2LSVA

The nmr high resolution structure of yeast tah1 in complex with the hsp90 c-terminal tail
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structural Analysis Shows How Tah1 Tethers Hsp90 to the R2TP Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone-binding protein/chaperone
molecule keywords TPR repeat-containing protein associated with Hsp90
total genus 30
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lsvA00
1ELRA 1WM5A 4BTAA 4BT9A 3UPVA 3Q49B 2QFCA 4AM9A 2LSUA 2XCBA 4N3AA 2MHKA 5G04J 5BNWA 3MV2B 5FZRA 4WNEA 3K9IA 5EX0A 4WNFA 3LY8A 3CK7A 4IN3B 3MKRA 3CVLA 3PE3A 5BT1A 3RU0A 2UY1B 2IFUA 4HOTA 3TG4A 3ASHA 4GZ5A 4I1AA 3UUXA 1QZ2A 3ESKA 2AVPA 4B94A 4UI9K 4HOSA 4I9EA 2KCKA 5BW8C 3MV3B 3QWWA 1P5QA 4I2ZA 3RJVA 3UQ3A 4G23A 4GPKA 2PZIA 5KJLA 3LY7A 3AS8A 3OXGA 5FJYA 2XGMA 3SF4A 5G05C 3CV0A 1ZU2A 4JA7A 4ME2A 2OOEA 2E2EA 3RO3A 2WQHA 4AIFA 3ZGQA 2LSVA 4N2QA 3GZ2A 4G24A 3JYSA 2NC9A 1FCHA 2ONDA 3LY9A 4GYWA 3VTXA 4N3BA 3GW4A 3PDNA 2VGXB 1OUVA 3NF1A 2VSNA 5HQ8A 2JLBA 2LNIA 4G2VA 3LPZA 2GW1A 4J8EA 2XPIA 3E4BA 4WNDA 4HOUA 3CK8A 2R5SA 4O6FA 4XI9A 2C0LA 3QKYA 3QOUA 4WUYA 3U4TA 3ZN3A 1HXIA 3CVNA 3FP3A 4GZ6A 1ELWA 5JJ6A 3SZ7A 2BUGA 3S7DA 4A1SA 3IEGA 4GYOA 3CK9A 5KJMA 4JL0A 3O48A 2UWJG 4CDRA 3EDTB 4U07A 2HO1A 5FZSA 3ZHEA 2XGSA 3Q5MA 3TAXA 4ABNA 2FBNA 5FTPA 3BEEA 3FWVA 2VSYA 3CEQA 1NA3A 3CKCA 3CVPA 4JHRA 3RIBA 5JJTA 1XNFA 4AY5A 3Q47B 3QWVA 3QDNA 4GCNA 3QWPA 5JJ7A 4U0ZA 4BWRA 1NZNA 2C0MA 4Y6WA 5CCMA 1HZ4A 2PQNA 4LEUA 3RKVA 4UQZA 2FO7A 3CVQA 2KCLA 4N5CA 5D0OD 3ASGA 4APOA 4KBQA 3LCAA 5G05J 5D0QD 3ZFWA 4CGVA 4N2SA 3KS2A 4N3CA 5AYWD 2C2LA 1IHGA 2L6JA 2VYIA 1YA0A 2YHCA 3OXLA 2PQRA 4H7XA 2VQ2A 4G1TA 4RG9A 3R9AB 4BT8A 3KAEA 1HH8A 3LKUA 3KD7A 5KJKA 3WXXA 4NQ0A 3FFLA 4KXKB 4U04A 5FT9A 3VTYA 5M72A 1A17A 3CKBA 4YVQC 3S7JA 2WPVA 4F3VA 5CHEE 5G04C 1QQEA 3ZPJA 4J8DA 4RG6A 4GA1A 1E96B 4J0UA 4H7YA 1KT0A 3LYAA 2IF4A 2PL2A 3URZA 5A6CA 4GCOA 4N39A 4GA0A 4J8FA 1B89A 5ARFA 3MA5A 5C1DA 2Y4TA 2DBAA 2KCVA 5A7DB 5DBKA 5LCWC 3OXFA 3GYZA 1KT1A 1KLXA 1NA0A 4NRHB 4GYYA 4UI9J 3ASDA 3AS5A 4I2WA 5ARGA 3S7FA 3HYMB 4KYOB 2YQ8A 2FI7A 5CCLA 4GA2A 3U3WA 4I9CA 4YNDA 1PC2A 1W3BA 2KATA 4GZ3A 3TG5A 4I17A 2UY1A 4JA9A 4YVOA 3ULQA 4XI0A 4EQFA 4AY6A 3Q4AB 3MEKA 1IYGA 3GZ1A 4UQXA 2Q7FA 5HI7A 1TJCA 2FF4A 2I6HA 3AS4A 4BTBA 5KJNA 4HOQA 3Q15A 2V5FA 4U0SA 2XCCA 3RO2A 4HORA 4CGWA 5EKQD 1ZBPA 2VGYA 3N71A 4G25A 3ZHEB 1WAO1 1Y8MA 3PE4A 4UQYA 5FZQA 2J9QA 4WNGA 2HYZA 2XGOA 4UI9C 4Y6CA 3S7BA 4W9RA 2VGXA 5LCWJ 4XIFA 5EX3A 2Y4UA 2FEZA 3TGOA 2P58C 2XEVA 2HR2A 4U0UA 3ASFA 4G26A 2KC7A 5DIZA
chains in the Genus database with same CATH superfamily
4HI9A 3FHEA 2I1KA 3WG7E 3MKRA 3FY4A 3EJNA 4ZFHA 4GZ5A 5JHAA 2KZTA 2OCCE 3LXUX 1RW2A 3PZ4A 4GTSA 2GRNB 3GZ2A 2PM7A 4C9BB 4UWGA 4N3BA 4OAUC 2B6CA 1BD8A 3LPZA 3E4BA 4FULA 3ZN3A 2BEDA 3LVQE 3CVNA 4GZ6A 4CYMD 4GPMA 4ACKA 3UM1A 4CDRA 5AIJA 1SVXA 4LNUD 3JUIA 4GTPA 4G11A 5D66A 1XNFA 2V5QC 4U0ZA 2Y0BG 4L7TA 1K1AA 1HZ4A 3O4ZA 3NAWA 1UJKA 3LCAA 3R9AB 4HLLA 3FDHA 2XENA 1TYQG 1E96B 2XS8A 3URZA 4GA0A 5C1DA 1HO8A 1A5EA 1NA0A 4F6RD 4L2YA 4GTOA 5G2NA 4K0RA 4FLHA 5CMWA 4ATZD 3L17A 4XE0A 4LCTA 4HORA 3PZ2A 1E8YA 5AQBA 3NZSA 5C2YA 1WM5A 3Q49B 3MKQA 2ILRA 2QZAA 4FHJA 2GRQB 1Y6IA 1OWNA 1N4SA 1OWLA 4B94A 3UQ3A 1SA4A 2KBXA 4BESA 3OXGA 2LO6A 3CVWA 4HRLA 5T8IA 3PRZA 2LSVA 2VTBB 4GMJA 3NF1A 4EECA 1V55E 3D9NA 3LJ3A 2F37A 5EN5D 2UWJG 1BPOA 2IO3C 4K03A 4UUCA 3DSUA 3BQOA 5CCMA 3ZXPA 4UQZA 3PUJA 3L54A 5G05J 4GU5A 2WM9A 4RG9A 4YDOA 4EZKA 5BV0A 3TWQA 3WXXA 3LJNA 4PS8A 1H2VC 3VTYA 3TWXA 3G2WA 4RQIA 3FEYA 3R7RA 3FH8A 5BUZA 4WWPA 4I2WA 5ARGA 1N9AA 3FUIA 3SQVA 3LVRE 4AVXA 1INZA 3ASOE 3MEKA 1UOHA 4L2LA 2I6HA 4MBGA 5ITZF 3ZHEB 3J5PA 4Y6CA 2XGOA 4TUUA 3FUMA 3CIAA 4UI9C 3TWRA 2ZIRA 3MCXA 3NOGD 3UXGA 5CMYA 3CGHA 1QYMA 3ONLA 3LY7A 5H7PA 4WWNA 1WDYA 5LOZA 1SA5A 3ESLA 1TR4A 4MKTA 4G2VA 2XPIA 3EIJA 4BERA 1YCSB 3TXMA 4WUYA 1H2UA 4BEPA 3MX3A 1N4QA 3BEEA 2VSYA 4ANWA 2R59A 2QYJA 3QDNA 3QWPA 1OCOE 4FADA 4C0MA 1SQMA 2LUHA 2KM4A 2ETCA 5AAOA 5D0QD 3SBTB 3KS2A 4R7LA 4G1TA 1WG0A 4EPZA 2R03A 2WPVA 3DSXA 3TJPA 3D9IA 3DEOA 3PS6A 3TWTA 4GCOA 4LNBA 1L5JA 4JXTA 4TUMA 1DVPA 1IHBA 3TWSA 2FULA 5G55A 4PS7A 5ENSD 2FI7A 5B3SE 4UWKA 4GZ3A 2AWIA 4BX9A 1MX6A 3C72A 1K8KG 1MYOA 2MRIA 2NYJA 4LUNU 5LCWJ 2P58C 4G26A 2KC7A 5DIZA 4BTAA 2DVWA 2QFCA 4EZLA 5G04J 2ZISA 4HXIA 1LF8A 3HIZA 2WB2A 2UY1B 2IFUA 3TG4A 1DNPA 4GMLA 4RSYA 4G23A 4GTQA 4PUCA 3ZGQA 1ZB1A 4TRQA 5HS0A 3SFZA 4A1GA 3ZXSA 4KMOA 3DXKG 1MZCA 2L6BA 1TNBA 3QKYA 3KEZA 2H6FA 3SNXA 1JCSA 2CFUA 3FUFA 5HKPA 3UT8A 2FBNA 3F6QA 2GRMA 3QWVA 1UN8A 2C0MA 1JCQA 1X81A 4JPSA 3U66A 4U63A 3IHYA 4IYPA 1AWCB 3FFLA 2ETBA 3E33A 3JQ1A 4BETA 5CBOA 3C98A 5A6CA 1D9SA 3SGHA 3MA5A 3DSWA 3QAQA 3FU5A 5AN8A 1KT1A 4ANVA 2J8SD 3ULYA 4APFA 1QNFA 4G8KA 4G8LA 3IKOB 4UQXA 5T3RA 2WXRA 3AS4A 2DCPA 1BI8B 5AJLA 2IQCA 3HDXA 2DYRE 2IU1A 3PNLB 4WNGA 2HYZA 3UX4A 4TXQA 3MYVA 4CT0A 1ELRA 4YDWA 2OV8A 4I1OB 3JXJA 3VLEA 4DUIA 2WXKA 5BT1A 1U2VG 2WXIA 3C3QA 2AVPA 1FPPA 1FVFA 1Z3XA 4B93B 3QWWA 4I2ZA 2XGMA 4U7EB 3PEVB 2CG2A 1OUVA 2GW1A 3PVLA 3X2QE 3TWVA 5KWDA 4GYOA 1U3CA 3Q5MA 3CKCA 4DX6D 4N5QA 1MX2A 2WXQA 1QBQA 3RSEG 3RKVA 3W9GA 4UWLA 3Q75A 4ILGA 5AYWD 4I17A 3P1UA 3FH7A 4MS6A 3APDA 3ONKA 2X38A 3L6AA 4U04A 4U8HA 2VJ8A 1FT2A 4LSZE 1BU9A 4HS2A 3ZPJA 4B8CB 2IEJA 1TNZA 1TN8A 2X6HA 1N4PA 3S7FA 5EYLA 3U3WA 4YNDA 2JEKA 4TXPA 2WXHA 4ZHBA 3D9KA 3AG1E 3G2VA 3UT7A 3DPDA 1D8EA 3APFA 3EU9A 5CEAA 2XRYA 3EHNA 4QQIA 2KZTB 3E32A 2F0YA 5A23A 3TGOA 1H2TC 4MLPA 3VLFA 3ZYLA 4F53A 1HG2A 3LS8A 3LY8A 5CBNA 4UI9K 1JWGA 3JCKC 3SF4A 3CV0A 4KVMA 2NXPA 4AIFA 4C48B 3JYSA 4UWHA 2P9SG 2IOLA 5HQ8A 1OY3D 3FTWA 3AG4E 3SZ7A 4AY6A 1TNUA 2BUGA 4XX5A 5BXOA 5FWQA 5ANLA 1S63A 3AU4A 1UJJA 3W9FA 3B7TA 3SHFA 2XHEA 3CVQA 4APOA 3KSQA 1N52A 3ISMC 4K5AB 3CLJA 4A3TA 2WXFA 2DWZA 3AJIA 4URKA 3DSVA 2I1JA 2PL2A 2WXMA 4J8FA 1B89A 3L9TA 4FJYA 5LCWC 5ENOD 1KLXA 3MGBA 1HF8A 4P29A 1TJCA 2RD0A 3HXBA 3EU5A 1TNOA 3V2OA 3DWLG 3HXCA 3Q7FA 3VLDA 2HR2A 2M63A 4YDYA 2X6KA 2X6IA 4A63B 1EDUA 3Q7AA 2LAIA 4IN3B 3ZNGA 4GPKA 4JA7A 3T8KA 3Q78A 1HG5A 3CK8A 3U64A 2CHXA 3QOUA 1NL4A 5EYPF 2P9NG 1BI7B 4JL0A 2WMNA 5B1AE 2HE0A 4CDMA 3FUHA 3QJZA 3PZ1A 5JJ7A 5ENNA 4JD2G 4EBAA 5D0OD 2ZGGA 3KEAA 3QNKA 5CECB 1IHGA 3OXLA 5EILA 4I1MA 4M3OA 2F8YA 1HH8A 2DIWA 3CHQA 3L16A 4J8DA 4J0UA 5FQ4A 3LYAA 3I4GA 1MX4A 2QYUA 3QB2A 3UKUG 4F1PA 3G2TA 4NURA 3TAXA 4UI9J 3ASDA 2EIME 4Q69A 5ANRA 3GZ1A 3ABLE 2BKKB 4A55A 3L08A 4HLEA 4CGWA 1EF1C 3N71A 1WAO1 1N95A 2GGFA 4TV3A 2GRPB 2XEVA 3D9JA 4KZ0A 4BT9A 5ENTD 4AM9A 2B0OE 2V8SE 3MV2B 4WNFA 3CK7A 1OCCE 1IKND 2OVFA 3ASHA 4X8QA 5G05C 3ULEG 1ZU2A 4ME2A 1RZ4A 3ZRHA 4O60A 3Q73A 3LY9A 4GYWA 5KBAA 4CT4A 4JB8P 4IRUA 4J8EA 4DI4A 3SFYA 5E76A 3D3MA 4A1SA 2EIKE 3IEGA 4A3VA 2ZGDA 5BPPA 3I4RB 1UG3A 1U3DA 3Q47B 4U95D 3DSTA 3GZSA 4AEZC 4LNGA 1E7UA 1HFAA 2VYIA 4DLOA 2J49A 2VQ2A 5D2MC 3MKQB 2XQ0A 4XEIG 5FT9A 3T5VA 1K1BA 1SZAA 4YVQC 1OT8A 3BG1B 3L82A 4GTRA 2ZXWE 5AARA 3T8MA 4ANXA 3EIQC 2HM8A 1NFIE 3E30A 2NSZA 3EHRA 3FTYA 1LD8A 5AQ9A 3QK0A 2VSOE 1PC2A 2KATA 3T9KA 2UY1A 2BF0X 2WXGA 4GZDA 2V5FA 5BXUA 3I5PA 5EKQD 2A5UA 3DXMG 3UTMA 2VGXA 1BLXB 3FTUA 4U8YD 5B1BE 4PS3A 4DJAA 2YHEA 4HBDA 3UPVA 2IOSA 2LXMA 2RKKA 3ML9A 5FZRA 4Q94A 2J09A 1TJFA 3P2BA 1UW4B 3TWUA 3UUXA 1P5QA 4HB5A 4HFGA 2XZDG 3ZKJA 2VSNA 2LNIA 1N4RA 4KZCA 4GMRA 4J6IA 3LDZA 4O6FA 4XI9A 5AENA 3FP3A 3FU3A 3CK9A 3JUEA 4E6HA 3RAUA 5FTPA 3ZVVA 2I9CA 2EQXA 5JA4D 4Y6WA 1G3NB 1JWFA 4BY6A 4N3CA 2QY7A 3HVEA 2WMOA 2E0IA 4XKBA 4LG6A 3PH0C 4LERA 5M72A 5EIBE 2QC9A 3DEPA 3UIOC 4WWOA 2OEWA 4RG6A 2V4LA 4MRUA 4DLQA 5ARFA 1E90A 2Y4TA 3AG3E 5DBKA 3GYZA 3AS5A 3ZYKA 2X6FA 3CHOA 3V31A 1ELKA 5EIDA 3RK6A 3NB2A 1JPLA 2VSXE 2XPYA 1D8DA 4CZ2D 4FU3A 5KNHD 3IHVA 3AU5A 5EDSA 2H6GA 4ILIA 2VGYA 4GTTA 2A4ZA 4F1SA 5FIOA 3NBNB 3ASNE 3HXFA 1DCQA 1S0PA 4RVBA 4JEHA 3K9IA 3CVLA 1N11A 2EINE 4I1AA 3UKRG 4FA6A 1PY1A 3NOCD 1NI1A 1HS6A 4G24A 1TEZA 3UM2A 3IBEA 1V54E 3C3RA 2DZOA 2V4HC 2WQ6A 2R5SA 5JJ6A 2YINA 5LFAA 1E8ZA 5FZSA 3MJWA 3ZUVB 2P9UG 1H19A 5AQ7A 3ASGA 3ZFWA 5IY5E 2PQRA 3KAEA 2L0IA 3CKBA 4PH4B 5G04C 2AW6A 2R2LA 5JHBA 2R17C 4FLBA 4L1BA 3DBSA 3Q9NC 2AXVA 1OWMA 4KVOA 3TL5A 2WXJA 3Q4AB 2ETAA 4EZJA 2RG8A 1ZBPA 2P2CP 4Q96A 1MJ0A 2IO2C 3HXEA 3QC1A 3FUJA 4J8YA 4UWFA 3MZLB 3R7QA 2VTBA 5EX0A 4JHJA 3S2AA 2P9LG 1JUQA 3CHPA 1QZ2A 3B95A 4Z68A 5KJLA 3ZEFA 3AS8A 1Z3YA 4J8SA 1FT1A 2WQHA 2ONDA 4AP2A 4HOUA 2P9KG 1HXIA 2XRZA 5CEDB 2L9BA 4U07A 2XGSA 2KXPC 4GTMA 4U96D 3CVPA 4XZ4A 5JJTA 4AY5A 3G2SA 1PAQA 4OVUA 3B7UX 4FHKA 4L23A 1O5MA 4N5CA 3FTZA 4J7WA 3EUVA 3PEUB 3E37A 2P9IG 4N2QA 2XPZA 4WAFA 2LAHA 2DYSE 2AXZA 4HI8A 3RRNB 5ENPD 2CHZA 3DRAA 1X5BA 4ACLA 5FINA 4ATGA 4F3VA 1TNYA 2CG3A 4GA1A 1KT0A 1WY6A 3L22A 2A5EA 2YQ8A 2H6HA 5CCLA 4GA2A 1S70B 3CSFA 4I6GA 4YDEA 2WVIA 2R05A 4BTBA 1HU3A 5KJNA 2P9PG 2XCCA 1H6OA 4G25A 4AXHA 3TWWA 4F7AA 2LSUA 3FULA 1OXJA 2J4BA 3RU0A 4HOTA 2V0PA 3SD5A 4DI3A 4B89A 1VDYA 3SY2A 1FCHA 3CHMA 1KZPA 3FTXA 3GW4A 3CVXA 2VGXB 2JLBA 3Q9UC 3ZYQA 1MQSA 3O48A 2HO1A 2IONA 3FWVA 4JHRA 3EHMA 3CVVA 2PM6A 4BWRA 1KZOA 3UI2A 3FUNA 4LEUA 3UM0A 1E7VA 2AJAA 4KBQA 4N2SA 3CHRA 4IULA 3D9MA 3SO8A 2L6JA 5BNWA 3B7SA 2BTDA 4CEMA 1O1RA 2F8XK 2WXPA 4NQ0A 3NQPA 3D9LA 1A17A 3CVUA 1H6KA 4V3IA 4DRXE 4EBAG 5HRYA 3RRUA 4N39A 5AQAA 2KCVA 4NRHB 1Z6TA 4XI0A 3D9HA 2Q7FA 4DX1A 4E85A 3FU0A 3DPYA 3V79K 5FZQA 3S7BA 1K3ZD 1HX8A 2IJGX 4QFVA 2JABA 2XS1A 3JXIA 2VGEA 2XZTG 3FTSA 4OVVA 3PE3A 2XEHA 3ENEA 5CERB 3ESKA 4HOSA 3MV3B 3PREA 3RJVA 2ZU6B 4ILHB 1S64A 1H6PA 3IV0A 1FVHA 2J07A 3PDNA 3AAAC 4O1OA 3SFXA 4WNDA 3PNTB 5LX8A 3U4TA 4RLYA 4DX5D 3T5XA 3HHMA 4NACA 4BX8A 4JC8A 2X3MA 2X6JA 5AJDA 3UM3A 3OAWA 3FH5A 1Q2ZA 4JEUA 2WQ7A 3S7JA 3SBSA 2WXNA 2AXUA 4C0EA 3ZYMA 2IF4A 3FUDA 4OAVB 4CRWA 4NIKA 1SW6A 4HRNA 3HYMB 2CFZA 3UT4A 3C3OA 3TXNA 3CHSA 4JA9A 3ULQA 5BV1A 1OCZE 2Y69E 3AG2E 5HI7A 2FF4A 3BU8A 3QARA 3CQCB 3D9PA 4L9PA 3U9WA 2BKGA 5ENQD 4GTVA 2J9QA 3V2XA 4W9RA 3APCA 2Y4UA 1JCRA 3HVEB 1LTXA 3E34A 1YMPA 3HRAA 2RFAA 3FEXA 2Y3AA 4WNEA 5BW8C 4FC8A 4O1PA 4TXRA 3HG0D 3Q79A 3RO3A 3CQGB 2NC9A 1EPUA 2PNNA 2IY0C 2RFMA 3KSLA 5T4YA 4AJWA 1ELWA 3EDTB 1NA3A 1IQRA 3RIBA 4BFRA 1O1SA 1LD7A 1IXVA 4JW1A 1N54A 2FO7A 2KCLA 3CVYA 5FQ7A 4FP7A 4HNAD 5LP0A 1OWPA 2YHCA 1YA0A 3FTVA 3PZDA 3LKUA 5KCMA 5KJKA 4CCAA 2OEVA 3NZUA 5FQ6A 5J08A 2FO1E 3OXFA 1E8WA 4DPRA 4KYOB 2GRLA 2EIJE 4YVOA 4EQFA 1IYGA 1KPSB 4M7CA 3CR3A 3EHQA 4U0SA 1Y8MA 3J5QB 3PE4A 4GB9A 1O1TA 4D10C 2FEZA 3ASFA 4AV7A 2XCBA 4LRZA 3IXEA 4GAAA 1TN7A 2J4DA 2KCKA 4K5CA 2DZNA 2PZIA 3B13A 2E2EA 1H0AA 3BG0B 1YYHA 1MHQA 4I43A 4I6EA 2C0LA 3B7BA 2XEEA 4K5BA 5CRUA 4PDXA 3ABME 5KJMA 4JHKA 2OVBA 3UINC 2MOWA 3ZHEA 5CRVA 3CEQA 2Y1LE 4GCNA 2LXLA 4EHMA 3CSTA 3ABKE 2PQNA 2CHWA 4HRMB 3JQ0A 5CHEE 4H7XA 3KD7A 3PUKA 1IQUA 5FQ8A 4B8AA 3G2UA 3L13A 3C5RA 1QQEA 1NP7A 2WXLA 4H7YA 1DC2A 2DBAA 2I2OA 1N0QA 3LEWA 4GYYA 1DCEA 1OWOA 1XGWA 4FJZA 4HQDA 2R02A 3V30A 3ZW3A 1UN9A 2WXOA 4HOQA 1OCRE 3Q15A 3RO2A 2GROB 5JMND 2J08A 3ZIMA 4HVBA 1GW6A 3ML8A 4U8VD 5E75A 4U0UA 1N0RA 1SZ9A 4BSZB 1N94A 4N3AA 2MHKA 4AOFA 4ANUA 1Z5SC 3UIPC 4I9EA 2GRRB 5FJYA 2OOEA 3UMVA 4I6JA 3VTXA 3FUKA 2EILE 5KNGA 1TN6A 4BSXA 3S7DA 3FU6A 4DK5A 3PZ3A 4B0ZA 2L0TB 4JVSA 4ABNA 4DX7D 4DX2A 3SI5A 1AP7A 1NZNA 4OYSA 3HXDA 3B7RL 4CGVA 2C2LA 4BT8A 3R9MA 4KXKB 4GZCA 5ENRD 1HE8A 3FUEA 4KT6B 3DSSA 2MYOA 3ZU7B 3D9OA 5A7DB 2H6IA 3I3NA 3OTNA 4I9CA 4XKCA 1W3BA 3RRMB 3TG5A 3BUAA 4JZYA 4CDNA 1EYHA 1E8XA 2YNQA 5J90A 4UQYA 4XIFA 5EX3A
chains in the Genus database with same CATH topology
1ELRA 2OV8A 3FHEA 2YHEA 4I1OB 3UPVA 3FTSA 2I1KA 2IOSA 4OVVA 3ML9A 3VLEA 5FZRA 2WXKA 4Q94A 2J09A 5BT1A 3MKRA 3PE3A 1TJFA 3EJNA 3FY4A 2WXIA 3ENEA 3P2BA 1UW4B 4GZ5A 3UUXA 5JHAA 2KZTA 2AVPA 3ESKA 1Z3XA 1FVFA 4HOSA 3MV3B 3PREA 3QWWA 1P5QA 4I2ZA 3RJVA 3LXUX 2XGMA 4HFGA 2ZU6B 4ILHB 3GZ2A 2PM7A 4C9BB 3PEVB 4UWGA 4N3BA 3IV0A 1FVHA 2CG2A 2J07A 3PDNA 1OUVA 2VSNA 2LNIA 3LPZA 2GW1A 3PVLA 3E4BA 4KZCA 4WNDA 4J6IA 3LDZA 3PNTB 5LX8A 4FULA 3ZN3A 4O6FA 4XI9A 3U4TA 5AENA 3LVQE 3CVNA 3FP3A 3FU3A 4GZ6A 4GYOA 4ACKA 3CK9A 3T5XA 1U3CA 4CDRA 3HHMA 5AIJA 4NACA 3Q5MA 3JUIA 4BX8A 4JC8A 4E6HA 2X3MA 5FTPA 2X6JA 3CKCA 4G11A 1XNFA 5AJDA 3ZVVA 2WXQA 2I9CA 4U0ZA 2EQXA 4Y6WA 4L7TA 1HZ4A 3O4ZA 3RKVA 4UWLA 1JWFA 3OAWA 1UJKA 3FH5A 3LCAA 4BY6A 4ILGA 4N3CA 5AYWD 4I17A 2QY7A 4JEUA 3P1UA 3R9AB 3HVEA 2WMOA 2WQ7A 3FH7A 2E0IA 4XKBA 4MS6A 3APDA 3ONKA 3PH0C 2X38A 3FDHA 3L6AA 4U04A 4U8HA 2VJ8A 4LERA 5M72A 3S7JA 3SBSA 4WWOA 2WXNA 2AXUA 4HS2A 3ZPJA 4C0EA 4RG6A 1E96B 4B8CB 3ZYMA 2V4LA 2IF4A 3URZA 4MRUA 3FUDA 4DLQA 4GA0A 5ARFA 2X6HA 5C1DA 1E90A 1HO8A 2Y4TA 5DBKA 4CRWA 3GYZA 1NA0A 3S7FA 3AS5A 4L2YA 3HYMB 2CFZA 3ZYKA 3U3WA 3UT4A 5G2NA 4YNDA 3TXNA 2X6FA 3CHOA 3CHSA 2JEKA 4K0RA 4JA9A 3ULQA 5BV1A 1ELKA 3RK6A 4FLHA 5CMWA 1JPLA 2VSXE 2XPYA 2WXHA 4FU3A 5HI7A 3IHVA 3L17A 2FF4A 3D9KA 3AU5A 4XE0A 5EDSA 3QARA 4LCTA 4ILIA 3CQCB 3D9PA 4HORA 3G2VA 3U9WA 2VGYA 3UT7A 1E8YA 3DPDA 3APFA 2A4ZA 4F1SA 2J9QA 2XRYA 3EHNA 2KZTB 4W9RA 3NZSA 3APCA 2Y4UA 5A23A 1H2TC 3TGOA 5C2YA 1WM5A 3HVEB 4MLPA 3VLFA 1S0PA 3Q49B 3MKQA 4RVBA 3ZYLA 2ILRA 4FHJA 1HG2A 4F53A 1Y6IA 1OWNA 3FEXA 3LS8A 2Y3AA 3K9IA 4JEHA 4WNEA 3LY8A 3CVLA 1OWLA 4I1AA 4FA6A 4B94A 1PY1A 4UI9K 5BW8C 4FC8A 1JWGA 3UQ3A 3JCKC 3OXGA 2LO6A 3CVWA 3SF4A 3CV0A 4KVMA 5T8IA 3RO3A 2NXPA 4AIFA 3PRZA 2LSVA 1HS6A 4G24A 3JYSA 2VTBB 3CQGB 2NC9A 4GMJA 1TEZA 1EPUA 4UWHA 3IBEA 2IOLA 5HQ8A 3NF1A 3FTWA 4EECA 2WQ6A 2R5SA 3D9NA 3LJ3A 5T4YA 5JJ6A 1ELWA 2YINA 3SZ7A 2BUGA 4AJWA 5LFAA 4AY6A 1E8ZA 4XX5A 2UWJG 3EDTB 1BPOA 5FZSA 5FWQA 5ANLA 4K03A 1NA3A 3AU4A 1IQRA 1UJJA 3MJWA 3RIBA 3B7TA 4BFRA 1H19A 3SHFA 5CCMA 4JW1A 1N54A 4UQZA 2FO7A 2XHEA 2KCLA 3CVQA 3PUJA 3ASGA 4APOA 3CVYA 3L54A 1N52A 4FP7A 4GU5A 5FQ7A 5G05J 3ZFWA 5LP0A 2WM9A 3CLJA 4A3TA 1OWPA 2YHCA 1YA0A 4RG9A 2PQRA 3FTVA 4EZKA 3KAEA 3PZDA 3LKUA 5BV0A 5KCMA 5KJKA 2L0IA 3WXXA 4CCAA 4PS8A 2WXFA 1H2VC 3VTYA 3CKBA 3G2WA 4PH4B 5G04C 4URKA 2AW6A 3FEYA 2I1JA 5JHBA 3NZUA 5FQ6A 2PL2A 2WXMA 3R7RA 2R17C 5J08A 4FLBA 3FH8A 4J8FA 1B89A 5BUZA 4L1BA 4FJYA 5LCWC 3OXFA 1E8WA 4DPRA 1KLXA 3DBSA 4WWPA 4I2WA 5ARGA 2AXVA 3FUIA 4KYOB 2GRLA 1OWMA 4KVOA 3LVRE 3MGBA 4YVOA 4AVXA 4EQFA 1INZA 1HF8A 3TL5A 2WXJA 3MEKA 3Q4AB 1IYGA 4P29A 4L2LA 1TJCA 2I6HA 3CR3A 2RD0A 4EZJA 2RG8A 4U0SA 1ZBPA 4Q96A 3ZHEB 1Y8MA 3PE4A 4Y6CA 2XGOA 4TUUA 3FUMA 3CIAA 4UI9C 3QC1A 4GB9A 4D10C 2FEZA 3FUJA 3VLDA 2HR2A 2M63A 3MCXA 3ASFA 4UWFA 3MZLB 2X6KA 4AV7A 2XCBA 2X6IA 3R7QA 2VTBA 5CMYA 5EX0A 1EDUA 4IN3B 2LAIA 4LRZA 4JHJA 4GAAA 3CGHA 3S2AA 1JUQA 2J4DA 3CHPA 1QZ2A 2KCKA 3ONLA 4GPKA 2PZIA 5KJLA 3LY7A 3ZEFA 3AS8A 3B13A 4WWNA 4JA7A 1Z3YA 2E2EA 4J8SA 2WQHA 5LOZA 1H0AA 3ESLA 2ONDA 3BG0B 4MKTA 1HG5A 4G2VA 2XPIA 3EIJA 4AP2A 4HOUA 1MHQA 3CK8A 4I43A 3U64A 2CHXA 2C0LA 3QOUA 4I6EA 4WUYA 3TXMA 1HXIA 1H2UA 4PDXA 2XRZA 2L9BA 5KJMA 4JHKA 2OVBA 4JL0A 3MX3A 2WMNA 4U07A 2MOWA 3ZHEA 2XGSA 4CDMA 3BEEA 2VSYA 3CEQA 3CVPA 3FUHA 4XZ4A 3QJZA 4ANWA 5JJTA 2R59A 4AY5A 4GCNA 3QDNA 3G2SA 3QWPA 5JJ7A 1PAQA 3CSTA 4OVUA 3B7UX 4FADA 4C0MA 4FHKA 1SQMA 2PQNA 4L23A 5ENNA 2KM4A 4EBAA 4N5CA 5D0OD 3FTZA 3QNKA 2CHWA 5D0QD 3SBTB 3KS2A 3JQ0A 3PEUB 1IHGA 3OXLA 4H7XA 4R7LA 5CHEE 4N2QA 4I1MA 2XPZA 4G1TA 4M3OA 2LAHA 4WAFA 1HH8A 3KD7A 2AXZA 3RRNB 3PUKA 1IQUA 2CHZA 4EPZA 5FQ8A 2DIWA 4B8AA 3CHQA 3L16A 2WPVA 1X5BA 3G2UA 4ACLA 4ATGA 4F3VA 3L13A 1QQEA 3TJPA 2CG3A 1NP7A 4J8DA 4GA1A 4J0UA 5FQ4A 2WXLA 4H7YA 1KT0A 3LYAA 3D9IA 1WY6A 3PS6A 3I4GA 4GCOA 1L5JA 3QB2A 4JXTA 2DBAA 3G2TA 1DVPA 2I2OA 4NURA 3LEWA 3TAXA 3L22A 4UI9J 2FULA 4GYYA 3ASDA 4PS7A 5G55A 1OWOA 2YQ8A 2FI7A 5CCLA 4GA2A 1XGWA 4UWKA 4GZ3A 4Q69A 3CSFA 4I6GA 4FJZA 5ANRA 3GZ1A 2AWIA 2WVIA 3ZW3A 1UN9A 4BTBA 4BX9A 1HU3A 2WXOA 5KJNA 4HOQA 4A55A 3L08A 3Q15A 4HLEA 2XCCA 3RO2A 4CGWA 1EF1C 3N71A 2MRIA 4G25A 1WAO1 4AXHA 2GGFA 2J08A 3ZIMA 4HVBA 4LUNU 1GW6A 3ML8A 4TV3A 5LCWJ 5E75A 2P58C 2XEVA 4U0UA 3D9JA 4G26A 2KC7A 1SZ9A 5DIZA 4KZ0A 4BT9A 4BTAA 4F7AA 2QFCA 4AM9A 2LSUA 4N3AA 4EZLA 2MHKA 2V8SE 3FULA 3MV2B 5G04J 4AOFA 4HXIA 1LF8A 4WNFA 3CK7A 4ANUA 3HIZA 2J4BA 2UY1B 3RU0A 2WB2A 2IFUA 2V0PA 3TG4A 1DNPA 2OVFA 3ASHA 4HOTA 4I9EA 4GMLA 3SD5A 4DI3A 4RSYA 4G23A 4PUCA 4B89A 5FJYA 5G05C 1VDYA 1ZU2A 4ME2A 2OOEA 3UMVA 3ZRHA 3ZGQA 4I6JA 4TRQA 1FCHA 3CHMA 3LY9A 4GYWA 3VTXA 3FTXA 3SFZA 4A1GA 3GW4A 4CT4A 3CVXA 2VGXB 3FUKA 2JLBA 4IRUA 4J8EA 3ZXSA 4KMOA 4DI4A 3QKYA 3KEZA 5E76A 4BSXA 3ZYQA 3D3MA 3S7DA 1MQSA 3SNXA 3FU6A 3IEGA 2CFUA 4A1SA 4A3VA 4DK5A 3O48A 5BPPA 4B0ZA 2HO1A 2IONA 3FUFA 2L0TB 4JVSA 3UT8A 4ABNA 2FBNA 3FWVA 4JHRA 3I4RB 1UG3A 3EHMA 1U3DA 2GRMA 3Q47B 3QWVA 3CVVA 2PM6A 4BWRA 1UN8A 3SI5A 3FUNA 1NZNA 2C0MA 4OYSA 3GZSA 4AEZC 4LEUA 3B7RL 1E7VA 4KBQA 1E7UA 4JPSA 4CGVA 3CHRA 4IULA 4U63A 3U66A 4N2SA 1HFAA 3D9MA 3IHYA 2C2LA 2VYIA 2L6JA 4DLOA 5BNWA 2J49A 2VQ2A 3B7SA 4BT8A 2BTDA 3MKQB 4CEMA 2XQ0A 4IYPA 2WXPA 3FFLA 4KXKB 4NQ0A 5FT9A 4GZCA 3NQPA 3D9LA 1A17A 1SZAA 4YVQC 3T5VA 3CVUA 3JQ1A 3BG1B 1H6KA 1HE8A 4V3IA 3C98A 3FUEA 3T8MA 4EBAG 4KT6B 5A6CA 3RRUA 4N39A 3SGHA 4ANXA 3EIQC 3MA5A 3D9OA 2HM8A 2KCVA 3QAQA 3FU5A 5A7DB 2NSZA 1KT1A 4ANVA 4NRHB 1Z6TA 3I3NA 3FTYA 4APFA 1QNFA 3OTNA 4I9CA 3QK0A 2VSOE 1PC2A 1W3BA 2KATA 4XKCA 3RRMB 3TG5A 4JZYA 2UY1A 4XI0A 2BF0X 2WXGA 3IKOB 4CDNA 4UQXA 2Q7FA 5T3RA 1EYHA 1E8XA 2WXRA 2YNQA 3AS4A 2DCPA 4GZDA 4E85A 3FU0A 2V5FA 5J90A 3I5PA 5AJLA 5EKQD 2IQCA 3HDXA 2A5UA 2IU1A 3PNLB 4UQYA 5FZQA 4WNGA 2HYZA 3S7BA 3UX4A 2VGXA 1HX8A 4XIFA 5EX3A 3FTUA 2IJGX 3MYVA 4QFVA 4CT0A 4PS3A 4DJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELR A;  1WM5 A;  4BTA A;  4BT9 A;  3UPV A;  3Q49 B;  2QFC A;  4AM9 A;  2LSU A;  2XCB A;  4N3A A;  2MHK A;  5G04 J;  5BNW A;  3MV2 B;  5FZR A;  4WNE A;  3K9I A;  5EX0 A;  4WNF A;  3LY8 A;  3CK7 A;  4IN3 B;  3MKR A;  3CVL A;  3PE3 A;  5BT1 A;  3RU0 A;  2UY1 B;  2IFU A;  4HOT A;  3TG4 A;  3ASH A;  4GZ5 A;  4I1A A;  3UUX A;  1QZ2 A;  3ESK A;  2AVP A;  4B94 A;  4UI9 K;  4HOS A;  4I9E A;  2KCK A;  5BW8 C;  3MV3 B;  3QWW A;  1P5Q A;  4I2Z A;  3RJV A;  3UQ3 A;  4G23 A;  4GPK A;  2PZI A;  5KJL A;  3LY7 A;  3AS8 A;  3OXG A;  5FJY A;  2XGM A;  3SF4 A;  5G05 C;  3CV0 A;  1ZU2 A;  4JA7 A;  4ME2 A;  2OOE A;  2E2E A;  3RO3 A;  2WQH A;  4AIF A;  3ZGQ A;  2LSV A;  4N2Q A;  3GZ2 A;  4G24 A;  3JYS A;  2NC9 A;  1FCH A;  2OND A;  3LY9 A;  4GYW A;  3VTX A;  4N3B A;  3GW4 A;  3PDN A;  2VGX B;  1OUV A;  3NF1 A;  2VSN A;  5HQ8 A;  2JLB A;  2LNI A;  4G2V A;  3LPZ A;  2GW1 A;  4J8E A;  2XPI A;  3E4B A;  4WND A;  4HOU A;  3CK8 A;  2R5S A;  4O6F A;  4XI9 A;  2C0L A;  3QKY A;  3QOU A;  4WUY A;  3U4T A;  3ZN3 A;  1HXI A;  3CVN A;  3FP3 A;  4GZ6 A;  1ELW A;  5JJ6 A;  3SZ7 A;  2BUG A;  3S7D A;  4A1S A;  3IEG A;  4GYO A;  3CK9 A;  5KJM A;  4JL0 A;  3O48 A;  2UWJ G;  4CDR A;  3EDT B;  4U07 A;  2HO1 A;  5FZS A;  3ZHE A;  2XGS A;  3Q5M A;  3TAX A;  4ABN A;  2FBN A;  5FTP A;  3BEE A;  3FWV A;  2VSY A;  3CEQ A;  1NA3 A;  3CKC A;  3CVP A;  4JHR A;  3RIB A;  5JJT A;  1XNF A;  4AY5 A;  3Q47 B;  3QWV A;  3QDN A;  4GCN A;  3QWP A;  5JJ7 A;  4U0Z A;  4BWR A;  1NZN A;  2C0M A;  4Y6W A;  5CCM A;  1HZ4 A;  2PQN A;  4LEU A;  3RKV A;  4UQZ A;  2FO7 A;  3CVQ A;  2KCL A;  4N5C A;  5D0O D;  3ASG A;  4APO A;  4KBQ A;  3LCA A;  5G05 J;  5D0Q D;  3ZFW A;  4CGV A;  4N2S A;  3KS2 A;  4N3C A;  5AYW D;  2C2L A;  1IHG A;  2L6J A;  2VYI A;  1YA0 A;  2YHC A;  3OXL A;  2PQR A;  4H7X A;  2VQ2 A;  4G1T A;  4RG9 A;  3R9A B;  4BT8 A;  3KAE A;  1HH8 A;  3LKU A;  3KD7 A;  5KJK A;  3WXX A;  4NQ0 A;  3FFL A;  4KXK B;  4U04 A;  5FT9 A;  3VTY A;  5M72 A;  1A17 A;  3CKB A;  4YVQ C;  3S7J A;  2WPV A;  4F3V A;  5CHE E;  5G04 C;  1QQE A;  3ZPJ A;  4J8D A;  4RG6 A;  4GA1 A;  1E96 B;  4J0U A;  4H7Y A;  1KT0 A;  3LYA A;  2IF4 A;  2PL2 A;  3URZ A;  5A6C A;  4GCO A;  4N39 A;  4GA0 A;  4J8F A;  1B89 A;  5ARF A;  3MA5 A;  5C1D A;  2Y4T A;  2DBA A;  2KCV A;  5A7D B;  5DBK A;  5LCW C;  3OXF A;  3GYZ A;  1KT1 A;  1KLX A;  1NA0 A;  4NRH B;  4GYY A;  4UI9 J;  3ASD A;  3AS5 A;  4I2W A;  5ARG A;  3S7F A;  3HYM B;  4KYO B;  2YQ8 A;  2FI7 A;  5CCL A;  4GA2 A;  3U3W A;  4I9C A;  4YND A;  1PC2 A;  1W3B A;  2KAT A;  4GZ3 A;  3TG5 A;  4I17 A;  2UY1 A;  4JA9 A;  4YVO A;  3ULQ A;  4XI0 A;  4EQF A;  4AY6 A;  3Q4A B;  3MEK A;  1IYG A;  3GZ1 A;  4UQX A;  2Q7F A;  5HI7 A;  1TJC A;  2FF4 A;  2I6H A;  3AS4 A;  4BTB A;  5KJN A;  4HOQ A;  3Q15 A;  2V5F A;  4U0S A;  2XCC A;  3RO2 A;  4HOR A;  4CGW A;  5EKQ D;  1ZBP A;  2VGY A;  3N71 A;  4G25 A;  3ZHE B;  1WAO 1;  1Y8M A;  3PE4 A;  4UQY A;  5FZQ A;  2J9Q A;  4WNG A;  2HYZ A;  2XGO A;  4UI9 C;  4Y6C A;  3S7B A;  4W9R A;  2VGX A;  5LCW J;  4XIF A;  5EX3 A;  2Y4U A;  2FEZ A;  3TGO A;  2P58 C;  2XEV A;  2HR2 A;  4U0U A;  3ASF A;  4G26 A;  2KC7 A;  5DIZ A; 
#chains in the Genus database with same CATH topology
 4HI9 A;  3FHE A;  2I1K A;  3WG7 E;  3MKR A;  3FY4 A;  3EJN A;  4ZFH A;  4GZ5 A;  5JHA A;  2KZT A;  2OCC E;  3LXU X;  1RW2 A;  3PZ4 A;  4GTS A;  2GRN B;  3GZ2 A;  2PM7 A;  4C9B B;  4UWG A;  4N3B A;  4OAU C;  2B6C A;  1BD8 A;  3LPZ A;  3E4B A;  4FUL A;  3ZN3 A;  2BED A;  3LVQ E;  3CVN A;  4GZ6 A;  4CYM D;  4GPM A;  4ACK A;  3UM1 A;  4CDR A;  5AIJ A;  1SVX A;  4LNU D;  3JUI A;  4GTP A;  4G11 A;  5D66 A;  1XNF A;  2V5Q C;  4U0Z A;  2Y0B G;  4L7T A;  1K1A A;  1HZ4 A;  3O4Z A;  3NAW A;  1UJK A;  3LCA A;  3R9A B;  4HLL A;  3FDH A;  2XEN A;  1TYQ G;  1E96 B;  2XS8 A;  3URZ A;  4GA0 A;  5C1D A;  1HO8 A;  1A5E A;  1NA0 A;  4F6R D;  4L2Y A;  4GTO A;  5G2N A;  4K0R A;  4FLH A;  5CMW A;  4ATZ D;  3L17 A;  4XE0 A;  4LCT A;  4HOR A;  3PZ2 A;  1E8Y A;  5AQB A;  3NZS A;  5C2Y A;  1WM5 A;  3Q49 B;  3MKQ A;  2ILR A;  2QZA A;  4FHJ A;  2GRQ B;  1Y6I A;  1OWN A;  1N4S A;  1OWL A;  4B94 A;  3UQ3 A;  1SA4 A;  2KBX A;  4BES A;  3OXG A;  2LO6 A;  3CVW A;  4HRL A;  5T8I A;  3PRZ A;  2LSV A;  2VTB B;  4GMJ A;  3NF1 A;  4EEC A;  1V55 E;  3D9N A;  3LJ3 A;  2F37 A;  5EN5 D;  2UWJ G;  1BPO A;  2IO3 C;  4K03 A;  4UUC A;  3DSU A;  3BQO A;  5CCM A;  3ZXP A;  4UQZ A;  3PUJ A;  3L54 A;  5G05 J;  4GU5 A;  2WM9 A;  4RG9 A;  4YDO A;  4EZK A;  5BV0 A;  3TWQ A;  3WXX A;  3LJN A;  4PS8 A;  1H2V C;  3VTY A;  3TWX A;  3G2W A;  4RQI A;  3FEY A;  3R7R A;  3FH8 A;  5BUZ A;  4WWP A;  4I2W A;  5ARG A;  1N9A A;  3FUI A;  3SQV A;  3LVR E;  4AVX A;  1INZ A;  3ASO E;  3MEK A;  1UOH A;  4L2L A;  2I6H A;  4MBG A;  5ITZ F;  3ZHE B;  3J5P A;  4Y6C A;  2XGO A;  4TUU A;  3FUM A;  3CIA A;  4UI9 C;  3TWR A;  2ZIR A;  3MCX A;  3NOG D;  3UXG A;  5CMY A;  3CGH A;  1QYM A;  3ONL A;  3LY7 A;  5H7P A;  4WWN A;  1WDY A;  5LOZ A;  1SA5 A;  3ESL A;  1TR4 A;  4MKT A;  4G2V A;  2XPI A;  3EIJ A;  4BER A;  1YCS B;  3TXM A;  4WUY A;  1H2U A;  4BEP A;  3MX3 A;  1N4Q A;  3BEE A;  2VSY A;  4ANW A;  2R59 A;  2QYJ A;  3QDN A;  3QWP A;  1OCO E;  4FAD A;  4C0M A;  1SQM A;  2LUH A;  2KM4 A;  2ETC A;  5AAO A;  5D0Q D;  3SBT B;  3KS2 A;  4R7L A;  4G1T A;  1WG0 A;  4EPZ A;  2R03 A;  2WPV A;  3DSX A;  3TJP A;  3D9I A;  3DEO A;  3PS6 A;  3TWT A;  4GCO A;  4LNB A;  1L5J A;  4JXT A;  4TUM A;  1DVP A;  1IHB A;  3TWS A;  2FUL A;  5G55 A;  4PS7 A;  5ENS D;  2FI7 A;  5B3S E;  4UWK A;  4GZ3 A;  2AWI A;  4BX9 A;  1MX6 A;  3C72 A;  1K8K G;  1MYO A;  2MRI A;  2NYJ A;  4LUN U;  5LCW J;  2P58 C;  4G26 A;  2KC7 A;  5DIZ A;  4BTA A;  2DVW A;  2QFC A;  4EZL A;  5G04 J;  2ZIS A;  4HXI A;  1LF8 A;  3HIZ A;  2WB2 A;  2UY1 B;  2IFU A;  3TG4 A;  1DNP A;  4GML A;  4RSY A;  4G23 A;  4GTQ A;  4PUC A;  3ZGQ A;  1ZB1 A;  4TRQ A;  5HS0 A;  3SFZ A;  4A1G A;  3ZXS A;  4KMO A;  3DXK G;  1MZC A;  2L6B A;  1TNB A;  3QKY A;  3KEZ A;  2H6F A;  3SNX A;  1JCS A;  2CFU A;  3FUF A;  5HKP A;  3UT8 A;  2FBN A;  3F6Q A;  2GRM A;  3QWV A;  1UN8 A;  2C0M A;  1JCQ A;  1X81 A;  4JPS A;  3U66 A;  4U63 A;  3IHY A;  4IYP A;  1AWC B;  3FFL A;  2ETB A;  3E33 A;  3JQ1 A;  4BET A;  5CBO A;  3C98 A;  5A6C A;  1D9S A;  3SGH A;  3MA5 A;  3DSW A;  3QAQ A;  3FU5 A;  5AN8 A;  1KT1 A;  4ANV A;  2J8S D;  3ULY A;  4APF A;  1QNF A;  4G8K A;  4G8L A;  3IKO B;  4UQX A;  5T3R A;  2WXR A;  3AS4 A;  2DCP A;  1BI8 B;  5AJL A;  2IQC A;  3HDX A;  2DYR E;  2IU1 A;  3PNL B;  4WNG A;  2HYZ A;  3UX4 A;  4TXQ A;  3MYV A;  4CT0 A;  1ELR A;  4YDW A;  2OV8 A;  4I1O B;  3JXJ A;  3VLE A;  4DUI A;  2WXK A;  5BT1 A;  1U2V G;  2WXI A;  3C3Q A;  2AVP A;  1FPP A;  1FVF A;  1Z3X A;  4B93 B;  3QWW A;  4I2Z A;  2XGM A;  4U7E B;  3PEV B;  2CG2 A;  1OUV A;  2GW1 A;  3PVL A;  3X2Q E;  3TWV A;  5KWD A;  4GYO A;  1U3C A;  3Q5M A;  3CKC A;  4DX6 D;  4N5Q A;  1MX2 A;  2WXQ A;  1QBQ A;  3RSE G;  3RKV A;  3W9G A;  4UWL A;  3Q75 A;  4ILG A;  5AYW D;  4I17 A;  3P1U A;  3FH7 A;  4MS6 A;  3APD A;  3ONK A;  2X38 A;  3L6A A;  4U04 A;  4U8H A;  2VJ8 A;  1FT2 A;  4LSZ E;  1BU9 A;  4HS2 A;  3ZPJ A;  4B8C B;  2IEJ A;  1TNZ A;  1TN8 A;  2X6H A;  1N4P A;  3S7F A;  5EYL A;  3U3W A;  4YND A;  2JEK A;  4TXP A;  2WXH A;  4ZHB A;  3D9K A;  3AG1 E;  3G2V A;  3UT7 A;  3DPD A;  1D8E A;  3APF A;  3EU9 A;  5CEA A;  2XRY A;  3EHN A;  4QQI A;  2KZT B;  3E32 A;  2F0Y A;  5A23 A;  3TGO A;  1H2T C;  4MLP A;  3VLF A;  3ZYL A;  4F53 A;  1HG2 A;  3LS8 A;  3LY8 A;  5CBN A;  4UI9 K;  1JWG A;  3JCK C;  3SF4 A;  3CV0 A;  4KVM A;  2NXP A;  4AIF A;  4C48 B;  3JYS A;  4UWH A;  2P9S G;  2IOL A;  5HQ8 A;  1OY3 D;  3FTW A;  3AG4 E;  3SZ7 A;  4AY6 A;  1TNU A;  2BUG A;  4XX5 A;  5BXO A;  5FWQ A;  5ANL A;  1S63 A;  3AU4 A;  1UJJ A;  3W9F A;  3B7T A;  3SHF A;  2XHE A;  3CVQ A;  4APO A;  3KSQ A;  1N52 A;  3ISM C;  4K5A B;  3CLJ A;  4A3T A;  2WXF A;  2DWZ A;  3AJI A;  4URK A;  3DSV A;  2I1J A;  2PL2 A;  2WXM A;  4J8F A;  1B89 A;  3L9T A;  4FJY A;  5LCW C;  5ENO D;  1KLX A;  3MGB A;  1HF8 A;  4P29 A;  1TJC A;  2RD0 A;  3HXB A;  3EU5 A;  1TNO A;  3V2O A;  3DWL G;  3HXC A;  3Q7F A;  3VLD A;  2HR2 A;  2M63 A;  4YDY A;  2X6K A;  2X6I A;  4A63 B;  1EDU A;  3Q7A A;  2LAI A;  4IN3 B;  3ZNG A;  4GPK A;  4JA7 A;  3T8K A;  3Q78 A;  1HG5 A;  3CK8 A;  3U64 A;  2CHX A;  3QOU A;  1NL4 A;  5EYP F;  2P9N G;  1BI7 B;  4JL0 A;  2WMN A;  5B1A E;  2HE0 A;  4CDM A;  3FUH A;  3QJZ A;  3PZ1 A;  5JJ7 A;  5ENN A;  4JD2 G;  4EBA A;  5D0O D;  2ZGG A;  3KEA A;  3QNK A;  5CEC B;  1IHG A;  3OXL A;  5EIL A;  4I1M A;  4M3O A;  2F8Y A;  1HH8 A;  2DIW A;  3CHQ A;  3L16 A;  4J8D A;  4J0U A;  5FQ4 A;  3LYA A;  3I4G A;  1MX4 A;  2QYU A;  3QB2 A;  3UKU G;  4F1P A;  3G2T A;  4NUR A;  3TAX A;  4UI9 J;  3ASD A;  2EIM E;  4Q69 A;  5ANR A;  3GZ1 A;  3ABL E;  2BKK B;  4A55 A;  3L08 A;  4HLE A;  4CGW A;  1EF1 C;  3N71 A;  1WAO 1;  1N95 A;  2GGF A;  4TV3 A;  2GRP B;  2XEV A;  3D9J A;  4KZ0 A;  4BT9 A;  5ENT D;  4AM9 A;  2B0O E;  2V8S E;  3MV2 B;  4WNF A;  3CK7 A;  1OCC E;  1IKN D;  2OVF A;  3ASH A;  4X8Q A;  5G05 C;  3ULE G;  1ZU2 A;  4ME2 A;  1RZ4 A;  3ZRH A;  4O60 A;  3Q73 A;  3LY9 A;  4GYW A;  5KBA A;  4CT4 A;  4JB8 P;  4IRU A;  4J8E A;  4DI4 A;  3SFY A;  5E76 A;  3D3M A;  4A1S A;  2EIK E;  3IEG A;  4A3V A;  2ZGD A;  5BPP A;  3I4R B;  1UG3 A;  1U3D A;  3Q47 B;  4U95 D;  3DST A;  3GZS A;  4AEZ C;  4LNG A;  1E7U A;  1HFA A;  2VYI A;  4DLO A;  2J49 A;  2VQ2 A;  5D2M C;  3MKQ B;  2XQ0 A;  4XEI G;  5FT9 A;  3T5V A;  1K1B A;  1SZA A;  4YVQ C;  1OT8 A;  3BG1 B;  3L82 A;  4GTR A;  2ZXW E;  5AAR A;  3T8M A;  4ANX A;  3EIQ C;  2HM8 A;  1NFI E;  3E30 A;  2NSZ A;  3EHR A;  3FTY A;  1LD8 A;  5AQ9 A;  3QK0 A;  2VSO E;  1PC2 A;  2KAT A;  3T9K A;  2UY1 A;  2BF0 X;  2WXG A;  4GZD A;  2V5F A;  5BXU A;  3I5P A;  5EKQ D;  2A5U A;  3DXM G;  3UTM A;  2VGX A;  1BLX B;  3FTU A;  4U8Y D;  5B1B E;  4PS3 A;  4DJA A;  2YHE A;  4HBD A;  3UPV A;  2IOS A;  2LXM A;  2RKK A;  3ML9 A;  5FZR A;  4Q94 A;  2J09 A;  1TJF A;  3P2B A;  1UW4 B;  3TWU A;  3UUX A;  1P5Q A;  4HB5 A;  4HFG A;  2XZD G;  3ZKJ A;  2VSN A;  2LNI A;  1N4R A;  4KZC A;  4GMR A;  4J6I A;  3LDZ A;  4O6F A;  4XI9 A;  5AEN A;  3FP3 A;  3FU3 A;  3CK9 A;  3JUE A;  4E6H A;  3RAU A;  5FTP A;  3ZVV A;  2I9C A;  2EQX A;  5JA4 D;  4Y6W A;  1G3N B;  1JWF A;  4BY6 A;  4N3C A;  2QY7 A;  3HVE A;  2WMO A;  2E0I A;  4XKB A;  4LG6 A;  3PH0 C;  4LER A;  5M72 A;  5EIB E;  2QC9 A;  3DEP A;  3UIO C;  4WWO A;  2OEW A;  4RG6 A;  2V4L A;  4MRU A;  4DLQ A;  5ARF A;  1E90 A;  2Y4T A;  3AG3 E;  5DBK A;  3GYZ A;  3AS5 A;  3ZYK A;  2X6F A;  3CHO A;  3V31 A;  1ELK A;  5EID A;  3RK6 A;  3NB2 A;  1JPL A;  2VSX E;  2XPY A;  1D8D A;  4CZ2 D;  4FU3 A;  5KNH D;  3IHV A;  3AU5 A;  5EDS A;  2H6G A;  4ILI A;  2VGY A;  4GTT A;  2A4Z A;  4F1S A;  5FIO A;  3NBN B;  3ASN E;  3HXF A;  1DCQ A;  1S0P A;  4RVB A;  4JEH A;  3K9I A;  3CVL A;  1N11 A;  2EIN E;  4I1A A;  3UKR G;  4FA6 A;  1PY1 A;  3NOC D;  1NI1 A;  1HS6 A;  4G24 A;  1TEZ A;  3UM2 A;  3IBE A;  1V54 E;  3C3R A;  2DZO A;  2V4H C;  2WQ6 A;  2R5S A;  5JJ6 A;  2YIN A;  5LFA A;  1E8Z A;  5FZS A;  3MJW A;  3ZUV B;  2P9U G;  1H19 A;  5AQ7 A;  3ASG A;  3ZFW A;  5IY5 E;  2PQR A;  3KAE A;  2L0I A;  3CKB A;  4PH4 B;  5G04 C;  2AW6 A;  2R2L A;  5JHB A;  2R17 C;  4FLB A;  4L1B A;  3DBS A;  3Q9N C;  2AXV A;  1OWM A;  4KVO A;  3TL5 A;  2WXJ A;  3Q4A B;  2ETA A;  4EZJ A;  2RG8 A;  1ZBP A;  2P2C P;  4Q96 A;  1MJ0 A;  2IO2 C;  3HXE A;  3QC1 A;  3FUJ A;  4J8Y A;  4UWF A;  3MZL B;  3R7Q A;  2VTB A;  5EX0 A;  4JHJ A;  3S2A A;  2P9L G;  1JUQ A;  3CHP A;  1QZ2 A;  3B95 A;  4Z68 A;  5KJL A;  3ZEF A;  3AS8 A;  1Z3Y A;  4J8S A;  1FT1 A;  2WQH A;  2OND A;  4AP2 A;  4HOU A;  2P9K G;  1HXI A;  2XRZ A;  5CED B;  2L9B A;  4U07 A;  2XGS A;  2KXP C;  4GTM A;  4U96 D;  3CVP A;  4XZ4 A;  5JJT A;  4AY5 A;  3G2S A;  1PAQ A;  4OVU A;  3B7U X;  4FHK A;  4L23 A;  1O5M A;  4N5C A;  3FTZ A;  4J7W A;  3EUV A;  3PEU B;  3E37 A;  2P9I G;  4N2Q A;  2XPZ A;  4WAF A;  2LAH A;  2DYS E;  2AXZ A;  4HI8 A;  3RRN B;  5ENP D;  2CHZ A;  3DRA A;  1X5B A;  4ACL A;  5FIN A;  4ATG A;  4F3V A;  1TNY A;  2CG3 A;  4GA1 A;  1KT0 A;  1WY6 A;  3L22 A;  2A5E A;  2YQ8 A;  2H6H A;  5CCL A;  4GA2 A;  1S70 B;  3CSF A;  4I6G A;  4YDE A;  2WVI A;  2R05 A;  4BTB A;  1HU3 A;  5KJN A;  2P9P G;  2XCC A;  1H6O A;  4G25 A;  4AXH A;  3TWW A;  4F7A A;  2LSU A;  3FUL A;  1OXJ A;  2J4B A;  3RU0 A;  4HOT A;  2V0P A;  3SD5 A;  4DI3 A;  4B89 A;  1VDY A;  3SY2 A;  1FCH A;  3CHM A;  1KZP A;  3FTX A;  3GW4 A;  3CVX A;  2VGX B;  2JLB A;  3Q9U C;  3ZYQ A;  1MQS A;  3O48 A;  2HO1 A;  2ION A;  3FWV A;  4JHR A;  3EHM A;  3CVV A;  2PM6 A;  4BWR A;  1KZO A;  3UI2 A;  3FUN A;  4LEU A;  3UM0 A;  1E7V A;  2AJA A;  4KBQ A;  4N2S A;  3CHR A;  4IUL A;  3D9M A;  3SO8 A;  2L6J A;  5BNW A;  3B7S A;  2BTD A;  4CEM A;  1O1R A;  2F8X K;  2WXP A;  4NQ0 A;  3NQP A;  3D9L A;  1A17 A;  3CVU A;  1H6K A;  4V3I A;  4DRX E;  4EBA G;  5HRY A;  3RRU A;  4N39 A;  5AQA A;  2KCV A;  4NRH B;  1Z6T A;  4XI0 A;  3D9H A;  2Q7F A;  4DX1 A;  4E85 A;  3FU0 A;  3DPY A;  3V79 K;  5FZQ A;  3S7B A;  1K3Z D;  1HX8 A;  2IJG X;  4QFV A;  2JAB A;  2XS1 A;  3JXI A;  2VGE A;  2XZT G;  3FTS A;  4OVV A;  3PE3 A;  2XEH A;  3ENE A;  5CER B;  3ESK A;  4HOS A;  3MV3 B;  3PRE A;  3RJV A;  2ZU6 B;  4ILH B;  1S64 A;  1H6P A;  3IV0 A;  1FVH A;  2J07 A;  3PDN A;  3AAA C;  4O1O A;  3SFX A;  4WND A;  3PNT B;  5LX8 A;  3U4T A;  4RLY A;  4DX5 D;  3T5X A;  3HHM A;  4NAC A;  4BX8 A;  4JC8 A;  2X3M A;  2X6J A;  5AJD A;  3UM3 A;  3OAW A;  3FH5 A;  1Q2Z A;  4JEU A;  2WQ7 A;  3S7J A;  3SBS A;  2WXN A;  2AXU A;  4C0E A;  3ZYM A;  2IF4 A;  3FUD A;  4OAV B;  4CRW A;  4NIK A;  1SW6 A;  4HRN A;  3HYM B;  2CFZ A;  3UT4 A;  3C3O A;  3TXN A;  3CHS A;  4JA9 A;  3ULQ A;  5BV1 A;  1OCZ E;  2Y69 E;  3AG2 E;  5HI7 A;  2FF4 A;  3BU8 A;  3QAR A;  3CQC B;  3D9P A;  4L9P A;  3U9W A;  2BKG A;  5ENQ D;  4GTV A;  2J9Q A;  3V2X A;  4W9R A;  3APC A;  2Y4U A;  1JCR A;  3HVE B;  1LTX A;  3E34 A;  1YMP A;  3HRA A;  2RFA A;  3FEX A;  2Y3A A;  4WNE A;  5BW8 C;  4FC8 A;  4O1P A;  4TXR A;  3HG0 D;  3Q79 A;  3RO3 A;  3CQG B;  2NC9 A;  1EPU A;  2PNN A;  2IY0 C;  2RFM A;  3KSL A;  5T4Y A;  4AJW A;  1ELW A;  3EDT B;  1NA3 A;  1IQR A;  3RIB A;  4BFR A;  1O1S A;  1LD7 A;  1IXV A;  4JW1 A;  1N54 A;  2FO7 A;  2KCL A;  3CVY A;  5FQ7 A;  4FP7 A;  4HNA D;  5LP0 A;  1OWP A;  2YHC A;  1YA0 A;  3FTV A;  3PZD A;  3LKU A;  5KCM A;  5KJK A;  4CCA A;  2OEV A;  3NZU A;  5FQ6 A;  5J08 A;  2FO1 E;  3OXF A;  1E8W A;  4DPR A;  4KYO B;  2GRL A;  2EIJ E;  4YVO A;  4EQF A;  1IYG A;  1KPS B;  4M7C A;  3CR3 A;  3EHQ A;  4U0S A;  1Y8M A;  3J5Q B;  3PE4 A;  4GB9 A;  1O1T A;  4D10 C;  2FEZ A;  3ASF A;  4AV7 A;  2XCB A;  4LRZ A;  3IXE A;  4GAA A;  1TN7 A;  2J4D A;  2KCK A;  4K5C A;  2DZN A;  2PZI A;  3B13 A;  2E2E A;  1H0A A;  3BG0 B;  1YYH A;  1MHQ A;  4I43 A;  4I6E A;  2C0L A;  3B7B A;  2XEE A;  4K5B A;  5CRU A;  4PDX A;  3ABM E;  5KJM A;  4JHK A;  2OVB A;  3UIN C;  2MOW A;  3ZHE A;  5CRV A;  3CEQ A;  2Y1L E;  4GCN A;  2LXL A;  4EHM A;  3CST A;  3ABK E;  2PQN A;  2CHW A;  4HRM B;  3JQ0 A;  5CHE E;  4H7X A;  3KD7 A;  3PUK A;  1IQU A;  5FQ8 A;  4B8A A;  3G2U A;  3L13 A;  3C5R A;  1QQE A;  1NP7 A;  2WXL A;  4H7Y A;  1DC2 A;  2DBA A;  2I2O A;  1N0Q A;  3LEW A;  4GYY A;  1DCE A;  1OWO A;  1XGW A;  4FJZ A;  4HQD A;  2R02 A;  3V30 A;  3ZW3 A;  1UN9 A;  2WXO A;  4HOQ A;  1OCR E;  3Q15 A;  3RO2 A;  2GRO B;  5JMN D;  2J08 A;  3ZIM A;  4HVB A;  1GW6 A;  3ML8 A;  4U8V D;  5E75 A;  4U0U A;  1N0R A;  1SZ9 A;  4BSZ B;  1N94 A;  4N3A A;  2MHK A;  4AOF A;  4ANU A;  1Z5S C;  3UIP C;  4I9E A;  2GRR B;  5FJY A;  2OOE A;  3UMV A;  4I6J A;  3VTX A;  3FUK A;  2EIL E;  5KNG A;  1TN6 A;  4BSX A;  3S7D A;  3FU6 A;  4DK5 A;  3PZ3 A;  4B0Z A;  2L0T B;  4JVS A;  4ABN A;  4DX7 D;  4DX2 A;  3SI5 A;  1AP7 A;  1NZN A;  4OYS A;  3HXD A;  3B7R L;  4CGV A;  2C2L A;  4BT8 A;  3R9M A;  4KXK B;  4GZC A;  5ENR D;  1HE8 A;  3FUE A;  4KT6 B;  3DSS A;  2MYO A;  3ZU7 B;  3D9O A;  5A7D B;  2H6I A;  3I3N A;  3OTN A;  4I9C A;  4XKC A;  1W3B A;  3RRM B;  3TG5 A;  3BUA A;  4JZY A;  4CDN A;  1EYH A;  1E8X A;  2YNQ A;  5J90 A;  4UQY A;  4XIF A;  5EX3 A; 
#chains in the Genus database with same CATH homology
 1ELR A;  2OV8 A;  3FHE A;  2YHE A;  4I1O B;  3UPV A;  3FTS A;  2I1K A;  2IOS A;  4OVV A;  3ML9 A;  3VLE A;  5FZR A;  2WXK A;  4Q94 A;  2J09 A;  5BT1 A;  3MKR A;  3PE3 A;  1TJF A;  3EJN A;  3FY4 A;  2WXI A;  3ENE A;  3P2B A;  1UW4 B;  4GZ5 A;  3UUX A;  5JHA A;  2KZT A;  2AVP A;  3ESK A;  1Z3X A;  1FVF A;  4HOS A;  3MV3 B;  3PRE A;  3QWW A;  1P5Q A;  4I2Z A;  3RJV A;  3LXU X;  2XGM A;  4HFG A;  2ZU6 B;  4ILH B;  3GZ2 A;  2PM7 A;  4C9B B;  3PEV B;  4UWG A;  4N3B A;  3IV0 A;  1FVH A;  2CG2 A;  2J07 A;  3PDN A;  1OUV A;  2VSN A;  2LNI A;  3LPZ A;  2GW1 A;  3PVL A;  3E4B A;  4KZC A;  4WND A;  4J6I A;  3LDZ A;  3PNT B;  5LX8 A;  4FUL A;  3ZN3 A;  4O6F A;  4XI9 A;  3U4T A;  5AEN A;  3LVQ E;  3CVN A;  3FP3 A;  3FU3 A;  4GZ6 A;  4GYO A;  4ACK A;  3CK9 A;  3T5X A;  1U3C A;  4CDR A;  3HHM A;  5AIJ A;  4NAC A;  3Q5M A;  3JUI A;  4BX8 A;  4JC8 A;  4E6H A;  2X3M A;  5FTP A;  2X6J A;  3CKC A;  4G11 A;  1XNF A;  5AJD A;  3ZVV A;  2WXQ A;  2I9C A;  4U0Z A;  2EQX A;  4Y6W A;  4L7T A;  1HZ4 A;  3O4Z A;  3RKV A;  4UWL A;  1JWF A;  3OAW A;  1UJK A;  3FH5 A;  3LCA A;  4BY6 A;  4ILG A;  4N3C A;  5AYW D;  4I17 A;  2QY7 A;  4JEU A;  3P1U A;  3R9A B;  3HVE A;  2WMO A;  2WQ7 A;  3FH7 A;  2E0I A;  4XKB A;  4MS6 A;  3APD A;  3ONK A;  3PH0 C;  2X38 A;  3FDH A;  3L6A A;  4U04 A;  4U8H A;  2VJ8 A;  4LER A;  5M72 A;  3S7J A;  3SBS A;  4WWO A;  2WXN A;  2AXU A;  4HS2 A;  3ZPJ A;  4C0E A;  4RG6 A;  1E96 B;  4B8C B;  3ZYM A;  2V4L A;  2IF4 A;  3URZ A;  4MRU A;  3FUD A;  4DLQ A;  4GA0 A;  5ARF A;  2X6H A;  5C1D A;  1E90 A;  1HO8 A;  2Y4T A;  5DBK A;  4CRW A;  3GYZ A;  1NA0 A;  3S7F A;  3AS5 A;  4L2Y A;  3HYM B;  2CFZ A;  3ZYK A;  3U3W A;  3UT4 A;  5G2N A;  4YND A;  3TXN A;  2X6F A;  3CHO A;  3CHS A;  2JEK A;  4K0R A;  4JA9 A;  3ULQ A;  5BV1 A;  1ELK A;  3RK6 A;  4FLH A;  5CMW A;  1JPL A;  2VSX E;  2XPY A;  2WXH A;  4FU3 A;  5HI7 A;  3IHV A;  3L17 A;  2FF4 A;  3D9K A;  3AU5 A;  4XE0 A;  5EDS A;  3QAR A;  4LCT A;  4ILI A;  3CQC B;  3D9P A;  4HOR A;  3G2V A;  3U9W A;  2VGY A;  3UT7 A;  1E8Y A;  3DPD A;  3APF A;  2A4Z A;  4F1S A;  2J9Q A;  2XRY A;  3EHN A;  2KZT B;  4W9R A;  3NZS A;  3APC A;  2Y4U A;  5A23 A;  1H2T C;  3TGO A;  5C2Y A;  1WM5 A;  3HVE B;  4MLP A;  3VLF A;  1S0P A;  3Q49 B;  3MKQ A;  4RVB A;  3ZYL A;  2ILR A;  4FHJ A;  1HG2 A;  4F53 A;  1Y6I A;  1OWN A;  3FEX A;  3LS8 A;  2Y3A A;  3K9I A;  4JEH A;  4WNE A;  3LY8 A;  3CVL A;  1OWL A;  4I1A A;  4FA6 A;  4B94 A;  1PY1 A;  4UI9 K;  5BW8 C;  4FC8 A;  1JWG A;  3UQ3 A;  3JCK C;  3OXG A;  2LO6 A;  3CVW A;  3SF4 A;  3CV0 A;  4KVM A;  5T8I A;  3RO3 A;  2NXP A;  4AIF A;  3PRZ A;  2LSV A;  1HS6 A;  4G24 A;  3JYS A;  2VTB B;  3CQG B;  2NC9 A;  4GMJ A;  1TEZ A;  1EPU A;  4UWH A;  3IBE A;  2IOL A;  5HQ8 A;  3NF1 A;  3FTW A;  4EEC A;  2WQ6 A;  2R5S A;  3D9N A;  3LJ3 A;  5T4Y A;  5JJ6 A;  1ELW A;  2YIN A;  3SZ7 A;  2BUG A;  4AJW A;  5LFA A;  4AY6 A;  1E8Z A;  4XX5 A;  2UWJ G;  3EDT B;  1BPO A;  5FZS A;  5FWQ A;  5ANL A;  4K03 A;  1NA3 A;  3AU4 A;  1IQR A;  1UJJ A;  3MJW A;  3RIB A;  3B7T A;  4BFR A;  1H19 A;  3SHF A;  5CCM A;  4JW1 A;  1N54 A;  4UQZ A;  2FO7 A;  2XHE A;  2KCL A;  3CVQ A;  3PUJ A;  3ASG A;  4APO A;  3CVY A;  3L54 A;  1N52 A;  4FP7 A;  4GU5 A;  5FQ7 A;  5G05 J;  3ZFW A;  5LP0 A;  2WM9 A;  3CLJ A;  4A3T A;  1OWP A;  2YHC A;  1YA0 A;  4RG9 A;  2PQR A;  3FTV A;  4EZK A;  3KAE A;  3PZD A;  3LKU A;  5BV0 A;  5KCM A;  5KJK A;  2L0I A;  3WXX A;  4CCA A;  4PS8 A;  2WXF A;  1H2V C;  3VTY A;  3CKB A;  3G2W A;  4PH4 B;  5G04 C;  4URK A;  2AW6 A;  3FEY A;  2I1J A;  5JHB A;  3NZU A;  5FQ6 A;  2PL2 A;  2WXM A;  3R7R A;  2R17 C;  5J08 A;  4FLB A;  3FH8 A;  4J8F A;  1B89 A;  5BUZ A;  4L1B A;  4FJY A;  5LCW C;  3OXF A;  1E8W A;  4DPR A;  1KLX A;  3DBS A;  4WWP A;  4I2W A;  5ARG A;  2AXV A;  3FUI A;  4KYO B;  2GRL A;  1OWM A;  4KVO A;  3LVR E;  3MGB A;  4YVO A;  4AVX A;  4EQF A;  1INZ A;  1HF8 A;  3TL5 A;  2WXJ A;  3MEK A;  3Q4A B;  1IYG A;  4P29 A;  4L2L A;  1TJC A;  2I6H A;  3CR3 A;  2RD0 A;  4EZJ A;  2RG8 A;  4U0S A;  1ZBP A;  4Q96 A;  3ZHE B;  1Y8M A;  3PE4 A;  4Y6C A;  2XGO A;  4TUU A;  3FUM A;  3CIA A;  4UI9 C;  3QC1 A;  4GB9 A;  4D10 C;  2FEZ A;  3FUJ A;  3VLD A;  2HR2 A;  2M63 A;  3MCX A;  3ASF A;  4UWF A;  3MZL B;  2X6K A;  4AV7 A;  2XCB A;  2X6I A;  3R7Q A;  2VTB A;  5CMY A;  5EX0 A;  1EDU A;  4IN3 B;  2LAI A;  4LRZ A;  4JHJ A;  4GAA A;  3CGH A;  3S2A A;  1JUQ A;  2J4D A;  3CHP A;  1QZ2 A;  2KCK A;  3ONL A;  4GPK A;  2PZI A;  5KJL A;  3LY7 A;  3ZEF A;  3AS8 A;  3B13 A;  4WWN A;  4JA7 A;  1Z3Y A;  2E2E A;  4J8S A;  2WQH A;  5LOZ A;  1H0A A;  3ESL A;  2OND A;  3BG0 B;  4MKT A;  1HG5 A;  4G2V A;  2XPI A;  3EIJ A;  4AP2 A;  4HOU A;  1MHQ A;  3CK8 A;  4I43 A;  3U64 A;  2CHX A;  2C0L A;  3QOU A;  4I6E A;  4WUY A;  3TXM A;  1HXI A;  1H2U A;  4PDX A;  2XRZ A;  2L9B A;  5KJM A;  4JHK A;  2OVB A;  4JL0 A;  3MX3 A;  2WMN A;  4U07 A;  2MOW A;  3ZHE A;  2XGS A;  4CDM A;  3BEE A;  2VSY A;  3CEQ A;  3CVP A;  3FUH A;  4XZ4 A;  3QJZ A;  4ANW A;  5JJT A;  2R59 A;  4AY5 A;  4GCN A;  3QDN A;  3G2S A;  3QWP A;  5JJ7 A;  1PAQ A;  3CST A;  4OVU A;  3B7U X;  4FAD A;  4C0M A;  4FHK A;  1SQM A;  2PQN A;  4L23 A;  5ENN A;  2KM4 A;  4EBA A;  4N5C A;  5D0O D;  3FTZ A;  3QNK A;  2CHW A;  5D0Q D;  3SBT B;  3KS2 A;  3JQ0 A;  3PEU B;  1IHG A;  3OXL A;  4H7X A;  4R7L A;  5CHE E;  4N2Q A;  4I1M A;  2XPZ A;  4G1T A;  4M3O A;  2LAH A;  4WAF A;  1HH8 A;  3KD7 A;  2AXZ A;  3RRN B;  3PUK A;  1IQU A;  2CHZ A;  4EPZ A;  5FQ8 A;  2DIW A;  4B8A A;  3CHQ A;  3L16 A;  2WPV A;  1X5B A;  3G2U A;  4ACL A;  4ATG A;  4F3V A;  3L13 A;  1QQE A;  3TJP A;  2CG3 A;  1NP7 A;  4J8D A;  4GA1 A;  4J0U A;  5FQ4 A;  2WXL A;  4H7Y A;  1KT0 A;  3LYA A;  3D9I A;  1WY6 A;  3PS6 A;  3I4G A;  4GCO A;  1L5J A;  3QB2 A;  4JXT A;  2DBA A;  3G2T A;  1DVP A;  2I2O A;  4NUR A;  3LEW A;  3TAX A;  3L22 A;  4UI9 J;  2FUL A;  4GYY A;  3ASD A;  4PS7 A;  5G55 A;  1OWO A;  2YQ8 A;  2FI7 A;  5CCL A;  4GA2 A;  1XGW A;  4UWK A;  4GZ3 A;  4Q69 A;  3CSF A;  4I6G A;  4FJZ A;  5ANR A;  3GZ1 A;  2AWI A;  2WVI A;  3ZW3 A;  1UN9 A;  4BTB A;  4BX9 A;  1HU3 A;  2WXO A;  5KJN A;  4HOQ A;  4A55 A;  3L08 A;  3Q15 A;  4HLE A;  2XCC A;  3RO2 A;  4CGW A;  1EF1 C;  3N71 A;  2MRI A;  4G25 A;  1WAO 1;  4AXH A;  2GGF A;  2J08 A;  3ZIM A;  4HVB A;  4LUN U;  1GW6 A;  3ML8 A;  4TV3 A;  5LCW J;  5E75 A;  2P58 C;  2XEV A;  4U0U A;  3D9J A;  4G26 A;  2KC7 A;  1SZ9 A;  5DIZ A;  4KZ0 A;  4BT9 A;  4BTA A;  4F7A A;  2QFC A;  4AM9 A;  2LSU A;  4N3A A;  4EZL A;  2MHK A;  2V8S E;  3FUL A;  3MV2 B;  5G04 J;  4AOF A;  4HXI A;  1LF8 A;  4WNF A;  3CK7 A;  4ANU A;  3HIZ A;  2J4B A;  2UY1 B;  3RU0 A;  2WB2 A;  2IFU A;  2V0P A;  3TG4 A;  1DNP A;  2OVF A;  3ASH A;  4HOT A;  4I9E A;  4GML A;  3SD5 A;  4DI3 A;  4RSY A;  4G23 A;  4PUC A;  4B89 A;  5FJY A;  5G05 C;  1VDY A;  1ZU2 A;  4ME2 A;  2OOE A;  3UMV A;  3ZRH A;  3ZGQ A;  4I6J A;  4TRQ A;  1FCH A;  3CHM A;  3LY9 A;  4GYW A;  3VTX A;  3FTX A;  3SFZ A;  4A1G A;  3GW4 A;  4CT4 A;  3CVX A;  2VGX B;  3FUK A;  2JLB A;  4IRU A;  4J8E A;  3ZXS A;  4KMO A;  4DI4 A;  3QKY A;  3KEZ A;  5E76 A;  4BSX A;  3ZYQ A;  3D3M A;  3S7D A;  1MQS A;  3SNX A;  3FU6 A;  3IEG A;  2CFU A;  4A1S A;  4A3V A;  4DK5 A;  3O48 A;  5BPP A;  4B0Z A;  2HO1 A;  2ION A;  3FUF A;  2L0T B;  4JVS A;  3UT8 A;  4ABN A;  2FBN A;  3FWV A;  4JHR A;  3I4R B;  1UG3 A;  3EHM A;  1U3D A;  2GRM A;  3Q47 B;  3QWV A;  3CVV A;  2PM6 A;  4BWR A;  1UN8 A;  3SI5 A;  3FUN A;  1NZN A;  2C0M A;  4OYS A;  3GZS A;  4AEZ C;  4LEU A;  3B7R L;  1E7V A;  4KBQ A;  1E7U A;  4JPS A;  4CGV A;  3CHR A;  4IUL A;  4U63 A;  3U66 A;  4N2S A;  1HFA A;  3D9M A;  3IHY A;  2C2L A;  2VYI A;  2L6J A;  4DLO A;  5BNW A;  2J49 A;  2VQ2 A;  3B7S A;  4BT8 A;  2BTD A;  3MKQ B;  4CEM A;  2XQ0 A;  4IYP A;  2WXP A;  3FFL A;  4KXK B;  4NQ0 A;  5FT9 A;  4GZC A;  3NQP A;  3D9L A;  1A17 A;  1SZA A;  4YVQ C;  3T5V A;  3CVU A;  3JQ1 A;  3BG1 B;  1H6K A;  1HE8 A;  4V3I A;  3C98 A;  3FUE A;  3T8M A;  4EBA G;  4KT6 B;  5A6C A;  3RRU A;  4N39 A;  3SGH A;  4ANX A;  3EIQ C;  3MA5 A;  3D9O A;  2HM8 A;  2KCV A;  3QAQ A;  3FU5 A;  5A7D B;  2NSZ A;  1KT1 A;  4ANV A;  4NRH B;  1Z6T A;  3I3N A;  3FTY A;  4APF A;  1QNF A;  3OTN A;  4I9C A;  3QK0 A;  2VSO E;  1PC2 A;  1W3B A;  2KAT A;  4XKC A;  3RRM B;  3TG5 A;  4JZY A;  2UY1 A;  4XI0 A;  2BF0 X;  2WXG A;  3IKO B;  4CDN A;  4UQX A;  2Q7F A;  5T3R A;  1EYH A;  1E8X A;  2WXR A;  2YNQ A;  3AS4 A;  2DCP A;  4GZD A;  4E85 A;  3FU0 A;  2V5F A;  5J90 A;  3I5P A;  5AJL A;  5EKQ D;  2IQC A;  3HDX A;  2A5U A;  2IU1 A;  3PNL B;  4UQY A;  5FZQ A;  4WNG A;  2HYZ A;  3S7B A;  3UX4 A;  2VGX A;  1HX8 A;  4XIF A;  5EX3 A;  3FTU A;  2IJG X;  3MYV A;  4QFV A;  4CT0 A;  4PS3 A;  4DJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...