIB A;  4GZ5 A;  5CCL A;  5AYW D;  5BT1 A;  3OXG A;  2C2L A;  3PE3 A;  4WNE A;  5KJK A;  4O6F A;  1ELR A;  3LYA A;  3CK9 A;  4UQZ A;  3JYS A;  3CK7 A;  2UY1 B;  2KCL A;  2V5F A;  3WXX A;  3FFL A;  4LEU A;  2FO7 A;  2KC7 A;  4G1T A;  5G05 C;  4NRH B;  3RO2 A;  5KJN A;  2E2E A;  3QWV A;  4H7Y A;  3SF4 A;  4CGV A;  3MA5 A;  4BTA A;  2XCB A;  4GA2 A;  5JJ7 A;  3ASG A;  4U0Z A;  4GYW A;  2LSU A;  1ELW A;  4F3V A;  2OND A;  2NC9 A;  3RKV A;  3OXF A;  4I1A A;  3LY7 A;  2P58 C;  2WQH A;  3PDN A;  4HOQ A;  2IFU A;  4U0S A;  5FZS A;  4N5C A;  4J8D A;  3ZHE A;  3GZ1 A;  5M72 A;  3U4T A;  2FF4 A;  2VGY A;  4XI0 A;  3QOU A;  1HH8 A;  2PZI A;  4HOU A;  4ME2 A;  4Y6C A;  4N2Q A;  1WAO 1;  1IYG A;  2AVP A;  4W9R A;  2VYI A;  3R9A B;  4KBQ A;  4ABN A;  3MV2 B;  3ASH A;  5FJY A;  2VGX B;  5A7D B;  3CKB A;  4JA9 A; 
#chains in the Genus database with same CATH topology
 3SO8 A;  4DJA A;  4E85 A;  4V3I A;  4OVU A;  2DWZ A;  1KT0 A;  3C3O A;  2KM4 A;  3P1U A;  5FZR A;  4HVB A;  4CZ2 D;  5DBK A;  5CMY A;  2XCC A;  3URZ A;  1Z3X A;  3PH0 C;  4CDM A;  4Q69 A;  5FZQ A;  3MEK A;  2VTB B;  4JA7 A;  4ZFH A;  4HRN A;  2F8X K;  2QZA A;  2P9S G;  1JWF A;  4IUL A;  3PZ4 A;  3FTZ A;  4J8E A;  4CDN A;  3TL5 A;  3UIN C;  2RKK A;  4GAA A;  4I6E A;  3UTM A;  1WM5 A;  4I2Z A;  2PQN A;  3AS4 A;  4K5C A;  2GW1 A;  1K3Z D;  1OWL A;  3OAW A;  3Q75 A;  5BXU A;  2JEK A;  4BFR A;  4XEI G;  1N0R A;  1UG3 A;  4R7L A;  1U2V G;  2UY1 A;  2XPZ A;  4CT0 A;  2EQX A;  3S7B A;  2XRZ A;  5C2Y A;  3L13 A;  4Q96 A;  2VSY A;  2LAH A;  2DCP A;  5LP0 A;  4KXK B;  3UXG A;  2KCK A;  3T8M A;  2WXN A;  2I2O A;  3NF1 A;  3VTX A;  3G2V A;  1OWO A;  4B94 A;  1UW4 B;  3VLD A;  2DYS E;  2IEJ A;  3S7J A;  4JHR A;  1N94 A;  1N95 A;  3CVL A;  1H6P A;  5BUZ A;  3APF A;  5G55 A;  4A1G A;  1TEZ A;  3K9I A;  1JCS A;  2QY7 A;  3EU9 A;  1IQU A;  3ZVV A;  2KAT A;  3IHV A;  3HVE A;  4TXQ A;  1UJJ A;  2FI7 A;  2NXP A;  3CGH A;  3ONK A;  2KXP C;  2J8S D;  2P9K G;  2WXL A;  4YVO A;  2P9L G;  4EZK A;  3PNL B;  2H6G A;  3CK8 A;  3ZNG A;  3FU3 A;  2GGF A;  3TWR A;  4HLE A;  3J5P A;  4ILH B;  4P29 A;  3Q73 A;  3ZUV B;  3RU0 A;  2PQR A;  2P9I G;  4AV7 A;  4BX9 A;  4PS8 A;  5CHE E;  5KNH D;  1TNY A;  5JJ6 A;  1YA0 A;  3B7B A;  3B95 A;  3KAE A;  2IY0 C;  3Q78 A;  4GTV A;  4TXP A;  4U63 A;  2GRN B;  5CRV A;  3BUA A;  1AWC B;  3TGO A;  4E6H A;  3UM2 A;  4BTB A;  3CVQ A;  1SA5 A;  3B13 A;  3EHM A;  2PM7 A;  4DX1 A;  4LNB A;  3D9K A;  1P5Q A;  5ENN A;  2I6H A;  4QFV A;  3APD A;  1D8D A;  3V79 K;  5KWD A;  2XHE A;  3B7T A;  1TNU A;  3MZL B;  1N4S A;  5A23 A;  4AP2 A;  3Q79 A;  2OOE A;  2Q7F A;  4XKC A;  2GRP B;  5G04 C;  5LCW J;  3SZ7 A;  4N3C A;  1BU9 A;  2OVF A;  4IN3 B;  1ELK A;  1QBQ A;  2ION A;  2ZIS A;  4HRM B;  3C5R A;  2PM6 A;  2DVW A;  2RFA A;  3HHM A;  2J4B A;  5IY5 E;  2YQ8 A;  1O5M A;  4OYS A;  4XX5 A;  4JL0 A;  2ETA A;  3N71 A;  5JHB A;  4IYP A;  4NIK A;  2J08 A;  2WMO A;  3FEY A;  4AXH A;  3U3W A;  3FEX A;  3TXN A;  2WXJ A;  5AQB A;  1TJC A;  2QYU A;  1E96 B;  3ZFW A;  4I9C A;  3U66 A;  2HYZ A;  1QNF A;  4NQ0 A;  2J4D A;  1KT1 A;  3FH5 A;  4O60 A;  3GZS A;  5ANR A;  4FHJ A;  5J08 A;  2L0I A;  3JCK C;  2C2L A;  4LCT A;  4RLY A;  3QNK A;  1ELR A;  5ENP D;  3LYA A;  4GU5 A;  1K1B A;  1N11 A;  4JXT A;  2RFM A;  2AWI A;  2XS1 A;  2KCL A;  4TUM A;  3R9M A;  3SQV A;  3DSV A;  1UJK A;  3WXX A;  1OY3 D;  1QYM A;  2VSO E;  3FFL A;  1N52 A;  2E2E A;  3SF4 A;  4CGV A;  1Y6I A;  3MA5 A;  5JJ7 A;  4URK A;  3AU5 A;  3D9H A;  2LSU A;  3ASN E;  5FIO A;  3HIZ A;  4I1A A;  1JCR A;  1BD8 A;  4ANU A;  1SQM A;  3ABL E;  3GZ1 A;  2L6B A;  1Q2Z A;  3U4T A;  3DPD A;  2FF4 A;  3AG1 E;  4L2L A;  4XI0 A;  1KZO A;  2IQC A;  2PZI A;  2ZGG A;  4JHK A;  4L7T A;  1OWN A;  3J5Q B;  1RW2 A;  4DRX E;  1TN6 A;  3ULE G;  4HXI A;  4BER A;  2OEW A;  3T9K A;  4ABN A;  3QAR A;  3V2O A;  5E76 A;  3FTY A;  5FJY A;  3DSW A;  3FUE A;  4K5B A;  4JA9 A;  3ZIM A;  2NSZ A;  3QB2 A;  4KZC A;  3FTV A;  4I43 A;  3ZYK A;  4GMJ A;  4O1P A;  3MV3 B;  4DLO A;  5ENR D;  2GRR B;  3DRA A;  3EUV A;  2XGS A;  5ARF A;  5JJT A;  2Y1L E;  3FP3 A;  4GYO A;  4A55 A;  4L1B A;  1KLX A;  2XS8 A;  3ZN3 A;  4BET A;  3E4B A;  3LKU A;  4GYY A;  3UT8 A;  2BKK B;  2X6I A;  3EU5 A;  4ANV A;  4RG9 A;  4AM9 A;  1W3B A;  5LX8 A;  3ESK A;  4UI9 J;  4KYO B;  3RRU A;  3HRA A;  5E75 A;  5ENS D;  5B1B E;  3CVN A;  4LNU D;  3D9I A;  3KSQ A;  3ULY A;  3EJN A;  2GRO B;  5EID A;  3DST A;  3C3R A;  4UWF A;  2V4H C;  4MRU A;  3DEO A;  2CFZ A;  4WUY A;  4ANX A;  4PS7 A;  4JEU A;  3FH8 A;  4GA0 A;  3VTY A;  5EIB E;  2MHK A;  4CGW A;  4J6I A;  4LRZ A;  1OT8 A;  3SNX A;  2Y4T A;  3GW4 A;  4TUU A;  3HG0 D;  3SGH A;  3RJV A;  4DUI A;  2IOS A;  3LCA A;  1BLX B;  1HG2 A;  5CRU A;  3TG5 A;  3G2T A;  4GTO A;  3MYV A;  4DI3 A;  1RZ4 A;  4UWG A;  2XQ0 A;  5G2N A;  3RAU A;  2IJG X;  5BXO A;  3CHS A;  2R59 A;  4GTQ A;  4HLL A;  2NYJ A;  3FUM A;  2GRQ B;  4JHJ A;  3UMV A;  3EIJ A;  3R7R A;  2FO1 E;  2WXR A;  3DPY A;  5CMW A;  2R17 C;  2J09 A;  4YDW A;  3Q5M A;  3AJI A;  3GZ2 A;  2YNQ A;  2GRM A;  1MZC A;  1HZ4 A;  5KCM A;  5AJD A;  5DIZ A;  1H0A A;  4A3V A;  3HXC A;  1HXI A;  5JHA A;  3RO3 A;  2WQ6 A;  1FVF A;  2KZT A;  5FWQ A;  3SBS A;  3LVQ E;  4CDR A;  3LJN A;  5H7P A;  3LDZ A;  3C72 A;  3CEQ A;  4GZC A;  2VGE A;  3CHR A;  5ENO D;  3S2A A;  4F1P A;  2EIJ E;  1G3N B;  3PEU B;  4XI9 A;  2LUH A;  4C0E A;  2IF4 A;  3CVU A;  4DX2 A;  3IV0 A;  5JMN D;  3LEW A;  2KBX A;  2WXK A;  3SFX A;  3UM0 A;  2DBA A;  1KPS B;  1N4R A;  3T8K A;  3MKQ A;  2FBN A;  3OXL A;  1O1S A;  2WXI A;  3UIP C;  5CER B;  1H6O A;  5ARG A;  4FUL A;  3HYM B;  2XGO A;  2AXV A;  2CHZ A;  5KBA A;  1VDY A;  5BV1 A;  3CHP A;  3ZHE B;  3UPV A;  4B0Z A;  5FQ6 A;  4JW1 A;  2X6J A;  1IKN D;  5BNW A;  1K1A A;  4HB5 A;  1B89 A;  4RSY A;  4KMO A;  3S7F A;  4CYM D;  1MQS A;  4DX5 D;  2Y0B G;  5EN5 D;  4XE0 A;  3UUX A;  4UUC A;  4GZD A;  5LCW C;  3FUN A;  1OXJ A;  3UT7 A;  4G26 A;  5EX0 A;  1TNZ A;  3LXU X;  3S7D A;  3E32 A;  4I9E A;  1FT2 A;  4TRQ A;  1NA3 A;  3FUH A;  1A17 A;  4BT9 A;  4YVQ C;  4NAC A;  5FT9 A;  5ITZ F;  3CR3 A;  3CVY A;  4U7E B;  1SA4 A;  5AEN A;  5LOZ A;  2WXO A;  4C0M A;  4GML A;  3L9T A;  1HO8 A;  1NI1 A;  2EIN E;  3CV0 A;  5D0Q D;  3HXF A;  4UWH A;  1N54 A;  3MJW A;  3TG4 A;  3L6A A;  1U3C A;  1UN9 A;  1NL4 A;  1NA0 A;  1V54 E;  1HS6 A;  4XIF A;  3V30 A;  1OUV A;  4G8K A;  5KJM A;  2DYR E;  3KEA A;  3U9W A;  3QC1 A;  3PZ1 A;  3ZYL A;  2XEV A;  4N39 A;  4MKT A;  4HRL A;  4PDX A;  5CCL A;  3NZS A;  1DCE A;  5AYW D;  2OV8 A;  3O4Z A;  1Z6T A;  4TXR A;  4BEP A;  2WM9 A;  4O6F A;  4JPS A;  2I9C A;  2XZT G;  4K0R A;  3V31 A;  3T5X A;  5AAR A;  4MS6 A;  3CK7 A;  1E8Z A;  2UY1 B;  2P9U G;  1S63 A;  2H6H A;  2KC7 A;  4QQI A;  3QWV A;  3LS8 A;  3ZXP A;  1LF8 A;  4A63 B;  4BTA A;  3NZU A;  3CHQ A;  3D3M A;  3ASG A;  4U0Z A;  2LO6 A;  1X5B A;  4GYW A;  5CED B;  3HXD A;  1ELW A;  1HE8 A;  3D9P A;  1H2V C;  3V2X A;  3RKV A;  2B0O E;  3FUI A;  1LD7 A;  1OWP A;  2F37 A;  2X6H A;  3D9J A;  3L17 A;  4L23 A;  1INZ A;  4LUN U;  2YHE A;  3HVE B;  1WAO 1;  2VYI A;  1V55 E;  4KBQ A;  1BPO A;  2RG8 A;  3CVX A;  3ASH A;  4HI8 A;  2VGY A;  3QJZ A;  3F6Q A;  4UWK A;  5D2M C;  3G2S A;  2XPY A;  1E90 A;  4DI4 A;  2F0Y A;  3AS5 A;  5HQ8 A;  3PZ2 A;  3QAQ A;  3ZPJ A;  3HXE A;  3JQ0 A;  5FQ7 A;  3IKO B;  2YHC A;  3APC A;  1YYH A;  3UQ3 A;  4I17 A;  2CG3 A;  2UWJ G;  3D9O A;  5ENT D;  4ACK A;  1SW6 A;  4WWP A;  1E7U A;  4UI9 C;  4AEZ C;  4BT8 A;  2VSN A;  3BG0 B;  3TWU A;  2PL2 A;  5EYP F;  3PVL A;  3QWP A;  3HDX A;  4I1O B;  3L82 A;  3TWX A;  2C0M A;  2MYO A;  3CSF A;  1HX8 A;  4N3A A;  3CIA A;  2MOW A;  4JD2 G;  4JC8 A;  3DEP A;  4U95 D;  5CCM A;  2ETC A;  3TWW A;  4WWO A;  3Q9N C;  3CVW A;  2A5E A;  4J8S A;  3ASD A;  3I5P A;  3ABK E;  3D9N A;  5CEA A;  5EX3 A;  3CVV A;  1TJF A;  2HR2 A;  1OCO E;  1ZU2 A;  4JEH A;  4FA6 A;  3FUJ A;  3HXB A;  4C9B B;  3FU6 A;  1DNP A;  4GTT A;  1S0P A;  3EIQ C;  1NZN A;  4GCN A;  4HOR A;  3MKR A;  1E8X A;  3D9L A;  3LJ3 A;  2AJA A;  4NUR A;  3Q4A B;  2A4Z A;  1MX4 A;  2QFC A;  3BQO A;  3TJP A;  1SZA A;  2M63 A;  1XGW A;  2KCV A;  2DZO A;  1DVP A;  2GRL A;  1DCQ A;  2B6C A;  2R5S A;  4TV3 A;  2P2C P;  1N9A A;  1L5J A;  3DSX A;  5T4Y A;  1HFA A;  4EHM A;  3JXJ A;  3Q7F A;  1Y8M A;  2WVI A;  4G23 A;  4WNG A;  3JQ1 A;  3CHM A;  4HNA D;  3FTX A;  3RK6 A;  3RRM B;  5HS0 A;  3SFZ A;  3ONL A;  4CCA A;  1TYQ G;  1E8Y A;  4RG6 A;  4UQY A;  2XGM A;  4Z68 A;  2VGX A;  2H6F A;  4JZY A;  5KNG A;  2VSX E;  5AN8 A;  1E8W A;  3R7Q A;  1SVX A;  1YCS B;  1H2T C;  3KEZ A;  4N5Q A;  1WG0 A;  1PAQ A;  3W9G A;  3TXM A;  4GTP A;  4HQD A;  4AY5 A;  3KD7 A;  4RQI A;  4DX7 D;  4U8Y D;  1EYH A;  1QZ2 A;  1UOH A;  3PEV B;  4I6G A;  3IEG A;  3LY9 A;  2E0I A;  4D10 C;  4FP7 A;  3FY4 A;  3NBN B;  2VTB A;  5BW8 C;  2WQ7 A;  5EKQ D;  2Y4U A;  4H7X A;  1YMP A;  4GZ6 A;  3NOC D;  4EZJ A;  4GTR A;  5EYL A;  3UM3 A;  2WXF A;  1IHB A;  2HE0 A;  3Q15 A;  3UKR G;  3ZYM A;  3T5V A;  4AIF A;  2ILR A;  4J0U A;  1UN8 A;  2LSV A;  4KZ0 A;  3E37 A;  4LG6 A;  4ANW A;  4BX8 A;  4YDY A;  1XNF A;  4GCO A;  1X81 A;  1MX2 A;  5FIN A;  4YND A;  3PE4 A;  5AIJ A;  2WB2 A;  4K03 A;  3PRE A;  4KVO A;  2A5U A;  5BV0 A;  3Q49 B;  5HKP A;  2OEV A;  5FQ8 A;  4GMR A;  3NOG D;  5HRY A;  2CFU A;  1Z5S C;  3CKC A;  3AG3 E;  1TN8 A;  2ZGD A;  3FUL A;  3DXM G;  2BKG A;  3CLJ A;  3FU5 A;  2LXM A;  2FUL A;  1K8K G;  4N3B A;  3SHF A;  1HF8 A;  3BEE A;  2JAB A;  4WND A;  3L16 A;  4G11 A;  2DZN A;  4FLB A;  5EIL A;  2AW6 A;  4F1S A;  4GTM A;  4HBD A;  3FHE A;  4B8A A;  4YDO A;  3WG7 E;  4DLQ A;  4GA1 A;  2V4L A;  3DXK G;  3B7R L;  1JUQ A;  4ILG A;  4OVV A;  4EQF A;  2XPI A;  4GPM A;  2H6I A;  2CHX A;  5HI7 A;  4FJY A;  3EHQ A;  5AQ7 A;  3ULQ A;  3UI2 A;  2IO3 C;  4EBA G;  5D66 A;  3PS6 A;  1OCR E;  5BT1 A;  3PE3 A;  1SZ9 A;  2RD0 A;  2V5Q C;  4FJZ A;  3FH7 A;  3NQP A;  3TWS A;  3CK9 A;  4Q94 A;  1MHQ A;  2ZU6 B;  3ZRH A;  3FTW A;  3I4R B;  2FO7 A;  5G05 C;  4G1T A;  3SY2 A;  3RO2 A;  4PUC A;  4OAU C;  2XCB A;  4EEC A;  2R05 A;  3ISM C;  2F8Y A;  2OCC E;  2J07 A;  2IO2 C;  1NFI E;  2OVB A;  4KT6 B;  4F3V A;  2OND A;  1HG5 A;  4EPZ A;  3OXF A;  5JA4 D;  5ENQ D;  3VLF A;  5T3R A;  3SFY A;  2WQH A;  3PDN A;  4HOQ A;  1BI8 B;  4U0S A;  5FZS A;  4N5C A;  3IBE A;  4J8D A;  2XEH A;  1TNO A;  1MJ0 A;  1OWM A;  3QOU A;  3PNT B;  1HH8 A;  4HOU A;  4ME2 A;  4Y6C A;  4X8Q A;  2AVP A;  1IYG A;  4XKB A;  4W9R A;  3D9M A;  5J90 A;  4OAV B;  4U8H A;  2KZT B;  3BU8 A;  4CEM A;  1E7V A;  5CEC B;  3AG4 E;  5A7D B;  3CKB A;  1MYO A;  5T8I A;  2LNI A;  3ZYQ A;  3ZW3 A;  2HO1 A;  4N2S A;  5AQ9 A;  4ATG A;  1EDU A;  1TNB A;  5CBN A;  2V0P A;  1GW6 A;  1FCH A;  3KS2 A;  1O1T A;  1FT1 A;  3Q7A A;  1N4P A;  3I3N A;  2R02 A;  4U0U A;  2X6K A;  2EIK E;  2XZD G;  3L22 A;  3PZD A;  1OCC E;  1D9S A;  3ASO E;  3L08 A;  3UKU G;  3MKQ B;  2IU1 A;  4FHK A;  3X2Q E;  3UM1 A;  3LPZ A;  3CVP A;  3GYZ A;  4L2Y A;  3ZKJ A;  1OCZ E;  5BPP A;  3SBT B;  1QQE A;  2L6J A;  3MGB A;  3FTU A;  2AXU A;  5A6C A;  2PNN A;  4HOT A;  3QKY A;  4U96 D;  5AJL A;  5G05 J;  3ZU7 B;  2P9N G;  3DWL G;  3SD5 A;  4DPR A;  1A5E A;  1D8E A;  3DSS A;  4ACL A;  3VLE A;  2LXL A;  3RSE G;  2XRY A;  3TWQ A;  4UWL A;  4BY6 A;  2ZXW E;  4G25 A;  2EIL E;  1U3D A;  4APO A;  1DC2 A;  4CRW A;  2Y69 E;  4ZHB A;  2BED A;  4LER A;  3FWV A;  3PUJ A;  3QDN A;  4A1S A;  3EHN A;  1ZB1 A;  3FTS A;  4UI9 K;  4FAD A;  5LFA A;  4B89 A;  3E34 A;  4EBA A;  2DIW A;  3FU0 A;  1JCQ A;  2XEE A;  4L9P A;  4B8C B;  1ZBP A;  3ASF A;  2WXM A;  3LVR E;  4WAF A;  5EDS A;  1PC2 A;  3ML9 A;  4LSZ E;  2X3M A;  1JWG A;  4O1O A;  3C3Q A;  2V8S E;  4GZ3 A;  5KJL A;  2JLB A;  1TN7 A;  4B93 B;  2J49 A;  2J9Q A;  3ESL A;  1EF1 C;  3E30 A;  5AQA A;  2VQ2 A;  4DK5 A;  2Y3A A;  4HOS A;  4AOF A;  4F6R D;  4CT4 A;  4J8Y A;  4FC8 A;  3MX3 A;  1JPL A;  5FTP A;  4BES A;  3UX4 A;  2WXP A;  1LTX A;  2BTD A;  1IHG A;  3JUI A;  4BSX A;  2R03 A;  4WNF A;  4I1M A;  4GPK A;  4WWN A;  3CHO A;  3AAA C;  3ZGQ A;  4IRU A;  4G2V A;  3TAX A;  4F7A A;  2IOL A;  2I1K A;  3G2U A;  1H2U A;  2X6F A;  1WDY A;  3JUE A;  2WPV A;  3Q47 B;  4I2W A;  2ZIR A;  1EPU A;  3EHR A;  3AS8 A;  4HS2 A;  1S64 A;  2BUG A;  3NAW A;  2ETB A;  4Y6W A;  4LNG A;  3E33 A;  3DBS A;  4MLP A;  2QC9 A;  4F53 A;  3BG1 B;  2QYJ A;  2P9P G;  3JXI A;  4U07 A;  3AU4 A;  4FLH A;  4JB8 P;  1LD8 A;  3QWW A;  3I4G A;  4HFG A;  4PH4 B;  5G04 J;  4UQX A;  2AXZ A;  4U04 A;  4JVS A;  3ENE A;  4RVB A;  4BWR A;  3DSU A;  1IXV A;  3RRN B;  3ZEF A;  4J8F A;  3G2W A;  2WMN A;  4EZL A;  3CQC B;  1AP7 A;  2R2L A;  4DX6 D;  5B3S E;  1N4Q A;  3C98 A;  3ABM E;  5C1D A;  3FUK A;  3LY8 A;  3O48 A;  5D0O D;  1H6K A;  4J7W A;  5B1A E;  4ATZ D;  4G24 A;  4FU3 A;  4C48 B;  2FEZ A;  2I1J A;  2CHW A;  3L54 A;  3ZXS A;  3IHY A;  3CQG B;  3EDT B;  1O1R A;  1H19 A;  1KZP A;  3KSL A;  3SI5 A;  4AY6 A;  3CST A;  4G8L A;  4BSZ B;  1Z3Y A;  2EIM E;  5FQ4 A;  1S70 B;  3RIB A;  4GZ5 A;  2YIN A;  2CG2 A;  3U64 A;  3NB2 A;  2VJ8 A;  3AG2 E;  1PY1 A;  3OXG A;  2WXQ A;  3P2B A;  4WNE A;  5KJK A;  4I6J A;  3B7U X;  5CBO A;  2MRI A;  4APF A;  1IQR A;  1N0Q A;  2X38 A;  3PUK A;  4UQZ A;  3JYS A;  4AVX A;  3FDH A;  2WXH A;  4KVM A;  4M7C A;  4U8V D;  3TWV A;  2V5F A;  5ANL A;  4XZ4 A;  2XEN A;  2BF0 X;  4LEU A;  4NRH B;  1TR4 A;  5KJN A;  4H7Y A;  1FPP A;  3QK0 A;  4HI9 A;  4M3O A;  3Q9U C;  3TWT A;  4AJW A;  4GA2 A;  2HM8 A;  3PRZ A;  1MX6 A;  3FUD A;  2NC9 A;  1NP7 A;  4YDE A;  3LY7 A;  2P58 C;  2WXG A;  4MBG A;  2IFU A;  3OTN A;  3IXE A;  3ZHE A;  4ILI A;  1HU3 A;  5M72 A;  3W9F A;  1WY6 A;  3MCX A;  2L0T B;  1BI7 B;  4A3T A;  3PZ3 A;  3FUF A;  4K5A B;  5AAO A;  2L9B A;  3ML8 A;  4PS3 A;  4N2Q A;  1FVH A;  3R9A B;  2LAI A;  3B7S A;  3MV2 B;  4GB9 A;  3UIO C;  4GTS A;  2VGX B;  3UT4 A;  2C0L A; 
#chains in the Genus database with same CATH homology
 3QJZ A;  5T8I A;  3ZIM A;  2LNI A;  4UWK A;  4DJA A;  3G2S A;  3ZYQ A;  3ZW3 A;  4E85 A;  4V3I A;  2NSZ A;  2XPY A;  1E90 A;  4DI4 A;  2HO1 A;  3AS5 A;  3QB2 A;  4KZC A;  5HQ8 A;  4N2S A;  3FTV A;  4OVU A;  4I43 A;  3ZYK A;  4ATG A;  1EDU A;  4GMJ A;  3MV3 B;  4DLO A;  4JA9 A;  3QAQ A;  1KT0 A;  3ZPJ A;  2XGS A;  3JQ0 A;  2KM4 A;  2V0P A;  5ARF A;  1GW6 A;  3IKO B;  5FQ7 A;  1FCH A;  3P1U A;  3KS2 A;  2YHC A;  5FZR A;  4HVB A;  3APC A;  5DBK A;  5CMY A;  5JJT A;  3FP3 A;  2XCC A;  3URZ A;  4GYO A;  4A55 A;  1Z3X A;  3I3N A;  3UQ3 A;  4L1B A;  4I17 A;  1KLX A;  3PH0 C;  4CDM A;  4Q69 A;  5FZQ A;  4U0U A;  2CG3 A;  2UWJ G;  2X6K A;  3D9O A;  3L22 A;  3ZN3 A;  3PZD A;  3E4B A;  3LKU A;  4GYY A;  3UT8 A;  4ACK A;  3MEK A;  2X6I A;  2VTB B;  4WWP A;  4ANV A;  4RG9 A;  4AM9 A;  1E7U A;  3L08 A;  4JA7 A;  4UI9 C;  1W3B A;  5LX8 A;  3MKQ B;  2IU1 A;  4FHK A;  4AEZ C;  3ESK A;  4UI9 J;  4BT8 A;  2VSN A;  3BG0 B;  3LPZ A;  4KYO B;  1JWF A;  2PL2 A;  4IUL A;  3CVP A;  3GYZ A;  3RRU A;  4L2Y A;  3PVL A;  5BPP A;  3QWP A;  3HDX A;  3SBT B;  4I1O B;  3FTZ A;  4J8E A;  5E75 A;  1QQE A;  2L6J A;  3MGB A;  4CDN A;  2C0M A;  3CSF A;  3CVN A;  3D9I A;  3FTU A;  3TL5 A;  1HX8 A;  4GAA A;  4I6E A;  2AXU A;  4N3A A;  3CIA A;  1WM5 A;  5A6C A;  3EJN A;  4I2Z A;  4HOT A;  2MOW A;  2PQN A;  3QKY A;  3AS4 A;  4JC8 A;  2GW1 A;  1OWL A;  4UWF A;  5AJL A;  5G05 J;  4MRU A;  3OAW A;  5CCM A;  2CFZ A;  2JEK A;  4BFR A;  4WWO A;  4WUY A;  4ANX A;  3CVW A;  4J8S A;  1UG3 A;  3ASD A;  3I5P A;  4JEU A;  3FH8 A;  4PS7 A;  4R7L A;  3SD5 A;  4GA0 A;  3VTY A;  4DPR A;  2MHK A;  4CGW A;  4J6I A;  3D9N A;  4ACL A;  4LRZ A;  2UY1 A;  3SNX A;  5EX3 A;  2Y4T A;  2XPZ A;  3GW4 A;  3CVV A;  1TJF A;  2HR2 A;  4CT0 A;  1ZU2 A;  2EQX A;  4JEH A;  3VLE A;  4TUU A;  3S7B A;  4FA6 A;  2XRZ A;  5C2Y A;  3FUJ A;  3SGH A;  4C9B B;  2XRY A;  3FU6 A;  3RJV A;  3L13 A;  1DNP A;  4Q96 A;  2VSY A;  1S0P A;  4UWL A;  2IOS A;  2LAH A;  3EIQ C;  2DCP A;  3LCA A;  1NZN A;  4BY6 A;  4G25 A;  5LP0 A;  4GCN A;  4HOR A;  1U3D A;  4KXK B;  4APO A;  3MKR A;  1E8X A;  1HG2 A;  3TG5 A;  3G2T A;  4CRW A;  2KCK A;  3D9L A;  3LJ3 A;  3MYV A;  4NUR A;  3Q4A B;  4DI3 A;  4UWG A;  2XQ0 A;  4LER A;  3T8M A;  2A4Z A;  2WXN A;  5G2N A;  2QFC A;  5KCM A;  2IJG X;  3FWV A;  3TJP A;  1SZA A;  3PUJ A;  2I2O A;  3NF1 A;  2M63 A;  1XGW A;  2KCV A;  3VTX A;  3G2V A;  3QDN A;  4A1S A;  1OWO A;  3EHN A;  1DVP A;  2GRL A;  3CHS A;  3FTS A;  4UI9 K;  4B94 A;  2R59 A;  4FAD A;  1UW4 B;  2R5S A;  3VLD A;  5LFA A;  4TV3 A;  1L5J A;  4B89 A;  3FUM A;  4EBA A;  2DIW A;  3FU0 A;  4JHJ A;  3UMV A;  3EIJ A;  5T4Y A;  1HFA A;  3R7R A;  1Y8M A;  3S7J A;  4JHR A;  4B8C B;  2WVI A;  3CVL A;  5BUZ A;  3APF A;  2WXR A;  4G23 A;  4WNG A;  5CMW A;  1ZBP A;  2R17 C;  5G55 A;  4A1G A;  2J09 A;  1TEZ A;  3K9I A;  3ASF A;  2WXM A;  3Q5M A;  2QY7 A;  3LVR E;  4WAF A;  3GZ2 A;  5EDS A;  1PC2 A;  1IQU A;  2GRM A;  2YNQ A;  3ML9 A;  3ZVV A;  1HZ4 A;  2KAT A;  2X3M A;  3IHV A;  3CHM A;  3JQ1 A;  3FTX A;  3HVE A;  1H0A A;  1JWG A;  5AJD A;  5DIZ A;  4A3V A;  3RK6 A;  3RRM B;  1HXI A;  2V8S E;  4GZ3 A;  3SFZ A;  5KJL A;  2JLB A;  3ONL A;  1UJJ A;  2FI7 A;  2NXP A;  3CGH A;  5JHA A;  3ONK A;  4CCA A;  3RO3 A;  2WQ6 A;  1FVF A;  2KZT A;  5FWQ A;  3SBS A;  1E8Y A;  2J49 A;  2J9Q A;  3LVQ E;  4RG6 A;  3ESL A;  4UQY A;  4CDR A;  1EF1 C;  2XGM A;  2VGX A;  4JZY A;  2VSX E;  3LDZ A;  2WXL A;  2VQ2 A;  4DK5 A;  1E8W A;  2Y3A A;  4HOS A;  3CEQ A;  4YVO A;  3R7Q A;  4AOF A;  4GZC A;  4CT4 A;  4EZK A;  4FC8 A;  3PNL B;  3MX3 A;  1JPL A;  3CHR A;  1H2T C;  3CK8 A;  3KEZ A;  3FU3 A;  2GGF A;  5FTP A;  4HLE A;  3S2A A;  3UX4 A;  2WXP A;  1PAQ A;  3PEU B;  4ILH B;  4P29 A;  4XI9 A;  3TXM A;  2BTD A;  3RU0 A;  1IHG A;  4AY5 A;  3KD7 A;  4C0E A;  2PQR A;  3JUI A;  4BSX A;  2IF4 A;  4AV7 A;  4BX9 A;  4PS8 A;  4WNF A;  3CVU A;  5CHE E;  4I1M A;  1EYH A;  4GPK A;  3IV0 A;  1QZ2 A;  4WWN A;  3LEW A;  3PEV B;  5JJ6 A;  1YA0 A;  2WXK A;  3CHO A;  3IEG A;  4I6G A;  3LY9 A;  3KAE A;  2E0I A;  3ZGQ A;  3CKB A;  4D10 C;  4FP7 A;  4IRU A;  4G2V A;  3TAX A;  3FY4 A;  4F7A A;  2IOL A;  2DBA A;  2VTB A;  5BW8 C;  4U63 A;  2I1K A;  3MKQ A;  2WQ7 A;  3G2U A;  1H2U A;  2X6F A;  2FBN A;  3TGO A;  3OXL A;  2WXI A;  4E6H A;  5EKQ D;  5ARG A;  2Y4U A;  4BTB A;  4H7X A;  3CVQ A;  3B13 A;  4GZ6 A;  3EHM A;  2PM7 A;  2WPV A;  4FUL A;  3Q47 B;  3HYM B;  4I2W A;  3D9K A;  2XGO A;  4EZJ A;  2AXV A;  2CHZ A;  1P5Q A;  1VDY A;  2I6H A;  4QFV A;  5ENN A;  5BV1 A;  2WXF A;  3CHP A;  3Q15 A;  1EPU A;  3AS8 A;  3ZYM A;  4HS2 A;  3ZHE B;  2BUG A;  3UPV A;  4B0Z A;  3T5V A;  5FQ6 A;  4AIF A;  3APD A;  4Y6W A;  4JW1 A;  2X6J A;  2ILR A;  4J0U A;  2XHE A;  3B7T A;  3DBS A;  4MLP A;  5BNW A;  1UN8 A;  2LSV A;  4KZ0 A;  3BG1 B;  3MZL B;  4ANW A;  4F53 A;  1B89 A;  4BX8 A;  5A23 A;  4U07 A;  4AP2 A;  1XNF A;  2OOE A;  3AU4 A;  4FLH A;  4RSY A;  2Q7F A;  4GCO A;  3QWW A;  4KMO A;  4XKC A;  3I4G A;  4HFG A;  4PH4 B;  1MQS A;  3S7F A;  5G04 C;  4XE0 A;  4YND A;  3UUX A;  3PE4 A;  5G04 J;  5AIJ A;  4GZD A;  5LCW C;  4UQX A;  2AXZ A;  4U04 A;  4JVS A;  2WB2 A;  3ENE A;  3FUN A;  4RVB A;  3UT7 A;  5LCW J;  3SZ7 A;  4G26 A;  4N3C A;  5EX0 A;  4BWR A;  2OVF A;  4K03 A;  3PRE A;  4KVO A;  3RRN B;  2A5U A;  5BV0 A;  3LXU X;  3S7D A;  3ZEF A;  4IN3 B;  3Q49 B;  4J8F A;  4I9E A;  3G2W A;  5FQ8 A;  2WMN A;  4TRQ A;  4EZL A;  3CQC B;  1ELK A;  1NA3 A;  3FUH A;  1A17 A;  2CFU A;  3C98 A;  4BT9 A;  4YVQ C;  4NAC A;  5FT9 A;  2ION A;  3CKC A;  3CR3 A;  5C1D A;  3CVY A;  3FUK A;  3LY8 A;  2PM6 A;  5AEN A;  3HHM A;  3FUL A;  3O48 A;  5LOZ A;  3CLJ A;  2WXO A;  3FU5 A;  5D0O D;  2J4B A;  1H6K A;  2YQ8 A;  4C0M A;  2FUL A;  4N3B A;  4GML A;  4OYS A;  3SHF A;  1HF8 A;  3BEE A;  4XX5 A;  1HO8 A;  4JL0 A;  4WND A;  3L16 A;  3CV0 A;  4G11 A;  3N71 A;  4G24 A;  5D0Q D;  5JHB A;  4FU3 A;  4IYP A;  4FLB A;  4UWH A;  1N54 A;  2J08 A;  2WMO A;  3MJW A;  3L6A A;  3TG4 A;  2FEZ A;  2AW6 A;  4F1S A;  2I1J A;  2CHW A;  3FHE A;  1U3C A;  3FEY A;  4B8A A;  1UN9 A;  4DLQ A;  4AXH A;  3U3W A;  4GA1 A;  3L54 A;  1NA0 A;  3ZXS A;  2V4L A;  3IHY A;  3FEX A;  1HS6 A;  4XIF A;  3B7R L;  3TXN A;  3CQG B;  1JUQ A;  3EDT B;  1OUV A;  4ILG A;  1H19 A;  4OVV A;  3SI5 A;  5KJM A;  4AY6 A;  4EQF A;  2XPI A;  2WXJ A;  3CST A;  2CHX A;  3U9W A;  1TJC A;  3QC1 A;  3ZYL A;  2XEV A;  1E96 B;  4N39 A;  5HI7 A;  3ZFW A;  1Z3Y A;  4FJY A;  4I9C A;  4MKT A;  3U66 A;  2HYZ A;  1QNF A;  5FQ4 A;  4NQ0 A;  3ULQ A;  2J4D A;  1KT1 A;  3FH5 A;  3GZS A;  3RIB A;  5ANR A;  4GZ5 A;  2YIN A;  4EBA G;  4PDX A;  2CG2 A;  4FHJ A;  5CCL A;  3NZS A;  3PS6 A;  3U64 A;  5J08 A;  5AYW D;  2VJ8 A;  2OV8 A;  3O4Z A;  1PY1 A;  1Z6T A;  5BT1 A;  2L0I A;  3JCK C;  3OXG A;  2WXQ A;  2C2L A;  3P2B A;  2WM9 A;  3PE3 A;  4WNE A;  5KJK A;  1SZ9 A;  4I6J A;  4LCT A;  3QNK A;  2RD0 A;  4O6F A;  1ELR A;  4JPS A;  3B7U X;  2I9C A;  4K0R A;  4FJZ A;  3FH7 A;  3LYA A;  4GU5 A;  2MRI A;  3NQP A;  1IQR A;  4APF A;  3T5X A;  3CK9 A;  4JXT A;  4Q94 A;  2X38 A;  3PUK A;  4UQZ A;  1MHQ A;  3JYS A;  4MS6 A;  3CK7 A;  1E8Z A;  2UY1 B;  2AWI A;  4AVX A;  3FDH A;  2WXH A;  4KVM A;  2ZU6 B;  2KCL A;  2V5F A;  5ANL A;  4XZ4 A;  3ZRH A;  3FTW A;  1UJK A;  2BF0 X;  3I4R B;  3WXX A;  2VSO E;  3FFL A;  4LEU A;  2FO7 A;  2KC7 A;  4G1T A;  5G05 C;  4NRH B;  1N52 A;  3RO2 A;  4PUC A;  2E2E A;  3LS8 A;  3QWV A;  4H7Y A;  3SF4 A;  3QK0 A;  5KJN A;  4CGV A;  1Y6I A;  1LF8 A;  4M3O A;  3MA5 A;  4BTA A;  2XCB A;  4AJW A;  3NZU A;  4EEC A;  4GA2 A;  2HM8 A;  3PRZ A;  3CHQ A;  3D3M A;  5JJ7 A;  3ASG A;  2J07 A;  4U0Z A;  3AU5 A;  2LO6 A;  4URK A;  1X5B A;  4GYW A;  2LSU A;  1ELW A;  1HE8 A;  2OVB A;  4KT6 B;  4F3V A;  3D9P A;  1H2V C;  2OND A;  3HIZ A;  3FUD A;  1HG5 A;  2NC9 A;  4EPZ A;  3RKV A;  3OXF A;  1NP7 A;  4I1A A;  3LY7 A;  3VLF A;  2P58 C;  5T3R A;  4ANU A;  3FUI A;  2WXG A;  2WQH A;  3PDN A;  1OWP A;  4HOQ A;  2IFU A;  4U0S A;  3OTN A;  1SQM A;  5FZS A;  4N5C A;  3IBE A;  4J8D A;  3ZHE A;  4ILI A;  1HU3 A;  3GZ1 A;  5M72 A;  1WY6 A;  2X6H A;  3U4T A;  3D9J A;  3MCX A;  3DPD A;  3L17 A;  4L23 A;  2FF4 A;  2L0T B;  1INZ A;  4L2L A;  4LUN U;  4XI0 A;  4A3T A;  1OWM A;  3QOU A;  2IQC A;  3PNT B;  1HH8 A;  2PZI A;  3FUF A;  2L9B A;  4JHK A;  4L7T A;  1OWN A;  2YHE A;  3HVE B;  4HOU A;  4ME2 A;  4Y6C A;  3ML8 A;  4PS3 A;  4N2Q A;  1WAO 1;  1IYG A;  2AVP A;  1FVH A;  4XKB A;  4W9R A;  2VYI A;  4HXI A;  3R9A B;  2LAI A;  3D9M A;  5J90 A;  3B7S A;  4KBQ A;  4U8H A;  4ABN A;  3MV2 B;  1BPO A;  2RG8 A;  2KZT B;  3ASH A;  3CVX A;  3QAR A;  4GB9 A;  5E76 A;  3FTY A;  5FJY A;  4CEM A;  3FUE A;  1E7V A;  2VGX B;  3UT4 A;  5A7D B;  2C0L A;  2VGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...