2LSVA

The nmr high resolution structure of yeast tah1 in complex with the hsp90 c-terminal tail
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structural Analysis Shows How Tah1 Tethers Hsp90 to the R2TP Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone-binding protein/chaperone
molecule keywords TPR repeat-containing protein associated with Hsp90
total genus 30
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lsvA00
3TGOA 4J8DA 2XPIA 4UQZA 3ZFWA 2XGOA 4CGVA 3RO2A 4G1TA 2KCLA 2XEVA 3CEQA 4UQYA 2PL2A 3S7FA 4A1SA 2FEZA 3PE3A 4GCNA 3GYZA 1PC2A 4WNDA 2FI7A 2FBNA 4G26A 4GZ3A 4U07A 3S7DA 4BT9A 1KLXA 3O48A 4GZ5A 4N3CA 4AM9A 3HYMB 4UI9J 5CHEE 3RKVA 3CK7A 3AS8A 3GZ2A 4J8EA 4JL0A 4I9EA 4LEUA 4N39A 4U04A 4WUYA 4I2ZA 4Y6CA 5EKQD 2VGYA 3LY7A 5ARGA 3OXGA 4N5CA 5EX3A 2AVPA 2HYZA 3ASHA 2UY1B 3QWVA 1YA0A 4HOQA 4NRHB 4J0UA 3KAEA 3CVLA 2LSUA 2VSNA 3ZPJA 4RG9A 5CCLA 4GYOA 4HOSA 5FTPA 5JJTA 3KS2A 5KJNA 2BUGA 4JHRA 4XI0A 3SZ7A 3FP3A 4UI9K 2XCCA 2Q7FA 3LPZA 3ZHEB 4B94A 2MHKA 3E4BA 3R9AB 5C1DA 4N3AA 5KJMA 3ASDA 2NC9A 4KBQA 3OXFA 1NA0A 3ASFA 3WXXA 3CK8A 1ELRA 3FWVA 3ZGQA 2YHCA 2LSVA 3CKCA 2VYIA 3OXLA 5D0QD 3S7JA 3AS5A 4N2SA 3LCAA 4BTBA 5M72A 2UWJG 3N71A 2DBAA 3ASGA 3CKBA 3UUXA 3NF1A 1IHGA 3VTXA 5G04C 3QDNA 1WM5A 4ME2A 3MV2B 2L6JA 4XIFA 5LCWC 2GW1A 4YNDA 4I2WA 3Q47B 4I17A 5DBKA 4N2QA 4BWRA 1OUVA 3CK9A 2E2EA 3CV0A 1ELWA 3LKUA 3Q4AB 2FO7A 3QOUA 3UPVA 3SF4A 5FZQA 4JA9A 2XCBA 3MA5A 1NA3A 4YVOA 3QKYA 5KJKA 4U0UA 1W3BA 4J8FA 4U0SA 3UQ3A 4F3VA 2JLBA 4G2VA 1WAO1 3RIBA 1KT1A 3MEKA 3PDNA 2KCVA 2C0MA 1QZ2A 2VGXA 5HI7A 1B89A 5D0OD 2KC7A 3MKRA 4WNEA 4O6FA 2FF4A 4WNFA 4W9RA 4XI9A 2P58C 2YQ8A 3TG4A 5ARFA 3GW4A 3QWPA 1KT0A 4CGWA 4JA7A 4RG6A 3QWWA 4G23A 4HOTA 3Q49B 4WNGA 4GA0A 5KJLA 5A7DB 4GA1A 3U3WA 4HOUA 1XNFA 2KCKA 4NQ0A 3CVNA 2VQ2A 2PZIA 5BW8C 2UY1A 2IFUA 5CCMA 2C0LA 3LYAA 4UQXA 4AIFA 4GCOA 1P5QA 3EDTB 3GZ1A 4BT8A 1ZU2A 3AS4A 3RO3A 3ULQA 4G25A 3K9IA 4IN3B 4KXKB 4YVQC 2HO1A 4CDRA 5AYWD 2PQNA 5FT9A 4ABNA 3Q15A 3ESKA 3LY9A 3Q5MA 2KATA 5JJ6A 3VTYA 1A17A 5FZSA 3MV3B 4Y6WA 4GA2A 5FJYA 2WPVA 4AY5A 3ZN3A 1FCHA 5FZRA 4UI9C 2LNIA 2OOEA 3KD7A 4I1AA 3TAXA 3U4TA 3TG5A 3ZHEA 1IYGA 2R5SA 2XGMA 4G24A 4H7XA 4GYYA 5EX0A 3CVQA 5BNWA 3LY8A 4GZ6A 5JJ7A 5G04J 2C2LA 2IF4A 4APOA 4GYWA 3IEGA 5G05J 2QFCA 2PQRA 4H7YA 4KYOB 1ZBPA 1NZNA 3S7BA 4EQFA 2Y4UA 1E96B 1Y8MA 4U0ZA 1HZ4A 3JYSA 5G05C 2J9QA 3RJVA 1HXIA 2Y4TA 3FFLA 3CVPA 4I9CA 1HH8A 2WQHA 4GPKA 5DIZA 4BTAA 5LCWJ 1QQEA 2HR2A 2I6HA 2ONDA 2VSYA 3URZA 2V5FA 4AY6A 5BT1A 5HQ8A 4N3BA 1TJCA 2VGXB 4HORA 5A6CA 3PE4A 3BEEA 2XGSA 3RU0A
chains in the Genus database with same CATH superfamily
3OAWA 3V30A 1QNFA 4TRQA 3I4RB 3UM1A 3O48A 4AM9A 3ABLE 4N39A 3PZ2A 4NRHB 4RG9A 4FHKA 3CSFA 3QJZA 4JZYA 5FTPA 3DSVA 3ZHEB 2J8SD 2LAHA 4CEMA 4TXPA 1KPSB 3Q9NC 3WG7E 3S7JA 3AS5A 3ASNE 1HG5A 2DBAA 1X5BA 3FU0A 3EHRA 4KVOA 2I1KA 4HFGA 2ZISA 4UWGA 2P9KG 1NA3A 2F8XK 4HNAD 3HXCA 5D0OD 3ZU7B 4C0EA 3MCXA 2RKKA 4W9RA 2WVIA 3ZRHA 4AV7A 3SD5A 3BQOA 3EIJA 3CVNA 3UTMA 5EYPF 5CCMA 4UQXA 4BT8A 1DNPA 4NACA 5E76A 4XKBA 2PQNA 5AIJA 3ESKA 2WPVA 5FZRA 4U7EB 4ANVA 4ACKA 3LY8A 3UKRG 1MHQA 4APOA 2ETAA 3BUAA 1WG0A 3D9NA 3TWRA 4BERA 2OVBA 5A6CA 4BSZB 1HO8A 1FVHA 4HS2A 3UIPC 1HFAA 3UT7A 3PUKA 2GRRB 4DX7D 4GZCA 4K0RA 2J49A 1VDYA 2KZTB 1BD8A 4Y6CA 4KZ0A 3ASHA 1N0QA 4Q94A 3DXKG 4D10C 5KJNA 1E8ZA 1BI7B 1NA0A 4BX9A 5D0QD 1MQSA 3UUXA 4EECA 2Y69E 4FP7A 2GRLA 3DSUA 5CRUA 3Q47B 3FH8A 1SZAA 5AARA 4N2QA 5B1AE 2WXKA 3Q4AB 2XZTG 4JA9A 4J8FA 2I9CA 2KCVA 1OWPA 4JHKA 2WB2A 4GA0A 5HRYA 2YINA 4GA1A 4C9BB 4F1PA 3UMVA 5BW8C 4OAUC 4F7AA 4KZCA 3SFXA 4MS6A 3HVEB 2XPYA 3DEOA 4FJZA 3E33A 1TN7A 2XS8A 3G2TA 1NI1A 1S64A 4AEZC 3CVQA 5EIBE 1OWMA 4GMJA 4DLOA 1H2TC 3CVWA 3DEPA 4APFA 5G05C 5CMWA 2L0IA 3NZSA 5CERB 3SHFA 4HORA 3PE4A 2XPIA 2KCLA 4YDWA 1N52A 4A1SA 4WWOA 5B1BE 3E37A 3CK7A 4ANUA 3MKQB 3AJIA 2OVFA 3B13A 5J08A 3C5RA 1YA0A 3QAQA 2XHEA 2AXZA 5ENPD 1U3CA 3W9GA 1Y6IA 4JHRA 3TWVA 5C1DA 4LERA 2V4LA 3ASFA 1UN8A 4TXRA 2IY0C 3SBTB 2QZAA 1WY6A 3E32A 3TWXA 1JWGA 4FULA 4XIFA 3TWQA 1V54E 3RRNB 4BETA 2CG3A 2J4BA 2XCBA 1W3BA 5LX8A 1DCQA 4GAAA 5AJLA 3DSWA 5H7PA 3AAAC 2YQ8A 3MX3A 3QWPA 3RRMB 4WNGA 2BKGA 4FLBA 2KZTA 3S2AA 2PM7A 1N54A 4NQ0A 1MX4A 2PZIA 2V8SE 3QNKA 4DRXE 4GCOA 3LVRE 5AYWD 1NFIE 1RZ4A 2EILE 3SBSA 4AY5A 3FUNA 4GA2A 1FCHA 3EU9A 4HXIA 2H6IA 3SQVA 2XGMA 1INZA 4KMOA 3SNXA 2B6CA 2IOLA 5G05J 2QFCA 3CHSA 2WXHA 4FC8A 4B89A 3KEAA 2Y4TA 3FFLA 4GPKA 4BSXA 5DIZA 5BT1A 1TJCA 1FT1A 3QWWA 3S7DA 2ZXWE 1TNZA 4PS7A 4GTVA 5EILA 3HXFA 1HS6A 1IXVA 3LXUX 2I1JA 4Q96A 1EYHA 3NOGD 4HOQA 3R7RA 3UM0A 4JC8A 5JJTA 2BUGA 3ABME 4A1GA 1JUQA 2LXLA 5KJMA 3KSLA 5JA4D 2DVWA 3N71A 2WM9A 3NF1A 4YNDA 2XS1A 4GMRA 3D9PA 3PDNA 2KC7A 2ETCA 1UG3A 2MOWA 3GW4A 3MGBA 3NZUA 4YDOA 3Q49B 1H6PA 3UINC 2VQ2A 4KT6B 1NL4A 3ASOE 4A3TA 3ULQA 5B3SE 3K9IA 1HF8A 1PY1A 4DI3A 2WXJA 2WQ7A 2WXPA 5HS0A 4TUUA 1V55E 4GYYA 5JHBA 4F1SA 4ANWA 4E85A 1TNBA 1HX8A 1Y8MA 5ENTD 3RRUA 2VSYA 4EBAA 5FINA 1N95A 2ZGDA 2PL2A 3DRAA 3IV0A 4GTPA 5EYLA 4DPRA 1IQRA 1H19A 4EZLA 4UWKA 1K3ZD 3AS8A 4JVSA 5ARGA 3UT4A 3G2VA 3R9MA 1U3DA 1N9AA 3UX4A 1LD7A 3ASDA 2XENA 3OXFA 4LNUD 4DK5A 3MJWA 4XE0A 3D9KA 3UT8A 2ETBA 4HRNA 3Q79A 4MLPA 5LFAA 3UPVA 1MX6A 2BF0X 2DIWA 1AP7A 1EPUA 1MJ0A 4O6FA 2VGEA 2RFMA 2PNNA 1RW2A 2NXPA 3J5QB 2KCKA 2EINE 3L6AA 3LVQE 1H2UA 4IRUA 1EDUA 5AQ9A 3EHQA 5FT9A 3Q7AA 4A63B 3JXIA 3Q15A 3DSTA 4J8SA 1MZCA 5HKPA 1OWNA 5BNWA 1TJFA 3CQCB 3ZNGA 2C2LA 2GGFA 4X8QA 1QYMA 3URZA 2V5FA 3HXBA 3FUMA 1KZOA 3T8MA 2KBXA 3P2BA 5BPPA 4DUIA 5T3RA 4IULA 3DPDA 4ILGA 2E0IA 2X38A 4U04A 2GROB 1S70B 2AVPA 5ENOD 4B94A 3JUEA 4BFRA 3JQ1A 3APFA 4OVUA 3FUJA 4BTBA 4AOFA 4BESA 2NSZA 5EDSA 4EBAG 3FTZA 1ELWA 2KM4A 2FO7A 3FUIA 4HRLA 1H2VC 1NP7A 5FIOA 4WWNA 3IHVA 3PZ4A 3CGHA 4WNEA 3PZ1A 3QC1A 4PDXA 3AU4A 1KT0A 4G23A 2IO3C 3I5PA 2H6FA 2P9SG 2IFUA 5ENQD 1O5MA 4CDRA 3LJNA 1JCQA 4HQDA 4JEHA 3FY4A 4I43A 3FULA 2L6BA 1FVFA 2R5SA 4H7XA 1UW4B 4PS8A 5AENA 4XEIG 4EQFA 3L08A 1QQEA 2HR2A 2I6HA 4L2LA 2VJ8A 5HQ8A 4Q69A 3FTWA 2YNQA 4GTMA 3PH0C 4WAFA 1D8DA 4N3CA 3R9AB 3CLJA 3OXGA 4ACLA 1H0AA 2GRMA 2LSUA 2R59A 5CMYA 3NB2A 2XEHA 1IHBA 2EIME 1N4PA 4N3AA 2IQCA 2LSVA 4B93B 5ANLA 5KWDA 3CVXA 3Q78A 3D9IA 4EPZA 4BX8A 5DBKA 2P2CP 4I17A 3CHOA 3MA5A 2AXUA 3QKYA 2CHWA 1WAO1 3FUDA 4URKA 5JHAA 3OTNA 4XI9A 4AP2A 2EIKE 1YMPA 4CGWA 3HRAA 4HOTA 4ANXA 2QYJA 4RSYA 4OYSA 3AG3E 2LXMA 2XEEA 3ZW3A 3T5XA 1JCSA 4ATGA 5FQ8A 4YVQC 2GRNB 3EHMA 2CHXA 3Q5MA 3PS6A 4LG6A 5BUZA 1HE8A 3TG5A 2XPZA 4C0MA 3L54A 5BXOA 1HZ4A 3DXMG 4I6EA 2CG2A 3CVPA 2XZDG 3T5VA 3G2UA 4P29A 3TJPA 3PE3A 4GCNA 3GYZA 2GRPB 4LCTA 3X2QE 2H6HA 2LUHA 5FWQA 3LS8A 2F37A 4WUYA 1Q2ZA 2WXQA 3B7BA 3HVEA 3ZPJA 5EN5D 2IO2C 1DVPA 2DZNA 3KS2A 4JEUA 2A4ZA 4UI9K 2VTBA 1UJKA 1DCEA 3ONKA 3PEUB 1BPOA 4CCAA 1Z3YA 1JPLA 4U8YD 3FU6A 3W9FA 5G04C 4HLLA 3LKUA 3QOUA 2X6FA 3ISMC 3SF4A 5CEDB 4O60A 5ENNA 3TXMA 2P9NG 1E7UA 2X6KA 3SI5A 2P58C 1N4SA 3FUFA 3D9OA 5G55A 3FH5A 4CT4A 4WWPA 3P1UA 3B7TA 1E8XA 2HO1A 2OCCE 2EIJE 2DWZA 4ILIA 1FPPA 5JJ6A 3ZKJA 3SO8A 5FJYA 4FA6A 5ENRD 4G24A 4RQIA 3B7RL 3ZVVA 2XQ0A 1N94A 2CFUA 4FJYA 3SFZA 4ZHBA 4JHJA 2ONDA 3FDHA 3NOCD 2IJGX 3CVYA 5CBOA 4ABNA 2Y3AA 3B7SA 2X3MA 1O1RA 3UKUG 2V5QC 3FTSA 4AVXA 1OCZE 1KLXA 3HYMB 2KXPC 3S7BA 1E8YA 2H6GA 5JMND 3ML9A 3L16A 4GYOA 3NQPA 1N11A 3G2SA 3ZXPA 2J08A 4KBQA 2YHEA 3TWSA 3WXXA 5AQBA 5ANRA 3VTXA 3RAUA 3ZYLA 1L5JA 3BU8A 3FEYA 4I2WA 4JXTA 2E2EA 3FH7A 1MYOA 1WDYA 3MEKA 1B89A 3G2WA 4G8KA 3E34A 3JQ0A 3CHMA 3O4ZA 1E90A 1OWLA 5KJLA 3MKQA 4I1OB 3ZYMA 3Q73A 3C3RA 2UY1A 1IQUA 2C0LA 3EDTB 1S63A 2F8YA 4GMLA 1LD8A 3FEXA 4MBGA 1A17A 3RK6A 3ULEG 1K8KG 1ELKA 4AJWA 2J09A 3PZDA 4HVBA 3TWUA 3IEGA 2Y4UA 2J9QA 4K5AB 2FO1E 1OWOA 1TEZA 1UOHA 2WXIA 2R17C 2WMNA 3CHRA 3E30A 3TGOA 2XEVA 3AG2E 2WXLA 2WXNA 3SGHA 4WNDA 3KEZA 5BV1A 4O1PA 4CYMD 5EKQD 4I9EA 2VGYA 2HYZA 3TXNA 4FLHA 4U8HA 3ABKE 3B95A 3FP3A 1OCCE 3TWTA 3E4BA 2P9IG 3OXLA 2V0PA 3V31A 5BXUA 1OY3D 3UM2A 3ENEA 4BWRA 3AG1E 4YVOA 4U0UA 5IY5E 3C98A 3RIBA 1KT1A 2RG8A 2C0MA 5KBAA 1OCRE 4U63A 1TR4A 4AIFA 1P5QA 2JEKA 4FU3A 3CQGB 2X6IA 3JCKC 3ZYKA 4K5CA 4Y6WA 4LSZE 3FU5A 2WXFA 3TAXA 4TV3A 5D2MC 5JJ7A 5G04J 2MRIA 4QFVA 1Z6TA 2Y0BG 3C3OA 1JCRA 3DSSA 4BTAA 5LCWJ 4GZDA 4DLQA 4HRMB 3FUEA 4DX5D 2AJAA 2FEZA 4GZ5A 1HG2A 3RKVA 2HE0A 1XGWA 3LY7A 4ZFHA 2VSNA 4B0ZA 2VSXE 4A55A 1K1BA 3I4GA 2DYSE 1SA5A 3SFYA 2QC9A 5ENSD 5CECB 3LPZA 3UIOC 3D9LA 5AN8A 3BG0B 3LCAA 4GTTA 4NURA 1OUVA 3CK9A 3C3QA 4U0SA 3UQ3A 5D66A 4UUCA 1Z3XA 2ILRA 5HI7A 3CHPA 1SQMA 4U96D 4U95D 1A5EA 3PVLA 4OAVB 1SZ9A 3U3WA 4HOUA 2I2OA 2DYRE 4L7TA 5CRVA 1PAQA 2LAIA 5E75A 4UWFA 2KATA 3J5PA 3VTYA 5FZSA 3L22A 3CVUA 1IYGA 1SW6A 1LF8A 3HHMA 1NZNA 3IHYA 3APDA 4HB5A 5FQ6A 1HH8A 2VSOE 4J8DA 4CDMA 2XGOA 3ZEFA 2CHZA 4J8YA 3RO2A 2EQXA 5J90A 1YYHA 4K03A 4BT9A 2WXMA 3TWWA 5CHEE 4I2ZA 3VLFA 3V2OA 2V4HC 5EX3A 3LDZA 2GRQB 4HOSA 3Q9UC 4M3OA 4XKCA 3V2XA 3FU3A 5CEAA 4LNGA 2Q7FA 2WMOA 3FUKA 2MHKA 1H6OA 5AJDA 3ZGQA 4DX1A 4ILHB 3IBEA 3BG1B 3LEWA 1O1SA 3RSEG 4YDEA 3B7UX 2NYJA 3Q7FA 4F3VA 4JB8P 4TXQA 3EIQC 4E6HA 4WNFA 3CIAA 3D9HA 5ARFA 2IOSA 4RG6A 5AAOA 2MYOA 2J4DA 2R02A 4JPSA 3DSXA 1ZU2A 3RO3A 4G25A 4KXKB 3R7QA 4U8VD 1OT8A 4OVVA 3MV3B 4Z68A 3ZN3A 2LNIA 5EX0A 3PZ3A 3T8KA 4GZ6A 3C72A 4EHMA 5C2YA 4YDYA 3ULYA 1N0RA 2B0OE 2HM8A 5AQAA 4HI8A 2WQHA 1QBQA 4UWLA 3AU5A 1TN8A 1BI8B 4UQZA 3ZFWA 3CR3A 4C48B 5KNGA 2RD0A 1PC2A 4U07A 1EF1C 4R7LA 1U2VG 3HXDA 4RVBA 2WXRA 4BEPA 2IU1A 4TUMA 2R03A 4J0UA 3PREA 1BU9A 5ITZF 5LP0A 3SZ7A 3ZXSA 3FTVA 4GTRA 1ELRA 4N5QA 3DBSA 3ASGA 3L17A 4ME2A 2L6JA 5LCWC 2GW1A 5G2NA 3CV0A 2BKKB 5KJKA 2A5EA 3LJ3A 4G2VA 4IYPA 3AG4E 2AW6A 1LTXA 2A5UA 1SA4A 1TNUA 4I6JA 3PRZA 4JA7A 4GTSA 1XNFA 4GTQA 3GZ1A 3AS4A 4G11A 4L1BA 3LY9A 4UI9C 3KD7A 3VLDA 4GYWA 2PQRA 4KYOB 4F53A 4EZKA 2QY7A 2F0YA 5LOZA 3FUHA 3KSQA 2VGXB 2XGSA 4GTOA 4MRUA 4UQYA 3L13A 1AWCB 2R2LA 2FBNA 4GZ3A 3HDXA 4UI9J 3GZ2A 4J8EA 3U64A 3CHQA 5KCMA 3ONLA 4RLYA 2X6HA 4K5BA 3KAEA 1SVXA 1X81A 4PH4B 5CCLA 4I6GA 1TNYA 1O1TA 4M7CA 2XRZA 3CK8A 2ZU6B 3Q75A 3CKCA 1OCOE 2AXVA 4PUCA 2JABA 4V3IA 1JWFA 2J07A 3ML8A 4L2YA 3MV2B 1H6KA 2IONA 3DPYA 5CBNA 2JLBA 2ZGGA 3U9WA 1QZ2A 3FTYA 4KVMA 3CSTA 3DWLG 1MX2A 2FF4A 3TG4A 4NIKA 3MZLB 1YCSB 4CZ2D 2WXGA 3EU5A 2M63A 4CRWA 2CFZA 4LUNU 4J6IA 4B8AA 3U4TA 2OEWA 4I1AA 3ZHEA 4CDNA 1GW6A 4H7YA 2FULA 1ZBPA 3FTUA 3JUIA 4HBDA 3EJNA 4I9CA 3IXEA 2P9PG 4UWHA 4JD2G 1N4QA 2QYUA 1TNOA 2P9LG 2P9UG 2X6JA 4J7WA 3RU0A 4CGVA 4G1TA 2R05A 3CEQA 3ZIMA 2FI7A 4L9PA 3ZYQA 3HIZA 2WQ6A 3QK0A 3I3NA 4LEUA 3F6QA 3UI2A 3PUJA 3NBNB 3SY2A 2UY1B 3QWVA 4O1OA 4QQIA 4AXHA 2DCPA 5A23A 2BTDA 2WXOA 3PNTB 1TN6A 3FWVA 2YHCA 2LO6A 4FHJA 3CKBA 1IHGA 1K1AA 1WM5A 4XZ4A 4B8CB 1BLXB 1ZB1A 3APCA 1D9SA 4MKTA 3MYVA 3MKRA 4F6RD 3FHEA 4HI9A 2RFAA 4EZJA 5FQ7A 1IKND 3QB2A 3EUVA 3FTXA 5M72A 3PEVB 4IN3B 3V79K 2BEDA 4HLEA 3D9JA 3CVVA 2PM6A 4GPMA 3PNLB 4GU5A 5BV0A 4BY6A 1E96B 4U0ZA 2AWIA 3ZUVB 3JYSA 3T9KA 4ATZD 3IKOB 3L82A 4AY6A 1UJJA 3UM3A 3D9MA 4DX6D 1D8EA 1E7VA 1S0PA 1E8WA 3S7FA 1HU3A 5T4YA 5KNHD 4G26A 1OXJA 3UXGA 4DJAA 4JL0A 4N5CA 4DX2A 2L9BA 1KZPA 4G8LA 4A3VA 3JXJA 4DI4A 3CVLA 3EHNA 2XRYA 3D3MA 3U66A 2VTBB 4XI0A 2XCCA 2NC9A 3ESLA 4XX5A 2VYIA 4N2SA 2UWJG 5T8IA 3HG0D 4FADA 4LRZA 1Z5SC 3QDNA 3VLEA 2ZIRA 5FZQA 2DZOA 1TYQG 1G3NB 2VGXA 1DC2A 3QARA 3L9TA 5AQ7A 2L0TB 4I1MA 5A7DB 1N4RA 1FT2A 3LYAA 3TL5A 4GB9A 1UN9A 2Y1LE 4PS3A 2OV8A 4JW1A 5EIDA 2OOEA 2IEJA 3GZSA 3HXEA 4LNBA 2IF4A 2OEVA 5FQ4A 3RJVA 1HXIA 4CT0A 4N3BA 3NAWA 4L23A 3BEEA
chains in the Genus database with same CATH topology
4UQZA 3ZFWA 3OAWA 3B7SA 2X3MA 2PL2A 3CR3A 3IV0A 1QNFA 3FTSA 2RD0A 4TRQA 4AVXA 1PC2A 4DPRA 1IQRA 1H19A 4EZLA 4U07A 3I4RB 1KLXA 3O48A 4AM9A 1EF1C 4R7LA 3HYMB 4UWKA 3AS8A 3S7BA 4JVSA 4N39A 5ARGA 1E8YA 3UT4A 4RVBA 2WXRA 3ML9A 2IU1A 4NRHB 3G2VA 3PREA 3L16A 4J0UA 4RG9A 4FHKA 4GYOA 1U3DA 3CSFA 3NQPA 3QJZA 5LP0A 4JZYA 5FTPA 3SZ7A 3G2SA 3ZXSA 3FTVA 3UX4A 2J08A 3ZHEB 2LAHA 4CEMA 3ASDA 4KBQA 3OXFA 2YHEA 3WXXA 1ELRA 4DK5A 3MJWA 3S7JA 4XE0A 3AS5A 3D9KA 3UT8A 3DBSA 5ANRA 1HG5A 2DBAA 3ASGA 1X5BA 3VTXA 3L17A 3ZYLA 1L5JA 3FU0A 3FEYA 4ME2A 2L6JA 4MLPA 5LCWC 2GW1A 5LFAA 4I2WA 4KVOA 4JXTA 2I1KA 3CV0A 2E2EA 5G2NA 3UPVA 4HFGA 2BF0X 3FH7A 2DIWA 4UWGA 5KJKA 1NA3A 3LJ3A 4G2VA 1EPUA 4IYPA 3MEKA 1B89A 5D0OD 3G2WA 2AW6A 4C0EA 3MCXA 4O6FA 2A5UA 3JQ0A 4W9RA 3CHMA 2WVIA 3O4ZA 4I6JA 3PRZA 1E90A 4JA7A 3ZRHA 1OWLA 5KJLA 4AV7A 2NXPA 3SD5A 3MKQA 4I1OB 3ZYMA 1XNFA 3EIJA 2KCKA 3CVNA 3L6AA 2UY1A 1IQUA 3LVQE 1H2UA 4IRUA 2C0LA 5CCMA 1EDUA 4UQXA 3EDTB 3GZ1A 4BT8A 3AS4A 4G11A 1DNPA 4NACA 5E76A 4L1BA 4XKBA 2PQNA 5FT9A 4GMLA 5AIJA 3Q15A 3FEXA 3ESKA 3LY9A 1A17A 4J8SA 3RK6A 2WPVA 5FZRA 4UI9C 3KD7A 1ELKA 4AJWA 2J09A 3PZDA 4ACKA 4ANVA 1OWNA 4HVBA 3VLDA 5BNWA 3LY8A 1TJFA 3CQCB 1MHQA 2C2LA 4APOA 4GYWA 3IEGA 2PQRA 4KYOB 2GGFA 2Y4UA 4F53A 2J9QA 4EZKA 2QY7A 5LOZA 1OWOA 3URZA 2V5FA 3D9NA 1TEZA 2WXIA 3FUMA 2R17C 3FUHA 2VGXB 2OVBA 2WMNA 5A6CA 3T8MA 3CHRA 2XGSA 3TGOA 1HO8A 1FVHA 4HS2A 4MRUA 2XEVA 3P2BA 4UQYA 2WXLA 1HFAA 3UT7A 3PUKA 3L13A 2WXNA 3SGHA 4WNDA 5BPPA 2FBNA 5T3RA 3KEZA 4GZ3A 4IULA 4GZCA 3DPDA 4K0RA 5BV1A 4ILGA 3HDXA 2J49A 4UI9J 1VDYA 2E0IA 2X38A 3GZ2A 4J8EA 4U04A 4I9EA 5EKQD 2KZTB 3CHQA 3U64A 4Y6CA 2VGYA 5KCMA 4KZ0A 2AVPA 2HYZA 3ASHA 4Q94A 3ONLA 3TXNA 2X6HA 3KAEA 4D10C 4PH4B 4FLHA 4U8HA 5CCLA 4I6GA 5KJNA 2XRZA 3FP3A 1E8ZA 4B94A 3E4BA 4BFRA 1NA0A 3CK8A 2ZU6B 4BX9A 3JQ1A 3CKCA 3APFA 3OXLA 5D0QD 2AXVA 4OVUA 2V0PA 3FUJA 4PUCA 4BTBA 4AOFA 4V3IA 1MQSA 3UUXA 4EECA 1JWFA 2J07A 4FP7A 2GRLA 3ML8A 2NSZA 4L2YA 5EDSA 3MV2B 4EBAG 3FTZA 3Q47B 3ENEA 1SZAA 3FH8A 4BWRA 4N2QA 2WXKA 1ELWA 2KM4A 3Q4AB 2FO7A 1H6KA 4JA9A 2IONA 3FUIA 4YVOA 4U0UA 4J8FA 2JLBA 3C98A 3RIBA 1H2VC 1NP7A 1KT1A 2I9CA 2RG8A 2KCVA 3U9WA 2C0MA 1QZ2A 3FTYA 3IHVA 4WWNA 4KVMA 1OWPA 3CSTA 3CGHA 4WNEA 3QC1A 2FF4A 4JHKA 2WB2A 3TG4A 4PDXA 3AU4A 1KT0A 4G23A 4GA0A 2YINA 4GA1A 4C9BB 3I5PA 3MZLB 4U63A 2WXGA 3UMVA 2M63A 5BW8C 2IFUA 4CRWA 4F7AA 4KZCA 4MS6A 4AIFA 2CFZA 1P5QA 2JEKA 3HVEB 3CQGB 4FU3A 4LUNU 4J6IA 4CDRA 2XPYA 2X6IA 4FJZA 4B8AA 4JEHA 3JCKC 3FY4A 4I43A 3FULA 3ZYKA 3G2TA 4Y6WA 3FU5A 2WXFA 3TAXA 3U4TA 4I1AA 1FVFA 3ZHEA 2R5SA 4H7XA 1UW4B 4PS8A 4CDNA 4TV3A 4AEZC 3CVQA 5JJ7A 5G04J 5AENA 1OWMA 4GMJA 4DLOA 1H2TC 1GW6A 2MRIA 4H7YA 1Z6TA 4QFVA 3CVWA 2FULA 1ZBPA 4EQFA 3FTUA 3JUIA 4APFA 3EJNA 3L08A 5G05C 4I9CA 5CMWA 4BTAA 5LCWJ 1QQEA 2HR2A 2I6HA 2L0IA 4GZDA 4UWHA 3NZSA 4L2LA 2VJ8A 4DLQA 5HQ8A 4Q69A 3FTWA 3SHFA 4HORA 2X6JA 3PE4A 3RU0A 2XPIA 3FUEA 2YNQA 4CGVA 3PH0C 2KCLA 4G1TA 3CEQA 1N52A 4WAFA 4A1SA 2FEZA 3ZIMA 2FI7A 4GZ5A 4N3CA 3HIZA 1HG2A 4WWOA 3ZYQA 3QK0A 3RKVA 2WQ6A 3I3NA 3CK7A 4LEUA 3R9AB 4ANUA 3MKQB 3PUJA 2OVFA 1XGWA 3B13A 3LY7A 3CLJA 3OXGA 4ACLA 5J08A 2UY1B 3QWVA 1YA0A 3QAQA 4AXHA 2DCPA 1H0AA 2GRMA 2XHEA 2LSUA 2VSNA 2R59A 5CMYA 4B0ZA 5A23A 2AXZA 2VSXE 4A55A 2BTDA 3I4GA 1U3CA 1Y6IA 4JHRA 2WXOA 3LPZA 3PNTB 4LERA 5C1DA 4N3AA 2IQCA 2V4LA 3ASFA 1UN8A 3D9LA 3FWVA 2YHCA 2LSVA 3SBTB 2LO6A 3BG0B 1WY6A 3LCAA 5ANLA 3CVXA 4FHJA 1JWGA 3CKBA 3D9IA 4FULA 4NURA 1IHGA 4EPZA 4BX8A 4XIFA 1WM5A 3RRNB 5DBKA 4I17A 1OUVA 3CK9A 4XZ4A 4B8CB 2CG3A 3CHOA 2J4BA 2XCBA 3APCA 3MA5A 2AXUA 3QKYA 1W3BA 2CHWA 4U0SA 3UQ3A 4MKTA 1WAO1 5LX8A 4GAAA 5AJLA 1Z3XA 2ILRA 3FUDA 5HI7A 4URKA 3MYVA 3MKRA 5JHAA 3OTNA 3FHEA 3CHPA 2YQ8A 4XI9A 4AP2A 1SQMA 3MX3A 3QWPA 3RRMB 4CGWA 3PVLA 4EZJA 1SZ9A 4HOTA 4WNGA 4ANXA 4RSYA 4FLBA 4HOUA 2I2OA 3U3WA 2KZTA 3S2AA 5FQ7A 2PM7A 4OYSA 1N54A 4L7TA 4NQ0A 3QB2A 2PZIA 3ZW3A 3FTXA 3T5XA 2V8SE 3QNKA 4GCOA 4ATGA 5M72A 5FQ8A 3PEVB 1PAQA 2LAIA 4IN3B 4YVQC 3LVRE 4HLEA 5AYWD 5E75A 4UWFA 3EHMA 2CHXA 3D9JA 3Q5MA 2KATA 3PS6A 3VTYA 5FZSA 3SBSA 3CVVA 4AY5A 3FUNA 4GA2A 1FCHA 3L22A 5BUZA 4HXIA 3CVUA 2PM6A 1IYGA 1HE8A 3TG5A 2XGMA 1INZA 4KMOA 1LF8A 3PNLB 3SNXA 4GU5A 3HHMA 2IOLA 2XPZA 4C0MA 5G05J 2QFCA 3L54A 1NZNA 3CHSA 5BV0A 4BY6A 1E96B 2WXHA 4U0ZA 1HZ4A 2AWIA 4FC8A 3IHYA 3APDA 3JYSA 4I6EA 4B89A 2CG2A 2Y4TA 3FFLA 3CVPA 5FQ6A 1HH8A 4BSXA 4GPKA 5DIZA 3IKOB 4AY6A 3T5VA 5BT1A 1UJJA 1TJCA 2VSOE 3G2UA 3QWWA 3S7DA 4J8DA 3D9MA 4P29A 4CDMA 2XGOA 3ZEFA 2CHZA 3RO2A 1E7VA 1S0PA 1E8WA 4PS7A 3S7FA 2EQXA 3TJPA 1HU3A 3PE3A 4GCNA 5J90A 3GYZA 4K03A 5T4YA 4G26A 4BT9A 2WXMA 4LCTA 1HS6A 5CHEE 5FWQA 4DJAA 3LS8A 3LXUX 4JL0A 4WUYA 4I2ZA 3VLFA 2I1JA 4N5CA 4Q96A 5EX3A 1EYHA 2WXQA 3LDZA 2L9BA 4HOQA 4A3VA 4DI4A 3R7RA 3CVLA 3EHNA 3HVEA 2XRYA 3ZPJA 1DVPA 4JC8A 4HOSA 3D3MA 5JJTA 3KS2A 3U66A 2VTBB 4M3OA 2BUGA 2A4ZA 4JEUA 4XI0A 4UI9K 4XKCA 3FU3A 2VTBA 1UJKA 4A1GA 1JUQA 2Q7FA 2WMOA 2XCCA 3FUKA 2MHKA 3ONKA 5KJMA 3PEUB 1BPOA 2NC9A 3ESLA 4XX5A 4CCAA 5AJDA 3ZGQA 1Z3YA 2VYIA 4N2SA 1JPLA 2UWJG 3N71A 4ILHB 5T8IA 2WM9A 3NF1A 3FU6A 4FADA 3IBEA 3BG1B 4LRZA 5G04C 3QDNA 3LEWA 4YNDA 3VLEA 3LKUA 3QOUA 2X6FA 3SF4A 3B7UX 5FZQA 4F3VA 5ENNA 3TXMA 3D9PA 3PDNA 2VGXA 1E7UA 2X6KA 3SI5A 2KC7A 3EIQC 4E6HA 4WNFA 3QARA 2P58C 3CIAA 1UG3A 2IOSA 2MOWA 3GW4A 2L0TB 5ARFA 3MGBA 3NZUA 4RG6A 3Q49B 4I1MA 5A7DB 3FUFA 3D9OA 5G55A 3FH5A 4CT4A 4WWPA 2VQ2A 4KT6B 2J4DA 4A3TA 3LYAA 4JPSA 3TL5A 3P1UA 4GB9A 1ZU2A 3RO3A 3ULQA 3B7TA 4G25A 1E8XA 3K9IA 1UN9A 4KXKB 2HO1A 1HF8A 3R7QA 4PS3A 1PY1A 4ILIA 4DI3A 2WXJA 2WQ7A 2OV8A 2WXPA 5JJ6A 4OVVA 3MV3B 5FJYA 4JW1A 3ZN3A 4TUUA 4FA6A 2LNIA 2OOEA 4G24A 4GYYA 5EX0A 3GZSA 4GZ6A 5JHBA 2IF4A 5C2YA 4F1SA 4ANWA 3B7RL 4E85A 2HM8A 5FQ4A 3ZVVA 1HX8A 1Y8MA 2XQ0A 2CFUA 4FJYA 3SFZA 3RJVA 1HXIA 2WQHA 4JHJA 4CT0A 2ONDA 3FDHA 2VSYA 3RRUA 3CVYA 2IJGX 4EBAA 4UWLA 4N3BA 3AU5A 4L23A 4ABNA 3BEEA 2Y3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGO A;  4J8D A;  2XPI A;  4UQZ A;  3ZFW A;  2XGO A;  4CGV A;  3RO2 A;  4G1T A;  2KCL A;  2XEV A;  3CEQ A;  4UQY A;  2PL2 A;  3S7F A;  4A1S A;  2FEZ A;  3PE3 A;  4GCN A;  3GYZ A;  1PC2 A;  4WND A;  2FI7 A;  2FBN A;  4G26 A;  4GZ3 A;  4U07 A;  3S7D A;  4BT9 A;  1KLX A;  3O48 A;  4GZ5 A;  4N3C A;  4AM9 A;  3HYM B;  4UI9 J;  5CHE E;  3RKV A;  3CK7 A;  3AS8 A;  3GZ2 A;  4J8E A;  4JL0 A;  4I9E A;  4LEU A;  4N39 A;  4U04 A;  4WUY A;  4I2Z A;  4Y6C A;  5EKQ D;  2VGY A;  3LY7 A;  5ARG A;  3OXG A;  4N5C A;  5EX3 A;  2AVP A;  2HYZ A;  3ASH A;  2UY1 B;  3QWV A;  1YA0 A;  4HOQ A;  4NRH B;  4J0U A;  3KAE A;  3CVL A;  2LSU A;  2VSN A;  3ZPJ A;  4RG9 A;  5CCL A;  4GYO A;  4HOS A;  5FTP A;  5JJT A;  3KS2 A;  5KJN A;  2BUG A;  4JHR A;  4XI0 A;  3SZ7 A;  3FP3 A;  4UI9 K;  2XCC A;  2Q7F A;  3LPZ A;  3ZHE B;  4B94 A;  2MHK A;  3E4B A;  3R9A B;  5C1D A;  4N3A A;  5KJM A;  3ASD A;  2NC9 A;  4KBQ A;  3OXF A;  1NA0 A;  3ASF A;  3WXX A;  3CK8 A;  1ELR A;  3FWV A;  3ZGQ A;  2YHC A;  2LSV A;  3CKC A;  2VYI A;  3OXL A;  5D0Q D;  3S7J A;  3AS5 A;  4N2S A;  3LCA A;  4BTB A;  5M72 A;  2UWJ G;  3N71 A;  2DBA A;  3ASG A;  3CKB A;  3UUX A;  3NF1 A;  1IHG A;  3VTX A;  5G04 C;  3QDN A;  1WM5 A;  4ME2 A;  3MV2 B;  2L6J A;  4XIF A;  5LCW C;  2GW1 A;  4YND A;  4I2W A;  3Q47 B;  4I17 A;  5DBK A;  4N2Q A;  4BWR A;  1OUV A;  3CK9 A;  2E2E A;  3CV0 A;  1ELW A;  3LKU A;  3Q4A B;  2FO7 A;  3QOU A;  3UPV A;  3SF4 A;  5FZQ A;  4JA9 A;  2XCB A;  3MA5 A;  1NA3 A;  4YVO A;  3QKY A;  5KJK A;  4U0U A;  1W3B A;  4J8F A;  4U0S A;  3UQ3 A;  4F3V A;  2JLB A;  4G2V A;  1WAO 1;  3RIB A;  1KT1 A;  3MEK A;  3PDN A;  2KCV A;  2C0M A;  1QZ2 A;  2VGX A;  5HI7 A;  1B89 A;  5D0O D;  2KC7 A;  3MKR A;  4WNE A;  4O6F A;  2FF4 A;  4WNF A;  4W9R A;  4XI9 A;  2P58 C;  2YQ8 A;  3TG4 A;  5ARF A;  3GW4 A;  3QWP A;  1KT0 A;  4CGW A;  4JA7 A;  4RG6 A;  3QWW A;  4G23 A;  4HOT A;  3Q49 B;  4WNG A;  4GA0 A;  5KJL A;  5A7D B;  4GA1 A;  3U3W A;  4HOU A;  1XNF A;  2KCK A;  4NQ0 A;  3CVN A;  2VQ2 A;  2PZI A;  5BW8 C;  2UY1 A;  2IFU A;  5CCM A;  2C0L A;  3LYA A;  4UQX A;  4AIF A;  4GCO A;  1P5Q A;  3EDT B;  3GZ1 A;  4BT8 A;  1ZU2 A;  3AS4 A;  3RO3 A;  3ULQ A;  4G25 A;  3K9I A;  4IN3 B;  4KXK B;  4YVQ C;  2HO1 A;  4CDR A;  5AYW D;  2PQN A;  5FT9 A;  4ABN A;  3Q15 A;  3ESK A;  3LY9 A;  3Q5M A;  2KAT A;  5JJ6 A;  3VTY A;  1A17 A;  5FZS A;  3MV3 B;  4Y6W A;  4GA2 A;  5FJY A;  2WPV A;  4AY5 A;  3ZN3 A;  1FCH A;  5FZR A;  4UI9 C;  2LNI A;  2OOE A;  3KD7 A;  4I1A A;  3TAX A;  3U4T A;  3TG5 A;  3ZHE A;  1IYG A;  2R5S A;  2XGM A;  4G24 A;  4H7X A;  4GYY A;  5EX0 A;  3CVQ A;  5BNW A;  3LY8 A;  4GZ6 A;  5JJ7 A;  5G04 J;  2C2L A;  2IF4 A;  4APO A;  4GYW A;  3IEG A;  5G05 J;  2QFC A;  2PQR A;  4H7Y A;  4KYO B;  1ZBP A;  1NZN A;  3S7B A;  4EQF A;  2Y4U A;  1E96 B;  1Y8M A;  4U0Z A;  1HZ4 A;  3JYS A;  5G05 C;  2J9Q A;  3RJV A;  1HXI A;  2Y4T A;  3FFL A;  3CVP A;  4I9C A;  1HH8 A;  2WQH A;  4GPK A;  5DIZ A;  4BTA A;  5LCW J;  1QQE A;  2HR2 A;  2I6H A;  2OND A;  2VSY A;  3URZ A;  2V5F A;  4AY6 A;  5BT1 A;  5HQ8 A;  4N3B A;  1TJC A;  2VGX B;  4HOR A;  5A6C A;  3PE4 A;  3BEE A;  2XGS A;  3RU0 A; 
#chains in the Genus database with same CATH topology
 3OAW A;  3V30 A;  1QNF A;  4TRQ A;  3I4R B;  3UM1 A;  3O48 A;  4AM9 A;  3ABL E;  4N39 A;  3PZ2 A;  4NRH B;  4RG9 A;  4FHK A;  3CSF A;  3QJZ A;  4JZY A;  5FTP A;  3DSV A;  3ZHE B;  2J8S D;  2LAH A;  4CEM A;  4TXP A;  1KPS B;  3Q9N C;  3WG7 E;  3S7J A;  3AS5 A;  3ASN E;  1HG5 A;  2DBA A;  1X5B A;  3FU0 A;  3EHR A;  4KVO A;  2I1K A;  4HFG A;  2ZIS A;  4UWG A;  2P9K G;  1NA3 A;  2F8X K;  4HNA D;  3HXC A;  5D0O D;  3ZU7 B;  4C0E A;  3MCX A;  2RKK A;  4W9R A;  2WVI A;  3ZRH A;  4AV7 A;  3SD5 A;  3BQO A;  3EIJ A;  3CVN A;  3UTM A;  5EYP F;  5CCM A;  4UQX A;  4BT8 A;  1DNP A;  4NAC A;  5E76 A;  4XKB A;  2PQN A;  5AIJ A;  3ESK A;  2WPV A;  5FZR A;  4U7E B;  4ANV A;  4ACK A;  3LY8 A;  3UKR G;  1MHQ A;  4APO A;  2ETA A;  3BUA A;  1WG0 A;  3D9N A;  3TWR A;  4BER A;  2OVB A;  5A6C A;  4BSZ B;  1HO8 A;  1FVH A;  4HS2 A;  3UIP C;  1HFA A;  3UT7 A;  3PUK A;  2GRR B;  4DX7 D;  4GZC A;  4K0R A;  2J49 A;  1VDY A;  2KZT B;  1BD8 A;  4Y6C A;  4KZ0 A;  3ASH A;  1N0Q A;  4Q94 A;  3DXK G;  4D10 C;  5KJN A;  1E8Z A;  1BI7 B;  1NA0 A;  4BX9 A;  5D0Q D;  1MQS A;  3UUX A;  4EEC A;  2Y69 E;  4FP7 A;  2GRL A;  3DSU A;  5CRU A;  3Q47 B;  3FH8 A;  1SZA A;  5AAR A;  4N2Q A;  5B1A E;  2WXK A;  3Q4A B;  2XZT G;  4JA9 A;  4J8F A;  2I9C A;  2KCV A;  1OWP A;  4JHK A;  2WB2 A;  4GA0 A;  5HRY A;  2YIN A;  4GA1 A;  4C9B B;  4F1P A;  3UMV A;  5BW8 C;  4OAU C;  4F7A A;  4KZC A;  3SFX A;  4MS6 A;  3HVE B;  2XPY A;  3DEO A;  4FJZ A;  3E33 A;  1TN7 A;  2XS8 A;  3G2T A;  1NI1 A;  1S64 A;  4AEZ C;  3CVQ A;  5EIB E;  1OWM A;  4GMJ A;  4DLO A;  1H2T C;  3CVW A;  3DEP A;  4APF A;  5G05 C;  5CMW A;  2L0I A;  3NZS A;  5CER B;  3SHF A;  4HOR A;  3PE4 A;  2XPI A;  2KCL A;  4YDW A;  1N52 A;  4A1S A;  4WWO A;  5B1B E;  3E37 A;  3CK7 A;  4ANU A;  3MKQ B;  3AJI A;  2OVF A;  3B13 A;  5J08 A;  3C5R A;  1YA0 A;  3QAQ A;  2XHE A;  2AXZ A;  5ENP D;  1U3C A;  3W9G A;  1Y6I A;  4JHR A;  3TWV A;  5C1D A;  4LER A;  2V4L A;  3ASF A;  1UN8 A;  4TXR A;  2IY0 C;  3SBT B;  2QZA A;  1WY6 A;  3E32 A;  3TWX A;  1JWG A;  4FUL A;  4XIF A;  3TWQ A;  1V54 E;  3RRN B;  4BET A;  2CG3 A;  2J4B A;  2XCB A;  1W3B A;  5LX8 A;  1DCQ A;  4GAA A;  5AJL A;  3DSW A;  5H7P A;  3AAA C;  2YQ8 A;  3MX3 A;  3QWP A;  3RRM B;  4WNG A;  2BKG A;  4FLB A;  2KZT A;  3S2A A;  2PM7 A;  1N54 A;  4NQ0 A;  1MX4 A;  2PZI A;  2V8S E;  3QNK A;  4DRX E;  4GCO A;  3LVR E;  5AYW D;  1NFI E;  1RZ4 A;  2EIL E;  3SBS A;  4AY5 A;  3FUN A;  4GA2 A;  1FCH A;  3EU9 A;  4HXI A;  2H6I A;  3SQV A;  2XGM A;  1INZ A;  4KMO A;  3SNX A;  2B6C A;  2IOL A;  5G05 J;  2QFC A;  3CHS A;  2WXH A;  4FC8 A;  4B89 A;  3KEA A;  2Y4T A;  3FFL A;  4GPK A;  4BSX A;  5DIZ A;  5BT1 A;  1TJC A;  1FT1 A;  3QWW A;  3S7D A;  2ZXW E;  1TNZ A;  4PS7 A;  4GTV A;  5EIL A;  3HXF A;  1HS6 A;  1IXV A;  3LXU X;  2I1J A;  4Q96 A;  1EYH A;  3NOG D;  4HOQ A;  3R7R A;  3UM0 A;  4JC8 A;  5JJT A;  2BUG A;  3ABM E;  4A1G A;  1JUQ A;  2LXL A;  5KJM A;  3KSL A;  5JA4 D;  2DVW A;  3N71 A;  2WM9 A;  3NF1 A;  4YND A;  2XS1 A;  4GMR A;  3D9P A;  3PDN A;  2KC7 A;  2ETC A;  1UG3 A;  2MOW A;  3GW4 A;  3MGB A;  3NZU A;  4YDO A;  3Q49 B;  1H6P A;  3UIN C;  2VQ2 A;  4KT6 B;  1NL4 A;  3ASO E;  4A3T A;  3ULQ A;  5B3S E;  3K9I A;  1HF8 A;  1PY1 A;  4DI3 A;  2WXJ A;  2WQ7 A;  2WXP A;  5HS0 A;  4TUU A;  1V55 E;  4GYY A;  5JHB A;  4F1S A;  4ANW A;  4E85 A;  1TNB A;  1HX8 A;  1Y8M A;  5ENT D;  3RRU A;  2VSY A;  4EBA A;  5FIN A;  1N95 A;  2ZGD A;  2PL2 A;  3DRA A;  3IV0 A;  4GTP A;  5EYL A;  4DPR A;  1IQR A;  1H19 A;  4EZL A;  4UWK A;  1K3Z D;  3AS8 A;  4JVS A;  5ARG A;  3UT4 A;  3G2V A;  3R9M A;  1U3D A;  1N9A A;  3UX4 A;  1LD7 A;  3ASD A;  2XEN A;  3OXF A;  4LNU D;  4DK5 A;  3MJW A;  4XE0 A;  3D9K A;  3UT8 A;  2ETB A;  4HRN A;  3Q79 A;  4MLP A;  5LFA A;  3UPV A;  1MX6 A;  2BF0 X;  2DIW A;  1AP7 A;  1EPU A;  1MJ0 A;  4O6F A;  2VGE A;  2RFM A;  2PNN A;  1RW2 A;  2NXP A;  3J5Q B;  2KCK A;  2EIN E;  3L6A A;  3LVQ E;  1H2U A;  4IRU A;  1EDU A;  5AQ9 A;  3EHQ A;  5FT9 A;  3Q7A A;  4A63 B;  3JXI A;  3Q15 A;  3DST A;  4J8S A;  1MZC A;  5HKP A;  1OWN A;  5BNW A;  1TJF A;  3CQC B;  3ZNG A;  2C2L A;  2GGF A;  4X8Q A;  1QYM A;  3URZ A;  2V5F A;  3HXB A;  3FUM A;  1KZO A;  3T8M A;  2KBX A;  3P2B A;  5BPP A;  4DUI A;  5T3R A;  4IUL A;  3DPD A;  4ILG A;  2E0I A;  2X38 A;  4U04 A;  2GRO B;  1S70 B;  2AVP A;  5ENO D;  4B94 A;  3JUE A;  4BFR A;  3JQ1 A;  3APF A;  4OVU A;  3FUJ A;  4BTB A;  4AOF A;  4BES A;  2NSZ A;  5EDS A;  4EBA G;  3FTZ A;  1ELW A;  2KM4 A;  2FO7 A;  3FUI A;  4HRL A;  1H2V C;  1NP7 A;  5FIO A;  4WWN A;  3IHV A;  3PZ4 A;  3CGH A;  4WNE A;  3PZ1 A;  3QC1 A;  4PDX A;  3AU4 A;  1KT0 A;  4G23 A;  2IO3 C;  3I5P A;  2H6F A;  2P9S G;  2IFU A;  5ENQ D;  1O5M A;  4CDR A;  3LJN A;  1JCQ A;  4HQD A;  4JEH A;  3FY4 A;  4I43 A;  3FUL A;  2L6B A;  1FVF A;  2R5S A;  4H7X A;  1UW4 B;  4PS8 A;  5AEN A;  4XEI G;  4EQF A;  3L08 A;  1QQE A;  2HR2 A;  2I6H A;  4L2L A;  2VJ8 A;  5HQ8 A;  4Q69 A;  3FTW A;  2YNQ A;  4GTM A;  3PH0 C;  4WAF A;  1D8D A;  4N3C A;  3R9A B;  3CLJ A;  3OXG A;  4ACL A;  1H0A A;  2GRM A;  2LSU A;  2R59 A;  5CMY A;  3NB2 A;  2XEH A;  1IHB A;  2EIM E;  1N4P A;  4N3A A;  2IQC A;  2LSV A;  4B93 B;  5ANL A;  5KWD A;  3CVX A;  3Q78 A;  3D9I A;  4EPZ A;  4BX8 A;  5DBK A;  2P2C P;  4I17 A;  3CHO A;  3MA5 A;  2AXU A;  3QKY A;  2CHW A;  1WAO 1;  3FUD A;  4URK A;  5JHA A;  3OTN A;  4XI9 A;  4AP2 A;  2EIK E;  1YMP A;  4CGW A;  3HRA A;  4HOT A;  4ANX A;  2QYJ A;  4RSY A;  4OYS A;  3AG3 E;  2LXM A;  2XEE A;  3ZW3 A;  3T5X A;  1JCS A;  4ATG A;  5FQ8 A;  4YVQ C;  2GRN B;  3EHM A;  2CHX A;  3Q5M A;  3PS6 A;  4LG6 A;  5BUZ A;  1HE8 A;  3TG5 A;  2XPZ A;  4C0M A;  3L54 A;  5BXO A;  1HZ4 A;  3DXM G;  4I6E A;  2CG2 A;  3CVP A;  2XZD G;  3T5V A;  3G2U A;  4P29 A;  3TJP A;  3PE3 A;  4GCN A;  3GYZ A;  2GRP B;  4LCT A;  3X2Q E;  2H6H A;  2LUH A;  5FWQ A;  3LS8 A;  2F37 A;  4WUY A;  1Q2Z A;  2WXQ A;  3B7B A;  3HVE A;  3ZPJ A;  5EN5 D;  2IO2 C;  1DVP A;  2DZN A;  3KS2 A;  4JEU A;  2A4Z A;  4UI9 K;  2VTB A;  1UJK A;  1DCE A;  3ONK A;  3PEU B;  1BPO A;  4CCA A;  1Z3Y A;  1JPL A;  4U8Y D;  3FU6 A;  3W9F A;  5G04 C;  4HLL A;  3LKU A;  3QOU A;  2X6F A;  3ISM C;  3SF4 A;  5CED B;  4O60 A;  5ENN A;  3TXM A;  2P9N G;  1E7U A;  2X6K A;  3SI5 A;  2P58 C;  1N4S A;  3FUF A;  3D9O A;  5G55 A;  3FH5 A;  4CT4 A;  4WWP A;  3P1U A;  3B7T A;  1E8X A;  2HO1 A;  2OCC E;  2EIJ E;  2DWZ A;  4ILI A;  1FPP A;  5JJ6 A;  3ZKJ A;  3SO8 A;  5FJY A;  4FA6 A;  5ENR D;  4G24 A;  4RQI A;  3B7R L;  3ZVV A;  2XQ0 A;  1N94 A;  2CFU A;  4FJY A;  3SFZ A;  4ZHB A;  4JHJ A;  2OND A;  3FDH A;  3NOC D;  2IJG X;  3CVY A;  5CBO A;  4ABN A;  2Y3A A;  3B7S A;  2X3M A;  1O1R A;  3UKU G;  2V5Q C;  3FTS A;  4AVX A;  1OCZ E;  1KLX A;  3HYM B;  2KXP C;  3S7B A;  1E8Y A;  2H6G A;  5JMN D;  3ML9 A;  3L16 A;  4GYO A;  3NQP A;  1N11 A;  3G2S A;  3ZXP A;  2J08 A;  4KBQ A;  2YHE A;  3TWS A;  3WXX A;  5AQB A;  5ANR A;  3VTX A;  3RAU A;  3ZYL A;  1L5J A;  3BU8 A;  3FEY A;  4I2W A;  4JXT A;  2E2E A;  3FH7 A;  1MYO A;  1WDY A;  3MEK A;  1B89 A;  3G2W A;  4G8K A;  3E34 A;  3JQ0 A;  3CHM A;  3O4Z A;  1E90 A;  1OWL A;  5KJL A;  3MKQ A;  4I1O B;  3ZYM A;  3Q73 A;  3C3R A;  2UY1 A;  1IQU A;  2C0L A;  3EDT B;  1S63 A;  2F8Y A;  4GML A;  1LD8 A;  3FEX A;  4MBG A;  1A17 A;  3RK6 A;  3ULE G;  1K8K G;  1ELK A;  4AJW A;  2J09 A;  3PZD A;  4HVB A;  3TWU A;  3IEG A;  2Y4U A;  2J9Q A;  4K5A B;  2FO1 E;  1OWO A;  1TEZ A;  1UOH A;  2WXI A;  2R17 C;  2WMN A;  3CHR A;  3E30 A;  3TGO A;  2XEV A;  3AG2 E;  2WXL A;  2WXN A;  3SGH A;  4WND A;  3KEZ A;  5BV1 A;  4O1P A;  4CYM D;  5EKQ D;  4I9E A;  2VGY A;  2HYZ A;  3TXN A;  4FLH A;  4U8H A;  3ABK E;  3B95 A;  3FP3 A;  1OCC E;  3TWT A;  3E4B A;  2P9I G;  3OXL A;  2V0P A;  3V31 A;  5BXU A;  1OY3 D;  3UM2 A;  3ENE A;  4BWR A;  3AG1 E;  4YVO A;  4U0U A;  5IY5 E;  3C98 A;  3RIB A;  1KT1 A;  2RG8 A;  2C0M A;  5KBA A;  1OCR E;  4U63 A;  1TR4 A;  4AIF A;  1P5Q A;  2JEK A;  4FU3 A;  3CQG B;  2X6I A;  3JCK C;  3ZYK A;  4K5C A;  4Y6W A;  4LSZ E;  3FU5 A;  2WXF A;  3TAX A;  4TV3 A;  5D2M C;  5JJ7 A;  5G04 J;  2MRI A;  4QFV A;  1Z6T A;  2Y0B G;  3C3O A;  1JCR A;  3DSS A;  4BTA A;  5LCW J;  4GZD A;  4DLQ A;  4HRM B;  3FUE A;  4DX5 D;  2AJA A;  2FEZ A;  4GZ5 A;  1HG2 A;  3RKV A;  2HE0 A;  1XGW A;  3LY7 A;  4ZFH A;  2VSN A;  4B0Z A;  2VSX E;  4A55 A;  1K1B A;  3I4G A;  2DYS E;  1SA5 A;  3SFY A;  2QC9 A;  5ENS D;  5CEC B;  3LPZ A;  3UIO C;  3D9L A;  5AN8 A;  3BG0 B;  3LCA A;  4GTT A;  4NUR A;  1OUV A;  3CK9 A;  3C3Q A;  4U0S A;  3UQ3 A;  5D66 A;  4UUC A;  1Z3X A;  2ILR A;  5HI7 A;  3CHP A;  1SQM A;  4U96 D;  4U95 D;  1A5E A;  3PVL A;  4OAV B;  1SZ9 A;  3U3W A;  4HOU A;  2I2O A;  2DYR E;  4L7T A;  5CRV A;  1PAQ A;  2LAI A;  5E75 A;  4UWF A;  2KAT A;  3J5P A;  3VTY A;  5FZS A;  3L22 A;  3CVU A;  1IYG A;  1SW6 A;  1LF8 A;  3HHM A;  1NZN A;  3IHY A;  3APD A;  4HB5 A;  5FQ6 A;  1HH8 A;  2VSO E;  4J8D A;  4CDM A;  2XGO A;  3ZEF A;  2CHZ A;  4J8Y A;  3RO2 A;  2EQX A;  5J90 A;  1YYH A;  4K03 A;  4BT9 A;  2WXM A;  3TWW A;  5CHE E;  4I2Z A;  3VLF A;  3V2O A;  2V4H C;  5EX3 A;  3LDZ A;  2GRQ B;  4HOS A;  3Q9U C;  4M3O A;  4XKC A;  3V2X A;  3FU3 A;  5CEA A;  4LNG A;  2Q7F A;  2WMO A;  3FUK A;  2MHK A;  1H6O A;  5AJD A;  3ZGQ A;  4DX1 A;  4ILH B;  3IBE A;  3BG1 B;  3LEW A;  1O1S A;  3RSE G;  4YDE A;  3B7U X;  2NYJ A;  3Q7F A;  4F3V A;  4JB8 P;  4TXQ A;  3EIQ C;  4E6H A;  4WNF A;  3CIA A;  3D9H A;  5ARF A;  2IOS A;  4RG6 A;  5AAO A;  2MYO A;  2J4D A;  2R02 A;  4JPS A;  3DSX A;  1ZU2 A;  3RO3 A;  4G25 A;  4KXK B;  3R7Q A;  4U8V D;  1OT8 A;  4OVV A;  3MV3 B;  4Z68 A;  3ZN3 A;  2LNI A;  5EX0 A;  3PZ3 A;  3T8K A;  4GZ6 A;  3C72 A;  4EHM A;  5C2Y A;  4YDY A;  3ULY A;  1N0R A;  2B0O E;  2HM8 A;  5AQA A;  4HI8 A;  2WQH A;  1QBQ A;  4UWL A;  3AU5 A;  1TN8 A;  1BI8 B;  4UQZ A;  3ZFW A;  3CR3 A;  4C48 B;  5KNG A;  2RD0 A;  1PC2 A;  4U07 A;  1EF1 C;  4R7L A;  1U2V G;  3HXD A;  4RVB A;  2WXR A;  4BEP A;  2IU1 A;  4TUM A;  2R03 A;  4J0U A;  3PRE A;  1BU9 A;  5ITZ F;  5LP0 A;  3SZ7 A;  3ZXS A;  3FTV A;  4GTR A;  1ELR A;  4N5Q A;  3DBS A;  3ASG A;  3L17 A;  4ME2 A;  2L6J A;  5LCW C;  2GW1 A;  5G2N A;  3CV0 A;  2BKK B;  5KJK A;  2A5E A;  3LJ3 A;  4G2V A;  4IYP A;  3AG4 E;  2AW6 A;  1LTX A;  2A5U A;  1SA4 A;  1TNU A;  4I6J A;  3PRZ A;  4JA7 A;  4GTS A;  1XNF A;  4GTQ A;  3GZ1 A;  3AS4 A;  4G11 A;  4L1B A;  3LY9 A;  4UI9 C;  3KD7 A;  3VLD A;  4GYW A;  2PQR A;  4KYO B;  4F53 A;  4EZK A;  2QY7 A;  2F0Y A;  5LOZ A;  3FUH A;  3KSQ A;  2VGX B;  2XGS A;  4GTO A;  4MRU A;  4UQY A;  3L13 A;  1AWC B;  2R2L A;  2FBN A;  4GZ3 A;  3HDX A;  4UI9 J;  3GZ2 A;  4J8E A;  3U64 A;  3CHQ A;  5KCM A;  3ONL A;  4RLY A;  2X6H A;  4K5B A;  3KAE A;  1SVX A;  1X81 A;  4PH4 B;  5CCL A;  4I6G A;  1TNY A;  1O1T A;  4M7C A;  2XRZ A;  3CK8 A;  2ZU6 B;  3Q75 A;  3CKC A;  1OCO E;  2AXV A;  4PUC A;  2JAB A;  4V3I A;  1JWF A;  2J07 A;  3ML8 A;  4L2Y A;  3MV2 B;  1H6K A;  2ION A;  3DPY A;  5CBN A;  2JLB A;  2ZGG A;  3U9W A;  1QZ2 A;  3FTY A;  4KVM A;  3CST A;  3DWL G;  1MX2 A;  2FF4 A;  3TG4 A;  4NIK A;  3MZL B;  1YCS B;  4CZ2 D;  2WXG A;  3EU5 A;  2M63 A;  4CRW A;  2CFZ A;  4LUN U;  4J6I A;  4B8A A;  3U4T A;  2OEW A;  4I1A A;  3ZHE A;  4CDN A;  1GW6 A;  4H7Y A;  2FUL A;  1ZBP A;  3FTU A;  3JUI A;  4HBD A;  3EJN A;  4I9C A;  3IXE A;  2P9P G;  4UWH A;  4JD2 G;  1N4Q A;  2QYU A;  1TNO A;  2P9L G;  2P9U G;  2X6J A;  4J7W A;  3RU0 A;  4CGV A;  4G1T A;  2R05 A;  3CEQ A;  3ZIM A;  2FI7 A;  4L9P A;  3ZYQ A;  3HIZ A;  2WQ6 A;  3QK0 A;  3I3N A;  4LEU A;  3F6Q A;  3UI2 A;  3PUJ A;  3NBN B;  3SY2 A;  2UY1 B;  3QWV A;  4O1O A;  4QQI A;  4AXH A;  2DCP A;  5A23 A;  2BTD A;  2WXO A;  3PNT B;  1TN6 A;  3FWV A;  2YHC A;  2LO6 A;  4FHJ A;  3CKB A;  1IHG A;  1K1A A;  1WM5 A;  4XZ4 A;  4B8C B;  1BLX B;  1ZB1 A;  3APC A;  1D9S A;  4MKT A;  3MYV A;  3MKR A;  4F6R D;  3FHE A;  4HI9 A;  2RFA A;  4EZJ A;  5FQ7 A;  1IKN D;  3QB2 A;  3EUV A;  3FTX A;  5M72 A;  3PEV B;  4IN3 B;  3V79 K;  2BED A;  4HLE A;  3D9J A;  3CVV A;  2PM6 A;  4GPM A;  3PNL B;  4GU5 A;  5BV0 A;  4BY6 A;  1E96 B;  4U0Z A;  2AWI A;  3ZUV B;  3JYS A;  3T9K A;  4ATZ D;  3IKO B;  3L82 A;  4AY6 A;  1UJJ A;  3UM3 A;  3D9M A;  4DX6 D;  1D8E A;  1E7V A;  1S0P A;  1E8W A;  3S7F A;  1HU3 A;  5T4Y A;  5KNH D;  4G26 A;  1OXJ A;  3UXG A;  4DJA A;  4JL0 A;  4N5C A;  4DX2 A;  2L9B A;  1KZP A;  4G8L A;  4A3V A;  3JXJ A;  4DI4 A;  3CVL A;  3EHN A;  2XRY A;  3D3M A;  3U66 A;  2VTB B;  4XI0 A;  2XCC A;  2NC9 A;  3ESL A;  4XX5 A;  2VYI A;  4N2S A;  2UWJ G;  5T8I A;  3HG0 D;  4FAD A;  4LRZ A;  1Z5S C;  3QDN A;  3VLE A;  2ZIR A;  5FZQ A;  2DZO A;  1TYQ G;  1G3N B;  2VGX A;  1DC2 A;  3QAR A;  3L9T A;  5AQ7 A;  2L0T B;  4I1M A;  5A7D B;  1N4R A;  1FT2 A;  3LYA A;  3TL5 A;  4GB9 A;  1UN9 A;  2Y1L E;  4PS3 A;  2OV8 A;  4JW1 A;  5EID A;  2OOE A;  2IEJ A;  3GZS A;  3HXE A;  4LNB A;  2IF4 A;  2OEV A;  5FQ4 A;  3RJV A;  1HXI A;  4CT0 A;  4N3B A;  3NAW A;  4L23 A;  3BEE A; 
#chains in the Genus database with same CATH homology
 4UQZ A;  3ZFW A;  3OAW A;  3B7S A;  2X3M A;  2PL2 A;  3CR3 A;  3IV0 A;  1QNF A;  3FTS A;  2RD0 A;  4TRQ A;  4AVX A;  1PC2 A;  4DPR A;  1IQR A;  1H19 A;  4EZL A;  4U07 A;  3I4R B;  1KLX A;  3O48 A;  4AM9 A;  1EF1 C;  4R7L A;  3HYM B;  4UWK A;  3AS8 A;  3S7B A;  4JVS A;  4N39 A;  5ARG A;  1E8Y A;  3UT4 A;  4RVB A;  2WXR A;  3ML9 A;  2IU1 A;  4NRH B;  3G2V A;  3PRE A;  3L16 A;  4J0U A;  4RG9 A;  4FHK A;  4GYO A;  1U3D A;  3CSF A;  3NQP A;  3QJZ A;  5LP0 A;  4JZY A;  5FTP A;  3SZ7 A;  3G2S A;  3ZXS A;  3FTV A;  3UX4 A;  2J08 A;  3ZHE B;  2LAH A;  4CEM A;  3ASD A;  4KBQ A;  3OXF A;  2YHE A;  3WXX A;  1ELR A;  4DK5 A;  3MJW A;  3S7J A;  4XE0 A;  3AS5 A;  3D9K A;  3UT8 A;  3DBS A;  5ANR A;  1HG5 A;  2DBA A;  3ASG A;  1X5B A;  3VTX A;  3L17 A;  3ZYL A;  1L5J A;  3FU0 A;  3FEY A;  4ME2 A;  2L6J A;  4MLP A;  5LCW C;  2GW1 A;  5LFA A;  4I2W A;  4KVO A;  4JXT A;  2I1K A;  3CV0 A;  2E2E A;  5G2N A;  3UPV A;  4HFG A;  2BF0 X;  3FH7 A;  2DIW A;  4UWG A;  5KJK A;  1NA3 A;  3LJ3 A;  4G2V A;  1EPU A;  4IYP A;  3MEK A;  1B89 A;  5D0O D;  3G2W A;  2AW6 A;  4C0E A;  3MCX A;  4O6F A;  2A5U A;  3JQ0 A;  4W9R A;  3CHM A;  2WVI A;  3O4Z A;  4I6J A;  3PRZ A;  1E90 A;  4JA7 A;  3ZRH A;  1OWL A;  5KJL A;  4AV7 A;  2NXP A;  3SD5 A;  3MKQ A;  4I1O B;  3ZYM A;  1XNF A;  3EIJ A;  2KCK A;  3CVN A;  3L6A A;  2UY1 A;  1IQU A;  3LVQ E;  1H2U A;  4IRU A;  2C0L A;  5CCM A;  1EDU A;  4UQX A;  3EDT B;  3GZ1 A;  4BT8 A;  3AS4 A;  4G11 A;  1DNP A;  4NAC A;  5E76 A;  4L1B A;  4XKB A;  2PQN A;  5FT9 A;  4GML A;  5AIJ A;  3Q15 A;  3FEX A;  3ESK A;  3LY9 A;  1A17 A;  4J8S A;  3RK6 A;  2WPV A;  5FZR A;  4UI9 C;  3KD7 A;  1ELK A;  4AJW A;  2J09 A;  3PZD A;  4ACK A;  4ANV A;  1OWN A;  4HVB A;  3VLD A;  5BNW A;  3LY8 A;  1TJF A;  3CQC B;  1MHQ A;  2C2L A;  4APO A;  4GYW A;  3IEG A;  2PQR A;  4KYO B;  2GGF A;  2Y4U A;  4F53 A;  2J9Q A;  4EZK A;  2QY7 A;  5LOZ A;  1OWO A;  3URZ A;  2V5F A;  3D9N A;  1TEZ A;  2WXI A;  3FUM A;  2R17 C;  3FUH A;  2VGX B;  2OVB A;  2WMN A;  5A6C A;  3T8M A;  3CHR A;  2XGS A;  3TGO A;  1HO8 A;  1FVH A;  4HS2 A;  4MRU A;  2XEV A;  3P2B A;  4UQY A;  2WXL A;  1HFA A;  3UT7 A;  3PUK A;  3L13 A;  2WXN A;  3SGH A;  4WND A;  5BPP A;  2FBN A;  5T3R A;  3KEZ A;  4GZ3 A;  4IUL A;  4GZC A;  3DPD A;  4K0R A;  5BV1 A;  4ILG A;  3HDX A;  2J49 A;  4UI9 J;  1VDY A;  2E0I A;  2X38 A;  3GZ2 A;  4J8E A;  4U04 A;  4I9E A;  5EKQ D;  2KZT B;  3CHQ A;  3U64 A;  4Y6C A;  2VGY A;  5KCM A;  4KZ0 A;  2AVP A;  2HYZ A;  3ASH A;  4Q94 A;  3ONL A;  3TXN A;  2X6H A;  3KAE A;  4D10 C;  4PH4 B;  4FLH A;  4U8H A;  5CCL A;  4I6G A;  5KJN A;  2XRZ A;  3FP3 A;  1E8Z A;  4B94 A;  3E4B A;  4BFR A;  1NA0 A;  3CK8 A;  2ZU6 B;  4BX9 A;  3JQ1 A;  3CKC A;  3APF A;  3OXL A;  5D0Q D;  2AXV A;  4OVU A;  2V0P A;  3FUJ A;  4PUC A;  4BTB A;  4AOF A;  4V3I A;  1MQS A;  3UUX A;  4EEC A;  1JWF A;  2J07 A;  4FP7 A;  2GRL A;  3ML8 A;  2NSZ A;  4L2Y A;  5EDS A;  3MV2 B;  4EBA G;  3FTZ A;  3Q47 B;  3ENE A;  1SZA A;  3FH8 A;  4BWR A;  4N2Q A;  2WXK A;  1ELW A;  2KM4 A;  3Q4A B;  2FO7 A;  1H6K A;  4JA9 A;  2ION A;  3FUI A;  4YVO A;  4U0U A;  4J8F A;  2JLB A;  3C98 A;  3RIB A;  1H2V C;  1NP7 A;  1KT1 A;  2I9C A;  2RG8 A;  2KCV A;  3U9W A;  2C0M A;  1QZ2 A;  3FTY A;  3IHV A;  4WWN A;  4KVM A;  1OWP A;  3CST A;  3CGH A;  4WNE A;  3QC1 A;  2FF4 A;  4JHK A;  2WB2 A;  3TG4 A;  4PDX A;  3AU4 A;  1KT0 A;  4G23 A;  4GA0 A;  2YIN A;  4GA1 A;  4C9B B;  3I5P A;  3MZL B;  4U63 A;  2WXG A;  3UMV A;  2M63 A;  5BW8 C;  2IFU A;  4CRW A;  4F7A A;  4KZC A;  4MS6 A;  4AIF A;  2CFZ A;  1P5Q A;  2JEK A;  3HVE B;  3CQG B;  4FU3 A;  4LUN U;  4J6I A;  4CDR A;  2XPY A;  2X6I A;  4FJZ A;  4B8A A;  4JEH A;  3JCK C;  3FY4 A;  4I43 A;  3FUL A;  3ZYK A;  3G2T A;  4Y6W A;  3FU5 A;  2WXF A;  3TAX A;  3U4T A;  4I1A A;  1FVF A;  3ZHE A;  2R5S A;  4H7X A;  1UW4 B;  4PS8 A;  4CDN A;  4TV3 A;  4AEZ C;  3CVQ A;  5JJ7 A;  5G04 J;  5AEN A;  1OWM A;  4GMJ A;  4DLO A;  1H2T C;  1GW6 A;  2MRI A;  4H7Y A;  1Z6T A;  4QFV A;  3CVW A;  2FUL A;  1ZBP A;  4EQF A;  3FTU A;  3JUI A;  4APF A;  3EJN A;  3L08 A;  5G05 C;  4I9C A;  5CMW A;  4BTA A;  5LCW J;  1QQE A;  2HR2 A;  2I6H A;  2L0I A;  4GZD A;  4UWH A;  3NZS A;  4L2L A;  2VJ8 A;  4DLQ A;  5HQ8 A;  4Q69 A;  3FTW A;  3SHF A;  4HOR A;  2X6J A;  3PE4 A;  3RU0 A;  2XPI A;  3FUE A;  2YNQ A;  4CGV A;  3PH0 C;  2KCL A;  4G1T A;  3CEQ A;  1N52 A;  4WAF A;  4A1S A;  2FEZ A;  3ZIM A;  2FI7 A;  4GZ5 A;  4N3C A;  3HIZ A;  1HG2 A;  4WWO A;  3ZYQ A;  3QK0 A;  3RKV A;  2WQ6 A;  3I3N A;  3CK7 A;  4LEU A;  3R9A B;  4ANU A;  3MKQ B;  3PUJ A;  2OVF A;  1XGW A;  3B13 A;  3LY7 A;  3CLJ A;  3OXG A;  4ACL A;  5J08 A;  2UY1 B;  3QWV A;  1YA0 A;  3QAQ A;  4AXH A;  2DCP A;  1H0A A;  2GRM A;  2XHE A;  2LSU A;  2VSN A;  2R59 A;  5CMY A;  4B0Z A;  5A23 A;  2AXZ A;  2VSX E;  4A55 A;  2BTD A;  3I4G A;  1U3C A;  1Y6I A;  4JHR A;  2WXO A;  3LPZ A;  3PNT B;  4LER A;  5C1D A;  4N3A A;  2IQC A;  2V4L A;  3ASF A;  1UN8 A;  3D9L A;  3FWV A;  2YHC A;  2LSV A;  3SBT B;  2LO6 A;  3BG0 B;  1WY6 A;  3LCA A;  5ANL A;  3CVX A;  4FHJ A;  1JWG A;  3CKB A;  3D9I A;  4FUL A;  4NUR A;  1IHG A;  4EPZ A;  4BX8 A;  4XIF A;  1WM5 A;  3RRN B;  5DBK A;  4I17 A;  1OUV A;  3CK9 A;  4XZ4 A;  4B8C B;  2CG3 A;  3CHO A;  2J4B A;  2XCB A;  3APC A;  3MA5 A;  2AXU A;  3QKY A;  1W3B A;  2CHW A;  4U0S A;  3UQ3 A;  4MKT A;  1WAO 1;  5LX8 A;  4GAA A;  5AJL A;  1Z3X A;  2ILR A;  3FUD A;  5HI7 A;  4URK A;  3MYV A;  3MKR A;  5JHA A;  3OTN A;  3FHE A;  3CHP A;  2YQ8 A;  4XI9 A;  4AP2 A;  1SQM A;  3MX3 A;  3QWP A;  3RRM B;  4CGW A;  3PVL A;  4EZJ A;  1SZ9 A;  4HOT A;  4WNG A;  4ANX A;  4RSY A;  4FLB A;  4HOU A;  2I2O A;  3U3W A;  2KZT A;  3S2A A;  5FQ7 A;  2PM7 A;  4OYS A;  1N54 A;  4L7T A;  4NQ0 A;  3QB2 A;  2PZI A;  3ZW3 A;  3FTX A;  3T5X A;  2V8S E;  3QNK A;  4GCO A;  4ATG A;  5M72 A;  5FQ8 A;  3PEV B;  1PAQ A;  2LAI A;  4IN3 B;  4YVQ C;  3LVR E;  4HLE A;  5AYW D;  5E75 A;  4UWF A;  3EHM A;  2CHX A;  3D9J A;  3Q5M A;  2KAT A;  3PS6 A;  3VTY A;  5FZS A;  3SBS A;  3CVV A;  4AY5 A;  3FUN A;  4GA2 A;  1FCH A;  3L22 A;  5BUZ A;  4HXI A;  3CVU A;  2PM6 A;  1IYG A;  1HE8 A;  3TG5 A;  2XGM A;  1INZ A;  4KMO A;  1LF8 A;  3PNL B;  3SNX A;  4GU5 A;  3HHM A;  2IOL A;  2XPZ A;  4C0M A;  5G05 J;  2QFC A;  3L54 A;  1NZN A;  3CHS A;  5BV0 A;  4BY6 A;  1E96 B;  2WXH A;  4U0Z A;  1HZ4 A;  2AWI A;  4FC8 A;  3IHY A;  3APD A;  3JYS A;  4I6E A;  4B89 A;  2CG2 A;  2Y4T A;  3FFL A;  3CVP A;  5FQ6 A;  1HH8 A;  4BSX A;  4GPK A;  5DIZ A;  3IKO B;  4AY6 A;  3T5V A;  5BT1 A;  1UJJ A;  1TJC A;  2VSO E;  3G2U A;  3QWW A;  3S7D A;  4J8D A;  3D9M A;  4P29 A;  4CDM A;  2XGO A;  3ZEF A;  2CHZ A;  3RO2 A;  1E7V A;  1S0P A;  1E8W A;  4PS7 A;  3S7F A;  2EQX A;  3TJP A;  1HU3 A;  3PE3 A;  4GCN A;  5J90 A;  3GYZ A;  4K03 A;  5T4Y A;  4G26 A;  4BT9 A;  2WXM A;  4LCT A;  1HS6 A;  5CHE E;  5FWQ A;  4DJA A;  3LS8 A;  3LXU X;  4JL0 A;  4WUY A;  4I2Z A;  3VLF A;  2I1J A;  4N5C A;  4Q96 A;  5EX3 A;  1EYH A;  2WXQ A;  3LDZ A;  2L9B A;  4HOQ A;  4A3V A;  4DI4 A;  3R7R A;  3CVL A;  3EHN A;  3HVE A;  2XRY A;  3ZPJ A;  1DVP A;  4JC8 A;  4HOS A;  3D3M A;  5JJT A;  3KS2 A;  3U66 A;  2VTB B;  4M3O A;  2BUG A;  2A4Z A;  4JEU A;  4XI0 A;  4UI9 K;  4XKC A;  3FU3 A;  2VTB A;  1UJK A;  4A1G A;  1JUQ A;  2Q7F A;  2WMO A;  2XCC A;  3FUK A;  2MHK A;  3ONK A;  5KJM A;  3PEU B;  1BPO A;  2NC9 A;  3ESL A;  4XX5 A;  4CCA A;  5AJD A;  3ZGQ A;  1Z3Y A;  2VYI A;  4N2S A;  1JPL A;  2UWJ G;  3N71 A;  4ILH B;  5T8I A;  2WM9 A;  3NF1 A;  3FU6 A;  4FAD A;  3IBE A;  3BG1 B;  4LRZ A;  5G04 C;  3QDN A;  3LEW A;  4YND A;  3VLE A;  3LKU A;  3QOU A;  2X6F A;  3SF4 A;  3B7U X;  5FZQ A;  4F3V A;  5ENN A;  3TXM A;  3D9P A;  3PDN A;  2VGX A;  1E7U A;  2X6K A;  3SI5 A;  2KC7 A;  3EIQ C;  4E6H A;  4WNF A;  3QAR A;  2P58 C;  3CIA A;  1UG3 A;  2IOS A;  2MOW A;  3GW4 A;  2L0T B;  5ARF A;  3MGB A;  3NZU A;  4RG6 A;  3Q49 B;  4I1M A;  5A7D B;  3FUF A;  3D9O A;  5G55 A;  3FH5 A;  4CT4 A;  4WWP A;  2VQ2 A;  4KT6 B;  2J4D A;  4A3T A;  3LYA A;  4JPS A;  3TL5 A;  3P1U A;  4GB9 A;  1ZU2 A;  3RO3 A;  3ULQ A;  3B7T A;  4G25 A;  1E8X A;  3K9I A;  1UN9 A;  4KXK B;  2HO1 A;  1HF8 A;  3R7Q A;  4PS3 A;  1PY1 A;  4ILI A;  4DI3 A;  2WXJ A;  2WQ7 A;  2OV8 A;  2WXP A;  5JJ6 A;  4OVV A;  3MV3 B;  5FJY A;  4JW1 A;  3ZN3 A;  4TUU A;  4FA6 A;  2LNI A;  2OOE A;  4G24 A;  4GYY A;  5EX0 A;  3GZS A;  4GZ6 A;  5JHB A;  2IF4 A;  5C2Y A;  4F1S A;  4ANW A;  3B7R L;  4E85 A;  2HM8 A;  5FQ4 A;  3ZVV A;  1HX8 A;  1Y8M A;  2XQ0 A;  2CFU A;  4FJY A;  3SFZ A;  3RJV A;  1HXI A;  2WQH A;  4JHJ A;  4CT0 A;  2OND A;  3FDH A;  2VSY A;  3RRU A;  3CVY A;  2IJG X;  4EBA A;  4UWL A;  4N3B A;  3AU5 A;  4L23 A;  4ABN A;  3BEE A;  2Y3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...