2LSVA

The nmr high resolution structure of yeast tah1 in complex with the hsp90 c-terminal tail
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TPR repeat-containing protein associated with Hsp90
publication title High-Resolution Structural Analysis Shows How Tah1 Tethers Hsp90 to the R2TP Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone-binding protein/chaperone
total genus 30
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lsvA00
1ZU2A 4U0ZA 3QDNA 3LKUA 2VYIA 4AY6A 1QQEA 4KYOB 2GW1A 3ULQA 2J9QA 2XEVA 5KJLA 1IYGA 4KBQA 4N5CA 2R5SA 3Q4AB 4GA2A 3CK8A 4HORA 3K9IA 2MHKA 4GCOA 3TGOA 3AS5A 1ZBPA 3WXXA 3S7FA 3ZHEB 2PZIA 4NQ0A 2V5FA 4F3VA 3VTYA 4UQYA 5G05J 3BEEA 3PDNA 3OXLA 4Y6WA 1WAO1 2LNIA 3CVNA 2DBAA 3Q49B 2KCVA 5DIZA 3RO3A 4N3BA 4I2WA 4JA7A 2KATA 4GYOA 3ZPJA 2VGYA 4BT8A 4APOA 2UWJG 4BT9A 1TJCA 2LSUA 3LY9A 4KXKB 3ASFA 3EDTB 2C0LA 3MEKA 2ONDA 2HO1A 3IEGA 3U3WA 3QWPA 4GZ6A 3TG4A 4AM9A 4BTBA 4HOSA 4W9RA 4I17A 3PE3A 3ZGQA 4U0SA 3TAXA 3RO2A 1P5QA 2PQNA 3LY7A 2C0MA 1NZNA 1KLXA 5KJKA 4I9CA 1HZ4A 4AIFA 3ZHEA 5FT9A 4LEUA 5BT1A 4YVOA 4HOTA 2LSVA 3TG5A 4AY5A 3CV0A 2Y4UA 3LYAA 2PQRA 2YQ8A 3UUXA 3MV2B 2FBNA 3R9AB 3S7BA 3ASDA 3URZA 3KD7A 1W3BA 5JJTA 2Q7FA 3KAEA 2PL2A 5G04C 4G25A 2XGSA 3CEQA 3MKRA 2HYZA 4NRHB 1YA0A 2UY1B 2VGXB 4I1AA 3ZFWA 2I6HA 4N3AA 2KCKA 4ABNA 3SF4A 4XI0A 4WUYA 5JJ7A 1OUVA 4WNGA 5EX0A 4ME2A 4YVQC 3ZN3A 4JL0A 4A1SA 3Q47B 3NF1A 5CCLA 2FEZA 3QWVA 1Y8MA 4N39A 5LCWC 5C1DA 4B94A 5D0QD 1ELRA 3FFLA 5AYWD 4GYWA 1KT0A 2FI7A 3JYSA 2WPVA 5G04J 3CVLA 2BUGA 1QZ2A 3GZ1A 4RG9A 4UI9C 3AS8A 2XPIA 5FZSA 3LCAA 1IHGA 4CGWA 5A6CA 3Q15A 3GZ2A 3OXGA 5BNWA 5EX3A 1NA3A 3LY8A 2FO7A 1WM5A 4RG6A 5KJNA 3S7JA 4GA1A 3FWVA 1FCHA 5A7DB 2YHCA 3MA5A 5LCWJ 4G26A 2UY1A 2VGXA 2E2EA 4G1TA 4EQFA 5CCMA 5ARGA 2QFCA 4N3CA 5JJ6A 4G24A 3RU0A 4H7XA 3SZ7A 4J0UA 2C2LA 4WNDA 3E4BA 5KJMA 3OXFA 2Y4TA 4CGVA 4UQZA 5DBKA 4XI9A 4JA9A 2JLBA 4UI9J 2VSYA 5D0OD 2KCLA 2HR2A 4U0UA 2KC7A 4J8EA 3CKBA 3ASHA 3AS4A 3ASGA 2VSNA 5HI7A 2XCBA 2XCCA 4HOUA 4WNEA 3O48A 5FZQA 2VQ2A 5CHEE 3GYZA 3CVPA 3RKVA 2XGOA 1B89A 2OOEA 4GA0A 4GPKA 1XNFA 3CK7A 4U04A 4G23A 2IFUA 4N2SA 1KT1A 2AVPA 3VTXA 3HYMB 5FJYA 3U4TA 1ELWA 5FZRA 4N2QA 3FP3A 3KS2A 3N71A 5BW8C 4J8FA 4JHRA 4GZ5A 3UPVA 2FF4A 1E96B 5EKQD 5HQ8A 4I2ZA 4BWRA 4BTAA 3QKYA 2L6JA 1HXIA 2NC9A 3CK9A 3GW4A 1NA0A 3UQ3A 4J8DA 2WQHA 4IN3B 4XIFA 4YNDA 3QOUA 2IF4A 4HOQA 5ARFA 4GZ3A 3CKCA 3CVQA 5M72A 3PE4A 4WNFA 4GYYA 4UQXA 3ESKA 3RIBA 4O6FA 1HH8A 4U07A 4Y6CA 3RJVA 1PC2A 4UI9K 1A17A 4GCNA 4H7YA 5FTPA 3LPZA 3Q5MA 3QWWA 4CDRA 3S7DA 5G05C 2P58C 4I9EA 4G2VA 2XGMA 3MV3B
chains in the Genus database with same CATH superfamily
3E33A 4KZ0A 2KZTB 3LKUA 1UG3A 2QY7A 2MOWA 4ZFHA 4LNGA 2IY0C 4TXQA 1QQEA 1UN9A 3CLJA 2AW6A 3NQPA 2J9QA 2XEVA 2GGFA 3PNTB 4F1PA 5FQ4A 3E34A 4N5CA 2R5SA 4GA2A 3C3QA 3CK8A 4HORA 4GCOA 3ISMC 5KWDA 3WXXA 3MZLB 2H6GA 1TN6A 4U7EB 2IO3C 4GTOA 3PEUB 1TNZA 4BY6A 3NZUA 4L9PA 4JD2G 4WWOA 4GMRA 3UM2A 1YYHA 3VTYA 1S70B 1WAO1 4PUCA 1FT1A 4YDWA 3Q49B 4EZLA 4HS2A 4FLBA 4DLQA 4G8KA 2BKGA 3DSWA 3O4ZA 4FP7A 3KEZA 1QBQA 1K1AA 2ETAA 4BFRA 2VGYA 1E8XA 2UWJG 1WDYA 2LSUA 3LY9A 4DK5A 3D9LA 3EDTB 2C0LA 1RW2A 3C3RA 3L6AA 5LFAA 3VLDA 4GZ6A 1OT8A 1LD8A 3ULEG 2EILE 3QARA 5G55A 2P9LG 3ONKA 2I1KA 2LO6A 3ZGQA 4D10C 3L13A 4XEIG 3SQVA 4ZHBA 3LY7A 1Z5SC 1OCZE 1KLXA 4GU5A 1OCCE 4DPRA 3NB2A 2ZGDA 1N4QA 1JCQA 1H2UA 3IHVA 3ZYQA 5FT9A 3I3NA 4B89A 4OAVB 4HOTA 1LD7A 5ENNA 3C72A 4EZJA 4FJZA 3MV2B 3D9IA 4TV3A 2FBNA 3FU6A 4KVOA 2M63A 3RRUA 4GZDA 1KPSB 5FQ6A 2WXJA 1H19A 2WXPA 5G04C 4F1SA 4AP2A 4GTRA 5AN8A 3MKRA 2HYZA 4NRHB 4DLOA 2VGXB 3ZFWA 2IJGX 1MJ0A 1EYHA 4XI0A 3G2WA 3CHMA 3PEVB 4ME2A 4YVQC 5ENRD 3ULYA 3SNXA 4B8CB 2PM6A 3B7BA 4BERA 2YNQA 4XKCA 4JL0A 3KSQA 1H2TC 4J6IA 5CCLA 3JQ0A 5LCWC 3RRMB 3TWQA 4G11A 4KVMA 2ZISA 3MCXA 4R7LA 1N52A 5H7PA 3MYVA 1ELRA 2AJAA 4KMOA 2FI7A 2PNNA 1SQMA 2BUGA 4C0MA 4LERA 4FHKA 1G3NB 1N94A 3C3OA 1A5EA 4NACA 3TWXA 4EHMA 4PH4B 4C0EA 2XENA 3LCAA 3X2QE 3SO8A 3GZ2A 5LX8A 1DVPA 2OV8A 1HG5A 2VTBB 2F8XK 1IHBA 3R9MA 4HVBA 4L2YA 3C5RA 4RG6A 1JUQA 4LSZE 2P2CP 2LAHA 4K03A 1FCHA 1AP7A 2YHCA 3MA5A 2UY1A 5AQBA 2R17C 3ZUVB 2R02A 3PUKA 4HRLA 1QYMA 5CEDB 3FU5A 5JJ6A 5BPPA 2IEJA 3FHEA 3E37A 3AG4E 2OCCE 4WNDA 1EDUA 2C2LA 2OEWA 4CGVA 3MKQB 1IQUA 5KCMA 4GMJA 5EDSA 3DPYA 2J8SD 4N5QA 2JLBA 3SFXA 5EN5D 5IY5E 4U8YD 2L0TB 3PRZA 3AS4A 2F0YA 3ASGA 3D9JA 2XRZA 3O48A 2LAIA 5FZQA 4LG6A 4OYSA 4AV7A 4EBAG 1B89A 4GA0A 5B1AE 1SA5A 3ZU7B 3CGHA 3FDHA 5AJLA 4GPKA 3HHMA 4G23A 2IFUA 1HE8A 1N95A 5CECB 1OWNA 4U63A 1ELWA 5LP0A 2BKKB 3TL5A 4LUNU 3UPVA 2FF4A 5EYLA 5EKQD 4DI3A 2XZDG 4I2ZA 3QKYA 2RFMA 1ELKA 1L5JA 1YMPA 2X6IA 2R03A 2Y1LE 1ZB1A 4HXIA 3IHYA 4B0ZA 1OY3D 3VLFA 2EIKE 3QOUA 4FA6A 3L9TA 3CKCA 5B3SE 1U3CA 4ACKA 4WNFA 4UQXA 5FWQA 2VSOE 1H0AA 2WXRA 4JHKA 4JHJA 2I1JA 1HF8A 3EUVA 3RJVA 2IOSA 3ABLE 3IKOB 5EIBE 5FTPA 1TEZA 3CVXA 4O1OA 3T8KA 3CQGB 4I9EA 3NBNB 2E0IA 5ENOD 4HI8A 1FVFA 2F37A 1N4SA 2F8YA 3UKUG 3QDNA 5E76A 1LF8A 2VYIA 4K0RA 3L54A 1U2VG 4V3IA 3ULQA 1Y6IA 2B6CA 4TXPA 4UWHA 1IYGA 3Q4AB 3MX3A 4CT4A 2MHKA 3SBSA 3PH0C 4CYMD 1ZBPA 4EZKA 3ZXSA 3S7FA 4C48B 4CDMA 4JEUA 3AJIA 3ZHEB 3CVYA 3DXMG 2PZIA 4Z68A 4C9BB 4NQ0A 4BSXA 3V79K 3FTWA 4F53A 1AWCB 5G05J 1FVHA 1S0PA 3OXLA 3PDNA 2LNIA 4U96D 2EINE 3DWLG 4CRWA 5DIZA 3FEXA 2R05A 1BI7B 1SA4A 3MGBA 3ZXPA 1YCSB 4APOA 2XPZA 4BESA 2KXPC 4U8VD 4URKA 3FUJA 4FULA 4GTVA 4AVXA 4OVUA 3IEGA 5ANRA 3CSTA 3QWPA 2KZTA 4AM9A 1BLXB 5ENPD 3TG4A 3L22A 4HOSA 3PZ1A 4W9RA 3ZYLA 1H6PA 4U0SA 3FUFA 2P9IG 4BEPA 4HFGA 2PQNA 3AU5A 4JPSA 1NZNA 3D9MA 5FQ8A 3UM3A 4I9CA 5JHAA 4LEUA 5BT1A 2LUHA 4AY5A 5T3RA 1Z6TA 4HI9A 2YQ8A 3UUXA 2Y69E 1E8ZA 2ZIRA 1HFAA 3ASDA 3FY4A 3JQ1A 3TWSA 4I1OB 3B7SA 1W3BA 5EIDA 5JA4D 5T8IA 3FH8A 1S64A 3TXMA 2L9BA 2BF0X 3APFA 2XGSA 1D9SA 5BUZA 4YDEA 1YA0A 2I6HA 1X81A 2KBXA 3SGHA 2KCKA 3KEAA 1DCEA 3G2VA 4ABNA 3SF4A 4EPZA 4I43A 5T4YA 3CIAA 4HRMB 3SBTB 3ZN3A 4ATGA 2Y0BG 3TWVA 2JEKA 3AU4A 3HIZA 4GTQA 3RK6A 4A1SA 3Q47B 5LOZA 1Y8MA 4N39A 4M3OA 2VSXE 5C1DA 2R2LA 5CRUA 3B7UX 1K1BA 1H6KA 1V54E 1BPOA 3L16A 2CG2A 4B94A 2WXLA 5D0QD 5FINA 2EIJE 1EPUA 2WXQA 4TRQA 3FFLA 3WG7E 1S63A 2P9KG 2WPVA 5G04J 1INZA 2RKKA 3CVLA 4L7TA 2GRPB 4QFVA 2I2OA 3GZ1A 4Q94A 4HLEA 3IBEA 5HRYA 4O1PA 4G8LA 3FUIA 3LJNA 5FZSA 2EQXA 2IU1A 3HVEA 1D8DA 2DYSE 3Q15A 3IV0A 2WQ7A 3LJ3A 3OXGA 4GTSA 1SW6A 4RQIA 3S2AA 1NA3A 3HDXA 3LY8A 2NYJA 3JUEA 1H6OA 3MJWA 3FWVA 2WXIA 2FO1E 1UJJA 3Q7AA 3BU8A 5A7DB 1E8WA 5LCWJ 1NP7A 2VGXA 4G1TA 1UJKA 1OWOA 2A5EA 4APFA 3EHMA 4EQFA 5CMYA 2QFCA 3RU0A 4H7XA 3UIPC 4DUIA 3ESLA 2R59A 4J8YA 3T8MA 1EF1C 1TJFA 3I4GA 4DX6D 2QYJA 2WB2A 5J90A 3AAAC 3BQOA 3C98A 3SHFA 3FULA 2WXNA 3ZVVA 2KC7A 2IONA 3UKRG 4FU3A 3ZEFA 3ASHA 3CKBA 4FC8A 5HI7A 3UT7A 1D8EA 2XCBA 2XQ0A 2XCCA 2WVIA 3EU5A 1UOHA 4M7CA 3E30A 4CZ2D 3FU3A 3FH7A 3JXIA 2P9UG 4X8QA 3D9KA 2OOEA 3DEPA 3FTVA 1XNFA 4GTPA 4U04A 2VTBA 5ANLA 2OVBA 5FZRA 3FP3A 4HNAD 4L1BA 4FHJA 4CT0A 3APCA 3QK0A 3FU0A 3FTUA 4DRXE 1N4RA 5CMWA 1SZ9A 1E96B 3ZYMA 4BTAA 1DC2A 1O1SA 1KZPA 4JEHA 3SFZA 3V2OA 1HXIA 3CK9A 5HS0A 3PNLB 5EILA 3GW4A 1NA0A 3UQ3A 5JHBA 4J8DA 4IN3B 4YNDA 3U64A 2IF4A 3QNKA 3G2TA 3CVQA 3ENEA 3ZKJA 5M72A 4GTTA 2IOLA 2DCPA 2P9NG 3ESKA 3PVLA 3RIBA 5B1BE 4WAFA 2J4BA 1HH8A 4U07A 3I5PA 1TNYA 4Y6CA 3UINC 1PC2A 4MLPA 1A17A 4H7YA 3FUNA 4IRUA 3LPZA 4RLYA 4ACLA 4GAAA 3S7DA 1FPPA 2X3MA 2WXMA 2P58C 4IYPA 5HKPA 4G2VA 2L0IA 4XZ4A 3PZDA 4LRZA 2RD0A 3JUIA 3HXEA 1ZU2A 3QB2A 3NOCD 1IKND 3HXCA 1GW6A 2J07A 4K5CA 3ZNGA 5KJLA 3K9IA 3TGOA 4KT6B 4RSYA 2WMNA 3TWTA 4EECA 1OCRE 3BG0B 2J49A 4UUCA 1PY1A 3BUAA 3PZ2A 4I6EA 2P9SG 2XEHA 2V5FA 4UQYA 3BEEA 4DI4A 2KCVA 4UWLA 3FUDA 4I6GA 2GRLA 3DSTA 3CVUA 3RO3A 4N3BA 4TXRA 2CFZA 4I2WA 1IQRA 4JA7A 2KATA 3ZPJA 4BT8A 2DIWA 3B7TA 1HO8A 3NOGD 3QJZA 4FADA 3UM1A 2ETCA 4Q96A 3ASFA 3MEKA 1TYQG 3UIOC 2WXFA 3U3WA 4I6JA 1MQSA 1HG2A 1UW4B 1MX2A 4BTBA 3Q7FA 1E90A 4MKTA 4I17A 3EHQA 3PE3A 5FQ7A 3ZIMA 1Z3XA 4NURA 4EBAA 1Q2ZA 1TN7A 2C0MA 3APDA 1N0RA 2XS8A 3T5VA 4JB8P 3AG3E 3Q9UC 3ZHEA 4AIFA 4YVOA 3CQCB 1WY6A 3TG5A 1OWMA 3CV0A 3NAWA 3LVRE 2H6FA 3RSEG 5FIOA 2CFUA 3R9AB 4E6HA 4JZYA 3URZA 2WM9A 2XRYA 3ZW3A 5JJTA 3VLEA 2Q7FA 3KAEA 2PL2A 1QNFA 2AWIA 4BETA 4NIKA 2J09A 4ATZD 1TNOA 4ANVA 1SVXA 3CEQA 1SZAA 4I1AA 3DSUA 1XGWA 3ZRHA 5JJ7A 2LXMA 4WNGA 5EX0A 3EIJA 2CHZA 4PS8A 1BD8A 4UWKA 4AXHA 3BG1B 2JABA 3T5XA 3V2XA 5KNGA 2ZGGA 3FUEA 4Q69A 2CG3A 2LXLA 3L82A 5CEAA 3G2UA 4JXTA 1KT0A 3JYSA 5CBOA 2OEVA 4OVVA 4GMLA 1BI8B 4RG9A 1IXVA 4UI9C 4CGWA 5A6CA 5ENQD 4JC8A 2J08A 3LS8A 4ILIA 3SI5A 2XS1A 1HU3A 3DRAA 2RG8A 3ONLA 3FUKA 3EIQC 1WM5A 2FO7A 4XKBA 3S7JA 4GA1A 2IQCA 4GTMA 3FUMA 4G26A 4UWFA 5AAOA 2NXPA 5CCMA 2J4DA 3SD5A 4U8HA 4KZCA 5ARGA 2I9CA 4N3CA 4G24A 3DBSA 5EYPF 2GRRB 3SZ7A 4HLLA 4J0UA 5KJMA 2Y4TA 2IO2C 2WXGA 3TXNA 4LCTA 1JCSA 3PUJA 2VSYA 4A3VA 2KCLA 3D3MA 5JMND 2HR2A 4U0UA 3P2BA 3Q73A 4J8EA 3J5PA 1N9AA 1X5BA 2B0OE 2MRIA 2AXUA 4P29A 2ILRA 3R7RA 1MZCA 5KNHD 3V30A 4WNEA 1HS6A 2VQ2A 1FT2A 2H6IA 2XGOA 5AARA 1RZ4A 1JWFA 3CK7A 5AENA 4N2SA 2AXZA 1KT1A 3VTXA 3R7QA 5FJYA 3D9HA 3U4TA 4N2QA 3N71A 4ANWA 4JHRA 4GZ5A 3T9KA 4ANUA 3B7RL 2P9PG 4BWRA 2ZU6B 3Q78A 4A1GA 3HXDA 3HG0D 2V4HC 2DYRE 2NC9A 3ASNE 4HB5A 2A4ZA 2WQHA 4XIFA 2Y3AA 2L6BA 5CERB 4GZ3A 4AEZC 4YDYA 4K5BA 3PE4A 5AIJA 4GYYA 4B8AA 2VJ8A 3UTMA 1DCQA 4B93B 5ITZF 3CVWA 4DX2A 1JWGA 4GZCA 1HX8A 4GCNA 3Q79A 3D9PA 1N0QA 1UN8A 3QWWA 2X38A 3HRAA 2BEDA 1TNUA 5CRVA 3ABME 4CEMA 4WWPA 4U0ZA 1MX4A 3FTSA 2WXOA 4AY6A 2HE0A 3EHRA 4KYOB 3QC1A 2GW1A 1H2VC 3DSVA 3OAWA 1MYOA 4KBQA 3HVEB 2QC9A 1TN8A 4U95D 3EHNA 2GRMA 3UT8A 3AS5A 4O60A 3HXFA 4J8SA 5J08A 2X6KA 5ENSD 4AJWA 4PS3A 1N11A 4GPMA 3L17A 3UMVA 4UWGA 4F3VA 5ENTD 1OWPA 3W9FA 2WMOA 4Y6WA 3CVNA 2DBAA 4BX8A 1E8YA 5AQ9A 4L23A 1E7VA 4HQDA 4K5AB 4MRUA 3PS6A 4JVSA 1JPLA 4DJAA 4GYOA 3CHSA 4HBDA 3I4RB 3UT4A 1PAQA 3CHRA 3B13A 4BT9A 4QQIA 1TJCA 5BXOA 1MHQA 4KXKB 2ONDA 5AQ7A 2HO1A 3KSLA 3B95A 2DWZA 2CHWA 3MKQA 3FTYA 3LEWA 4CCAA 4PDXA 3FTXA 4E85A 3D9OA 2HM8A 2ZXWE 3TAXA 3DSXA 5AJDA 4ILGA 3LDZA 3RO2A 1P5QA 5KJKA 1OWLA 2ETBA 2QZAA 1HZ4A 2X6HA 4A3TA 1Z3YA 2V0PA 3ASOE 4FLHA 2LSVA 3IXEA 2FULA 2X6FA 1DNPA 5D66A 3ML9A 2Y4UA 3LYAA 2PQRA 2XHEA 4MS6A 3QAQA 3S7BA 3E32A 2V8SE 1NL4A 3Q75A 4F6RD 3KD7A 2AXVA 3CSFA 5CBNA 3EU9A 3LVQE 2EIME 1V55E 5G2NA 4CDNA 2RFAA 4J7WA 3FEYA 2KM4A 4G25A 2BTDA 1O5MA 2UY1B 3TWUA 4YDOA 5C2YA 4N3AA 2V5QC 4DX1A 3HXBA 2DZOA 2YINA 4WUYA 2MYOA 3U9WA 3UXGA 1OUVA 3SFYA 2XZTG 4A63B 1KZOA 1OXJA 3CHOA 3P1UA 1OCOE 3L08A 3G2SA 3NF1A 2FEZA 3QWVA 3ZYKA 5BXUA 5KBAA 4XE0A 4A55A 3JCKC 3GZSA 2X6JA 2NSZA 3J5QB 1K8KG 3UM0A 5AYWD 4GYWA 2CHXA 2A5UA 4GB9A 1QZ2A 3UX4A 3AS8A 2XPIA 1IHGA 1O1TA 4AOFA 2GRNB 2WXKA 5BNWA 5EX3A 4RVBA 3SY2A 5KJNA 4BSZB 3V31A 3U66A 3OTNA 1E7UA 2E2EA 4TUUA 3DSSA 1NI1A 3CVVA 3PZ4A 3UI2A 3E4BA 1VDYA 4ILHB 1K3ZD 3OXFA 1TNBA 3PREA 4UQZA 5DBKA 1WG0A 3RRNB 4XI9A 4XX5A 2XEEA 3ABKE 4JW1A 3AG1E 4JA9A 3F6QA 5D2MC 2GRQB 4UI9J 5D0OD 3AG2E 2H6HA 1N54A 3EJNA 2XPYA 2VSNA 3PZ3A 3DPDA 4OAUC 4PS7A 1JCRA 4HOUA 3Q9NC 2WXHA 1BU9A 4FJYA 1TR4A 2PM7A 5CHEE 3LXUX 3GYZA 3CVPA 3RKVA 4F7AA 4DX7D 3FTZA 2YHEA 2OVFA 5E75A 2DZNA 3TJPA 1MX6A 2DVWA 4HRNA 2AVPA 3CR3A 3HYMB 4IULA 4TUMA 3KS2A 4MBGA 5BW8C 1N4PA 3TWRA 2WQ6A 4J8FA 3RAUA 2QYUA 5HQ8A 5A23A 4WWNA 1NFIE 3FUHA 2L6JA 5BV0A 1U3DA 5AQAA 3TWWA 3DEOA 2GROB 3FH5A 4HOQA 5ARFA 1O1RA 1LTXA 4LNUD 4DX5D 2V4LA 3D9NA 4ANXA 3JXJA 4LNBA 3CHQA 5BV1A 4O6FA 3ML8A 3NZSA 4UI9K 2VGEA 3CHPA 3Q5MA 4BX9A 4CDRA 3DXKG 5G05C 3W9GA 4L2LA 2XGMA 3MV3B 4I1MA
chains in the Genus database with same CATH topology
1ZU2A 3QB2A 4WWPA 4KZ0A 4U0ZA 3QDNA 3FTSA 2KZTB 5E76A 3LKUA 1LF8A 1UG3A 2QY7A 2WXOA 1GW6A 2VYIA 2MOWA 2J07A 4K0RA 4AY6A 3L54A 1QQEA 1UN9A 4KYOB 3QC1A 2GW1A 2AW6A 3CLJA 1H2VC 2J9QA 2XEVA 3NQPA 4V3IA 3ULQA 2GGFA 1Y6IA 3PNTB 5KJLA 3OAWA 1IYGA 4UWHA 5FQ4A 4KBQA 3HVEB 4N5CA 2R5SA 3Q4AB 4GA2A 3CK8A 3MX3A 4CT4A 4HORA 3K9IA 2MHKA 4GCOA 3SBSA 3PH0C 3EHNA 2GRMA 3UT8A 3AS5A 3TGOA 4KT6B 1ZBPA 3WXXA 3MZLB 4EZKA 4RSYA 2WMNA 4J8SA 4EECA 3BG0B 5J08A 2X6KA 3S7FA 3ZXSA 3PEUB 4BY6A 4CDMA 4JEUA 3NZUA 2J49A 4AJWA 4PS3A 3ZHEB 3CVYA 1PY1A 4WWOA 2PZIA 3L17A 4I6EA 4C9BB 4NQ0A 3UMVA 4BSXA 4UWGA 2V5FA 3FTWA 4F3VA 3VTYA 4F53A 4UQYA 5G05J 1OWPA 1FVHA 3BEEA 1S0PA 2WMOA 1WAO1 3OXLA 2LNIA 3PDNA 4PUCA 3CVNA 4Y6WA 2DBAA 3Q49B 4BX8A 1E8YA 4EZLA 4DI4A 4CRWA 2KCVA 4UWLA 3FUDA 5DIZA 4HS2A 4I6GA 4FLBA 4L23A 2GRLA 1E7VA 3CVUA 4DLQA 3RO3A 3FEXA 4MRUA 3O4ZA 4N3BA 2CFZA 4FP7A 3PS6A 4JVSA 4I2WA 1IQRA 4JA7A 3MGBA 2KATA 1JPLA 3KEZA 4DJAA 4GYOA 3ZPJA 3CHSA 3I4RB 4BFRA 3UT4A 2VGYA 1E8XA 1PAQA 4BT8A 4APOA 2XPZA 2UWJG 3B13A 3CHRA 2DIWA 4BT9A 3B7TA 1TJCA 1HO8A 4FADA 3QJZA 2LSUA 4URKA 3FUJA 3LY9A 1MHQA 4KXKB 4DK5A 3D9LA 4FULA 4Q96A 3ASFA 3EDTB 2C0LA 3MEKA 2ONDA 2HO1A 3L6AA 4AVXA 4OVUA 5LFAA 3IEGA 5ANRA 3VLDA 2WXFA 3U3WA 3CSTA 4I6JA 3QWPA 4GZ6A 2KZTA 1MQSA 2CHWA 3MKQA 3QARA 3TG4A 4AM9A 1HG2A 3FTYA 3LEWA 5G55A 3L22A 4PDXA 4CCAA 3ONKA 1UW4B 2I1KA 4BTBA 3FTXA 4HOSA 4E85A 1E90A 2LO6A 4W9RA 3D9OA 2HM8A 4MKTA 4I17A 3PE3A 3ZGQA 5FQ7A 3ZYLA 4U0SA 4D10C 3ZIMA 3L13A 1Z3XA 3FUFA 4NURA 3TAXA 4EBAA 4HFGA 4ILGA 5AJDA 3LDZA 3RO2A 1P5QA 2PQNA 3LY7A 2C0MA 3APDA 3AU5A 4JPSA 1NZNA 1KLXA 5KJKA 4GU5A 1OWLA 3D9MA 5FQ8A 4DPRA 4I9CA 3T5VA 5JHAA 1HZ4A 2X6HA 4A3TA 1Z3YA 1H2UA 2V0PA 3IHVA 3ZHEA 5FT9A 3ZYQA 3I3NA 4AIFA 4B89A 4FLHA 4LEUA 5BT1A 4YVOA 4HOTA 2LSVA 2FULA 3CQCB 2X6FA 1DNPA 1WY6A 1OWMA 5T3RA 1Z6TA 3CV0A 3TG5A 4AY5A 3ML9A 5ENNA 2Y4UA 3LYAA 3LVRE 2PQRA 2XHEA 2YQ8A 3UUXA 4MS6A 4EZJA 4FJZA 3MV2B 3D9IA 4TV3A 2FBNA 1E8ZA 3QAQA 2CFUA 3R9AB 3S7BA 1HFAA 2V8SE 4E6HA 4JZYA 3ASDA 3FU6A 3FY4A 3JQ1A 4KVOA 3URZA 4I1OB 2M63A 2WM9A 2XRYA 3B7SA 3KD7A 3RRUA 1W3BA 4GZDA 3ZW3A 2AXVA 3CSFA 5JJTA 3LVQE 3VLEA 5T8IA 3FH8A 5FQ6A 5G2NA 2Q7FA 4CDNA 3KAEA 2WXJA 1H19A 2PL2A 3FEYA 3TXMA 2L9BA 2WXPA 5G04C 1QNFA 2AWIA 2BF0X 2KM4A 4AP2A 3APFA 2BTDA 2J09A 2XGSA 4G25A 4F1SA 4ANVA 3CEQA 5BUZA 3MKRA 2HYZA 1SZAA 4NRHB 4DLOA 1YA0A 2UY1B 2VGXB 4I1AA 2IJGX 3ZFWA 5C2YA 1XGWA 2I6HA 3SGHA 1EYHA 4N3AA 2KCKA 3ZRHA 3G2VA 4ABNA 3SF4A 4XI0A 3G2WA 4EPZA 2YINA 4I43A 4WUYA 3U9WA 3CHMA 3PEVB 1OUVA 4WNGA 5JJ7A 5EX0A 3EIJA 4ME2A 4YVQC 2CHZA 3CHOA 5T4YA 3CIAA 2PM6A 3P1UA 3SBTB 3SNXA 4B8CB 3ZN3A 4ATGA 2JEKA 3AU4A 2YNQA 3HIZA 4XKCA 4JL0A 3L08A 1H2TC 4PS8A 3G2SA 3RK6A 4A1SA 3Q47B 3NF1A 4J6IA 5LOZA 5CCLA 2FEZA 3JQ0A 3QWVA 3ZYKA 1Y8MA 4N39A 4UWKA 5LCWC 4AXHA 3BG1B 4M3OA 2VSXE 3RRMB 5C1DA 3T5XA 4XE0A 4G11A 4KVMA 4A55A 3MCXA 3B7UX 4R7LA 1H6KA 1BPOA 1N52A 2CG2A 3L16A 3JCKC 2WXLA 5D0QD 4B94A 3FUEA 3GZSA 2X6JA 4Q69A 2CG3A 3MYVA 1ELRA 1EPUA 2NSZA 2WXQA 4TRQA 3FFLA 5AYWD 4GYWA 4KMOA 3G2UA 4JXTA 2CHXA 1KT0A 2FI7A 3JYSA 2WPVA 2A5UA 5G04J 1INZA 1SQMA 3CVLA 4L7TA 4OVVA 4GB9A 2BUGA 4C0MA 4GMLA 4LERA 4FHKA 4QFVA 1QZ2A 2I2OA 3UX4A 3GZ1A 4Q94A 4NACA 4HLEA 3IBEA 4RG9A 3FUIA 4PH4B 4UI9C 4C0EA 3AS8A 2XPIA 5FZSA 3LCAA 1IHGA 4CGWA 4AOFA 5A6CA 2EQXA 4JC8A 2IU1A 2J08A 3HVEA 2WXKA 3LS8A 4ILIA 3Q15A 3IV0A 2WQ7A 3GZ2A 3SI5A 3LJ3A 3OXGA 5LX8A 1HU3A 1DVPA 2OV8A 5BNWA 1HG5A 2VTBB 5EX3A 4RVBA 2RG8A 3ONLA 3FUKA 3S2AA 4HVBA 1NA3A 3HDXA 3EIQC 3LY8A 1WM5A 2FO7A 4L2YA 4RG6A 5KJNA 4XKBA 3S7JA 1JUQA 4GA1A 3MJWA 2IQCA 3FWVA 2LAHA 2WXIA 1FCHA 1UJJA 4K03A 3U66A 3FUMA 5A7DB 2YHCA 3MA5A 1E8WA 3OTNA 1E7UA 1NP7A 2UY1A 4G26A 5LCWJ 2VGXA 2E2EA 4G1TA 2R17C 4TUUA 4UWFA 1UJKA 1OWOA 3PUKA 4APFA 2NXPA 3EHMA 2J4DA 4EQFA 5CCMA 3SD5A 5CMYA 4U8HA 4KZCA 5ARGA 3CVVA 2QFCA 2I9CA 3FU5A 4N3CA 5JJ6A 5BPPA 4G24A 3RU0A 3DBSA 3FHEA 4H7XA 3SZ7A 4J0UA 1EDUA 2C2LA 3ESLA 4WNDA 3E4BA 1VDYA 4ILHB 5KJMA 3OXFA 2R59A 3PREA 2Y4TA 3T8MA 4CGVA 1EF1C 2WXGA 1TJFA 3I4GA 4UQZA 3TXNA 5DBKA 3RRNB 4LCTA 3MKQB 3PUJA 1IQUA 2WB2A 4XI9A 4XX5A 5KCMA 5J90A 4GMJA 5EDSA 4JW1A 4JA9A 3C98A 3SHFA 2JLBA 4UI9J 2VSYA 5D0OD 4A3VA 2KCLA 3D3MA 2HR2A 3FULA 4U0UA 2WXNA 3P2BA 1N54A 3ZVVA 2KC7A 2IONA 4J8EA 1X5BA 3EJNA 4FU3A 2MRIA 2L0TB 2XPYA 3ZEFA 3ASHA 3CKBA 3PRZA 3AS4A 2AXUA 3ASGA 2VSNA 4FC8A 5HI7A 4P29A 2ILRA 3UT7A 3D9JA 2XRZA 3DPDA 2XCBA 3R7RA 2XQ0A 2XCCA 4PS7A 2WVIA 4HOUA 4WNEA 2WXHA 3O48A 2LAIA 1HS6A 5FZQA 2VQ2A 4FJYA 5CHEE 2PM7A 3LXUX 3GYZA 4OYSA 3CVPA 3RKVA 4AV7A 3FU3A 3FH7A 2XGOA 4LRZA 4F7AA 3D9KA 4EBAG 1B89A 2OOEA 4GA0A 3FTZA 2YHEA 1JWFA 3CGHA 3FTVA 3FDHA 2OVFA 5E75A 5AJLA 4GPKA 1XNFA 3TJPA 3CK7A 3HHMA 4U04A 4G23A 5AENA 2IFUA 4N2SA 1HE8A 2VTBA 2AXZA 1KT1A 2AVPA 3CR3A 1OWNA 3VTXA 4U63A 5ANLA 3HYMB 4IULA 5FJYA 1ELWA 3R7QA 3U4TA 2OVBA 5LP0A 5FZRA 4N2QA 3FP3A 3KS2A 3N71A 4ANWA 5BW8C 4L1BA 4FHJA 2WQ6A 4CT0A 3APCA 3QK0A 3FU0A 4J8FA 4LUNU 3TL5A 3FTUA 4JHRA 4GZ5A 3UPVA 5CMWA 2FF4A 1SZ9A 1E96B 5EKQD 4ANUA 4DI3A 3B7RL 5HQ8A 4I2ZA 2ZU6B 3ZYMA 4BWRA 5A23A 4BTAA 3QKYA 4A1GA 1ELKA 1L5JA 4WWNA 2X6IA 4JEHA 3FUHA 3SFZA 2L6JA 5BV0A 1HXIA 3CK9A 1U3DA 2NC9A 3PNLB 4HXIA 3GW4A 1NA0A 3IHYA 3UQ3A 2A4ZA 5JHBA 4B0ZA 4J8DA 2WQHA 4IN3B 4XIFA 4YNDA 2Y3AA 3U64A 3VLFA 3QOUA 2IF4A 3FH5A 3QNKA 4HOQA 4FA6A 3G2TA 5ARFA 4GZ3A 3CKCA 3CVQA 3ENEA 5M72A 4AEZC 3PE4A 1U3CA 2IOLA 4ACKA 5AIJA 4WNFA 2DCPA 4GYYA 4UQXA 5FWQA 4B8AA 2V4LA 3D9NA 2VJ8A 2VSOE 3ESKA 3PVLA 3RIBA 4ANXA 3CHQA 5BV1A 1H0AA 4O6FA 3ML8A 2WXRA 4JHKA 4WAFA 3CVWA 3NZSA 4JHJA 2J4BA 1HH8A 2I1JA 4U07A 3I5PA 4CEMA 1HF8A 4Y6CA 3RJVA 1JWGA 4GZCA 1PC2A 4UI9K 1HX8A 2IOSA 4MLPA 1A17A 3IKOB 4GCNA 3CHPA 4H7YA 3FUNA 5FTPA 1TEZA 3D9PA 4IRUA 3LPZA 3CVXA 3Q5MA 4ACLA 4GAAA 4BX9A 1UN8A 3QWWA 4CDRA 3S7DA 3CQGB 5G05C 2X38A 2X3MA 2WXMA 4L2LA 2P58C 4I9EA 4IYPA 4G2VA 2E0IA 2L0IA 1FVFA 4XZ4A 2XGMA 3PZDA 3MV3B 2RD0A 4I1MA 3JUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU2 A;  4U0Z A;  3QDN A;  3LKU A;  2VYI A;  4AY6 A;  1QQE A;  4KYO B;  2GW1 A;  3ULQ A;  2J9Q A;  2XEV A;  5KJL A;  1IYG A;  4KBQ A;  4N5C A;  2R5S A;  3Q4A B;  4GA2 A;  3CK8 A;  4HOR A;  3K9I A;  2MHK A;  4GCO A;  3TGO A;  3AS5 A;  1ZBP A;  3WXX A;  3S7F A;  3ZHE B;  2PZI A;  4NQ0 A;  2V5F A;  4F3V A;  3VTY A;  4UQY A;  5G05 J;  3BEE A;  3PDN A;  3OXL A;  4Y6W A;  1WAO 1;  2LNI A;  3CVN A;  2DBA A;  3Q49 B;  2KCV A;  5DIZ A;  3RO3 A;  4N3B A;  4I2W A;  4JA7 A;  2KAT A;  4GYO A;  3ZPJ A;  2VGY A;  4BT8 A;  4APO A;  2UWJ G;  4BT9 A;  1TJC A;  2LSU A;  3LY9 A;  4KXK B;  3ASF A;  3EDT B;  2C0L A;  3MEK A;  2OND A;  2HO1 A;  3IEG A;  3U3W A;  3QWP A;  4GZ6 A;  3TG4 A;  4AM9 A;  4BTB A;  4HOS A;  4W9R A;  4I17 A;  3PE3 A;  3ZGQ A;  4U0S A;  3TAX A;  3RO2 A;  1P5Q A;  2PQN A;  3LY7 A;  2C0M A;  1NZN A;  1KLX A;  5KJK A;  4I9C A;  1HZ4 A;  4AIF A;  3ZHE A;  5FT9 A;  4LEU A;  5BT1 A;  4YVO A;  4HOT A;  2LSV A;  3TG5 A;  4AY5 A;  3CV0 A;  2Y4U A;  3LYA A;  2PQR A;  2YQ8 A;  3UUX A;  3MV2 B;  2FBN A;  3R9A B;  3S7B A;  3ASD A;  3URZ A;  3KD7 A;  1W3B A;  5JJT A;  2Q7F A;  3KAE A;  2PL2 A;  5G04 C;  4G25 A;  2XGS A;  3CEQ A;  3MKR A;  2HYZ A;  4NRH B;  1YA0 A;  2UY1 B;  2VGX B;  4I1A A;  3ZFW A;  2I6H A;  4N3A A;  2KCK A;  4ABN A;  3SF4 A;  4XI0 A;  4WUY A;  5JJ7 A;  1OUV A;  4WNG A;  5EX0 A;  4ME2 A;  4YVQ C;  3ZN3 A;  4JL0 A;  4A1S A;  3Q47 B;  3NF1 A;  5CCL A;  2FEZ A;  3QWV A;  1Y8M A;  4N39 A;  5LCW C;  5C1D A;  4B94 A;  5D0Q D;  1ELR A;  3FFL A;  5AYW D;  4GYW A;  1KT0 A;  2FI7 A;  3JYS A;  2WPV A;  5G04 J;  3CVL A;  2BUG A;  1QZ2 A;  3GZ1 A;  4RG9 A;  4UI9 C;  3AS8 A;  2XPI A;  5FZS A;  3LCA A;  1IHG A;  4CGW A;  5A6C A;  3Q15 A;  3GZ2 A;  3OXG A;  5BNW A;  5EX3 A;  1NA3 A;  3LY8 A;  2FO7 A;  1WM5 A;  4RG6 A;  5KJN A;  3S7J A;  4GA1 A;  3FWV A;  1FCH A;  5A7D B;  2YHC A;  3MA5 A;  5LCW J;  4G26 A;  2UY1 A;  2VGX A;  2E2E A;  4G1T A;  4EQF A;  5CCM A;  5ARG A;  2QFC A;  4N3C A;  5JJ6 A;  4G24 A;  3RU0 A;  4H7X A;  3SZ7 A;  4J0U A;  2C2L A;  4WND A;  3E4B A;  5KJM A;  3OXF A;  2Y4T A;  4CGV A;  4UQZ A;  5DBK A;  4XI9 A;  4JA9 A;  2JLB A;  4UI9 J;  2VSY A;  5D0O D;  2KCL A;  2HR2 A;  4U0U A;  2KC7 A;  4J8E A;  3CKB A;  3ASH A;  3AS4 A;  3ASG A;  2VSN A;  5HI7 A;  2XCB A;  2XCC A;  4HOU A;  4WNE A;  3O48 A;  5FZQ A;  2VQ2 A;  5CHE E;  3GYZ A;  3CVP A;  3RKV A;  2XGO A;  1B89 A;  2OOE A;  4GA0 A;  4GPK A;  1XNF A;  3CK7 A;  4U04 A;  4G23 A;  2IFU A;  4N2S A;  1KT1 A;  2AVP A;  3VTX A;  3HYM B;  5FJY A;  3U4T A;  1ELW A;  5FZR A;  4N2Q A;  3FP3 A;  3KS2 A;  3N71 A;  5BW8 C;  4J8F A;  4JHR A;  4GZ5 A;  3UPV A;  2FF4 A;  1E96 B;  5EKQ D;  5HQ8 A;  4I2Z A;  4BWR A;  4BTA A;  3QKY A;  2L6J A;  1HXI A;  2NC9 A;  3CK9 A;  3GW4 A;  1NA0 A;  3UQ3 A;  4J8D A;  2WQH A;  4IN3 B;  4XIF A;  4YND A;  3QOU A;  2IF4 A;  4HOQ A;  5ARF A;  4GZ3 A;  3CKC A;  3CVQ A;  5M72 A;  3PE4 A;  4WNF A;  4GYY A;  4UQX A;  3ESK A;  3RIB A;  4O6F A;  1HH8 A;  4U07 A;  4Y6C A;  3RJV A;  1PC2 A;  4UI9 K;  1A17 A;  4GCN A;  4H7Y A;  5FTP A;  3LPZ A;  3Q5M A;  3QWW A;  4CDR A;  3S7D A;  5G05 C;  2P58 C;  4I9E A;  4G2V A;  2XGM A;  3MV3 B; 
#chains in the Genus database with same CATH topology
 3E33 A;  4KZ0 A;  2KZT B;  3LKU A;  1UG3 A;  2QY7 A;  2MOW A;  4ZFH A;  4LNG A;  2IY0 C;  4TXQ A;  1QQE A;  1UN9 A;  3CLJ A;  2AW6 A;  3NQP A;  2J9Q A;  2XEV A;  2GGF A;  3PNT B;  4F1P A;  5FQ4 A;  3E34 A;  4N5C A;  2R5S A;  4GA2 A;  3C3Q A;  3CK8 A;  4HOR A;  4GCO A;  3ISM C;  5KWD A;  3WXX A;  3MZL B;  2H6G A;  1TN6 A;  4U7E B;  2IO3 C;  4GTO A;  3PEU B;  1TNZ A;  4BY6 A;  3NZU A;  4L9P A;  4JD2 G;  4WWO A;  4GMR A;  3UM2 A;  1YYH A;  3VTY A;  1S70 B;  1WAO 1;  4PUC A;  1FT1 A;  4YDW A;  3Q49 B;  4EZL A;  4HS2 A;  4FLB A;  4DLQ A;  4G8K A;  2BKG A;  3DSW A;  3O4Z A;  4FP7 A;  3KEZ A;  1QBQ A;  1K1A A;  2ETA A;  4BFR A;  2VGY A;  1E8X A;  2UWJ G;  1WDY A;  2LSU A;  3LY9 A;  4DK5 A;  3D9L A;  3EDT B;  2C0L A;  1RW2 A;  3C3R A;  3L6A A;  5LFA A;  3VLD A;  4GZ6 A;  1OT8 A;  1LD8 A;  3ULE G;  2EIL E;  3QAR A;  5G55 A;  2P9L G;  3ONK A;  2I1K A;  2LO6 A;  3ZGQ A;  4D10 C;  3L13 A;  4XEI G;  3SQV A;  4ZHB A;  3LY7 A;  1Z5S C;  1OCZ E;  1KLX A;  4GU5 A;  1OCC E;  4DPR A;  3NB2 A;  2ZGD A;  1N4Q A;  1JCQ A;  1H2U A;  3IHV A;  3ZYQ A;  5FT9 A;  3I3N A;  4B89 A;  4OAV B;  4HOT A;  1LD7 A;  5ENN A;  3C72 A;  4EZJ A;  4FJZ A;  3MV2 B;  3D9I A;  4TV3 A;  2FBN A;  3FU6 A;  4KVO A;  2M63 A;  3RRU A;  4GZD A;  1KPS B;  5FQ6 A;  2WXJ A;  1H19 A;  2WXP A;  5G04 C;  4F1S A;  4AP2 A;  4GTR A;  5AN8 A;  3MKR A;  2HYZ A;  4NRH B;  4DLO A;  2VGX B;  3ZFW A;  2IJG X;  1MJ0 A;  1EYH A;  4XI0 A;  3G2W A;  3CHM A;  3PEV B;  4ME2 A;  4YVQ C;  5ENR D;  3ULY A;  3SNX A;  4B8C B;  2PM6 A;  3B7B A;  4BER A;  2YNQ A;  4XKC A;  4JL0 A;  3KSQ A;  1H2T C;  4J6I A;  5CCL A;  3JQ0 A;  5LCW C;  3RRM B;  3TWQ A;  4G11 A;  4KVM A;  2ZIS A;  3MCX A;  4R7L A;  1N52 A;  5H7P A;  3MYV A;  1ELR A;  2AJA A;  4KMO A;  2FI7 A;  2PNN A;  1SQM A;  2BUG A;  4C0M A;  4LER A;  4FHK A;  1G3N B;  1N94 A;  3C3O A;  1A5E A;  4NAC A;  3TWX A;  4EHM A;  4PH4 B;  4C0E A;  2XEN A;  3LCA A;  3X2Q E;  3SO8 A;  3GZ2 A;  5LX8 A;  1DVP A;  2OV8 A;  1HG5 A;  2VTB B;  2F8X K;  1IHB A;  3R9M A;  4HVB A;  4L2Y A;  3C5R A;  4RG6 A;  1JUQ A;  4LSZ E;  2P2C P;  2LAH A;  4K03 A;  1FCH A;  1AP7 A;  2YHC A;  3MA5 A;  2UY1 A;  5AQB A;  2R17 C;  3ZUV B;  2R02 A;  3PUK A;  4HRL A;  1QYM A;  5CED B;  3FU5 A;  5JJ6 A;  5BPP A;  2IEJ A;  3FHE A;  3E37 A;  3AG4 E;  2OCC E;  4WND A;  1EDU A;  2C2L A;  2OEW A;  4CGV A;  3MKQ B;  1IQU A;  5KCM A;  4GMJ A;  5EDS A;  3DPY A;  2J8S D;  4N5Q A;  2JLB A;  3SFX A;  5EN5 D;  5IY5 E;  4U8Y D;  2L0T B;  3PRZ A;  3AS4 A;  2F0Y A;  3ASG A;  3D9J A;  2XRZ A;  3O48 A;  2LAI A;  5FZQ A;  4LG6 A;  4OYS A;  4AV7 A;  4EBA G;  1B89 A;  4GA0 A;  5B1A E;  1SA5 A;  3ZU7 B;  3CGH A;  3FDH A;  5AJL A;  4GPK A;  3HHM A;  4G23 A;  2IFU A;  1HE8 A;  1N95 A;  5CEC B;  1OWN A;  4U63 A;  1ELW A;  5LP0 A;  2BKK B;  3TL5 A;  4LUN U;  3UPV A;  2FF4 A;  5EYL A;  5EKQ D;  4DI3 A;  2XZD G;  4I2Z A;  3QKY A;  2RFM A;  1ELK A;  1L5J A;  1YMP A;  2X6I A;  2R03 A;  2Y1L E;  1ZB1 A;  4HXI A;  3IHY A;  4B0Z A;  1OY3 D;  3VLF A;  2EIK E;  3QOU A;  4FA6 A;  3L9T A;  3CKC A;  5B3S E;  1U3C A;  4ACK A;  4WNF A;  4UQX A;  5FWQ A;  2VSO E;  1H0A A;  2WXR A;  4JHK A;  4JHJ A;  2I1J A;  1HF8 A;  3EUV A;  3RJV A;  2IOS A;  3ABL E;  3IKO B;  5EIB E;  5FTP A;  1TEZ A;  3CVX A;  4O1O A;  3T8K A;  3CQG B;  4I9E A;  3NBN B;  2E0I A;  5ENO D;  4HI8 A;  1FVF A;  2F37 A;  1N4S A;  2F8Y A;  3UKU G;  3QDN A;  5E76 A;  1LF8 A;  2VYI A;  4K0R A;  3L54 A;  1U2V G;  4V3I A;  3ULQ A;  1Y6I A;  2B6C A;  4TXP A;  4UWH A;  1IYG A;  3Q4A B;  3MX3 A;  4CT4 A;  2MHK A;  3SBS A;  3PH0 C;  4CYM D;  1ZBP A;  4EZK A;  3ZXS A;  3S7F A;  4C48 B;  4CDM A;  4JEU A;  3AJI A;  3ZHE B;  3CVY A;  3DXM G;  2PZI A;  4Z68 A;  4C9B B;  4NQ0 A;  4BSX A;  3V79 K;  3FTW A;  4F53 A;  1AWC B;  5G05 J;  1FVH A;  1S0P A;  3OXL A;  3PDN A;  2LNI A;  4U96 D;  2EIN E;  3DWL G;  4CRW A;  5DIZ A;  3FEX A;  2R05 A;  1BI7 B;  1SA4 A;  3MGB A;  3ZXP A;  1YCS B;  4APO A;  2XPZ A;  4BES A;  2KXP C;  4U8V D;  4URK A;  3FUJ A;  4FUL A;  4GTV A;  4AVX A;  4OVU A;  3IEG A;  5ANR A;  3CST A;  3QWP A;  2KZT A;  4AM9 A;  1BLX B;  5ENP D;  3TG4 A;  3L22 A;  4HOS A;  3PZ1 A;  4W9R A;  3ZYL A;  1H6P A;  4U0S A;  3FUF A;  2P9I G;  4BEP A;  4HFG A;  2PQN A;  3AU5 A;  4JPS A;  1NZN A;  3D9M A;  5FQ8 A;  3UM3 A;  4I9C A;  5JHA A;  4LEU A;  5BT1 A;  2LUH A;  4AY5 A;  5T3R A;  1Z6T A;  4HI9 A;  2YQ8 A;  3UUX A;  2Y69 E;  1E8Z A;  2ZIR A;  1HFA A;  3ASD A;  3FY4 A;  3JQ1 A;  3TWS A;  4I1O B;  3B7S A;  1W3B A;  5EID A;  5JA4 D;  5T8I A;  3FH8 A;  1S64 A;  3TXM A;  2L9B A;  2BF0 X;  3APF A;  2XGS A;  1D9S A;  5BUZ A;  4YDE A;  1YA0 A;  2I6H A;  1X81 A;  2KBX A;  3SGH A;  2KCK A;  3KEA A;  1DCE A;  3G2V A;  4ABN A;  3SF4 A;  4EPZ A;  4I43 A;  5T4Y A;  3CIA A;  4HRM B;  3SBT B;  3ZN3 A;  4ATG A;  2Y0B G;  3TWV A;  2JEK A;  3AU4 A;  3HIZ A;  4GTQ A;  3RK6 A;  4A1S A;  3Q47 B;  5LOZ A;  1Y8M A;  4N39 A;  4M3O A;  2VSX E;  5C1D A;  2R2L A;  5CRU A;  3B7U X;  1K1B A;  1H6K A;  1V54 E;  1BPO A;  3L16 A;  2CG2 A;  4B94 A;  2WXL A;  5D0Q D;  5FIN A;  2EIJ E;  1EPU A;  2WXQ A;  4TRQ A;  3FFL A;  3WG7 E;  1S63 A;  2P9K G;  2WPV A;  5G04 J;  1INZ A;  2RKK A;  3CVL A;  4L7T A;  2GRP B;  4QFV A;  2I2O A;  3GZ1 A;  4Q94 A;  4HLE A;  3IBE A;  5HRY A;  4O1P A;  4G8L A;  3FUI A;  3LJN A;  5FZS A;  2EQX A;  2IU1 A;  3HVE A;  1D8D A;  2DYS E;  3Q15 A;  3IV0 A;  2WQ7 A;  3LJ3 A;  3OXG A;  4GTS A;  1SW6 A;  4RQI A;  3S2A A;  1NA3 A;  3HDX A;  3LY8 A;  2NYJ A;  3JUE A;  1H6O A;  3MJW A;  3FWV A;  2WXI A;  2FO1 E;  1UJJ A;  3Q7A A;  3BU8 A;  5A7D B;  1E8W A;  5LCW J;  1NP7 A;  2VGX A;  4G1T A;  1UJK A;  1OWO A;  2A5E A;  4APF A;  3EHM A;  4EQF A;  5CMY A;  2QFC A;  3RU0 A;  4H7X A;  3UIP C;  4DUI A;  3ESL A;  2R59 A;  4J8Y A;  3T8M A;  1EF1 C;  1TJF A;  3I4G A;  4DX6 D;  2QYJ A;  2WB2 A;  5J90 A;  3AAA C;  3BQO A;  3C98 A;  3SHF A;  3FUL A;  2WXN A;  3ZVV A;  2KC7 A;  2ION A;  3UKR G;  4FU3 A;  3ZEF A;  3ASH A;  3CKB A;  4FC8 A;  5HI7 A;  3UT7 A;  1D8E A;  2XCB A;  2XQ0 A;  2XCC A;  2WVI A;  3EU5 A;  1UOH A;  4M7C A;  3E30 A;  4CZ2 D;  3FU3 A;  3FH7 A;  3JXI A;  2P9U G;  4X8Q A;  3D9K A;  2OOE A;  3DEP A;  3FTV A;  1XNF A;  4GTP A;  4U04 A;  2VTB A;  5ANL A;  2OVB A;  5FZR A;  3FP3 A;  4HNA D;  4L1B A;  4FHJ A;  4CT0 A;  3APC A;  3QK0 A;  3FU0 A;  3FTU A;  4DRX E;  1N4R A;  5CMW A;  1SZ9 A;  1E96 B;  3ZYM A;  4BTA A;  1DC2 A;  1O1S A;  1KZP A;  4JEH A;  3SFZ A;  3V2O A;  1HXI A;  3CK9 A;  5HS0 A;  3PNL B;  5EIL A;  3GW4 A;  1NA0 A;  3UQ3 A;  5JHB A;  4J8D A;  4IN3 B;  4YND A;  3U64 A;  2IF4 A;  3QNK A;  3G2T A;  3CVQ A;  3ENE A;  3ZKJ A;  5M72 A;  4GTT A;  2IOL A;  2DCP A;  2P9N G;  3ESK A;  3PVL A;  3RIB A;  5B1B E;  4WAF A;  2J4B A;  1HH8 A;  4U07 A;  3I5P A;  1TNY A;  4Y6C A;  3UIN C;  1PC2 A;  4MLP A;  1A17 A;  4H7Y A;  3FUN A;  4IRU A;  3LPZ A;  4RLY A;  4ACL A;  4GAA A;  3S7D A;  1FPP A;  2X3M A;  2WXM A;  2P58 C;  4IYP A;  5HKP A;  4G2V A;  2L0I A;  4XZ4 A;  3PZD A;  4LRZ A;  2RD0 A;  3JUI A;  3HXE A;  1ZU2 A;  3QB2 A;  3NOC D;  1IKN D;  3HXC A;  1GW6 A;  2J07 A;  4K5C A;  3ZNG A;  5KJL A;  3K9I A;  3TGO A;  4KT6 B;  4RSY A;  2WMN A;  3TWT A;  4EEC A;  1OCR E;  3BG0 B;  2J49 A;  4UUC A;  1PY1 A;  3BUA A;  3PZ2 A;  4I6E A;  2P9S G;  2XEH A;  2V5F A;  4UQY A;  3BEE A;  4DI4 A;  2KCV A;  4UWL A;  3FUD A;  4I6G A;  2GRL A;  3DST A;  3CVU A;  3RO3 A;  4N3B A;  4TXR A;  2CFZ A;  4I2W A;  1IQR A;  4JA7 A;  2KAT A;  3ZPJ A;  4BT8 A;  2DIW A;  3B7T A;  1HO8 A;  3NOG D;  3QJZ A;  4FAD A;  3UM1 A;  2ETC A;  4Q96 A;  3ASF A;  3MEK A;  1TYQ G;  3UIO C;  2WXF A;  3U3W A;  4I6J A;  1MQS A;  1HG2 A;  1UW4 B;  1MX2 A;  4BTB A;  3Q7F A;  1E90 A;  4MKT A;  4I17 A;  3EHQ A;  3PE3 A;  5FQ7 A;  3ZIM A;  1Z3X A;  4NUR A;  4EBA A;  1Q2Z A;  1TN7 A;  2C0M A;  3APD A;  1N0R A;  2XS8 A;  3T5V A;  4JB8 P;  3AG3 E;  3Q9U C;  3ZHE A;  4AIF A;  4YVO A;  3CQC B;  1WY6 A;  3TG5 A;  1OWM A;  3CV0 A;  3NAW A;  3LVR E;  2H6F A;  3RSE G;  5FIO A;  2CFU A;  3R9A B;  4E6H A;  4JZY A;  3URZ A;  2WM9 A;  2XRY A;  3ZW3 A;  5JJT A;  3VLE A;  2Q7F A;  3KAE A;  2PL2 A;  1QNF A;  2AWI A;  4BET A;  4NIK A;  2J09 A;  4ATZ D;  1TNO A;  4ANV A;  1SVX A;  3CEQ A;  1SZA A;  4I1A A;  3DSU A;  1XGW A;  3ZRH A;  5JJ7 A;  2LXM A;  4WNG A;  5EX0 A;  3EIJ A;  2CHZ A;  4PS8 A;  1BD8 A;  4UWK A;  4AXH A;  3BG1 B;  2JAB A;  3T5X A;  3V2X A;  5KNG A;  2ZGG A;  3FUE A;  4Q69 A;  2CG3 A;  2LXL A;  3L82 A;  5CEA A;  3G2U A;  4JXT A;  1KT0 A;  3JYS A;  5CBO A;  2OEV A;  4OVV A;  4GML A;  1BI8 B;  4RG9 A;  1IXV A;  4UI9 C;  4CGW A;  5A6C A;  5ENQ D;  4JC8 A;  2J08 A;  3LS8 A;  4ILI A;  3SI5 A;  2XS1 A;  1HU3 A;  3DRA A;  2RG8 A;  3ONL A;  3FUK A;  3EIQ C;  1WM5 A;  2FO7 A;  4XKB A;  3S7J A;  4GA1 A;  2IQC A;  4GTM A;  3FUM A;  4G26 A;  4UWF A;  5AAO A;  2NXP A;  5CCM A;  2J4D A;  3SD5 A;  4U8H A;  4KZC A;  5ARG A;  2I9C A;  4N3C A;  4G24 A;  3DBS A;  5EYP F;  2GRR B;  3SZ7 A;  4HLL A;  4J0U A;  5KJM A;  2Y4T A;  2IO2 C;  2WXG A;  3TXN A;  4LCT A;  1JCS A;  3PUJ A;  2VSY A;  4A3V A;  2KCL A;  3D3M A;  5JMN D;  2HR2 A;  4U0U A;  3P2B A;  3Q73 A;  4J8E A;  3J5P A;  1N9A A;  1X5B A;  2B0O E;  2MRI A;  2AXU A;  4P29 A;  2ILR A;  3R7R A;  1MZC A;  5KNH D;  3V30 A;  4WNE A;  1HS6 A;  2VQ2 A;  1FT2 A;  2H6I A;  2XGO A;  5AAR A;  1RZ4 A;  1JWF A;  3CK7 A;  5AEN A;  4N2S A;  2AXZ A;  1KT1 A;  3VTX A;  3R7Q A;  5FJY A;  3D9H A;  3U4T A;  4N2Q A;  3N71 A;  4ANW A;  4JHR A;  4GZ5 A;  3T9K A;  4ANU A;  3B7R L;  2P9P G;  4BWR A;  2ZU6 B;  3Q78 A;  4A1G A;  3HXD A;  3HG0 D;  2V4H C;  2DYR E;  2NC9 A;  3ASN E;  4HB5 A;  2A4Z A;  2WQH A;  4XIF A;  2Y3A A;  2L6B A;  5CER B;  4GZ3 A;  4AEZ C;  4YDY A;  4K5B A;  3PE4 A;  5AIJ A;  4GYY A;  4B8A A;  2VJ8 A;  3UTM A;  1DCQ A;  4B93 B;  5ITZ F;  3CVW A;  4DX2 A;  1JWG A;  4GZC A;  1HX8 A;  4GCN A;  3Q79 A;  3D9P A;  1N0Q A;  1UN8 A;  3QWW A;  2X38 A;  3HRA A;  2BED A;  1TNU A;  5CRV A;  3ABM E;  4CEM A;  4WWP A;  4U0Z A;  1MX4 A;  3FTS A;  2WXO A;  4AY6 A;  2HE0 A;  3EHR A;  4KYO B;  3QC1 A;  2GW1 A;  1H2V C;  3DSV A;  3OAW A;  1MYO A;  4KBQ A;  3HVE B;  2QC9 A;  1TN8 A;  4U95 D;  3EHN A;  2GRM A;  3UT8 A;  3AS5 A;  4O60 A;  3HXF A;  4J8S A;  5J08 A;  2X6K A;  5ENS D;  4AJW A;  4PS3 A;  1N11 A;  4GPM A;  3L17 A;  3UMV A;  4UWG A;  4F3V A;  5ENT D;  1OWP A;  3W9F A;  2WMO A;  4Y6W A;  3CVN A;  2DBA A;  4BX8 A;  1E8Y A;  5AQ9 A;  4L23 A;  1E7V A;  4HQD A;  4K5A B;  4MRU A;  3PS6 A;  4JVS A;  1JPL A;  4DJA A;  4GYO A;  3CHS A;  4HBD A;  3I4R B;  3UT4 A;  1PAQ A;  3CHR A;  3B13 A;  4BT9 A;  4QQI A;  1TJC A;  5BXO A;  1MHQ A;  4KXK B;  2OND A;  5AQ7 A;  2HO1 A;  3KSL A;  3B95 A;  2DWZ A;  2CHW A;  3MKQ A;  3FTY A;  3LEW A;  4CCA A;  4PDX A;  3FTX A;  4E85 A;  3D9O A;  2HM8 A;  2ZXW E;  3TAX A;  3DSX A;  5AJD A;  4ILG A;  3LDZ A;  3RO2 A;  1P5Q A;  5KJK A;  1OWL A;  2ETB A;  2QZA A;  1HZ4 A;  2X6H A;  4A3T A;  1Z3Y A;  2V0P A;  3ASO E;  4FLH A;  2LSV A;  3IXE A;  2FUL A;  2X6F A;  1DNP A;  5D66 A;  3ML9 A;  2Y4U A;  3LYA A;  2PQR A;  2XHE A;  4MS6 A;  3QAQ A;  3S7B A;  3E32 A;  2V8S E;  1NL4 A;  3Q75 A;  4F6R D;  3KD7 A;  2AXV A;  3CSF A;  5CBN A;  3EU9 A;  3LVQ E;  2EIM E;  1V55 E;  5G2N A;  4CDN A;  2RFA A;  4J7W A;  3FEY A;  2KM4 A;  4G25 A;  2BTD A;  1O5M A;  2UY1 B;  3TWU A;  4YDO A;  5C2Y A;  4N3A A;  2V5Q C;  4DX1 A;  3HXB A;  2DZO A;  2YIN A;  4WUY A;  2MYO A;  3U9W A;  3UXG A;  1OUV A;  3SFY A;  2XZT G;  4A63 B;  1KZO A;  1OXJ A;  3CHO A;  3P1U A;  1OCO E;  3L08 A;  3G2S A;  3NF1 A;  2FEZ A;  3QWV A;  3ZYK A;  5BXU A;  5KBA A;  4XE0 A;  4A55 A;  3JCK C;  3GZS A;  2X6J A;  2NSZ A;  3J5Q B;  1K8K G;  3UM0 A;  5AYW D;  4GYW A;  2CHX A;  2A5U A;  4GB9 A;  1QZ2 A;  3UX4 A;  3AS8 A;  2XPI A;  1IHG A;  1O1T A;  4AOF A;  2GRN B;  2WXK A;  5BNW A;  5EX3 A;  4RVB A;  3SY2 A;  5KJN A;  4BSZ B;  3V31 A;  3U66 A;  3OTN A;  1E7U A;  2E2E A;  4TUU A;  3DSS A;  1NI1 A;  3CVV A;  3PZ4 A;  3UI2 A;  3E4B A;  1VDY A;  4ILH B;  1K3Z D;  3OXF A;  1TNB A;  3PRE A;  4UQZ A;  5DBK A;  1WG0 A;  3RRN B;  4XI9 A;  4XX5 A;  2XEE A;  3ABK E;  4JW1 A;  3AG1 E;  4JA9 A;  3F6Q A;  5D2M C;  2GRQ B;  4UI9 J;  5D0O D;  3AG2 E;  2H6H A;  1N54 A;  3EJN A;  2XPY A;  2VSN A;  3PZ3 A;  3DPD A;  4OAU C;  4PS7 A;  1JCR A;  4HOU A;  3Q9N C;  2WXH A;  1BU9 A;  4FJY A;  1TR4 A;  2PM7 A;  5CHE E;  3LXU X;  3GYZ A;  3CVP A;  3RKV A;  4F7A A;  4DX7 D;  3FTZ A;  2YHE A;  2OVF A;  5E75 A;  2DZN A;  3TJP A;  1MX6 A;  2DVW A;  4HRN A;  2AVP A;  3CR3 A;  3HYM B;  4IUL A;  4TUM A;  3KS2 A;  4MBG A;  5BW8 C;  1N4P A;  3TWR A;  2WQ6 A;  4J8F A;  3RAU A;  2QYU A;  5HQ8 A;  5A23 A;  4WWN A;  1NFI E;  3FUH A;  2L6J A;  5BV0 A;  1U3D A;  5AQA A;  3TWW A;  3DEO A;  2GRO B;  3FH5 A;  4HOQ A;  5ARF A;  1O1R A;  1LTX A;  4LNU D;  4DX5 D;  2V4L A;  3D9N A;  4ANX A;  3JXJ A;  4LNB A;  3CHQ A;  5BV1 A;  4O6F A;  3ML8 A;  3NZS A;  4UI9 K;  2VGE A;  3CHP A;  3Q5M A;  4BX9 A;  4CDR A;  3DXK G;  5G05 C;  3W9G A;  4L2L A;  2XGM A;  3MV3 B;  4I1M A; 
#chains in the Genus database with same CATH homology
 1ZU2 A;  3QB2 A;  4WWP A;  4KZ0 A;  4U0Z A;  3QDN A;  3FTS A;  2KZT B;  5E76 A;  3LKU A;  1LF8 A;  1UG3 A;  2QY7 A;  2WXO A;  1GW6 A;  2VYI A;  2MOW A;  2J07 A;  4K0R A;  4AY6 A;  3L54 A;  1QQE A;  1UN9 A;  4KYO B;  3QC1 A;  2GW1 A;  2AW6 A;  3CLJ A;  1H2V C;  2J9Q A;  2XEV A;  3NQP A;  4V3I A;  3ULQ A;  2GGF A;  1Y6I A;  3PNT B;  5KJL A;  3OAW A;  1IYG A;  4UWH A;  5FQ4 A;  4KBQ A;  3HVE B;  4N5C A;  2R5S A;  3Q4A B;  4GA2 A;  3CK8 A;  3MX3 A;  4CT4 A;  4HOR A;  3K9I A;  2MHK A;  4GCO A;  3SBS A;  3PH0 C;  3EHN A;  2GRM A;  3UT8 A;  3AS5 A;  3TGO A;  4KT6 B;  1ZBP A;  3WXX A;  3MZL B;  4EZK A;  4RSY A;  2WMN A;  4J8S A;  4EEC A;  3BG0 B;  5J08 A;  2X6K A;  3S7F A;  3ZXS A;  3PEU B;  4BY6 A;  4CDM A;  4JEU A;  3NZU A;  2J49 A;  4AJW A;  4PS3 A;  3ZHE B;  3CVY A;  1PY1 A;  4WWO A;  2PZI A;  3L17 A;  4I6E A;  4C9B B;  4NQ0 A;  3UMV A;  4BSX A;  4UWG A;  2V5F A;  3FTW A;  4F3V A;  3VTY A;  4F53 A;  4UQY A;  5G05 J;  1OWP A;  1FVH A;  3BEE A;  1S0P A;  2WMO A;  1WAO 1;  3OXL A;  2LNI A;  3PDN A;  4PUC A;  3CVN A;  4Y6W A;  2DBA A;  3Q49 B;  4BX8 A;  1E8Y A;  4EZL A;  4DI4 A;  4CRW A;  2KCV A;  4UWL A;  3FUD A;  5DIZ A;  4HS2 A;  4I6G A;  4FLB A;  4L23 A;  2GRL A;  1E7V A;  3CVU A;  4DLQ A;  3RO3 A;  3FEX A;  4MRU A;  3O4Z A;  4N3B A;  2CFZ A;  4FP7 A;  3PS6 A;  4JVS A;  4I2W A;  1IQR A;  4JA7 A;  3MGB A;  2KAT A;  1JPL A;  3KEZ A;  4DJA A;  4GYO A;  3ZPJ A;  3CHS A;  3I4R B;  4BFR A;  3UT4 A;  2VGY A;  1E8X A;  1PAQ A;  4BT8 A;  4APO A;  2XPZ A;  2UWJ G;  3B13 A;  3CHR A;  2DIW A;  4BT9 A;  3B7T A;  1TJC A;  1HO8 A;  4FAD A;  3QJZ A;  2LSU A;  4URK A;  3FUJ A;  3LY9 A;  1MHQ A;  4KXK B;  4DK5 A;  3D9L A;  4FUL A;  4Q96 A;  3ASF A;  3EDT B;  2C0L A;  3MEK A;  2OND A;  2HO1 A;  3L6A A;  4AVX A;  4OVU A;  5LFA A;  3IEG A;  5ANR A;  3VLD A;  2WXF A;  3U3W A;  3CST A;  4I6J A;  3QWP A;  4GZ6 A;  2KZT A;  1MQS A;  2CHW A;  3MKQ A;  3QAR A;  3TG4 A;  4AM9 A;  1HG2 A;  3FTY A;  3LEW A;  5G55 A;  3L22 A;  4PDX A;  4CCA A;  3ONK A;  1UW4 B;  2I1K A;  4BTB A;  3FTX A;  4HOS A;  4E85 A;  1E90 A;  2LO6 A;  4W9R A;  3D9O A;  2HM8 A;  4MKT A;  4I17 A;  3PE3 A;  3ZGQ A;  5FQ7 A;  3ZYL A;  4U0S A;  4D10 C;  3ZIM A;  3L13 A;  1Z3X A;  3FUF A;  4NUR A;  3TAX A;  4EBA A;  4HFG A;  4ILG A;  5AJD A;  3LDZ A;  3RO2 A;  1P5Q A;  2PQN A;  3LY7 A;  2C0M A;  3APD A;  3AU5 A;  4JPS A;  1NZN A;  1KLX A;  5KJK A;  4GU5 A;  1OWL A;  3D9M A;  5FQ8 A;  4DPR A;  4I9C A;  3T5V A;  5JHA A;  1HZ4 A;  2X6H A;  4A3T A;  1Z3Y A;  1H2U A;  2V0P A;  3IHV A;  3ZHE A;  5FT9 A;  3ZYQ A;  3I3N A;  4AIF A;  4B89 A;  4FLH A;  4LEU A;  5BT1 A;  4YVO A;  4HOT A;  2LSV A;  2FUL A;  3CQC B;  2X6F A;  1DNP A;  1WY6 A;  1OWM A;  5T3R A;  1Z6T A;  3CV0 A;  3TG5 A;  4AY5 A;  3ML9 A;  5ENN A;  2Y4U A;  3LYA A;  3LVR E;  2PQR A;  2XHE A;  2YQ8 A;  3UUX A;  4MS6 A;  4EZJ A;  4FJZ A;  3MV2 B;  3D9I A;  4TV3 A;  2FBN A;  1E8Z A;  3QAQ A;  2CFU A;  3R9A B;  3S7B A;  1HFA A;  2V8S E;  4E6H A;  4JZY A;  3ASD A;  3FU6 A;  3FY4 A;  3JQ1 A;  4KVO A;  3URZ A;  4I1O B;  2M63 A;  2WM9 A;  2XRY A;  3B7S A;  3KD7 A;  3RRU A;  1W3B A;  4GZD A;  3ZW3 A;  2AXV A;  3CSF A;  5JJT A;  3LVQ E;  3VLE A;  5T8I A;  3FH8 A;  5FQ6 A;  5G2N A;  2Q7F A;  4CDN A;  3KAE A;  2WXJ A;  1H19 A;  2PL2 A;  3FEY A;  3TXM A;  2L9B A;  2WXP A;  5G04 C;  1QNF A;  2AWI A;  2BF0 X;  2KM4 A;  4AP2 A;  3APF A;  2BTD A;  2J09 A;  2XGS A;  4G25 A;  4F1S A;  4ANV A;  3CEQ A;  5BUZ A;  3MKR A;  2HYZ A;  1SZA A;  4NRH B;  4DLO A;  1YA0 A;  2UY1 B;  2VGX B;  4I1A A;  2IJG X;  3ZFW A;  5C2Y A;  1XGW A;  2I6H A;  3SGH A;  1EYH A;  4N3A A;  2KCK A;  3ZRH A;  3G2V A;  4ABN A;  3SF4 A;  4XI0 A;  3G2W A;  4EPZ A;  2YIN A;  4I43 A;  4WUY A;  3U9W A;  3CHM A;  3PEV B;  1OUV A;  4WNG A;  5JJ7 A;  5EX0 A;  3EIJ A;  4ME2 A;  4YVQ C;  2CHZ A;  3CHO A;  5T4Y A;  3CIA A;  2PM6 A;  3P1U A;  3SBT B;  3SNX A;  4B8C B;  3ZN3 A;  4ATG A;  2JEK A;  3AU4 A;  2YNQ A;  3HIZ A;  4XKC A;  4JL0 A;  3L08 A;  1H2T C;  4PS8 A;  3G2S A;  3RK6 A;  4A1S A;  3Q47 B;  3NF1 A;  4J6I A;  5LOZ A;  5CCL A;  2FEZ A;  3JQ0 A;  3QWV A;  3ZYK A;  1Y8M A;  4N39 A;  4UWK A;  5LCW C;  4AXH A;  3BG1 B;  4M3O A;  2VSX E;  3RRM B;  5C1D A;  3T5X A;  4XE0 A;  4G11 A;  4KVM A;  4A55 A;  3MCX A;  3B7U X;  4R7L A;  1H6K A;  1BPO A;  1N52 A;  2CG2 A;  3L16 A;  3JCK C;  2WXL A;  5D0Q D;  4B94 A;  3FUE A;  3GZS A;  2X6J A;  4Q69 A;  2CG3 A;  3MYV A;  1ELR A;  1EPU A;  2NSZ A;  2WXQ A;  4TRQ A;  3FFL A;  5AYW D;  4GYW A;  4KMO A;  3G2U A;  4JXT A;  2CHX A;  1KT0 A;  2FI7 A;  3JYS A;  2WPV A;  2A5U A;  5G04 J;  1INZ A;  1SQM A;  3CVL A;  4L7T A;  4OVV A;  4GB9 A;  2BUG A;  4C0M A;  4GML A;  4LER A;  4FHK A;  4QFV A;  1QZ2 A;  2I2O A;  3UX4 A;  3GZ1 A;  4Q94 A;  4NAC A;  4HLE A;  3IBE A;  4RG9 A;  3FUI A;  4PH4 B;  4UI9 C;  4C0E A;  3AS8 A;  2XPI A;  5FZS A;  3LCA A;  1IHG A;  4CGW A;  4AOF A;  5A6C A;  2EQX A;  4JC8 A;  2IU1 A;  2J08 A;  3HVE A;  2WXK A;  3LS8 A;  4ILI A;  3Q15 A;  3IV0 A;  2WQ7 A;  3GZ2 A;  3SI5 A;  3LJ3 A;  3OXG A;  5LX8 A;  1HU3 A;  1DVP A;  2OV8 A;  5BNW A;  1HG5 A;  2VTB B;  5EX3 A;  4RVB A;  2RG8 A;  3ONL A;  3FUK A;  3S2A A;  4HVB A;  1NA3 A;  3HDX A;  3EIQ C;  3LY8 A;  1WM5 A;  2FO7 A;  4L2Y A;  4RG6 A;  5KJN A;  4XKB A;  3S7J A;  1JUQ A;  4GA1 A;  3MJW A;  2IQC A;  3FWV A;  2LAH A;  2WXI A;  1FCH A;  1UJJ A;  4K03 A;  3U66 A;  3FUM A;  5A7D B;  2YHC A;  3MA5 A;  1E8W A;  3OTN A;  1E7U A;  1NP7 A;  2UY1 A;  4G26 A;  5LCW J;  2VGX A;  2E2E A;  4G1T A;  2R17 C;  4TUU A;  4UWF A;  1UJK A;  1OWO A;  3PUK A;  4APF A;  2NXP A;  3EHM A;  2J4D A;  4EQF A;  5CCM A;  3SD5 A;  5CMY A;  4U8H A;  4KZC A;  5ARG A;  3CVV A;  2QFC A;  2I9C A;  3FU5 A;  4N3C A;  5JJ6 A;  5BPP A;  4G24 A;  3RU0 A;  3DBS A;  3FHE A;  4H7X A;  3SZ7 A;  4J0U A;  1EDU A;  2C2L A;  3ESL A;  4WND A;  3E4B A;  1VDY A;  4ILH B;  5KJM A;  3OXF A;  2R59 A;  3PRE A;  2Y4T A;  3T8M A;  4CGV A;  1EF1 C;  2WXG A;  1TJF A;  3I4G A;  4UQZ A;  3TXN A;  5DBK A;  3RRN B;  4LCT A;  3MKQ B;  3PUJ A;  1IQU A;  2WB2 A;  4XI9 A;  4XX5 A;  5KCM A;  5J90 A;  4GMJ A;  5EDS A;  4JW1 A;  4JA9 A;  3C98 A;  3SHF A;  2JLB A;  4UI9 J;  2VSY A;  5D0O D;  4A3V A;  2KCL A;  3D3M A;  2HR2 A;  3FUL A;  4U0U A;  2WXN A;  3P2B A;  1N54 A;  3ZVV A;  2KC7 A;  2ION A;  4J8E A;  1X5B A;  3EJN A;  4FU3 A;  2MRI A;  2L0T B;  2XPY A;  3ZEF A;  3ASH A;  3CKB A;  3PRZ A;  3AS4 A;  2AXU A;  3ASG A;  2VSN A;  4FC8 A;  5HI7 A;  4P29 A;  2ILR A;  3UT7 A;  3D9J A;  2XRZ A;  3DPD A;  2XCB A;  3R7R A;  2XQ0 A;  2XCC A;  4PS7 A;  2WVI A;  4HOU A;  4WNE A;  2WXH A;  3O48 A;  2LAI A;  1HS6 A;  5FZQ A;  2VQ2 A;  4FJY A;  5CHE E;  2PM7 A;  3LXU X;  3GYZ A;  4OYS A;  3CVP A;  3RKV A;  4AV7 A;  3FU3 A;  3FH7 A;  2XGO A;  4LRZ A;  4F7A A;  3D9K A;  4EBA G;  1B89 A;  2OOE A;  4GA0 A;  3FTZ A;  2YHE A;  1JWF A;  3CGH A;  3FTV A;  3FDH A;  2OVF A;  5E75 A;  5AJL A;  4GPK A;  1XNF A;  3TJP A;  3CK7 A;  3HHM A;  4U04 A;  4G23 A;  5AEN A;  2IFU A;  4N2S A;  1HE8 A;  2VTB A;  2AXZ A;  1KT1 A;  2AVP A;  3CR3 A;  1OWN A;  3VTX A;  4U63 A;  5ANL A;  3HYM B;  4IUL A;  5FJY A;  1ELW A;  3R7Q A;  3U4T A;  2OVB A;  5LP0 A;  5FZR A;  4N2Q A;  3FP3 A;  3KS2 A;  3N71 A;  4ANW A;  5BW8 C;  4L1B A;  4FHJ A;  2WQ6 A;  4CT0 A;  3APC A;  3QK0 A;  3FU0 A;  4J8F A;  4LUN U;  3TL5 A;  3FTU A;  4JHR A;  4GZ5 A;  3UPV A;  5CMW A;  2FF4 A;  1SZ9 A;  1E96 B;  5EKQ D;  4ANU A;  4DI3 A;  3B7R L;  5HQ8 A;  4I2Z A;  2ZU6 B;  3ZYM A;  4BWR A;  5A23 A;  4BTA A;  3QKY A;  4A1G A;  1ELK A;  1L5J A;  4WWN A;  2X6I A;  4JEH A;  3FUH A;  3SFZ A;  2L6J A;  5BV0 A;  1HXI A;  3CK9 A;  1U3D A;  2NC9 A;  3PNL B;  4HXI A;  3GW4 A;  1NA0 A;  3IHY A;  3UQ3 A;  2A4Z A;  5JHB A;  4B0Z A;  4J8D A;  2WQH A;  4IN3 B;  4XIF A;  4YND A;  2Y3A A;  3U64 A;  3VLF A;  3QOU A;  2IF4 A;  3FH5 A;  3QNK A;  4HOQ A;  4FA6 A;  3G2T A;  5ARF A;  4GZ3 A;  3CKC A;  3CVQ A;  3ENE A;  5M72 A;  4AEZ C;  3PE4 A;  1U3C A;  2IOL A;  4ACK A;  5AIJ A;  4WNF A;  2DCP A;  4GYY A;  4UQX A;  5FWQ A;  4B8A A;  2V4L A;  3D9N A;  2VJ8 A;  2VSO E;  3ESK A;  3PVL A;  3RIB A;  4ANX A;  3CHQ A;  5BV1 A;  1H0A A;  4O6F A;  3ML8 A;  2WXR A;  4JHK A;  4WAF A;  3CVW A;  3NZS A;  4JHJ A;  2J4B A;  1HH8 A;  2I1J A;  4U07 A;  3I5P A;  4CEM A;  1HF8 A;  4Y6C A;  3RJV A;  1JWG A;  4GZC A;  1PC2 A;  4UI9 K;  1HX8 A;  2IOS A;  4MLP A;  1A17 A;  3IKO B;  4GCN A;  3CHP A;  4H7Y A;  3FUN A;  5FTP A;  1TEZ A;  3D9P A;  4IRU A;  3LPZ A;  3CVX A;  3Q5M A;  4ACL A;  4GAA A;  4BX9 A;  1UN8 A;  3QWW A;  4CDR A;  3S7D A;  3CQG B;  5G05 C;  2X38 A;  2X3M A;  2WXM A;  4L2L A;  2P58 C;  4I9E A;  4IYP A;  4G2V A;  2E0I A;  2L0I A;  1FVF A;  4XZ4 A;  2XGM A;  3PZD A;  3MV3 B;  2RD0 A;  4I1M A;  3JUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...