2LSVA

The nmr high resolution structure of yeast tah1 in complex with the hsp90 c-terminal tail
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structural Analysis Shows How Tah1 Tethers Hsp90 to the R2TP Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone-binding protein/chaperone
molecule keywords TPR repeat-containing protein associated with Hsp90
total genus 30
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lsvA00
3KD7A 4HORA 2V5FA 4HOQA 5FZSA 3Q49B 4N5CA 3TGOA 1KLXA 3IEGA 2UWJG 3CK9A 4I9EA 3RU0A 2HR2A 4LEUA 3MEKA 3Q5MA 4WNFA 1YA0A 2UY1A 4U0SA 3UQ3A 3Q47B 4KYOB 3CK8A 2FF4A 3CEQA 2J9QA 4KBQA 4N2QA 5G04J 2UY1B 2YHCA 3ULQA 2OOEA 5LCWC 3UPVA 4EQFA 3WXXA 1TJCA 4YNDA 4GCNA 1HZ4A 4U0UA 2KC7A 2YQ8A 3LY9A 3PE3A 5ARGA 5G05J 5C1DA 2VGXA 4N2SA 2C0LA 4XI0A 3R9AB 3PDNA 3RKVA 2XEVA 2XGOA 3VTXA 1PC2A 4BTBA 2E2EA 3TAXA 4NQ0A 2WQHA 2XPIA 1ELWA 2FEZA 4UI9K 2I6HA 1HH8A 2PL2A 3CVNA 2Y4UA 3LKUA 4H7XA 4Y6CA 2PZIA 3CVQA 3OXFA 4WNDA 3ZGQA 4A1SA 3RO2A 4CGWA 3QWVA 4J8EA 4WNGA 2AVPA 2KCVA 3GYZA 4G24A 4U07A 3QWPA 5BT1A 2P58C 2KCLA 2FBNA 3FFLA 4I1AA 5DBKA 4N3BA 3S7FA 1ZBPA 4XI9A 4JA9A 1NZNA 4G1TA 3TG4A 5JJ7A 1IYGA 2R5SA 3ZN3A 2C0MA 4JA7A 3EDTB 5BW8C 5HQ8A 1WM5A 4JL0A 5KJLA 1KT0A 3CVPA 4Y6WA 5KJMA 5D0OD 1KT1A 3U3WA 3MKRA 3KS2A 3MV3B 4ME2A 4GCOA 4U0ZA 4AY6A 2IFUA 1E96B 4W9RA 3ASGA 4N39A 3TG5A 4N3CA 3PE4A 2HYZA 2L6JA 3CV0A 3E4BA 3LPZA 2LSVA 3K9IA 3SF4A 5LCWJ 3URZA 1W3BA 4HOSA 5KJNA 2PQRA 2XCBA 3AS8A 3OXGA 1Y8MA 4XIFA 2HO1A 3LY7A 4ABNA 5FZRA 5CCMA 3ZHEB 2XCCA 3JYSA 4HOTA 2XGSA 5FTPA 3VTYA 1NA0A 3ASHA 3OXLA 3MA5A 2XGMA 2MHKA 3ZHEA 1QZ2A 5DIZA 4UI9J 2LNIA 1OUVA 1ZU2A 2VQ2A 4U04A 3S7DA 4BT9A 2KATA 1A17A 2KCKA 4GZ3A 3HYMB 4B94A 5FZQA 2DBAA 5ARFA 4RG6A 5G04C 3ZFWA 4AIFA 3LYAA 4KXKB 2IF4A 3NF1A 3RJVA 4APOA 3GZ2A 5HI7A 2VSYA 5A7DB 4GYWA 5G05C 3AS4A 3SZ7A 4G26A 4YVOA 5A6CA 4J0UA 5JJ6A 5M72A 2Y4TA 2FI7A 4GA2A 4CDRA 3N71A 5EKQD 1FCHA 3FWVA 4BTAA 2Q7FA 3FP3A 4I2WA 4RG9A 5D0QD 3Q15A 3ZPJA 3GZ1A 3CVLA 3Q4AB 2VYIA 1B89A 1XNFA 2JLBA 2QFCA 2VSNA 3ASDA 3QKYA 4IN3B 3QOUA 1QQEA 4JHRA 5CHEE 4I17A 4GZ6A 3S7BA 4I2ZA 5CCLA 2PQNA 4AM9A 4GZ5A 4UQXA 2ONDA 5BNWA 4H7YA 2C2LA 4WUYA 3CKCA 3CKBA 4GA1A 4GYOA 4YVQC 2GW1A 4J8DA 5FT9A 3CK7A 4GPKA 4G2VA 1ELRA 1P5QA 3O48A 4UI9C 4CGVA 4I9CA 3UUXA 1WAO1 4WNEA 3ESKA 4BT8A 4J8FA 3RIBA 3BEEA 4G23A 2FO7A 4UQZA 4AY5A 4F3VA 5KJKA 5AYWD 3GW4A 4NRHB 4N3AA 3RO3A 2BUGA 1IHGA 2NC9A 3ASFA 3QWWA 2VGXB 3KAEA 4UQYA 3LCAA 1HXIA 4O6FA 3QDNA 5EX0A 3S7JA 5JJTA 2LSUA 4G25A 5EX3A 2WPVA 4GYYA 2VGYA 4HOUA 4GA0A 3U4TA 1NA3A 3LY8A 4BWRA 5FJYA 3MV2B 3AS5A
chains in the Genus database with same CATH superfamily
4HORA 1EYHA 4HI8A 4I9EA 3DSXA 3Q5MA 3FU5A 3PS6A 2FF4A 4BSZB 4GZDA 2CHWA 3ZIMA 4U0UA 2XZDG 2CHXA 5AJLA 2R05A 3U66A 1PC2A 4JVSA 1N9AA 4U07A 3ASOE 3C98A 5DBKA 1NL4A 2WXKA 4Q69A 1KT0A 4UWHA 1TNZA 1O1RA 4NURA 1E8YA 2LSVA 3C3QA 1N4PA 2I2OA 5KJNA 2VSXE 5CCMA 5CMWA 4UI9J 3S7DA 5CEAA 5G2NA 3FTZA 4B94A 4L1BA 2IEJA 4BETA 3FUKA 4L23A 1SZAA 3QOUA 4ANVA 3VLFA 4FADA 4H7YA 4YVQC 1JWFA 3W9FA 2L0TB 3AG2E 1P5QA 2BTDA 4F3VA 1H2VC 1OCZE 2J07A 2NYJA 3HG0D 3LY8A 4DRXE 4AXHA 3I5PA 4C48B 3ONKA 4HVBA 2UWJG 2RD0A 2I1JA 3Q47B 2H6FA 2WXGA 4I6GA 3V79K 4MRUA 2H6GA 5E76A 4GCNA 2DIWA 3Q78A 2CG3A 2VGXA 3Q73A 4DI3A 2J4DA 3C5RA 3MX3A 4UI9K 3UM3A 5BV1A 3FDHA 4WNGA 1DNPA 4KZCA 3T8MA 4G8KA 2GRPB 4P29A 4F1PA 4LERA 5IY5E 3AJIA 2ETCA 1E96B 3FH5A 2IU1A 1Y8MA 3ZVVA 3ZHEB 2H6HA 3OXLA 4G8LA 2OVBA 1SVXA 4FLBA 3Q79A 3ZYLA 5LFAA 2IF4A 2GRLA 3UT7A 3QK0A 3PEUB 2BF0X 1E7UA 5EKQD 3ML9A 3FP3A 3GZ1A 1S0PA 1MHQA 3BG1B 5ENPD 4Z68A 2P9NG 5ANLA 2V4HC 3ZYMA 1KZPA 3ESLA 3HXEA 5FQ4A 5T8IA 2GRRB 2GRMA 4UWGA 4EPZA 5KBAA 3JQ1A 4HOUA 5AQ9A 5EILA 2XS8A 4BY6A 3KD7A 1IXVA 1H6OA 1OWLA 2FO1E 4BSXA 1YA0A 3LDZA 2H6IA 4BEPA 3ULQA 1N11A 4XX5A 1HF8A 5EDSA 2XRZA 1OWPA 2XEVA 2ETBA 2E2EA 3JCKC 3CIAA 3TAXA 2ZU6B 2PL2A 3B7BA 4RSYA 3QWVA 4EBAA 5AQBA 5J08A 4I43A 3CHMA 3HIZA 2ZGGA 5AQ7A 3FUNA 1WY6A 1O1SA 4XI9A 2OV8A 1IYGA 4JA7A 1WM5A 3DPDA 2KZTA 1E8ZA 3E4BA 3X2QE 4K03A 3AS8A 2X6FA 3L17A 3RRNB 3Q9NC 5FTPA 4GZ3A 2DBAA 4GTQA 3ZFWA 2YINA 2A5EA 3HXBA 1INZA 4CDNA 1B89A 4TXPA 2ZXWE 4JPSA 2WXFA 1HG2A 3TWQA 2DCPA 5FWQA 1K8KG 3B95A 4GPKA 4BX8A 4UI9C 1N95A 3V2XA 3RRMB 3ASFA 3DWLG 4G25A 3TWVA 3B7SA 4JHJA 4BWRA 1OCOE 4DJAA 3MGBA 5ANRA 4EQFA 2XRYA 4JXTA 1JCSA 5G05J 2C0LA 2GGFA 3E37A 1V55E 1ELWA 3UINC 3LVRE 4L9PA 2NXPA 5BT1A 5CBOA 3TG4A 4G1TA 1BU9A 3ZYQA 1TN6A 4L2YA 1KT1A 4HNAD 4GMRA 3PE4A 1YMPA 3RSEG 1WG0A 3D9MA 4K0RA 5CMYA 2EILE 1NA0A 2ZISA 5CBNA 3KEAA 3FUHA 4YDYA 3NOGD 3HYMB 3ZU7B 2GROB 1HFAA 1DCQA 2Q7FA 4I2WA 4E85A 1XNFA 4HRMB 4I17A 3D3MA 4GA1A 1ELRA 4OAUC 3BEEA 3SFXA 4DLQA 3RO3A 1IHGA 3LJNA 3QWWA 3S7JA 4MLPA 3Q9UC 4LUNU 1IKND 1SQMA 3RK6A 4U8VD 2WXNA 2J49A 1UG3A 1QBQA 3CK8A 1MQSA 3JUIA 1DCEA 2XPZA 3D9NA 3I4RB 3TGOA 3D9PA 1YCSB 3EJNA 2V4LA 2ZGDA 4KZ0A 1ZBPA 4JA9A 4FHKA 3MV3B 2ETAA 4AV7A 4WWOA 2HYZA 2AXUA 3K9IA 2WVIA 3T9KA 3G2SA 3W9GA 3ONLA 2XCCA 4UWKA 4KT6B 3AU5A 5BV0A 1RZ4A 1OUVA 2XHEA 1IQUA 4A3TA 5EIDA 2KZTB 4YVOA 4CT4A 2FI7A 2DZNA 4YDWA 3FTUA 3E34A 4FA6A 1H0AA 4NIKA 2DZOA 4RQIA 4GZ6A 2V0PA 4GYOA 4U8HA 4J8DA 4GTVA 4KVOA 4CGVA 4HBDA 4GZCA 2BKKB 3UMVA 1PAQA 4AY5A 2B6CA 3NZSA 5LX8A 1D8EA 1LTXA 4EZKA 3G2VA 4ANXA 3AU4A 2VGYA 4GA0A 4C0EA 4EBAG 2NSZA 3IXEA 4N5CA 1WDYA 4LEUA 3B7UX 3EUVA 3Q7AA 5BPPA 2UY1B 3WXXA 2KC7A 3SY2A 1N0QA 3V31A 2WXLA 5JHAA 2FEZA 4GTRA 4IYPA 1X5BA 4HLLA 3ZEFA 3UIOC 3LJ3A 4J8EA 3GYZA 1N94A 1QYMA 3PZDA 1SA5A 3DPYA 1Y6IA 5JJ7A 5T3RA 4AP2A 5AENA 4LSZE 4DX6D 1TR4A 2L9BA 1BLXB 4FLHA 3OXGA 3UI2A 5B3SE 1TN8A 2V8SE 4ILGA 4J6IA 4XKCA 2V5QC 2IO3C 5A6CA 1O1TA 2Y4TA 3CR3A 4GPMA 4HFGA 3FH8A 3F6QA 3SD5A 4CT0A 3CHRA 4BTAA 4PH4B 4IN3B 3EHNA 3CVWA 3ASDA 1Q2ZA 4UQXA 3CKCA 1IQRA 4HI9A 2I1KA 3O48A 3CGHA 4I1OB 2EIKE 2AW6A 5G55A 3GZSA 4NRHB 4GU5A 2F8YA 4XKBA 1MX6A 2J09A 1H6PA 1NA3A 3AS5A 2V5FA 4CRWA 1FT2A 5KJKA 3UX4A 5EYPF 3UM0A 5LCWC 3UPVA 3S2AA 3FUIA 4YNDA 1HZ4A 2RFAA 4Q96A 2XGOA 3L08A 3TWTA 4J8SA 3G2UA 3JXIA 3ABKE 4LNUD 4DUIA 2R17C 2YNQA 2Y0BG 2FBNA 4L2LA 3U3WA 2FULA 3CVVA 3ASGA 3PZ2A 3LPZA 4MBGA 2QY7A 3J5PA 5FZRA 3VTYA 3MA5A 2XGMA 3DSVA 2GRNB 4U04A 3G2WA 3CHQA 2M63A 4M7CA 3R9MA 4DPRA 3RAUA 3QB2A 3T5XA 4RG9A 4TV3A 3Q15A 1HO8A 3PNTB 5FQ8A 2QFCA 3PZ1A 3MZLB 1UOHA 2PQNA 1S70B 2CFZA 1XGWA 3FUDA 2MRIA 4F6RD 3P1UA 3U9WA 3CHPA 1JCQA 3ZNGA 4HXIA 3CSFA 2WXHA 2X38A 4K5AB 5EX0A 4LG6A 5EX3A 1OXJA 3ULYA 2EINE 3U4TA 4QFVA 3CHOA 4WWNA 4HOQA 4O1OA 3FU3A 1UN8A 4YDOA 4JC8A 3CEQA 3FTSA 2XQ0A 2OOEA 3T8KA 5CCLA 3TWRA 4X8QA 4H7XA 2LAHA 5AN8A 2LUHA 1N0RA 3JXJA 4KMOA 2KCVA 1DVPA 1NZNA 4C9BB 2R5SA 4XE0A 1LF8A 4HB5A 4W9RA 2IQCA 3URZA 4M3OA 1W3BA 5LOZA 4HOSA 2ZIRA 2XCBA 5JHBA 1EF1C 2CHZA 2R02A 3CSTA 2J8SD 1ZU2A 4ZHBA 4AIFA 3LYAA 5CECB 3RJVA 1E8WA 3UXGA 3HHMA 4RLYA 1FCHA 4AVXA 3D9LA 1N4RA 3S7BA 3RRUA 1SW6A 4I6EA 1H2UA 2WXIA 5BNWA 4EHMA 2GW1A 3CK7A 4G2VA 5BUZA 4UWLA 1FVFA 4ANWA 2BUGA 3B7RL 5CRVA 3SBSA 3KAEA 5FQ7A 5CEDB 5AAOA 3ZW3A 1PY1A 5FJYA 1JWGA 1KLXA 2RKKA 3RU0A 3AG3E 3UQ3A 2R2LA 3DSUA 5BXOA 2AJAA 2J9QA 5G04J 4DX5D 3UM2A 3C3RA 1BD8A 3IBEA 3RKVA 4GMJA 5HRYA 2WQHA 1HH8A 3UKRG 4DX1A 2PZIA 1N52A 4A1SA 5ENTD 2F8XK 3VLEA 2DYRE 3QAQA 3HDXA 2WXRA 4CEMA 5LP0A 3WG7E 5HQ8A 3CQCB 5KJLA 4Y6WA 3ZXPA 2Y69E 5CRUA 2LAIA 3T5VA 1H19A 2A5UA 3FH7A 3DRAA 1KZOA 3LY7A 2AWIA 5A23A 2WXOA 2J4BA 2PNNA 3TJPA 3LXUX 4GTTA 3C3OA 3FU6A 2HE0A 1OWMA 5FZQA 3NF1A 4JHKA 2WB2A 1BI7B 4GYWA 1NP7A 4LRZA 4HS2A 2VYIA 1TEZA 3FULA 4TUMA 1L5JA 3D9OA 3DXKG 5AQAA 1JUQA 1WAO1 4J8FA 5T4YA 3FY4A 2VGEA 1JPLA 3EHMA 4WAFA 5JMND 5JJTA 1HE8A 3PNLB 4GTSA 3TXMA 3CVUA 3HXCA 3QKYA 4GMLA 3Q49B 3IEGA 2HR2A 4MKTA 3E32A 3LY9A 3B7TA 3E33A 4ILHB 3ABME 1A5EA 3VLDA 3UT4A 3ZGQA 3RO2A 3CHSA 3ASNE 3FEYA 4GTMA 4UUCA 3CVXA 4I6JA 4I1MA 5BW8C 3EDTB 4G11A 2IFUA 4JEHA 5JA4D 4N39A 5KCMA 3ENEA 1NFIE 4PS3A 1TYQG 3NZUA 2MHKA 1SZ9A 3CQGB 4BERA 2RFMA 2VQ2A 4DK5A 4IRUA 3U64A 2CFUA 3SZ7A 4J0UA 3TWXA 3APDA 1S63A 3ZN3A 4I2ZA 3R7RA 5AJDA 4U63A 1HX8A 2P9UG 1Z3XA 2PM6A 3OTNA 2P9IG 3UUXA 1OCCE 2A4ZA 1EPUA 4RVBA 4U8YD 3Q7FA 3GW4A 2VSOE 3KSLA 5ENQD 2PM7A 2WM9A 2NC9A 1D9SA 3LCAA 3QDNA 3PUKA 1SA4A 2WXJA 3IHVA 4N2QA 4PS8A 5ARGA 3NB2A 1LD7A 1ELKA 3VTXA 1Z6TA 3EIQC 2I6HA 1ZB1A 3LKUA 4WNDA 3EHQA 3L22A 2R03A 4O1PA 1MX2A 4BX9A 5BXUA 3V2OA 3FFLA 5B1BE 3LVQE 1IHBA 1U3DA 4TUUA 5D0OD 4AY6A 2IJGX 3MYVA 2BEDA 2OEWA 1QNFA 3CV0A 3SFZA 3FUMA 3DEPA 2CG2A 3ASHA 3NOCD 3ZHEA 4DLOA 3NQPA 1Z3YA 1A17A 3IV0A 3SGHA 3GZ2A 5A7DB 4F53A 3D9KA 2VTBB 2X6IA 3IKOB 4AJWA 3TWWA 3EU9A 3UT8A 4A63B 1OY3D 1UW4B 1BPOA 3MKQB 3UIPC 3ULEG 2ILRA 1E90A 3AG1E 4AOFA 3FTYA 1HU3A 2AXVA 3R7QA 1TNUA 4G23A 4N3AA 2VGXB 4PDXA 1HXIA 4O6FA 3APCA 4URKA 3FUEA 2WMOA 3KEZA 2QYJA 2P2CP 3PVLA 4KYOB 3CVYA 4KBQA 2DWZA 4A55A 3HVEA 2XPYA 4V3IA 4BTBA 3FUFA 4ATZD 4Y6CA 2I9CA 2KM4A 3SI5A 2KBXA 2E0IA 4J7WA 4OVUA 3JQ0A 1OWOA 2P58C 2KCLA 5H7PA 2F37A 4N3BA 4ATGA 1V54E 2P9SG 5KWDA 1N54A 2RG8A 1OT8A 3PUJA 4JL0A 2IONA 3BUAA 3DBSA 1K3ZD 4GAAA 4ME2A 4U0ZA 2EIME 2L6JA 3ISMC 3SO8A 3MJWA 3SFYA 2X6HA 3AAAC 4TRQA 3ZUVB 3TWSA 3L9TA 5EIBE 4NACA 1QZ2A 5FINA 1FPPA 4RG6A 1HS6A 1S64A 5HI7A 3AS4A 4DX2A 4ANUA 2XZTG 5M72A 4B0ZA 2OEVA 2DVWA 3Q4AB 1OCRE 5CHEE 2L0IA 3G2TA 4GZ5A 3TL5A 4WUYA 5FIOA 5FT9A 3J5QB 1MX4A 1YYHA 2GRQB 2FO7A 4ACKA 3ZYKA 5AYWD 5D2MC 4EZJA 2P9PG 2WPVA 3D9JA 5FZSA 4DI4A 3C72A 2XENA 3MEKA 1UJKA 2UY1A 2Y1LE 3PEVB 1K1BA 4OAVB 2P9KG 2EQXA 4N2SA 1LD8A 2WQ7A 1MZCA 3V30A 3SBTB 4C0MA 4EECA 1TNOA 3FHEA 4YDEA 2EIJE 3DSTA 3OXFA 4CGWA 4B8CB 2AVPA 4L7TA 4APFA 4G24A 1GW6A 4U95D 3S7FA 4CYMD 2WMNA 1G3NB 3MKRA 1KPSB 2X3MA 2P9LG 5CERB 2PQRA 3JYSA 1K1AA 5ENSD 3LS8A 1D8DA 4BT9A 5AIJA 3PZ4A 2KATA 2KCKA 5E75A 4OYSA 4APOA 5FQ6A 3HRAA 4N5QA 4JD2G 3N71A 3UKUG 2R59A 4MS6A 4F7AA 4XEIG 3QJZA 3CLJA 4TXQA 3OAWA 5KNGA 3Q75A 4OVVA 4ZFHA 2X6KA 1U2VG 4UQYA 3HXDA 4FULA 2BKGA 1JCRA 4U7EB 3MV2B 3RIBA 5ENOD 1H2TC 3L54A 3ZXSA 3L6AA 5C1DA 2OVFA 4XI0A 3MCXA 3PDNA 4ILIA 3UTMA 2IOLA 1MJ0A 5ENRD 5B1AE 4WWPA 3CVQA 4CZ2D 3EIJA 3SHFA 5EN5D 5AARA 3ML8A 2F0YA 4ACLA 4B89A 3DEOA 2QZAA 1Z5SC 4QQIA 5KJMA 3CVPA 4B93B 3KS2A 3QC1A 1TN7A 5C2YA 4B8AA 3TG5A 5J90A 5EYLA 3D9HA 2LO6A 2IO2C 3ZKJA 3NAWA 2KXPC 5DIZA 4XZ4A 1HG5A 1N4QA 2VSYA 4IULA 3HVEB 4DX7D 4G26A 1O5MA 3ABLE 2VTBA 4CDRA 4FC8A 3CVLA 4FJZA 4FJYA 3HXFA 3FUJA 1QQEA 1X81A 4AM9A 1TNYA 3CKBA 2QYUA 2Y3AA 4K5BA 1UN9A 4WNEA 2YHEA 3ESKA 4AEZC 1AWCB 3SNXA 5HS0A 3FU0A 2LSUA 4CDMA 2WXQA 4GYYA 4FP7A 2X6JA 3KSQA 4GCOA 3I4GA 3E30A 3CK9A 4KVMA 4LNBA 4WNFA 5ENNA 2YHCA 3O4ZA 2WXMA 4EZLA 3QARA 4K5CA 2YQ8A 2DYSE 3FTVA 2XPIA 3FTWA 3CVNA 3JUEA 5KNHD 3MKQA 3TWUA 4FHJA 1OWNA 3DSWA 3QWPA 4HRNA 4TXRA 4HQDA 3PRZA 1UJJA 4PUCA 4N3CA 2L6BA 3SF4A 2J08A 1FVHA 2MOWA 4XIFA 4ABNA 1H6KA 3SQVA 3L16A 4LCTA 2LNIA 2QC9A 5ITZF 1BI8B 4KXKB 4JW1A 3I3NA 1U3CA 2IY0C 3FWVA 4O60A 2JLBA 4BESA 3PREA 2ONDA 3FEXA 2VJ8A 3QNKA 5D66A 4I9CA 4UQZA 2WQ6A 2JEKA 4UWFA 1TNBA 2AXZA 3L82A 4HLEA 2OCCE 4A1GA 4JB8P 3IHYA 3UM1A 3BU8A 3ZRHA 3BG0B 4U0SA 1E7VA 4U96D 4FU3A 1TJCA 3NBNB 3PE3A 5HKPA 2LXLA 2IOSA 4A3VA 3R9AB 1VDYA 1TJFA 4NQ0A 2Y4UA 3PZ3A 3B13A 3LEWA 1NI1A 2XEEA 4GTPA 4I1AA 3EU5A 4J8YA 4LNGA 2C0MA 3APFA 2XEHA 4JZYA 5LCWJ 4BFRA 2HO1A 1DC2A 4HOTA 2XGSA 3L13A 4CCAA 3P2BA 1MYOA 3TXNA 5ARFA 2B0OE 4F1SA 5G04C 4E6HA 4D10C 4R7LA 1N4SA 4GB9A 5G05C 4Q94A 5JJ6A 4GA2A 1AP7A 5D0QD 3ZPJA 2HM8A 2VSNA 4JHRA 2C2LA 1EDUA 4GTOA 4HRLA 3EHRA 1FT1A 3DSSA 2JABA 1RW2A 2MYOA 4PS7A 4BT8A 3BQOA 3FTXA 1E8XA 2XS1A 3PH0C 2LXMA 4JEUA 3D9IA 3DXMG 3AG4E 2WXPA
chains in the Genus database with same CATH topology
3D9JA 4HORA 1EYHA 2WXNA 5FZSA 4DI4A 1JWGA 1KLXA 4I9EA 3RU0A 2J49A 3MEKA 1UG3A 1UJKA 2UY1A 3Q5MA 3UQ3A 3FU5A 3PS6A 3CK8A 2FF4A 2J9QA 1MQSA 3PEVB 3JUIA 4GZDA 2CHWA 5G04J 3ZIMA 4U0UA 2EQXA 4N2SA 2CHXA 5AJLA 3IBEA 2WQ7A 3RKVA 3U66A 1PC2A 2XPZA 3D9NA 4GMJA 3SBTB 4C0MA 3I4RB 4EECA 3FHEA 2WQHA 3TGOA 1HH8A 3D9PA 4JVSA 2PZIA 1N52A 3OXFA 4A1SA 4CGWA 3VLEA 4B8CB 2AVPA 3EJNA 4L7TA 4APFA 4G24A 4U07A 1GW6A 3QAQA 3C98A 3HDXA 5DBKA 2WXRA 2V4LA 3S7FA 4CEMA 4KZ0A 1ZBPA 4JA9A 5LP0A 2WXKA 2WMNA 5HQ8A 3CQCB 4Q69A 5KJLA 1KT0A 4UWHA 4Y6WA 3MKRA 4FHKA 3MV3B 2X3MA 4NURA 1E8YA 4AV7A 4WWOA 2HYZA 2AXUA 2LAIA 2LSVA 3K9IA 3T5VA 1H19A 2A5UA 3FH7A 2I2OA 5KJNA 2VSXE 2PQRA 2WVIA 3G2SA 3ONLA 3LY7A 2AWIA 5A23A 5CCMA 2WXOA 2XCCA 2J4BA 3JYSA 4UWKA 4KT6B 3AU5A 3LS8A 3TJPA 5BV0A 3LXUX 4UI9J 5CMWA 1OUVA 4BT9A 3S7DA 5AIJA 5G2NA 2KATA 3FU6A 2KCKA 3FTZA 1OWMA 5E75A 5FZQA 4OYSA 2XHEA 1IQUA 4L1BA 4B94A 4A3TA 3NF1A 4JHKA 4APOA 5FQ6A 3FUKA 4L23A 2WB2A 4GYWA 2KZTB 4YVOA 4CT4A 1SZAA 2FI7A 1NP7A 4LRZA 3FTUA 3N71A 4FA6A 1H0AA 4HS2A 2R59A 2VYIA 1TEZA 4MS6A 4F7AA 3QOUA 4GZ6A 3FULA 4ANVA 2V0PA 3VLFA 4FADA 3QJZA 4H7YA 4YVQC 4GYOA 1JWFA 3CLJA 4J8DA 2L0TB 4U8HA 1L5JA 3D9OA 1P5QA 2BTDA 4KVOA 4CGVA 3OAWA 4GZCA 1JUQA 1WAO1 4J8FA 4OVVA 1PAQA 5T4YA 3FY4A 3UMVA 4AY5A 4F3VA 3NZSA 5LX8A 1JPLA 2X6KA 3EHMA 4WAFA 4UQYA 1H2VC 4EZKA 4FULA 2J07A 3G2VA 5JJTA 4ANXA 1HE8A 3AU4A 3PNLB 2VGYA 3TXMA 4GA0A 3CVUA 3LY8A 4C0EA 4EBAG 3MV2B 2NSZA 3QKYA 4GMLA 3RIBA 4AXHA 3I5PA 3Q49B 4N5CA 3ONKA 4HVBA 3IEGA 2UWJG 2RD0A 2HR2A 4LEUA 1H2TC 3B7UX 2I1JA 3Q47B 2WXGA 4I6GA 4MKTA 4MRUA 3L54A 3ZXSA 5BPPA 2UY1B 3L6AA 5E76A 3WXXA 4GCNA 5C1DA 2DIWA 2KC7A 3LY9A 3B7TA 2CG3A 2VGXA 2OVFA 4XI0A 4DI3A 2WXLA 3MCXA 3PDNA 2J4DA 4ILIA 2IOLA 4ILHB 5JHAA 2FEZA 3MX3A 4UI9K 4IYPA 4WWPA 1X5BA 3VLDA 3CVQA 5BV1A 3UT4A 3FDHA 3ZGQA 3RO2A 3EIJA 3ZEFA 3LJ3A 4J8EA 4WNGA 3CHSA 3SHFA 3GYZA 3FEYA 3PZDA 1DNPA 3ML8A 3CVXA 4I6JA 4ACLA 4KZCA 4B89A 3T8MA 1Y6IA 5JJ7A 4P29A 4I1MA 5BW8C 3EDTB 4LERA 5T3RA 4AP2A 4G11A 5KJMA 3CVPA 5AENA 3KS2A 3QC1A 2IFUA 1E96B 4JEHA 5C2YA 4B8AA 4N39A 3TG5A 5J90A 2L9BA 3FH5A 5KCMA 2LO6A 3ENEA 4FLHA 4PS3A 2IU1A 3OXGA 1Y8MA 3ZVVA 3ZHEB 3NZUA 3OXLA 2MHKA 1SZ9A 3CQGB 5DIZA 2OVBA 2V8SE 2VQ2A 4ILGA 4J6IA 4XKCA 4XZ4A 1HG5A 4FLBA 3ZYLA 5LFAA 4DK5A 4IRUA 2IF4A 2CFUA 2GRLA 3U64A 2VSYA 4IULA 3HVEB 5A6CA 3SZ7A 3QK0A 4G26A 3UT7A 4J0UA 2Y4TA 3CR3A 2BF0X 3PEUB 2VTBA 4CDRA 1E7UA 3APDA 4HFGA 4FC8A 3FH8A 3ML9A 3FP3A 5EKQD 3SD5A 3CHRA 4BTAA 4CT0A 3GZ1A 3CVLA 4FJZA 4FJYA 3EHNA 4IN3B 4PH4B 3ZN3A 3ASDA 3CVWA 1S0PA 3FUJA 1QQEA 1MHQA 3BG1B 4I2ZA 5ANLA 3R7RA 4UQXA 5AJDA 4AM9A 4U63A 1HX8A 3CKCA 3CKBA 1Z3XA 2Y3AA 1IQRA 3ZYMA 2PM6A 1UN9A 3OTNA 2I1KA 3O48A 3CGHA 3ESLA 4I1OB 3UUXA 2A4ZA 1EPUA 4RVBA 2YHEA 3ESKA 2AW6A 4WNEA 5FQ4A 5T8IA 5G55A 3GZSA 4AEZC 2GRMA 4UWGA 3GW4A 4NRHB 4GU5A 2VSOE 4EPZA 2PM7A 2WM9A 3JQ1A 2NC9A 3SNXA 4XKBA 3LCAA 3QDNA 3FU0A 2LSUA 4CDMA 3PUKA 2WXQA 2J09A 4FP7A 4GYYA 2X6JA 4HOUA 1NA3A 2WXJA 4BY6A 3AS5A 4GCOA 3KD7A 2V5FA 3IHVA 4CRWA 3I4GA 1OWLA 3CK9A 4KVMA 4BSXA 5KJKA 4WNFA 1YA0A 3UX4A 3LDZA 5ENNA 4N2QA 4PS8A 2YHCA 3O4ZA 3ULQA 5LCWC 3UPVA 2WXMA 3S2AA 4EZLA 3FUIA 1HF8A 3QARA 1HZ4A 4XX5A 4YNDA 2YQ8A 5ARGA 5EDSA 4Q96A 1ELKA 2XRZA 3VTXA 1OWPA 2XEVA 2XGOA 3L08A 2E2EA 3JCKC 3FTVA 3CIAA 3TAXA 1Z6TA 2ZU6B 2XPIA 3EIQC 2I6HA 2PL2A 3CVNA 3FTWA 3LKUA 4J8SA 4RSYA 4WNDA 3G2UA 3L22A 3MKQA 4FHJA 3QWVA 4EBAA 1OWNA 4BX9A 5J08A 4I43A 3CHMA 2R17C 3HIZA 3QWPA 3FUNA 2YNQA 3FFLA 2FBNA 1WY6A 4XI9A 2OV8A 1IYGA 3LVQE 4L2LA 4JA7A 1U3DA 4TUUA 1WM5A 3PRZA 3U3WA 3DPDA 5D0OD 2KZTA 4AY6A 1UJJA 2IJGX 2FULA 4PUCA 3CVVA 3ASGA 3MYVA 4N3CA 1E8ZA 1QNFA 3CV0A 3E4BA 3LPZA 3SF4A 2QY7A 3SFZA 2J08A 3FUMA 4K03A 1FVHA 3AS8A 2MOWA 2X6FA 3L17A 4XIFA 4ABNA 3RRNB 5FZRA 1H6KA 2CG2A 5FTPA 3VTYA 3ASHA 3L16A 3MA5A 2XGMA 3ZHEA 4LCTA 4DLOA 3NQPA 2LNIA 1Z3YA 4U04A 3G2WA 1A17A 4GZ3A 2DBAA 3IV0A 3ZFWA 3CHQA 2YINA 4KXKB 3SGHA 2M63A 3GZ2A 3I3NA 4JW1A 5A7DB 3D9KA 4F53A 1U3CA 3T5XA 3QB2A 2X6IA 3IKOB 4DPRA 2VTBB 4AJWA 3FWVA 1INZA 4RG9A 4TV3A 3Q15A 4CDNA 1HO8A 3PNTB 3UT8A 1B89A 2JLBA 2QFCA 5FQ8A 1UW4B 1BPOA 3MKQB 2ILRA 4JPSA 3MZLB 1E90A 2PQNA 2WXFA 3PREA 1HG2A 2ONDA 3FEXA 2CFZA 2DCPA 2VJ8A 4AOFA 3QNKA 5FWQA 1XGWA 3FUDA 4GPKA 4BX8A 2MRIA 3FTYA 4UI9C 1HU3A 2AXVA 3P1UA 4I9CA 3R7QA 3U9WA 3CHPA 4G23A 4UQZA 2WQ6A 4N3AA 4HXIA 2JEKA 4UWFA 3RRMB 3ASFA 2VGXB 4PDXA 3CSFA 2AXZA 2WXHA 2X38A 1HXIA 4O6FA 5EX0A 3APCA 4URKA 4G25A 5EX3A 3B7SA 3FUEA 4JHJA 3U4TA 4BWRA 4QFVA 3CHOA 4WWNA 4HLEA 2WMOA 4DJAA 4HOQA 3MGBA 3KEZA 4A1GA 3PVLA 3FU3A 5ANRA 3IHYA 3BG0B 4U0SA 1E7VA 1UN8A 4JC8A 4KYOB 3ZRHA 3CEQA 3FTSA 4KBQA 3CVYA 2XQ0A 2OOEA 4FU3A 4A55A 4EQFA 1TJCA 3HVEA 5CCLA 2XRYA 4JXTA 5G05J 3PE3A 4A3VA 2IOSA 2XPYA 2C0LA 3R9AB 4V3IA 4BTBA 1VDYA 2GGFA 3FUFA 1TJFA 4NQ0A 1ELWA 4H7XA 4Y6CA 2Y4UA 2LAHA 2I9CA 3LVRE 2KM4A 3B13A 2KCVA 2E0IA 2NXPA 3LEWA 4KMOA 3JQ0A 4OVUA 1OWOA 3SI5A 5BT1A 2P58C 1DVPA 2KCLA 4I1AA 4N3BA 4ATGA 1NZNA 4G1TA 3TG4A 4C9BB 1N54A 2RG8A 2R5SA 2C0MA 3PUJA 3APFA 4JL0A 3ZYQA 2IONA 3DBSA 4L2YA 1KT1A 4GAAA 4ME2A 4XE0A 4U0ZA 1LF8A 4W9RA 2IQCA 3PE4A 2L6JA 4JZYA 5LCWJ 4BFRA 3URZA 3MJWA 1W3BA 4M3OA 5LOZA 4HOSA 2X6HA 2XCBA 3D9MA 4TRQA 5JHBA 4K0RA 2HO1A 5CMYA 4HOTA 2XGSA 3L13A 1NA0A 1EF1C 4CCAA 4NACA 1QZ2A 2CHZA 3CSTA 3P2BA 1ZU2A 3FUHA 3HYMB 3TXNA 5ARFA 4RG6A 1HS6A 5G04C 4F1SA 4AIFA 3LYAA 3RJVA 4D10C 4R7LA 4E6HA 5HI7A 1E8WA 4GB9A 5G05C 3AS4A 4Q94A 4ANUA 5M72A 5JJ6A 4B0ZA 4GA2A 3HHMA 1HFAA 1FCHA 4AVXA 3D9LA 2Q7FA 4I2WA 5D0QD 4E85A 3ZPJA 2HM8A 3Q4AB 1XNFA 2VSNA 5CHEE 4JHRA 2L0IA 3RRUA 3S7BA 4I17A 4I6EA 1H2UA 3G2TA 3D3MA 4GZ5A 2WXIA 5BNWA 2C2LA 3TL5A 4WUYA 4GA1A 1EDUA 5FT9A 2GW1A 3CK7A 4G2VA 1ELRA 5BUZA 4PS7A 4BT8A 3BEEA 4UWLA 2FO7A 3FTXA 1E8XA 3PH0C 4ACKA 3ZYKA 5AYWD 1FVFA 4DLQA 3RO3A 4ANWA 2BUGA 1IHGA 3B7RL 3QWWA 4JEUA 3D9IA 3KAEA 3SBSA 5FQ7A 3S7JA 4EZJA 2WPVA 2WXPA 3ZW3A 4MLPA 4LUNU 1SQMA 1PY1A 5FJYA 3RK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KD7 A;  4HOR A;  2V5F A;  4HOQ A;  5FZS A;  3Q49 B;  4N5C A;  3TGO A;  1KLX A;  3IEG A;  2UWJ G;  3CK9 A;  4I9E A;  3RU0 A;  2HR2 A;  4LEU A;  3MEK A;  3Q5M A;  4WNF A;  1YA0 A;  2UY1 A;  4U0S A;  3UQ3 A;  3Q47 B;  4KYO B;  3CK8 A;  2FF4 A;  3CEQ A;  2J9Q A;  4KBQ A;  4N2Q A;  5G04 J;  2UY1 B;  2YHC A;  3ULQ A;  2OOE A;  5LCW C;  3UPV A;  4EQF A;  3WXX A;  1TJC A;  4YND A;  4GCN A;  1HZ4 A;  4U0U A;  2KC7 A;  2YQ8 A;  3LY9 A;  3PE3 A;  5ARG A;  5G05 J;  5C1D A;  2VGX A;  4N2S A;  2C0L A;  4XI0 A;  3R9A B;  3PDN A;  3RKV A;  2XEV A;  2XGO A;  3VTX A;  1PC2 A;  4BTB A;  2E2E A;  3TAX A;  4NQ0 A;  2WQH A;  2XPI A;  1ELW A;  2FEZ A;  4UI9 K;  2I6H A;  1HH8 A;  2PL2 A;  3CVN A;  2Y4U A;  3LKU A;  4H7X A;  4Y6C A;  2PZI A;  3CVQ A;  3OXF A;  4WND A;  3ZGQ A;  4A1S A;  3RO2 A;  4CGW A;  3QWV A;  4J8E A;  4WNG A;  2AVP A;  2KCV A;  3GYZ A;  4G24 A;  4U07 A;  3QWP A;  5BT1 A;  2P58 C;  2KCL A;  2FBN A;  3FFL A;  4I1A A;  5DBK A;  4N3B A;  3S7F A;  1ZBP A;  4XI9 A;  4JA9 A;  1NZN A;  4G1T A;  3TG4 A;  5JJ7 A;  1IYG A;  2R5S A;  3ZN3 A;  2C0M A;  4JA7 A;  3EDT B;  5BW8 C;  5HQ8 A;  1WM5 A;  4JL0 A;  5KJL A;  1KT0 A;  3CVP A;  4Y6W A;  5KJM A;  5D0O D;  1KT1 A;  3U3W A;  3MKR A;  3KS2 A;  3MV3 B;  4ME2 A;  4GCO A;  4U0Z A;  4AY6 A;  2IFU A;  1E96 B;  4W9R A;  3ASG A;  4N39 A;  3TG5 A;  4N3C A;  3PE4 A;  2HYZ A;  2L6J A;  3CV0 A;  3E4B A;  3LPZ A;  2LSV A;  3K9I A;  3SF4 A;  5LCW J;  3URZ A;  1W3B A;  4HOS A;  5KJN A;  2PQR A;  2XCB A;  3AS8 A;  3OXG A;  1Y8M A;  4XIF A;  2HO1 A;  3LY7 A;  4ABN A;  5FZR A;  5CCM A;  3ZHE B;  2XCC A;  3JYS A;  4HOT A;  2XGS A;  5FTP A;  3VTY A;  1NA0 A;  3ASH A;  3OXL A;  3MA5 A;  2XGM A;  2MHK A;  3ZHE A;  1QZ2 A;  5DIZ A;  4UI9 J;  2LNI A;  1OUV A;  1ZU2 A;  2VQ2 A;  4U04 A;  3S7D A;  4BT9 A;  2KAT A;  1A17 A;  2KCK A;  4GZ3 A;  3HYM B;  4B94 A;  5FZQ A;  2DBA A;  5ARF A;  4RG6 A;  5G04 C;  3ZFW A;  4AIF A;  3LYA A;  4KXK B;  2IF4 A;  3NF1 A;  3RJV A;  4APO A;  3GZ2 A;  5HI7 A;  2VSY A;  5A7D B;  4GYW A;  5G05 C;  3AS4 A;  3SZ7 A;  4G26 A;  4YVO A;  5A6C A;  4J0U A;  5JJ6 A;  5M72 A;  2Y4T A;  2FI7 A;  4GA2 A;  4CDR A;  3N71 A;  5EKQ D;  1FCH A;  3FWV A;  4BTA A;  2Q7F A;  3FP3 A;  4I2W A;  4RG9 A;  5D0Q D;  3Q15 A;  3ZPJ A;  3GZ1 A;  3CVL A;  3Q4A B;  2VYI A;  1B89 A;  1XNF A;  2JLB A;  2QFC A;  2VSN A;  3ASD A;  3QKY A;  4IN3 B;  3QOU A;  1QQE A;  4JHR A;  5CHE E;  4I17 A;  4GZ6 A;  3S7B A;  4I2Z A;  5CCL A;  2PQN A;  4AM9 A;  4GZ5 A;  4UQX A;  2OND A;  5BNW A;  4H7Y A;  2C2L A;  4WUY A;  3CKC A;  3CKB A;  4GA1 A;  4GYO A;  4YVQ C;  2GW1 A;  4J8D A;  5FT9 A;  3CK7 A;  4GPK A;  4G2V A;  1ELR A;  1P5Q A;  3O48 A;  4UI9 C;  4CGV A;  4I9C A;  3UUX A;  1WAO 1;  4WNE A;  3ESK A;  4BT8 A;  4J8F A;  3RIB A;  3BEE A;  4G23 A;  2FO7 A;  4UQZ A;  4AY5 A;  4F3V A;  5KJK A;  5AYW D;  3GW4 A;  4NRH B;  4N3A A;  3RO3 A;  2BUG A;  1IHG A;  2NC9 A;  3ASF A;  3QWW A;  2VGX B;  3KAE A;  4UQY A;  3LCA A;  1HXI A;  4O6F A;  3QDN A;  5EX0 A;  3S7J A;  5JJT A;  2LSU A;  4G25 A;  5EX3 A;  2WPV A;  4GYY A;  2VGY A;  4HOU A;  4GA0 A;  3U4T A;  1NA3 A;  3LY8 A;  4BWR A;  5FJY A;  3MV2 B;  3AS5 A; 
#chains in the Genus database with same CATH topology
 4HOR A;  1EYH A;  4HI8 A;  4I9E A;  3DSX A;  3Q5M A;  3FU5 A;  3PS6 A;  2FF4 A;  4BSZ B;  4GZD A;  2CHW A;  3ZIM A;  4U0U A;  2XZD G;  2CHX A;  5AJL A;  2R05 A;  3U66 A;  1PC2 A;  4JVS A;  1N9A A;  4U07 A;  3ASO E;  3C98 A;  5DBK A;  1NL4 A;  2WXK A;  4Q69 A;  1KT0 A;  4UWH A;  1TNZ A;  1O1R A;  4NUR A;  1E8Y A;  2LSV A;  3C3Q A;  1N4P A;  2I2O A;  5KJN A;  2VSX E;  5CCM A;  5CMW A;  4UI9 J;  3S7D A;  5CEA A;  5G2N A;  3FTZ A;  4B94 A;  4L1B A;  2IEJ A;  4BET A;  3FUK A;  4L23 A;  1SZA A;  3QOU A;  4ANV A;  3VLF A;  4FAD A;  4H7Y A;  4YVQ C;  1JWF A;  3W9F A;  2L0T B;  3AG2 E;  1P5Q A;  2BTD A;  4F3V A;  1H2V C;  1OCZ E;  2J07 A;  2NYJ A;  3HG0 D;  3LY8 A;  4DRX E;  4AXH A;  3I5P A;  4C48 B;  3ONK A;  4HVB A;  2UWJ G;  2RD0 A;  2I1J A;  3Q47 B;  2H6F A;  2WXG A;  4I6G A;  3V79 K;  4MRU A;  2H6G A;  5E76 A;  4GCN A;  2DIW A;  3Q78 A;  2CG3 A;  2VGX A;  3Q73 A;  4DI3 A;  2J4D A;  3C5R A;  3MX3 A;  4UI9 K;  3UM3 A;  5BV1 A;  3FDH A;  4WNG A;  1DNP A;  4KZC A;  3T8M A;  4G8K A;  2GRP B;  4P29 A;  4F1P A;  4LER A;  5IY5 E;  3AJI A;  2ETC A;  1E96 B;  3FH5 A;  2IU1 A;  1Y8M A;  3ZVV A;  3ZHE B;  2H6H A;  3OXL A;  4G8L A;  2OVB A;  1SVX A;  4FLB A;  3Q79 A;  3ZYL A;  5LFA A;  2IF4 A;  2GRL A;  3UT7 A;  3QK0 A;  3PEU B;  2BF0 X;  1E7U A;  5EKQ D;  3ML9 A;  3FP3 A;  3GZ1 A;  1S0P A;  1MHQ A;  3BG1 B;  5ENP D;  4Z68 A;  2P9N G;  5ANL A;  2V4H C;  3ZYM A;  1KZP A;  3ESL A;  3HXE A;  5FQ4 A;  5T8I A;  2GRR B;  2GRM A;  4UWG A;  4EPZ A;  5KBA A;  3JQ1 A;  4HOU A;  5AQ9 A;  5EIL A;  2XS8 A;  4BY6 A;  3KD7 A;  1IXV A;  1H6O A;  1OWL A;  2FO1 E;  4BSX A;  1YA0 A;  3LDZ A;  2H6I A;  4BEP A;  3ULQ A;  1N11 A;  4XX5 A;  1HF8 A;  5EDS A;  2XRZ A;  1OWP A;  2XEV A;  2ETB A;  2E2E A;  3JCK C;  3CIA A;  3TAX A;  2ZU6 B;  2PL2 A;  3B7B A;  4RSY A;  3QWV A;  4EBA A;  5AQB A;  5J08 A;  4I43 A;  3CHM A;  3HIZ A;  2ZGG A;  5AQ7 A;  3FUN A;  1WY6 A;  1O1S A;  4XI9 A;  2OV8 A;  1IYG A;  4JA7 A;  1WM5 A;  3DPD A;  2KZT A;  1E8Z A;  3E4B A;  3X2Q E;  4K03 A;  3AS8 A;  2X6F A;  3L17 A;  3RRN B;  3Q9N C;  5FTP A;  4GZ3 A;  2DBA A;  4GTQ A;  3ZFW A;  2YIN A;  2A5E A;  3HXB A;  1INZ A;  4CDN A;  1B89 A;  4TXP A;  2ZXW E;  4JPS A;  2WXF A;  1HG2 A;  3TWQ A;  2DCP A;  5FWQ A;  1K8K G;  3B95 A;  4GPK A;  4BX8 A;  4UI9 C;  1N95 A;  3V2X A;  3RRM B;  3ASF A;  3DWL G;  4G25 A;  3TWV A;  3B7S A;  4JHJ A;  4BWR A;  1OCO E;  4DJA A;  3MGB A;  5ANR A;  4EQF A;  2XRY A;  4JXT A;  1JCS A;  5G05 J;  2C0L A;  2GGF A;  3E37 A;  1V55 E;  1ELW A;  3UIN C;  3LVR E;  4L9P A;  2NXP A;  5BT1 A;  5CBO A;  3TG4 A;  4G1T A;  1BU9 A;  3ZYQ A;  1TN6 A;  4L2Y A;  1KT1 A;  4HNA D;  4GMR A;  3PE4 A;  1YMP A;  3RSE G;  1WG0 A;  3D9M A;  4K0R A;  5CMY A;  2EIL E;  1NA0 A;  2ZIS A;  5CBN A;  3KEA A;  3FUH A;  4YDY A;  3NOG D;  3HYM B;  3ZU7 B;  2GRO B;  1HFA A;  1DCQ A;  2Q7F A;  4I2W A;  4E85 A;  1XNF A;  4HRM B;  4I17 A;  3D3M A;  4GA1 A;  1ELR A;  4OAU C;  3BEE A;  3SFX A;  4DLQ A;  3RO3 A;  1IHG A;  3LJN A;  3QWW A;  3S7J A;  4MLP A;  3Q9U C;  4LUN U;  1IKN D;  1SQM A;  3RK6 A;  4U8V D;  2WXN A;  2J49 A;  1UG3 A;  1QBQ A;  3CK8 A;  1MQS A;  3JUI A;  1DCE A;  2XPZ A;  3D9N A;  3I4R B;  3TGO A;  3D9P A;  1YCS B;  3EJN A;  2V4L A;  2ZGD A;  4KZ0 A;  1ZBP A;  4JA9 A;  4FHK A;  3MV3 B;  2ETA A;  4AV7 A;  4WWO A;  2HYZ A;  2AXU A;  3K9I A;  2WVI A;  3T9K A;  3G2S A;  3W9G A;  3ONL A;  2XCC A;  4UWK A;  4KT6 B;  3AU5 A;  5BV0 A;  1RZ4 A;  1OUV A;  2XHE A;  1IQU A;  4A3T A;  5EID A;  2KZT B;  4YVO A;  4CT4 A;  2FI7 A;  2DZN A;  4YDW A;  3FTU A;  3E34 A;  4FA6 A;  1H0A A;  4NIK A;  2DZO A;  4RQI A;  4GZ6 A;  2V0P A;  4GYO A;  4U8H A;  4J8D A;  4GTV A;  4KVO A;  4CGV A;  4HBD A;  4GZC A;  2BKK B;  3UMV A;  1PAQ A;  4AY5 A;  2B6C A;  3NZS A;  5LX8 A;  1D8E A;  1LTX A;  4EZK A;  3G2V A;  4ANX A;  3AU4 A;  2VGY A;  4GA0 A;  4C0E A;  4EBA G;  2NSZ A;  3IXE A;  4N5C A;  1WDY A;  4LEU A;  3B7U X;  3EUV A;  3Q7A A;  5BPP A;  2UY1 B;  3WXX A;  2KC7 A;  3SY2 A;  1N0Q A;  3V31 A;  2WXL A;  5JHA A;  2FEZ A;  4GTR A;  4IYP A;  1X5B A;  4HLL A;  3ZEF A;  3UIO C;  3LJ3 A;  4J8E A;  3GYZ A;  1N94 A;  1QYM A;  3PZD A;  1SA5 A;  3DPY A;  1Y6I A;  5JJ7 A;  5T3R A;  4AP2 A;  5AEN A;  4LSZ E;  4DX6 D;  1TR4 A;  2L9B A;  1BLX B;  4FLH A;  3OXG A;  3UI2 A;  5B3S E;  1TN8 A;  2V8S E;  4ILG A;  4J6I A;  4XKC A;  2V5Q C;  2IO3 C;  5A6C A;  1O1T A;  2Y4T A;  3CR3 A;  4GPM A;  4HFG A;  3FH8 A;  3F6Q A;  3SD5 A;  4CT0 A;  3CHR A;  4BTA A;  4PH4 B;  4IN3 B;  3EHN A;  3CVW A;  3ASD A;  1Q2Z A;  4UQX A;  3CKC A;  1IQR A;  4HI9 A;  2I1K A;  3O48 A;  3CGH A;  4I1O B;  2EIK E;  2AW6 A;  5G55 A;  3GZS A;  4NRH B;  4GU5 A;  2F8Y A;  4XKB A;  1MX6 A;  2J09 A;  1H6P A;  1NA3 A;  3AS5 A;  2V5F A;  4CRW A;  1FT2 A;  5KJK A;  3UX4 A;  5EYP F;  3UM0 A;  5LCW C;  3UPV A;  3S2A A;  3FUI A;  4YND A;  1HZ4 A;  2RFA A;  4Q96 A;  2XGO A;  3L08 A;  3TWT A;  4J8S A;  3G2U A;  3JXI A;  3ABK E;  4LNU D;  4DUI A;  2R17 C;  2YNQ A;  2Y0B G;  2FBN A;  4L2L A;  3U3W A;  2FUL A;  3CVV A;  3ASG A;  3PZ2 A;  3LPZ A;  4MBG A;  2QY7 A;  3J5P A;  5FZR A;  3VTY A;  3MA5 A;  2XGM A;  3DSV A;  2GRN B;  4U04 A;  3G2W A;  3CHQ A;  2M63 A;  4M7C A;  3R9M A;  4DPR A;  3RAU A;  3QB2 A;  3T5X A;  4RG9 A;  4TV3 A;  3Q15 A;  1HO8 A;  3PNT B;  5FQ8 A;  2QFC A;  3PZ1 A;  3MZL B;  1UOH A;  2PQN A;  1S70 B;  2CFZ A;  1XGW A;  3FUD A;  2MRI A;  4F6R D;  3P1U A;  3U9W A;  3CHP A;  1JCQ A;  3ZNG A;  4HXI A;  3CSF A;  2WXH A;  2X38 A;  4K5A B;  5EX0 A;  4LG6 A;  5EX3 A;  1OXJ A;  3ULY A;  2EIN E;  3U4T A;  4QFV A;  3CHO A;  4WWN A;  4HOQ A;  4O1O A;  3FU3 A;  1UN8 A;  4YDO A;  4JC8 A;  3CEQ A;  3FTS A;  2XQ0 A;  2OOE A;  3T8K A;  5CCL A;  3TWR A;  4X8Q A;  4H7X A;  2LAH A;  5AN8 A;  2LUH A;  1N0R A;  3JXJ A;  4KMO A;  2KCV A;  1DVP A;  1NZN A;  4C9B B;  2R5S A;  4XE0 A;  1LF8 A;  4HB5 A;  4W9R A;  2IQC A;  3URZ A;  4M3O A;  1W3B A;  5LOZ A;  4HOS A;  2ZIR A;  2XCB A;  5JHB A;  1EF1 C;  2CHZ A;  2R02 A;  3CST A;  2J8S D;  1ZU2 A;  4ZHB A;  4AIF A;  3LYA A;  5CEC B;  3RJV A;  1E8W A;  3UXG A;  3HHM A;  4RLY A;  1FCH A;  4AVX A;  3D9L A;  1N4R A;  3S7B A;  3RRU A;  1SW6 A;  4I6E A;  1H2U A;  2WXI A;  5BNW A;  4EHM A;  2GW1 A;  3CK7 A;  4G2V A;  5BUZ A;  4UWL A;  1FVF A;  4ANW A;  2BUG A;  3B7R L;  5CRV A;  3SBS A;  3KAE A;  5FQ7 A;  5CED B;  5AAO A;  3ZW3 A;  1PY1 A;  5FJY A;  1JWG A;  1KLX A;  2RKK A;  3RU0 A;  3AG3 E;  3UQ3 A;  2R2L A;  3DSU A;  5BXO A;  2AJA A;  2J9Q A;  5G04 J;  4DX5 D;  3UM2 A;  3C3R A;  1BD8 A;  3IBE A;  3RKV A;  4GMJ A;  5HRY A;  2WQH A;  1HH8 A;  3UKR G;  4DX1 A;  2PZI A;  1N52 A;  4A1S A;  5ENT D;  2F8X K;  3VLE A;  2DYR E;  3QAQ A;  3HDX A;  2WXR A;  4CEM A;  5LP0 A;  3WG7 E;  5HQ8 A;  3CQC B;  5KJL A;  4Y6W A;  3ZXP A;  2Y69 E;  5CRU A;  2LAI A;  3T5V A;  1H19 A;  2A5U A;  3FH7 A;  3DRA A;  1KZO A;  3LY7 A;  2AWI A;  5A23 A;  2WXO A;  2J4B A;  2PNN A;  3TJP A;  3LXU X;  4GTT A;  3C3O A;  3FU6 A;  2HE0 A;  1OWM A;  5FZQ A;  3NF1 A;  4JHK A;  2WB2 A;  1BI7 B;  4GYW A;  1NP7 A;  4LRZ A;  4HS2 A;  2VYI A;  1TEZ A;  3FUL A;  4TUM A;  1L5J A;  3D9O A;  3DXK G;  5AQA A;  1JUQ A;  1WAO 1;  4J8F A;  5T4Y A;  3FY4 A;  2VGE A;  1JPL A;  3EHM A;  4WAF A;  5JMN D;  5JJT A;  1HE8 A;  3PNL B;  4GTS A;  3TXM A;  3CVU A;  3HXC A;  3QKY A;  4GML A;  3Q49 B;  3IEG A;  2HR2 A;  4MKT A;  3E32 A;  3LY9 A;  3B7T A;  3E33 A;  4ILH B;  3ABM E;  1A5E A;  3VLD A;  3UT4 A;  3ZGQ A;  3RO2 A;  3CHS A;  3ASN E;  3FEY A;  4GTM A;  4UUC A;  3CVX A;  4I6J A;  4I1M A;  5BW8 C;  3EDT B;  4G11 A;  2IFU A;  4JEH A;  5JA4 D;  4N39 A;  5KCM A;  3ENE A;  1NFI E;  4PS3 A;  1TYQ G;  3NZU A;  2MHK A;  1SZ9 A;  3CQG B;  4BER A;  2RFM A;  2VQ2 A;  4DK5 A;  4IRU A;  3U64 A;  2CFU A;  3SZ7 A;  4J0U A;  3TWX A;  3APD A;  1S63 A;  3ZN3 A;  4I2Z A;  3R7R A;  5AJD A;  4U63 A;  1HX8 A;  2P9U G;  1Z3X A;  2PM6 A;  3OTN A;  2P9I G;  3UUX A;  1OCC E;  2A4Z A;  1EPU A;  4RVB A;  4U8Y D;  3Q7F A;  3GW4 A;  2VSO E;  3KSL A;  5ENQ D;  2PM7 A;  2WM9 A;  2NC9 A;  1D9S A;  3LCA A;  3QDN A;  3PUK A;  1SA4 A;  2WXJ A;  3IHV A;  4N2Q A;  4PS8 A;  5ARG A;  3NB2 A;  1LD7 A;  1ELK A;  3VTX A;  1Z6T A;  3EIQ C;  2I6H A;  1ZB1 A;  3LKU A;  4WND A;  3EHQ A;  3L22 A;  2R03 A;  4O1P A;  1MX2 A;  4BX9 A;  5BXU A;  3V2O A;  3FFL A;  5B1B E;  3LVQ E;  1IHB A;  1U3D A;  4TUU A;  5D0O D;  4AY6 A;  2IJG X;  3MYV A;  2BED A;  2OEW A;  1QNF A;  3CV0 A;  3SFZ A;  3FUM A;  3DEP A;  2CG2 A;  3ASH A;  3NOC D;  3ZHE A;  4DLO A;  3NQP A;  1Z3Y A;  1A17 A;  3IV0 A;  3SGH A;  3GZ2 A;  5A7D B;  4F53 A;  3D9K A;  2VTB B;  2X6I A;  3IKO B;  4AJW A;  3TWW A;  3EU9 A;  3UT8 A;  4A63 B;  1OY3 D;  1UW4 B;  1BPO A;  3MKQ B;  3UIP C;  3ULE G;  2ILR A;  1E90 A;  3AG1 E;  4AOF A;  3FTY A;  1HU3 A;  2AXV A;  3R7Q A;  1TNU A;  4G23 A;  4N3A A;  2VGX B;  4PDX A;  1HXI A;  4O6F A;  3APC A;  4URK A;  3FUE A;  2WMO A;  3KEZ A;  2QYJ A;  2P2C P;  3PVL A;  4KYO B;  3CVY A;  4KBQ A;  2DWZ A;  4A55 A;  3HVE A;  2XPY A;  4V3I A;  4BTB A;  3FUF A;  4ATZ D;  4Y6C A;  2I9C A;  2KM4 A;  3SI5 A;  2KBX A;  2E0I A;  4J7W A;  4OVU A;  3JQ0 A;  1OWO A;  2P58 C;  2KCL A;  5H7P A;  2F37 A;  4N3B A;  4ATG A;  1V54 E;  2P9S G;  5KWD A;  1N54 A;  2RG8 A;  1OT8 A;  3PUJ A;  4JL0 A;  2ION A;  3BUA A;  3DBS A;  1K3Z D;  4GAA A;  4ME2 A;  4U0Z A;  2EIM E;  2L6J A;  3ISM C;  3SO8 A;  3MJW A;  3SFY A;  2X6H A;  3AAA C;  4TRQ A;  3ZUV B;  3TWS A;  3L9T A;  5EIB E;  4NAC A;  1QZ2 A;  5FIN A;  1FPP A;  4RG6 A;  1HS6 A;  1S64 A;  5HI7 A;  3AS4 A;  4DX2 A;  4ANU A;  2XZT G;  5M72 A;  4B0Z A;  2OEV A;  2DVW A;  3Q4A B;  1OCR E;  5CHE E;  2L0I A;  3G2T A;  4GZ5 A;  3TL5 A;  4WUY A;  5FIO A;  5FT9 A;  3J5Q B;  1MX4 A;  1YYH A;  2GRQ B;  2FO7 A;  4ACK A;  3ZYK A;  5AYW D;  5D2M C;  4EZJ A;  2P9P G;  2WPV A;  3D9J A;  5FZS A;  4DI4 A;  3C72 A;  2XEN A;  3MEK A;  1UJK A;  2UY1 A;  2Y1L E;  3PEV B;  1K1B A;  4OAV B;  2P9K G;  2EQX A;  4N2S A;  1LD8 A;  2WQ7 A;  1MZC A;  3V30 A;  3SBT B;  4C0M A;  4EEC A;  1TNO A;  3FHE A;  4YDE A;  2EIJ E;  3DST A;  3OXF A;  4CGW A;  4B8C B;  2AVP A;  4L7T A;  4APF A;  4G24 A;  1GW6 A;  4U95 D;  3S7F A;  4CYM D;  2WMN A;  1G3N B;  3MKR A;  1KPS B;  2X3M A;  2P9L G;  5CER B;  2PQR A;  3JYS A;  1K1A A;  5ENS D;  3LS8 A;  1D8D A;  4BT9 A;  5AIJ A;  3PZ4 A;  2KAT A;  2KCK A;  5E75 A;  4OYS A;  4APO A;  5FQ6 A;  3HRA A;  4N5Q A;  4JD2 G;  3N71 A;  3UKU G;  2R59 A;  4MS6 A;  4F7A A;  4XEI G;  3QJZ A;  3CLJ A;  4TXQ A;  3OAW A;  5KNG A;  3Q75 A;  4OVV A;  4ZFH A;  2X6K A;  1U2V G;  4UQY A;  3HXD A;  4FUL A;  2BKG A;  1JCR A;  4U7E B;  3MV2 B;  3RIB A;  5ENO D;  1H2T C;  3L54 A;  3ZXS A;  3L6A A;  5C1D A;  2OVF A;  4XI0 A;  3MCX A;  3PDN A;  4ILI A;  3UTM A;  2IOL A;  1MJ0 A;  5ENR D;  5B1A E;  4WWP A;  3CVQ A;  4CZ2 D;  3EIJ A;  3SHF A;  5EN5 D;  5AAR A;  3ML8 A;  2F0Y A;  4ACL A;  4B89 A;  3DEO A;  2QZA A;  1Z5S C;  4QQI A;  5KJM A;  3CVP A;  4B93 B;  3KS2 A;  3QC1 A;  1TN7 A;  5C2Y A;  4B8A A;  3TG5 A;  5J90 A;  5EYL A;  3D9H A;  2LO6 A;  2IO2 C;  3ZKJ A;  3NAW A;  2KXP C;  5DIZ A;  4XZ4 A;  1HG5 A;  1N4Q A;  2VSY A;  4IUL A;  3HVE B;  4DX7 D;  4G26 A;  1O5M A;  3ABL E;  2VTB A;  4CDR A;  4FC8 A;  3CVL A;  4FJZ A;  4FJY A;  3HXF A;  3FUJ A;  1QQE A;  1X81 A;  4AM9 A;  1TNY A;  3CKB A;  2QYU A;  2Y3A A;  4K5B A;  1UN9 A;  4WNE A;  2YHE A;  3ESK A;  4AEZ C;  1AWC B;  3SNX A;  5HS0 A;  3FU0 A;  2LSU A;  4CDM A;  2WXQ A;  4GYY A;  4FP7 A;  2X6J A;  3KSQ A;  4GCO A;  3I4G A;  3E30 A;  3CK9 A;  4KVM A;  4LNB A;  4WNF A;  5ENN A;  2YHC A;  3O4Z A;  2WXM A;  4EZL A;  3QAR A;  4K5C A;  2YQ8 A;  2DYS E;  3FTV A;  2XPI A;  3FTW A;  3CVN A;  3JUE A;  5KNH D;  3MKQ A;  3TWU A;  4FHJ A;  1OWN A;  3DSW A;  3QWP A;  4HRN A;  4TXR A;  4HQD A;  3PRZ A;  1UJJ A;  4PUC A;  4N3C A;  2L6B A;  3SF4 A;  2J08 A;  1FVH A;  2MOW A;  4XIF A;  4ABN A;  1H6K A;  3SQV A;  3L16 A;  4LCT A;  2LNI A;  2QC9 A;  5ITZ F;  1BI8 B;  4KXK B;  4JW1 A;  3I3N A;  1U3C A;  2IY0 C;  3FWV A;  4O60 A;  2JLB A;  4BES A;  3PRE A;  2OND A;  3FEX A;  2VJ8 A;  3QNK A;  5D66 A;  4I9C A;  4UQZ A;  2WQ6 A;  2JEK A;  4UWF A;  1TNB A;  2AXZ A;  3L82 A;  4HLE A;  2OCC E;  4A1G A;  4JB8 P;  3IHY A;  3UM1 A;  3BU8 A;  3ZRH A;  3BG0 B;  4U0S A;  1E7V A;  4U96 D;  4FU3 A;  1TJC A;  3NBN B;  3PE3 A;  5HKP A;  2LXL A;  2IOS A;  4A3V A;  3R9A B;  1VDY A;  1TJF A;  4NQ0 A;  2Y4U A;  3PZ3 A;  3B13 A;  3LEW A;  1NI1 A;  2XEE A;  4GTP A;  4I1A A;  3EU5 A;  4J8Y A;  4LNG A;  2C0M A;  3APF A;  2XEH A;  4JZY A;  5LCW J;  4BFR A;  2HO1 A;  1DC2 A;  4HOT A;  2XGS A;  3L13 A;  4CCA A;  3P2B A;  1MYO A;  3TXN A;  5ARF A;  2B0O E;  4F1S A;  5G04 C;  4E6H A;  4D10 C;  4R7L A;  1N4S A;  4GB9 A;  5G05 C;  4Q94 A;  5JJ6 A;  4GA2 A;  1AP7 A;  5D0Q D;  3ZPJ A;  2HM8 A;  2VSN A;  4JHR A;  2C2L A;  1EDU A;  4GTO A;  4HRL A;  3EHR A;  1FT1 A;  3DSS A;  2JAB A;  1RW2 A;  2MYO A;  4PS7 A;  4BT8 A;  3BQO A;  3FTX A;  1E8X A;  2XS1 A;  3PH0 C;  2LXM A;  4JEU A;  3D9I A;  3DXM G;  3AG4 E;  2WXP A; 
#chains in the Genus database with same CATH homology
 3D9J A;  4HOR A;  1EYH A;  2WXN A;  5FZS A;  4DI4 A;  1JWG A;  1KLX A;  4I9E A;  3RU0 A;  2J49 A;  3MEK A;  1UG3 A;  1UJK A;  2UY1 A;  3Q5M A;  3UQ3 A;  3FU5 A;  3PS6 A;  3CK8 A;  2FF4 A;  2J9Q A;  1MQS A;  3PEV B;  3JUI A;  4GZD A;  2CHW A;  5G04 J;  3ZIM A;  4U0U A;  2EQX A;  4N2S A;  2CHX A;  5AJL A;  3IBE A;  2WQ7 A;  3RKV A;  3U66 A;  1PC2 A;  2XPZ A;  3D9N A;  4GMJ A;  3SBT B;  4C0M A;  3I4R B;  4EEC A;  3FHE A;  2WQH A;  3TGO A;  1HH8 A;  3D9P A;  4JVS A;  2PZI A;  1N52 A;  3OXF A;  4A1S A;  4CGW A;  3VLE A;  4B8C B;  2AVP A;  3EJN A;  4L7T A;  4APF A;  4G24 A;  4U07 A;  1GW6 A;  3QAQ A;  3C98 A;  3HDX A;  5DBK A;  2WXR A;  2V4L A;  3S7F A;  4CEM A;  4KZ0 A;  1ZBP A;  4JA9 A;  5LP0 A;  2WXK A;  2WMN A;  5HQ8 A;  3CQC B;  4Q69 A;  5KJL A;  1KT0 A;  4UWH A;  4Y6W A;  3MKR A;  4FHK A;  3MV3 B;  2X3M A;  4NUR A;  1E8Y A;  4AV7 A;  4WWO A;  2HYZ A;  2AXU A;  2LAI A;  2LSV A;  3K9I A;  3T5V A;  1H19 A;  2A5U A;  3FH7 A;  2I2O A;  5KJN A;  2VSX E;  2PQR A;  2WVI A;  3G2S A;  3ONL A;  3LY7 A;  2AWI A;  5A23 A;  5CCM A;  2WXO A;  2XCC A;  2J4B A;  3JYS A;  4UWK A;  4KT6 B;  3AU5 A;  3LS8 A;  3TJP A;  5BV0 A;  3LXU X;  4UI9 J;  5CMW A;  1OUV A;  4BT9 A;  3S7D A;  5AIJ A;  5G2N A;  2KAT A;  3FU6 A;  2KCK A;  3FTZ A;  1OWM A;  5E75 A;  5FZQ A;  4OYS A;  2XHE A;  1IQU A;  4L1B A;  4B94 A;  4A3T A;  3NF1 A;  4JHK A;  4APO A;  5FQ6 A;  3FUK A;  4L23 A;  2WB2 A;  4GYW A;  2KZT B;  4YVO A;  4CT4 A;  1SZA A;  2FI7 A;  1NP7 A;  4LRZ A;  3FTU A;  3N71 A;  4FA6 A;  1H0A A;  4HS2 A;  2R59 A;  2VYI A;  1TEZ A;  4MS6 A;  4F7A A;  3QOU A;  4GZ6 A;  3FUL A;  4ANV A;  2V0P A;  3VLF A;  4FAD A;  3QJZ A;  4H7Y A;  4YVQ C;  4GYO A;  1JWF A;  3CLJ A;  4J8D A;  2L0T B;  4U8H A;  1L5J A;  3D9O A;  1P5Q A;  2BTD A;  4KVO A;  4CGV A;  3OAW A;  4GZC A;  1JUQ A;  1WAO 1;  4J8F A;  4OVV A;  1PAQ A;  5T4Y A;  3FY4 A;  3UMV A;  4AY5 A;  4F3V A;  3NZS A;  5LX8 A;  1JPL A;  2X6K A;  3EHM A;  4WAF A;  4UQY A;  1H2V C;  4EZK A;  4FUL A;  2J07 A;  3G2V A;  5JJT A;  4ANX A;  1HE8 A;  3AU4 A;  3PNL B;  2VGY A;  3TXM A;  4GA0 A;  3CVU A;  3LY8 A;  4C0E A;  4EBA G;  3MV2 B;  2NSZ A;  3QKY A;  4GML A;  3RIB A;  4AXH A;  3I5P A;  3Q49 B;  4N5C A;  3ONK A;  4HVB A;  3IEG A;  2UWJ G;  2RD0 A;  2HR2 A;  4LEU A;  1H2T C;  3B7U X;  2I1J A;  3Q47 B;  2WXG A;  4I6G A;  4MKT A;  4MRU A;  3L54 A;  3ZXS A;  5BPP A;  2UY1 B;  3L6A A;  5E76 A;  3WXX A;  4GCN A;  5C1D A;  2DIW A;  2KC7 A;  3LY9 A;  3B7T A;  2CG3 A;  2VGX A;  2OVF A;  4XI0 A;  4DI3 A;  2WXL A;  3MCX A;  3PDN A;  2J4D A;  4ILI A;  2IOL A;  4ILH B;  5JHA A;  2FEZ A;  3MX3 A;  4UI9 K;  4IYP A;  4WWP A;  1X5B A;  3VLD A;  3CVQ A;  5BV1 A;  3UT4 A;  3FDH A;  3ZGQ A;  3RO2 A;  3EIJ A;  3ZEF A;  3LJ3 A;  4J8E A;  4WNG A;  3CHS A;  3SHF A;  3GYZ A;  3FEY A;  3PZD A;  1DNP A;  3ML8 A;  3CVX A;  4I6J A;  4ACL A;  4KZC A;  4B89 A;  3T8M A;  1Y6I A;  5JJ7 A;  4P29 A;  4I1M A;  5BW8 C;  3EDT B;  4LER A;  5T3R A;  4AP2 A;  4G11 A;  5KJM A;  3CVP A;  5AEN A;  3KS2 A;  3QC1 A;  2IFU A;  1E96 B;  4JEH A;  5C2Y A;  4B8A A;  4N39 A;  3TG5 A;  5J90 A;  2L9B A;  3FH5 A;  5KCM A;  2LO6 A;  3ENE A;  4FLH A;  4PS3 A;  2IU1 A;  3OXG A;  1Y8M A;  3ZVV A;  3ZHE B;  3NZU A;  3OXL A;  2MHK A;  1SZ9 A;  3CQG B;  5DIZ A;  2OVB A;  2V8S E;  2VQ2 A;  4ILG A;  4J6I A;  4XKC A;  4XZ4 A;  1HG5 A;  4FLB A;  3ZYL A;  5LFA A;  4DK5 A;  4IRU A;  2IF4 A;  2CFU A;  2GRL A;  3U64 A;  2VSY A;  4IUL A;  3HVE B;  5A6C A;  3SZ7 A;  3QK0 A;  4G26 A;  3UT7 A;  4J0U A;  2Y4T A;  3CR3 A;  2BF0 X;  3PEU B;  2VTB A;  4CDR A;  1E7U A;  3APD A;  4HFG A;  4FC8 A;  3FH8 A;  3ML9 A;  3FP3 A;  5EKQ D;  3SD5 A;  3CHR A;  4BTA A;  4CT0 A;  3GZ1 A;  3CVL A;  4FJZ A;  4FJY A;  3EHN A;  4IN3 B;  4PH4 B;  3ZN3 A;  3ASD A;  3CVW A;  1S0P A;  3FUJ A;  1QQE A;  1MHQ A;  3BG1 B;  4I2Z A;  5ANL A;  3R7R A;  4UQX A;  5AJD A;  4AM9 A;  4U63 A;  1HX8 A;  3CKC A;  3CKB A;  1Z3X A;  2Y3A A;  1IQR A;  3ZYM A;  2PM6 A;  1UN9 A;  3OTN A;  2I1K A;  3O48 A;  3CGH A;  3ESL A;  4I1O B;  3UUX A;  2A4Z A;  1EPU A;  4RVB A;  2YHE A;  3ESK A;  2AW6 A;  4WNE A;  5FQ4 A;  5T8I A;  5G55 A;  3GZS A;  4AEZ C;  2GRM A;  4UWG A;  3GW4 A;  4NRH B;  4GU5 A;  2VSO E;  4EPZ A;  2PM7 A;  2WM9 A;  3JQ1 A;  2NC9 A;  3SNX A;  4XKB A;  3LCA A;  3QDN A;  3FU0 A;  2LSU A;  4CDM A;  3PUK A;  2WXQ A;  2J09 A;  4FP7 A;  4GYY A;  2X6J A;  4HOU A;  1NA3 A;  2WXJ A;  4BY6 A;  3AS5 A;  4GCO A;  3KD7 A;  2V5F A;  3IHV A;  4CRW A;  3I4G A;  1OWL A;  3CK9 A;  4KVM A;  4BSX A;  5KJK A;  4WNF A;  1YA0 A;  3UX4 A;  3LDZ A;  5ENN A;  4N2Q A;  4PS8 A;  2YHC A;  3O4Z A;  3ULQ A;  5LCW C;  3UPV A;  2WXM A;  3S2A A;  4EZL A;  3FUI A;  1HF8 A;  3QAR A;  1HZ4 A;  4XX5 A;  4YND A;  2YQ8 A;  5ARG A;  5EDS A;  4Q96 A;  1ELK A;  2XRZ A;  3VTX A;  1OWP A;  2XEV A;  2XGO A;  3L08 A;  2E2E A;  3JCK C;  3FTV A;  3CIA A;  3TAX A;  1Z6T A;  2ZU6 B;  2XPI A;  3EIQ C;  2I6H A;  2PL2 A;  3CVN A;  3FTW A;  3LKU A;  4J8S A;  4RSY A;  4WND A;  3G2U A;  3L22 A;  3MKQ A;  4FHJ A;  3QWV A;  4EBA A;  1OWN A;  4BX9 A;  5J08 A;  4I43 A;  3CHM A;  2R17 C;  3HIZ A;  3QWP A;  3FUN A;  2YNQ A;  3FFL A;  2FBN A;  1WY6 A;  4XI9 A;  2OV8 A;  1IYG A;  3LVQ E;  4L2L A;  4JA7 A;  1U3D A;  4TUU A;  1WM5 A;  3PRZ A;  3U3W A;  3DPD A;  5D0O D;  2KZT A;  4AY6 A;  1UJJ A;  2IJG X;  2FUL A;  4PUC A;  3CVV A;  3ASG A;  3MYV A;  4N3C A;  1E8Z A;  1QNF A;  3CV0 A;  3E4B A;  3LPZ A;  3SF4 A;  2QY7 A;  3SFZ A;  2J08 A;  3FUM A;  4K03 A;  1FVH A;  3AS8 A;  2MOW A;  2X6F A;  3L17 A;  4XIF A;  4ABN A;  3RRN B;  5FZR A;  1H6K A;  2CG2 A;  5FTP A;  3VTY A;  3ASH A;  3L16 A;  3MA5 A;  2XGM A;  3ZHE A;  4LCT A;  4DLO A;  3NQP A;  2LNI A;  1Z3Y A;  4U04 A;  3G2W A;  1A17 A;  4GZ3 A;  2DBA A;  3IV0 A;  3ZFW A;  3CHQ A;  2YIN A;  4KXK B;  3SGH A;  2M63 A;  3GZ2 A;  3I3N A;  4JW1 A;  5A7D B;  3D9K A;  4F53 A;  1U3C A;  3T5X A;  3QB2 A;  2X6I A;  3IKO B;  4DPR A;  2VTB B;  4AJW A;  3FWV A;  1INZ A;  4RG9 A;  4TV3 A;  3Q15 A;  4CDN A;  1HO8 A;  3PNT B;  3UT8 A;  1B89 A;  2JLB A;  2QFC A;  5FQ8 A;  1UW4 B;  1BPO A;  3MKQ B;  2ILR A;  4JPS A;  3MZL B;  1E90 A;  2PQN A;  2WXF A;  3PRE A;  1HG2 A;  2OND A;  3FEX A;  2CFZ A;  2DCP A;  2VJ8 A;  4AOF A;  3QNK A;  5FWQ A;  1XGW A;  3FUD A;  4GPK A;  4BX8 A;  2MRI A;  3FTY A;  4UI9 C;  1HU3 A;  2AXV A;  3P1U A;  4I9C A;  3R7Q A;  3U9W A;  3CHP A;  4G23 A;  4UQZ A;  2WQ6 A;  4N3A A;  4HXI A;  2JEK A;  4UWF A;  3RRM B;  3ASF A;  2VGX B;  4PDX A;  3CSF A;  2AXZ A;  2WXH A;  2X38 A;  1HXI A;  4O6F A;  5EX0 A;  3APC A;  4URK A;  4G25 A;  5EX3 A;  3B7S A;  3FUE A;  4JHJ A;  3U4T A;  4BWR A;  4QFV A;  3CHO A;  4WWN A;  4HLE A;  2WMO A;  4DJA A;  4HOQ A;  3MGB A;  3KEZ A;  4A1G A;  3PVL A;  3FU3 A;  5ANR A;  3IHY A;  3BG0 B;  4U0S A;  1E7V A;  1UN8 A;  4JC8 A;  4KYO B;  3ZRH A;  3CEQ A;  3FTS A;  4KBQ A;  3CVY A;  2XQ0 A;  2OOE A;  4FU3 A;  4A55 A;  4EQF A;  1TJC A;  3HVE A;  5CCL A;  2XRY A;  4JXT A;  5G05 J;  3PE3 A;  4A3V A;  2IOS A;  2XPY A;  2C0L A;  3R9A B;  4V3I A;  4BTB A;  1VDY A;  2GGF A;  3FUF A;  1TJF A;  4NQ0 A;  1ELW A;  4H7X A;  4Y6C A;  2Y4U A;  2LAH A;  2I9C A;  3LVR E;  2KM4 A;  3B13 A;  2KCV A;  2E0I A;  2NXP A;  3LEW A;  4KMO A;  3JQ0 A;  4OVU A;  1OWO A;  3SI5 A;  5BT1 A;  2P58 C;  1DVP A;  2KCL A;  4I1A A;  4N3B A;  4ATG A;  1NZN A;  4G1T A;  3TG4 A;  4C9B B;  1N54 A;  2RG8 A;  2R5S A;  2C0M A;  3PUJ A;  3APF A;  4JL0 A;  3ZYQ A;  2ION A;  3DBS A;  4L2Y A;  1KT1 A;  4GAA A;  4ME2 A;  4XE0 A;  4U0Z A;  1LF8 A;  4W9R A;  2IQC A;  3PE4 A;  2L6J A;  4JZY A;  5LCW J;  4BFR A;  3URZ A;  3MJW A;  1W3B A;  4M3O A;  5LOZ A;  4HOS A;  2X6H A;  2XCB A;  3D9M A;  4TRQ A;  5JHB A;  4K0R A;  2HO1 A;  5CMY A;  4HOT A;  2XGS A;  3L13 A;  1NA0 A;  1EF1 C;  4CCA A;  4NAC A;  1QZ2 A;  2CHZ A;  3CST A;  3P2B A;  1ZU2 A;  3FUH A;  3HYM B;  3TXN A;  5ARF A;  4RG6 A;  1HS6 A;  5G04 C;  4F1S A;  4AIF A;  3LYA A;  3RJV A;  4D10 C;  4R7L A;  4E6H A;  5HI7 A;  1E8W A;  4GB9 A;  5G05 C;  3AS4 A;  4Q94 A;  4ANU A;  5M72 A;  5JJ6 A;  4B0Z A;  4GA2 A;  3HHM A;  1HFA A;  1FCH A;  4AVX A;  3D9L A;  2Q7F A;  4I2W A;  5D0Q D;  4E85 A;  3ZPJ A;  2HM8 A;  3Q4A B;  1XNF A;  2VSN A;  5CHE E;  4JHR A;  2L0I A;  3RRU A;  3S7B A;  4I17 A;  4I6E A;  1H2U A;  3G2T A;  3D3M A;  4GZ5 A;  2WXI A;  5BNW A;  2C2L A;  3TL5 A;  4WUY A;  4GA1 A;  1EDU A;  5FT9 A;  2GW1 A;  3CK7 A;  4G2V A;  1ELR A;  5BUZ A;  4PS7 A;  4BT8 A;  3BEE A;  4UWL A;  2FO7 A;  3FTX A;  1E8X A;  3PH0 C;  4ACK A;  3ZYK A;  5AYW D;  1FVF A;  4DLQ A;  3RO3 A;  4ANW A;  2BUG A;  1IHG A;  3B7R L;  3QWW A;  4JEU A;  3D9I A;  3KAE A;  3SBS A;  5FQ7 A;  3S7J A;  4EZJ A;  2WPV A;  2WXP A;  3ZW3 A;  4MLP A;  4LUN U;  1SQM A;  1PY1 A;  5FJY A;  3RK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...