2LSVA

The nmr high resolution structure of yeast tah1 in complex with the hsp90 c-terminal tail
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone-binding protein/chaperone
molecule keywords TPR repeat-containing protein associated with Hsp90
publication title High-Resolution Structural Analysis Shows How Tah1 Tethers Hsp90 to the R2TP Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lsvA00
4NQ0A 4YVQC 4YVOA 3Q5MA 4AIFA 4N39A 4AM9A 3MV2B 3QKYA 5KJMA 2L6JA 3CEQA 4CDRA 3E4BA 4GCNA 2HR2A 2VSNA 4UI9J 2PQRA 1P5QA 3QOUA 2FEZA 4GA1A 3LKUA 3RJVA 2VSYA 1B89A 4A1SA 3U3WA 5JJTA 3QWWA 4Y6WA 1E96B 4N2SA 1HH8A 2IFUA 4Y6CA 5FZSA 5KJLA 4N3AA 2PL2A 2C0LA 3MEKA 4BTAA 4KXKB 2KATA 4I9EA 4G1TA 3AS5A 4AY6A 2KCLA 4GZ6A 2YHCA 3K9IA 5G04C 1ELWA 4J0UA 5D0QD 3CK9A 2UY1B 4CGWA 4JHRA 3Q49B 2UWJG 3OXFA 3LYAA 3WXXA 4F3VA 3EDTB 2WPVA 3TAXA 4B94A 3IEGA 3CKBA 5A6CA 4G26A 2KCKA 3SZ7A 4AY5A 4NRHB 4G2VA 2V5FA 3ZHEB 4N5CA 3RIBA 4GZ3A 2Y4TA 3CKCA 2XGMA 4GYYA 3QDNA 3GYZA 3MKRA 4BT8A 1KT1A 5D0OD 3UUXA 5ARGA 3CK8A 2R5SA 3LCAA 4XI0A 4BTBA 4XIFA 1YA0A 3FFLA 4GPKA 2BUGA 4UQYA 3RU0A 3PDNA 3TG5A 4JL0A 4HOQA 4WNGA 1WM5A 4I1AA 4U0SA 3ZFWA 3BEEA 3R9AB 2QFCA 4G23A 2C0MA 1PC2A 3CVQA 2I6HA 4W9RA 3GW4A 5EKQD 3CK7A 4HOUA 2C2LA 4GZ5A 3PE3A 3RKVA 1NA0A 5DIZA 3VTYA 1IYGA 3CVPA 2VGXA 3QWVA 5JJ7A 3N71A 3S7DA 5FZRA 4H7XA 2YQ8A 3SF4A 4KYOB 4GCOA 2GW1A 4HOSA 2XEVA 5JJ6A 3Q47B 3AS4A 1IHGA 5FTPA 2Q7FA 1ELRA 2IF4A 2XGSA 1XNFA 4UQZA 3PE4A 3ZN3A 3ESKA 3LY9A 1KLXA 3RO3A 2J9QA 4GA2A 3CV0A 4U0UA 2DBAA 3QWPA 2WQHA 1ZU2A 4GYWA 3HYMB 2XCBA 4N3CA 4UI9C 2VYIA 4RG9A 4G25A 3S7BA 2XPIA 2UY1A 5CCMA 3FP3A 3ZGQA 5M72A 3FWVA 1OUVA 3URZA 3LY7A 4LEUA 3KS2A 3ASGA 4IN3B 3S7JA 3MV3B 4JA9A 3ASFA 5G04J 3U4TA 3ZPJA 4WNFA 1NZNA 1ZBPA 1HXIA 5CCLA 5HQ8A 3TGOA 1WAO1 3RO2A 5CHEE 4ABNA 1NA3A 1A17A 4EQFA 3ZHEA 2FF4A 4WNDA 3OXLA 4HORA 4I2ZA 2LNIA 5AYWD 2VQ2A 5DBKA 5FZQA 2LSUA 4H7YA 3S7FA 3AS8A 1HZ4A 5ARFA 3CVNA 2VGXB 5LCWC 2E2EA 3OXGA 3LPZA 5C1DA 5EX3A 4I17A 3ASDA 1QQEA 4HOTA 4BT9A 2HO1A 5A7DB 3UPVA 2NC9A 2FBNA 4N2QA 2JLBA 5G05C 3GZ1A 4XI9A 4JA7A 1TJCA 4APOA 2HYZA 2XCCA 4I9CA 5FJYA 4U0ZA 5BW8C 3CVLA 4WUYA 1KT0A 5EX0A 5KJNA 2AVPA 4U04A 2XGOA 4U07A 4N3BA 5FT9A 5HI7A 4G24A 4GYOA 5BNWA 2OOEA 2MHKA 3TG4A 5BT1A 1Y8MA 4I2WA 2PQNA 2ONDA 5LCWJ 3O48A 3UQ3A 3NF1A 2LSVA 4O6FA 4J8FA 2VGYA 3ULQA 3VTXA 4RG6A 4BWRA 5KJKA 2KC7A 4CGVA 3ASHA 3KAEA 3LY8A 4ME2A 4UQXA 4YNDA 2FO7A 2PZIA 2Y4UA 3Q4AB 4UI9K 1QZ2A 3JYSA 1W3BA 2P58C 3MA5A 5G05J 4WNEA 3GZ2A 3KD7A 4GA0A 2FI7A 4J8DA 2KCVA 4J8EA 4KBQA 3Q15A 1FCHA
chains in the Genus database with same CATH superfamily
4LRZA 4BX8A 4GB9A 4F7AA 3BUAA 4GTSA 3UT8A 1N52A 2NYJA 4HQDA 1E8XA 1PAQA 4AIFA 4N39A 4U7EB 3RRMB 3MV2B 5ENTD 4L9PA 2L6JA 1UOHA 3CEQA 4JEUA 4QFVA 1MX6A 2VSNA 2PQRA 4C48B 1D9SA 2CFZA 2EIME 4V3IA 1OWOA 2AJAA 3DWLG 3D9NA 5FQ8A 2AXUA 3SBTB 4A1SA 4JW1A 3ONKA 3QWWA 2B6CA 3L16A 1SW6A 4GTPA 2IFUA 5AARA 5KJLA 2PL2A 2WXQA 2C0LA 4BTAA 1LTXA 4G1TA 1SA5A 1TNBA 4AY6A 4HXIA 3D9OA 4XZ4A 3DEPA 4KZCA 3Q78A 5G04C 1ELWA 4JB8P 2X6HA 3P2BA 3CK9A 1QBQA 4CZ2D 4CGWA 2XEHA 3L17A 3Q49B 3AJIA 3LYAA 3HXCA 2IO3C 3TAXA 5T3RA 2ILRA 4JHJA 2H6HA 5EYPF 4JZYA 4TXQA 5HKPA 3FHEA 4G2VA 3NOGD 4GTRA 5EIBE 4FLBA 1NFIE 2WXMA 3FDHA 2Y4TA 5B1BE 4GYYA 1HF8A 2GRMA 4BT8A 1N11A 3JQ1A 1OCRE 5AAOA 3TWTA 5D0OD 1BI7B 3MGBA 3ONLA 3UIPC 3LCAA 1HX8A 4BTBA 3V79K 3J5PA 1H2UA 1YA0A 2BUGA 5LX8A 1HE8A 4EZJA 5ENQD 5BPPA 2R2LA 2F8YA 4I1AA 1N0RA 4ATZD 4GMLA 4EPZA 3BEEA 1JCQA 1BPOA 4DPRA 4JEHA 2LXLA 2I6HA 3CVQA 2WXFA 4F1PA 3CK7A 4C0EA 5EN5D 4MKTA 3UM3A 3V31A 2IONA 5DIZA 4OVVA 4A3TA 5AJLA 4IULA 4GTMA 3ZRHA 2WB2A 2R59A 2VTBB 4HVBA 2H6GA 2IO2C 4PS7A 3IV0A 2AXVA 3RAUA 2GW1A 4PS3A 5LOZA 2AWIA 3UTMA 4CRWA 3LDZA 2XEVA 1KZPA 3Q47B 3CHRA 2KZTB 3MCXA 2XGSA 3CHSA 5EILA 1JCSA 3TJPA 1HO8A 3EIQC 2CHXA 3PE4A 3ZN3A 3QARA 3ESKA 1QYMA 2WXKA 3W9FA 2IQCA 3ZYQA 3SFYA 4HI9A 2WQHA 2WXLA 4P29A 3CVUA 2JABA 1ELKA 2XCBA 2VYIA 3F6QA 2DZOA 3DSVA 5ENPD 4B0ZA 3SD5A 2XPIA 5CCMA 3FWVA 3URZA 3ZYKA 2CHZA 5AQ9A 4IN3B 3S7JA 2XZTG 4JA9A 2J08A 3KEAA 3FUFA 4DJAA 3ASFA 3ZPJA 3HVEB 4LUNU 3UM2A 3FUJA 3LJ3A 1V54E 3D9MA 3DPYA 3C72A 3TGOA 4CEMA 1A17A 2NSZA 4J8SA 4BY6A 3ZHEA 4U8YD 2OV8A 1U3CA 1TNYA 1O1RA 2LNIA 1E7UA 2VQ2A 3OAWA 5FZQA 2WQ6A 2WXHA 3O4ZA 5BXUA 3MYVA 3CVNA 4ATGA 4UWKA 3L9TA 3B7UX 4K5BA 4EBAG 3IBEA 3FULA 3DRAA 2XHEA 3FUKA 3UI2A 3ASDA 4EECA 3EHNA 4DI4A 5ENOD 3B7RL 4HOTA 1OCZE 5JMND 4XEIG 3LS8A 1SZAA 2JLBA 2R17C 3GZ1A 1OWLA 4APOA 3RK6A 2R02A 3ZU7B 3CVLA 1MHQA 3T8KA 4GTOA 3UT4A 1H0AA 3CQGB 1KT0A 5KJNA 3FTYA 2OOEA 2P9UG 3B7BA 4I2WA 4I6JA 4ANXA 5LCWJ 1TNOA 4FA6A 3PREA 4FJYA 3FEYA 3NF1A 1Z6TA 4J8FA 2V5QC 1TR4A 4Q94A 1LF8A 3UMVA 2KC7A 1Q2ZA 3ASHA 2F8XK 3SHFA 4GTTA 4O1PA 2DIWA 1PY1A 2FO7A 4KT6B 1E90A 4HNAD 2EQXA 2L9BA 2RG8A 2BKGA 1X81A 3D9JA 1Z3XA 1Y6IA 5ENSD 4BX9A 2X6KA 2X38A 4OAVB 3Q73A 4HRNA 2KCVA 3C3RA 3CHPA 1U3DA 1FCHA 4ILGA 2J07A 4YVOA 3Q5MA 1IXVA 5CRVA 4BFRA 3QKYA 5KJMA 3B7SA 4CYMD 4UUCA 2HM8A 3DPDA 3BG1B 1NI1A 4IYPA 3DBSA 4A3VA 2DYSE 3DSUA 1N4RA 1KPSB 4GA1A 4XE0A 4OYSA 4HLEA 4E85A 3E32A 2VSYA 3UM1A 3U9WA 1B89A 4DX1A 3CHQA 1HH8A 2H6FA 3G2VA 4L1BA 4WWOA 1OCOE 3FH7A 3ML9A 2Y0BG 3QNKA 4B89A 3QK0A 3AS5A 3EUVA 1UN8A 5KCMA 3MKQA 1IHBA 3K9IA 5J90A 3JQ0A 5D0QD 1OXJA 2GRRB 2UY1B 3APCA 5CEAA 2IEJA 4JHRA 2XPZA 2A5UA 4F3VA 2I2OA 2OEVA 3BU8A 1MX2A 1NL4A 4PUCA 1XGWA 3EDTB 3QAQA 1MZCA 3CKBA 2HE0A 5T8IA 3EHRA 5CECB 2KCKA 4EZKA 2X6JA 3V2OA 4I6GA 4HLLA 2V5FA 3ULEG 4F6RD 4I1OB 4CT0A 4N5CA 4GZ3A 5AN8A 3CKCA 1OWNA 3V30A 2NXPA 3RRUA 2QZAA 3LVQE 2RFMA 4ACLA 3CVWA 3R9MA 1KT1A 3HDXA 3PZ1A 1LD7A 2F37A 2R5SA 4GTQA 4FLHA 4C0MA 4TUMA 5JHBA 4N5QA 1WM5A 5LP0A 4U0SA 3WG7E 1U2VG 4FHKA 3EJNA 3ZFWA 3E34A 3UT7A 2QFCA 4G23A 2M63A 4GU5A 2C0MA 3AG3E 4JHKA 3T8MA 3HIZA 4HOUA 3QB2A 2MRIA 3HG0D 4ZHBA 4AV7A 3TWVA 4JC8A 2VGXA 3QWVA 5AENA 1N54A 3LJNA 2YQ8A 3SF4A 1EDUA 3E37A 3Q9UC 4KYOB 4CT4A 1WG0A 1FVFA 3EHQA 1YCSB 3PVLA 3C5RA 3C98A 3U64A 3KSQA 3AS4A 2BF0X 4ILIA 4UQZA 2ETBA 4ANWA 4AOFA 3IHVA 2J9QA 2E0IA 1H19A 3PUJA 2OVBA 1YMPA 1N4PA 3CQCB 5JA4D 4GZDA 1ZU2A 5FQ4A 3HYMB 4RQIA 4WWPA 2PNNA 2Y1LE 4RLYA 1JUQA 3FP3A 4GZCA 2ZISA 3FTVA 2BEDA 4LEUA 3KS2A 3SGHA 1O1TA 1V55E 2J4DA 4B8AA 3EHMA 3HXFA 2X3MA 1S70B 4JPSA 1ZBPA 3NOCD 5ENRD 4KZ0A 4DLOA 5CHEE 4ABNA 1NA3A 5G2NA 4KVOA 4EQFA 5CMWA 2WQ7A 2I1JA 3D9LA 2WVIA 2FF4A 3OXLA 4I1MA 2XEEA 4DX5D 2XPYA 4HORA 4I2ZA 2IOLA 1D8EA 3FUDA 3FEXA 4EZLA 2LSUA 3EIJA 5B1AE 3S7FA 3AS8A 1TNZA 3ABME 2VGXB 2WXOA 2RKKA 4NURA 2XS8A 3C3QA 3BQOA 4J6IA 2E2EA 5C1DA 2WXGA 4C9BB 2MOWA 2RFAA 3LEWA 4FHJA 2LAHA 1BI8B 4BT9A 3NBNB 4BSZB 5A7DB 1H6PA 3FTSA 4GPMA 3ZNGA 2XZDG 2EIJE 3IHYA 4JXTA 1N0QA 4UWGA 2WXIA 2XCCA 5FJYA 5BW8C 2YNQA 2VGEA 4XX5A 4XKBA 5BXOA 5FWQA 2YINA 3UM0A 1BLXB 4MBGA 4TV3A 2X6IA 1VDYA 4K5AB 5FT9A 1H2TC 5BNWA 3CLJA 4AVXA 4FADA 4ZFHA 1JPLA 2ZXWE 3L82A 5AQAA 1FT2A 4CDNA 4HRLA 3Q7AA 2LSVA 2P9LG 5T4YA 3ESLA 3ULQA 3VTXA 2J49A 4D10C 4U95D 4YNDA 3Q4AB 2VSOE 1QZ2A 3JYSA 3TWXA 1W3BA 3ZXSA 3NB2A 5LFAA 4GAAA 2FI7A 2V4LA 5ENNA 4KBQA 5CMYA 3ML8A 2CFUA 2P9SG 4NQ0A 4K03A 4YVQC 3ENEA 1MJ0A 5JHAA 5FQ6A 5BV1A 4HS2A 1SA4A 1GW6A 5HRYA 2Y3AA 4GMRA 4JVSA 2HR2A 2QYJA 3TWQA 4UI9J 1H6KA 3QJZA 3HXBA 5BV0A 5KWDA 3FU5A 3LKUA 3TWSA 2R03A 3FY4A 1UJJA 4LERA 1MYOA 2EILE 3U3WA 3CHOA 4Y6WA 4N2SA 4CCAA 3DSTA 4N3AA 3PEUB 3MEKA 3FU0A 2CG2A 4DI3A 2KATA 3L22A 4MLPA 4IRUA 5ANRA 3ZYMA 1DVPA 3D9PA 4DX2A 3G2UA 3FUIA 5FINA 4PDXA 2ZGGA 1EYHA 4R7LA 3APFA 4WAFA 1EF1C 4B93B 1K1BA 3X2QE 3SBSA 4M3OA 4G8LA 3DSWA 3ZVVA 2V4HC 2WPVA 4TXRA 3ZIMA 2Y69E 2XRZA 3IEGA 4FJZA 2IJGX 4G26A 3L13A 3SZ7A 3PH0C 4EHMA 4GMJA 4AY5A 4NRHB 3D9HA 1TEZA 3ZHEB 5J08A 4LG6A 3QDNA 3MKRA 3UIOC 2R05A 3DEOA 2P9NG 2J09A 4O1OA 1MQSA 1UJKA 4X8QA 4XI0A 3CR3A 3EU5A 4J8YA 2GROB 5E75A 5HS0A 3PZ2A 3PDNA 4JL0A 4XKCA 2P9KG 4AXHA 4AP2A 4WNGA 3L6AA 3L08A 3IKOB 5D66A 5AQBA 3ASOE 3CHMA 4NIKA 3SFZA 3Q79A 3P1UA 4G8KA 4APFA 2KXPC 4BETA 1SQMA 3FH5A 5D2MC 2L6BA 3GW4A 5EKQD 3PE3A 4PS8A 2I9CA 5AJDA 4FP7A 1WDYA 3PRZA 3VTYA 3SO8A 1N4QA 1FT1A 4HB5A 3CGHA 2FULA 3B95A 1IYGA 2JEKA 3VLFA 5AIJA 1S64A 3HHMA 3S7DA 4H7XA 3RRNB 3ZKJA 1H2VC 3FTUA 2KBXA 4BSXA 4HOSA 2CHWA 4B8CB 3PZDA 1UN9A 4RVBA 4YDWA 4FC8A 1IHGA 3NZUA 5FTPA 2QYUA 1HFAA 1ELRA 1NP7A 1XNFA 4AJWA 1OY3D 3SY2A 4WWNA 1KLXA 5CEDB 4GA2A 3CV0A 4URKA 4U0UA 2DBAA 3UX4A 3QWPA 1JCRA 4GYWA 3SFXA 4N3CA 2EIKE 4RG9A 3I4GA 4L2LA 1O1SA 5CRUA 4G25A 2X6FA 3S7BA 1TN8A 1EPUA 1OUVA 3LY7A 2GRLA 4L7TA 1OT8A 3D3MA 3T5XA 3MV3B 1UG3A 3UKRG 3J5QB 1N95A 5G04J 1IQRA 3KSLA 3CSFA 2ZGDA 2LUHA 4L2YA 3ZW3A 5CCLA 5HQ8A 3PS6A 4A1GA 1WAO1 3RO2A 3TXNA 3FU6A 3PZ3A 3HRAA 2VSXE 3MJWA 5BUZA 3NAWA 1S63A 4A55A 4Q69A 5KNHD 4H7YA 1HZ4A 2BTDA 5ARFA 3NQPA 4U8HA 3MKQB 3CVYA 5EX3A 4I17A 3ASNE 5ITZF 3ZEFA 2AW6A 4UWHA 2H6IA 4ACKA 4OVUA 4YDEA 3UPVA 2NC9A 3U66A 3GZSA 5G05C 1IKND 3TXMA 3PEVB 4JA7A 4GTVA 3FH8A 2HYZA 5EIDA 3AU5A 4U0ZA 5H7PA 4J7WA 2VJ8A 3DSSA 4YDYA 1E8ZA 2V8SE 3AG1E 3V2XA 2AVPA 4U04A 1IQUA 2P9IG 4N3BA 1DCEA 1DCQA 5BT1A 1TNUA 1Y8MA 2VTBA 4DLQA 2ONDA 3G2WA 4TUUA 4O6FA 4RG6A 4BWRA 5KJKA 4CGVA 3KAEA 2KZTA 4ME2A 1HU3A 4UWLA 4UQXA 2Y4UA 4UI9K 2B0OE 3I3NA 3MA5A 4WNEA 3GZ2A 2PM6A 3KD7A 3VLDA 3I5PA 3D9IA 4J8DA 3Q9NC 1Z5SC 2OVFA 2LAIA 3E33A 3Q15A 3ISMC 3ZXPA 4U96D 1OCCE 4Z68A 4O60A 3G2TA 3CIAA 4LNGA 2DWZA 2EINE 3FTXA 1O5MA 4AM9A 1D8DA 2DZNA 4L23A 4CDRA 1AP7A 3E4BA 4GCNA 2DYRE 1X5BA 5E76A 3HVEA 5IY5E 4KVMA 1P5QA 3QOUA 5C2YA 2FEZA 5ANLA 3RJVA 4ANVA 2QC9A 1HG5A 2YHEA 3DSXA 5JJTA 1E96B 4RSYA 3JCKC 3RSEG 2GGFA 4Y6CA 3Q75A 5FZSA 3NZSA 3AG2E 4KXKB 3CVXA 4I9EA 2XENA 5KBAA 2KCLA 4GZ6A 2YHCA 4DX6D 4CDMA 4J0UA 1E8YA 1S0PA 1ZB1A 3PNTB 1DNPA 4LCTA 5A23A 5CERB 5CBOA 2J8SD 1N94A 2UWJG 2MYOA 3OXFA 3WXXA 3ABKE 1G3NB 2CG3A 2V0PA 3L54A 1HS6A 4B94A 4BESA 2IOSA 3G2SA 5A6CA 3R7QA 3UKUG 1LD8A 4K0RA 3JXIA 4I43A 1K8KG 3FUMA 4NACA 3MZLB 2P9PG 3RIBA 2DCPA 4ILHB 5B3SE 2XGMA 3GYZA 4TRQA 4DUIA 4UWFA 3CSTA 2XRYA 3UUXA 3UXGA 5ARGA 3CK8A 3HXDA 1FVHA 4XIFA 3JUIA 3Q7FA 3FFLA 4GPKA 1TJFA 4U8VD 4UQYA 3RU0A 3TG5A 3SI5A 5EYLA 1QNFA 4HOQA 3S2AA 3B13A 5FIOA 1A5EA 2GRPB 3PUKA 3CVVA 3R9AB 1FPPA 4E6HA 1SZ9A 1PC2A 4W9RA 2J4BA 4DK5A 3DXKG 1TYQG 2C2LA 1L5JA 4GZ5A 1TN6A 2WMNA 3RKVA 1RW2A 4LNUD 1JWFA 1NA0A 3LVRE 4F53A 1K1AA 3T9KA 2DVWA 4A63B 3PZ4A 3LXUX 4LSZE 3CVPA 5JJ7A 3N71A 3JUEA 2WXRA 5FZRA 4HI8A 4LNBA 3VLEA 5G55A 5CBNA 4GCOA 2ETAA 2OEWA 5JJ6A 1WY6A 4HRMB 2Q7FA 3DXMG 2IF4A 1JWGA 3AU4A 3SQVA 4U63A 2WXJA 2IU1A 3T5VA 1YYHA 1OWMA 3LY9A 3RO3A 5FQ7A 3FTWA 3D9KA 4AEZC 2XQ0A 2OCCE 4UI9C 2A4ZA 2A5EA 1HG2A 1AWCB 2UY1A 2BKKB 3ZGQA 5M72A 3B7TA 2LXMA 4BERA 1INZA 3APDA 1H6OA 5AQ7A 3ASGA 2KM4A 2LO6A 3ABLE 4Q96A 2WXNA 1OWPA 2GRQB 3U4TA 4WNFA 3C3OA 1NZNA 3E30A 2IY0C 3EU9A 1HXIA 4EBAA 2RD0A 3QC1A 3R7RA 4HFGA 3FUNA 4PH4B 1SVXA 3HXEA 4WNDA 2XS1A 4HBDA 2P2CP 3ZYLA 2QY7A 5AYWD 5DBKA 3AAAC 2WXPA 2PM7A 4G11A 4OAUC 4DRXE 1TN7A 4F1SA 5LCWC 3AG4E 3SNXA 3TWRA 4TXPA 2FO1E 3LPZA 3OXGA 3TWWA 1QQEA 3BG0B 3JXJA 1BD8A 3OTNA 1N9AA 3ULYA 4M7CA 2ZU6B 2HO1A 2F0YA 3W9GA 4QQIA 2FBNA 4DX7D 1BU9A 4N2QA 2GRNB 4XI9A 1TJCA 3MX3A 4I9CA 4FU3A 2ETCA 2AXZA 1RZ4A 2L0IA 4K5CA 3I4RB 3FTZA 3ZUVB 2I1KA 4MS6A 3KEZA 4WUYA 5EX0A 1E8WA 2XGOA 4U07A 2ZIRA 5HI7A 4G24A 4GYOA 4KMOA 2MHKA 5KNGA 3TG4A 1UW4B 1DC2A 2PQNA 4JD2G 4ANUA 3TWUA 3O48A 1Z3YA 3UQ3A 3IXEA 3FUHA 2VGYA 3UINC 1MX4A 3PNLB 3LY8A 4MRUA 1N4SA 4BEPA 2PZIA 4FULA 1E7VA 1KZOA 4I6EA 3FUEA 2L0TB 2P58C 5G05J 1K3ZD 3FU3A 2WM9A 4GA0A 2WMOA 5EDSA 4YDOA 3TL5A 4J8EA
chains in the Genus database with same CATH topology
2CFUA 4ILGA 4NQ0A 4K03A 4LRZA 4YVQC 3ENEA 4BX8A 4GB9A 2J07A 4YVOA 4F7AA 5JHAA 5FQ6A 5BV1A 3Q5MA 3UT8A 1N52A 3G2TA 4HS2A 3CIAA 1E8XA 1PAQA 3FTXA 4AIFA 1GW6A 4N39A 3RRMB 4AM9A 4BFRA 3MV2B 3QKYA 5KJMA 4L23A 2L6JA 3B7SA 2Y3AA 3CEQA 4CDRA 4JEUA 2HM8A 4JVSA 3E4BA 4GCNA 2HR2A 3DPDA 4QFVA 3BG1B 2VSNA 4UI9J 1H6KA 1X5BA 2PQRA 3QJZA 5E76A 3HVEA 4IYPA 3DBSA 1P5QA 4KVMA 4A3VA 5BV0A 2CFZA 3QOUA 5C2YA 3FU5A 2FEZA 5ANLA 4V3IA 1OWOA 4GA1A 4XE0A 3LKUA 3RJVA 4ANVA 4OYSA 3D9NA 4E85A 4HLEA 1HG5A 2YHEA 2VSYA 5FQ8A 3U9WA 3FY4A 1B89A 1UJJA 4LERA 2AXUA 3SBTB 4A1SA 4JW1A 3U3WA 3ONKA 3CHOA 5JJTA 3QWWA 4Y6WA 1E96B 3CHQA 4RSYA 4CCAA 4N2SA 3JCKC 1HH8A 3L16A 2IFUA 3G2VA 2GGFA 4Y6CA 5FZSA 5KJLA 4L1BA 4N3AA 2PL2A 2WXQA 3NZSA 3PEUB 3FH7A 4WWOA 2C0LA 3MEKA 3ML9A 4BTAA 3FU0A 2CG2A 4DI3A 3QNKA 4KXKB 2KATA 3L22A 3CVXA 4I9EA 4G1TA 4B89A 3QK0A 3AS5A 4AY6A 4MLPA 4HXIA 4IRUA 1UN8A 3D9OA 4XZ4A 5ANRA 2KCLA 4KZCA 5KCMA 3MKQA 3ZYMA 1DVPA 3D9PA 4GZ6A 2YHCA 3K9IA 3G2UA 5G04C 1ELWA 3JQ0A 3FUIA 5J90A 4PDXA 4CDMA 4J0UA 5D0QD 1E8YA 1EYHA 1S0PA 4R7LA 2X6HA 3P2BA 3CK9A 3APFA 3PNTB 2UY1B 1DNPA 4LCTA 4CGWA 4WAFA 1EF1C 5A23A 3APCA 4JHRA 3L17A 3SBSA 3Q49B 2XPZA 4M3OA 2UWJG 2A5UA 3OXFA 3LYAA 3WXXA 4F3VA 2I2OA 2CG3A 2V0PA 4PUCA 1XGWA 3EDTB 3L54A 3ZVVA 2WPVA 3QAQA 3TAXA 3ZIMA 1HS6A 4B94A 2XRZA 2IOSA 5T3RA 3IEGA 3CKBA 2ILRA 3G2SA 5T8IA 4FJZA 2IJGX 5A6CA 3R7QA 4G26A 3L13A 2KCKA 3SZ7A 2X6JA 4JHJA 4EZKA 3PH0C 4GMJA 4K0RA 4JZYA 4AY5A 4I6GA 4NRHB 1TEZA 3FHEA 4G2VA 4I43A 2V5FA 3FUMA 3ZHEB 4NACA 5J08A 3MZLB 4FLBA 4I1OB 4CT0A 4N5CA 3RIBA 2DCPA 2WXMA 4GZ3A 4ILHB 3FDHA 2Y4TA 4BX9A 3CKCA 1OWNA 2XGMA 4GYYA 3QDNA 1HF8A 3GYZA 2GRMA 2NXPA 3RRUA 3LVQE 3MKRA 4TRQA 4BT8A 4UWFA 3JQ1A 4ACLA 3CSTA 3CVWA 1KT1A 2XRYA 3HDXA 5D0OD 2J09A 3UUXA 3MGBA 1MQSA 3ONLA 5ARGA 1UJKA 3CK8A 2R5SA 3LCAA 4XI0A 1HX8A 3CR3A 4BTBA 1FVHA 5E75A 4XIFA 3JUIA 1H2UA 1YA0A 3FFLA 1TJFA 2BUGA 4UQYA 4GPKA 4FLHA 3RU0A 3PDNA 4C0MA 3TG5A 5LX8A 1HE8A 4JL0A 4XKCA 3SI5A 4EZJA 4AXHA 1QNFA 4HOQA 3S2AA 4AP2A 4WNGA 5BPPA 3L6AA 3B13A 5JHBA 1WM5A 4I1AA 5LP0A 3L08A 4U0SA 3IKOB 4GMLA 3PUKA 4FHKA 3EJNA 3ZFWA 4EPZA 3BEEA 3UT7A 3CVVA 3R9AB 2QFCA 4G23A 1BPOA 4E6HA 3CHMA 3SFZA 1SZ9A 2M63A 4GU5A 3P1UA 2C0MA 4APFA 4DPRA 1PC2A 3CVQA 1SQMA 2I6HA 3FH5A 2WXFA 4JEHA 4W9RA 4JHKA 3GW4A 3T8MA 5EKQD 3CK7A 3HIZA 4HOUA 2J4BA 4DK5A 4C0EA 2C2LA 1L5JA 4GZ5A 3PE3A 2WMNA 4MKTA 4PS8A 3QB2A 2I9CA 3RKVA 2MRIA 5AJDA 2IONA 4FP7A 1JWFA 1NA0A 3LVRE 3PRZA 4OVVA 5DIZA 3VTYA 5AJLA 4IULA 4A3TA 4F53A 4AV7A 3CGHA 2FULA 4JC8A 1IYGA 2JEKA 3LXUX 3VLFA 3ZRHA 3CVPA 2WB2A 2VGXA 3QWVA 5AIJA 2R59A 5JJ7A 5AENA 2VTBB 1N54A 4HVBA 3N71A 3HHMA 3S7DA 2WXRA 5FZRA 4H7XA 2YQ8A 4PS7A 3IV0A 3RRNB 3SF4A 1H2VC 1EDUA 3FTUA 5G55A 3VLEA 2AXVA 4KYOB 4CT4A 4GCOA 2GW1A 1FVFA 4BSXA 4HOSA 4PS3A 2CHWA 3PVLA 4B8CB 3PZDA 5LOZA 1UN9A 2AWIA 4RVBA 4CRWA 3LDZA 4FC8A 2XEVA 3C98A 5JJ6A 3U64A 1WY6A 3AS4A 3CHRA 3Q47B 1IHGA 2BF0X 3NZUA 5FTPA 2KZTB 4ILIA 2Q7FA 3MCXA 1HFAA 1ELRA 2IF4A 1JWGA 2XGSA 3CHSA 1NP7A 3AU4A 3TJPA 1XNFA 1HO8A 3EIQC 4AJWA 4UQZA 4U63A 2CHXA 3PE4A 3ZN3A 3QARA 3ESKA 2WXJA 4ANWA 4AOFA 2IU1A 3T5VA 2WXKA 4WWNA 1OWMA 1KLXA 2IQCA 3IHVA 3LY9A 3RO3A 2J9QA 2E0IA 1H19A 3PUJA 5FQ7A 2OVBA 3ZYQA 4GA2A 3CV0A 4URKA 4U0UA 2DBAA 3UX4A 3FTWA 3CQCB 3QWPA 3D9KA 4GZDA 2WQHA 2WXLA 4P29A 1ZU2A 4GYWA 4AEZC 3CVUA 5FQ4A 3HYMB 1ELKA 2XCBA 2XQ0A 4N3CA 4WWPA 4UI9C 2VYIA 4RG9A 3I4GA 4L2LA 2A4ZA 1HG2A 4G25A 1JUQA 2X6FA 3S7BA 4B0ZA 3SD5A 2XPIA 2UY1A 5CCMA 3FP3A 3ZGQA 3B7TA 3FWVA 4GZCA 5M72A 1EPUA 1OUVA 3URZA 3LY7A 2GRLA 4L7TA 3FTVA 1INZA 3APDA 4LEUA 3KS2A 3SGHA 3ZYKA 2CHZA 3D3MA 3T5XA 3ASGA 2J4DA 2KM4A 4B8AA 2LO6A 3EHMA 4IN3B 3S7JA 3MV3B 1UG3A 4Q96A 4JA9A 2X3MA 2J08A 2WXNA 1OWPA 3FUFA 4DJAA 3ASFA 5G04J 3HVEB 4LUNU 3U4TA 3ZPJA 4WNFA 1IQRA 1NZNA 3FUJA 3LJ3A 3CSFA 4JPSA 1ZBPA 3D9MA 4L2YA 3ZW3A 1HXIA 4KZ0A 5CCLA 4EBAA 4DLOA 5HQ8A 3TGOA 4CEMA 3PS6A 4A1GA 1WAO1 3RO2A 5CHEE 4ABNA 1NA3A 2RD0A 3QC1A 3TXNA 3FU6A 1A17A 2NSZA 3R7RA 4HFGA 2VSXE 5G2NA 4KVOA 4EQFA 3FUNA 4J8SA 5CMWA 4PH4B 2WQ7A 4BY6A 3MJWA 3ZHEA 2I1JA 3D9LA 2WVIA 2FF4A 4WNDA 5BUZA 3OXLA 2OV8A 4I1MA 2XPYA 4HORA 4A55A 1U3CA 4I2ZA 4Q69A 3ZYLA 2LNIA 2IOLA 1E7UA 2QY7A 2VQ2A 3OAWA 5DBKA 5FZQA 5AYWD 3FUDA 3FEXA 4EZLA 2LSUA 3EIJA 4H7YA 3S7FA 2WQ6A 3AS8A 1HZ4A 2WXHA 3O4ZA 2BTDA 5ARFA 2WXPA 2PM7A 3MYVA 3CVNA 4ATGA 2VGXB 4G11A 4UWKA 3B7UX 2WXOA 3NQPA 4U8HA 4NURA 3MKQB 4F1SA 5LCWC 3SNXA 4EBAG 3IBEA 4J6IA 2E2EA 3LPZA 3FULA 3OXGA 5C1DA 3CVYA 2WXGA 2XHEA 5EX3A 4C9BB 3FUKA 2MOWA 3LEWA 4I17A 3CHPA 3ASDA 4EECA 3EHNA 4FHJA 4DI4A 1QQEA 3B7RL 3BG0B 3ZEFA 2LAHA 2AW6A 3OTNA 4HOTA 4UWHA 4BT9A 4ACKA 4OVUA 2ZU6B 2HO1A 5A7DB 3UPVA 2NC9A 3LS8A 2FBNA 3U66A 4N2QA 3FTSA 3GZSA 1SZAA 3IHYA 2JLBA 5G05C 4JXTA 2R17C 3GZ1A 4XI9A 1OWLA 3TXMA 3PEVB 4JA7A 1TJCA 4APOA 4UWGA 3FH8A 2WXIA 3MX3A 2HYZA 2XCCA 4I9CA 5FJYA 3AU5A 4FU3A 4U0ZA 5BW8C 2AXZA 3RK6A 2YNQA 2L0IA 4XX5A 3CVLA 1MHQA 4XKBA 3I4RB 3FTZA 2VJ8A 5FWQA 2I1KA 2YINA 3KEZA 4MS6A 1E8ZA 3UT4A 2V8SE 1H0AA 4WUYA 3CQGB 4TV3A 1KT0A 2X6IA 5EX0A 5KJNA 2AVPA 1E8WA 3FTYA 1VDYA 4U04A 1IQUA 2XGOA 4U07A 4N3BA 5FT9A 1H2TC 4G24A 5HI7A 4GYOA 5BNWA 3CLJA 4KMOA 4AVXA 4FADA 2OOEA 2MHKA 3TG4A 5BT1A 1Y8MA 2VTBA 1JPLA 1UW4B 4I6JA 4I2WA 4ANXA 4DLQA 2PQNA 2ONDA 5LCWJ 4CDNA 4ANUA 4FA6A 3O48A 3PREA 1Z3YA 3G2WA 4FJYA 3UQ3A 3FEYA 3NF1A 2LSVA 3FUHA 4O6FA 4TUUA 5T4YA 1Z6TA 4J8FA 3ESLA 2VGYA 3ULQA 4Q94A 3VTXA 1LF8A 4RG6A 3UMVA 4BWRA 5KJKA 2J49A 2KC7A 4CGVA 3ASHA 3KAEA 3PNLB 4D10C 3LY8A 3SHFA 4MRUA 2KZTA 4ME2A 1HU3A 4UWLA 2DIWA 4UQXA 1PY1A 4YNDA 2FO7A 2PZIA 2Y4UA 4KT6B 4FULA 1E7VA 3Q4AB 4I6EA 2VSOE 4UI9K 1E90A 2EQXA 2L9BA 2RG8A 3FUEA 3I3NA 2L0TB 1QZ2A 3JYSA 3D9JA 1W3BA 2P58C 3MA5A 5G05J 1Z3XA 3ZXSA 1Y6IA 3GZ2A 4WNEA 2PM6A 3KD7A 3FU3A 3VLDA 2WM9A 3I5PA 3D9IA 4GA0A 2X6KA 4GAAA 2WMOA 2X38A 5EDSA 2FI7A 5LFAA 4J8DA 3TL5A 2V4LA 5ENNA 2OVFA 2KCVA 2LAIA 4J8EA 4KBQA 5CMYA 3Q15A 1U3DA 3ML8A 1FCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ0 A;  4YVQ C;  4YVO A;  3Q5M A;  4AIF A;  4N39 A;  4AM9 A;  3MV2 B;  3QKY A;  5KJM A;  2L6J A;  3CEQ A;  4CDR A;  3E4B A;  4GCN A;  2HR2 A;  2VSN A;  4UI9 J;  2PQR A;  1P5Q A;  3QOU A;  2FEZ A;  4GA1 A;  3LKU A;  3RJV A;  2VSY A;  1B89 A;  4A1S A;  3U3W A;  5JJT A;  3QWW A;  4Y6W A;  1E96 B;  4N2S A;  1HH8 A;  2IFU A;  4Y6C A;  5FZS A;  5KJL A;  4N3A A;  2PL2 A;  2C0L A;  3MEK A;  4BTA A;  4KXK B;  2KAT A;  4I9E A;  4G1T A;  3AS5 A;  4AY6 A;  2KCL A;  4GZ6 A;  2YHC A;  3K9I A;  5G04 C;  1ELW A;  4J0U A;  5D0Q D;  3CK9 A;  2UY1 B;  4CGW A;  4JHR A;  3Q49 B;  2UWJ G;  3OXF A;  3LYA A;  3WXX A;  4F3V A;  3EDT B;  2WPV A;  3TAX A;  4B94 A;  3IEG A;  3CKB A;  5A6C A;  4G26 A;  2KCK A;  3SZ7 A;  4AY5 A;  4NRH B;  4G2V A;  2V5F A;  3ZHE B;  4N5C A;  3RIB A;  4GZ3 A;  2Y4T A;  3CKC A;  2XGM A;  4GYY A;  3QDN A;  3GYZ A;  3MKR A;  4BT8 A;  1KT1 A;  5D0O D;  3UUX A;  5ARG A;  3CK8 A;  2R5S A;  3LCA A;  4XI0 A;  4BTB A;  4XIF A;  1YA0 A;  3FFL A;  4GPK A;  2BUG A;  4UQY A;  3RU0 A;  3PDN A;  3TG5 A;  4JL0 A;  4HOQ A;  4WNG A;  1WM5 A;  4I1A A;  4U0S A;  3ZFW A;  3BEE A;  3R9A B;  2QFC A;  4G23 A;  2C0M A;  1PC2 A;  3CVQ A;  2I6H A;  4W9R A;  3GW4 A;  5EKQ D;  3CK7 A;  4HOU A;  2C2L A;  4GZ5 A;  3PE3 A;  3RKV A;  1NA0 A;  5DIZ A;  3VTY A;  1IYG A;  3CVP A;  2VGX A;  3QWV A;  5JJ7 A;  3N71 A;  3S7D A;  5FZR A;  4H7X A;  2YQ8 A;  3SF4 A;  4KYO B;  4GCO A;  2GW1 A;  4HOS A;  2XEV A;  5JJ6 A;  3Q47 B;  3AS4 A;  1IHG A;  5FTP A;  2Q7F A;  1ELR A;  2IF4 A;  2XGS A;  1XNF A;  4UQZ A;  3PE4 A;  3ZN3 A;  3ESK A;  3LY9 A;  1KLX A;  3RO3 A;  2J9Q A;  4GA2 A;  3CV0 A;  4U0U A;  2DBA A;  3QWP A;  2WQH A;  1ZU2 A;  4GYW A;  3HYM B;  2XCB A;  4N3C A;  4UI9 C;  2VYI A;  4RG9 A;  4G25 A;  3S7B A;  2XPI A;  2UY1 A;  5CCM A;  3FP3 A;  3ZGQ A;  5M72 A;  3FWV A;  1OUV A;  3URZ A;  3LY7 A;  4LEU A;  3KS2 A;  3ASG A;  4IN3 B;  3S7J A;  3MV3 B;  4JA9 A;  3ASF A;  5G04 J;  3U4T A;  3ZPJ A;  4WNF A;  1NZN A;  1ZBP A;  1HXI A;  5CCL A;  5HQ8 A;  3TGO A;  1WAO 1;  3RO2 A;  5CHE E;  4ABN A;  1NA3 A;  1A17 A;  4EQF A;  3ZHE A;  2FF4 A;  4WND A;  3OXL A;  4HOR A;  4I2Z A;  2LNI A;  5AYW D;  2VQ2 A;  5DBK A;  5FZQ A;  2LSU A;  4H7Y A;  3S7F A;  3AS8 A;  1HZ4 A;  5ARF A;  3CVN A;  2VGX B;  5LCW C;  2E2E A;  3OXG A;  3LPZ A;  5C1D A;  5EX3 A;  4I17 A;  3ASD A;  1QQE A;  4HOT A;  4BT9 A;  2HO1 A;  5A7D B;  3UPV A;  2NC9 A;  2FBN A;  4N2Q A;  2JLB A;  5G05 C;  3GZ1 A;  4XI9 A;  4JA7 A;  1TJC A;  4APO A;  2HYZ A;  2XCC A;  4I9C A;  5FJY A;  4U0Z A;  5BW8 C;  3CVL A;  4WUY A;  1KT0 A;  5EX0 A;  5KJN A;  2AVP A;  4U04 A;  2XGO A;  4U07 A;  4N3B A;  5FT9 A;  5HI7 A;  4G24 A;  4GYO A;  5BNW A;  2OOE A;  2MHK A;  3TG4 A;  5BT1 A;  1Y8M A;  4I2W A;  2PQN A;  2OND A;  5LCW J;  3O48 A;  3UQ3 A;  3NF1 A;  2LSV A;  4O6F A;  4J8F A;  2VGY A;  3ULQ A;  3VTX A;  4RG6 A;  4BWR A;  5KJK A;  2KC7 A;  4CGV A;  3ASH A;  3KAE A;  3LY8 A;  4ME2 A;  4UQX A;  4YND A;  2FO7 A;  2PZI A;  2Y4U A;  3Q4A B;  4UI9 K;  1QZ2 A;  3JYS A;  1W3B A;  2P58 C;  3MA5 A;  5G05 J;  4WNE A;  3GZ2 A;  3KD7 A;  4GA0 A;  2FI7 A;  4J8D A;  2KCV A;  4J8E A;  4KBQ A;  3Q15 A;  1FCH A; 
#chains in the Genus database with same CATH topology
 4LRZ A;  4BX8 A;  4GB9 A;  4F7A A;  3BUA A;  4GTS A;  3UT8 A;  1N52 A;  2NYJ A;  4HQD A;  1E8X A;  1PAQ A;  4AIF A;  4N39 A;  4U7E B;  3RRM B;  3MV2 B;  5ENT D;  4L9P A;  2L6J A;  1UOH A;  3CEQ A;  4JEU A;  4QFV A;  1MX6 A;  2VSN A;  2PQR A;  4C48 B;  1D9S A;  2CFZ A;  2EIM E;  4V3I A;  1OWO A;  2AJA A;  3DWL G;  3D9N A;  5FQ8 A;  2AXU A;  3SBT B;  4A1S A;  4JW1 A;  3ONK A;  3QWW A;  2B6C A;  3L16 A;  1SW6 A;  4GTP A;  2IFU A;  5AAR A;  5KJL A;  2PL2 A;  2WXQ A;  2C0L A;  4BTA A;  1LTX A;  4G1T A;  1SA5 A;  1TNB A;  4AY6 A;  4HXI A;  3D9O A;  4XZ4 A;  3DEP A;  4KZC A;  3Q78 A;  5G04 C;  1ELW A;  4JB8 P;  2X6H A;  3P2B A;  3CK9 A;  1QBQ A;  4CZ2 D;  4CGW A;  2XEH A;  3L17 A;  3Q49 B;  3AJI A;  3LYA A;  3HXC A;  2IO3 C;  3TAX A;  5T3R A;  2ILR A;  4JHJ A;  2H6H A;  5EYP F;  4JZY A;  4TXQ A;  5HKP A;  3FHE A;  4G2V A;  3NOG D;  4GTR A;  5EIB E;  4FLB A;  1NFI E;  2WXM A;  3FDH A;  2Y4T A;  5B1B E;  4GYY A;  1HF8 A;  2GRM A;  4BT8 A;  1N11 A;  3JQ1 A;  1OCR E;  5AAO A;  3TWT A;  5D0O D;  1BI7 B;  3MGB A;  3ONL A;  3UIP C;  3LCA A;  1HX8 A;  4BTB A;  3V79 K;  3J5P A;  1H2U A;  1YA0 A;  2BUG A;  5LX8 A;  1HE8 A;  4EZJ A;  5ENQ D;  5BPP A;  2R2L A;  2F8Y A;  4I1A A;  1N0R A;  4ATZ D;  4GML A;  4EPZ A;  3BEE A;  1JCQ A;  1BPO A;  4DPR A;  4JEH A;  2LXL A;  2I6H A;  3CVQ A;  2WXF A;  4F1P A;  3CK7 A;  4C0E A;  5EN5 D;  4MKT A;  3UM3 A;  3V31 A;  2ION A;  5DIZ A;  4OVV A;  4A3T A;  5AJL A;  4IUL A;  4GTM A;  3ZRH A;  2WB2 A;  2R59 A;  2VTB B;  4HVB A;  2H6G A;  2IO2 C;  4PS7 A;  3IV0 A;  2AXV A;  3RAU A;  2GW1 A;  4PS3 A;  5LOZ A;  2AWI A;  3UTM A;  4CRW A;  3LDZ A;  2XEV A;  1KZP A;  3Q47 B;  3CHR A;  2KZT B;  3MCX A;  2XGS A;  3CHS A;  5EIL A;  1JCS A;  3TJP A;  1HO8 A;  3EIQ C;  2CHX A;  3PE4 A;  3ZN3 A;  3QAR A;  3ESK A;  1QYM A;  2WXK A;  3W9F A;  2IQC A;  3ZYQ A;  3SFY A;  4HI9 A;  2WQH A;  2WXL A;  4P29 A;  3CVU A;  2JAB A;  1ELK A;  2XCB A;  2VYI A;  3F6Q A;  2DZO A;  3DSV A;  5ENP D;  4B0Z A;  3SD5 A;  2XPI A;  5CCM A;  3FWV A;  3URZ A;  3ZYK A;  2CHZ A;  5AQ9 A;  4IN3 B;  3S7J A;  2XZT G;  4JA9 A;  2J08 A;  3KEA A;  3FUF A;  4DJA A;  3ASF A;  3ZPJ A;  3HVE B;  4LUN U;  3UM2 A;  3FUJ A;  3LJ3 A;  1V54 E;  3D9M A;  3DPY A;  3C72 A;  3TGO A;  4CEM A;  1A17 A;  2NSZ A;  4J8S A;  4BY6 A;  3ZHE A;  4U8Y D;  2OV8 A;  1U3C A;  1TNY A;  1O1R A;  2LNI A;  1E7U A;  2VQ2 A;  3OAW A;  5FZQ A;  2WQ6 A;  2WXH A;  3O4Z A;  5BXU A;  3MYV A;  3CVN A;  4ATG A;  4UWK A;  3L9T A;  3B7U X;  4K5B A;  4EBA G;  3IBE A;  3FUL A;  3DRA A;  2XHE A;  3FUK A;  3UI2 A;  3ASD A;  4EEC A;  3EHN A;  4DI4 A;  5ENO D;  3B7R L;  4HOT A;  1OCZ E;  5JMN D;  4XEI G;  3LS8 A;  1SZA A;  2JLB A;  2R17 C;  3GZ1 A;  1OWL A;  4APO A;  3RK6 A;  2R02 A;  3ZU7 B;  3CVL A;  1MHQ A;  3T8K A;  4GTO A;  3UT4 A;  1H0A A;  3CQG B;  1KT0 A;  5KJN A;  3FTY A;  2OOE A;  2P9U G;  3B7B A;  4I2W A;  4I6J A;  4ANX A;  5LCW J;  1TNO A;  4FA6 A;  3PRE A;  4FJY A;  3FEY A;  3NF1 A;  1Z6T A;  4J8F A;  2V5Q C;  1TR4 A;  4Q94 A;  1LF8 A;  3UMV A;  2KC7 A;  1Q2Z A;  3ASH A;  2F8X K;  3SHF A;  4GTT A;  4O1P A;  2DIW A;  1PY1 A;  2FO7 A;  4KT6 B;  1E90 A;  4HNA D;  2EQX A;  2L9B A;  2RG8 A;  2BKG A;  1X81 A;  3D9J A;  1Z3X A;  1Y6I A;  5ENS D;  4BX9 A;  2X6K A;  2X38 A;  4OAV B;  3Q73 A;  4HRN A;  2KCV A;  3C3R A;  3CHP A;  1U3D A;  1FCH A;  4ILG A;  2J07 A;  4YVO A;  3Q5M A;  1IXV A;  5CRV A;  4BFR A;  3QKY A;  5KJM A;  3B7S A;  4CYM D;  4UUC A;  2HM8 A;  3DPD A;  3BG1 B;  1NI1 A;  4IYP A;  3DBS A;  4A3V A;  2DYS E;  3DSU A;  1N4R A;  1KPS B;  4GA1 A;  4XE0 A;  4OYS A;  4HLE A;  4E85 A;  3E32 A;  2VSY A;  3UM1 A;  3U9W A;  1B89 A;  4DX1 A;  3CHQ A;  1HH8 A;  2H6F A;  3G2V A;  4L1B A;  4WWO A;  1OCO E;  3FH7 A;  3ML9 A;  2Y0B G;  3QNK A;  4B89 A;  3QK0 A;  3AS5 A;  3EUV A;  1UN8 A;  5KCM A;  3MKQ A;  1IHB A;  3K9I A;  5J90 A;  3JQ0 A;  5D0Q D;  1OXJ A;  2GRR B;  2UY1 B;  3APC A;  5CEA A;  2IEJ A;  4JHR A;  2XPZ A;  2A5U A;  4F3V A;  2I2O A;  2OEV A;  3BU8 A;  1MX2 A;  1NL4 A;  4PUC A;  1XGW A;  3EDT B;  3QAQ A;  1MZC A;  3CKB A;  2HE0 A;  5T8I A;  3EHR A;  5CEC B;  2KCK A;  4EZK A;  2X6J A;  3V2O A;  4I6G A;  4HLL A;  2V5F A;  3ULE G;  4F6R D;  4I1O B;  4CT0 A;  4N5C A;  4GZ3 A;  5AN8 A;  3CKC A;  1OWN A;  3V30 A;  2NXP A;  3RRU A;  2QZA A;  3LVQ E;  2RFM A;  4ACL A;  3CVW A;  3R9M A;  1KT1 A;  3HDX A;  3PZ1 A;  1LD7 A;  2F37 A;  2R5S A;  4GTQ A;  4FLH A;  4C0M A;  4TUM A;  5JHB A;  4N5Q A;  1WM5 A;  5LP0 A;  4U0S A;  3WG7 E;  1U2V G;  4FHK A;  3EJN A;  3ZFW A;  3E34 A;  3UT7 A;  2QFC A;  4G23 A;  2M63 A;  4GU5 A;  2C0M A;  3AG3 E;  4JHK A;  3T8M A;  3HIZ A;  4HOU A;  3QB2 A;  2MRI A;  3HG0 D;  4ZHB A;  4AV7 A;  3TWV A;  4JC8 A;  2VGX A;  3QWV A;  5AEN A;  1N54 A;  3LJN A;  2YQ8 A;  3SF4 A;  1EDU A;  3E37 A;  3Q9U C;  4KYO B;  4CT4 A;  1WG0 A;  1FVF A;  3EHQ A;  1YCS B;  3PVL A;  3C5R A;  3C98 A;  3U64 A;  3KSQ A;  3AS4 A;  2BF0 X;  4ILI A;  4UQZ A;  2ETB A;  4ANW A;  4AOF A;  3IHV A;  2J9Q A;  2E0I A;  1H19 A;  3PUJ A;  2OVB A;  1YMP A;  1N4P A;  3CQC B;  5JA4 D;  4GZD A;  1ZU2 A;  5FQ4 A;  3HYM B;  4RQI A;  4WWP A;  2PNN A;  2Y1L E;  4RLY A;  1JUQ A;  3FP3 A;  4GZC A;  2ZIS A;  3FTV A;  2BED A;  4LEU A;  3KS2 A;  3SGH A;  1O1T A;  1V55 E;  2J4D A;  4B8A A;  3EHM A;  3HXF A;  2X3M A;  1S70 B;  4JPS A;  1ZBP A;  3NOC D;  5ENR D;  4KZ0 A;  4DLO A;  5CHE E;  4ABN A;  1NA3 A;  5G2N A;  4KVO A;  4EQF A;  5CMW A;  2WQ7 A;  2I1J A;  3D9L A;  2WVI A;  2FF4 A;  3OXL A;  4I1M A;  2XEE A;  4DX5 D;  2XPY A;  4HOR A;  4I2Z A;  2IOL A;  1D8E A;  3FUD A;  3FEX A;  4EZL A;  2LSU A;  3EIJ A;  5B1A E;  3S7F A;  3AS8 A;  1TNZ A;  3ABM E;  2VGX B;  2WXO A;  2RKK A;  4NUR A;  2XS8 A;  3C3Q A;  3BQO A;  4J6I A;  2E2E A;  5C1D A;  2WXG A;  4C9B B;  2MOW A;  2RFA A;  3LEW A;  4FHJ A;  2LAH A;  1BI8 B;  4BT9 A;  3NBN B;  4BSZ B;  5A7D B;  1H6P A;  3FTS A;  4GPM A;  3ZNG A;  2XZD G;  2EIJ E;  3IHY A;  4JXT A;  1N0Q A;  4UWG A;  2WXI A;  2XCC A;  5FJY A;  5BW8 C;  2YNQ A;  2VGE A;  4XX5 A;  4XKB A;  5BXO A;  5FWQ A;  2YIN A;  3UM0 A;  1BLX B;  4MBG A;  4TV3 A;  2X6I A;  1VDY A;  4K5A B;  5FT9 A;  1H2T C;  5BNW A;  3CLJ A;  4AVX A;  4FAD A;  4ZFH A;  1JPL A;  2ZXW E;  3L82 A;  5AQA A;  1FT2 A;  4CDN A;  4HRL A;  3Q7A A;  2LSV A;  2P9L G;  5T4Y A;  3ESL A;  3ULQ A;  3VTX A;  2J49 A;  4D10 C;  4U95 D;  4YND A;  3Q4A B;  2VSO E;  1QZ2 A;  3JYS A;  3TWX A;  1W3B A;  3ZXS A;  3NB2 A;  5LFA A;  4GAA A;  2FI7 A;  2V4L A;  5ENN A;  4KBQ A;  5CMY A;  3ML8 A;  2CFU A;  2P9S G;  4NQ0 A;  4K03 A;  4YVQ C;  3ENE A;  1MJ0 A;  5JHA A;  5FQ6 A;  5BV1 A;  4HS2 A;  1SA4 A;  1GW6 A;  5HRY A;  2Y3A A;  4GMR A;  4JVS A;  2HR2 A;  2QYJ A;  3TWQ A;  4UI9 J;  1H6K A;  3QJZ A;  3HXB A;  5BV0 A;  5KWD A;  3FU5 A;  3LKU A;  3TWS A;  2R03 A;  3FY4 A;  1UJJ A;  4LER A;  1MYO A;  2EIL E;  3U3W A;  3CHO A;  4Y6W A;  4N2S A;  4CCA A;  3DST A;  4N3A A;  3PEU B;  3MEK A;  3FU0 A;  2CG2 A;  4DI3 A;  2KAT A;  3L22 A;  4MLP A;  4IRU A;  5ANR A;  3ZYM A;  1DVP A;  3D9P A;  4DX2 A;  3G2U A;  3FUI A;  5FIN A;  4PDX A;  2ZGG A;  1EYH A;  4R7L A;  3APF A;  4WAF A;  1EF1 C;  4B93 B;  1K1B A;  3X2Q E;  3SBS A;  4M3O A;  4G8L A;  3DSW A;  3ZVV A;  2V4H C;  2WPV A;  4TXR A;  3ZIM A;  2Y69 E;  2XRZ A;  3IEG A;  4FJZ A;  2IJG X;  4G26 A;  3L13 A;  3SZ7 A;  3PH0 C;  4EHM A;  4GMJ A;  4AY5 A;  4NRH B;  3D9H A;  1TEZ A;  3ZHE B;  5J08 A;  4LG6 A;  3QDN A;  3MKR A;  3UIO C;  2R05 A;  3DEO A;  2P9N G;  2J09 A;  4O1O A;  1MQS A;  1UJK A;  4X8Q A;  4XI0 A;  3CR3 A;  3EU5 A;  4J8Y A;  2GRO B;  5E75 A;  5HS0 A;  3PZ2 A;  3PDN A;  4JL0 A;  4XKC A;  2P9K G;  4AXH A;  4AP2 A;  4WNG A;  3L6A A;  3L08 A;  3IKO B;  5D66 A;  5AQB A;  3ASO E;  3CHM A;  4NIK A;  3SFZ A;  3Q79 A;  3P1U A;  4G8K A;  4APF A;  2KXP C;  4BET A;  1SQM A;  3FH5 A;  5D2M C;  2L6B A;  3GW4 A;  5EKQ D;  3PE3 A;  4PS8 A;  2I9C A;  5AJD A;  4FP7 A;  1WDY A;  3PRZ A;  3VTY A;  3SO8 A;  1N4Q A;  1FT1 A;  4HB5 A;  3CGH A;  2FUL A;  3B95 A;  1IYG A;  2JEK A;  3VLF A;  5AIJ A;  1S64 A;  3HHM A;  3S7D A;  4H7X A;  3RRN B;  3ZKJ A;  1H2V C;  3FTU A;  2KBX A;  4BSX A;  4HOS A;  2CHW A;  4B8C B;  3PZD A;  1UN9 A;  4RVB A;  4YDW A;  4FC8 A;  1IHG A;  3NZU A;  5FTP A;  2QYU A;  1HFA A;  1ELR A;  1NP7 A;  1XNF A;  4AJW A;  1OY3 D;  3SY2 A;  4WWN A;  1KLX A;  5CED B;  4GA2 A;  3CV0 A;  4URK A;  4U0U A;  2DBA A;  3UX4 A;  3QWP A;  1JCR A;  4GYW A;  3SFX A;  4N3C A;  2EIK E;  4RG9 A;  3I4G A;  4L2L A;  1O1S A;  5CRU A;  4G25 A;  2X6F A;  3S7B A;  1TN8 A;  1EPU A;  1OUV A;  3LY7 A;  2GRL A;  4L7T A;  1OT8 A;  3D3M A;  3T5X A;  3MV3 B;  1UG3 A;  3UKR G;  3J5Q B;  1N95 A;  5G04 J;  1IQR A;  3KSL A;  3CSF A;  2ZGD A;  2LUH A;  4L2Y A;  3ZW3 A;  5CCL A;  5HQ8 A;  3PS6 A;  4A1G A;  1WAO 1;  3RO2 A;  3TXN A;  3FU6 A;  3PZ3 A;  3HRA A;  2VSX E;  3MJW A;  5BUZ A;  3NAW A;  1S63 A;  4A55 A;  4Q69 A;  5KNH D;  4H7Y A;  1HZ4 A;  2BTD A;  5ARF A;  3NQP A;  4U8H A;  3MKQ B;  3CVY A;  5EX3 A;  4I17 A;  3ASN E;  5ITZ F;  3ZEF A;  2AW6 A;  4UWH A;  2H6I A;  4ACK A;  4OVU A;  4YDE A;  3UPV A;  2NC9 A;  3U66 A;  3GZS A;  5G05 C;  1IKN D;  3TXM A;  3PEV B;  4JA7 A;  4GTV A;  3FH8 A;  2HYZ A;  5EID A;  3AU5 A;  4U0Z A;  5H7P A;  4J7W A;  2VJ8 A;  3DSS A;  4YDY A;  1E8Z A;  2V8S E;  3AG1 E;  3V2X A;  2AVP A;  4U04 A;  1IQU A;  2P9I G;  4N3B A;  1DCE A;  1DCQ A;  5BT1 A;  1TNU A;  1Y8M A;  2VTB A;  4DLQ A;  2OND A;  3G2W A;  4TUU A;  4O6F A;  4RG6 A;  4BWR A;  5KJK A;  4CGV A;  3KAE A;  2KZT A;  4ME2 A;  1HU3 A;  4UWL A;  4UQX A;  2Y4U A;  4UI9 K;  2B0O E;  3I3N A;  3MA5 A;  4WNE A;  3GZ2 A;  2PM6 A;  3KD7 A;  3VLD A;  3I5P A;  3D9I A;  4J8D A;  3Q9N C;  1Z5S C;  2OVF A;  2LAI A;  3E33 A;  3Q15 A;  3ISM C;  3ZXP A;  4U96 D;  1OCC E;  4Z68 A;  4O60 A;  3G2T A;  3CIA A;  4LNG A;  2DWZ A;  2EIN E;  3FTX A;  1O5M A;  4AM9 A;  1D8D A;  2DZN A;  4L23 A;  4CDR A;  1AP7 A;  3E4B A;  4GCN A;  2DYR E;  1X5B A;  5E76 A;  3HVE A;  5IY5 E;  4KVM A;  1P5Q A;  3QOU A;  5C2Y A;  2FEZ A;  5ANL A;  3RJV A;  4ANV A;  2QC9 A;  1HG5 A;  2YHE A;  3DSX A;  5JJT A;  1E96 B;  4RSY A;  3JCK C;  3RSE G;  2GGF A;  4Y6C A;  3Q75 A;  5FZS A;  3NZS A;  3AG2 E;  4KXK B;  3CVX A;  4I9E A;  2XEN A;  5KBA A;  2KCL A;  4GZ6 A;  2YHC A;  4DX6 D;  4CDM A;  4J0U A;  1E8Y A;  1S0P A;  1ZB1 A;  3PNT B;  1DNP A;  4LCT A;  5A23 A;  5CER B;  5CBO A;  2J8S D;  1N94 A;  2UWJ G;  2MYO A;  3OXF A;  3WXX A;  3ABK E;  1G3N B;  2CG3 A;  2V0P A;  3L54 A;  1HS6 A;  4B94 A;  4BES A;  2IOS A;  3G2S A;  5A6C A;  3R7Q A;  3UKU G;  1LD8 A;  4K0R A;  3JXI A;  4I43 A;  1K8K G;  3FUM A;  4NAC A;  3MZL B;  2P9P G;  3RIB A;  2DCP A;  4ILH B;  5B3S E;  2XGM A;  3GYZ A;  4TRQ A;  4DUI A;  4UWF A;  3CST A;  2XRY A;  3UUX A;  3UXG A;  5ARG A;  3CK8 A;  3HXD A;  1FVH A;  4XIF A;  3JUI A;  3Q7F A;  3FFL A;  4GPK A;  1TJF A;  4U8V D;  4UQY A;  3RU0 A;  3TG5 A;  3SI5 A;  5EYL A;  1QNF A;  4HOQ A;  3S2A A;  3B13 A;  5FIO A;  1A5E A;  2GRP B;  3PUK A;  3CVV A;  3R9A B;  1FPP A;  4E6H A;  1SZ9 A;  1PC2 A;  4W9R A;  2J4B A;  4DK5 A;  3DXK G;  1TYQ G;  2C2L A;  1L5J A;  4GZ5 A;  1TN6 A;  2WMN A;  3RKV A;  1RW2 A;  4LNU D;  1JWF A;  1NA0 A;  3LVR E;  4F53 A;  1K1A A;  3T9K A;  2DVW A;  4A63 B;  3PZ4 A;  3LXU X;  4LSZ E;  3CVP A;  5JJ7 A;  3N71 A;  3JUE A;  2WXR A;  5FZR A;  4HI8 A;  4LNB A;  3VLE A;  5G55 A;  5CBN A;  4GCO A;  2ETA A;  2OEW A;  5JJ6 A;  1WY6 A;  4HRM B;  2Q7F A;  3DXM G;  2IF4 A;  1JWG A;  3AU4 A;  3SQV A;  4U63 A;  2WXJ A;  2IU1 A;  3T5V A;  1YYH A;  1OWM A;  3LY9 A;  3RO3 A;  5FQ7 A;  3FTW A;  3D9K A;  4AEZ C;  2XQ0 A;  2OCC E;  4UI9 C;  2A4Z A;  2A5E A;  1HG2 A;  1AWC B;  2UY1 A;  2BKK B;  3ZGQ A;  5M72 A;  3B7T A;  2LXM A;  4BER A;  1INZ A;  3APD A;  1H6O A;  5AQ7 A;  3ASG A;  2KM4 A;  2LO6 A;  3ABL E;  4Q96 A;  2WXN A;  1OWP A;  2GRQ B;  3U4T A;  4WNF A;  3C3O A;  1NZN A;  3E30 A;  2IY0 C;  3EU9 A;  1HXI A;  4EBA A;  2RD0 A;  3QC1 A;  3R7R A;  4HFG A;  3FUN A;  4PH4 B;  1SVX A;  3HXE A;  4WND A;  2XS1 A;  4HBD A;  2P2C P;  3ZYL A;  2QY7 A;  5AYW D;  5DBK A;  3AAA C;  2WXP A;  2PM7 A;  4G11 A;  4OAU C;  4DRX E;  1TN7 A;  4F1S A;  5LCW C;  3AG4 E;  3SNX A;  3TWR A;  4TXP A;  2FO1 E;  3LPZ A;  3OXG A;  3TWW A;  1QQE A;  3BG0 B;  3JXJ A;  1BD8 A;  3OTN A;  1N9A A;  3ULY A;  4M7C A;  2ZU6 B;  2HO1 A;  2F0Y A;  3W9G A;  4QQI A;  2FBN A;  4DX7 D;  1BU9 A;  4N2Q A;  2GRN B;  4XI9 A;  1TJC A;  3MX3 A;  4I9C A;  4FU3 A;  2ETC A;  2AXZ A;  1RZ4 A;  2L0I A;  4K5C A;  3I4R B;  3FTZ A;  3ZUV B;  2I1K A;  4MS6 A;  3KEZ A;  4WUY A;  5EX0 A;  1E8W A;  2XGO A;  4U07 A;  2ZIR A;  5HI7 A;  4G24 A;  4GYO A;  4KMO A;  2MHK A;  5KNG A;  3TG4 A;  1UW4 B;  1DC2 A;  2PQN A;  4JD2 G;  4ANU A;  3TWU A;  3O48 A;  1Z3Y A;  3UQ3 A;  3IXE A;  3FUH A;  2VGY A;  3UIN C;  1MX4 A;  3PNL B;  3LY8 A;  4MRU A;  1N4S A;  4BEP A;  2PZI A;  4FUL A;  1E7V A;  1KZO A;  4I6E A;  3FUE A;  2L0T B;  2P58 C;  5G05 J;  1K3Z D;  3FU3 A;  2WM9 A;  4GA0 A;  2WMO A;  5EDS A;  4YDO A;  3TL5 A;  4J8E A; 
#chains in the Genus database with same CATH homology
 2CFU A;  4ILG A;  4NQ0 A;  4K03 A;  4LRZ A;  4YVQ C;  3ENE A;  4BX8 A;  4GB9 A;  2J07 A;  4YVO A;  4F7A A;  5JHA A;  5FQ6 A;  5BV1 A;  3Q5M A;  3UT8 A;  1N52 A;  3G2T A;  4HS2 A;  3CIA A;  1E8X A;  1PAQ A;  3FTX A;  4AIF A;  1GW6 A;  4N39 A;  3RRM B;  4AM9 A;  4BFR A;  3MV2 B;  3QKY A;  5KJM A;  4L23 A;  2L6J A;  3B7S A;  2Y3A A;  3CEQ A;  4CDR A;  4JEU A;  2HM8 A;  4JVS A;  3E4B A;  4GCN A;  2HR2 A;  3DPD A;  4QFV A;  3BG1 B;  2VSN A;  4UI9 J;  1H6K A;  1X5B A;  2PQR A;  3QJZ A;  5E76 A;  3HVE A;  4IYP A;  3DBS A;  1P5Q A;  4KVM A;  4A3V A;  5BV0 A;  2CFZ A;  3QOU A;  5C2Y A;  3FU5 A;  2FEZ A;  5ANL A;  4V3I A;  1OWO A;  4GA1 A;  4XE0 A;  3LKU A;  3RJV A;  4ANV A;  4OYS A;  3D9N A;  4E85 A;  4HLE A;  1HG5 A;  2YHE A;  2VSY A;  5FQ8 A;  3U9W A;  3FY4 A;  1B89 A;  1UJJ A;  4LER A;  2AXU A;  3SBT B;  4A1S A;  4JW1 A;  3U3W A;  3ONK A;  3CHO A;  5JJT A;  3QWW A;  4Y6W A;  1E96 B;  3CHQ A;  4RSY A;  4CCA A;  4N2S A;  3JCK C;  1HH8 A;  3L16 A;  2IFU A;  3G2V A;  2GGF A;  4Y6C A;  5FZS A;  5KJL A;  4L1B A;  4N3A A;  2PL2 A;  2WXQ A;  3NZS A;  3PEU B;  3FH7 A;  4WWO A;  2C0L A;  3MEK A;  3ML9 A;  4BTA A;  3FU0 A;  2CG2 A;  4DI3 A;  3QNK A;  4KXK B;  2KAT A;  3L22 A;  3CVX A;  4I9E A;  4G1T A;  4B89 A;  3QK0 A;  3AS5 A;  4AY6 A;  4MLP A;  4HXI A;  4IRU A;  1UN8 A;  3D9O A;  4XZ4 A;  5ANR A;  2KCL A;  4KZC A;  5KCM A;  3MKQ A;  3ZYM A;  1DVP A;  3D9P A;  4GZ6 A;  2YHC A;  3K9I A;  3G2U A;  5G04 C;  1ELW A;  3JQ0 A;  3FUI A;  5J90 A;  4PDX A;  4CDM A;  4J0U A;  5D0Q D;  1E8Y A;  1EYH A;  1S0P A;  4R7L A;  2X6H A;  3P2B A;  3CK9 A;  3APF A;  3PNT B;  2UY1 B;  1DNP A;  4LCT A;  4CGW A;  4WAF A;  1EF1 C;  5A23 A;  3APC A;  4JHR A;  3L17 A;  3SBS A;  3Q49 B;  2XPZ A;  4M3O A;  2UWJ G;  2A5U A;  3OXF A;  3LYA A;  3WXX A;  4F3V A;  2I2O A;  2CG3 A;  2V0P A;  4PUC A;  1XGW A;  3EDT B;  3L54 A;  3ZVV A;  2WPV A;  3QAQ A;  3TAX A;  3ZIM A;  1HS6 A;  4B94 A;  2XRZ A;  2IOS A;  5T3R A;  3IEG A;  3CKB A;  2ILR A;  3G2S A;  5T8I A;  4FJZ A;  2IJG X;  5A6C A;  3R7Q A;  4G26 A;  3L13 A;  2KCK A;  3SZ7 A;  2X6J A;  4JHJ A;  4EZK A;  3PH0 C;  4GMJ A;  4K0R A;  4JZY A;  4AY5 A;  4I6G A;  4NRH B;  1TEZ A;  3FHE A;  4G2V A;  4I43 A;  2V5F A;  3FUM A;  3ZHE B;  4NAC A;  5J08 A;  3MZL B;  4FLB A;  4I1O B;  4CT0 A;  4N5C A;  3RIB A;  2DCP A;  2WXM A;  4GZ3 A;  4ILH B;  3FDH A;  2Y4T A;  4BX9 A;  3CKC A;  1OWN A;  2XGM A;  4GYY A;  3QDN A;  1HF8 A;  3GYZ A;  2GRM A;  2NXP A;  3RRU A;  3LVQ E;  3MKR A;  4TRQ A;  4BT8 A;  4UWF A;  3JQ1 A;  4ACL A;  3CST A;  3CVW A;  1KT1 A;  2XRY A;  3HDX A;  5D0O D;  2J09 A;  3UUX A;  3MGB A;  1MQS A;  3ONL A;  5ARG A;  1UJK A;  3CK8 A;  2R5S A;  3LCA A;  4XI0 A;  1HX8 A;  3CR3 A;  4BTB A;  1FVH A;  5E75 A;  4XIF A;  3JUI A;  1H2U A;  1YA0 A;  3FFL A;  1TJF A;  2BUG A;  4UQY A;  4GPK A;  4FLH A;  3RU0 A;  3PDN A;  4C0M A;  3TG5 A;  5LX8 A;  1HE8 A;  4JL0 A;  4XKC A;  3SI5 A;  4EZJ A;  4AXH A;  1QNF A;  4HOQ A;  3S2A A;  4AP2 A;  4WNG A;  5BPP A;  3L6A A;  3B13 A;  5JHB A;  1WM5 A;  4I1A A;  5LP0 A;  3L08 A;  4U0S A;  3IKO B;  4GML A;  3PUK A;  4FHK A;  3EJN A;  3ZFW A;  4EPZ A;  3BEE A;  3UT7 A;  3CVV A;  3R9A B;  2QFC A;  4G23 A;  1BPO A;  4E6H A;  3CHM A;  3SFZ A;  1SZ9 A;  2M63 A;  4GU5 A;  3P1U A;  2C0M A;  4APF A;  4DPR A;  1PC2 A;  3CVQ A;  1SQM A;  2I6H A;  3FH5 A;  2WXF A;  4JEH A;  4W9R A;  4JHK A;  3GW4 A;  3T8M A;  5EKQ D;  3CK7 A;  3HIZ A;  4HOU A;  2J4B A;  4DK5 A;  4C0E A;  2C2L A;  1L5J A;  4GZ5 A;  3PE3 A;  2WMN A;  4MKT A;  4PS8 A;  3QB2 A;  2I9C A;  3RKV A;  2MRI A;  5AJD A;  2ION A;  4FP7 A;  1JWF A;  1NA0 A;  3LVR E;  3PRZ A;  4OVV A;  5DIZ A;  3VTY A;  5AJL A;  4IUL A;  4A3T A;  4F53 A;  4AV7 A;  3CGH A;  2FUL A;  4JC8 A;  1IYG A;  2JEK A;  3LXU X;  3VLF A;  3ZRH A;  3CVP A;  2WB2 A;  2VGX A;  3QWV A;  5AIJ A;  2R59 A;  5JJ7 A;  5AEN A;  2VTB B;  1N54 A;  4HVB A;  3N71 A;  3HHM A;  3S7D A;  2WXR A;  5FZR A;  4H7X A;  2YQ8 A;  4PS7 A;  3IV0 A;  3RRN B;  3SF4 A;  1H2V C;  1EDU A;  3FTU A;  5G55 A;  3VLE A;  2AXV A;  4KYO B;  4CT4 A;  4GCO A;  2GW1 A;  1FVF A;  4BSX A;  4HOS A;  4PS3 A;  2CHW A;  3PVL A;  4B8C B;  3PZD A;  5LOZ A;  1UN9 A;  2AWI A;  4RVB A;  4CRW A;  3LDZ A;  4FC8 A;  2XEV A;  3C98 A;  5JJ6 A;  3U64 A;  1WY6 A;  3AS4 A;  3CHR A;  3Q47 B;  1IHG A;  2BF0 X;  3NZU A;  5FTP A;  2KZT B;  4ILI A;  2Q7F A;  3MCX A;  1HFA A;  1ELR A;  2IF4 A;  1JWG A;  2XGS A;  3CHS A;  1NP7 A;  3AU4 A;  3TJP A;  1XNF A;  1HO8 A;  3EIQ C;  4AJW A;  4UQZ A;  4U63 A;  2CHX A;  3PE4 A;  3ZN3 A;  3QAR A;  3ESK A;  2WXJ A;  4ANW A;  4AOF A;  2IU1 A;  3T5V A;  2WXK A;  4WWN A;  1OWM A;  1KLX A;  2IQC A;  3IHV A;  3LY9 A;  3RO3 A;  2J9Q A;  2E0I A;  1H19 A;  3PUJ A;  5FQ7 A;  2OVB A;  3ZYQ A;  4GA2 A;  3CV0 A;  4URK A;  4U0U A;  2DBA A;  3UX4 A;  3FTW A;  3CQC B;  3QWP A;  3D9K A;  4GZD A;  2WQH A;  2WXL A;  4P29 A;  1ZU2 A;  4GYW A;  4AEZ C;  3CVU A;  5FQ4 A;  3HYM B;  1ELK A;  2XCB A;  2XQ0 A;  4N3C A;  4WWP A;  4UI9 C;  2VYI A;  4RG9 A;  3I4G A;  4L2L A;  2A4Z A;  1HG2 A;  4G25 A;  1JUQ A;  2X6F A;  3S7B A;  4B0Z A;  3SD5 A;  2XPI A;  2UY1 A;  5CCM A;  3FP3 A;  3ZGQ A;  3B7T A;  3FWV A;  4GZC A;  5M72 A;  1EPU A;  1OUV A;  3URZ A;  3LY7 A;  2GRL A;  4L7T A;  3FTV A;  1INZ A;  3APD A;  4LEU A;  3KS2 A;  3SGH A;  3ZYK A;  2CHZ A;  3D3M A;  3T5X A;  3ASG A;  2J4D A;  2KM4 A;  4B8A A;  2LO6 A;  3EHM A;  4IN3 B;  3S7J A;  3MV3 B;  1UG3 A;  4Q96 A;  4JA9 A;  2X3M A;  2J08 A;  2WXN A;  1OWP A;  3FUF A;  4DJA A;  3ASF A;  5G04 J;  3HVE B;  4LUN U;  3U4T A;  3ZPJ A;  4WNF A;  1IQR A;  1NZN A;  3FUJ A;  3LJ3 A;  3CSF A;  4JPS A;  1ZBP A;  3D9M A;  4L2Y A;  3ZW3 A;  1HXI A;  4KZ0 A;  5CCL A;  4EBA A;  4DLO A;  5HQ8 A;  3TGO A;  4CEM A;  3PS6 A;  4A1G A;  1WAO 1;  3RO2 A;  5CHE E;  4ABN A;  1NA3 A;  2RD0 A;  3QC1 A;  3TXN A;  3FU6 A;  1A17 A;  2NSZ A;  3R7R A;  4HFG A;  2VSX E;  5G2N A;  4KVO A;  4EQF A;  3FUN A;  4J8S A;  5CMW A;  4PH4 B;  2WQ7 A;  4BY6 A;  3MJW A;  3ZHE A;  2I1J A;  3D9L A;  2WVI A;  2FF4 A;  4WND A;  5BUZ A;  3OXL A;  2OV8 A;  4I1M A;  2XPY A;  4HOR A;  4A55 A;  1U3C A;  4I2Z A;  4Q69 A;  3ZYL A;  2LNI A;  2IOL A;  1E7U A;  2QY7 A;  2VQ2 A;  3OAW A;  5DBK A;  5FZQ A;  5AYW D;  3FUD A;  3FEX A;  4EZL A;  2LSU A;  3EIJ A;  4H7Y A;  3S7F A;  2WQ6 A;  3AS8 A;  1HZ4 A;  2WXH A;  3O4Z A;  2BTD A;  5ARF A;  2WXP A;  2PM7 A;  3MYV A;  3CVN A;  4ATG A;  2VGX B;  4G11 A;  4UWK A;  3B7U X;  2WXO A;  3NQP A;  4U8H A;  4NUR A;  3MKQ B;  4F1S A;  5LCW C;  3SNX A;  4EBA G;  3IBE A;  4J6I A;  2E2E A;  3LPZ A;  3FUL A;  3OXG A;  5C1D A;  3CVY A;  2WXG A;  2XHE A;  5EX3 A;  4C9B B;  3FUK A;  2MOW A;  3LEW A;  4I17 A;  3CHP A;  3ASD A;  4EEC A;  3EHN A;  4FHJ A;  4DI4 A;  1QQE A;  3B7R L;  3BG0 B;  3ZEF A;  2LAH A;  2AW6 A;  3OTN A;  4HOT A;  4UWH A;  4BT9 A;  4ACK A;  4OVU A;  2ZU6 B;  2HO1 A;  5A7D B;  3UPV A;  2NC9 A;  3LS8 A;  2FBN A;  3U66 A;  4N2Q A;  3FTS A;  3GZS A;  1SZA A;  3IHY A;  2JLB A;  5G05 C;  4JXT A;  2R17 C;  3GZ1 A;  4XI9 A;  1OWL A;  3TXM A;  3PEV B;  4JA7 A;  1TJC A;  4APO A;  4UWG A;  3FH8 A;  2WXI A;  3MX3 A;  2HYZ A;  2XCC A;  4I9C A;  5FJY A;  3AU5 A;  4FU3 A;  4U0Z A;  5BW8 C;  2AXZ A;  3RK6 A;  2YNQ A;  2L0I A;  4XX5 A;  3CVL A;  1MHQ A;  4XKB A;  3I4R B;  3FTZ A;  2VJ8 A;  5FWQ A;  2I1K A;  2YIN A;  3KEZ A;  4MS6 A;  1E8Z A;  3UT4 A;  2V8S E;  1H0A A;  4WUY A;  3CQG B;  4TV3 A;  1KT0 A;  2X6I A;  5EX0 A;  5KJN A;  2AVP A;  1E8W A;  3FTY A;  1VDY A;  4U04 A;  1IQU A;  2XGO A;  4U07 A;  4N3B A;  5FT9 A;  1H2T C;  4G24 A;  5HI7 A;  4GYO A;  5BNW A;  3CLJ A;  4KMO A;  4AVX A;  4FAD A;  2OOE A;  2MHK A;  3TG4 A;  5BT1 A;  1Y8M A;  2VTB A;  1JPL A;  1UW4 B;  4I6J A;  4I2W A;  4ANX A;  4DLQ A;  2PQN A;  2OND A;  5LCW J;  4CDN A;  4ANU A;  4FA6 A;  3O48 A;  3PRE A;  1Z3Y A;  3G2W A;  4FJY A;  3UQ3 A;  3FEY A;  3NF1 A;  2LSV A;  3FUH A;  4O6F A;  4TUU A;  5T4Y A;  1Z6T A;  4J8F A;  3ESL A;  2VGY A;  3ULQ A;  4Q94 A;  3VTX A;  1LF8 A;  4RG6 A;  3UMV A;  4BWR A;  5KJK A;  2J49 A;  2KC7 A;  4CGV A;  3ASH A;  3KAE A;  3PNL B;  4D10 C;  3LY8 A;  3SHF A;  4MRU A;  2KZT A;  4ME2 A;  1HU3 A;  4UWL A;  2DIW A;  4UQX A;  1PY1 A;  4YND A;  2FO7 A;  2PZI A;  2Y4U A;  4KT6 B;  4FUL A;  1E7V A;  3Q4A B;  4I6E A;  2VSO E;  4UI9 K;  1E90 A;  2EQX A;  2L9B A;  2RG8 A;  3FUE A;  3I3N A;  2L0T B;  1QZ2 A;  3JYS A;  3D9J A;  1W3B A;  2P58 C;  3MA5 A;  5G05 J;  1Z3X A;  3ZXS A;  1Y6I A;  3GZ2 A;  4WNE A;  2PM6 A;  3KD7 A;  3FU3 A;  3VLD A;  2WM9 A;  3I5P A;  3D9I A;  4GA0 A;  2X6K A;  4GAA A;  2WMO A;  2X38 A;  5EDS A;  2FI7 A;  5LFA A;  4J8D A;  3TL5 A;  2V4L A;  5ENN A;  2OVF A;  2KCV A;  2LAI A;  4J8E A;  4KBQ A;  5CMY A;  3Q15 A;  1U3D A;  3ML8 A;  1FCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...