3D9JA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
137
structure length
137
Chain Sequence
b'EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 56
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9jA00
1H0AA 1SZAA 1HG2A 3G2TA 3RRUA 2BF0X 1XGWA 2LO6A 1UJJA 3G2WA 5LOZA 1SZ9A 3CLJA 3D9NA 4FU3A 1INZA 3ONLA 4NACA 2DIWA 4JXTA 2QY7A 3G2VA 3G2UA 1JPLA 4GZDA 1DVPA 1ELKA 5CMYA 2V8SE 4HFGA 3ZYQA 3D9OA 4Q94A 3LDZA 1EYHA 4AVXA 1MHQA 3D9IA 5J08A 1LF8A 1VDYA 1HG5A 3ZYLA 1JWGA 1HF8A 5LP0A 2MOWA 1EDUA 3D9PA 2KM4A 2DCPA 1PY1A 2L0TB 3D9JA 4Q96A 3ONKA 4FLBA 1JWFA 3D9LA 3ZYMA 3D9KA 1HFAA 3D9MA 4GZCA 2L0IA 3ZYKA 1JUQA 5CMWA 1X5BA 1UJKA 1HX8A 3G2SA
chains in the Genus database with same CATH superfamily
2XZTG 3IBEA 1WAO1 3AS8A 1SQMA 3UUXA 4YDWA 3I3NA 2WQHA 3E34A 3EU9A 3JQ1A 4LERA 5FWQA 3PZ4A 4WWNA 3PNLB 3JXIA 3JXJA 4N3AA 2I1JA 1AP7A 4DX2A 5JJ7A 3ZYKA 1JUQA 2HR2A 1X5BA 4BY6A 5LX8A 4PS7A 4K5AB 3DSTA 4L2YA 3QWVA 4RVBA 3ZGQA 1UW4B 2P9NG 4FJZA 1O1TA 3CVWA 3T5XA 4N3CA 4FULA 2DZNA 3I5PA 3Q78A 3UPVA 3ZYLA 2QFCA 2EINE 4LSZE 3PVLA 3FY4A 3FUEA 4BEPA 3UKRG 3FTXA 1FPPA 4GMRA 3ZXPA 5FIOA 5AQBA 2Q7FA 2C0LA 1OT8A 4EPZA 4IRUA 4A1GA 3SBTB 2XPIA 4CGWA 4U96D 4D10C 2C0MA 3SF4A 3KS2A 3V31A 1E8YA 3AG2E 3O48A 3FEYA 1TR4A 3T5VA 3UIOC 5AQAA 4AY5A 4YVQC 5JMND 3BG1B 2IONA 3FTYA 3AG1E 1N0RA 2XS8A 3DXMG 3QB2A 3RU0A 2Y1LE 3VLDA 3QWWA 2LNIA 3MJWA 3SHFA 2E0IA 4TRQA 3BQOA 4EQFA 2AVPA 4ANWA 4EBAA 4GU5A 5CBOA 2FI7A 5EILA 3ONKA 4TXQA 4UWFA 3MV3B 3MCXA 5HQ8A 2LXLA 4N5CA 5EDSA 4K0RA 2XCCA 2PZIA 1MX2A 4IYPA 1NFIE 2PL2A 2P9KG 3UMVA 2CHZA 4DI4A 2ZGDA 3CSFA 5ENRD 3QAQA 4PUCA 4EZJA 4APFA 4AM9A 3ML9A 4DX1A 3SO8A 3UINC 4BETA 2AXVA 1N4SA 5A6CA 3PE3A 1OWOA 3RAUA 3ZKJA 3PNTB 1QZ2A 3F6QA 3QK0A 2J09A 3TWUA 1ELRA 3O4ZA 2XEEA 3TWWA 5CMWA 4B8CB 2GRNB 4BESA 4WUYA 4ILHB 4JD2G 3ZYQA 3Q79A 2JEKA 4XE0A 2M63A 1N4PA 1HU3A 3L54A 3D9KA 5T3RA 4XI9A 3UI2A 3CVQA 4JHRA 3G2TA 5CRUA 3ULEG 1KT1A 3Q47B 5B3SE 2J08A 4G8LA 4KVOA 3FULA 3ABLE 1A17A 3SFXA 1MQSA 4YDOA 3HVEB 2JABA 5AQ9A 4XKBA 3JUEA 4DUIA 3B7UX 2FF4A 2WXNA 3K9IA 4Q94A 4ILIA 4TUMA 3MYVA 3PH0C 4GB9A 4ME2A 3MV2B 3W9GA 4LCTA 3WG7E 1HE8A 1NI1A 3KSLA 3C3RA 5FQ8A 3UKUG 3ZVVA 1XGWA 2X6KA 2YHEA 3SY2A 5KWDA 3OXFA 4EECA 3NF1A 2L9BA 3U9WA 3SZ7A 3NB2A 2YHCA 4DLQA 3CHSA 3HYMB 4GCNA 1S0PA 1NP7A 3L22A 4K5BA 4NURA 5C1DA 3SNXA 2IY0C 4AEZC 2B6CA 3CKCA 1OCOE 2GRPB 3CVNA 4XI0A 2WXMA 3L6AA 3PREA 3J5PA 1NA0A 4N2QA 4OAVB 2B0OE 3PZ2A 5FINA 4K5CA 3C3OA 2RFMA 2Y69E 5G55A 4HXIA 2VSOE 5EKQD 1YA0A 3JYSA 5EYLA 4E6HA 2PQRA 1TEZA 2WXIA 1KT0A 2F0YA 5E76A 5HI7A 3E4BA 4CZ2D 4QQIA 4L7TA 4BT8A 2YINA 3APCA 3EHRA 1TYQG 2KBXA 3DBSA 1K1BA 2P9IG 4AXHA 4OVUA 3E30A 3DEPA 4Q96A 3FUIA 1N94A 2BKGA 3VLFA 3E33A 4LRZA 2OV8A 3RO2A 4RG6A 5FZRA 1S70B 4I1MA 1LD7A 3CHQA 3HHMA 3TXNA 1UG3A 4TUUA 5CBNA 3ASFA 2OVBA 3DSWA 4IN3B 4MBGA 3PZDA 3B7SA 3FH7A 5ENQD 3LJNA 3KD7A 4I9CA 5BPPA 1LTXA 3FUMA 1KPSB 1Y8MA 1SZAA 2WXFA 3TWVA 1TNOA 2IEJA 2DIWA 3TAXA 3FTSA 3CEQA 4U07A 3ZUVB 4F1SA 3R9AB 1OUVA 3ASHA 3LJ3A 1ZU2A 1H6OA 4GCOA 2DCPA 4RLYA 1IYGA 4F7AA 4I17A 2PQNA 1INZA 4G25A 2HO1A 4E85A 2ETAA 4YDYA 5BXOA 3V30A 4UI9C 2ZIRA 1EDUA 3CV0A 1DNPA 5D66A 5D0QD 5J90A 2IU1A 3OXGA 3RRUA 1N0QA 4ILGA 2F37A 3GW4A 4DLOA 2H6GA 3CVLA 4GTOA 2P58C 3ESKA 4AVXA 4CRWA 3DWLG 3CVPA 3TWQA 2NXPA 5D0OD 3Q73A 5JA4D 2VSXE 3NOGD 4BWRA 3UIPC 1SZ9A 1RZ4A 2EIKE 4UWGA 1EYHA 4AJWA 2OOEA 2X6HA 4J7WA 1TN6A 4I6GA 2KM4A 1HFAA 1HXIA 2EQXA 4AV7A 1JCSA 2AWIA 3PEUB 3DSUA 4HBDA 3E37A 4XX5A 2RG8A 4CT4A 1FVHA 3AG4E 2VJ8A 3Q4AB 3HXFA 2GRRB 3L13A 2A5EA 5FQ7A 3CK9A 3UTMA 1A5EA 4JW1A 4EZKA 1TN7A 3B7TA 1UJJA 4B0ZA 3GZ2A 4PS8A 3ISMC 3UT7A 1ELKA 1U3DA 3IEGA 2FEZA 3BG0B 4GPMA 4N3BA 2VTBB 5AYWD 3LY7A 4KVMA 4BSXA 4CT0A 3TGOA 1NA3A 4OYSA 1BI8B 3U64A 3PZ1A 2P2CP 4NIKA 4BX9A 1DVPA 4A1SA 2CFUA 1NL4A 4HRLA 3GZ1A 1YYHA 2XQ0A 3NQPA 5FZQA 3SFZA 1U2VG 5CCMA 4AP2A 4WNFA 4HQDA 5JHBA 3UT4A 2WXPA 5EX0A 1OWPA 3LPZA 3QWPA 4GAAA 2DWZA 4DK5A 3J5QB 2VSYA 4AIFA 2WMOA 3FEXA 3LCAA 4JA9A 4JEHA 3FTZA 3LS8A 4HLEA 2F8XK 3DSVA 3RO3A 4U7EB 3FUJA 4TXRA 5KCMA 3Q49B 2VTBA 4FC8A 1QYMA 5KJKA 1BPOA 3MA5A 2YNQA 4CGVA 1LF8A 5AENA 3ZHEA 3ASGA 3LXUX 2AXUA 1OWLA 2WXRA 2WMNA 1H0AA 3W9FA 4BSZB 1TN8A 2WXGA 2XGOA 3TJPA 3HRAA 4MS6A 1DCEA 4LNBA 4I1OB 2XENA 2HYZA 4O1PA 4BFRA 2KC7A 2ILRA 3EHNA 4GZCA 2UY1B 1SVXA 2DZOA 3ZXSA 4XZ4A 1JPLA 3ZEFA 1BI7B 4O1OA 3JCKC 3AU5A 2FO7A 1D8DA 1DC2A 1WG0A 2KCKA 1O5MA 2I9CA 4G1TA 3B13A 5KJLA 2LAIA 2QZAA 3S2AA 2KCVA 1PY1A 2XGSA 4EZLA 4H7XA 2EILE 3HDXA 3ESLA 4CYMD 2GRMA 2V4HC 1TNZA 2X6IA 3TL5A 5BT1A 2XRYA 3FP3A 4FHJA 4XIFA 3CHPA 1PAQA 5AQ7A 3SGHA 3ABKE 4UWHA 4YVOA 4U8YD 2P9UG 2A4ZA 4CDRA 2KXPC 4N5QA 5D2MC 3BU8A 2Y4TA 5ENTD 4ZFHA 1AWCB 3B7RL 4ATZD 5LCWC 3RKVA 3HG0D 2RKKA 5G04J 1HZ4A 1JWGA 2IO2C 5A23A 2ETBA 4U04A 4GA2A 1UJKA 4BX8A 2H6FA 4BTAA 3D9NA 4NACA 3AJIA 3D9HA 1RW2A 4KZCA 2X3MA 1H2UA 4C0EA 5EN5D 1P5QA 3QC1A 1HF8A 3DPYA 1ELWA 5G05C 2R05A 4AY6A 4P29A 5CCLA 3FUDA 4I2WA 4J6IA 1JCQA 2WXJA 3UXGA 3C5RA 1H6PA 4HI9A 4JL0A 3ASOE 2WVIA 4UWKA 4XEIG 3D9PA 3EU5A 2FBNA 5H7PA 3HXDA 3IKOB 3D9LA 3R9MA 1HX8A 3FTUA 2WQ7A 4GTQA 3QDNA 4JHJA 4M7CA 2ETCA 3HXBA 5FTPA 5BXUA 3KEAA 4ACKA 4J8FA 4K03A 4UQXA 2LAHA 1E8ZA 4AOFA 3KSQA 3Q7AA 3CQCB 3NZUA 4MRUA 3PRZA 4C48B 3IV0A 3V2XA 5AAOA 1IQUA 3HVEA 2QYJA 4Y6CA 1OY3D 1SW6A 2HM8A 2J07A 5KBAA 4V3IA 5A7DB 3TWRA 3CHOA 1IXVA 4I43A 4A63B 3EIJA 2WXKA 4WNEA 3VLEA 2P9LG 1MYOA 2C2LA 5LP0A 3RSEG 3RRNB 3R7RA 3QOUA 5T4YA 2R02A 3UM0A 3MZLB 4DRXE 4ACLA 1IQRA 4L2LA 5M72A 4F53A 1TNYA 1FT1A 4LG6A 1YMPA 3C72A 2V5FA 3D9MA 4IULA 3ABME 4FJYA 4Q69A 2DVWA 3EDTB 3DPDA 3FHEA 4JPSA 5EX3A 5ENNA 3DXKG 4ZHBA 1VDYA 2MRIA 5ANRA 3CHMA 4KT6B 4B94A 4B89A 3GYZA 3JUIA 4DPRA 3PUJA 2VGXB 3UT8A 3G2SA 4LNGA 5HS0A 2UWJG 4HOTA 2XZDG 4I9EA 3D9OA 3QNKA 1MHQA 2QYUA 4CDNA 3B95A 4I6EA 1O1RA 2XRZA 2IF4A 3CKBA 4LUNU 4HVBA 1B89A 3VTXA 1OXJA 5LOZA 4FA6A 5KNGA 4GMJA 1FT2A 4G24A 2VGYA 1N9AA 3CK8A 4RG9A 2A5UA 5HRYA 2KCLA 4KZ0A 4GTMA 1UOHA 3AAAC 2PM6A 3DEOA 5ANLA 3AS4A 5B1BE 3HXEA 4GTVA 2DYRE 2GROB 3NAWA 1N11A 2LXMA 4C9BB 3ONLA 3KEZA 5AARA 4GTPA 3BEEA 2VGXA 4WAFA 4BTBA 4O60A 5BNWA 1ZB1A 4HOSA 5CERB 3IXEA 2L0IA 4HB5A 3ASDA 4F6RD 1PC2A 2ZXWE 3TWTA 5JJTA 1O1SA 3FUHA 2WXHA 4UI9K 3PZ3A 5LFAA 5JJ6A 4GZ3A 2L6JA 3S7JA 4J8DA 4J8YA 5ENSD 1H2TC 3RRMB 2XPZA 2DBAA 4FU3A 4OVVA 4X8QA 1K1AA 2KATA 3EHMA 5KNHD 2CHWA 1X81A 3HIZA 5T8IA 5C2YA 2I1KA 4L9PA 1E7VA 4PH4B 4GYYA 2VGEA 4UI9J 3LY8A 1S64A 4B8AA 2BEDA 4HOUA 4HOQA 3AG3E 1D8EA 1N4QA 4CEMA 2CFZA 3FTWA 5FQ4A 2GRLA 4LNUD 3P2BA 3L16A 4KXKB 1IKND 3SQVA 5KJMA 4JEUA 2X6FA 3ZU7B 3EIQC 3MKRA 2OEVA 2BTDA 4A3TA 3SFYA 3LVRE 4WWPA 2WPVA 3MEKA 3APDA 3C3QA 2P9PG 3V2OA 5CEAA 3I4GA 1NZNA 5DIZA 2VSNA 4G26A 2LSVA 4G23A 3CSTA 2I6HA 4F3VA 1HO8A 1DCQA 2XS1A 4ANVA 3ZRHA 3G2UA 2NYJA 4NQ0A 4Y6WA 5HKPA 4HNAD 3ZPJA 2MHKA 2ZGGA 3VTYA 4J8EA 4G8KA 2FO1E 2LUHA 4ANXA 2Y0BG 2WB2A 2IQCA 4BT9A 2QY7A 3CGHA 3TG4A 2J49A 1N95A 3CVYA 1BD8A 4YNDA 3RIBA 4L23A 3ULYA 2WXQA 4G2VA 4ABNA 4KBQA 1K8KG 4FADA 4WNGA 3T8KA 4JZYA 2IOLA 2CG3A 3SBSA 2J8SD 1TJCA 3Q9NC 3APFA 2NSZA 4GA1A 2J4DA 3UM3A 5AJLA 3Q75A 2WQ6A 2MYOA 3S7BA 4JB8P 5CHEE 3AU4A 2V4LA 4JVSA 3U66A 1OCRE 2XEHA 3LVQE 2DYSE 1FCHA 1TNUA 4KYOB 5CRVA 5ARFA 1GW6A 4XKCA 3CQGB 1TNBA 3MX3A 4FLBA 5EIDA 4NRHB 3DRAA 4L1BA 3ASNE 3V79K 5G04C 1N4RA 4UQYA 2ONDA 5CMYA 2E2EA 3UM1A 1N52A 4R7LA 4U8HA 4FHKA 1H6KA 5FQ6A 5G2NA 2XHEA 3ZW3A 3FFLA 2BUGA 2RFAA 1XNFA 1WY6A 2V8SE 2WXLA 4U8VD 2UY1A 1N54A 3TG5A 1Q2ZA 3FDHA 2V0PA 3AS5A 1Z3XA 3DSXA 2JLBA 1L5JA 2OVFA 2HE0A 5DBKA 4HRMB 3CVVA 2PM7A 4U0ZA 1EPUA 3LY9A 1V54E 2FULA 3CVUA 5FT9A 2PNNA 2AJAA 1JCRA 3CK7A 3MKQB 3HXCA 2IFUA 1E8XA 4RSYA 5BW8C 2QC9A 2Y3AA 2GW1A 3CHRA 1ZBPA 5IY5E 2AXZA 4PS3A 4O6FA 1OCZE 5J08A 2R2LA 4DI3A 4LEUA 3TXMA 4EBAG 4A55A 1Y6IA 5AN8A 4GYOA 2EIJE 4I2ZA 1E8WA 3E32A 4U63A 3ZFWA 3KAEA 4FLHA 4G11A 3SD5A 3LKUA 2CG2A 3ZYMA 1JWFA 3FH5A 1Z3YA 2IOSA 1G3NB 1HG2A 3CLJA 3DSSA 3R7QA 4GZDA 1EF1C 3QKYA 1W3BA 3ENEA 5LCWJ 3FU6A 3MKQA 2L6BA 2RD0A 4FP7A 4GZ5A 3NOCD 5FJYA 4YDEA 4JA7A 3PUKA 4DX7D 1LD8A 4UWLA 4M3OA 3CR3A 4DX5D 4CCAA 4DJAA 2BKKB 3FUKA 1BLXB 4J0UA 4HORA 4I1AA 1E7UA 3BUAA 2WXOA 1S63A 5G05J 4U0SA 2AW6A 2LO6A 4RQIA 5EIBE 3P1UA 4QFVA 4HS2A 3TWXA 4JXTA 5CECB 3G2VA 3EUVA 5BV0A 4CDMA 1D9SA 3N71A 2XCBA 4BERA 1H19A 4F1PA 2R17C 2R5SA 3L08A 2NC9A 2Y4UA 4N39A 1OWNA 3D3MA 4GTRA 1KZOA 5FZSA 5ENOD 4J8SA 4PDXA 4URKA 4HFGA 3UX4A 3PE4A 2J9QA 1SA4A 4GTSA 5EYPF 2MOWA 3FU5A 4H7YA 3OTNA 5AIJA 4GYWA 4U95D 3FU3A 4WNDA 2LSUA 5ARGA 3T8MA 5BUZA 5AJDA 4C0MA 4JC8A 3RK6A 3X2QE 2H6IA 3D9IA 3L9TA 1E90A 3UQ3A 1H2VC 3EHQA 3QARA 3ZN3A 2ZISA 3URZA 4Z68A 1FVFA 3FTVA 2GGFA 3L17A 3ML8A 4UUCA 3PS6A 3OXLA 3OAWA 4KMOA 2X6JA 3WXXA 4UQZA 1QQEA 2ZU6B 4OAUC 3FUFA 2H6HA 1UN8A 3IHVA 1OCCE 3GZSA 2L0TB 1IHBA 2X38A 3G2WA 5ENPD 4JHKA 3Q7FA 4A3VA 2J4BA 2VQ2A 1MX6A 5CEDB 3ZNGA 4EHMA 3MGBA 3Q9UC 2IJGX 4WWOA 4TXPA 3CVXA 3U4TA 3L82A 4HRNA 4U0UA 5BV1A 2F8YA 2GRQB 1TJFA 2OCCE 3SI5A 4MKTA 4N2SA 4GA0A 4MLPA 3UM2A 1UN9A 3Q15A 3LEWA 3PEVB 1OWMA 3S7FA 1WDYA 4I6JA 4GMLA 5JHAA 1K3ZD 3T9KA 2BF0X 2KZTB 3Q5MA 1QNFA 3TWSA 4GTTA 2I2OA 3LYAA 3U3WA 1MZCA 3NBNB 4ANUA 3ZIMA 4DX6D 4ATGA 4APOA 3C98A 3FWVA 3JQ0A 3CIAA 2R03A 1MX4A 1KZPA 3NZSA 4B93B 1KLXA 3FH8A 2XPYA 5ITZF 2V5QC 3ULQA 1Z5SC 3B7BA 2R59A 4GPKA 3RJVA 2YQ8A 3IHYA 3QJZA 1V55E 3FU0A 1HG5A 1U3CA 1SA5A 2KZTA 4HI8A 3D9JA 4TV3A 1WM5A 2CHXA 1E96B 2XGMA 1MJ0A 3I4RB 3S7DA 3FUNA 2OEWA 5B1AE 1BU9A 3PDNA 4HLLA 5E75A 1QBQA 2VYIA 3LDZA 2P9SG 2IO3C 4W9RA 1IHGA 3EJNA 1HH8A 4GZ6A 5KJNA 1HS6A 2XEVA 1YCSB 2EIME 3ZHEB 1Z6TA 2WM9A
chains in the Genus database with same CATH topology
1E8ZA 4F7AA 4I17A 4AOFA 2BUGA 2PQNA 1INZA 4G25A 3CQCB 3IBEA 1WAO1 3NZUA 2HO1A 4MRUA 4E85A 1XNFA 3AS8A 1SQMA 3PRZA 1WY6A 2V8SE 3UUXA 2WXLA 3I3NA 3IV0A 2WQHA 3JQ1A 1IQUA 4LERA 5FWQA 4WWNA 3HVEA 4UI9C 3PNLB 2UY1A 1N54A 3TG5A 1EDUA 4N3AA 3CV0A 2I1JA 3FDHA 1DNPA 2V0PA 3AS5A 1Z3XA 4Y6CA 5JJ7A 5D0QD 3ZYKA 1JUQA 5J90A 2HR2A 2JLBA 2IU1A 1X5BA 1L5JA 3OXGA 2OVFA 3RRUA 5DBKA 4BY6A 5LX8A 4PS7A 4ILGA 4L2YA 2HM8A 2J07A 3CVVA 3QWVA 4V3IA 5A7DB 2PM7A 3GW4A 4DLOA 3CHOA 4RVBA 3ZGQA 4U0ZA 1UW4B 1EPUA 3CVLA 3LY9A 4FJZA 4I43A 2P58C 3CVWA 3ESKA 4N3CA 3T5XA 4FULA 4AVXA 2FULA 3EIJA 3CVUA 3I5PA 3UPVA 4CRWA 2WXKA 5FT9A 4WNEA 3VLEA 3CVPA 3ZYLA 2C2LA 5LP0A 2QFCA 2NXPA 5D0OD 3PVLA 3CK7A 3FY4A 3FUEA 3RRNB 3R7RA 3QOUA 5T4YA 3MKQB 2VSXE 3FTXA 4BWRA 2IFUA 1E8XA 4RSYA 3MZLB 1SZ9A 5BW8C 4ACLA 1IQRA 4L2LA 2Q7FA 2Y3AA 5M72A 2C0LA 2GW1A 3CHRA 1ZBPA 4EPZA 4IRUA 4A1GA 4F53A 4UWGA 3SBTB 2AXZA 4PS3A 1EYHA 2XPIA 4AJWA 4CGWA 4O6FA 5J08A 2OOEA 4DI3A 2X6HA 4D10C 4LEUA 3TXMA 4I6GA 2C0MA 2KM4A 3SF4A 3KS2A 4EBAG 2V5FA 4A55A 1HFAA 1E8YA 3D9MA 4IULA 1HXIA 1Y6IA 2EQXA 4GYOA 4FJYA 4AV7A 4Q69A 3O48A 2AWIA 3FEYA 3PEUB 4I2ZA 3EDTB 1E8WA 3DPDA 3FHEA 3T5VA 4JPSA 4XX5A 5EX3A 5ENNA 4AY5A 2RG8A 4U63A 4YVQC 3ZFWA 3KAEA 4CT4A 4FLHA 3BG1B 4G11A 1FVHA 1VDYA 2IONA 2MRIA 3LKUA 5ANRA 3SD5A 2VJ8A 3CHMA 3FTYA 3Q4AB 4KT6B 4B94A 3L13A 5FQ7A 4B89A 3CK9A 3GYZA 2CG2A 4JW1A 4EZKA 3JUIA 1JWFA 3QB2A 3ZYMA 3RU0A 4DPRA 3FH5A 3PUJA 3VLDA 3B7TA 2VGXB 1Z3YA 2IOSA 3UT8A 3G2SA 3QWWA 1HG2A 2LNIA 1UJJA 3MJWA 3SHFA 3CLJA 4B0ZA 2E0IA 3GZ2A 4TRQA 2UWJG 4PS8A 4HOTA 3R7QA 3UT7A 4GZDA 1EF1C 4I9EA 3QKYA 1ELKA 1W3BA 4EQFA 1U3DA 3D9OA 3ENEA 3QNKA 3IEGA 1MHQA 2AVPA 2FEZA 3FU6A 4GU5A 4ANWA 4CDNA 4EBAA 3MKQA 5LCWJ 2FI7A 3BG0B 4I6EA 4N3BA 2RD0A 2VTBB 4FP7A 5AYWD 3LY7A 4KVMA 4BSXA 4CT0A 4GZ5A 3TGOA 2XRZA 3ONKA 5FJYA 4UWFA 3MV3B 1NA3A 2IF4A 3CKBA 3MCXA 4JA7A 4LUNU 1B89A 3PUKA 4OYSA 4HVBA 5HQ8A 4N5CA 3VTXA 5EDSA 5LOZA 4FA6A 4UWLA 3U64A 4K0RA 4M3OA 3CR3A 2XCCA 4GMJA 4CCAA 4DJAA 2PZIA 4G24A 4BX9A 1DVPA 2VGYA 3FUKA 4A1SA 3CK8A 4J0UA 4IYPA 4RG9A 4HORA 2PL2A 2A5UA 2KCLA 4KZ0A 2CFUA 4I1AA 3UMVA 2CHZA 3GZ1A 1E7UA 2PM6A 2XQ0A 3NQPA 4DI4A 5ANLA 5FZQA 3AS4A 3SFZA 3CSFA 5CCMA 3QAQA 4PUCA 4WNFA 4AP2A 2WXOA 4EZJA 5G05J 5JHBA 4U0SA 3UT4A 4APFA 2AW6A 2LO6A 4AM9A 3P1UA 3ML9A 4C9BB 2WXPA 4QFVA 4HS2A 5EX0A 1OWPA 3ONLA 3KEZA 4JXTA 3LPZA 3QWPA 2AXVA 3G2VA 4GAAA 5BV0A 5A6CA 3BEEA 4CDMA 3PE3A 1OWOA 3N71A 4DK5A 2XCBA 2VGXA 4WAFA 1H19A 2VSYA 2R17C 4BTBA 2R5SA 2WMOA 1QZ2A 3L08A 3FEXA 3LCAA 3PNTB 4JA9A 2NC9A 4AIFA 5KJNA 3QK0A 4JEHA 2J09A 3FTZA 3LS8A 2Y4UA 4N39A 5BNWA 4HOSA 1OWNA 1ELRA 4HLEA 3D3MA 3O4ZA 2L0IA 5CMWA 3ASDA 4B8CB 3RO3A 5FZSA 1PC2A 3FUJA 5KCMA 5JJTA 3Q49B 4WUYA 2VTBA 3FUHA 2WXHA 4J8SA 4FC8A 4ILHB 4UI9K 5KJKA 4PDXA 1BPOA 3MA5A 4HFGA 3UX4A 3ZYQA 4URKA 2YNQA 5LFAA 4CGVA 5JJ6A 2JEKA 3PE4A 4XE0A 1LF8A 2M63A 3ZHEA 5AENA 3ASGA 2J9QA 3LXUX 1HU3A 2AXUA 4GZ3A 2L6JA 3S7JA 3L54A 1OWLA 2MOWA 3FU5A 4H7YA 2WXRA 4J8DA 3OTNA 3D9KA 5T3RA 5AIJA 4XI9A 4GYWA 3CVQA 4JHRA 2WMNA 3FU3A 4WNDA 1H0AA 2LSUA 1H2TC 3G2TA 3RRMB 2XPZA 2DBAA 4FU3A 4OVVA 5ARGA 1KT1A 3T8MA 2WXGA 5AJDA 2XGOA 2KATA 3EHMA 3Q47B 4JC8A 3RK6A 4C0MA 5BUZA 2J08A 3TJPA 2CHWA 4MS6A 4KVOA 3D9IA 3FULA 3HIZA 5C2YA 5T8IA 4I1OB 1E90A 3UQ3A 2I1KA 2HYZA 1E7VA 4PH4B 1A17A 4BFRA 1H2VC 1MQSA 2KC7A 4GYYA 2ILRA 4UI9J 3EHNA 3LY8A 4GZCA 3QARA 4B8AA 3HVEB 4HOUA 2UY1B 3ZN3A 4HOQA 4XKBA 3URZA 2CFZA 4CEMA 3ZXSA 1FVFA 3FTVA 3FTWA 2GGFA 3B7UX 3L17A 3ML8A 2FF4A 4XZ4A 3PS6A 2WXNA 3OXLA 5FQ4A 1JPLA 3OAWA 3K9IA 3ZEFA 4KMOA 2X6JA 4Q94A 3WXXA 2GRLA 4UQZA 1QQEA 2ZU6B 4ILIA 3MYVA 3P2BA 3L16A 3PH0C 4GB9A 4KXKB 4ME2A 3JCKC 3FUFA 3AU5A 1UN8A 3IHVA 4JEUA 5KJMA 2X6FA 3MV2B 3GZSA 4LCTA 2L0TB 2FO7A 1HE8A 2X38A 3EIQC 5FQ8A 3ZVVA 3MKRA 3G2WA 1XGWA 2KCKA 2BTDA 4JHKA 4A3TA 2X6KA 2YHEA 3LVRE 3OXFA 2I9CA 4WWPA 4G1TA 4A3VA 4EECA 2J4BA 2WPVA 2L9BA 3MEKA 3NF1A 2VQ2A 3U9WA 3APDA 3SZ7A 3B13A 5KJLA 2YHCA 3I4GA 1NZNA 2LAIA 5DIZA 4DLQA 2VSNA 3S2AA 3CHSA 4G26A 2KCVA 3HYMB 3MGBA 4GCNA 1PY1A 2LSVA 1S0PA 2XGSA 4EZLA 4H7XA 2IJGX 4WWOA 3HDXA 3CVXA 1NP7A 3U4TA 4G23A 3CSTA 2I6HA 3L22A 4F3VA 1HO8A 3ESLA 4U0UA 2GRMA 4NURA 5BV1A 2X6IA 4ANVA 3TL5A 3ZRHA 2XRYA 3SNXA 3FP3A 5BT1A 5C1DA 3G2UA 4FHJA 4XIFA 1TJFA 4AEZC 3CHPA 4NQ0A 1PAQA 3SI5A 3SGHA 4MKTA 4N2SA 4Y6WA 3CKCA 3ZPJA 4GA0A 4MLPA 2MHKA 4UWHA 4YVOA 3CVNA 4XI0A 1UN9A 3Q15A 2WXMA 3VTYA 2A4ZA 3L6AA 3PREA 4J8EA 4CDRA 1NA0A 3LEWA 4N2QA 3PEVB 1OWMA 3S7FA 4I6JA 4GMLA 4ANXA 2Y4TA 5JHAA 2WB2A 2BF0X 2IQCA 3B7RL 2KZTB 3Q5MA 5G55A 1QNFA 4BT9A 5LCWC 4HXIA 2QY7A 2VSOE 3RKVA 3CGHA 3TG4A 2J49A 5G04J 1HZ4A 3CVYA 5EKQD 4YNDA 1YA0A 2I2OA 3JYSA 3LYAA 4E6HA 3U3WA 3RIBA 1JWGA 2PQRA 4L23A 2WXQA 5A23A 1TEZA 2WXIA 4ANUA 3ZIMA 4G2VA 4U04A 4GA2A 1KT0A 4ABNA 4KBQA 5E76A 4FADA 5HI7A 1UJKA 4WNGA 3E4BA 4ATGA 4APOA 4BX8A 4BTAA 4JZYA 3D9NA 3C98A 4L7TA 3FWVA 3JQ0A 2IOLA 4NACA 4BT8A 2YINA 2CG3A 3CIAA 3SBSA 3APCA 4KZCA 2X3MA 1H2UA 3NZSA 1TJCA 4C0EA 1KLXA 3DBSA 3APFA 2NSZA 1P5QA 4AXHA 3QC1A 1HF8A 2J4DA 2XPYA 3FH8A 4GA1A 4OVUA 5AJLA 1ELWA 4Q96A 3FUIA 5G05C 4AY6A 4P29A 3VLFA 5CCLA 2WQ6A 3S7BA 3ULQA 4LRZA 3FUDA 4I2WA 4J6IA 5CHEE 3AU4A 2OV8A 2V4LA 2R59A 4JVSA 3U66A 2WXJA 3RO2A 4RG6A 5FZRA 3LVQE 4I1MA 3CHQA 4GPKA 1FCHA 3HHMA 4KYOB 3TXNA 3RJVA 1UG3A 2YQ8A 3IHYA 3QJZA 4TUUA 5ARFA 3ASFA 4JL0A 2OVBA 3FU0A 2WVIA 1HG5A 1GW6A 4UWKA 4IN3B 4XKCA 1U3CA 3CQGB 3PZDA 2KZTA 3D9PA 3B7SA 3D9JA 3MX3A 2FBNA 4FLBA 3FH7A 4TV3A 1WM5A 4NRHB 3KD7A 2CHXA 1E96B 2XGMA 4I9CA 5BPPA 3I4RB 3IKOB 3D9LA 3FUMA 1HX8A 3FUNA 1Y8MA 1SZAA 2WXFA 3FTUA 4L1BA 3S7DA 2WQ7A 3PDNA 3QDNA 5G04C 4JHJA 2DIWA 4UQYA 5E75A 2ONDA 3TAXA 3FTSA 5CMYA 3CEQA 2E2EA 4U07A 2VYIA 3LDZA 5FTPA 4F1SA 4W9RA 3R9AB 1IHGA 1OUVA 3EJNA 3ASHA 3LJ3A 1N52A 4R7LA 4ACKA 1ZU2A 4J8FA 4K03A 1HH8A 4U8HA 4FHKA 4GCOA 1H6KA 2DCPA 1HS6A 4GZ6A 4UQXA 5FQ6A 5G2NA 2XEVA 2XHEA 3ZW3A 3FFLA 3ZHEB 1IYGA 1Z6TA 2WM9A 2LAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0A A;  1SZA A;  1HG2 A;  3G2T A;  3RRU A;  2BF0 X;  1XGW A;  2LO6 A;  1UJJ A;  3G2W A;  5LOZ A;  1SZ9 A;  3CLJ A;  3D9N A;  4FU3 A;  1INZ A;  3ONL A;  4NAC A;  2DIW A;  4JXT A;  2QY7 A;  3G2V A;  3G2U A;  1JPL A;  4GZD A;  1DVP A;  1ELK A;  5CMY A;  2V8S E;  4HFG A;  3ZYQ A;  3D9O A;  4Q94 A;  3LDZ A;  1EYH A;  4AVX A;  1MHQ A;  3D9I A;  5J08 A;  1LF8 A;  1VDY A;  1HG5 A;  3ZYL A;  1JWG A;  1HF8 A;  5LP0 A;  2MOW A;  1EDU A;  3D9P A;  2KM4 A;  2DCP A;  1PY1 A;  2L0T B;  3D9J A;  4Q96 A;  3ONK A;  4FLB A;  1JWF A;  3D9L A;  3ZYM A;  3D9K A;  1HFA A;  3D9M A;  4GZC A;  2L0I A;  3ZYK A;  1JUQ A;  5CMW A;  1X5B A;  1UJK A;  1HX8 A;  3G2S A; 
#chains in the Genus database with same CATH topology
 2XZT G;  3IBE A;  1WAO 1;  3AS8 A;  1SQM A;  3UUX A;  4YDW A;  3I3N A;  2WQH A;  3E34 A;  3EU9 A;  3JQ1 A;  4LER A;  5FWQ A;  3PZ4 A;  4WWN A;  3PNL B;  3JXI A;  3JXJ A;  4N3A A;  2I1J A;  1AP7 A;  4DX2 A;  5JJ7 A;  3ZYK A;  1JUQ A;  2HR2 A;  1X5B A;  4BY6 A;  5LX8 A;  4PS7 A;  4K5A B;  3DST A;  4L2Y A;  3QWV A;  4RVB A;  3ZGQ A;  1UW4 B;  2P9N G;  4FJZ A;  1O1T A;  3CVW A;  3T5X A;  4N3C A;  4FUL A;  2DZN A;  3I5P A;  3Q78 A;  3UPV A;  3ZYL A;  2QFC A;  2EIN E;  4LSZ E;  3PVL A;  3FY4 A;  3FUE A;  4BEP A;  3UKR G;  3FTX A;  1FPP A;  4GMR A;  3ZXP A;  5FIO A;  5AQB A;  2Q7F A;  2C0L A;  1OT8 A;  4EPZ A;  4IRU A;  4A1G A;  3SBT B;  2XPI A;  4CGW A;  4U96 D;  4D10 C;  2C0M A;  3SF4 A;  3KS2 A;  3V31 A;  1E8Y A;  3AG2 E;  3O48 A;  3FEY A;  1TR4 A;  3T5V A;  3UIO C;  5AQA A;  4AY5 A;  4YVQ C;  5JMN D;  3BG1 B;  2ION A;  3FTY A;  3AG1 E;  1N0R A;  2XS8 A;  3DXM G;  3QB2 A;  3RU0 A;  2Y1L E;  3VLD A;  3QWW A;  2LNI A;  3MJW A;  3SHF A;  2E0I A;  4TRQ A;  3BQO A;  4EQF A;  2AVP A;  4ANW A;  4EBA A;  4GU5 A;  5CBO A;  2FI7 A;  5EIL A;  3ONK A;  4TXQ A;  4UWF A;  3MV3 B;  3MCX A;  5HQ8 A;  2LXL A;  4N5C A;  5EDS A;  4K0R A;  2XCC A;  2PZI A;  1MX2 A;  4IYP A;  1NFI E;  2PL2 A;  2P9K G;  3UMV A;  2CHZ A;  4DI4 A;  2ZGD A;  3CSF A;  5ENR D;  3QAQ A;  4PUC A;  4EZJ A;  4APF A;  4AM9 A;  3ML9 A;  4DX1 A;  3SO8 A;  3UIN C;  4BET A;  2AXV A;  1N4S A;  5A6C A;  3PE3 A;  1OWO A;  3RAU A;  3ZKJ A;  3PNT B;  1QZ2 A;  3F6Q A;  3QK0 A;  2J09 A;  3TWU A;  1ELR A;  3O4Z A;  2XEE A;  3TWW A;  5CMW A;  4B8C B;  2GRN B;  4BES A;  4WUY A;  4ILH B;  4JD2 G;  3ZYQ A;  3Q79 A;  2JEK A;  4XE0 A;  2M63 A;  1N4P A;  1HU3 A;  3L54 A;  3D9K A;  5T3R A;  4XI9 A;  3UI2 A;  3CVQ A;  4JHR A;  3G2T A;  5CRU A;  3ULE G;  1KT1 A;  3Q47 B;  5B3S E;  2J08 A;  4G8L A;  4KVO A;  3FUL A;  3ABL E;  1A17 A;  3SFX A;  1MQS A;  4YDO A;  3HVE B;  2JAB A;  5AQ9 A;  4XKB A;  3JUE A;  4DUI A;  3B7U X;  2FF4 A;  2WXN A;  3K9I A;  4Q94 A;  4ILI A;  4TUM A;  3MYV A;  3PH0 C;  4GB9 A;  4ME2 A;  3MV2 B;  3W9G A;  4LCT A;  3WG7 E;  1HE8 A;  1NI1 A;  3KSL A;  3C3R A;  5FQ8 A;  3UKU G;  3ZVV A;  1XGW A;  2X6K A;  2YHE A;  3SY2 A;  5KWD A;  3OXF A;  4EEC A;  3NF1 A;  2L9B A;  3U9W A;  3SZ7 A;  3NB2 A;  2YHC A;  4DLQ A;  3CHS A;  3HYM B;  4GCN A;  1S0P A;  1NP7 A;  3L22 A;  4K5B A;  4NUR A;  5C1D A;  3SNX A;  2IY0 C;  4AEZ C;  2B6C A;  3CKC A;  1OCO E;  2GRP B;  3CVN A;  4XI0 A;  2WXM A;  3L6A A;  3PRE A;  3J5P A;  1NA0 A;  4N2Q A;  4OAV B;  2B0O E;  3PZ2 A;  5FIN A;  4K5C A;  3C3O A;  2RFM A;  2Y69 E;  5G55 A;  4HXI A;  2VSO E;  5EKQ D;  1YA0 A;  3JYS A;  5EYL A;  4E6H A;  2PQR A;  1TEZ A;  2WXI A;  1KT0 A;  2F0Y A;  5E76 A;  5HI7 A;  3E4B A;  4CZ2 D;  4QQI A;  4L7T A;  4BT8 A;  2YIN A;  3APC A;  3EHR A;  1TYQ G;  2KBX A;  3DBS A;  1K1B A;  2P9I G;  4AXH A;  4OVU A;  3E30 A;  3DEP A;  4Q96 A;  3FUI A;  1N94 A;  2BKG A;  3VLF A;  3E33 A;  4LRZ A;  2OV8 A;  3RO2 A;  4RG6 A;  5FZR A;  1S70 B;  4I1M A;  1LD7 A;  3CHQ A;  3HHM A;  3TXN A;  1UG3 A;  4TUU A;  5CBN A;  3ASF A;  2OVB A;  3DSW A;  4IN3 B;  4MBG A;  3PZD A;  3B7S A;  3FH7 A;  5ENQ D;  3LJN A;  3KD7 A;  4I9C A;  5BPP A;  1LTX A;  3FUM A;  1KPS B;  1Y8M A;  1SZA A;  2WXF A;  3TWV A;  1TNO A;  2IEJ A;  2DIW A;  3TAX A;  3FTS A;  3CEQ A;  4U07 A;  3ZUV B;  4F1S A;  3R9A B;  1OUV A;  3ASH A;  3LJ3 A;  1ZU2 A;  1H6O A;  4GCO A;  2DCP A;  4RLY A;  1IYG A;  4F7A A;  4I17 A;  2PQN A;  1INZ A;  4G25 A;  2HO1 A;  4E85 A;  2ETA A;  4YDY A;  5BXO A;  3V30 A;  4UI9 C;  2ZIR A;  1EDU A;  3CV0 A;  1DNP A;  5D66 A;  5D0Q D;  5J90 A;  2IU1 A;  3OXG A;  3RRU A;  1N0Q A;  4ILG A;  2F37 A;  3GW4 A;  4DLO A;  2H6G A;  3CVL A;  4GTO A;  2P58 C;  3ESK A;  4AVX A;  4CRW A;  3DWL G;  3CVP A;  3TWQ A;  2NXP A;  5D0O D;  3Q73 A;  5JA4 D;  2VSX E;  3NOG D;  4BWR A;  3UIP C;  1SZ9 A;  1RZ4 A;  2EIK E;  4UWG A;  1EYH A;  4AJW A;  2OOE A;  2X6H A;  4J7W A;  1TN6 A;  4I6G A;  2KM4 A;  1HFA A;  1HXI A;  2EQX A;  4AV7 A;  1JCS A;  2AWI A;  3PEU B;  3DSU A;  4HBD A;  3E37 A;  4XX5 A;  2RG8 A;  4CT4 A;  1FVH A;  3AG4 E;  2VJ8 A;  3Q4A B;  3HXF A;  2GRR B;  3L13 A;  2A5E A;  5FQ7 A;  3CK9 A;  3UTM A;  1A5E A;  4JW1 A;  4EZK A;  1TN7 A;  3B7T A;  1UJJ A;  4B0Z A;  3GZ2 A;  4PS8 A;  3ISM C;  3UT7 A;  1ELK A;  1U3D A;  3IEG A;  2FEZ A;  3BG0 B;  4GPM A;  4N3B A;  2VTB B;  5AYW D;  3LY7 A;  4KVM A;  4BSX A;  4CT0 A;  3TGO A;  1NA3 A;  4OYS A;  1BI8 B;  3U64 A;  3PZ1 A;  2P2C P;  4NIK A;  4BX9 A;  1DVP A;  4A1S A;  2CFU A;  1NL4 A;  4HRL A;  3GZ1 A;  1YYH A;  2XQ0 A;  3NQP A;  5FZQ A;  3SFZ A;  1U2V G;  5CCM A;  4AP2 A;  4WNF A;  4HQD A;  5JHB A;  3UT4 A;  2WXP A;  5EX0 A;  1OWP A;  3LPZ A;  3QWP A;  4GAA A;  2DWZ A;  4DK5 A;  3J5Q B;  2VSY A;  4AIF A;  2WMO A;  3FEX A;  3LCA A;  4JA9 A;  4JEH A;  3FTZ A;  3LS8 A;  4HLE A;  2F8X K;  3DSV A;  3RO3 A;  4U7E B;  3FUJ A;  4TXR A;  5KCM A;  3Q49 B;  2VTB A;  4FC8 A;  1QYM A;  5KJK A;  1BPO A;  3MA5 A;  2YNQ A;  4CGV A;  1LF8 A;  5AEN A;  3ZHE A;  3ASG A;  3LXU X;  2AXU A;  1OWL A;  2WXR A;  2WMN A;  1H0A A;  3W9F A;  4BSZ B;  1TN8 A;  2WXG A;  2XGO A;  3TJP A;  3HRA A;  4MS6 A;  1DCE A;  4LNB A;  4I1O B;  2XEN A;  2HYZ A;  4O1P A;  4BFR A;  2KC7 A;  2ILR A;  3EHN A;  4GZC A;  2UY1 B;  1SVX A;  2DZO A;  3ZXS A;  4XZ4 A;  1JPL A;  3ZEF A;  1BI7 B;  4O1O A;  3JCK C;  3AU5 A;  2FO7 A;  1D8D A;  1DC2 A;  1WG0 A;  2KCK A;  1O5M A;  2I9C A;  4G1T A;  3B13 A;  5KJL A;  2LAI A;  2QZA A;  3S2A A;  2KCV A;  1PY1 A;  2XGS A;  4EZL A;  4H7X A;  2EIL E;  3HDX A;  3ESL A;  4CYM D;  2GRM A;  2V4H C;  1TNZ A;  2X6I A;  3TL5 A;  5BT1 A;  2XRY A;  3FP3 A;  4FHJ A;  4XIF A;  3CHP A;  1PAQ A;  5AQ7 A;  3SGH A;  3ABK E;  4UWH A;  4YVO A;  4U8Y D;  2P9U G;  2A4Z A;  4CDR A;  2KXP C;  4N5Q A;  5D2M C;  3BU8 A;  2Y4T A;  5ENT D;  4ZFH A;  1AWC B;  3B7R L;  4ATZ D;  5LCW C;  3RKV A;  3HG0 D;  2RKK A;  5G04 J;  1HZ4 A;  1JWG A;  2IO2 C;  5A23 A;  2ETB A;  4U04 A;  4GA2 A;  1UJK A;  4BX8 A;  2H6F A;  4BTA A;  3D9N A;  4NAC A;  3AJI A;  3D9H A;  1RW2 A;  4KZC A;  2X3M A;  1H2U A;  4C0E A;  5EN5 D;  1P5Q A;  3QC1 A;  1HF8 A;  3DPY A;  1ELW A;  5G05 C;  2R05 A;  4AY6 A;  4P29 A;  5CCL A;  3FUD A;  4I2W A;  4J6I A;  1JCQ A;  2WXJ A;  3UXG A;  3C5R A;  1H6P A;  4HI9 A;  4JL0 A;  3ASO E;  2WVI A;  4UWK A;  4XEI G;  3D9P A;  3EU5 A;  2FBN A;  5H7P A;  3HXD A;  3IKO B;  3D9L A;  3R9M A;  1HX8 A;  3FTU A;  2WQ7 A;  4GTQ A;  3QDN A;  4JHJ A;  4M7C A;  2ETC A;  3HXB A;  5FTP A;  5BXU A;  3KEA A;  4ACK A;  4J8F A;  4K03 A;  4UQX A;  2LAH A;  1E8Z A;  4AOF A;  3KSQ A;  3Q7A A;  3CQC B;  3NZU A;  4MRU A;  3PRZ A;  4C48 B;  3IV0 A;  3V2X A;  5AAO A;  1IQU A;  3HVE A;  2QYJ A;  4Y6C A;  1OY3 D;  1SW6 A;  2HM8 A;  2J07 A;  5KBA A;  4V3I A;  5A7D B;  3TWR A;  3CHO A;  1IXV A;  4I43 A;  4A63 B;  3EIJ A;  2WXK A;  4WNE A;  3VLE A;  2P9L G;  1MYO A;  2C2L A;  5LP0 A;  3RSE G;  3RRN B;  3R7R A;  3QOU A;  5T4Y A;  2R02 A;  3UM0 A;  3MZL B;  4DRX E;  4ACL A;  1IQR A;  4L2L A;  5M72 A;  4F53 A;  1TNY A;  1FT1 A;  4LG6 A;  1YMP A;  3C72 A;  2V5F A;  3D9M A;  4IUL A;  3ABM E;  4FJY A;  4Q69 A;  2DVW A;  3EDT B;  3DPD A;  3FHE A;  4JPS A;  5EX3 A;  5ENN A;  3DXK G;  4ZHB A;  1VDY A;  2MRI A;  5ANR A;  3CHM A;  4KT6 B;  4B94 A;  4B89 A;  3GYZ A;  3JUI A;  4DPR A;  3PUJ A;  2VGX B;  3UT8 A;  3G2S A;  4LNG A;  5HS0 A;  2UWJ G;  4HOT A;  2XZD G;  4I9E A;  3D9O A;  3QNK A;  1MHQ A;  2QYU A;  4CDN A;  3B95 A;  4I6E A;  1O1R A;  2XRZ A;  2IF4 A;  3CKB A;  4LUN U;  4HVB A;  1B89 A;  3VTX A;  1OXJ A;  5LOZ A;  4FA6 A;  5KNG A;  4GMJ A;  1FT2 A;  4G24 A;  2VGY A;  1N9A A;  3CK8 A;  4RG9 A;  2A5U A;  5HRY A;  2KCL A;  4KZ0 A;  4GTM A;  1UOH A;  3AAA C;  2PM6 A;  3DEO A;  5ANL A;  3AS4 A;  5B1B E;  3HXE A;  4GTV A;  2DYR E;  2GRO B;  3NAW A;  1N11 A;  2LXM A;  4C9B B;  3ONL A;  3KEZ A;  5AAR A;  4GTP A;  3BEE A;  2VGX A;  4WAF A;  4BTB A;  4O60 A;  5BNW A;  1ZB1 A;  4HOS A;  5CER B;  3IXE A;  2L0I A;  4HB5 A;  3ASD A;  4F6R D;  1PC2 A;  2ZXW E;  3TWT A;  5JJT A;  1O1S A;  3FUH A;  2WXH A;  4UI9 K;  3PZ3 A;  5LFA A;  5JJ6 A;  4GZ3 A;  2L6J A;  3S7J A;  4J8D A;  4J8Y A;  5ENS D;  1H2T C;  3RRM B;  2XPZ A;  2DBA A;  4FU3 A;  4OVV A;  4X8Q A;  1K1A A;  2KAT A;  3EHM A;  5KNH D;  2CHW A;  1X81 A;  3HIZ A;  5T8I A;  5C2Y A;  2I1K A;  4L9P A;  1E7V A;  4PH4 B;  4GYY A;  2VGE A;  4UI9 J;  3LY8 A;  1S64 A;  4B8A A;  2BED A;  4HOU A;  4HOQ A;  3AG3 E;  1D8E A;  1N4Q A;  4CEM A;  2CFZ A;  3FTW A;  5FQ4 A;  2GRL A;  4LNU D;  3P2B A;  3L16 A;  4KXK B;  1IKN D;  3SQV A;  5KJM A;  4JEU A;  2X6F A;  3ZU7 B;  3EIQ C;  3MKR A;  2OEV A;  2BTD A;  4A3T A;  3SFY A;  3LVR E;  4WWP A;  2WPV A;  3MEK A;  3APD A;  3C3Q A;  2P9P G;  3V2O A;  5CEA A;  3I4G A;  1NZN A;  5DIZ A;  2VSN A;  4G26 A;  2LSV A;  4G23 A;  3CST A;  2I6H A;  4F3V A;  1HO8 A;  1DCQ A;  2XS1 A;  4ANV A;  3ZRH A;  3G2U A;  2NYJ A;  4NQ0 A;  4Y6W A;  5HKP A;  4HNA D;  3ZPJ A;  2MHK A;  2ZGG A;  3VTY A;  4J8E A;  4G8K A;  2FO1 E;  2LUH A;  4ANX A;  2Y0B G;  2WB2 A;  2IQC A;  4BT9 A;  2QY7 A;  3CGH A;  3TG4 A;  2J49 A;  1N95 A;  3CVY A;  1BD8 A;  4YND A;  3RIB A;  4L23 A;  3ULY A;  2WXQ A;  4G2V A;  4ABN A;  4KBQ A;  1K8K G;  4FAD A;  4WNG A;  3T8K A;  4JZY A;  2IOL A;  2CG3 A;  3SBS A;  2J8S D;  1TJC A;  3Q9N C;  3APF A;  2NSZ A;  4GA1 A;  2J4D A;  3UM3 A;  5AJL A;  3Q75 A;  2WQ6 A;  2MYO A;  3S7B A;  4JB8 P;  5CHE E;  3AU4 A;  2V4L A;  4JVS A;  3U66 A;  1OCR E;  2XEH A;  3LVQ E;  2DYS E;  1FCH A;  1TNU A;  4KYO B;  5CRV A;  5ARF A;  1GW6 A;  4XKC A;  3CQG B;  1TNB A;  3MX3 A;  4FLB A;  5EID A;  4NRH B;  3DRA A;  4L1B A;  3ASN E;  3V79 K;  5G04 C;  1N4R A;  4UQY A;  2OND A;  5CMY A;  2E2E A;  3UM1 A;  1N52 A;  4R7L A;  4U8H A;  4FHK A;  1H6K A;  5FQ6 A;  5G2N A;  2XHE A;  3ZW3 A;  3FFL A;  2BUG A;  2RFA A;  1XNF A;  1WY6 A;  2V8S E;  2WXL A;  4U8V D;  2UY1 A;  1N54 A;  3TG5 A;  1Q2Z A;  3FDH A;  2V0P A;  3AS5 A;  1Z3X A;  3DSX A;  2JLB A;  1L5J A;  2OVF A;  2HE0 A;  5DBK A;  4HRM B;  3CVV A;  2PM7 A;  4U0Z A;  1EPU A;  3LY9 A;  1V54 E;  2FUL A;  3CVU A;  5FT9 A;  2PNN A;  2AJA A;  1JCR A;  3CK7 A;  3MKQ B;  3HXC A;  2IFU A;  1E8X A;  4RSY A;  5BW8 C;  2QC9 A;  2Y3A A;  2GW1 A;  3CHR A;  1ZBP A;  5IY5 E;  2AXZ A;  4PS3 A;  4O6F A;  1OCZ E;  5J08 A;  2R2L A;  4DI3 A;  4LEU A;  3TXM A;  4EBA G;  4A55 A;  1Y6I A;  5AN8 A;  4GYO A;  2EIJ E;  4I2Z A;  1E8W A;  3E32 A;  4U63 A;  3ZFW A;  3KAE A;  4FLH A;  4G11 A;  3SD5 A;  3LKU A;  2CG2 A;  3ZYM A;  1JWF A;  3FH5 A;  1Z3Y A;  2IOS A;  1G3N B;  1HG2 A;  3CLJ A;  3DSS A;  3R7Q A;  4GZD A;  1EF1 C;  3QKY A;  1W3B A;  3ENE A;  5LCW J;  3FU6 A;  3MKQ A;  2L6B A;  2RD0 A;  4FP7 A;  4GZ5 A;  3NOC D;  5FJY A;  4YDE A;  4JA7 A;  3PUK A;  4DX7 D;  1LD8 A;  4UWL A;  4M3O A;  3CR3 A;  4DX5 D;  4CCA A;  4DJA A;  2BKK B;  3FUK A;  1BLX B;  4J0U A;  4HOR A;  4I1A A;  1E7U A;  3BUA A;  2WXO A;  1S63 A;  5G05 J;  4U0S A;  2AW6 A;  2LO6 A;  4RQI A;  5EIB E;  3P1U A;  4QFV A;  4HS2 A;  3TWX A;  4JXT A;  5CEC B;  3G2V A;  3EUV A;  5BV0 A;  4CDM A;  1D9S A;  3N71 A;  2XCB A;  4BER A;  1H19 A;  4F1P A;  2R17 C;  2R5S A;  3L08 A;  2NC9 A;  2Y4U A;  4N39 A;  1OWN A;  3D3M A;  4GTR A;  1KZO A;  5FZS A;  5ENO D;  4J8S A;  4PDX A;  4URK A;  4HFG A;  3UX4 A;  3PE4 A;  2J9Q A;  1SA4 A;  4GTS A;  5EYP F;  2MOW A;  3FU5 A;  4H7Y A;  3OTN A;  5AIJ A;  4GYW A;  4U95 D;  3FU3 A;  4WND A;  2LSU A;  5ARG A;  3T8M A;  5BUZ A;  5AJD A;  4C0M A;  4JC8 A;  3RK6 A;  3X2Q E;  2H6I A;  3D9I A;  3L9T A;  1E90 A;  3UQ3 A;  1H2V C;  3EHQ A;  3QAR A;  3ZN3 A;  2ZIS A;  3URZ A;  4Z68 A;  1FVF A;  3FTV A;  2GGF A;  3L17 A;  3ML8 A;  4UUC A;  3PS6 A;  3OXL A;  3OAW A;  4KMO A;  2X6J A;  3WXX A;  4UQZ A;  1QQE A;  2ZU6 B;  4OAU C;  3FUF A;  2H6H A;  1UN8 A;  3IHV A;  1OCC E;  3GZS A;  2L0T B;  1IHB A;  2X38 A;  3G2W A;  5ENP D;  4JHK A;  3Q7F A;  4A3V A;  2J4B A;  2VQ2 A;  1MX6 A;  5CED B;  3ZNG A;  4EHM A;  3MGB A;  3Q9U C;  2IJG X;  4WWO A;  4TXP A;  3CVX A;  3U4T A;  3L82 A;  4HRN A;  4U0U A;  5BV1 A;  2F8Y A;  2GRQ B;  1TJF A;  2OCC E;  3SI5 A;  4MKT A;  4N2S A;  4GA0 A;  4MLP A;  3UM2 A;  1UN9 A;  3Q15 A;  3LEW A;  3PEV B;  1OWM A;  3S7F A;  1WDY A;  4I6J A;  4GML A;  5JHA A;  1K3Z D;  3T9K A;  2BF0 X;  2KZT B;  3Q5M A;  1QNF A;  3TWS A;  4GTT A;  2I2O A;  3LYA A;  3U3W A;  1MZC A;  3NBN B;  4ANU A;  3ZIM A;  4DX6 D;  4ATG A;  4APO A;  3C98 A;  3FWV A;  3JQ0 A;  3CIA A;  2R03 A;  1MX4 A;  1KZP A;  3NZS A;  4B93 B;  1KLX A;  3FH8 A;  2XPY A;  5ITZ F;  2V5Q C;  3ULQ A;  1Z5S C;  3B7B A;  2R59 A;  4GPK A;  3RJV A;  2YQ8 A;  3IHY A;  3QJZ A;  1V55 E;  3FU0 A;  1HG5 A;  1U3C A;  1SA5 A;  2KZT A;  4HI8 A;  3D9J A;  4TV3 A;  1WM5 A;  2CHX A;  1E96 B;  2XGM A;  1MJ0 A;  3I4R B;  3S7D A;  3FUN A;  2OEW A;  5B1A E;  1BU9 A;  3PDN A;  4HLL A;  5E75 A;  1QBQ A;  2VYI A;  3LDZ A;  2P9S G;  2IO3 C;  4W9R A;  1IHG A;  3EJN A;  1HH8 A;  4GZ6 A;  5KJN A;  1HS6 A;  2XEV A;  1YCS B;  2EIM E;  3ZHE B;  1Z6T A;  2WM9 A; 
#chains in the Genus database with same CATH homology
 1E8Z A;  4F7A A;  4I17 A;  4AOF A;  2BUG A;  2PQN A;  1INZ A;  4G25 A;  3CQC B;  3IBE A;  1WAO 1;  3NZU A;  2HO1 A;  4MRU A;  4E85 A;  1XNF A;  3AS8 A;  1SQM A;  3PRZ A;  1WY6 A;  2V8S E;  3UUX A;  2WXL A;  3I3N A;  3IV0 A;  2WQH A;  3JQ1 A;  1IQU A;  4LER A;  5FWQ A;  4WWN A;  3HVE A;  4UI9 C;  3PNL B;  2UY1 A;  1N54 A;  3TG5 A;  1EDU A;  4N3A A;  3CV0 A;  2I1J A;  3FDH A;  1DNP A;  2V0P A;  3AS5 A;  1Z3X A;  4Y6C A;  5JJ7 A;  5D0Q D;  3ZYK A;  1JUQ A;  5J90 A;  2HR2 A;  2JLB A;  2IU1 A;  1X5B A;  1L5J A;  3OXG A;  2OVF A;  3RRU A;  5DBK A;  4BY6 A;  5LX8 A;  4PS7 A;  4ILG A;  4L2Y A;  2HM8 A;  2J07 A;  3CVV A;  3QWV A;  4V3I A;  5A7D B;  2PM7 A;  3GW4 A;  4DLO A;  3CHO A;  4RVB A;  3ZGQ A;  4U0Z A;  1UW4 B;  1EPU A;  3CVL A;  3LY9 A;  4FJZ A;  4I43 A;  2P58 C;  3CVW A;  3ESK A;  4N3C A;  3T5X A;  4FUL A;  4AVX A;  2FUL A;  3EIJ A;  3CVU A;  3I5P A;  3UPV A;  4CRW A;  2WXK A;  5FT9 A;  4WNE A;  3VLE A;  3CVP A;  3ZYL A;  2C2L A;  5LP0 A;  2QFC A;  2NXP A;  5D0O D;  3PVL A;  3CK7 A;  3FY4 A;  3FUE A;  3RRN B;  3R7R A;  3QOU A;  5T4Y A;  3MKQ B;  2VSX E;  3FTX A;  4BWR A;  2IFU A;  1E8X A;  4RSY A;  3MZL B;  1SZ9 A;  5BW8 C;  4ACL A;  1IQR A;  4L2L A;  2Q7F A;  2Y3A A;  5M72 A;  2C0L A;  2GW1 A;  3CHR A;  1ZBP A;  4EPZ A;  4IRU A;  4A1G A;  4F53 A;  4UWG A;  3SBT B;  2AXZ A;  4PS3 A;  1EYH A;  2XPI A;  4AJW A;  4CGW A;  4O6F A;  5J08 A;  2OOE A;  4DI3 A;  2X6H A;  4D10 C;  4LEU A;  3TXM A;  4I6G A;  2C0M A;  2KM4 A;  3SF4 A;  3KS2 A;  4EBA G;  2V5F A;  4A55 A;  1HFA A;  1E8Y A;  3D9M A;  4IUL A;  1HXI A;  1Y6I A;  2EQX A;  4GYO A;  4FJY A;  4AV7 A;  4Q69 A;  3O48 A;  2AWI A;  3FEY A;  3PEU B;  4I2Z A;  3EDT B;  1E8W A;  3DPD A;  3FHE A;  3T5V A;  4JPS A;  4XX5 A;  5EX3 A;  5ENN A;  4AY5 A;  2RG8 A;  4U63 A;  4YVQ C;  3ZFW A;  3KAE A;  4CT4 A;  4FLH A;  3BG1 B;  4G11 A;  1FVH A;  1VDY A;  2ION A;  2MRI A;  3LKU A;  5ANR A;  3SD5 A;  2VJ8 A;  3CHM A;  3FTY A;  3Q4A B;  4KT6 B;  4B94 A;  3L13 A;  5FQ7 A;  4B89 A;  3CK9 A;  3GYZ A;  2CG2 A;  4JW1 A;  4EZK A;  3JUI A;  1JWF A;  3QB2 A;  3ZYM A;  3RU0 A;  4DPR A;  3FH5 A;  3PUJ A;  3VLD A;  3B7T A;  2VGX B;  1Z3Y A;  2IOS A;  3UT8 A;  3G2S A;  3QWW A;  1HG2 A;  2LNI A;  1UJJ A;  3MJW A;  3SHF A;  3CLJ A;  4B0Z A;  2E0I A;  3GZ2 A;  4TRQ A;  2UWJ G;  4PS8 A;  4HOT A;  3R7Q A;  3UT7 A;  4GZD A;  1EF1 C;  4I9E A;  3QKY A;  1ELK A;  1W3B A;  4EQF A;  1U3D A;  3D9O A;  3ENE A;  3QNK A;  3IEG A;  1MHQ A;  2AVP A;  2FEZ A;  3FU6 A;  4GU5 A;  4ANW A;  4CDN A;  4EBA A;  3MKQ A;  5LCW J;  2FI7 A;  3BG0 B;  4I6E A;  4N3B A;  2RD0 A;  2VTB B;  4FP7 A;  5AYW D;  3LY7 A;  4KVM A;  4BSX A;  4CT0 A;  4GZ5 A;  3TGO A;  2XRZ A;  3ONK A;  5FJY A;  4UWF A;  3MV3 B;  1NA3 A;  2IF4 A;  3CKB A;  3MCX A;  4JA7 A;  4LUN U;  1B89 A;  3PUK A;  4OYS A;  4HVB A;  5HQ8 A;  4N5C A;  3VTX A;  5EDS A;  5LOZ A;  4FA6 A;  4UWL A;  3U64 A;  4K0R A;  4M3O A;  3CR3 A;  2XCC A;  4GMJ A;  4CCA A;  4DJA A;  2PZI A;  4G24 A;  4BX9 A;  1DVP A;  2VGY A;  3FUK A;  4A1S A;  3CK8 A;  4J0U A;  4IYP A;  4RG9 A;  4HOR A;  2PL2 A;  2A5U A;  2KCL A;  4KZ0 A;  2CFU A;  4I1A A;  3UMV A;  2CHZ A;  3GZ1 A;  1E7U A;  2PM6 A;  2XQ0 A;  3NQP A;  4DI4 A;  5ANL A;  5FZQ A;  3AS4 A;  3SFZ A;  3CSF A;  5CCM A;  3QAQ A;  4PUC A;  4WNF A;  4AP2 A;  2WXO A;  4EZJ A;  5G05 J;  5JHB A;  4U0S A;  3UT4 A;  4APF A;  2AW6 A;  2LO6 A;  4AM9 A;  3P1U A;  3ML9 A;  4C9B B;  2WXP A;  4QFV A;  4HS2 A;  5EX0 A;  1OWP A;  3ONL A;  3KEZ A;  4JXT A;  3LPZ A;  3QWP A;  2AXV A;  3G2V A;  4GAA A;  5BV0 A;  5A6C A;  3BEE A;  4CDM A;  3PE3 A;  1OWO A;  3N71 A;  4DK5 A;  2XCB A;  2VGX A;  4WAF A;  1H19 A;  2VSY A;  2R17 C;  4BTB A;  2R5S A;  2WMO A;  1QZ2 A;  3L08 A;  3FEX A;  3LCA A;  3PNT B;  4JA9 A;  2NC9 A;  4AIF A;  5KJN A;  3QK0 A;  4JEH A;  2J09 A;  3FTZ A;  3LS8 A;  2Y4U A;  4N39 A;  5BNW A;  4HOS A;  1OWN A;  1ELR A;  4HLE A;  3D3M A;  3O4Z A;  2L0I A;  5CMW A;  3ASD A;  4B8C B;  3RO3 A;  5FZS A;  1PC2 A;  3FUJ A;  5KCM A;  5JJT A;  3Q49 B;  4WUY A;  2VTB A;  3FUH A;  2WXH A;  4J8S A;  4FC8 A;  4ILH B;  4UI9 K;  5KJK A;  4PDX A;  1BPO A;  3MA5 A;  4HFG A;  3UX4 A;  3ZYQ A;  4URK A;  2YNQ A;  5LFA A;  4CGV A;  5JJ6 A;  2JEK A;  3PE4 A;  4XE0 A;  1LF8 A;  2M63 A;  3ZHE A;  5AEN A;  3ASG A;  2J9Q A;  3LXU X;  1HU3 A;  2AXU A;  4GZ3 A;  2L6J A;  3S7J A;  3L54 A;  1OWL A;  2MOW A;  3FU5 A;  4H7Y A;  2WXR A;  4J8D A;  3OTN A;  3D9K A;  5T3R A;  5AIJ A;  4XI9 A;  4GYW A;  3CVQ A;  4JHR A;  2WMN A;  3FU3 A;  4WND A;  1H0A A;  2LSU A;  1H2T C;  3G2T A;  3RRM B;  2XPZ A;  2DBA A;  4FU3 A;  4OVV A;  5ARG A;  1KT1 A;  3T8M A;  2WXG A;  5AJD A;  2XGO A;  2KAT A;  3EHM A;  3Q47 B;  4JC8 A;  3RK6 A;  4C0M A;  5BUZ A;  2J08 A;  3TJP A;  2CHW A;  4MS6 A;  4KVO A;  3D9I A;  3FUL A;  3HIZ A;  5C2Y A;  5T8I A;  4I1O B;  1E90 A;  3UQ3 A;  2I1K A;  2HYZ A;  1E7V A;  4PH4 B;  1A17 A;  4BFR A;  1H2V C;  1MQS A;  2KC7 A;  4GYY A;  2ILR A;  4UI9 J;  3EHN A;  3LY8 A;  4GZC A;  3QAR A;  4B8A A;  3HVE B;  4HOU A;  2UY1 B;  3ZN3 A;  4HOQ A;  4XKB A;  3URZ A;  2CFZ A;  4CEM A;  3ZXS A;  1FVF A;  3FTV A;  3FTW A;  2GGF A;  3B7U X;  3L17 A;  3ML8 A;  2FF4 A;  4XZ4 A;  3PS6 A;  2WXN A;  3OXL A;  5FQ4 A;  1JPL A;  3OAW A;  3K9I A;  3ZEF A;  4KMO A;  2X6J A;  4Q94 A;  3WXX A;  2GRL A;  4UQZ A;  1QQE A;  2ZU6 B;  4ILI A;  3MYV A;  3P2B A;  3L16 A;  3PH0 C;  4GB9 A;  4KXK B;  4ME2 A;  3JCK C;  3FUF A;  3AU5 A;  1UN8 A;  3IHV A;  4JEU A;  5KJM A;  2X6F A;  3MV2 B;  3GZS A;  4LCT A;  2L0T B;  2FO7 A;  1HE8 A;  2X38 A;  3EIQ C;  5FQ8 A;  3ZVV A;  3MKR A;  3G2W A;  1XGW A;  2KCK A;  2BTD A;  4JHK A;  4A3T A;  2X6K A;  2YHE A;  3LVR E;  3OXF A;  2I9C A;  4WWP A;  4G1T A;  4A3V A;  4EEC A;  2J4B A;  2WPV A;  2L9B A;  3MEK A;  3NF1 A;  2VQ2 A;  3U9W A;  3APD A;  3SZ7 A;  3B13 A;  5KJL A;  2YHC A;  3I4G A;  1NZN A;  2LAI A;  5DIZ A;  4DLQ A;  2VSN A;  3S2A A;  3CHS A;  4G26 A;  2KCV A;  3HYM B;  3MGB A;  4GCN A;  1PY1 A;  2LSV A;  1S0P A;  2XGS A;  4EZL A;  4H7X A;  2IJG X;  4WWO A;  3HDX A;  3CVX A;  1NP7 A;  3U4T A;  4G23 A;  3CST A;  2I6H A;  3L22 A;  4F3V A;  1HO8 A;  3ESL A;  4U0U A;  2GRM A;  4NUR A;  5BV1 A;  2X6I A;  4ANV A;  3TL5 A;  3ZRH A;  2XRY A;  3SNX A;  3FP3 A;  5BT1 A;  5C1D A;  3G2U A;  4FHJ A;  4XIF A;  1TJF A;  4AEZ C;  3CHP A;  4NQ0 A;  1PAQ A;  3SI5 A;  3SGH A;  4MKT A;  4N2S A;  4Y6W A;  3CKC A;  3ZPJ A;  4GA0 A;  4MLP A;  2MHK A;  4UWH A;  4YVO A;  3CVN A;  4XI0 A;  1UN9 A;  3Q15 A;  2WXM A;  3VTY A;  2A4Z A;  3L6A A;  3PRE A;  4J8E A;  4CDR A;  1NA0 A;  3LEW A;  4N2Q A;  3PEV B;  1OWM A;  3S7F A;  4I6J A;  4GML A;  4ANX A;  2Y4T A;  5JHA A;  2WB2 A;  2BF0 X;  2IQC A;  3B7R L;  2KZT B;  3Q5M A;  5G55 A;  1QNF A;  4BT9 A;  5LCW C;  4HXI A;  2QY7 A;  2VSO E;  3RKV A;  3CGH A;  3TG4 A;  2J49 A;  5G04 J;  1HZ4 A;  3CVY A;  5EKQ D;  4YND A;  1YA0 A;  2I2O A;  3JYS A;  3LYA A;  4E6H A;  3U3W A;  3RIB A;  1JWG A;  2PQR A;  4L23 A;  2WXQ A;  5A23 A;  1TEZ A;  2WXI A;  4ANU A;  3ZIM A;  4G2V A;  4U04 A;  4GA2 A;  1KT0 A;  4ABN A;  4KBQ A;  5E76 A;  4FAD A;  5HI7 A;  1UJK A;  4WNG A;  3E4B A;  4ATG A;  4APO A;  4BX8 A;  4BTA A;  4JZY A;  3D9N A;  3C98 A;  4L7T A;  3FWV A;  3JQ0 A;  2IOL A;  4NAC A;  4BT8 A;  2YIN A;  2CG3 A;  3CIA A;  3SBS A;  3APC A;  4KZC A;  2X3M A;  1H2U A;  3NZS A;  1TJC A;  4C0E A;  1KLX A;  3DBS A;  3APF A;  2NSZ A;  1P5Q A;  4AXH A;  3QC1 A;  1HF8 A;  2J4D A;  2XPY A;  3FH8 A;  4GA1 A;  4OVU A;  5AJL A;  1ELW A;  4Q96 A;  3FUI A;  5G05 C;  4AY6 A;  4P29 A;  3VLF A;  5CCL A;  2WQ6 A;  3S7B A;  3ULQ A;  4LRZ A;  3FUD A;  4I2W A;  4J6I A;  5CHE E;  3AU4 A;  2OV8 A;  2V4L A;  2R59 A;  4JVS A;  3U66 A;  2WXJ A;  3RO2 A;  4RG6 A;  5FZR A;  3LVQ E;  4I1M A;  3CHQ A;  4GPK A;  1FCH A;  3HHM A;  4KYO B;  3TXN A;  3RJV A;  1UG3 A;  2YQ8 A;  3IHY A;  3QJZ A;  4TUU A;  5ARF A;  3ASF A;  4JL0 A;  2OVB A;  3FU0 A;  2WVI A;  1HG5 A;  1GW6 A;  4UWK A;  4IN3 B;  4XKC A;  1U3C A;  3CQG B;  3PZD A;  2KZT A;  3D9P A;  3B7S A;  3D9J A;  3MX3 A;  2FBN A;  4FLB A;  3FH7 A;  4TV3 A;  1WM5 A;  4NRH B;  3KD7 A;  2CHX A;  1E96 B;  2XGM A;  4I9C A;  5BPP A;  3I4R B;  3IKO B;  3D9L A;  3FUM A;  1HX8 A;  3FUN A;  1Y8M A;  1SZA A;  2WXF A;  3FTU A;  4L1B A;  3S7D A;  2WQ7 A;  3PDN A;  3QDN A;  5G04 C;  4JHJ A;  2DIW A;  4UQY A;  5E75 A;  2OND A;  3TAX A;  3FTS A;  5CMY A;  3CEQ A;  2E2E A;  4U07 A;  2VYI A;  3LDZ A;  5FTP A;  4F1S A;  4W9R A;  3R9A B;  1IHG A;  1OUV A;  3EJN A;  3ASH A;  3LJ3 A;  1N52 A;  4R7L A;  4ACK A;  1ZU2 A;  4J8F A;  4K03 A;  1HH8 A;  4U8H A;  4FHK A;  4GCO A;  1H6K A;  2DCP A;  1HS6 A;  4GZ6 A;  4UQX A;  5FQ6 A;  5G2N A;  2XEV A;  2XHE A;  3ZW3 A;  3FFL A;  3ZHE B;  1IYG A;  1Z6T A;  2WM9 A;  2LAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...