3D9JA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
137
structure length
137
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA-binding protein 16
total genus 56
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9jA00
1PY1A 1DVPA 5J08A 1HG2A 4FLBA 3D9OA 3D9MA 4FU3A 3ZYQA 3D9LA 1JUQA 3G2WA 1X5BA 3CLJA 4Q94A 3D9KA 1JWFA 3G2SA 1UJJA 1HFAA 2MOWA 4GZDA 1UJKA 2KM4A 3ZYLA 1EYHA 3LDZA 2V8SE 3ONLA 3ZYKA 1H0AA 5CMWA 3D9IA 4JXTA 2LO6A 1SZ9A 2DIWA 4NACA 1INZA 1JWGA 3G2VA 4GZCA 1LF8A 4Q96A 1VDYA 3RRUA 2L0IA 5LP0A 1XGWA 3D9NA 3G2UA 1SZAA 3ZYMA 5LOZA 1JPLA 3ONKA 1EDUA 3G2TA 1HG5A 2DCPA 2QY7A 3D9JA 3D9PA 2BF0X 2L0TB 5CMYA 1HF8A 1ELKA 4AVXA 4HFGA 1HX8A 1MHQA
chains in the Genus database with same CATH superfamily
3LXUX 3RAUA 3KD7A 2X38A 4YNDA 1H6KA 1FVFA 3TG4A 2ETAA 3SGHA 4I9CA 3AS4A 3U9WA 2XS8A 3RO3A 2OEWA 3G2SA 1EPUA 2LSUA 3ZXPA 3CVNA 4ILIA 4N39A 3S7FA 1S70B 3HYMB 1OCCE 1TNZA 1ELKA 4CDRA 4LNGA 2QFCA 4Q94A 2L6JA 5AENA 3LVRE 4B89A 5AAOA 2YHEA 3UUXA 3Q7FA 3QOUA 3ESKA 3QKYA 4UWKA 2PL2A 2ZIRA 1HX8A 3ABKE 5FQ8A 4FU3A 1JCQA 3MA5A 4YDWA 2GRPB 4KYOB 3E32A 3MZLB 3HHMA 4L9PA 4CT4A 3ESLA 3Q47B 3UM0A 2IF4A 4HRMB 4JD2G 4CYMD 1Q2ZA 1H19A 3JQ1A 2RD0A 5M72A 3UPVA 5AIJA 2PQNA 1FCHA 3HXDA 5ANLA 4GYWA 3L16A 5ENPD 4FULA 3CK8A 3X2QE 4ANXA 4U04A 3O48A 3Q9NC 2Y4UA 2XCCA 3D9PA 3CSTA 3TWRA 3I5PA 2EQXA 3FTUA 4BEPA 4DK5A 3APFA 3B7TA 3DBSA 4AOFA 2JLBA 2F8XK 4ANVA 2WXFA 4ANUA 2RKKA 4LNUD 1N9AA 4XEIG 1Z3XA 1S63A 3GZ1A 3W9GA 3FUIA 3NB2A 1BPOA 2ONDA 1N54A 4GTSA 4ZHBA 3UT8A 3ULYA 4AXHA 2MOWA 3HXCA 1N0QA 2GRNB 3LDZA 1O5MA 3I4GA 4OAVB 1PC2A 1SW6A 3R9AB 4RLYA 2HYZA 3UKRG 3CHQA 3ZIMA 1HG5A 3P1UA 3PH0C 3ZFWA 2P9PG 4GTQA 3E34A 1BD8A 3QWPA 2IU1A 2V5QC 4RG9A 4M3OA 1AP7A 3Q75A 5BV1A 1K8KG 5ENQD 4ABNA 2MHKA 3TXNA 3EU5A 4U96D 4K5BA 2ZU6B 3LJ3A 4UQXA 3EHNA 4EBAG 3CHRA 3R7RA 5EX0A 2R17C 4GMLA 4I9EA 3FEXA 2XQ0A 4N5CA 4B8AA 4DI4A 2QY7A 4IRUA 3DSUA 4LG6A 4FA6A 3RJVA 2C2LA 5FJYA 3FEYA 3ML9A 1X81A 1QBQA 3DPYA 1O1SA 2JABA 3AJIA 3Q78A 5KBAA 4G11A 4DX2A 4ATGA 3FU6A 3IXEA 2X3MA 2QZAA 1KZPA 3DSWA 5HI7A 2P9UG 5CCLA 4N2SA 4RQIA 4G2VA 4Z68A 3FFLA 3UM3A 4F6RD 3D9OA 2J49A 3LS8A 3SBSA 2Y69E 4QQIA 4A63B 4UI9J 3EHQA 4GA2A 3EIQC 4BX9A 2PM6A 4YVOA 1HE8A 1IYGA 4AV7A 3MV3B 3RKVA 3ASFA 5KCMA 4L7TA 2J09A 3SHFA 4G8KA 5AQAA 2XPZA 1QYMA 3VLDA 3PZ3A 2UY1A 1UN9A 5EX3A 3MKRA 1TNOA 5AN8A 4XIFA 3PE3A 5JHAA 2IJGX 4TUUA 2RFAA 2KC7A 4DRXE 4TRQA 4ZFHA 3MCXA 4J8YA 3DSSA 2I6HA 4A55A 4NURA 3V2OA 2OEVA 1EDUA 4FHKA 4JC8A 1KLXA 4JHKA 4JA7A 4KVOA 5ARGA 3PS6A 1Z3YA 5ENTD 3NZSA 3V30A 3Q9UC 5FZSA 2OV8A 3L08A 4MBGA 3RO2A 3ZXSA 1YYHA 4AY6A 3FHEA 1FT1A 2UY1B 4WAFA 1H6OA 2PQRA 4JEHA 3SFYA 4FLBA 4F1PA 1SA5A 1OWMA 2KATA 1NFIE 3ZVVA 2LO6A 3L9TA 3PVLA 4GMRA 3SI5A 4XKBA 5B1AE 4N3BA 5AJDA 3ZEFA 1FPPA 5D0QD 1H6PA 4HI8A 3PZ2A 2WXIA 5T8IA 4Q69A 1V54E 3NOGD 2WXGA 2J8SD 1NP7A 2CHXA 2HM8A 2PNNA 3LY7A 2OOEA 4KZCA 1V55E 4B94A 5JMND 3AS8A 3MEKA 2MRIA 4N3CA 4JL0A 2XEHA 3RIBA 2F0YA 2VJ8A 3D9KA 2V0PA 3IKOB 2E2EA 1QQEA 3SBTB 4DLOA 1H2TC 1OCRE 2IFUA 3CVWA 5DIZA 3OXLA 2P9KG 1LD8A 3MGBA 3D9MA 3KEAA 3ZRHA 3DSXA 2ETCA 4GZDA 1ZB1A 3CK9A 3DWLG 2WQ6A 4JHRA 4GPMA 4GU5A 5A7DB 1D8EA 3ZGQA 3SO8A 4BETA 3IEGA 3G2UA 2UWJG 3SY2A 4BERA 2Q7FA 4HLEA 3F6QA 3SF4A 1EF1C 4LCTA 4J7WA 2IO3C 3LPZA 4GTPA 4J8FA 5AARA 4V3IA 2XEEA 3BU8A 3GZSA 3NAWA 3PZDA 3TWUA 4NQ0A 3CSFA 5AQBA 1PAQA 3DSTA 1IQRA 2WB2A 2LXLA 2OCCE 3L54A 4H7XA 1QNFA 1SQMA 2KCLA 4J6IA 1BI7B 3EJNA 5ARFA 5LCWJ 1EYHA 2B0OE 3ULQA 2AWIA 4DX6D 3E4BA 3OAWA 5ITZF 4L23A 3PE4A 5EDSA 4IN3B 4GYYA 3J5PA 4Q96A 3TWWA 5DBKA 4TXQA 4OYSA 1HXIA 4GTTA 2YNQA 4ACLA 3SFXA 5E75A 1BU9A 3C98A 4JEUA 2AXUA 2DCPA 2J4BA 1NA3A 2BF0X 3CEQA 2FO7A 3ZW3A 3RRMB 2AVPA 1RZ4A 4DJAA 4JXTA 1ZBPA 4NIKA 2X6JA 5FTPA 3R7QA 4IULA 3B7SA 3VLFA 4KMOA 4B8CB 4U95D 5BV0A 1OUVA 3RRNB 1IQUA 1JCRA 4ATZD 5HKPA 1OCZE 1TYQG 4E85A 4H7YA 3DRAA 1JWGA 4JW1A 3C3QA 2CG3A 3T8KA 2XS1A 1JPLA 3CHMA 4AP2A 3ASDA 4BT9A 4LUNU 4UUCA 3ML8A 3PUKA 1LTXA 4XI0A 2KM4A 4BFRA 3DEPA 4FHJA 1W3BA 4AIFA 4I1MA 2IOLA 3FDHA 3CVLA 4WNFA 5ENOD 3GW4A 4FADA 1NZNA 4AVXA 4O1PA 3MX3A 4TXRA 2CHZA 1E8YA 5ENRD 4Y6WA 1A5EA 3OXGA 2DZNA 3HXFA 4HS2A 5JJTA 2EIJE 4GA0A 5JJ6A 3L6AA 2XEVA 2VTBA 1WM5A 2FEZA 5KJLA 1OCOE 4HXIA 2KBXA 4J8DA 1E96B 3W9FA 4JB8P 3ISMC 3ABME 3HIZA 3JUIA 5G04J 3T8MA 2XGMA 5KJMA 2WXHA 2FULA 5CMWA 4URKA 1TNUA 5BUZA 4CEMA 3TWQA 4DX5D 4CCAA 2RFMA 1KPSB 1HU3A 3ZU7B 3PUJA 1Z5SC 2NC9A 1YMPA 1MX4A 4A3VA 4ACKA 4XKCA 4GB9A 4DX7D 2X6KA 2J4DA 4HNAD 4I6EA 2R2LA 2X6IA 3J5QB 3TL5A 5FZRA 5G2NA 3L13A 2FO1E 4LEUA 3HXBA 4FP7A 2CFUA 3JXJA 1TJCA 3Q7AA 3ZYQA 3FULA 2CG2A 2I2OA 4HORA 5CHEE 4HVBA 2P9NG 4EPZA 2NYJA 5E76A 1HO8A 3UIOC 4RVBA 2A5UA 4UWHA 4EZLA 4GPKA 2VSXE 4WNDA 4U0UA 2GRRB 4UI9C 4EZJA 3U3WA 3E30A 3URZA 3JYSA 3CVQA 3ONLA 5CBNA 4D10C 1E90A 2X6FA 4A3TA 3FTXA 4GTRA 4GZ5A 2GW1A 3NF1A 4WNEA 5LX8A 5BXUA 1ZU2A 3L17A 4I1OB 5B1BE 3TJPA 5FQ6A 4GCOA 4GZ6A 3AS5A 2L0IA 3KAEA 3PZ4A 3RU0A 1H2UA 3EUVA 4HRLA 3WG7E 2IEJA 2KXPC 5C2YA 5A23A 5JHBA 3QK0A 2P9LG 2PM7A 4ME2A 3CLJA 4C48B 4K5CA 2YINA 1E8XA 1OY3D 3C3RA 4W9RA 2Y4TA 1UN8A 2ZGDA 1LF8A 4GTOA 4P29A 2FBNA 1XGWA 3C72A 2BEDA 4MRUA 1TR4A 2KZTA 1MHQA 5KJNA 3C5RA 3UM1A 4UWGA 4RG6A 3LEWA 4NACA 2I1KA 1IKND 1NA0A 1K1AA 3S7BA 2VTBB 2PZIA 4I6GA 2VYIA 4L1BA 5D0OD 2IO2C 5G05J 3CVVA 3O4ZA 3QNKA 4UI9K 4FC8A 3QB2A 4F1SA 3C3OA 4U8HA 1SVXA 4E6HA 2ZXWE 3SNXA 5LCWC 2WQ7A 1ELRA 3FH5A 3E33A 3TG5A 3ENEA 1A17A 1N11A 5JJ7A 2FI7A 2E0IA 3S2AA 4AM9A 3ZHEA 3ZYKA 3TWTA 3B7UX 2XPIA 4O60A 1NI1A 3E37A 1D9SA 1Y8MA 3CR3A 3V79K 4JA9A 1Y6IA 3UT7A 3PEUB 1JWFA 3Q15A 4I43A 3T5VA 5ANRA 3ULEG 3ZYLA 1MQSA 1H0AA 4N3AA 4O6FA 4LRZA 4O1OA 3N71A 2VGXB 2KZTB 1DCEA 5LOZA 4G8LA 5CEAA 1HF8A 3SZ7A 3FWVA 2AXVA 5BW8C 3FUHA 1KT0A 5AQ7A 4J0UA 5B3SE 3IV0A 5CRUA 2LAIA 2WXRA 1VDYA 4CT0A 3EDTB 4WWOA 5BPPA 2V5FA 2CHWA 1GW6A 3LY8A 5FINA 3KSQA 5CCMA 1E8ZA 4EQFA 3K9IA 1N4PA 3D9JA 4JZYA 3PNTB 2C0MA 2QC9A 4L2LA 1OWLA 1ELWA 5EN5D 4EECA 2WM9A 3PNLB 3PEVB 4PH4B 2BTDA 2P9IG 3TGOA 2LUHA 2QYJA 5FIOA 4BWRA 1TNBA 2VSOE 4ILGA 2DBAA 3NQPA 5EILA 3BG1B 2H6IA 3I3NA 2YQ8A 3CHSA 3UKUG 3SD5A 4F53A 3CQGB 5G05C 2VGXA 3ASGA 3S7JA 4WWNA 2H6GA 5T4YA 3ASHA 4HI9A 3JXIA 2IY0C 4TXPA 2FF4A 2XCBA 4UQYA 5LFAA 3CGHA 1KZOA 3AU5A 5T3RA 4HOQA 1N0RA 4AEZC 3Q49B 3FUJA 3AG3E 2WMOA 4CZ2D 3ZHEB 4HLLA 4KT6B 1HH8A 3AG2E 3CK7A 1TN7A 2WXOA 3T5XA 4PS7A 1U3DA 1DC2A 4MKTA 1AWCB 2NSZA 1BI8B 3VLEA 3T9KA 4F7AA 4FJYA 4TUMA 3IHVA 3FH8A 4JPSA 4F3VA 3DEOA 4L2YA 4B0ZA 4BESA 4CDNA 4XI9A 3L82A 3ZKJA 5J90A 4U63A 2WXPA 4AJWA 4ANWA 2LNIA 4FLHA 1N52A 3Q73A 1INZA 3UIPC 3D9NA 2ZISA 2DYRE 3G2TA 5ENNA 3FUKA 3IHYA 4DLQA 4I17A 3UI2A 5JA4D 3QWVA 3U64A 4BTAA 3CVPA 4C0EA 1HS6A 1N4RA 3EU9A 3B13A 3FUNA 3AAAC 4LNBA 2VSNA 1E7UA 1TN8A 3U66A 3LJNA 1MZCA 5EIBE 3HVEA 3CV0A 2Y0BG 4K03A 1K1BA 4LERA 3BQOA 4GZ3A 4HFGA 3SQVA 3ZUVB 2R59A 2ETBA 4G25A 4YDOA 3G2WA 1RW2A 4BTBA 5FWQA 2VQ2A 3TAXA 2L9BA 2XPYA 3UX4A 4GAAA 5G04C 4PS3A 1U3CA 4YDEA 1KT1A 2M63A 3DXMG 3HDXA 3MKQB 2R03A 4BSXA 5AYWD 3V2XA 4C9BB 3D9IA 5KWDA 1IXVA 3FTYA 3HXEA 5LP0A 3AG4E 4G26A 1QZ2A 2HE0A 5FQ7A 5HRYA 1MX6A 2A5EA 2WXKA 3FP3A 3CVYA 3UM2A 4GTVA 5J08A 2ILRA 5D66A 3DXKG 2WMNA 5BNWA 3CVUA 3WXXA 3RRUA 4NRHB 3CIAA 1N4QA 3I4RB 4PS8A 3VTYA 1G3NB 2JEKA 3FY4A 4FJZA 4PDXA 4XZ4A 2A4ZA 3FU3A 4MLPA 3B7BA 4CGVA 2WXJA 4DPRA 2VGYA 2GRQB 3UQ3A 1WY6A 5CBOA 4ILHB 3FTSA 4WUYA 2P9SG 3PRZA 4DX1A 3OXFA 3KEZA 2LSVA 1OWOA 1IHBA 5CECB 2QYUA 4N2QA 1DNPA 3RSEG 3Q5MA 2R05A 1BLXB 5EKQD 1WG0A 4MS6A 3JQ0A 3D9LA 2J08A 4KZ0A 1OT8A 1WAO1 3BEEA 1N4SA 2L6BA 2EINE 4UWLA 4I2ZA 4TV3A 3V31A 4U0ZA 3D9HA 5KNGA 1OWNA 1OXJA 3UTMA 3LYAA 3U4TA 1H2VC 2HR2A 3EHMA 4I1AA 4GZCA 3UT4A 5AQ9A 3S7DA 3NBNB 1UW4B 4A1SA 2RG8A 2BKKB 2WXMA 2J9QA 4OVVA 2NXPA 1HFAA 2VGEA 3CVXA 5HS0A 2ZGGA 3LKUA 2DIWA 4I6JA 5AJLA 4U0SA 1WDYA 3TWSA 4K0RA 2I1JA 4U8VD 3LVQE 1TJFA 4J8EA 2KCVA 3PZ1A 1OWPA 1N94A 3P2BA 4APOA 5A6CA 3QWWA 1S0PA 3CKBA 1S64A 3NOCD 4UWFA 4XE0A 3TWXA 5BXOA 4DI3A 4CDMA 2IOSA 1IHGA 1DVPA 1FT2A 3MYVA 4WWPA 3EIJA 5ENSD 3NZUA 3CQCB 1UG3A 1YCSB 1MJ0A 4AY5A 4WNGA 2C0LA 4QFVA 1TEZA 1N95A 4HBDA 4GYOA 4PUCA 1TNYA 3KSLA 3RK6A 2R02A 3MV2B 4HOTA 3FUDA 3QC1A 5BT1A 3FU5A 3FUFA 1B89A 3APCA 3DSVA 2GRLA 4GCNA 4CGWA 2CFZA 2GRMA 3HRAA 3AU4A 3FUEA 2OVBA 3ZPJA 3R9MA 4BSZB 2GGFA 2R5SA 1K3ZD 4GTMA 4UQZA 4R7LA 5FT9A 3ASNE 2V8SE 3MJWA 5EYLA 3OTNA 1XNFA 3FUMA 4OVUA 1LD7A 1SA4A 4HQDA 1O1RA 4Y6CA 2BKGA 2F37A 5D2MC 2P2CP 4X8QA 2EILE 3QARA 3HVEB 3PDNA 1DCQA 4OAUC 5EIDA 1PY1A 4G1TA 4KXKB 3QAQA 3GYZA 3CHPA 1Z6TA 2OVFA 3VTXA 3LCAA 4EZKA 2AJAA 3QJZA 3FH7A 2Y3AA 2LXMA 4BT8A 3D3MA 2WQHA 5CMYA 2V4HC 4K5AB 3GZ2A 4KBQA 2EIME 4N5QA 4G23A 3EHRA 3Q79A 2HO1A 1UJKA 2XGSA 4A1GA 4HOSA 4U07A 2F8YA 4LSZE 1SZ9A 1JCSA 4APFA 4J8SA 4IYPA 4U7EB 4YDYA 4YVQC 2IONA 2WPVA 2H6FA 4HB5A 4GA1A 4G24A 3B95A 3FTWA 3JUEA 5CRVA 3FTVA 3G2VA 1MYOA 3ZNGA 3LY9A 3FTZA 2XZDG 2YHCA 3APDA 1HG2A 2KCKA 5KJKA 3BG0B 3JCKC 5KNHD 1UJJA 3CHOA 3PREA 4B93B 2AXZA 5H7PA 1UOHA 3CKCA 3ZN3A 4CRWA 1SZAA 3IBEA 3ZYMA 3ONKA 1O1TA 1E8WA 2B6CA 3SFZA 2XZTG 4JVSA 1TN6A 4DUIA 3FU0A 1D8DA 2DVWA 4I2WA 3DPDA 4EBAA 2J07A 1YA0A 4RSYA 3UINC 3UMVA 4HRNA 5FQ4A 3AG1E 2AW6A 2MYOA 1P5QA 4C0MA 2I9CA 2IQCA 2VSYA 2EIKE 1L5JA 3HG0D 2XGOA 2DZOA 2LAHA 2XHEA 1E7VA 4HOUA 3UXGA 3QDNA 5FZQA 2V4LA 2GROB 4EHMA 5CERB 3BUAA 3L22A 1MX2A 4BX8A 3TXMA 3KS2A 3ABLE 5C1DA 2H6HA 1NL4A 4XX5A 5EYPF 2P58C 1FVHA 2XRYA 2XENA 4U8YD 3MKQA 2WXQA 2DYSE 3B7RL 2WXLA 2WXNA 2XRZA 5CEDB 3Q4AB 2BUGA 1JUQA 1X5BA 3ASOE 4KVMA 4BY6A 1HZ4A 2Y1LE 5G55A 5HQ8A 2X6HA 2DWZA 2L0TB 4GMJA 5IY5E 4M7CA 4JHJA 2WVIA 1U2VG 3TWVA
chains in the Genus database with same CATH topology
5CCMA 5KJNA 3RIBA 3LXUX 4WUYA 3KD7A 2VJ8A 2X38A 3D9KA 3PRZA 4UWGA 4YNDA 3OXFA 1H6KA 3KEZA 2V0PA 2LSVA 4RG6A 1OWOA 3LEWA 3IKOB 2E2EA 4NACA 1FVFA 1QQEA 3SBTB 3TG4A 2I1KA 4DLOA 1H2TC 2IFUA 3CVWA 1NA0A 4N2QA 5DIZA 3OXLA 3SGHA 1DNPA 4I9CA 3S7BA 3Q5MA 3AS4A 3U9WA 2VTBB 2PZIA 4I6GA 3UT7A 2VYIA 4L1BA 5EKQD 5D0OD 3MGBA 4MS6A 3JQ0A 3D9MA 3D9LA 5G05J 3ZRHA 3CVVA 3O4ZA 3QNKA 3RO3A 2J08A 4UI9K 3G2SA 4FC8A 1EPUA 4GZDA 4KZ0A 3QB2A 3CK9A 4F1SA 1WAO1 2WQ6A 3BEEA 4JHRA 4U8HA 4GU5A 5A7DB 2LSUA 3ZGQA 3CVNA 4ILIA 3IEGA 3G2UA 2UWJG 4UWLA 4E6HA 4I2ZA 4TV3A 4N39A 4HLEA 2Q7FA 4U0ZA 3S7FA 3SNXA 5LCWC 3SF4A 1OWNA 1EF1C 4LCTA 1ELRA 3FH5A 2WQ7A 3HYMB 3LPZA 1ELKA 3LYAA 3U4TA 4CDRA 4J8FA 4V3IA 1H2VC 2QFCA 3ENEA 3TG5A 2HR2A 1A17A 4Q94A 3EHMA 2L6JA 3GZSA 5JJ7A 4JL0A 2FI7A 3PZDA 2E0IA 3S2AA 4AM9A 3ZHEA 5AENA 3LVRE 3ZYKA 4NQ0A 4B89A 2YHEA 3UUXA 4I1AA 3CSFA 3B7UX 4GZCA 1PAQA 3QOUA 1IQRA 2XPIA 3UT4A 2WB2A 3ESKA 3S7DA 1UW4B 3QKYA 4UWKA 2PL2A 4A1SA 2RG8A 3L54A 1Y8MA 4H7XA 1QNFA 3CR3A 1SQMA 2KCLA 1HX8A 4J6IA 5FQ8A 2WXMA 2J9QA 4FU3A 4JA9A 3EJNA 1Y6IA 3MA5A 3PEUB 1JWFA 2NXPA 3Q15A 4I43A 1HFAA 4KYOB 5ANRA 5ARFA 3CVXA 5LCWJ 3ZYLA 1EYHA 1MQSA 1H0AA 4N3AA 3LKUA 3ULQA 2DIWA 4O6FA 3MZLB 2AWIA 4LRZA 3E4BA 3N71A 3HHMA 4I6JA 4CT4A 5AJLA 3OAWA 2VGXB 3ESLA 2KZTB 4L23A 3Q47B 4U0SA 2IF4A 5LOZA 3PE4A 5EDSA 4K0RA 2I1JA 4IN3B 4GYYA 3LVQE 1HF8A 1H19A 3SZ7A 1TJFA 4Q96A 4J8EA 2KCVA 3JQ1A 5DBKA 3FWVA 4HVBA 2RD0A 5M72A 2AXVA 5BW8C 4OYSA 1OWPA 3UPVA 5AIJA 2PQNA 1FCHA 1HXIA 3FUHA 5A6CA 3P2BA 4APOA 5ANLA 3QWWA 3L16A 4GYWA 2YNQA 4ACLA 1KT0A 4FULA 1S0PA 4J0UA 3CK8A 3IV0A 4ANXA 2LAIA 4U04A 2WXRA 3O48A 1VDYA 3CKBA 5E75A 3C98A 4JEUA 2Y4UA 2AXUA 2DCPA 2J4BA 4UWFA 1NA3A 4XE0A 3D9PA 3CSTA 2XCCA 2BF0X 4DI3A 4CDMA 4CT0A 3I5PA 2EQXA 2IOSA 2FO7A 3CEQA 1IHGA 1DVPA 3ZW3A 3FTUA 3EDTB 4DK5A 3APFA 3MYVA 3EIJA 4WWPA 3NZUA 3CQCB 4WWOA 1UG3A 3B7TA 3RRMB 3DBSA 2AVPA 5BPPA 4AOFA 2JLBA 4DJAA 2V5FA 4AY5A 2CHWA 1GW6A 4JXTA 4WNGA 1ZBPA 2C0LA 4QFVA 3FTSA 1TEZA 3LY8A 4ANVA 2X6JA 2WXFA 4GYOA 4ANUA 5FTPA 4PUCA 3R7QA 3RK6A 1Z3XA 4IULA 1E8ZA 3B7SA 4KMOA 3GZ1A 3K9IA 3VLFA 4EQFA 4B8CB 3D9JA 4JZYA 3FUIA 3PNTB 5BV0A 3MV2B 1OUVA 4HOTA 3RRNB 1BPOA 2ONDA 1N54A 3FUDA 2C0MA 1IQUA 3QC1A 5BT1A 4L2LA 1OWLA 1ELWA 3FU5A 3FUFA 3UT8A 4EECA 1B89A 3APCA 4AXHA 2MOWA 2WM9A 3PNLB 4E85A 3PEVB 2GRLA 3LDZA 4H7YA 3I4GA 4GCNA 4PH4B 1PC2A 2BTDA 1JWGA 3TGOA 4JW1A 3R9AB 2CG3A 4CGWA 2CFZA 4BWRA 2GRMA 2HYZA 2VSOE 3CHQA 3AU4A 3FUEA 3ZIMA 2OVBA 1JPLA 4ILGA 1HG5A 2DBAA 3CHMA 3P1UA 3PH0C 3ZPJA 4AP2A 3ZFWA 2GGFA 3ASDA 2R5SA 4BT9A 3NQPA 4LUNU 3BG1B 3I3NA 2YQ8A 3CHSA 3QWPA 3SD5A 4F53A 2IU1A 3CQGB 3ML8A 3PUKA 4UQZA 5G05C 4R7LA 4XI0A 2VGXA 3ASGA 4M3OA 4RG9A 4WWNA 2KM4A 5FT9A 3S7JA 4BFRA 2V8SE 3MJWA 4FHJA 1W3BA 3OTNA 4AIFA 4I1MA 5BV1A 2IOLA 1XNFA 5T4YA 3FUMA 3ASHA 3FDHA 4OVUA 4ABNA 2MHKA 3CVLA 3TXNA 4WNFA 4Y6CA 2FF4A 2XCBA 4UQYA 3GW4A 3QARA 4FADA 1NZNA 3HVEB 5LFAA 3CGHA 3PDNA 4AVXA 2ZU6B 3LJ3A 4UQXA 3AU5A 5T3RA 1PY1A 3EHNA 3MX3A 4G1TA 4HOQA 4EBAG 2CHZA 4KXKB 3QAQA 3CHRA 1E8YA 3GYZA 4AEZC 3CHPA 1Z6TA 3Q49B 3FUJA 2OVFA 3VTXA 3R7RA 3LCAA 4Y6WA 5EX0A 4EZKA 2R17C 2WMOA 4GMLA 4I9EA 3QJZA 3FEXA 3ZHEB 3OXGA 4KT6B 2XQ0A 4N5CA 3FH7A 4B8AA 4DI4A 1HH8A 2Y3AA 4BT8A 2QY7A 3CK7A 4HS2A 3D3MA 2WQHA 2WXOA 4IRUA 3T5XA 5JJTA 5CMYA 4GA0A 4PS7A 5JJ6A 3L6AA 1U3DA 2XEVA 3GZ2A 4FA6A 4MKTA 3RJVA 2C2LA 2NSZA 4KBQA 5FJYA 3FEYA 3ML9A 4G23A 3VLEA 2VTBA 4A1GA 2HO1A 1UJKA 1WM5A 2FEZA 2XGSA 4FJYA 4F7AA 3IHVA 4HOSA 4G11A 4U07A 3FH8A 1SZ9A 5KJLA 4JPSA 4ATGA 3FU6A 4APFA 4HXIA 2X3MA 4J8DA 1E96B 4F3VA 4J8SA 4IYPA 4L2YA 4B0ZA 4CDNA 5HI7A 4XI9A 5CCLA 4N2SA 4YVQC 3HIZA 3JUIA 2IONA 2WPVA 4G2VA 3FFLA 5G04J 5J90A 3T8MA 3D9OA 2XGMA 4U63A 4GA1A 4G24A 5KJMA 2WXHA 2WXPA 2FULA 2J49A 4AJWA 4ANWA 3LS8A 3FTWA 2LNIA 3SBSA 5CMWA 4FLHA 4URKA 5BUZA 4CEMA 1N52A 3FTVA 1INZA 3G2VA 4UI9J 4GA2A 3D9NA 3EIQC 4CCAA 4BX9A 3LY9A 2PM6A 3G2TA 1HU3A 5ENNA 4YVOA 3FTZA 3FUKA 2YHCA 3APDA 3IHYA 3PUJA 1HE8A 1IYGA 4DLQA 4I17A 4AV7A 3QWVA 3U64A 4BTAA 3CVPA 3MV3B 1HG2A 2KCKA 3RKVA 3ASFA 2NC9A 1HS6A 4L7TA 2J09A 5KCMA 3BG0B 4C0EA 5KJKA 3JCKC 3B13A 1UJJA 4A3VA 3CHOA 4ACKA 3SHFA 3FUNA 4XKCA 4GB9A 2X6KA 3PREA 2J4DA 2VSNA 2AXZA 4I6EA 1E7UA 2X6IA 3CKCA 2XPZA 3VLDA 2UY1A 3ZN3A 1UN9A 5EX3A 3U66A 3MKRA 4CRWA 1SZAA 3CV0A 3HVEA 3IBEA 3ONKA 3ZYMA 3TL5A 5FZRA 4K03A 1E8WA 4LERA 5G2NA 3L13A 4GZ3A 4HFGA 4LEUA 4FP7A 2R59A 2CFUA 4XIFA 3SFZA 4G25A 3PE3A 4JVSA 5JHAA 1TJCA 3ZYQA 2IJGX 3G2WA 3FULA 2CG2A 3FU0A 4TUUA 2I2OA 4I2WA 2KC7A 3DPDA 5CHEE 4BTBA 4TRQA 5FWQA 4EBAA 2J07A 3MCXA 4EPZA 1YA0A 2VQ2A 4RSYA 5E76A 1HO8A 3UMVA 3TAXA 2L9BA 4RVBA 2A5UA 4UWHA 2XPYA 5FQ4A 3UX4A 4GAAA 5G04C 2I6HA 2AW6A 4A55A 4NURA 4EZLA 4PS3A 1EDUA 1P5QA 1U3CA 4GPKA 4FHKA 1KT1A 2VSXE 4JC8A 2I9CA 2M63A 4C0MA 3T5VA 2IQCA 4WNDA 2VSYA 4U0UA 3HDXA 1KLXA 4JHKA 1L5JA 4UI9C 3MKQB 4JA7A 4KVOA 4EZJA 5ARGA 4BSXA 3U3WA 5AYWD 3PS6A 3URZA 1Z3YA 3NZSA 3JYSA 3CVQA 4C9BB 2XGOA 3ONLA 3D9IA 2LAHA 2XHEA 5FZSA 2OV8A 3L08A 4D10C 1E7VA 1E90A 2X6FA 3FTYA 4HOUA 3RO2A 3ZXSA 4AY6A 4A3TA 5LP0A 3FHEA 3FTXA 3QDNA 4G26A 1QZ2A 5FZQA 2V4LA 4GZ5A 2GW1A 2UY1B 5FQ7A 4WAFA 2PQRA 3NF1A 4WNEA 3L22A 2WXKA 5LX8A 4BX8A 4HORA 3FP3A 4JEHA 3KS2A 3TXMA 3CVYA 5C1DA 5J08A 2ILRA 4FLBA 1ZU2A 4XX5A 3L17A 1OWMA 1FVHA 2KATA 2P58C 2XRYA 4I1OB 3TJPA 2WMNA 5FQ6A 3ZVVA 2LO6A 4GCOA 4GZ6A 3PVLA 3AS5A 5BNWA 3CVUA 3SI5A 3MKQA 3WXXA 4XKBA 2WXQA 3RRUA 2L0IA 3KAEA 4NRHB 3RU0A 1H2UA 3CIAA 4N3BA 3B7RL 2WXLA 2WXNA 5AJDA 2XRZA 3ZEFA 3I4RB 5C2YA 5D0QD 5A23A 5JHBA 4PS8A 3Q4AB 3VTYA 2BUGA 2JEKA 3QK0A 1JUQA 3FY4A 1X5BA 2PM7A 3CLJA 4FJZA 4ME2A 4PDXA 2WXIA 5T8IA 4Q69A 2YINA 2A4ZA 1E8XA 4XZ4A 2WXGA 3FU3A 4OVVA 1NP7A 4KVMA 2CHXA 2HM8A 4W9RA 4MLPA 2Y4TA 1UN8A 3LY7A 2OOEA 4CGVA 1LF8A 2WXJA 4KZCA 4DPRA 4P29A 2FBNA 4BY6A 1XGWA 2VGYA 4B94A 1HZ4A 3UQ3A 3AS8A 3MEKA 5G55A 5HQ8A 2X6HA 2L0TB 2MRIA 1WY6A 4GMJA 4MRUA 4JHJA 2WVIA 4N3CA 2KZTA 4ILHB 1MHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PY1 A;  1DVP A;  5J08 A;  1HG2 A;  4FLB A;  3D9O A;  3D9M A;  4FU3 A;  3ZYQ A;  3D9L A;  1JUQ A;  3G2W A;  1X5B A;  3CLJ A;  4Q94 A;  3D9K A;  1JWF A;  3G2S A;  1UJJ A;  1HFA A;  2MOW A;  4GZD A;  1UJK A;  2KM4 A;  3ZYL A;  1EYH A;  3LDZ A;  2V8S E;  3ONL A;  3ZYK A;  1H0A A;  5CMW A;  3D9I A;  4JXT A;  2LO6 A;  1SZ9 A;  2DIW A;  4NAC A;  1INZ A;  1JWG A;  3G2V A;  4GZC A;  1LF8 A;  4Q96 A;  1VDY A;  3RRU A;  2L0I A;  5LP0 A;  1XGW A;  3D9N A;  3G2U A;  1SZA A;  3ZYM A;  5LOZ A;  1JPL A;  3ONK A;  1EDU A;  3G2T A;  1HG5 A;  2DCP A;  2QY7 A;  3D9J A;  3D9P A;  2BF0 X;  2L0T B;  5CMY A;  1HF8 A;  1ELK A;  4AVX A;  4HFG A;  1HX8 A;  1MHQ A; 
#chains in the Genus database with same CATH topology
 3LXU X;  3RAU A;  3KD7 A;  2X38 A;  4YND A;  1H6K A;  1FVF A;  3TG4 A;  2ETA A;  3SGH A;  4I9C A;  3AS4 A;  3U9W A;  2XS8 A;  3RO3 A;  2OEW A;  3G2S A;  1EPU A;  2LSU A;  3ZXP A;  3CVN A;  4ILI A;  4N39 A;  3S7F A;  1S70 B;  3HYM B;  1OCC E;  1TNZ A;  1ELK A;  4CDR A;  4LNG A;  2QFC A;  4Q94 A;  2L6J A;  5AEN A;  3LVR E;  4B89 A;  5AAO A;  2YHE A;  3UUX A;  3Q7F A;  3QOU A;  3ESK A;  3QKY A;  4UWK A;  2PL2 A;  2ZIR A;  1HX8 A;  3ABK E;  5FQ8 A;  4FU3 A;  1JCQ A;  3MA5 A;  4YDW A;  2GRP B;  4KYO B;  3E32 A;  3MZL B;  3HHM A;  4L9P A;  4CT4 A;  3ESL A;  3Q47 B;  3UM0 A;  2IF4 A;  4HRM B;  4JD2 G;  4CYM D;  1Q2Z A;  1H19 A;  3JQ1 A;  2RD0 A;  5M72 A;  3UPV A;  5AIJ A;  2PQN A;  1FCH A;  3HXD A;  5ANL A;  4GYW A;  3L16 A;  5ENP D;  4FUL A;  3CK8 A;  3X2Q E;  4ANX A;  4U04 A;  3O48 A;  3Q9N C;  2Y4U A;  2XCC A;  3D9P A;  3CST A;  3TWR A;  3I5P A;  2EQX A;  3FTU A;  4BEP A;  4DK5 A;  3APF A;  3B7T A;  3DBS A;  4AOF A;  2JLB A;  2F8X K;  4ANV A;  2WXF A;  4ANU A;  2RKK A;  4LNU D;  1N9A A;  4XEI G;  1Z3X A;  1S63 A;  3GZ1 A;  3W9G A;  3FUI A;  3NB2 A;  1BPO A;  2OND A;  1N54 A;  4GTS A;  4ZHB A;  3UT8 A;  3ULY A;  4AXH A;  2MOW A;  3HXC A;  1N0Q A;  2GRN B;  3LDZ A;  1O5M A;  3I4G A;  4OAV B;  1PC2 A;  1SW6 A;  3R9A B;  4RLY A;  2HYZ A;  3UKR G;  3CHQ A;  3ZIM A;  1HG5 A;  3P1U A;  3PH0 C;  3ZFW A;  2P9P G;  4GTQ A;  3E34 A;  1BD8 A;  3QWP A;  2IU1 A;  2V5Q C;  4RG9 A;  4M3O A;  1AP7 A;  3Q75 A;  5BV1 A;  1K8K G;  5ENQ D;  4ABN A;  2MHK A;  3TXN A;  3EU5 A;  4U96 D;  4K5B A;  2ZU6 B;  3LJ3 A;  4UQX A;  3EHN A;  4EBA G;  3CHR A;  3R7R A;  5EX0 A;  2R17 C;  4GML A;  4I9E A;  3FEX A;  2XQ0 A;  4N5C A;  4B8A A;  4DI4 A;  2QY7 A;  4IRU A;  3DSU A;  4LG6 A;  4FA6 A;  3RJV A;  2C2L A;  5FJY A;  3FEY A;  3ML9 A;  1X81 A;  1QBQ A;  3DPY A;  1O1S A;  2JAB A;  3AJI A;  3Q78 A;  5KBA A;  4G11 A;  4DX2 A;  4ATG A;  3FU6 A;  3IXE A;  2X3M A;  2QZA A;  1KZP A;  3DSW A;  5HI7 A;  2P9U G;  5CCL A;  4N2S A;  4RQI A;  4G2V A;  4Z68 A;  3FFL A;  3UM3 A;  4F6R D;  3D9O A;  2J49 A;  3LS8 A;  3SBS A;  2Y69 E;  4QQI A;  4A63 B;  4UI9 J;  3EHQ A;  4GA2 A;  3EIQ C;  4BX9 A;  2PM6 A;  4YVO A;  1HE8 A;  1IYG A;  4AV7 A;  3MV3 B;  3RKV A;  3ASF A;  5KCM A;  4L7T A;  2J09 A;  3SHF A;  4G8K A;  5AQA A;  2XPZ A;  1QYM A;  3VLD A;  3PZ3 A;  2UY1 A;  1UN9 A;  5EX3 A;  3MKR A;  1TNO A;  5AN8 A;  4XIF A;  3PE3 A;  5JHA A;  2IJG X;  4TUU A;  2RFA A;  2KC7 A;  4DRX E;  4TRQ A;  4ZFH A;  3MCX A;  4J8Y A;  3DSS A;  2I6H A;  4A55 A;  4NUR A;  3V2O A;  2OEV A;  1EDU A;  4FHK A;  4JC8 A;  1KLX A;  4JHK A;  4JA7 A;  4KVO A;  5ARG A;  3PS6 A;  1Z3Y A;  5ENT D;  3NZS A;  3V30 A;  3Q9U C;  5FZS A;  2OV8 A;  3L08 A;  4MBG A;  3RO2 A;  3ZXS A;  1YYH A;  4AY6 A;  3FHE A;  1FT1 A;  2UY1 B;  4WAF A;  1H6O A;  2PQR A;  4JEH A;  3SFY A;  4FLB A;  4F1P A;  1SA5 A;  1OWM A;  2KAT A;  1NFI E;  3ZVV A;  2LO6 A;  3L9T A;  3PVL A;  4GMR A;  3SI5 A;  4XKB A;  5B1A E;  4N3B A;  5AJD A;  3ZEF A;  1FPP A;  5D0Q D;  1H6P A;  4HI8 A;  3PZ2 A;  2WXI A;  5T8I A;  4Q69 A;  1V54 E;  3NOG D;  2WXG A;  2J8S D;  1NP7 A;  2CHX A;  2HM8 A;  2PNN A;  3LY7 A;  2OOE A;  4KZC A;  1V55 E;  4B94 A;  5JMN D;  3AS8 A;  3MEK A;  2MRI A;  4N3C A;  4JL0 A;  2XEH A;  3RIB A;  2F0Y A;  2VJ8 A;  3D9K A;  2V0P A;  3IKO B;  2E2E A;  1QQE A;  3SBT B;  4DLO A;  1H2T C;  1OCR E;  2IFU A;  3CVW A;  5DIZ A;  3OXL A;  2P9K G;  1LD8 A;  3MGB A;  3D9M A;  3KEA A;  3ZRH A;  3DSX A;  2ETC A;  4GZD A;  1ZB1 A;  3CK9 A;  3DWL G;  2WQ6 A;  4JHR A;  4GPM A;  4GU5 A;  5A7D B;  1D8E A;  3ZGQ A;  3SO8 A;  4BET A;  3IEG A;  3G2U A;  2UWJ G;  3SY2 A;  4BER A;  2Q7F A;  4HLE A;  3F6Q A;  3SF4 A;  1EF1 C;  4LCT A;  4J7W A;  2IO3 C;  3LPZ A;  4GTP A;  4J8F A;  5AAR A;  4V3I A;  2XEE A;  3BU8 A;  3GZS A;  3NAW A;  3PZD A;  3TWU A;  4NQ0 A;  3CSF A;  5AQB A;  1PAQ A;  3DST A;  1IQR A;  2WB2 A;  2LXL A;  2OCC E;  3L54 A;  4H7X A;  1QNF A;  1SQM A;  2KCL A;  4J6I A;  1BI7 B;  3EJN A;  5ARF A;  5LCW J;  1EYH A;  2B0O E;  3ULQ A;  2AWI A;  4DX6 D;  3E4B A;  3OAW A;  5ITZ F;  4L23 A;  3PE4 A;  5EDS A;  4IN3 B;  4GYY A;  3J5P A;  4Q96 A;  3TWW A;  5DBK A;  4TXQ A;  4OYS A;  1HXI A;  4GTT A;  2YNQ A;  4ACL A;  3SFX A;  5E75 A;  1BU9 A;  3C98 A;  4JEU A;  2AXU A;  2DCP A;  2J4B A;  1NA3 A;  2BF0 X;  3CEQ A;  2FO7 A;  3ZW3 A;  3RRM B;  2AVP A;  1RZ4 A;  4DJA A;  4JXT A;  1ZBP A;  4NIK A;  2X6J A;  5FTP A;  3R7Q A;  4IUL A;  3B7S A;  3VLF A;  4KMO A;  4B8C B;  4U95 D;  5BV0 A;  1OUV A;  3RRN B;  1IQU A;  1JCR A;  4ATZ D;  5HKP A;  1OCZ E;  1TYQ G;  4E85 A;  4H7Y A;  3DRA A;  1JWG A;  4JW1 A;  3C3Q A;  2CG3 A;  3T8K A;  2XS1 A;  1JPL A;  3CHM A;  4AP2 A;  3ASD A;  4BT9 A;  4LUN U;  4UUC A;  3ML8 A;  3PUK A;  1LTX A;  4XI0 A;  2KM4 A;  4BFR A;  3DEP A;  4FHJ A;  1W3B A;  4AIF A;  4I1M A;  2IOL A;  3FDH A;  3CVL A;  4WNF A;  5ENO D;  3GW4 A;  4FAD A;  1NZN A;  4AVX A;  4O1P A;  3MX3 A;  4TXR A;  2CHZ A;  1E8Y A;  5ENR D;  4Y6W A;  1A5E A;  3OXG A;  2DZN A;  3HXF A;  4HS2 A;  5JJT A;  2EIJ E;  4GA0 A;  5JJ6 A;  3L6A A;  2XEV A;  2VTB A;  1WM5 A;  2FEZ A;  5KJL A;  1OCO E;  4HXI A;  2KBX A;  4J8D A;  1E96 B;  3W9F A;  4JB8 P;  3ISM C;  3ABM E;  3HIZ A;  3JUI A;  5G04 J;  3T8M A;  2XGM A;  5KJM A;  2WXH A;  2FUL A;  5CMW A;  4URK A;  1TNU A;  5BUZ A;  4CEM A;  3TWQ A;  4DX5 D;  4CCA A;  2RFM A;  1KPS B;  1HU3 A;  3ZU7 B;  3PUJ A;  1Z5S C;  2NC9 A;  1YMP A;  1MX4 A;  4A3V A;  4ACK A;  4XKC A;  4GB9 A;  4DX7 D;  2X6K A;  2J4D A;  4HNA D;  4I6E A;  2R2L A;  2X6I A;  3J5Q B;  3TL5 A;  5FZR A;  5G2N A;  3L13 A;  2FO1 E;  4LEU A;  3HXB A;  4FP7 A;  2CFU A;  3JXJ A;  1TJC A;  3Q7A A;  3ZYQ A;  3FUL A;  2CG2 A;  2I2O A;  4HOR A;  5CHE E;  4HVB A;  2P9N G;  4EPZ A;  2NYJ A;  5E76 A;  1HO8 A;  3UIO C;  4RVB A;  2A5U A;  4UWH A;  4EZL A;  4GPK A;  2VSX E;  4WND A;  4U0U A;  2GRR B;  4UI9 C;  4EZJ A;  3U3W A;  3E30 A;  3URZ A;  3JYS A;  3CVQ A;  3ONL A;  5CBN A;  4D10 C;  1E90 A;  2X6F A;  4A3T A;  3FTX A;  4GTR A;  4GZ5 A;  2GW1 A;  3NF1 A;  4WNE A;  5LX8 A;  5BXU A;  1ZU2 A;  3L17 A;  4I1O B;  5B1B E;  3TJP A;  5FQ6 A;  4GCO A;  4GZ6 A;  3AS5 A;  2L0I A;  3KAE A;  3PZ4 A;  3RU0 A;  1H2U A;  3EUV A;  4HRL A;  3WG7 E;  2IEJ A;  2KXP C;  5C2Y A;  5A23 A;  5JHB A;  3QK0 A;  2P9L G;  2PM7 A;  4ME2 A;  3CLJ A;  4C48 B;  4K5C A;  2YIN A;  1E8X A;  1OY3 D;  3C3R A;  4W9R A;  2Y4T A;  1UN8 A;  2ZGD A;  1LF8 A;  4GTO A;  4P29 A;  2FBN A;  1XGW A;  3C72 A;  2BED A;  4MRU A;  1TR4 A;  2KZT A;  1MHQ A;  5KJN A;  3C5R A;  3UM1 A;  4UWG A;  4RG6 A;  3LEW A;  4NAC A;  2I1K A;  1IKN D;  1NA0 A;  1K1A A;  3S7B A;  2VTB B;  2PZI A;  4I6G A;  2VYI A;  4L1B A;  5D0O D;  2IO2 C;  5G05 J;  3CVV A;  3O4Z A;  3QNK A;  4UI9 K;  4FC8 A;  3QB2 A;  4F1S A;  3C3O A;  4U8H A;  1SVX A;  4E6H A;  2ZXW E;  3SNX A;  5LCW C;  2WQ7 A;  1ELR A;  3FH5 A;  3E33 A;  3TG5 A;  3ENE A;  1A17 A;  1N11 A;  5JJ7 A;  2FI7 A;  2E0I A;  3S2A A;  4AM9 A;  3ZHE A;  3ZYK A;  3TWT A;  3B7U X;  2XPI A;  4O60 A;  1NI1 A;  3E37 A;  1D9S A;  1Y8M A;  3CR3 A;  3V79 K;  4JA9 A;  1Y6I A;  3UT7 A;  3PEU B;  1JWF A;  3Q15 A;  4I43 A;  3T5V A;  5ANR A;  3ULE G;  3ZYL A;  1MQS A;  1H0A A;  4N3A A;  4O6F A;  4LRZ A;  4O1O A;  3N71 A;  2VGX B;  2KZT B;  1DCE A;  5LOZ A;  4G8L A;  5CEA A;  1HF8 A;  3SZ7 A;  3FWV A;  2AXV A;  5BW8 C;  3FUH A;  1KT0 A;  5AQ7 A;  4J0U A;  5B3S E;  3IV0 A;  5CRU A;  2LAI A;  2WXR A;  1VDY A;  4CT0 A;  3EDT B;  4WWO A;  5BPP A;  2V5F A;  2CHW A;  1GW6 A;  3LY8 A;  5FIN A;  3KSQ A;  5CCM A;  1E8Z A;  4EQF A;  3K9I A;  1N4P A;  3D9J A;  4JZY A;  3PNT B;  2C0M A;  2QC9 A;  4L2L A;  1OWL A;  1ELW A;  5EN5 D;  4EEC A;  2WM9 A;  3PNL B;  3PEV B;  4PH4 B;  2BTD A;  2P9I G;  3TGO A;  2LUH A;  2QYJ A;  5FIO A;  4BWR A;  1TNB A;  2VSO E;  4ILG A;  2DBA A;  3NQP A;  5EIL A;  3BG1 B;  2H6I A;  3I3N A;  2YQ8 A;  3CHS A;  3UKU G;  3SD5 A;  4F53 A;  3CQG B;  5G05 C;  2VGX A;  3ASG A;  3S7J A;  4WWN A;  2H6G A;  5T4Y A;  3ASH A;  4HI9 A;  3JXI A;  2IY0 C;  4TXP A;  2FF4 A;  2XCB A;  4UQY A;  5LFA A;  3CGH A;  1KZO A;  3AU5 A;  5T3R A;  4HOQ A;  1N0R A;  4AEZ C;  3Q49 B;  3FUJ A;  3AG3 E;  2WMO A;  4CZ2 D;  3ZHE B;  4HLL A;  4KT6 B;  1HH8 A;  3AG2 E;  3CK7 A;  1TN7 A;  2WXO A;  3T5X A;  4PS7 A;  1U3D A;  1DC2 A;  4MKT A;  1AWC B;  2NSZ A;  1BI8 B;  3VLE A;  3T9K A;  4F7A A;  4FJY A;  4TUM A;  3IHV A;  3FH8 A;  4JPS A;  4F3V A;  3DEO A;  4L2Y A;  4B0Z A;  4BES A;  4CDN A;  4XI9 A;  3L82 A;  3ZKJ A;  5J90 A;  4U63 A;  2WXP A;  4AJW A;  4ANW A;  2LNI A;  4FLH A;  1N52 A;  3Q73 A;  1INZ A;  3UIP C;  3D9N A;  2ZIS A;  2DYR E;  3G2T A;  5ENN A;  3FUK A;  3IHY A;  4DLQ A;  4I17 A;  3UI2 A;  5JA4 D;  3QWV A;  3U64 A;  4BTA A;  3CVP A;  4C0E A;  1HS6 A;  1N4R A;  3EU9 A;  3B13 A;  3FUN A;  3AAA C;  4LNB A;  2VSN A;  1E7U A;  1TN8 A;  3U66 A;  3LJN A;  1MZC A;  5EIB E;  3HVE A;  3CV0 A;  2Y0B G;  4K03 A;  1K1B A;  4LER A;  3BQO A;  4GZ3 A;  4HFG A;  3SQV A;  3ZUV B;  2R59 A;  2ETB A;  4G25 A;  4YDO A;  3G2W A;  1RW2 A;  4BTB A;  5FWQ A;  2VQ2 A;  3TAX A;  2L9B A;  2XPY A;  3UX4 A;  4GAA A;  5G04 C;  4PS3 A;  1U3C A;  4YDE A;  1KT1 A;  2M63 A;  3DXM G;  3HDX A;  3MKQ B;  2R03 A;  4BSX A;  5AYW D;  3V2X A;  4C9B B;  3D9I A;  5KWD A;  1IXV A;  3FTY A;  3HXE A;  5LP0 A;  3AG4 E;  4G26 A;  1QZ2 A;  2HE0 A;  5FQ7 A;  5HRY A;  1MX6 A;  2A5E A;  2WXK A;  3FP3 A;  3CVY A;  3UM2 A;  4GTV A;  5J08 A;  2ILR A;  5D66 A;  3DXK G;  2WMN A;  5BNW A;  3CVU A;  3WXX A;  3RRU A;  4NRH B;  3CIA A;  1N4Q A;  3I4R B;  4PS8 A;  3VTY A;  1G3N B;  2JEK A;  3FY4 A;  4FJZ A;  4PDX A;  4XZ4 A;  2A4Z A;  3FU3 A;  4MLP A;  3B7B A;  4CGV A;  2WXJ A;  4DPR A;  2VGY A;  2GRQ B;  3UQ3 A;  1WY6 A;  5CBO A;  4ILH B;  3FTS A;  4WUY A;  2P9S G;  3PRZ A;  4DX1 A;  3OXF A;  3KEZ A;  2LSV A;  1OWO A;  1IHB A;  5CEC B;  2QYU A;  4N2Q A;  1DNP A;  3RSE G;  3Q5M A;  2R05 A;  1BLX B;  5EKQ D;  1WG0 A;  4MS6 A;  3JQ0 A;  3D9L A;  2J08 A;  4KZ0 A;  1OT8 A;  1WAO 1;  3BEE A;  1N4S A;  2L6B A;  2EIN E;  4UWL A;  4I2Z A;  4TV3 A;  3V31 A;  4U0Z A;  3D9H A;  5KNG A;  1OWN A;  1OXJ A;  3UTM A;  3LYA A;  3U4T A;  1H2V C;  2HR2 A;  3EHM A;  4I1A A;  4GZC A;  3UT4 A;  5AQ9 A;  3S7D A;  3NBN B;  1UW4 B;  4A1S A;  2RG8 A;  2BKK B;  2WXM A;  2J9Q A;  4OVV A;  2NXP A;  1HFA A;  2VGE A;  3CVX A;  5HS0 A;  2ZGG A;  3LKU A;  2DIW A;  4I6J A;  5AJL A;  4U0S A;  1WDY A;  3TWS A;  4K0R A;  2I1J A;  4U8V D;  3LVQ E;  1TJF A;  4J8E A;  2KCV A;  3PZ1 A;  1OWP A;  1N94 A;  3P2B A;  4APO A;  5A6C A;  3QWW A;  1S0P A;  3CKB A;  1S64 A;  3NOC D;  4UWF A;  4XE0 A;  3TWX A;  5BXO A;  4DI3 A;  4CDM A;  2IOS A;  1IHG A;  1DVP A;  1FT2 A;  3MYV A;  4WWP A;  3EIJ A;  5ENS D;  3NZU A;  3CQC B;  1UG3 A;  1YCS B;  1MJ0 A;  4AY5 A;  4WNG A;  2C0L A;  4QFV A;  1TEZ A;  1N95 A;  4HBD A;  4GYO A;  4PUC A;  1TNY A;  3KSL A;  3RK6 A;  2R02 A;  3MV2 B;  4HOT A;  3FUD A;  3QC1 A;  5BT1 A;  3FU5 A;  3FUF A;  1B89 A;  3APC A;  3DSV A;  2GRL A;  4GCN A;  4CGW A;  2CFZ A;  2GRM A;  3HRA A;  3AU4 A;  3FUE A;  2OVB A;  3ZPJ A;  3R9M A;  4BSZ B;  2GGF A;  2R5S A;  1K3Z D;  4GTM A;  4UQZ A;  4R7L A;  5FT9 A;  3ASN E;  2V8S E;  3MJW A;  5EYL A;  3OTN A;  1XNF A;  3FUM A;  4OVU A;  1LD7 A;  1SA4 A;  4HQD A;  1O1R A;  4Y6C A;  2BKG A;  2F37 A;  5D2M C;  2P2C P;  4X8Q A;  2EIL E;  3QAR A;  3HVE B;  3PDN A;  1DCQ A;  4OAU C;  5EID A;  1PY1 A;  4G1T A;  4KXK B;  3QAQ A;  3GYZ A;  3CHP A;  1Z6T A;  2OVF A;  3VTX A;  3LCA A;  4EZK A;  2AJA A;  3QJZ A;  3FH7 A;  2Y3A A;  2LXM A;  4BT8 A;  3D3M A;  2WQH A;  5CMY A;  2V4H C;  4K5A B;  3GZ2 A;  4KBQ A;  2EIM E;  4N5Q A;  4G23 A;  3EHR A;  3Q79 A;  2HO1 A;  1UJK A;  2XGS A;  4A1G A;  4HOS A;  4U07 A;  2F8Y A;  4LSZ E;  1SZ9 A;  1JCS A;  4APF A;  4J8S A;  4IYP A;  4U7E B;  4YDY A;  4YVQ C;  2ION A;  2WPV A;  2H6F A;  4HB5 A;  4GA1 A;  4G24 A;  3B95 A;  3FTW A;  3JUE A;  5CRV A;  3FTV A;  3G2V A;  1MYO A;  3ZNG A;  3LY9 A;  3FTZ A;  2XZD G;  2YHC A;  3APD A;  1HG2 A;  2KCK A;  5KJK A;  3BG0 B;  3JCK C;  5KNH D;  1UJJ A;  3CHO A;  3PRE A;  4B93 B;  2AXZ A;  5H7P A;  1UOH A;  3CKC A;  3ZN3 A;  4CRW A;  1SZA A;  3IBE A;  3ZYM A;  3ONK A;  1O1T A;  1E8W A;  2B6C A;  3SFZ A;  2XZT G;  4JVS A;  1TN6 A;  4DUI A;  3FU0 A;  1D8D A;  2DVW A;  4I2W A;  3DPD A;  4EBA A;  2J07 A;  1YA0 A;  4RSY A;  3UIN C;  3UMV A;  4HRN A;  5FQ4 A;  3AG1 E;  2AW6 A;  2MYO A;  1P5Q A;  4C0M A;  2I9C A;  2IQC A;  2VSY A;  2EIK E;  1L5J A;  3HG0 D;  2XGO A;  2DZO A;  2LAH A;  2XHE A;  1E7V A;  4HOU A;  3UXG A;  3QDN A;  5FZQ A;  2V4L A;  2GRO B;  4EHM A;  5CER B;  3BUA A;  3L22 A;  1MX2 A;  4BX8 A;  3TXM A;  3KS2 A;  3ABL E;  5C1D A;  2H6H A;  1NL4 A;  4XX5 A;  5EYP F;  2P58 C;  1FVH A;  2XRY A;  2XEN A;  4U8Y D;  3MKQ A;  2WXQ A;  2DYS E;  3B7R L;  2WXL A;  2WXN A;  2XRZ A;  5CED B;  3Q4A B;  2BUG A;  1JUQ A;  1X5B A;  3ASO E;  4KVM A;  4BY6 A;  1HZ4 A;  2Y1L E;  5G55 A;  5HQ8 A;  2X6H A;  2DWZ A;  2L0T B;  4GMJ A;  5IY5 E;  4M7C A;  4JHJ A;  2WVI A;  1U2V G;  3TWV A; 
#chains in the Genus database with same CATH homology
 5CCM A;  5KJN A;  3RIB A;  3LXU X;  4WUY A;  3KD7 A;  2VJ8 A;  2X38 A;  3D9K A;  3PRZ A;  4UWG A;  4YND A;  3OXF A;  1H6K A;  3KEZ A;  2V0P A;  2LSV A;  4RG6 A;  1OWO A;  3LEW A;  3IKO B;  2E2E A;  4NAC A;  1FVF A;  1QQE A;  3SBT B;  3TG4 A;  2I1K A;  4DLO A;  1H2T C;  2IFU A;  3CVW A;  1NA0 A;  4N2Q A;  5DIZ A;  3OXL A;  3SGH A;  1DNP A;  4I9C A;  3S7B A;  3Q5M A;  3AS4 A;  3U9W A;  2VTB B;  2PZI A;  4I6G A;  3UT7 A;  2VYI A;  4L1B A;  5EKQ D;  5D0O D;  3MGB A;  4MS6 A;  3JQ0 A;  3D9M A;  3D9L A;  5G05 J;  3ZRH A;  3CVV A;  3O4Z A;  3QNK A;  3RO3 A;  2J08 A;  4UI9 K;  3G2S A;  4FC8 A;  1EPU A;  4GZD A;  4KZ0 A;  3QB2 A;  3CK9 A;  4F1S A;  1WAO 1;  2WQ6 A;  3BEE A;  4JHR A;  4U8H A;  4GU5 A;  5A7D B;  2LSU A;  3ZGQ A;  3CVN A;  4ILI A;  3IEG A;  3G2U A;  2UWJ G;  4UWL A;  4E6H A;  4I2Z A;  4TV3 A;  4N39 A;  4HLE A;  2Q7F A;  4U0Z A;  3S7F A;  3SNX A;  5LCW C;  3SF4 A;  1OWN A;  1EF1 C;  4LCT A;  1ELR A;  3FH5 A;  2WQ7 A;  3HYM B;  3LPZ A;  1ELK A;  3LYA A;  3U4T A;  4CDR A;  4J8F A;  4V3I A;  1H2V C;  2QFC A;  3ENE A;  3TG5 A;  2HR2 A;  1A17 A;  4Q94 A;  3EHM A;  2L6J A;  3GZS A;  5JJ7 A;  4JL0 A;  2FI7 A;  3PZD A;  2E0I A;  3S2A A;  4AM9 A;  3ZHE A;  5AEN A;  3LVR E;  3ZYK A;  4NQ0 A;  4B89 A;  2YHE A;  3UUX A;  4I1A A;  3CSF A;  3B7U X;  4GZC A;  1PAQ A;  3QOU A;  1IQR A;  2XPI A;  3UT4 A;  2WB2 A;  3ESK A;  3S7D A;  1UW4 B;  3QKY A;  4UWK A;  2PL2 A;  4A1S A;  2RG8 A;  3L54 A;  1Y8M A;  4H7X A;  1QNF A;  3CR3 A;  1SQM A;  2KCL A;  1HX8 A;  4J6I A;  5FQ8 A;  2WXM A;  2J9Q A;  4FU3 A;  4JA9 A;  3EJN A;  1Y6I A;  3MA5 A;  3PEU B;  1JWF A;  2NXP A;  3Q15 A;  4I43 A;  1HFA A;  4KYO B;  5ANR A;  5ARF A;  3CVX A;  5LCW J;  3ZYL A;  1EYH A;  1MQS A;  1H0A A;  4N3A A;  3LKU A;  3ULQ A;  2DIW A;  4O6F A;  3MZL B;  2AWI A;  4LRZ A;  3E4B A;  3N71 A;  3HHM A;  4I6J A;  4CT4 A;  5AJL A;  3OAW A;  2VGX B;  3ESL A;  2KZT B;  4L23 A;  3Q47 B;  4U0S A;  2IF4 A;  5LOZ A;  3PE4 A;  5EDS A;  4K0R A;  2I1J A;  4IN3 B;  4GYY A;  3LVQ E;  1HF8 A;  1H19 A;  3SZ7 A;  1TJF A;  4Q96 A;  4J8E A;  2KCV A;  3JQ1 A;  5DBK A;  3FWV A;  4HVB A;  2RD0 A;  5M72 A;  2AXV A;  5BW8 C;  4OYS A;  1OWP A;  3UPV A;  5AIJ A;  2PQN A;  1FCH A;  1HXI A;  3FUH A;  5A6C A;  3P2B A;  4APO A;  5ANL A;  3QWW A;  3L16 A;  4GYW A;  2YNQ A;  4ACL A;  1KT0 A;  4FUL A;  1S0P A;  4J0U A;  3CK8 A;  3IV0 A;  4ANX A;  2LAI A;  4U04 A;  2WXR A;  3O48 A;  1VDY A;  3CKB A;  5E75 A;  3C98 A;  4JEU A;  2Y4U A;  2AXU A;  2DCP A;  2J4B A;  4UWF A;  1NA3 A;  4XE0 A;  3D9P A;  3CST A;  2XCC A;  2BF0 X;  4DI3 A;  4CDM A;  4CT0 A;  3I5P A;  2EQX A;  2IOS A;  2FO7 A;  3CEQ A;  1IHG A;  1DVP A;  3ZW3 A;  3FTU A;  3EDT B;  4DK5 A;  3APF A;  3MYV A;  3EIJ A;  4WWP A;  3NZU A;  3CQC B;  4WWO A;  1UG3 A;  3B7T A;  3RRM B;  3DBS A;  2AVP A;  5BPP A;  4AOF A;  2JLB A;  4DJA A;  2V5F A;  4AY5 A;  2CHW A;  1GW6 A;  4JXT A;  4WNG A;  1ZBP A;  2C0L A;  4QFV A;  3FTS A;  1TEZ A;  3LY8 A;  4ANV A;  2X6J A;  2WXF A;  4GYO A;  4ANU A;  5FTP A;  4PUC A;  3R7Q A;  3RK6 A;  1Z3X A;  4IUL A;  1E8Z A;  3B7S A;  4KMO A;  3GZ1 A;  3K9I A;  3VLF A;  4EQF A;  4B8C B;  3D9J A;  4JZY A;  3FUI A;  3PNT B;  5BV0 A;  3MV2 B;  1OUV A;  4HOT A;  3RRN B;  1BPO A;  2OND A;  1N54 A;  3FUD A;  2C0M A;  1IQU A;  3QC1 A;  5BT1 A;  4L2L A;  1OWL A;  1ELW A;  3FU5 A;  3FUF A;  3UT8 A;  4EEC A;  1B89 A;  3APC A;  4AXH A;  2MOW A;  2WM9 A;  3PNL B;  4E85 A;  3PEV B;  2GRL A;  3LDZ A;  4H7Y A;  3I4G A;  4GCN A;  4PH4 B;  1PC2 A;  2BTD A;  1JWG A;  3TGO A;  4JW1 A;  3R9A B;  2CG3 A;  4CGW A;  2CFZ A;  4BWR A;  2GRM A;  2HYZ A;  2VSO E;  3CHQ A;  3AU4 A;  3FUE A;  3ZIM A;  2OVB A;  1JPL A;  4ILG A;  1HG5 A;  2DBA A;  3CHM A;  3P1U A;  3PH0 C;  3ZPJ A;  4AP2 A;  3ZFW A;  2GGF A;  3ASD A;  2R5S A;  4BT9 A;  3NQP A;  4LUN U;  3BG1 B;  3I3N A;  2YQ8 A;  3CHS A;  3QWP A;  3SD5 A;  4F53 A;  2IU1 A;  3CQG B;  3ML8 A;  3PUK A;  4UQZ A;  5G05 C;  4R7L A;  4XI0 A;  2VGX A;  3ASG A;  4M3O A;  4RG9 A;  4WWN A;  2KM4 A;  5FT9 A;  3S7J A;  4BFR A;  2V8S E;  3MJW A;  4FHJ A;  1W3B A;  3OTN A;  4AIF A;  4I1M A;  5BV1 A;  2IOL A;  1XNF A;  5T4Y A;  3FUM A;  3ASH A;  3FDH A;  4OVU A;  4ABN A;  2MHK A;  3CVL A;  3TXN A;  4WNF A;  4Y6C A;  2FF4 A;  2XCB A;  4UQY A;  3GW4 A;  3QAR A;  4FAD A;  1NZN A;  3HVE B;  5LFA A;  3CGH A;  3PDN A;  4AVX A;  2ZU6 B;  3LJ3 A;  4UQX A;  3AU5 A;  5T3R A;  1PY1 A;  3EHN A;  3MX3 A;  4G1T A;  4HOQ A;  4EBA G;  2CHZ A;  4KXK B;  3QAQ A;  3CHR A;  1E8Y A;  3GYZ A;  4AEZ C;  3CHP A;  1Z6T A;  3Q49 B;  3FUJ A;  2OVF A;  3VTX A;  3R7R A;  3LCA A;  4Y6W A;  5EX0 A;  4EZK A;  2R17 C;  2WMO A;  4GML A;  4I9E A;  3QJZ A;  3FEX A;  3ZHE B;  3OXG A;  4KT6 B;  2XQ0 A;  4N5C A;  3FH7 A;  4B8A A;  4DI4 A;  1HH8 A;  2Y3A A;  4BT8 A;  2QY7 A;  3CK7 A;  4HS2 A;  3D3M A;  2WQH A;  2WXO A;  4IRU A;  3T5X A;  5JJT A;  5CMY A;  4GA0 A;  4PS7 A;  5JJ6 A;  3L6A A;  1U3D A;  2XEV A;  3GZ2 A;  4FA6 A;  4MKT A;  3RJV A;  2C2L A;  2NSZ A;  4KBQ A;  5FJY A;  3FEY A;  3ML9 A;  4G23 A;  3VLE A;  2VTB A;  4A1G A;  2HO1 A;  1UJK A;  1WM5 A;  2FEZ A;  2XGS A;  4FJY A;  4F7A A;  3IHV A;  4HOS A;  4G11 A;  4U07 A;  3FH8 A;  1SZ9 A;  5KJL A;  4JPS A;  4ATG A;  3FU6 A;  4APF A;  4HXI A;  2X3M A;  4J8D A;  1E96 B;  4F3V A;  4J8S A;  4IYP A;  4L2Y A;  4B0Z A;  4CDN A;  5HI7 A;  4XI9 A;  5CCL A;  4N2S A;  4YVQ C;  3HIZ A;  3JUI A;  2ION A;  2WPV A;  4G2V A;  3FFL A;  5G04 J;  5J90 A;  3T8M A;  3D9O A;  2XGM A;  4U63 A;  4GA1 A;  4G24 A;  5KJM A;  2WXH A;  2WXP A;  2FUL A;  2J49 A;  4AJW A;  4ANW A;  3LS8 A;  3FTW A;  2LNI A;  3SBS A;  5CMW A;  4FLH A;  4URK A;  5BUZ A;  4CEM A;  1N52 A;  3FTV A;  1INZ A;  3G2V A;  4UI9 J;  4GA2 A;  3D9N A;  3EIQ C;  4CCA A;  4BX9 A;  3LY9 A;  2PM6 A;  3G2T A;  1HU3 A;  5ENN A;  4YVO A;  3FTZ A;  3FUK A;  2YHC A;  3APD A;  3IHY A;  3PUJ A;  1HE8 A;  1IYG A;  4DLQ A;  4I17 A;  4AV7 A;  3QWV A;  3U64 A;  4BTA A;  3CVP A;  3MV3 B;  1HG2 A;  2KCK A;  3RKV A;  3ASF A;  2NC9 A;  1HS6 A;  4L7T A;  2J09 A;  5KCM A;  3BG0 B;  4C0E A;  5KJK A;  3JCK C;  3B13 A;  1UJJ A;  4A3V A;  3CHO A;  4ACK A;  3SHF A;  3FUN A;  4XKC A;  4GB9 A;  2X6K A;  3PRE A;  2J4D A;  2VSN A;  2AXZ A;  4I6E A;  1E7U A;  2X6I A;  3CKC A;  2XPZ A;  3VLD A;  2UY1 A;  3ZN3 A;  1UN9 A;  5EX3 A;  3U66 A;  3MKR A;  4CRW A;  1SZA A;  3CV0 A;  3HVE A;  3IBE A;  3ONK A;  3ZYM A;  3TL5 A;  5FZR A;  4K03 A;  1E8W A;  4LER A;  5G2N A;  3L13 A;  4GZ3 A;  4HFG A;  4LEU A;  4FP7 A;  2R59 A;  2CFU A;  4XIF A;  3SFZ A;  4G25 A;  3PE3 A;  4JVS A;  5JHA A;  1TJC A;  3ZYQ A;  2IJG X;  3G2W A;  3FUL A;  2CG2 A;  3FU0 A;  4TUU A;  2I2O A;  4I2W A;  2KC7 A;  3DPD A;  5CHE E;  4BTB A;  4TRQ A;  5FWQ A;  4EBA A;  2J07 A;  3MCX A;  4EPZ A;  1YA0 A;  2VQ2 A;  4RSY A;  5E76 A;  1HO8 A;  3UMV A;  3TAX A;  2L9B A;  4RVB A;  2A5U A;  4UWH A;  2XPY A;  5FQ4 A;  3UX4 A;  4GAA A;  5G04 C;  2I6H A;  2AW6 A;  4A55 A;  4NUR A;  4EZL A;  4PS3 A;  1EDU A;  1P5Q A;  1U3C A;  4GPK A;  4FHK A;  1KT1 A;  2VSX E;  4JC8 A;  2I9C A;  2M63 A;  4C0M A;  3T5V A;  2IQC A;  4WND A;  2VSY A;  4U0U A;  3HDX A;  1KLX A;  4JHK A;  1L5J A;  4UI9 C;  3MKQ B;  4JA7 A;  4KVO A;  4EZJ A;  5ARG A;  4BSX A;  3U3W A;  5AYW D;  3PS6 A;  3URZ A;  1Z3Y A;  3NZS A;  3JYS A;  3CVQ A;  4C9B B;  2XGO A;  3ONL A;  3D9I A;  2LAH A;  2XHE A;  5FZS A;  2OV8 A;  3L08 A;  4D10 C;  1E7V A;  1E90 A;  2X6F A;  3FTY A;  4HOU A;  3RO2 A;  3ZXS A;  4AY6 A;  4A3T A;  5LP0 A;  3FHE A;  3FTX A;  3QDN A;  4G26 A;  1QZ2 A;  5FZQ A;  2V4L A;  4GZ5 A;  2GW1 A;  2UY1 B;  5FQ7 A;  4WAF A;  2PQR A;  3NF1 A;  4WNE A;  3L22 A;  2WXK A;  5LX8 A;  4BX8 A;  4HOR A;  3FP3 A;  4JEH A;  3KS2 A;  3TXM A;  3CVY A;  5C1D A;  5J08 A;  2ILR A;  4FLB A;  1ZU2 A;  4XX5 A;  3L17 A;  1OWM A;  1FVH A;  2KAT A;  2P58 C;  2XRY A;  4I1O B;  3TJP A;  2WMN A;  5FQ6 A;  3ZVV A;  2LO6 A;  4GCO A;  4GZ6 A;  3PVL A;  3AS5 A;  5BNW A;  3CVU A;  3SI5 A;  3MKQ A;  3WXX A;  4XKB A;  2WXQ A;  3RRU A;  2L0I A;  3KAE A;  4NRH B;  3RU0 A;  1H2U A;  3CIA A;  4N3B A;  3B7R L;  2WXL A;  2WXN A;  5AJD A;  2XRZ A;  3ZEF A;  3I4R B;  5C2Y A;  5D0Q D;  5A23 A;  5JHB A;  4PS8 A;  3Q4A B;  3VTY A;  2BUG A;  2JEK A;  3QK0 A;  1JUQ A;  3FY4 A;  1X5B A;  2PM7 A;  3CLJ A;  4FJZ A;  4ME2 A;  4PDX A;  2WXI A;  5T8I A;  4Q69 A;  2YIN A;  2A4Z A;  1E8X A;  4XZ4 A;  2WXG A;  3FU3 A;  4OVV A;  1NP7 A;  4KVM A;  2CHX A;  2HM8 A;  4W9R A;  4MLP A;  2Y4T A;  1UN8 A;  3LY7 A;  2OOE A;  4CGV A;  1LF8 A;  2WXJ A;  4KZC A;  4DPR A;  4P29 A;  2FBN A;  4BY6 A;  1XGW A;  2VGY A;  4B94 A;  1HZ4 A;  3UQ3 A;  3AS8 A;  3MEK A;  5G55 A;  5HQ8 A;  2X6H A;  2L0T B;  2MRI A;  1WY6 A;  4GMJ A;  4MRU A;  4JHJ A;  2WVI A;  4N3C A;  2KZT A;  4ILH B;  1MHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...