2LSVA

The nmr high resolution structure of yeast tah1 in complex with the hsp90 c-terminal tail
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
b'SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TPR repeat-containing protein associated with Hsp90
publication title High-Resolution Structural Analysis Shows How Tah1 Tethers Hsp90 to the R2TP Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone-binding protein/chaperone
total genus 30
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lsvA00
4WUYA 3HYMB 3KS2A 3PE4A 3FWVA 3MV2B 5FJYA 4JL0A 2C2LA 3TGOA 3N71A 3VTYA 2R5SA 4G23A 4I9EA 1TJCA 5BNWA 4GPKA 4A1SA 4UI9K 4YNDA 2KATA 2Y4TA 3LY7A 5ARGA 1NZNA 3TG5A 4I9CA 3GZ1A 4O6FA 3CK8A 1HH8A 1PC2A 4CDRA 2LSVA 1QQEA 2KCLA 4RG6A 2WPVA 4YVOA 3Q49B 1ZBPA 4CGVA 2FO7A 3ASFA 5JJ6A 2VSNA 4GA0A 4I17A 4BT8A 1NA3A 5G04J 3U3WA 5JJTA 4G2VA 3CEQA 2MHKA 3LPZA 4U0ZA 3LY9A 3ZFWA 3Q15A 3LYAA 5CCMA 5FZRA 3CK7A 4N3CA 3QDNA 3QWWA 3AS8A 4WNEA 5HI7A 1NA0A 1OUVA 4U04A 5A7DB 3FP3A 5LCWJ 4EQFA 4U0SA 3UUXA 1IHGA 5FT9A 2QFCA 2L6JA 3QWVA 2VGXB 2Y4UA 2YQ8A 2Q7FA 4LEUA 4N2SA 1HXIA 1ELWA 4WNFA 1W3BA 3LCAA 4B94A 2PQRA 3GZ2A 1ELRA 4GZ3A 1E96B 3ULQA 2VGYA 5G04C 5HQ8A 1IYGA 2XPIA 4RG9A 3UQ3A 2KC7A 2YHCA 3CVQA 2PL2A 2VQ2A 4F3VA 2HR2A 3K9IA 5KJLA 3VTXA 4UI9J 2PZIA 4U0UA 4IN3B 5LCWC 2XGMA 4GYYA 5EX3A 3LY8A 3URZA 3MA5A 3E4BA 4CGWA 3RO3A 4GZ6A 4ME2A 3S7JA 3OXGA 4GA2A 3RO2A 3GYZA 3R9AB 3KAEA 2HYZA 1XNFA 3ZGQA 3PDNA 4XIFA 3RU0A 2HO1A 3PE3A 4GA1A 3ASGA 5CCLA 3ZPJA 3SF4A 4BTBA 4HOTA 5BW8C 2C0LA 1WAO1 3LKUA 4J8DA 4KYOB 3Q5MA 4KBQA 2XCBA 2XEVA 3Q47B 5M72A 4UI9C 5KJMA 2UY1B 4G25A 3MV3B 3ZHEB 3ASDA 3ASHA 4G24A 5KJKA 1B89A 5DIZA 4AY5A 2FI7A 4UQYA 3BEEA 4BWRA 1FCHA 4G1TA 3U4TA 4WNDA 2DBAA 4AIFA 2PQNA 3TG4A 4NRHB 1KT1A 3MKRA 1YA0A 2KCVA 4N3BA 3QOUA 4H7YA 4I2ZA 2VYIA 5ARFA 5KJNA 2J9QA 2FBNA 4N5CA 1KT0A 3JYSA 1Y8MA 4N39A 1WM5A 4GZ5A 2ONDA 4AM9A 3WXXA 5C1DA 3KD7A 5JJ7A 4ABNA 4J8EA 4BT9A 4KXKB 1KLXA 3CV0A 5EKQD 3CKCA 2VGXA 5BT1A 4XI9A 5D0OD 5FZSA 3QWPA 3SZ7A 4H7XA 2GW1A 3RIBA 4GCNA 4J0UA 1QZ2A 2FF4A 2LNIA 3EDTB 3RJVA 4JA7A 1P5QA 3MEKA 4WNGA 3CK9A 4U07A 5FTPA 2XGOA 4UQZA 2V5FA 4NQ0A 3S7FA 3S7DA 1A17A 5AYWD 4N2QA 2OOEA 5G05J 4W9RA 3TAXA 3S7BA 3OXLA 4I2WA 3Q4AB 5CHEE 2UWJG 4JA9A 4JHRA 3CVPA 5FZQA 1ZU2A 3OXFA 4GYWA 4HOSA 4UQXA 3IEGA 5EX0A 5A6CA 4J8FA 3UPVA 2KCKA 4XI0A 1HZ4A 2XGSA 2WQHA 4HOUA 3RKVA 2I6HA 3FFLA 3GW4A 2VSYA 4G26A 3ESKA 4I1AA 3AS4A 3NF1A 2E2EA 2JLBA 2NC9A 2FEZA 3CVLA 4BTAA 3O48A 4APOA 2IF4A 4YVQC 2P58C 2BUGA 3ZN3A 4Y6CA 3AS5A 5G05C 2UY1A 4Y6WA 3ZHEA 5D0QD 2XCCA 2LSUA 5DBKA 3CVNA 3QKYA 4GYOA 2IFUA 2AVPA 3CKBA 4N3AA 4HORA 4GCOA 4AY6A 2C0MA 4HOQA
chains in the Genus database with same CATH superfamily
1K8KG 3DRAA 3ML9A 2F8YA 3AG3E 1TN7A 3KS2A 4DI3A 3F6QA 2EIJE 2WXPA 4ACLA 1QBQA 2QYJA 2ZGGA 1Z3XA 3RRNB 1HFAA 4I9EA 4OYSA 2XRZA 2F37A 3T9KA 1H6PA 1BU9A 2YHEA 4GPKA 2IEJA 3LY7A 2J4BA 4LG6A 3B7UX 2WXFA 2EINE 3DPYA 3FTZA 2FO1E 3NOCD 2LSVA 3AG1E 4ILHB 4L2LA 2L6BA 5G2NA 2WPVA 3DPDA 1D8EA 3D9KA 4J8YA 4YVOA 3SGHA 4HS2A 4KVOA 3UKRG 2P9UG 2R17C 2ZISA 3ASFA 4CT0A 3ASOE 3DSVA 2WVIA 3U3WA 2NXPA 5AARA 2P9NG 4AV7A 3LY9A 5JA4D 1X5BA 3LYAA 5T8IA 4N3CA 1K1AA 5KWDA 4BETA 1IHBA 3FTUA 4HB5A 1LD7A 5HI7A 4A3VA 1NA0A 3MJWA 3W9FA 5A7DB 4HI9A 1MHQA 4U0SA 2DYSE 3HXFA 2DWZA 5FT9A 3L82A 2VGXB 3U64A 2Y4UA 2OV8A 4HXIA 4N2SA 1NI1A 2PQRA 1IQUA 3ZW3A 3CSTA 1MQSA 3EIQC 2DCPA 3AAAC 5HQ8A 3ZYQA 1IYGA 2XQ0A 3UINC 2RG8A 2R2LA 3DSTA 3UQ3A 3DXKG 3L17A 3ASNE 1LF8A 3CVQA 4ACKA 3SNXA 3FU5A 4F3VA 2XENA 4HLLA 3FEXA 4CRWA 5CEDB 4UI9J 3MKQA 1NL4A 2PZIA 3DSXA 2VTBB 2WXQA 2GRMA 3DBSA 2GROB 4GYYA 4YDWA 4QQIA 5FWQA 5D2MC 4GTMA 3TWXA 1UJJA 3QJZA 5G55A 5HKPA 2DZOA 2FULA 5LFAA 2RFMA 1MX4A 2HYZA 4FA6A 2ZU6B 1DCQA 4ANVA 4CZ2D 1EDUA 3NQPA 1BPOA 5CCLA 4L23A 5BW8C 2YINA 1WAO1 3JXIA 3PZ4A 1FVHA 2JEKA 5AENA 5M72A 4UI9C 5KJMA 3CHRA 2XS1A 4G25A 3MV3B 3HXCA 2XZDG 3ASDA 1D9SA 5CMYA 5EDSA 2FI7A 3NB2A 3SY2A 4GTVA 1BI7B 3UI2A 3MZLB 2WM9A 4AIFA 2J49A 2CFZA 3TWTA 4L2YA 3TG4A 1KT1A 3ABME 5CMWA 1YA0A 1QNFA 4B89A 3QOUA 3Q7FA 4RLYA 5KCMA 4PH4B 4U8HA 4YDYA 5KJNA 3PNLB 2FBNA 1H2VC 4N5CA 3JYSA 4J7WA 4Z68A 3CHQA 3UX4A 4LERA 2LUHA 3IV0A 3KD7A 4D10C 3D9PA 4ABNA 1WY6A 3Q9NC 2WMNA 1N0QA 3BG0B 5FQ6A 3EHRA 5EKQD 3HDXA 1HX8A 3L22A 3Q9UC 3CKCA 2WXMA 2RKKA 3LJ3A 3SZ7A 3FTYA 2GW1A 1MZCA 3NAWA 4GCNA 2GGFA 4J6IA 3SFZA 1JWFA 1QZ2A 1FT1A 3RJVA 1P5QA 3ISMC 4I6EA 3CK9A 3ABKE 4U07A 4BSXA 2J07A 4OVVA 5KNHD 2WXIA 2ETCA 4CDNA 1ZB1A 4O1PA 2V0PA 4CT4A 3FH8A 5G05J 3Q7AA 3ABLE 3NBNB 3S7BA 3OXLA 3ZNGA 4I2WA 3FUNA 4JPSA 3Q4AB 4FJZA 4GZDA 1H2TC 1BD8A 1N4PA 2EQXA 3R7RA 3UT8A 4BX9A 5ENNA 3HVEB 4GTTA 4MS6A 1OT8A 2P9IG 2P2CP 4UUCA 4JEUA 3Q73A 4XEIG 5HS0A 2IQCA 2WXKA 1AP7A 2WQHA 3GW4A 4G26A 3C3RA 3FUFA 3HHMA 3B7SA 3RK6A 3E30A 5EIDA 2DYRE 3FUJA 2IF4A 2P58C 2A5EA 1TNOA 2BUGA 4E85A 3ZN3A 1BLXB 4Y6CA 3V31A 2DZNA 3AS5A 3LDZA 5G05C 4Y6WA 3ZHEA 2QYUA 4XZ4A 2LSUA 5DBKA 3CVNA 3HG0D 2IOLA 4F1SA 3UM0A 4HORA 1TNBA 4AXHA 4JEHA 4TUMA 3TWRA 3HXDA 2QY7A 4WUYA 4ANXA 4CCAA 3HYMB 2KBXA 3EHQA 4HRLA 5ENRD 4EZKA 2C2LA 4ILGA 1OCZE 3N71A 4HBDA 5BUZA 3UIPC 3Q79A 3TXMA 2IY0C 3FU3A 4A1SA 4UI9K 3TG5A 5AJDA 5AQAA 4O6FA 3BUAA 3ZEFA 5ENPD 2WMOA 4K5AB 1QQEA 5ITZF 5D66A 2KCLA 3C3QA 2MYOA 3FEYA 3UXGA 4IULA 4CGVA 3TWQA 5JJ6A 5CERB 2AWIA 1N4RA 4F6RD 4FC8A 4I17A 4KZ0A 4BT8A 1FPPA 4TUUA 3V2XA 1NA3A 5G04J 4BERA 3CSFA 5AJLA 4G2VA 3CEQA 3LPZA 4U0ZA 4JXTA 4DRXE 4K5CA 3IXEA 2PM6A 4FP7A 2X6IA 3CK7A 3ONLA 3QWWA 1VDYA 4CYMD 1OUVA 2CFUA 2H6HA 2QFCA 2L6JA 3FTSA 3ZXPA 1SVXA 4FJYA 2YQ8A 2X6JA 4LEUA 5CECB 1HXIA 4WWOA 3MGBA 4FULA 1ELRA 4ILIA 4UWGA 4A1GA 4JHJA 2VGYA 5G04C 5CBOA 3ML8A 1N4SA 3CLJA 3RSEG 4DLOA 2YHCA 3PNTB 5KBAA 2WQ6A 2OEWA 3CHOA 5B3SE 2PL2A 2VQ2A 2HR2A 1TN8A 4M7CA 3FH5A 3EIJA 2B0OE 5KJLA 4TXRA 3I4RB 3UT4A 1H6KA 2IO3C 4U0UA 4IN3B 2XGMA 2LAIA 4U8YD 1E7VA 1V55E 4LCTA 4DX1A 1DVPA 3LY8A 3URZA 3ZIMA 3E4BA 3RO3A 5BXOA 3S7JA 3RO2A 3GYZA 3R9AB 4HRMB 1S63A 3I3NA 1XNFA 1SZAA 1NP7A 4EHMA 4XIFA 4MRUA 1OWNA 3UM2A 2B6CA 2WXOA 2WXRA 2GRRB 3BQOA 3SO8A 4IYPA 3SF4A 3ULEG 3LKUA 1O5MA 1SA5A 4I1OB 4GB9A 4OVUA 1QYMA 2XEVA 1FT2A 3SFXA 1TN6A 2UY1B 3EU5A 4KMOA 4URKA 2ETAA 2EIKE 2V8SE 1INZA 5KJKA 1WG0A 1B89A 3ULYA 1N11A 3APDA 3UTMA 4EPZA 3PS6A 4BWRA 1MX6A 3MYVA 3L54A 4PS8A 3U4TA 3FHEA 1TJFA 2DBAA 4C9BB 3T8KA 5J90A 2VJ8A 4NRHB 3MKRA 4GPMA 5EN5D 3CVWA 2GRQB 3FUEA 1JWGA 4IRUA 2VYIA 1IQRA 1HS6A 4GZCA 1PAQA 4N39A 1WM5A 1Q2ZA 3BU8A 4AM9A 3WXXA 5BPPA 5C1DA 1TYQG 4DX7D 4J8EA 2A5UA 4KXKB 3CV0A 5BT1A 1O1TA 2WB2A 1E8ZA 1X81A 4XI9A 5D0OD 3QWPA 4MBGA 1KPSB 5AN8A 1O1SA 1JUQA 4H7XA 4AJWA 2DIWA 3P2BA 4J0UA 4BSZB 4GTRA 2J08A 2FF4A 4HLEA 3EDTB 4G8LA 4JA7A 1LD8A 2KZTA 4ATZD 4DLQA 2LO6A 3BG1B 1JPLA 2XGOA 4HVBA 2OVFA 5FQ7A 3S7FA 3S7DA 3AU5A 1A17A 5AQBA 3PEUB 4N2QA 4M3OA 3C5RA 2OOEA 3CVYA 4TV3A 1OWLA 1EYHA 3EHNA 3CVPA 5FZQA 3CVXA 4FHKA 3NZUA 1ZU2A 4GYWA 1O1RA 2CHXA 5EX0A 3G2VA 5JHBA 1KZOA 4ZHBA 1OWPA 2EILE 1E8WA 4J8FA 2QZAA 2XGSA 4HOUA 3ZXSA 2XHEA 2I6HA 3FFLA 1OCOE 3ZYMA 2VSYA 3ENEA 4I6JA 3AS4A 4HNAD 1NFIE 2BKGA 3U66A 2OEVA 2FEZA 1JCRA 2AXUA 4YVQC 1UJKA 4N5QA 1N0RA 3LVRE 3L16A 3MKQB 3V2OA 2LXLA 4DK5A 1Z6TA 4EZJA 2V5QC 3JCKC 3V79K 3UT7A 1LTXA 2IONA 3ZKJA 4HI8A 2QC9A 1D8DA 2H6IA 2IFUA 4QFVA 2AVPA 4A63B 4GCOA 2C0MA 4HOQA 2KZTB 2WXNA 3PZ2A 3CVVA 2JABA 5FJYA 5ANLA 4JL0A 3TWUA 3TGOA 4A55A 2ILRA 3S2AA 3VTYA 3FDHA 1N54A 5J08A 3EJNA 3AJIA 3UMVA 5ARGA 4I9CA 3GZ1A 3P1UA 4DUIA 3B13A 5E75A 4CDRA 4DX6D 4DX5D 1EF1C 4RG6A 3C72A 1U3CA 3IKOB 3VLEA 2FO7A 1E8YA 2VSNA 5ENTD 4EZLA 5ENOD 4GA0A 4UWKA 3CQGB 4LSZE 1HO8A 3U9WA 3B95A 3RRMB 4BY6A 2X6FA 1TEZA 3ZFWA 1MYOA 3DSSA 4LRZA 2Y3AA 2P9SG 3SHFA 5FIOA 3LVQE 3AS8A 3E37A 1OY3D 3ZVVA 4WNEA 2XEEA 3PZ1A 5EIBE 3LXUX 3QNKA 4XKBA 5LCWJ 3UUXA 1IHGA 2ZGDA 4AOFA 1H19A 2VGEA 2M63A 3QK0A 2R03A 4WNFA 4NACA 4B94A 2WXHA 3GZ2A 4GZ3A 1E96B 4GMLA 3PH0C 1ELKA 4RG9A 1UN8A 4K0RA 4UWFA 3IHVA 2KC7A 3QB2A 1AWCB 2GRNB 3FUHA 3SI5A 3HXEA 4WWNA 3L08A 4ANUA 5IY5E 4B8CB 3VTXA 4OAUC 4I1MA 4UWHA 5LCWC 2BKKB 1DCEA 3SQVA 2I9CA 4OAVB 4MKTA 1N4QA 4JHKA 3MA5A 4CGWA 4YDEA 3R7QA 3OXGA 3X2QE 3LS8A 3KSLA 4GTOA 4V3IA 4FU3A 3SBSA 1N52A 3PDNA 3HRAA 3WG7E 2HO1A 2MOWA 4GA1A 2AW6A 3ZPJA 3EUVA 4BTBA 3HIZA 3PVLA 2C0LA 3T5VA 4U7EB 4KYOB 4RSYA 1SZ9A 4F1PA 3I4GA 4KBQA 4K03A 3Q47B 5T4YA 4APFA 4GMJA 3OTNA 3ZHEB 2IOSA 1U2VG 3CHSA 3ASHA 1UOHA 4G24A 1JCQA 1WDYA 2GRLA 4AY5A 5BV0A 3FULA 3FUIA 4CEMA 3RRUA 3JQ0A 4G1TA 2DVWA 4U95D 4WNDA 2P9PG 3TXNA 2CHZA 2YNQA 1RW2A 1L5JA 2CG2A 3OAWA 4N3BA 3CIAA 4H7YA 1YCSB 3JXJA 3LEWA 2VSOE 2J9QA 4Q69A 2OCCE 3IHYA 2XEHA 1KT0A 1DNPA 3JUIA 3AG2E 2ZIRA 2P9LG 4GZ5A 2ONDA 3CR3A 2GRPB 5JJ7A 4AP2A 2I1JA 1KLXA 4L1BA 2VGXA 5BV1A 5LOZA 5FQ4A 1TNZA 3EU9A 2PM7A 5CRVA 1H0AA 3D9MA 2E0IA 4JVSA 2BEDA 3APFA 4B0ZA 5JMND 5H7PA 2IO2C 4B93B 1S0PA 2WQ7A 1HG5A 1E7UA 3MX3A 2CHWA 2I2OA 3MEKA 4WNGA 4BEPA 4UQZA 2V5FA 3B7TA 4GTPA 2ETBA 1Y6IA 2X38A 5JHAA 1Z5SC 3AU4A 5AYWD 3CGHA 5ENSD 3TWWA 2KXPC 3QARA 1E8XA 2VTBA 5EILA 2Y1LE 4J8SA 4JA9A 2UWJG 3L13A 4JHRA 3KEZA 2XS8A 1U3DA 3D9OA 4UQXA 3PEVB 4LNUD 2RFAA 3IEGA 3V30A 4NIKA 4EECA 2ZXWE 3KEAA 1IKND 3UPVA 2KCKA 2V4LA 4P29A 1HZ4A 2PNNA 3TWSA 4DI4A 3ESKA 5ANRA 1SA4A 5E76A 3PZ3A 4Q96A 2E2EA 1N94A 1K1BA 3ZYLA 2NC9A 4HRNA 4BESA 3VLDA 3CVLA 4KZCA 4X8QA 4APOA 3G2SA 4HQDA 4XKCA 4JZYA 3JUEA 4E6HA 4F7AA 4AEZC 3DWLG 3T5XA 3MCXA 5LX8A 1K3ZD 2H6FA 1HF8A 3D9NA 5BXUA 3UM3A 4JD2G 2AXVA 3LJNA 4WAFA 3TL5A 2V4HC 1UN9A 3QKYA 4U63A 5B1AE 5AQ9A 3CKBA 4N3AA 2AJAA 3E34A 4YDOA 1TR4A 4AY6A 3PREA 3NZSA 1XGWA 3HXBA 3PE4A 3FWVA 3MV2B 3J5QB 3O4ZA 2F0YA 5AIJA 2XZTG 2R5SA 3Q75A 4PS3A 4G23A 5T3RA 1TJCA 5BNWA 2WXGA 4KT6B 4XE0A 1HU3A 4YNDA 2KATA 2Y4TA 2BTDA 1NZNA 2R59A 4LNBA 3NOGD 2LXMA 2OVBA 3Q78A 3GZSA 1OCCE 3FUDA 4TRQA 3CVUA 3FUMA 1SW6A 1HH8A 3CK8A 1PC2A 5FQ8A 3CHPA 1V54E 3KSQA 3G2WA 1N9AA 2AXZA 3TJPA 1OCRE 3B7RL 3Q49B 1ZBPA 3JQ1A 4RQIA 1DC2A 4XX5A 3SD5A 1N95A 3E33A 2A4ZA 3IBEA 1MJ0A 4L9PA 5JJTA 3FTVA 3FUKA 3UIOC 2MHKA 3D9HA 2P9KG 3Q15A 5CCMA 5FZRA 4ATGA 5CEAA 3QDNA 1SQMA 3TWVA 1H6OA 3UM1A 4BFRA 2X6KA 4BX8A 4U04A 3FP3A 4EQFA 3DEPA 3B7BA 3QWVA 3ZRHA 3D3MA 2Q7FA 3HVEA 5HRYA 5A23A 4ZFHA 1ELWA 1W3BA 4ANWA 3LCAA 3CHMA 2L0IA 4DPRA 4EBAG 2IU1A 3ULQA 4F53A 1HE8A 3ESLA 2LAHA 4GMRA 3FU0A 2XPIA 4U8VD 2XPZA 3K9IA 4K5BA 4A3TA 2WXLA 3ZYKA 2L9BA 1OWMA 3G2TA 5EX3A 3PUJA 4DX2A 2H6GA 2XPYA 4GZ6A 4ME2A 4AVXA 3DSUA 4GA2A 4FLBA 4G8KA 3KAEA 4PDXA 3ZGQA 4L7TA 3RU0A 1G3NB 3PE3A 2CG3A 2KM4A 3ASGA 5LP0A 3R9MA 2HM8A 4HOTA 4JC8A 3C3OA 4J8DA 1TNUA 4B8AA 4I6GA 3DSWA 1OWOA 1MX2A 4MLPA 3Q5MA 1A5EA 2XCBA 5KNGA 4FADA 1GW6A 1IXVA 3DEOA 2EIME 3FU6A 3FTWA 1UG3A 1YMPA 3D9LA 5DIZA 4UQYA 3QAQA 3BEEA 1FCHA 4GTQA 5B1BE 3L6AA 4C48B 4O60A 2PQNA 3FH7A 3APCA 3VLFA 4TXPA 3PUKA 5FINA 4I43A 1KZPA 2KCVA 4GU5A 1PY1A 4I2ZA 3QC1A 5ARFA 4LNGA 5ENQD 4GAAA 2J4DA 2X6HA 4Q94A 1Y8MA 4JB8P 3E32A 3SFYA 1YYHA 1TNYA 4HFGA 3FY4A 2L0TB 1EPUA 3C98A 4BT9A 3ZUVB 5AAOA 3RAUA 1HG2A 5CBNA 3T8MA 5FZSA 2BF0X 2MRIA 1RZ4A 4R7LA 4NURA 3RIBA 4TXQA 4C0EA 3FTXA 5CRUA 3G2UA 1S70B 2IJGX 2F8XK 2LNIA 4UWLA 2Y69E 4GTSA 3ONKA 3D9JA 2XRYA 4FHJA 5FTPA 4JW1A 3PZDA 2I1KA 3W9GA 2NSZA 4NQ0A 2R02A 1OXJA 4WWPA 2J09A 3EHMA 1Z3YA 2HE0A 4PUCA 2NYJA 4W9RA 3TAXA 5EYLA 2J8SD 5CHEE 1S64A 1JCSA 2R05A 4U96D 3OXFA 4HOSA 3CQCB 4O1OA 3ZU7B 4G11A 2RD0A 5A6CA 3DXMG 1H2UA 4XI0A 3RKVA 3I5PA 4I1AA 3NF1A 4EBAA 2JLBA 4FLHA 4DJAA 3UKUG 1E90A 2Y0BG 4BTAA 4CDMA 3PRZA 3O48A 3J5PA 5AQ7A 5EYPF 4LUNU 2X3MA 1UW4B 5C2YA 2UY1A 3AG4E 3SBTB 5D0QD 4PS7A 2XCCA 3L9TA 1BI8B 3D9IA 2WXJA 1FVFA 4GYOA 4KVMA 4C0MA 2VSXE 4RVBA
chains in the Genus database with same CATH topology
4JEHA 3ML9A 2WXNA 2QY7A 1XGWA 4WUYA 4ANXA 4CCAA 3HYMB 3KS2A 3PE4A 4DI3A 3CVVA 3FWVA 3MV2B 2WXPA 4EZKA 5FJYA 5ANLA 4JL0A 2C2LA 4ILGA 3O4ZA 4ACLA 3TGOA 3N71A 5AIJA 4A55A 5BUZA 2ILRA 3S2AA 1Z3XA 2R5SA 3RRNB 3VTYA 3FDHA 4PS3A 1HFAA 1N54A 4G23A 4I9EA 4OYSA 2XRZA 3TXMA 5J08A 5T3RA 1TJCA 5BNWA 3FU3A 3EJNA 2YHEA 2WXGA 4GPKA 4A1SA 4KT6B 4UI9K 1HU3A 4XE0A 4YNDA 2KATA 3UMVA 2Y4TA 2BTDA 3LY7A 5ARGA 1NZNA 2J4BA 2R59A 3TG5A 2OVBA 4I9CA 3B7UX 2WXFA 3GZ1A 3GZSA 5AJDA 3P1UA 3B13A 3FUDA 4O6FA 4TRQA 3ZEFA 3FUMA 3CVUA 3CK8A 1HH8A 1PC2A 5E75A 3FTZA 3NZSA 2WMOA 4CDRA 2LSVA 5FQ8A 4ILHB 4L2LA 3CHPA 1QQEA 2KCLA 3G2WA 1EF1C 4RG6A 2WPVA 5G2NA 2AXZA 3DPDA 3D9KA 1U3CA 3TJPA 3FEYA 4YVOA 3IKOB 3B7RL 3SGHA 3Q49B 4HS2A 4IULA 4KVOA 3VLEA 1ZBPA 4CGVA 3JQ1A 2FO7A 1E8YA 2R17C 3ASFA 5JJ6A 2AWIA 4XX5A 2VSNA 3SD5A 4EZLA 4GA0A 2A4ZA 4UWKA 3IBEA 4CT0A 4FC8A 4I17A 3CQGB 4KZ0A 4BT8A 2WVIA 4TUUA 1NA3A 1HO8A 5G04J 3U3WA 2NXPA 3U9WA 5JJTA 3RRMB 3CSFA 3FTVA 5AJLA 4BY6A 3FUKA 2X6FA 4G2VA 1TEZA 3CEQA 4AV7A 2MHKA 3LPZA 4U0ZA 3LY9A 3ZFWA 1X5BA 4HOQA 3Q15A 3LYAA 4JXTA 5CCMA 5T8IA 5FZRA 4LRZA 2Y3AA 2PM6A 4FP7A 3SHFA 2X6IA 3CK7A 4ATGA 4N3CA 3QDNA 1SQMA 3ONLA 3LVQE 3QWWA 3AS8A 1VDYA 4BFRA 2X6KA 3ZVVA 4WNEA 4BX8A 3FTUA 5HI7A 4A3VA 1NA0A 1OUVA 3LXUX 3MJWA 4U04A 3QNKA 4XKBA 5A7DB 2CFUA 3FP3A 4EQFA 5LCWJ 1MHQA 4U0SA 3UUXA 1IHGA 5FT9A 2QFCA 2L6JA 3QWVA 3FTSA 4AOFA 1H19A 2VGXB 3ZRHA 3U64A 2Y4UA 2OV8A 4FJYA 3D3MA 2YQ8A 2Q7FA 2M63A 3QK0A 4HXIA 3HVEA 2X6JA 4LEUA 4N2SA 5A23A 1HXIA 4WWOA 1ELWA 4WNFA 1W3BA 4ANWA 3LCAA 4NACA 3MGBA 4FULA 4B94A 2PQRA 2WXHA 3GZ2A 1ELRA 2L0IA 3CHMA 4GZ3A 4DPRA 4ILIA 4EBAG 1IQUA 1E96B 3ZW3A 2IU1A 3ULQA 4F53A 4UWGA 3CSTA 1HE8A 1MQSA 3ESLA 4A1GA 3EIQC 4JHJA 2LAHA 2VGYA 2DCPA 5G04C 5HQ8A 3ML8A 3ZYQA 1IYGA 2XQ0A 3FU0A 4GMLA 2XPIA 2RG8A 3CLJA 1ELKA 3PH0C 4RG9A 1UN8A 4K0RA 3UQ3A 4UWFA 4DLOA 3IHVA 2KC7A 2YHCA 3PNTB 2XPZA 3L17A 3QB2A 1LF8A 2WQ6A 3CHOA 3CVQA 4ACKA 3FUHA 3SNXA 3SI5A 2PL2A 3FU5A 2VQ2A 4F3VA 2HR2A 3K9IA 4WWNA 3L08A 4ANUA 3FH5A 4A3TA 3EIJA 2WXLA 3FEXA 4B8CB 4CRWA 5KJLA 3VTXA 3I4RB 4UI9J 3MKQA 1H6KA 3UT4A 2PZIA 4I1MA 2VTBB 2WXQA 4IN3B 4U0UA 4UWHA 3ZYKA 5LCWC 2XGMA 2L9BA 2GRMA 3DBSA 1OWMA 2LAIA 4DI4A 1E7VA 4GYYA 2I9CA 4MKTA 3G2TA 5EX3A 4LCTA 5FWQA 1DVPA 3LY8A 3PUJA 4JHKA 3URZA 3MA5A 3ZIMA 3E4BA 4CGWA 1UJJA 3RO3A 3QJZA 3R7QA 2XPYA 4GZ6A 5G55A 4ME2A 3S7JA 3OXGA 4AVXA 4GA2A 3RO2A 3GYZA 3LS8A 3R9AB 4FLBA 4V3IA 2FULA 5LFAA 3KAEA 2HYZA 3I3NA 1XNFA 4FA6A 4PDXA 3ZGQA 2ZU6B 1SZAA 4FU3A 1NP7A 4ANVA 3SBSA 1N52A 3PDNA 1EDUA 4L7TA 3NQPA 4XIFA 4MRUA 1OWNA 1BPOA 3RU0A 2HO1A 2MOWA 2WXOA 3PE3A 2CG3A 2KM4A 2WXRA 3ASGA 4GA1A 5CCLA 2AW6A 4IYPA 3ZPJA 4L23A 5LP0A 3SF4A 2HM8A 4BTBA 4HOTA 4JC8A 3HIZA 3PVLA 2YINA 2C0LA 5BW8C 1WAO1 3LKUA 4J8DA 3T5VA 4I1OB 4B8AA 4I6GA 1FVHA 4KYOB 1OWOA 4MLPA 1SZ9A 3Q5MA 4GB9A 4RSYA 3I4GA 4OVUA 4KBQA 4K03A 2XCBA 2JEKA 2XEVA 3Q47B 5AENA 5T4YA 5M72A 4APFA 4UI9C 4GMJA 5KJMA 4FADA 3CHRA 2UY1B 1GW6A 3OTNA 4G25A 4KMOA 3MV3B 2IOSA 3ZHEB 4URKA 3ASDA 3CHSA 2V8SE 3ASHA 3FU6A 4G24A 3FTWA 5KJKA 1INZA 1UG3A 1B89A 3D9LA 2GRLA 5CMYA 5DIZA 4AY5A 5BV0A 5EDSA 3APDA 2FI7A 4UQYA 3FULA 4EPZA 3QAQA 3FUIA 3PS6A 3BEEA 4BWRA 3MYVA 1FCHA 4CEMA 3L54A 4PS8A 3RRUA 3JQ0A 4G1TA 3L6AA 3U4TA 3FHEA 1TJFA 3MZLB 2WM9A 4WNDA 2DBAA 4AIFA 2J49A 3TXNA 2PQNA 3FH7A 3APCA 2CFZA 4C9BB 2CHZA 5J90A 3VLFA 2VJ8A 4L2YA 3TG4A 4NRHB 1KT1A 2YNQA 3MKRA 3PUKA 5CMWA 1L5JA 1QNFA 1YA0A 2CG2A 2KCVA 3OAWA 4I43A 4B89A 3CVWA 4GU5A 4N3BA 3QOUA 3FUEA 3CIAA 4H7YA 1PY1A 4I2ZA 1JWGA 3LEWA 4IRUA 2VSOE 3QC1A 2VYIA 4PH4B 4U8HA 5ARFA 2J9QA 1IQRA 5KCMA 4Q69A 5KJNA 3IHYA 1HS6A 4GZCA 3PNLB 2FBNA 4GAAA 1H2VC 1PAQA 4N5CA 2J4DA 2X6HA 1KT0A 3JYSA 4Q94A 1DNPA 1Y8MA 4N39A 3JUIA 1WM5A 3CHQA 3UX4A 4GZ5A 2ONDA 4AM9A 4LERA 3IV0A 4HFGA 3CR3A 3WXXA 5BPPA 5C1DA 3FY4A 3KD7A 4D10C 5JJ7A 3D9PA 4ABNA 2L0TB 1EPUA 4J8EA 3C98A 4AP2A 1WY6A 4BT9A 2A5UA 2WMNA 2I1JA 3BG0B 4KXKB 1KLXA 3CV0A 4L1BA 5FQ6A 5EKQD 3HDXA 1HX8A 3L22A 3CKCA 2VGXA 1HG2A 5BT1A 2WB2A 1E8ZA 5BV1A 5LOZA 4XI9A 5FQ4A 5D0OD 2WXMA 2PM7A 3T8MA 5FZSA 3QWPA 1H0AA 3LJ3A 2BF0X 2MRIA 3SZ7A 3FTYA 3D9MA 2E0IA 1JUQA 4H7XA 4JVSA 3APFA 2GW1A 4B0ZA 4AJWA 2DIWA 4R7LA 4NURA 3RIBA 3P2BA 4C0EA 3FTXA 3G2UA 2IJGX 4GCNA 1S0PA 4J0UA 2GGFA 2WQ7A 1HG5A 4J6IA 1E7UA 3SFZA 1JWFA 1QZ2A 2FF4A 2J08A 2LNIA 3MX3A 3EDTB 2CHWA 4UWLA 3RJVA 4JA7A 2I2OA 4HLEA 1P5QA 2KZTA 3ONKA 3D9JA 4I6EA 2XRYA 3MEKA 3CK9A 4FHJA 4WNGA 4DLQA 2LO6A 4U07A 5FTPA 3BG1B 1JPLA 2XGOA 4JW1A 3PZDA 2I1KA 2J07A 2V5FA 4UQZA 4BSXA 4HVBA 2OVFA 3B7TA 2NSZA 4NQ0A 4OVVA 5FQ7A 1Y6IA 3S7FA 3S7DA 2X38A 2WXIA 5JHAA 4WWPA 3AU4A 3AU5A 1A17A 5AYWD 4CDNA 2J09A 3EHMA 1Z3YA 3PEUB 4N2QA 4M3OA 4CT4A 2V0PA 3FH8A 2OOEA 3CGHA 4PUCA 3QARA 5G05J 4W9RA 1E8XA 3TAXA 2VTBA 3CVYA 4TV3A 3S7BA 3OXLA 4I2WA 3FUNA 4JPSA 3Q4AB 4FJZA 4GZDA 5CHEE 4J8SA 1H2TC 2UWJG 1OWLA 1EYHA 3L13A 2EQXA 3KEZA 3EHNA 3CVPA 4JA9A 4JHRA 3R7RA 3UT8A 4BX9A 5FZQA 5ENNA 3CVXA 1U3DA 4FHKA 3NZUA 3D9OA 1ZU2A 3HVEB 3OXFA 4GYWA 4HOSA 4MS6A 2CHXA 3CQCB 4UQXA 3PEVB 3IEGA 5EX0A 3G2VA 5JHBA 4G11A 1OWPA 4EECA 4JEUA 2RD0A 1E8WA 5A6CA 4J8FA 1H2UA 3UPVA 2KCKA 2IQCA 2V4LA 4XI0A 2WXKA 1HZ4A 2XGSA 2WQHA 4HOUA 4P29A 2XHEA 3RKVA 2I6HA 3FFLA 3GW4A 3ZXSA 3ZYMA 2VSYA 4G26A 3ENEA 3I5PA 3ESKA 4I1AA 3AS4A 4I6JA 3NF1A 4Q96A 5ANRA 2E2EA 5E76A 4EBAA 2JLBA 3FUFA 3HHMA 3B7SA 3RK6A 4FLHA 3ZYLA 4DJAA 3U66A 2NC9A 3VLDA 1E90A 2FEZA 3CVLA 3FUJA 4BTAA 4CDMA 3PRZA 4KZCA 3O48A 2AXUA 3G2SA 4APOA 4XKCA 2IF4A 4JZYA 4YVQC 1UJKA 2P58C 4E6HA 4F7AA 4LUNU 4AEZC 2X3MA 2BUGA 3T5XA 3LVRE 3MCXA 3ZN3A 4E85A 4Y6CA 5LX8A 1UW4B 3L16A 3MKQB 5C2YA 3AS5A 1HF8A 3LDZA 2UY1A 5G05C 4Y6WA 4DK5A 3ZHEA 3D9NA 1Z6TA 3SBTB 5D0QD 4XZ4A 4PS7A 4EZJA 2XCCA 2LSUA 5DBKA 2AXVA 3JCKC 3CVNA 3UT7A 4WAFA 3TL5A 2IOLA 4F1SA 1UN9A 3QKYA 4U63A 2IONA 3D9IA 2WXJA 1FVFA 4GYOA 4KVMA 4C0MA 2IFUA 4QFVA 2AVPA 3CKBA 4N3AA 2VSXE 4HORA 4RVBA 4AXHA 4GCOA 4AY6A 2C0MA 3PREA 2KZTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUY A;  3HYM B;  3KS2 A;  3PE4 A;  3FWV A;  3MV2 B;  5FJY A;  4JL0 A;  2C2L A;  3TGO A;  3N71 A;  3VTY A;  2R5S A;  4G23 A;  4I9E A;  1TJC A;  5BNW A;  4GPK A;  4A1S A;  4UI9 K;  4YND A;  2KAT A;  2Y4T A;  3LY7 A;  5ARG A;  1NZN A;  3TG5 A;  4I9C A;  3GZ1 A;  4O6F A;  3CK8 A;  1HH8 A;  1PC2 A;  4CDR A;  2LSV A;  1QQE A;  2KCL A;  4RG6 A;  2WPV A;  4YVO A;  3Q49 B;  1ZBP A;  4CGV A;  2FO7 A;  3ASF A;  5JJ6 A;  2VSN A;  4GA0 A;  4I17 A;  4BT8 A;  1NA3 A;  5G04 J;  3U3W A;  5JJT A;  4G2V A;  3CEQ A;  2MHK A;  3LPZ A;  4U0Z A;  3LY9 A;  3ZFW A;  3Q15 A;  3LYA A;  5CCM A;  5FZR A;  3CK7 A;  4N3C A;  3QDN A;  3QWW A;  3AS8 A;  4WNE A;  5HI7 A;  1NA0 A;  1OUV A;  4U04 A;  5A7D B;  3FP3 A;  5LCW J;  4EQF A;  4U0S A;  3UUX A;  1IHG A;  5FT9 A;  2QFC A;  2L6J A;  3QWV A;  2VGX B;  2Y4U A;  2YQ8 A;  2Q7F A;  4LEU A;  4N2S A;  1HXI A;  1ELW A;  4WNF A;  1W3B A;  3LCA A;  4B94 A;  2PQR A;  3GZ2 A;  1ELR A;  4GZ3 A;  1E96 B;  3ULQ A;  2VGY A;  5G04 C;  5HQ8 A;  1IYG A;  2XPI A;  4RG9 A;  3UQ3 A;  2KC7 A;  2YHC A;  3CVQ A;  2PL2 A;  2VQ2 A;  4F3V A;  2HR2 A;  3K9I A;  5KJL A;  3VTX A;  4UI9 J;  2PZI A;  4U0U A;  4IN3 B;  5LCW C;  2XGM A;  4GYY A;  5EX3 A;  3LY8 A;  3URZ A;  3MA5 A;  3E4B A;  4CGW A;  3RO3 A;  4GZ6 A;  4ME2 A;  3S7J A;  3OXG A;  4GA2 A;  3RO2 A;  3GYZ A;  3R9A B;  3KAE A;  2HYZ A;  1XNF A;  3ZGQ A;  3PDN A;  4XIF A;  3RU0 A;  2HO1 A;  3PE3 A;  4GA1 A;  3ASG A;  5CCL A;  3ZPJ A;  3SF4 A;  4BTB A;  4HOT A;  5BW8 C;  2C0L A;  1WAO 1;  3LKU A;  4J8D A;  4KYO B;  3Q5M A;  4KBQ A;  2XCB A;  2XEV A;  3Q47 B;  5M72 A;  4UI9 C;  5KJM A;  2UY1 B;  4G25 A;  3MV3 B;  3ZHE B;  3ASD A;  3ASH A;  4G24 A;  5KJK A;  1B89 A;  5DIZ A;  4AY5 A;  2FI7 A;  4UQY A;  3BEE A;  4BWR A;  1FCH A;  4G1T A;  3U4T A;  4WND A;  2DBA A;  4AIF A;  2PQN A;  3TG4 A;  4NRH B;  1KT1 A;  3MKR A;  1YA0 A;  2KCV A;  4N3B A;  3QOU A;  4H7Y A;  4I2Z A;  2VYI A;  5ARF A;  5KJN A;  2J9Q A;  2FBN A;  4N5C A;  1KT0 A;  3JYS A;  1Y8M A;  4N39 A;  1WM5 A;  4GZ5 A;  2OND A;  4AM9 A;  3WXX A;  5C1D A;  3KD7 A;  5JJ7 A;  4ABN A;  4J8E A;  4BT9 A;  4KXK B;  1KLX A;  3CV0 A;  5EKQ D;  3CKC A;  2VGX A;  5BT1 A;  4XI9 A;  5D0O D;  5FZS A;  3QWP A;  3SZ7 A;  4H7X A;  2GW1 A;  3RIB A;  4GCN A;  4J0U A;  1QZ2 A;  2FF4 A;  2LNI A;  3EDT B;  3RJV A;  4JA7 A;  1P5Q A;  3MEK A;  4WNG A;  3CK9 A;  4U07 A;  5FTP A;  2XGO A;  4UQZ A;  2V5F A;  4NQ0 A;  3S7F A;  3S7D A;  1A17 A;  5AYW D;  4N2Q A;  2OOE A;  5G05 J;  4W9R A;  3TAX A;  3S7B A;  3OXL A;  4I2W A;  3Q4A B;  5CHE E;  2UWJ G;  4JA9 A;  4JHR A;  3CVP A;  5FZQ A;  1ZU2 A;  3OXF A;  4GYW A;  4HOS A;  4UQX A;  3IEG A;  5EX0 A;  5A6C A;  4J8F A;  3UPV A;  2KCK A;  4XI0 A;  1HZ4 A;  2XGS A;  2WQH A;  4HOU A;  3RKV A;  2I6H A;  3FFL A;  3GW4 A;  2VSY A;  4G26 A;  3ESK A;  4I1A A;  3AS4 A;  3NF1 A;  2E2E A;  2JLB A;  2NC9 A;  2FEZ A;  3CVL A;  4BTA A;  3O48 A;  4APO A;  2IF4 A;  4YVQ C;  2P58 C;  2BUG A;  3ZN3 A;  4Y6C A;  3AS5 A;  5G05 C;  2UY1 A;  4Y6W A;  3ZHE A;  5D0Q D;  2XCC A;  2LSU A;  5DBK A;  3CVN A;  3QKY A;  4GYO A;  2IFU A;  2AVP A;  3CKB A;  4N3A A;  4HOR A;  4GCO A;  4AY6 A;  2C0M A;  4HOQ A; 
#chains in the Genus database with same CATH topology
 1K8K G;  3DRA A;  3ML9 A;  2F8Y A;  3AG3 E;  1TN7 A;  3KS2 A;  4DI3 A;  3F6Q A;  2EIJ E;  2WXP A;  4ACL A;  1QBQ A;  2QYJ A;  2ZGG A;  1Z3X A;  3RRN B;  1HFA A;  4I9E A;  4OYS A;  2XRZ A;  2F37 A;  3T9K A;  1H6P A;  1BU9 A;  2YHE A;  4GPK A;  2IEJ A;  3LY7 A;  2J4B A;  4LG6 A;  3B7U X;  2WXF A;  2EIN E;  3DPY A;  3FTZ A;  2FO1 E;  3NOC D;  2LSV A;  3AG1 E;  4ILH B;  4L2L A;  2L6B A;  5G2N A;  2WPV A;  3DPD A;  1D8E A;  3D9K A;  4J8Y A;  4YVO A;  3SGH A;  4HS2 A;  4KVO A;  3UKR G;  2P9U G;  2R17 C;  2ZIS A;  3ASF A;  4CT0 A;  3ASO E;  3DSV A;  2WVI A;  3U3W A;  2NXP A;  5AAR A;  2P9N G;  4AV7 A;  3LY9 A;  5JA4 D;  1X5B A;  3LYA A;  5T8I A;  4N3C A;  1K1A A;  5KWD A;  4BET A;  1IHB A;  3FTU A;  4HB5 A;  1LD7 A;  5HI7 A;  4A3V A;  1NA0 A;  3MJW A;  3W9F A;  5A7D B;  4HI9 A;  1MHQ A;  4U0S A;  2DYS E;  3HXF A;  2DWZ A;  5FT9 A;  3L82 A;  2VGX B;  3U64 A;  2Y4U A;  2OV8 A;  4HXI A;  4N2S A;  1NI1 A;  2PQR A;  1IQU A;  3ZW3 A;  3CST A;  1MQS A;  3EIQ C;  2DCP A;  3AAA C;  5HQ8 A;  3ZYQ A;  1IYG A;  2XQ0 A;  3UIN C;  2RG8 A;  2R2L A;  3DST A;  3UQ3 A;  3DXK G;  3L17 A;  3ASN E;  1LF8 A;  3CVQ A;  4ACK A;  3SNX A;  3FU5 A;  4F3V A;  2XEN A;  4HLL A;  3FEX A;  4CRW A;  5CED B;  4UI9 J;  3MKQ A;  1NL4 A;  2PZI A;  3DSX A;  2VTB B;  2WXQ A;  2GRM A;  3DBS A;  2GRO B;  4GYY A;  4YDW A;  4QQI A;  5FWQ A;  5D2M C;  4GTM A;  3TWX A;  1UJJ A;  3QJZ A;  5G55 A;  5HKP A;  2DZO A;  2FUL A;  5LFA A;  2RFM A;  1MX4 A;  2HYZ A;  4FA6 A;  2ZU6 B;  1DCQ A;  4ANV A;  4CZ2 D;  1EDU A;  3NQP A;  1BPO A;  5CCL A;  4L23 A;  5BW8 C;  2YIN A;  1WAO 1;  3JXI A;  3PZ4 A;  1FVH A;  2JEK A;  5AEN A;  5M72 A;  4UI9 C;  5KJM A;  3CHR A;  2XS1 A;  4G25 A;  3MV3 B;  3HXC A;  2XZD G;  3ASD A;  1D9S A;  5CMY A;  5EDS A;  2FI7 A;  3NB2 A;  3SY2 A;  4GTV A;  1BI7 B;  3UI2 A;  3MZL B;  2WM9 A;  4AIF A;  2J49 A;  2CFZ A;  3TWT A;  4L2Y A;  3TG4 A;  1KT1 A;  3ABM E;  5CMW A;  1YA0 A;  1QNF A;  4B89 A;  3QOU A;  3Q7F A;  4RLY A;  5KCM A;  4PH4 B;  4U8H A;  4YDY A;  5KJN A;  3PNL B;  2FBN A;  1H2V C;  4N5C A;  3JYS A;  4J7W A;  4Z68 A;  3CHQ A;  3UX4 A;  4LER A;  2LUH A;  3IV0 A;  3KD7 A;  4D10 C;  3D9P A;  4ABN A;  1WY6 A;  3Q9N C;  2WMN A;  1N0Q A;  3BG0 B;  5FQ6 A;  3EHR A;  5EKQ D;  3HDX A;  1HX8 A;  3L22 A;  3Q9U C;  3CKC A;  2WXM A;  2RKK A;  3LJ3 A;  3SZ7 A;  3FTY A;  2GW1 A;  1MZC A;  3NAW A;  4GCN A;  2GGF A;  4J6I A;  3SFZ A;  1JWF A;  1QZ2 A;  1FT1 A;  3RJV A;  1P5Q A;  3ISM C;  4I6E A;  3CK9 A;  3ABK E;  4U07 A;  4BSX A;  2J07 A;  4OVV A;  5KNH D;  2WXI A;  2ETC A;  4CDN A;  1ZB1 A;  4O1P A;  2V0P A;  4CT4 A;  3FH8 A;  5G05 J;  3Q7A A;  3ABL E;  3NBN B;  3S7B A;  3OXL A;  3ZNG A;  4I2W A;  3FUN A;  4JPS A;  3Q4A B;  4FJZ A;  4GZD A;  1H2T C;  1BD8 A;  1N4P A;  2EQX A;  3R7R A;  3UT8 A;  4BX9 A;  5ENN A;  3HVE B;  4GTT A;  4MS6 A;  1OT8 A;  2P9I G;  2P2C P;  4UUC A;  4JEU A;  3Q73 A;  4XEI G;  5HS0 A;  2IQC A;  2WXK A;  1AP7 A;  2WQH A;  3GW4 A;  4G26 A;  3C3R A;  3FUF A;  3HHM A;  3B7S A;  3RK6 A;  3E30 A;  5EID A;  2DYR E;  3FUJ A;  2IF4 A;  2P58 C;  2A5E A;  1TNO A;  2BUG A;  4E85 A;  3ZN3 A;  1BLX B;  4Y6C A;  3V31 A;  2DZN A;  3AS5 A;  3LDZ A;  5G05 C;  4Y6W A;  3ZHE A;  2QYU A;  4XZ4 A;  2LSU A;  5DBK A;  3CVN A;  3HG0 D;  2IOL A;  4F1S A;  3UM0 A;  4HOR A;  1TNB A;  4AXH A;  4JEH A;  4TUM A;  3TWR A;  3HXD A;  2QY7 A;  4WUY A;  4ANX A;  4CCA A;  3HYM B;  2KBX A;  3EHQ A;  4HRL A;  5ENR D;  4EZK A;  2C2L A;  4ILG A;  1OCZ E;  3N71 A;  4HBD A;  5BUZ A;  3UIP C;  3Q79 A;  3TXM A;  2IY0 C;  3FU3 A;  4A1S A;  4UI9 K;  3TG5 A;  5AJD A;  5AQA A;  4O6F A;  3BUA A;  3ZEF A;  5ENP D;  2WMO A;  4K5A B;  1QQE A;  5ITZ F;  5D66 A;  2KCL A;  3C3Q A;  2MYO A;  3FEY A;  3UXG A;  4IUL A;  4CGV A;  3TWQ A;  5JJ6 A;  5CER B;  2AWI A;  1N4R A;  4F6R D;  4FC8 A;  4I17 A;  4KZ0 A;  4BT8 A;  1FPP A;  4TUU A;  3V2X A;  1NA3 A;  5G04 J;  4BER A;  3CSF A;  5AJL A;  4G2V A;  3CEQ A;  3LPZ A;  4U0Z A;  4JXT A;  4DRX E;  4K5C A;  3IXE A;  2PM6 A;  4FP7 A;  2X6I A;  3CK7 A;  3ONL A;  3QWW A;  1VDY A;  4CYM D;  1OUV A;  2CFU A;  2H6H A;  2QFC A;  2L6J A;  3FTS A;  3ZXP A;  1SVX A;  4FJY A;  2YQ8 A;  2X6J A;  4LEU A;  5CEC B;  1HXI A;  4WWO A;  3MGB A;  4FUL A;  1ELR A;  4ILI A;  4UWG A;  4A1G A;  4JHJ A;  2VGY A;  5G04 C;  5CBO A;  3ML8 A;  1N4S A;  3CLJ A;  3RSE G;  4DLO A;  2YHC A;  3PNT B;  5KBA A;  2WQ6 A;  2OEW A;  3CHO A;  5B3S E;  2PL2 A;  2VQ2 A;  2HR2 A;  1TN8 A;  4M7C A;  3FH5 A;  3EIJ A;  2B0O E;  5KJL A;  4TXR A;  3I4R B;  3UT4 A;  1H6K A;  2IO3 C;  4U0U A;  4IN3 B;  2XGM A;  2LAI A;  4U8Y D;  1E7V A;  1V55 E;  4LCT A;  4DX1 A;  1DVP A;  3LY8 A;  3URZ A;  3ZIM A;  3E4B A;  3RO3 A;  5BXO A;  3S7J A;  3RO2 A;  3GYZ A;  3R9A B;  4HRM B;  1S63 A;  3I3N A;  1XNF A;  1SZA A;  1NP7 A;  4EHM A;  4XIF A;  4MRU A;  1OWN A;  3UM2 A;  2B6C A;  2WXO A;  2WXR A;  2GRR B;  3BQO A;  3SO8 A;  4IYP A;  3SF4 A;  3ULE G;  3LKU A;  1O5M A;  1SA5 A;  4I1O B;  4GB9 A;  4OVU A;  1QYM A;  2XEV A;  1FT2 A;  3SFX A;  1TN6 A;  2UY1 B;  3EU5 A;  4KMO A;  4URK A;  2ETA A;  2EIK E;  2V8S E;  1INZ A;  5KJK A;  1WG0 A;  1B89 A;  3ULY A;  1N11 A;  3APD A;  3UTM A;  4EPZ A;  3PS6 A;  4BWR A;  1MX6 A;  3MYV A;  3L54 A;  4PS8 A;  3U4T A;  3FHE A;  1TJF A;  2DBA A;  4C9B B;  3T8K A;  5J90 A;  2VJ8 A;  4NRH B;  3MKR A;  4GPM A;  5EN5 D;  3CVW A;  2GRQ B;  3FUE A;  1JWG A;  4IRU A;  2VYI A;  1IQR A;  1HS6 A;  4GZC A;  1PAQ A;  4N39 A;  1WM5 A;  1Q2Z A;  3BU8 A;  4AM9 A;  3WXX A;  5BPP A;  5C1D A;  1TYQ G;  4DX7 D;  4J8E A;  2A5U A;  4KXK B;  3CV0 A;  5BT1 A;  1O1T A;  2WB2 A;  1E8Z A;  1X81 A;  4XI9 A;  5D0O D;  3QWP A;  4MBG A;  1KPS B;  5AN8 A;  1O1S A;  1JUQ A;  4H7X A;  4AJW A;  2DIW A;  3P2B A;  4J0U A;  4BSZ B;  4GTR A;  2J08 A;  2FF4 A;  4HLE A;  3EDT B;  4G8L A;  4JA7 A;  1LD8 A;  2KZT A;  4ATZ D;  4DLQ A;  2LO6 A;  3BG1 B;  1JPL A;  2XGO A;  4HVB A;  2OVF A;  5FQ7 A;  3S7F A;  3S7D A;  3AU5 A;  1A17 A;  5AQB A;  3PEU B;  4N2Q A;  4M3O A;  3C5R A;  2OOE A;  3CVY A;  4TV3 A;  1OWL A;  1EYH A;  3EHN A;  3CVP A;  5FZQ A;  3CVX A;  4FHK A;  3NZU A;  1ZU2 A;  4GYW A;  1O1R A;  2CHX A;  5EX0 A;  3G2V A;  5JHB A;  1KZO A;  4ZHB A;  1OWP A;  2EIL E;  1E8W A;  4J8F A;  2QZA A;  2XGS A;  4HOU A;  3ZXS A;  2XHE A;  2I6H A;  3FFL A;  1OCO E;  3ZYM A;  2VSY A;  3ENE A;  4I6J A;  3AS4 A;  4HNA D;  1NFI E;  2BKG A;  3U66 A;  2OEV A;  2FEZ A;  1JCR A;  2AXU A;  4YVQ C;  1UJK A;  4N5Q A;  1N0R A;  3LVR E;  3L16 A;  3MKQ B;  3V2O A;  2LXL A;  4DK5 A;  1Z6T A;  4EZJ A;  2V5Q C;  3JCK C;  3V79 K;  3UT7 A;  1LTX A;  2ION A;  3ZKJ A;  4HI8 A;  2QC9 A;  1D8D A;  2H6I A;  2IFU A;  4QFV A;  2AVP A;  4A63 B;  4GCO A;  2C0M A;  4HOQ A;  2KZT B;  2WXN A;  3PZ2 A;  3CVV A;  2JAB A;  5FJY A;  5ANL A;  4JL0 A;  3TWU A;  3TGO A;  4A55 A;  2ILR A;  3S2A A;  3VTY A;  3FDH A;  1N54 A;  5J08 A;  3EJN A;  3AJI A;  3UMV A;  5ARG A;  4I9C A;  3GZ1 A;  3P1U A;  4DUI A;  3B13 A;  5E75 A;  4CDR A;  4DX6 D;  4DX5 D;  1EF1 C;  4RG6 A;  3C72 A;  1U3C A;  3IKO B;  3VLE A;  2FO7 A;  1E8Y A;  2VSN A;  5ENT D;  4EZL A;  5ENO D;  4GA0 A;  4UWK A;  3CQG B;  4LSZ E;  1HO8 A;  3U9W A;  3B95 A;  3RRM B;  4BY6 A;  2X6F A;  1TEZ A;  3ZFW A;  1MYO A;  3DSS A;  4LRZ A;  2Y3A A;  2P9S G;  3SHF A;  5FIO A;  3LVQ E;  3AS8 A;  3E37 A;  1OY3 D;  3ZVV A;  4WNE A;  2XEE A;  3PZ1 A;  5EIB E;  3LXU X;  3QNK A;  4XKB A;  5LCW J;  3UUX A;  1IHG A;  2ZGD A;  4AOF A;  1H19 A;  2VGE A;  2M63 A;  3QK0 A;  2R03 A;  4WNF A;  4NAC A;  4B94 A;  2WXH A;  3GZ2 A;  4GZ3 A;  1E96 B;  4GML A;  3PH0 C;  1ELK A;  4RG9 A;  1UN8 A;  4K0R A;  4UWF A;  3IHV A;  2KC7 A;  3QB2 A;  1AWC B;  2GRN B;  3FUH A;  3SI5 A;  3HXE A;  4WWN A;  3L08 A;  4ANU A;  5IY5 E;  4B8C B;  3VTX A;  4OAU C;  4I1M A;  4UWH A;  5LCW C;  2BKK B;  1DCE A;  3SQV A;  2I9C A;  4OAV B;  4MKT A;  1N4Q A;  4JHK A;  3MA5 A;  4CGW A;  4YDE A;  3R7Q A;  3OXG A;  3X2Q E;  3LS8 A;  3KSL A;  4GTO A;  4V3I A;  4FU3 A;  3SBS A;  1N52 A;  3PDN A;  3HRA A;  3WG7 E;  2HO1 A;  2MOW A;  4GA1 A;  2AW6 A;  3ZPJ A;  3EUV A;  4BTB A;  3HIZ A;  3PVL A;  2C0L A;  3T5V A;  4U7E B;  4KYO B;  4RSY A;  1SZ9 A;  4F1P A;  3I4G A;  4KBQ A;  4K03 A;  3Q47 B;  5T4Y A;  4APF A;  4GMJ A;  3OTN A;  3ZHE B;  2IOS A;  1U2V G;  3CHS A;  3ASH A;  1UOH A;  4G24 A;  1JCQ A;  1WDY A;  2GRL A;  4AY5 A;  5BV0 A;  3FUL A;  3FUI A;  4CEM A;  3RRU A;  3JQ0 A;  4G1T A;  2DVW A;  4U95 D;  4WND A;  2P9P G;  3TXN A;  2CHZ A;  2YNQ A;  1RW2 A;  1L5J A;  2CG2 A;  3OAW A;  4N3B A;  3CIA A;  4H7Y A;  1YCS B;  3JXJ A;  3LEW A;  2VSO E;  2J9Q A;  4Q69 A;  2OCC E;  3IHY A;  2XEH A;  1KT0 A;  1DNP A;  3JUI A;  3AG2 E;  2ZIR A;  2P9L G;  4GZ5 A;  2OND A;  3CR3 A;  2GRP B;  5JJ7 A;  4AP2 A;  2I1J A;  1KLX A;  4L1B A;  2VGX A;  5BV1 A;  5LOZ A;  5FQ4 A;  1TNZ A;  3EU9 A;  2PM7 A;  5CRV A;  1H0A A;  3D9M A;  2E0I A;  4JVS A;  2BED A;  3APF A;  4B0Z A;  5JMN D;  5H7P A;  2IO2 C;  4B93 B;  1S0P A;  2WQ7 A;  1HG5 A;  1E7U A;  3MX3 A;  2CHW A;  2I2O A;  3MEK A;  4WNG A;  4BEP A;  4UQZ A;  2V5F A;  3B7T A;  4GTP A;  2ETB A;  1Y6I A;  2X38 A;  5JHA A;  1Z5S C;  3AU4 A;  5AYW D;  3CGH A;  5ENS D;  3TWW A;  2KXP C;  3QAR A;  1E8X A;  2VTB A;  5EIL A;  2Y1L E;  4J8S A;  4JA9 A;  2UWJ G;  3L13 A;  4JHR A;  3KEZ A;  2XS8 A;  1U3D A;  3D9O A;  4UQX A;  3PEV B;  4LNU D;  2RFA A;  3IEG A;  3V30 A;  4NIK A;  4EEC A;  2ZXW E;  3KEA A;  1IKN D;  3UPV A;  2KCK A;  2V4L A;  4P29 A;  1HZ4 A;  2PNN A;  3TWS A;  4DI4 A;  3ESK A;  5ANR A;  1SA4 A;  5E76 A;  3PZ3 A;  4Q96 A;  2E2E A;  1N94 A;  1K1B A;  3ZYL A;  2NC9 A;  4HRN A;  4BES A;  3VLD A;  3CVL A;  4KZC A;  4X8Q A;  4APO A;  3G2S A;  4HQD A;  4XKC A;  4JZY A;  3JUE A;  4E6H A;  4F7A A;  4AEZ C;  3DWL G;  3T5X A;  3MCX A;  5LX8 A;  1K3Z D;  2H6F A;  1HF8 A;  3D9N A;  5BXU A;  3UM3 A;  4JD2 G;  2AXV A;  3LJN A;  4WAF A;  3TL5 A;  2V4H C;  1UN9 A;  3QKY A;  4U63 A;  5B1A E;  5AQ9 A;  3CKB A;  4N3A A;  2AJA A;  3E34 A;  4YDO A;  1TR4 A;  4AY6 A;  3PRE A;  3NZS A;  1XGW A;  3HXB A;  3PE4 A;  3FWV A;  3MV2 B;  3J5Q B;  3O4Z A;  2F0Y A;  5AIJ A;  2XZT G;  2R5S A;  3Q75 A;  4PS3 A;  4G23 A;  5T3R A;  1TJC A;  5BNW A;  2WXG A;  4KT6 B;  4XE0 A;  1HU3 A;  4YND A;  2KAT A;  2Y4T A;  2BTD A;  1NZN A;  2R59 A;  4LNB A;  3NOG D;  2LXM A;  2OVB A;  3Q78 A;  3GZS A;  1OCC E;  3FUD A;  4TRQ A;  3CVU A;  3FUM A;  1SW6 A;  1HH8 A;  3CK8 A;  1PC2 A;  5FQ8 A;  3CHP A;  1V54 E;  3KSQ A;  3G2W A;  1N9A A;  2AXZ A;  3TJP A;  1OCR E;  3B7R L;  3Q49 B;  1ZBP A;  3JQ1 A;  4RQI A;  1DC2 A;  4XX5 A;  3SD5 A;  1N95 A;  3E33 A;  2A4Z A;  3IBE A;  1MJ0 A;  4L9P A;  5JJT A;  3FTV A;  3FUK A;  3UIO C;  2MHK A;  3D9H A;  2P9K G;  3Q15 A;  5CCM A;  5FZR A;  4ATG A;  5CEA A;  3QDN A;  1SQM A;  3TWV A;  1H6O A;  3UM1 A;  4BFR A;  2X6K A;  4BX8 A;  4U04 A;  3FP3 A;  4EQF A;  3DEP A;  3B7B A;  3QWV A;  3ZRH A;  3D3M A;  2Q7F A;  3HVE A;  5HRY A;  5A23 A;  4ZFH A;  1ELW A;  1W3B A;  4ANW A;  3LCA A;  3CHM A;  2L0I A;  4DPR A;  4EBA G;  2IU1 A;  3ULQ A;  4F53 A;  1HE8 A;  3ESL A;  2LAH A;  4GMR A;  3FU0 A;  2XPI A;  4U8V D;  2XPZ A;  3K9I A;  4K5B A;  4A3T A;  2WXL A;  3ZYK A;  2L9B A;  1OWM A;  3G2T A;  5EX3 A;  3PUJ A;  4DX2 A;  2H6G A;  2XPY A;  4GZ6 A;  4ME2 A;  4AVX A;  3DSU A;  4GA2 A;  4FLB A;  4G8K A;  3KAE A;  4PDX A;  3ZGQ A;  4L7T A;  3RU0 A;  1G3N B;  3PE3 A;  2CG3 A;  2KM4 A;  3ASG A;  5LP0 A;  3R9M A;  2HM8 A;  4HOT A;  4JC8 A;  3C3O A;  4J8D A;  1TNU A;  4B8A A;  4I6G A;  3DSW A;  1OWO A;  1MX2 A;  4MLP A;  3Q5M A;  1A5E A;  2XCB A;  5KNG A;  4FAD A;  1GW6 A;  1IXV A;  3DEO A;  2EIM E;  3FU6 A;  3FTW A;  1UG3 A;  1YMP A;  3D9L A;  5DIZ A;  4UQY A;  3QAQ A;  3BEE A;  1FCH A;  4GTQ A;  5B1B E;  3L6A A;  4C48 B;  4O60 A;  2PQN A;  3FH7 A;  3APC A;  3VLF A;  4TXP A;  3PUK A;  5FIN A;  4I43 A;  1KZP A;  2KCV A;  4GU5 A;  1PY1 A;  4I2Z A;  3QC1 A;  5ARF A;  4LNG A;  5ENQ D;  4GAA A;  2J4D A;  2X6H A;  4Q94 A;  1Y8M A;  4JB8 P;  3E32 A;  3SFY A;  1YYH A;  1TNY A;  4HFG A;  3FY4 A;  2L0T B;  1EPU A;  3C98 A;  4BT9 A;  3ZUV B;  5AAO A;  3RAU A;  1HG2 A;  5CBN A;  3T8M A;  5FZS A;  2BF0 X;  2MRI A;  1RZ4 A;  4R7L A;  4NUR A;  3RIB A;  4TXQ A;  4C0E A;  3FTX A;  5CRU A;  3G2U A;  1S70 B;  2IJG X;  2F8X K;  2LNI A;  4UWL A;  2Y69 E;  4GTS A;  3ONK A;  3D9J A;  2XRY A;  4FHJ A;  5FTP A;  4JW1 A;  3PZD A;  2I1K A;  3W9G A;  2NSZ A;  4NQ0 A;  2R02 A;  1OXJ A;  4WWP A;  2J09 A;  3EHM A;  1Z3Y A;  2HE0 A;  4PUC A;  2NYJ A;  4W9R A;  3TAX A;  5EYL A;  2J8S D;  5CHE E;  1S64 A;  1JCS A;  2R05 A;  4U96 D;  3OXF A;  4HOS A;  3CQC B;  4O1O A;  3ZU7 B;  4G11 A;  2RD0 A;  5A6C A;  3DXM G;  1H2U A;  4XI0 A;  3RKV A;  3I5P A;  4I1A A;  3NF1 A;  4EBA A;  2JLB A;  4FLH A;  4DJA A;  3UKU G;  1E90 A;  2Y0B G;  4BTA A;  4CDM A;  3PRZ A;  3O48 A;  3J5P A;  5AQ7 A;  5EYP F;  4LUN U;  2X3M A;  1UW4 B;  5C2Y A;  2UY1 A;  3AG4 E;  3SBT B;  5D0Q D;  4PS7 A;  2XCC A;  3L9T A;  1BI8 B;  3D9I A;  2WXJ A;  1FVF A;  4GYO A;  4KVM A;  4C0M A;  2VSX E;  4RVB A; 
#chains in the Genus database with same CATH homology
 4JEH A;  3ML9 A;  2WXN A;  2QY7 A;  1XGW A;  4WUY A;  4ANX A;  4CCA A;  3HYM B;  3KS2 A;  3PE4 A;  4DI3 A;  3CVV A;  3FWV A;  3MV2 B;  2WXP A;  4EZK A;  5FJY A;  5ANL A;  4JL0 A;  2C2L A;  4ILG A;  3O4Z A;  4ACL A;  3TGO A;  3N71 A;  5AIJ A;  4A55 A;  5BUZ A;  2ILR A;  3S2A A;  1Z3X A;  2R5S A;  3RRN B;  3VTY A;  3FDH A;  4PS3 A;  1HFA A;  1N54 A;  4G23 A;  4I9E A;  4OYS A;  2XRZ A;  3TXM A;  5J08 A;  5T3R A;  1TJC A;  5BNW A;  3FU3 A;  3EJN A;  2YHE A;  2WXG A;  4GPK A;  4A1S A;  4KT6 B;  4UI9 K;  1HU3 A;  4XE0 A;  4YND A;  2KAT A;  3UMV A;  2Y4T A;  2BTD A;  3LY7 A;  5ARG A;  1NZN A;  2J4B A;  2R59 A;  3TG5 A;  2OVB A;  4I9C A;  3B7U X;  2WXF A;  3GZ1 A;  3GZS A;  5AJD A;  3P1U A;  3B13 A;  3FUD A;  4O6F A;  4TRQ A;  3ZEF A;  3FUM A;  3CVU A;  3CK8 A;  1HH8 A;  1PC2 A;  5E75 A;  3FTZ A;  3NZS A;  2WMO A;  4CDR A;  2LSV A;  5FQ8 A;  4ILH B;  4L2L A;  3CHP A;  1QQE A;  2KCL A;  3G2W A;  1EF1 C;  4RG6 A;  2WPV A;  5G2N A;  2AXZ A;  3DPD A;  3D9K A;  1U3C A;  3TJP A;  3FEY A;  4YVO A;  3IKO B;  3B7R L;  3SGH A;  3Q49 B;  4HS2 A;  4IUL A;  4KVO A;  3VLE A;  1ZBP A;  4CGV A;  3JQ1 A;  2FO7 A;  1E8Y A;  2R17 C;  3ASF A;  5JJ6 A;  2AWI A;  4XX5 A;  2VSN A;  3SD5 A;  4EZL A;  4GA0 A;  2A4Z A;  4UWK A;  3IBE A;  4CT0 A;  4FC8 A;  4I17 A;  3CQG B;  4KZ0 A;  4BT8 A;  2WVI A;  4TUU A;  1NA3 A;  1HO8 A;  5G04 J;  3U3W A;  2NXP A;  3U9W A;  5JJT A;  3RRM B;  3CSF A;  3FTV A;  5AJL A;  4BY6 A;  3FUK A;  2X6F A;  4G2V A;  1TEZ A;  3CEQ A;  4AV7 A;  2MHK A;  3LPZ A;  4U0Z A;  3LY9 A;  3ZFW A;  1X5B A;  4HOQ A;  3Q15 A;  3LYA A;  4JXT A;  5CCM A;  5T8I A;  5FZR A;  4LRZ A;  2Y3A A;  2PM6 A;  4FP7 A;  3SHF A;  2X6I A;  3CK7 A;  4ATG A;  4N3C A;  3QDN A;  1SQM A;  3ONL A;  3LVQ E;  3QWW A;  3AS8 A;  1VDY A;  4BFR A;  2X6K A;  3ZVV A;  4WNE A;  4BX8 A;  3FTU A;  5HI7 A;  4A3V A;  1NA0 A;  1OUV A;  3LXU X;  3MJW A;  4U04 A;  3QNK A;  4XKB A;  5A7D B;  2CFU A;  3FP3 A;  4EQF A;  5LCW J;  1MHQ A;  4U0S A;  3UUX A;  1IHG A;  5FT9 A;  2QFC A;  2L6J A;  3QWV A;  3FTS A;  4AOF A;  1H19 A;  2VGX B;  3ZRH A;  3U64 A;  2Y4U A;  2OV8 A;  4FJY A;  3D3M A;  2YQ8 A;  2Q7F A;  2M63 A;  3QK0 A;  4HXI A;  3HVE A;  2X6J A;  4LEU A;  4N2S A;  5A23 A;  1HXI A;  4WWO A;  1ELW A;  4WNF A;  1W3B A;  4ANW A;  3LCA A;  4NAC A;  3MGB A;  4FUL A;  4B94 A;  2PQR A;  2WXH A;  3GZ2 A;  1ELR A;  2L0I A;  3CHM A;  4GZ3 A;  4DPR A;  4ILI A;  4EBA G;  1IQU A;  1E96 B;  3ZW3 A;  2IU1 A;  3ULQ A;  4F53 A;  4UWG A;  3CST A;  1HE8 A;  1MQS A;  3ESL A;  4A1G A;  3EIQ C;  4JHJ A;  2LAH A;  2VGY A;  2DCP A;  5G04 C;  5HQ8 A;  3ML8 A;  3ZYQ A;  1IYG A;  2XQ0 A;  3FU0 A;  4GML A;  2XPI A;  2RG8 A;  3CLJ A;  1ELK A;  3PH0 C;  4RG9 A;  1UN8 A;  4K0R A;  3UQ3 A;  4UWF A;  4DLO A;  3IHV A;  2KC7 A;  2YHC A;  3PNT B;  2XPZ A;  3L17 A;  3QB2 A;  1LF8 A;  2WQ6 A;  3CHO A;  3CVQ A;  4ACK A;  3FUH A;  3SNX A;  3SI5 A;  2PL2 A;  3FU5 A;  2VQ2 A;  4F3V A;  2HR2 A;  3K9I A;  4WWN A;  3L08 A;  4ANU A;  3FH5 A;  4A3T A;  3EIJ A;  2WXL A;  3FEX A;  4B8C B;  4CRW A;  5KJL A;  3VTX A;  3I4R B;  4UI9 J;  3MKQ A;  1H6K A;  3UT4 A;  2PZI A;  4I1M A;  2VTB B;  2WXQ A;  4IN3 B;  4U0U A;  4UWH A;  3ZYK A;  5LCW C;  2XGM A;  2L9B A;  2GRM A;  3DBS A;  1OWM A;  2LAI A;  4DI4 A;  1E7V A;  4GYY A;  2I9C A;  4MKT A;  3G2T A;  5EX3 A;  4LCT A;  5FWQ A;  1DVP A;  3LY8 A;  3PUJ A;  4JHK A;  3URZ A;  3MA5 A;  3ZIM A;  3E4B A;  4CGW A;  1UJJ A;  3RO3 A;  3QJZ A;  3R7Q A;  2XPY A;  4GZ6 A;  5G55 A;  4ME2 A;  3S7J A;  3OXG A;  4AVX A;  4GA2 A;  3RO2 A;  3GYZ A;  3LS8 A;  3R9A B;  4FLB A;  4V3I A;  2FUL A;  5LFA A;  3KAE A;  2HYZ A;  3I3N A;  1XNF A;  4FA6 A;  4PDX A;  3ZGQ A;  2ZU6 B;  1SZA A;  4FU3 A;  1NP7 A;  4ANV A;  3SBS A;  1N52 A;  3PDN A;  1EDU A;  4L7T A;  3NQP A;  4XIF A;  4MRU A;  1OWN A;  1BPO A;  3RU0 A;  2HO1 A;  2MOW A;  2WXO A;  3PE3 A;  2CG3 A;  2KM4 A;  2WXR A;  3ASG A;  4GA1 A;  5CCL A;  2AW6 A;  4IYP A;  3ZPJ A;  4L23 A;  5LP0 A;  3SF4 A;  2HM8 A;  4BTB A;  4HOT A;  4JC8 A;  3HIZ A;  3PVL A;  2YIN A;  2C0L A;  5BW8 C;  1WAO 1;  3LKU A;  4J8D A;  3T5V A;  4I1O B;  4B8A A;  4I6G A;  1FVH A;  4KYO B;  1OWO A;  4MLP A;  1SZ9 A;  3Q5M A;  4GB9 A;  4RSY A;  3I4G A;  4OVU A;  4KBQ A;  4K03 A;  2XCB A;  2JEK A;  2XEV A;  3Q47 B;  5AEN A;  5T4Y A;  5M72 A;  4APF A;  4UI9 C;  4GMJ A;  5KJM A;  4FAD A;  3CHR A;  2UY1 B;  1GW6 A;  3OTN A;  4G25 A;  4KMO A;  3MV3 B;  2IOS A;  3ZHE B;  4URK A;  3ASD A;  3CHS A;  2V8S E;  3ASH A;  3FU6 A;  4G24 A;  3FTW A;  5KJK A;  1INZ A;  1UG3 A;  1B89 A;  3D9L A;  2GRL A;  5CMY A;  5DIZ A;  4AY5 A;  5BV0 A;  5EDS A;  3APD A;  2FI7 A;  4UQY A;  3FUL A;  4EPZ A;  3QAQ A;  3FUI A;  3PS6 A;  3BEE A;  4BWR A;  3MYV A;  1FCH A;  4CEM A;  3L54 A;  4PS8 A;  3RRU A;  3JQ0 A;  4G1T A;  3L6A A;  3U4T A;  3FHE A;  1TJF A;  3MZL B;  2WM9 A;  4WND A;  2DBA A;  4AIF A;  2J49 A;  3TXN A;  2PQN A;  3FH7 A;  3APC A;  2CFZ A;  4C9B B;  2CHZ A;  5J90 A;  3VLF A;  2VJ8 A;  4L2Y A;  3TG4 A;  4NRH B;  1KT1 A;  2YNQ A;  3MKR A;  3PUK A;  5CMW A;  1L5J A;  1QNF A;  1YA0 A;  2CG2 A;  2KCV A;  3OAW A;  4I43 A;  4B89 A;  3CVW A;  4GU5 A;  4N3B A;  3QOU A;  3FUE A;  3CIA A;  4H7Y A;  1PY1 A;  4I2Z A;  1JWG A;  3LEW A;  4IRU A;  2VSO E;  3QC1 A;  2VYI A;  4PH4 B;  4U8H A;  5ARF A;  2J9Q A;  1IQR A;  5KCM A;  4Q69 A;  5KJN A;  3IHY A;  1HS6 A;  4GZC A;  3PNL B;  2FBN A;  4GAA A;  1H2V C;  1PAQ A;  4N5C A;  2J4D A;  2X6H A;  1KT0 A;  3JYS A;  4Q94 A;  1DNP A;  1Y8M A;  4N39 A;  3JUI A;  1WM5 A;  3CHQ A;  3UX4 A;  4GZ5 A;  2OND A;  4AM9 A;  4LER A;  3IV0 A;  4HFG A;  3CR3 A;  3WXX A;  5BPP A;  5C1D A;  3FY4 A;  3KD7 A;  4D10 C;  5JJ7 A;  3D9P A;  4ABN A;  2L0T B;  1EPU A;  4J8E A;  3C98 A;  4AP2 A;  1WY6 A;  4BT9 A;  2A5U A;  2WMN A;  2I1J A;  3BG0 B;  4KXK B;  1KLX A;  3CV0 A;  4L1B A;  5FQ6 A;  5EKQ D;  3HDX A;  1HX8 A;  3L22 A;  3CKC A;  2VGX A;  1HG2 A;  5BT1 A;  2WB2 A;  1E8Z A;  5BV1 A;  5LOZ A;  4XI9 A;  5FQ4 A;  5D0O D;  2WXM A;  2PM7 A;  3T8M A;  5FZS A;  3QWP A;  1H0A A;  3LJ3 A;  2BF0 X;  2MRI A;  3SZ7 A;  3FTY A;  3D9M A;  2E0I A;  1JUQ A;  4H7X A;  4JVS A;  3APF A;  2GW1 A;  4B0Z A;  4AJW A;  2DIW A;  4R7L A;  4NUR A;  3RIB A;  3P2B A;  4C0E A;  3FTX A;  3G2U A;  2IJG X;  4GCN A;  1S0P A;  4J0U A;  2GGF A;  2WQ7 A;  1HG5 A;  4J6I A;  1E7U A;  3SFZ A;  1JWF A;  1QZ2 A;  2FF4 A;  2J08 A;  2LNI A;  3MX3 A;  3EDT B;  2CHW A;  4UWL A;  3RJV A;  4JA7 A;  2I2O A;  4HLE A;  1P5Q A;  2KZT A;  3ONK A;  3D9J A;  4I6E A;  2XRY A;  3MEK A;  3CK9 A;  4FHJ A;  4WNG A;  4DLQ A;  2LO6 A;  4U07 A;  5FTP A;  3BG1 B;  1JPL A;  2XGO A;  4JW1 A;  3PZD A;  2I1K A;  2J07 A;  2V5F A;  4UQZ A;  4BSX A;  4HVB A;  2OVF A;  3B7T A;  2NSZ A;  4NQ0 A;  4OVV A;  5FQ7 A;  1Y6I A;  3S7F A;  3S7D A;  2X38 A;  2WXI A;  5JHA A;  4WWP A;  3AU4 A;  3AU5 A;  1A17 A;  5AYW D;  4CDN A;  2J09 A;  3EHM A;  1Z3Y A;  3PEU B;  4N2Q A;  4M3O A;  4CT4 A;  2V0P A;  3FH8 A;  2OOE A;  3CGH A;  4PUC A;  3QAR A;  5G05 J;  4W9R A;  1E8X A;  3TAX A;  2VTB A;  3CVY A;  4TV3 A;  3S7B A;  3OXL A;  4I2W A;  3FUN A;  4JPS A;  3Q4A B;  4FJZ A;  4GZD A;  5CHE E;  4J8S A;  1H2T C;  2UWJ G;  1OWL A;  1EYH A;  3L13 A;  2EQX A;  3KEZ A;  3EHN A;  3CVP A;  4JA9 A;  4JHR A;  3R7R A;  3UT8 A;  4BX9 A;  5FZQ A;  5ENN A;  3CVX A;  1U3D A;  4FHK A;  3NZU A;  3D9O A;  1ZU2 A;  3HVE B;  3OXF A;  4GYW A;  4HOS A;  4MS6 A;  2CHX A;  3CQC B;  4UQX A;  3PEV B;  3IEG A;  5EX0 A;  3G2V A;  5JHB A;  4G11 A;  1OWP A;  4EEC A;  4JEU A;  2RD0 A;  1E8W A;  5A6C A;  4J8F A;  1H2U A;  3UPV A;  2KCK A;  2IQC A;  2V4L A;  4XI0 A;  2WXK A;  1HZ4 A;  2XGS A;  2WQH A;  4HOU A;  4P29 A;  2XHE A;  3RKV A;  2I6H A;  3FFL A;  3GW4 A;  3ZXS A;  3ZYM A;  2VSY A;  4G26 A;  3ENE A;  3I5P A;  3ESK A;  4I1A A;  3AS4 A;  4I6J A;  3NF1 A;  4Q96 A;  5ANR A;  2E2E A;  5E76 A;  4EBA A;  2JLB A;  3FUF A;  3HHM A;  3B7S A;  3RK6 A;  4FLH A;  3ZYL A;  4DJA A;  3U66 A;  2NC9 A;  3VLD A;  1E90 A;  2FEZ A;  3CVL A;  3FUJ A;  4BTA A;  4CDM A;  3PRZ A;  4KZC A;  3O48 A;  2AXU A;  3G2S A;  4APO A;  4XKC A;  2IF4 A;  4JZY A;  4YVQ C;  1UJK A;  2P58 C;  4E6H A;  4F7A A;  4LUN U;  4AEZ C;  2X3M A;  2BUG A;  3T5X A;  3LVR E;  3MCX A;  3ZN3 A;  4E85 A;  4Y6C A;  5LX8 A;  1UW4 B;  3L16 A;  3MKQ B;  5C2Y A;  3AS5 A;  1HF8 A;  3LDZ A;  2UY1 A;  5G05 C;  4Y6W A;  4DK5 A;  3ZHE A;  3D9N A;  1Z6T A;  3SBT B;  5D0Q D;  4XZ4 A;  4PS7 A;  4EZJ A;  2XCC A;  2LSU A;  5DBK A;  2AXV A;  3JCK C;  3CVN A;  3UT7 A;  4WAF A;  3TL5 A;  2IOL A;  4F1S A;  1UN9 A;  3QKY A;  4U63 A;  2ION A;  3D9I A;  2WXJ A;  1FVF A;  4GYO A;  4KVM A;  4C0M A;  2IFU A;  4QFV A;  2AVP A;  3CKB A;  4N3A A;  2VSX E;  4HOR A;  4RVB A;  4AXH A;  4GCO A;  4AY6 A;  2C0M A;  3PRE A;  2KZT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...