3D9JA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
137
structure length
137
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA-binding protein 16
total genus 56
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9jA00
1H0AA 1ELKA 2KM4A 2MOWA 3D9KA 3ONKA 4GZDA 1XGWA 1HFAA 3ZYQA 5LP0A 2V8SE 1HF8A 3D9PA 1VDYA 3LDZA 1HG5A 5J08A 2L0TB 1EYHA 1MHQA 1UJKA 4GZCA 3G2WA 3D9LA 4Q96A 2DCPA 5CMWA 4HFGA 1EDUA 1HX8A 1LF8A 2LO6A 3ZYLA 1INZA 2BF0X 3D9MA 1JPLA 1SZ9A 1SZAA 3D9IA 4FU3A 3G2TA 3G2VA 4FLBA 2DIWA 3CLJA 3D9OA 2QY7A 4JXTA 5CMYA 5LOZA 1DVPA 2L0IA 4NACA 1UJJA 1HG2A 1JWGA 4Q94A 1JUQA 3RRUA 1PY1A 3ONLA 4AVXA 3G2UA 1JWFA 3D9JA 3D9NA 1X5BA 3ZYMA 3G2SA 3ZYKA
chains in the Genus database with same CATH superfamily
3C3RA 4J8YA 2FBNA 1HG5A 5CCLA 2R59A 4BETA 2WXQA 1NA3A 2MYOA 4G8LA 1JWFA 3TG4A 4N2SA 3UUXA 4PS8A 5G04C 3CK8A 2X38A 2WXMA 4J6IA 1QZ2A 4FHJA 2X6FA 5B1BE 4FLBA 5BNWA 3UKRG 4HXIA 3IKOB 4BT9A 2XPYA 2YHEA 4CT4A 3AG1E 4BERA 2KM4A 4JPSA 4NRHB 4CCAA 3S7BA 5JHBA 3U4TA 3LYAA 3CHRA 3KS2A 4BESA 3ESLA 2WXOA 3Q9UC 4I6EA 4FLHA 5FQ6A 1TNBA 3Q7AA 1N11A 5C1DA 2J08A 1FPPA 1UW4B 1KLXA 1LD8A 3TWWA 3OAWA 2HO1A 3FTSA 4AM9A 2LUHA 4LERA 4FADA 1V55E 4PUCA 3Q15A 3FUKA 1K1BA 3APFA 4EPZA 4J7WA 4GTTA 5KNGA 4GYYA 1OCZE 1HE8A 1K8KG 1AWCB 5BV0A 4L23A 3RRNB 3DXMG 2WB2A 1O1TA 3ASDA 2WXPA 3RO3A 3ULYA 2PNNA 1FT2A 5AQAA 3RRMB 3S7JA 2EQXA 4AV7A 3BU8A 4A55A 2JABA 1ZU2A 3LJ3A 2LAHA 2PZIA 4YDEA 4JHRA 5LOZA 4BY6A 3CIAA 4JHJA 3ASGA 4LUNU 2AWIA 2IJGX 1OUVA 3ABME 3L6AA 4JD2G 3OXLA 3FTYA 3LDZA 4NURA 1EF1C 2VSNA 4N2QA 1FCHA 3MEKA 3JQ0A 3ML9A 4RLYA 1D8DA 3HIZA 4TV3A 3SHFA 3ZW3A 4UWFA 3L82A 5FQ4A 3FTUA 3CVUA 3ZHEB 3CVVA 3FH7A 3HVEA 2IFUA 5H7PA 3DEPA 4KVOA 1NI1A 2Y1LE 2KATA 3BG0B 3WG7E 1YMPA 3PEVB 3CVNA 3D3MA 2DZOA 2FULA 3GZSA 2YINA 4Q69A 2FEZA 1N0RA 1N52A 2X6HA 3L08A 2CHWA 1WDYA 3SF4A 1HXIA 5CEDB 3U9WA 5JJTA 4FJZA 1EYHA 2A4ZA 1NFIE 2P9NG 3EJNA 1YYHA 3NOCD 1DNPA 4AJWA 5AYWD 3PZ4A 1OCOE 5HRYA 1N95A 5CHEE 3EHNA 1TR4A 4EBAA 4GAAA 2GRRB 1E8ZA 3I4RB 3LVRE 1K3ZD 4N39A 1H19A 3UTMA 4F1PA 3PUJA 4DX2A 1WM5A 2P9LG 3OXGA 3TWVA 3E37A 3EHQA 1O5MA 1FVFA 3KD7A 1U2VG 4GMRA 4PH4B 3DSUA 4JL0A 4BEPA 3AU4A 1YA0A 3TWXA 5KNHD 3ZVVA 1OWNA 5E76A 4FU3A 3QDNA 1GW6A 2A5UA 1IHGA 2P58C 2OVBA 4L9PA 3LXUX 3FU5A 3R9MA 1QYMA 4RSYA 1IQUA 3LY8A 1BLXB 4PS3A 3FP3A 4FC8A 4B89A 3SBSA 4Z68A 4J8EA 1TJFA 2I1JA 1Q2ZA 2GRPB 2OVFA 2XEVA 4GPKA 3CVXA 3FTZA 1NA0A 4KBQA 2V8SE 3D9HA 4A3VA 3HG0D 2OEWA 4APOA 3AS5A 5FT9A 3U66A 2A5EA 5EDSA 4GTQA 2B6CA 3FEXA 3QWWA 4XI9A 1KT1A 5ANRA 2XEHA 1U3CA 1WG0A 5HQ8A 5CBOA 4ILGA 5ENOD 4ANXA 4U0ZA 4DX1A 1WAO1 4B93B 2R5SA 3RIBA 5KBAA 3C72A 4U8HA 4XX5A 4JA7A 2P9PG 4LNGA 4B94A 4UWHA 5DIZA 1N4SA 2L6BA 3EIJA 3GZ1A 2I1KA 3IHVA 4FHKA 2VGYA 3CVWA 4A1GA 2ETCA 1LF8A 1N9AA 2UY1B 4K5AB 2PM7A 3G2TA 2AXVA 3KEAA 1JUQA 4C9BB 1W3BA 3T5XA 3ZYKA 2PM6A 2XCBA 3AG3E 2XGSA 3UI2A 4O60A 2VGXA 1QQEA 2Y4UA 3EIQC 4MKTA 2B0OE 3JXIA 2AXZA 4G26A 5AAOA 1IYGA 3U64A 5HI7A 4K03A 4GCOA 4N3BA 2WPVA 4GZDA 3MA5A 4YVQC 2VQ2A 4UUCA 3MCXA 3UKUG 4HI9A 4I1OB 1HS6A 4MRUA 4YVOA 4HORA 4HRMB 1TN8A 3PE3A 2V0PA 2P9UG 4CGVA 2RFMA 3EHMA 3CV0A 2VSOE 4F3VA 4HVBA 3ZRHA 4O6FA 4RQIA 2IF4A 3CHQA 3ZHEA 3K9IA 4GYWA 2H6IA 2Y69E 4XKBA 1OY3D 3D9NA 3DSVA 2ZXWE 5M72A 5ENNA 1ELKA 4PS7A 4OVUA 3SGHA 3LY7A 3E4BA 4GCNA 1AP7A 3HXDA 4OAVB 4ZHBA 1HU3A 4TXQA 3UQ3A 1SA5A 2HE0A 2LSVA 2DZNA 5KJNA 4BTBA 3CVLA 2RFAA 3ZXPA 4BSXA 1WY6A 3Q79A 1KZPA 4G24A 3VLDA 4EBAG 5C2YA 3D9PA 3IV0A 1S64A 3JUIA 1H2VC 4LSZE 4ANVA 3PS6A 4MLPA 4JW1A 1H6KA 3SY2A 4YDWA 4DJAA 1TNOA 2P9KG 4UQXA 3ASNE 5EKQD 2LSUA 4G8KA 4AVXA 1K1AA 5AQ7A 4EQFA 3ZPJA 3PEUB 3QB2A 1E96B 2MHKA 2WXJA 4JVSA 3TG5A 4CZ2D 3LCAA 5ITZF 4TUUA 1BI7B 3ML8A 3URZA 2J8SD 4C48B 2BTDA 2DYRE 4XEIG 4GZ3A 4O1PA 3RSEG 4XKCA 1JCQA 1E7VA 3CKBA 3DSSA 4AXHA 3B7RL 3FFLA 4I1AA 5LFAA 3DBSA 2EILE 3QKYA 2PQNA 4U63A 4HBDA 5AJLA 1BI8B 3FU3A 2F37A 3NF1A 5FZRA 5AARA 3P2BA 1UJKA 3F6QA 1PC2A 3V2OA 4DLOA 4D10C 2GW1A 1DC2A 4CDRA 3S7DA 4KT6B 1G3NB 2OOEA 3G2SA 3B7UX 2ONDA 3PZ2A 1Y6IA 4YDOA 3TWTA 2BUGA 1LTXA 3VLFA 4M7CA 1NZNA 1SQMA 3CHMA 2MRIA 2YNQA 3IBEA 2WMNA 2X6IA 4AY6A 1NL4A 5LCWC 2KZTB 3NB2A 4GTOA 4CT0A 3PE4A 3UM3A 2ZU6B 5ANLA 3OTNA 3CVPA 2FO7A 1PY1A 4E85A 2H6HA 3L22A 4GTSA 4LNUD 5D2MC 3I3NA 4U0SA 2WVIA 1ZBPA 3G2WA 1S63A 3CEQA 3FU0A 2ETAA 4UQZA 5FZSA 4GTMA 4B0ZA 1OWMA 4GYOA 5EIBE 3AU5A 5JHAA 3UM1A 1N54A 4K5CA 3FH5A 1SZ9A 3HYMB 4BX8A 3EDTB 1OCCE 2IOLA 3RKVA 4N5QA 2ZGGA 4A3TA 2GROB 4KZCA 3L9TA 3UMVA 1D8EA 4GZ5A 3JYSA 3AG4E 5KWDA 2KCKA 3PZ1A 3V2XA 5BPPA 1JPLA 3QWPA 3JCKC 4EECA 3TWSA 4MBGA 1X5BA 4AIFA 4JEHA 4HOUA 4IRUA 3T8KA 4KVMA 2CG2A 4WWNA 5ENRD 5BV1A 1IKND 3Q7FA 4HI8A 2F8XK 5E75A 4HLEA 3L17A 5ENQD 4I9CA 4DUIA 3FUMA 5LCWJ 5A7DB 1A5EA 4LNBA 5EIDA 4ZFHA 3QC1A 3SBTB 2DWZA 5EYLA 1BD8A 1INZA 2IU1A 2CHZA 3PNTB 3LPZA 4G11A 4WWOA 5G55A 3Q4AB 3KEZA 4TUMA 4EZKA 2FF4A 3V79K 1H0AA 2ZISA 3Q75A 4JC8A 5JJ6A 3AAAC 4J8DA 2IOSA 4L2YA 3UXGA 4F53A 5ENTD 2PL2A 5B1AE 3MV3B 4EHMA 3NAWA 4WNDA 5CMWA 2L6JA 2GRMA 3TXMA 3RU0A 3LJNA 1JCRA 1H2UA 5FQ8A 2R05A 1OT8A 3ZEFA 2EIME 3X2QE 5LX8A 2Y4TA 2KCLA 4OYSA 3BG1B 1QNFA 2QYUA 3FTWA 3FUDA 3IXEA 2XS8A 2DCPA 4HQDA 3Q49B 3PH0C 1IXVA 2LNIA 5ARGA 3QAQA 1UOHA 3JQ1A 3QK0A 3DSWA 1V54E 3B95A 3ZGQA 4HLLA 2L0TB 3MX3A 5FIOA 3ABKE 2IO3C 2IONA 3DPDA 1DCQA 4FA6A 3ASHA 2F8YA 3Q73A 3RRUA 3FUJA 4ILHB 5AIJA 5FWQA 4L7TA 2MOWA 4J0UA 3HRAA 4K0RA 4L2LA 2H6FA 3PZDA 1UN9A 3CHPA 3HXFA 3Q78A 3CK7A 1E8XA 2VGXB 3TXNA 2JLBA 2X6KA 4FJYA 2VTBB 3RK6A 4IN3B 4BFRA 2VSXE 4U96D 1ELWA 3PRZA 2J4DA 1LD7A 4UI9K 5J08A 3SFYA 4DPRA 4GZ6A 2E0IA 2WXLA 3PDNA 4WUYA 3V30A 3LVQE 4HB5A 3ZU7B 3FUNA 2LAIA 1TN7A 2L9BA 3DRAA 4C0MA 4I1MA 4G2VA 2J09A 1TNYA 4O1OA 2QFCA 3AJIA 1MQSA 3N71A 1MX6A 2XRYA 2IY0C 4XIFA 4M3OA 3D9LA 4Y6CA 2KXPC 4HFGA 5D0QD 2J07A 3QOUA 3ULEG 5AJDA 2NSZA 2VJ8A 3AS8A 3DSXA 3ISMC 2WXRA 4I2ZA 4I9EA 4XI0A 5BT1A 2J49A 2V4HC 3BUAA 1RZ4A 4DI3A 5BXOA 5CBNA 3TAXA 4E6HA 1E90A 5EX0A 3C3QA 2WM9A 1Y8MA 4UQYA 5CEAA 3SD5A 4BT8A 4HOQA 2JEKA 2OV8A 2XENA 4BSZB 5FINA 4UWKA 1SA4A 3ESKA 4W9RA 1SZAA 4NQ0A 4BX9A 3ONLA 4DI4A 2IEJA 2P2CP 3CVQA 4HRLA 4LRZA 4YNDA 3ZFWA 3JUEA 3U3WA 3AG2E 4TRQA 2PQRA 4TXPA 3T5VA 1H2TC 3CLJA 3BQOA 4DX5D 3UIOC 4QFVA 5AQBA 3TL5A 3E33A 3W9FA 4CRWA 2E2EA 3B7BA 5KJMA 1DCEA 5AENA 1SVXA 3D9KA 5A23A 3CVYA 4GTRA 1S70B 4WNFA 5A6CA 2P9SG 4HOSA 3LS8A 2WXHA 1MYOA 1OWOA 2NXPA 3APCA 4AEZC 3CQGB 3PNLB 3DPYA 5AQ9A 1BU9A 4QQIA 3O4ZA 4UI9C 4HNAD 1N4RA 4JHKA 1HF8A 3MV2B 5D0OD 3FUEA 3D9MA 2UY1A 3D9IA 3CHSA 5EILA 4JXTA 2XCCA 3I4GA 1XNFA 4H7XA 4OAUC 3SO8A 5LP0A 3KAEA 1HX8A 4AOFA 4ME2A 2CFUA 2CG3A 3T9KA 3RJVA 3SQVA 4B8CB 3NZSA 1O1RA 4NACA 4V3IA 3R7QA 3NOGD 1HFAA 1OWLA 2V5FA 4P29A 2WXKA 3R9AB 4U8VD 4G1TA 2V4LA 3P1UA 1H6OA 3FU6A 4GMLA 5EN5D 3D9JA 3VTYA 5ENSD 4WAFA 1P5QA 3HXCA 4IULA 2XS1A 4Q96A 1MHQA 4GZCA 4L1BA 5JJ7A 2IQCA 3RAUA 3IHYA 4DX6D 4MS6A 3CSTA 2RKKA 3QWVA 3PZ3A 3QNKA 4FP7A 3IEGA 4JZYA 1UN8A 3T8MA 1A17A 1E7UA 3BEEA 3FDHA 3TWQA 4F6RD 4RG9A 2AJAA 2L0IA 5T4YA 4U0UA 3HDXA 4N3AA 5BUZA 2DYSE 3PVLA 2HYZA 4KMOA 4B8AA 4LG6A 2IO2C 3LY9A 4JA9A 1HG2A 2C0LA 3CHOA 1MX2A 3DEOA 3DSTA 2VSYA 3CQCB 3J5PA 3ENEA 5CERB 1IQRA 3L13A 3FUHA 3QJZA 2XHEA 4G25A 3ZKJA 4H7YA 5EX3A 2C0MA 4I2WA 3VLEA 1L5JA 3C3OA 4DX7D 2YHCA 5ENPD 3O48A 3VTXA 4ABNA 4U95D 3ASOE 2XZDG 4AY5A 2XEEA 4KZ0A 2AW6A 4ATZD 1UG3A 4CGWA 3ZXSA 3UINC 4LCTA 3ABLE 2X3MA 5T8IA 2Y0BG 3FUFA 5G2NA 4I17A 2QYJA 4DK5A 3E34A 1BPOA 3GZ2A 3FY4A 1N94A 4U7EB 4I43A 1TJCA 4N5CA 1U3DA 4ANUA 3WXXA 2WXIA 2GRNB 4X8QA 2XZTG 1Z6TA 3UX4A 2GRLA 2KBXA 3JXJA 4TXRA 4DRXE 3LKUA 1KPSB 4EZJA 3UM0A 1Z5SC 3L16A 1TEZA 1OWPA 5HKPA 1N4QA 2H6GA 3KSQA 4ACLA 2DIWA 2M63A 4KXKB 4GTVA 4J8FA 4U07A 4A63B 4URKA 2DBAA 2C2LA 3ZNGA 1Z3XA 2WQ7A 3HXBA 4YDYA 2XGOA 2LO6A 3EU9A 3ULQA 3UT4A 4J8SA 2I9CA 2RG8A 3ZYMA 2YQ8A 4GA1A 2FO1E 1TNZA 4IYPA 3FTVA 4G23A 3OXFA 4F7AA 4GA2A 2KC7A 1FT1A 1IHBA 4EZLA 3UT8A 3NZUA 4XZ4A 5FQ7A 3D9OA 3CK9A 3GW4A 3ZUVB 2X6JA 3UIPC 3NBNB 2DVWA 2I6HA 5EYPF 4BTAA 3E32A 3DWLG 2P9IG 2Y3AA 4UWLA 3AS4A 5CMYA 4Q94A 1UJJA 2VYIA 3Q5MA 2ZIRA 1RW2A 4APFA 3ONKA 3SNXA 2XRZA 1JCSA 5BW8C 1OXJA 3SFZA 5JA4D 3CKCA 3KSLA 1ZB1A 3MKQB 3MYVA 1DVPA 2UWJG 2I2OA 3EU5A 3NQPA 4HS2A 3B13A 3FHEA 5KJKA 1HO8A 5KJLA 2QZAA 4RVBA 4BWRA 2R02A 3B7TA 4CDMA 3TWRA 1MJ0A 5G05C 2LXLA 3J5QB 5AN8A 2WQ6A 4RG6A 3SI5A 1TN6A 2KCVA 3PUKA 1ELRA 5BXUA 4HRNA 1N4PA 3FTXA 1HH8A 2FI7A 4OVVA 1OCRE 4K5BA 1KZOA 1MZCA 1D9SA 4CDNA 3ASFA 4UWGA 4Y6WA 2BF0X 3W9GA 3G2VA 2QC9A 5B3SE 3UPVA 2BEDA 2EIKE 1N0QA 2RD0A 4F1SA 4JB8P 3ZN3A 1Z3YA 5JMND 3MKRA 3CSFA 2ETBA 2BKGA 4R7LA 1X81A 3ZIMA 2OEVA 3UT7A 2XQ0A 4GU5A 2XPIA 4WNEA 4UI9J 1H6PA 3SFXA 4GB9A 5FTPA 1O1SA 4AP2A 3MKQA 3MJWA 3QARA 2R2LA 4LEUA 3APDA 5CRVA 4ILIA 1EDUA 3EHRA 2XGMA 1S0PA 4ANWA 4I6JA 4ACKA 1SW6A 1QBQA 1MX4A 3MZLB 1JWGA 3PREA 4GA0A 3UM2A 2Q7FA 3G2UA 2VGEA 1PAQA 4WWPA 1E8YA 4WNGA 2GRQB 4N3CA 4XE0A 4A1SA 2ZGDA 1YCSB 2AVPA 3MGBA 4FULA 1TNUA 2VTBA 3CR3A 5T3RA 2F0YA 5IY5E 2XPZA 3TGOA 3S2AA 3DXKG 5G04J 2WXNA 2LXMA 5KCMA 3TJPA 5HS0A 5G05J 5FZQA 3LEWA 4C0EA 3FULA 2OCCE 2WXFA 2WXGA 4GMJA 2EIJE 1B89A 5ARFA 2ILRA 2WQHA 3E30A 3R7RA 2GGFA 2BKKB 2NYJA 2HM8A 4ATGA 2R03A 4KYOB 2NC9A 4CYMD 4GPMA 3FH8A 3TWUA 2CFZA 3B7SA 3CGHA 5FJYA 5DBKA 3HVEB 2R17C 4GTPA 3HXEA 3SZ7A 4I6GA 2QY7A 1NP7A 4PDXA 1TYQG 3C5RA 5J90A 1EPUA 5D66A 1XGWA 5CRUA 2WMOA 3S7FA 2KZTA 3L54A 3ZYLA 3V31A 4HOTA 2AXUA 4U04A 1FVHA 3HHMA 5CECB 3EUVA 4CEMA 3ZYQA 2J9QA 2J4BA 4NIKA 4DLQA 1VDYA 3Q47B 3FEYA 2EINE 2CHXA 1KT0A 1E8WA 2HR2A 1HZ4A 2V5QC 3FWVA 3I5PA 3RO2A 4JEUA 4U8YD 3C98A 3Q9NC 3FUIA 3GYZA 5CCMA
chains in the Genus database with same CATH topology
2X3MA 5HI7A 4K03A 5T8IA 4GCOA 4N3BA 2FBNA 2WPVA 4GZDA 3MA5A 3ZGQA 3FUFA 4YVQC 2VQ2A 1HG5A 5CCLA 2L0TB 3MX3A 5G2NA 3MCXA 4I17A 4I1OB 1HS6A 4DK5A 2R59A 2IONA 1BPOA 3GZ2A 3DPDA 2WXQA 3FY4A 4FA6A 4MRUA 3ASHA 1NA3A 4I43A 3RRUA 4YVOA 3FUJA 4HORA 1TJCA 4ILHB 1JWFA 5AIJA 3TG4A 4N2SA 3UUXA 3PE3A 4PS8A 5FWQA 2V0PA 4N5CA 4L7TA 1U3DA 2MOWA 3CK8A 4J0UA 5G04C 4ANUA 2X38A 4K0RA 4L2LA 3WXXA 4CGVA 3PZDA 2WXIA 3EHMA 1UN9A 2WXMA 3CHPA 3CV0A 2VSOE 4J6IA 3CK7A 1E8XA 1QZ2A 2VGXB 3ZRHA 4F3VA 4O6FA 4FHJA 2JLBA 3TXNA 4HVBA 1Z6TA 2X6KA 2IF4A 4FJYA 2VTBB 3CHQA 3RK6A 2X6FA 4IN3B 3K9IA 4FLBA 3UX4A 2VSXE 2GRLA 4GYWA 3ZHEA 4BFRA 4HXIA 5BNWA 3IKOB 4XKBA 4BT9A 2XPYA 2YHEA 3D9NA 4CT4A 1ELWA 3LKUA 3PRZA 2J4DA 4EZJA 5M72A 5ENNA 1ELKA 4PS7A 2KM4A 4JPSA 4NRHB 4OVUA 4UI9K 3LY7A 3SGHA 4CCAA 3E4BA 4GCNA 3S7BA 5JHBA 3L16A 5J08A 1TEZA 1OWPA 3U4TA 3LYAA 4DPRA 3CHRA 4GZ6A 2E0IA 2WXLA 3PDNA 1HU3A 4WUYA 3UQ3A 3LVQE 4ACLA 3KS2A 3ESLA 2LSVA 2WXOA 2DIWA 4BTBA 5KJNA 3CVLA 2M63A 3FUNA 4KXKB 4J8FA 2LAIA 1WY6A 4BSXA 4U07A 2L9BA 4I6EA 4FLHA 4URKA 4C0MA 4I1MA 4G2VA 4G24A 3VLDA 2J09A 5FQ6A 2DBAA 2C2LA 2QFCA 1MQSA 1Z3XA 2WQ7A 4EBAG 5C2YA 3D9PA 3N71A 5C1DA 2XRYA 3IV0A 2J08A 1UW4B 4XIFA 4M3OA 1KLXA 3D9LA 3JUIA 4Y6CA 4HFGA 1H2VC 4ANVA 2XGOA 2LO6A 5D0QD 3PS6A 4MLPA 4JW1A 1H6KA 3OAWA 2HO1A 4DJAA 2J07A 3QOUA 3ULQA 3FTSA 3UT4A 4UQXA 4J8SA 5EKQD 4AM9A 4FADA 2I9CA 4LERA 2LSUA 5AJDA 2NSZA 4AVXA 4PUCA 2VJ8A 3AS8A 2RG8A 3Q15A 3FUKA 3ZYMA 2YQ8A 3APFA 4GA1A 4EQFA 3ZPJA 3PEUB 2WXRA 4EPZA 4I2ZA 3QB2A 4I9EA 3FTVA 1E96B 2MHKA 2J49A 3OXFA 4G23A 4IYPA 4XI0A 4GA2A 4F7AA 2KC7A 5BT1A 2WXJA 4JVSA 4GYYA 3TG5A 4DI3A 3LCAA 4EZLA 1HE8A 4TUUA 3UT8A 3ML8A 3NZUA 4XZ4A 5FQ7A 3TAXA 5BV0A 4E6HA 1E90A 4L23A 3URZA 5EX0A 3RRNB 3D9OA 3CK9A 3GW4A 2BTDA 2WB2A 2X6JA 3ASDA 2WM9A 2WXPA 3RO3A 1Y8MA 2I6HA 4UQYA 3RRMB 3S7JA 3SD5A 4BT8A 2EQXA 4AV7A 4BTAA 4GZ3A 4HOQA 4A55A 2JEKA 2OV8A 1E7VA 4XKCA 3CKBA 4UWKA 3ESKA 4AXHA 2Y3AA 3B7RL 1ZU2A 3LJ3A 4W9RA 2LAHA 1SZAA 2PZIA 3FFLA 4UWLA 4I1AA 3AS4A 4JHRA 5LFAA 5LOZA 3DBSA 3QKYA 5CMYA 4BY6A 4NQ0A 3CIAA 4JHJA 1UJJA 2VYIA 4Q94A 4BX9A 2PQNA 3ASGA 3ONLA 4LUNU 2AWIA 4U63A 5AJLA 3Q5MA 2IJGX 4DI4A 3FU3A 3NF1A 4APFA 1OUVA 3CVQA 3L6AA 3ONKA 5FZRA 3SNXA 4LRZA 2XRZA 4YNDA 3OXLA 3FTYA 3LDZA 4NURA 1EF1C 3ZFWA 5BW8C 3P2BA 1UJKA 3SFZA 2VSNA 1PC2A 3U3WA 4N2QA 1FCHA 3MEKA 3JQ0A 3ML9A 4DLOA 4D10C 3CKCA 2GW1A 3HIZA 4TV3A 4TRQA 3MKQB 3SHFA 4UWFA 3ZW3A 2PQRA 4CDRA 3MYVA 5FQ4A 3FTUA 3S7DA 1H2TC 3CLJA 3T5VA 3ZHEB 3CVVA 3CVUA 3FH7A 4KT6B 1DVPA 2UWJG 4QFVA 2I2OA 3NQPA 3TL5A 4CRWA 3HVEA 4HS2A 2IFUA 3B13A 2OOEA 2E2EA 3FHEA 3G2SA 5KJMA 4KVOA 5KJKA 1HO8A 5AENA 3B7UX 5A23A 3D9KA 3CVYA 5KJLA 2ONDA 4RVBA 4BWRA 3B7TA 2KATA 4WNFA 4CDMA 1Y6IA 5A6CA 3BG0B 5G05C 3PEVB 2WQ6A 3CVNA 3D3MA 4HOSA 3LS8A 4RG6A 2FULA 3GZSA 2YINA 2BUGA 4Q69A 2WXHA 3SI5A 2KCVA 2FEZA 3VLFA 1OWOA 3PUKA 1ELRA 2NXPA 3APCA 4AEZC 3CQGB 3PNLB 1NZNA 1N52A 2X6HA 1SQMA 3L08A 3FTXA 1HH8A 2CHWA 2FI7A 4OVVA 3O4ZA 3CHMA 4UI9C 3SF4A 2MRIA 2YNQA 4JHKA 3IBEA 1HXIA 1HF8A 4CDNA 3U9WA 2WMNA 5JJTA 2X6IA 4FJZA 1EYHA 4AY6A 2A4ZA 3ASFA 3MV2B 5LCWC 2KZTB 3EJNA 5D0OD 3FUEA 1DNPA 4UWGA 4Y6WA 4AJWA 4CT0A 2BF0X 3D9MA 5AYWD 2UY1A 3D9IA 3PE4A 2ZU6B 3G2VA 3OTNA 3CHSA 5ANLA 4JXTA 2XCCA 3CVPA 5CHEE 3I4GA 3UPVA 2FO7A 1PY1A 4E85A 3EHNA 4EBAA 4GAAA 3L22A 2RD0A 1XNFA 4F1SA 4H7XA 3ZN3A 1Z3YA 1E8ZA 3I4RB 3MKRA 3CSFA 5LP0A 3I3NA 3LVRE 4U0SA 2WVIA 4N39A 1H19A 1ZBPA 3G2WA 4R7LA 3KAEA 1HX8A 3CEQA 3ZIMA 3PUJA 4AOFA 4ME2A 2CFUA 1WM5A 2CG3A 3RJVA 3OXGA 3FU0A 3UT7A 2XQ0A 4GU5A 4B8CB 3NZSA 2XPIA 4WNEA 4UQZA 5FZSA 4NACA 4V3IA 4UI9J 1FVFA 4GB9A 3KD7A 5FTPA 3R7QA 4B0ZA 1OWMA 4GYOA 4PH4B 4AP2A 3AU5A 3MKQA 3MJWA 3QARA 1HFAA 5JHAA 4JL0A 3AU4A 4LEUA 3APDA 1OWLA 1YA0A 2V5FA 2WXKA 4P29A 3R9AB 1N54A 4ILIA 1EDUA 4G1TA 3ZVVA 2V4LA 2XGMA 3FH5A 3P1UA 1OWNA 1S0PA 1SZ9A 4ANWA 3HYMB 5E76A 4I6JA 4ACKA 4FU3A 3QDNA 4BX8A 3EDTB 1GW6A 3MZLB 1JWGA 2IOLA 3PREA 4GA0A 3FU6A 3RKVA 4GMLA 2Q7FA 3G2UA 3D9JA 2A5UA 1IHGA 2P58C 3VTYA 4A3TA 2OVBA 1PAQA 4WAFA 1P5QA 4KZCA 4WWPA 1E8YA 3LXUX 3FU5A 4WNGA 4IULA 3UMVA 4GZ5A 3JYSA 4N3CA 4RSYA 1IQUA 4Q96A 1MHQA 4GZCA 4XE0A 3LY8A 4A1SA 2KCKA 4L1BA 4PS3A 3FP3A 4FC8A 4B89A 5JJ7A 2AVPA 3MGBA 3SBSA 2IQCA 5BPPA 4FULA 4J8EA 1JPLA 2VTBA 1TJFA 3CR3A 3JCKC 3QWPA 2I1JA 4EECA 5T3RA 3IHYA 2OVFA 4MS6A 2XEVA 2XPZA 3S2AA 3TGOA 3CVXA 4GPKA 3CSTA 3FTZA 5G04J 3QWVA 3QNKA 1X5BA 2WXNA 3IEGA 4FP7A 4JZYA 4AIFA 4JEHA 1UN8A 5KCMA 4HOUA 4IRUA 3TJPA 3T8MA 4KVMA 1NA0A 1A17A 2V8SE 4KBQA 5FZQA 5G05J 1E7UA 2CG2A 3BEEA 3FDHA 3LEWA 4A3VA 4WWNA 4APOA 3AS5A 4C0EA 5BV1A 3FULA 5FT9A 2WXFA 3U66A 5EDSA 2WXGA 4GMJA 4RG9A 1B89A 2L0IA 5T4YA 4U0UA 5ARFA 3FEXA 2ILRA 2WQHA 3QWWA 5E75A 4HLEA 3L17A 4XI9A 1KT1A 3R7RA 4I9CA 5ANRA 2GGFA 2HM8A 3HDXA 4ATGA 1U3CA 3FUMA 4KYOB 4N3AA 5BUZA 5LCWJ 2NC9A 5A7DB 5HQ8A 3PVLA 4ILGA 3QC1A 4ANXA 3SBTB 2HYZA 4KMOA 4B8AA 3FH8A 4U0ZA 2CFZA 3B7SA 3CGHA 5FJYA 1WAO1 5DBKA 3HVEB 1INZA 2R5SA 2R17C 3RIBA 2IU1A 3LY9A 2CHZA 3PNTB 3LPZA 4G11A 3SZ7A 4I6GA 4JA9A 4WWOA 2QY7A 1NP7A 5G55A 3Q4AB 3KEZA 1HG2A 4JA7A 4U8HA 4XX5A 2C0LA 3CHOA 4EZKA 4B94A 4PDXA 2FF4A 4UWHA 5DIZA 5J90A 1EPUA 1H0AA 4JC8A 5JJ6A 3EIJA 4J8DA 1XGWA 2IOSA 2VSYA 4L2YA 3GZ1A 2I1KA 4F53A 2PL2A 2WMOA 3CQCB 3IHVA 4FHKA 2VGYA 1IQRA 3ENEA 3MV3B 4WNDA 4A1GA 3S7FA 2KZTA 5CMWA 3L54A 1LF8A 2L6JA 3CVWA 3ZYLA 2GRMA 3L13A 3FUHA 3TXMA 2UY1B 3RU0A 2PM7A 3G2TA 2XHEA 3QJZA 4HOTA 4G25A 1H2UA 5FQ8A 2AXUA 2AXVA 4H7YA 4U04A 1JUQA 4C9BB 3ZEFA 1W3BA 5EX3A 3T5XA 1FVHA 2C0MA 4I2WA 2Y4TA 3ZYKA 5LX8A 2PM6A 2KCLA 2XCBA 3HHMA 4OYSA 3VLEA 1L5JA 3BG1B 1QNFA 3ZYQA 2XGSA 2J9QA 4CEMA 2J4BA 2YHCA 3FTWA 1VDYA 3FUDA 3O48A 3Q47B 3VTXA 4DLQA 2VGXA 2DCPA 3FEYA 1QQEA 2CHXA 2Y4UA 1KT0A 3Q49B 1E8WA 4ABNA 2HR2A 3PH0C 3EIQC 1HZ4A 2LNIA 3FWVA 5ARGA 4MKTA 4AY5A 3I5PA 4KZ0A 3RO2A 2AXZA 3QAQA 4G26A 2AW6A 4JEUA 1UG3A 3JQ1A 3C98A 4CGWA 1IYGA 3FUIA 3U64A 3ZXSA 3GYZA 4LCTA 3QK0A 5CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0A A;  1ELK A;  2KM4 A;  2MOW A;  3D9K A;  3ONK A;  4GZD A;  1XGW A;  1HFA A;  3ZYQ A;  5LP0 A;  2V8S E;  1HF8 A;  3D9P A;  1VDY A;  3LDZ A;  1HG5 A;  5J08 A;  2L0T B;  1EYH A;  1MHQ A;  1UJK A;  4GZC A;  3G2W A;  3D9L A;  4Q96 A;  2DCP A;  5CMW A;  4HFG A;  1EDU A;  1HX8 A;  1LF8 A;  2LO6 A;  3ZYL A;  1INZ A;  2BF0 X;  3D9M A;  1JPL A;  1SZ9 A;  1SZA A;  3D9I A;  4FU3 A;  3G2T A;  3G2V A;  4FLB A;  2DIW A;  3CLJ A;  3D9O A;  2QY7 A;  4JXT A;  5CMY A;  5LOZ A;  1DVP A;  2L0I A;  4NAC A;  1UJJ A;  1HG2 A;  1JWG A;  4Q94 A;  1JUQ A;  3RRU A;  1PY1 A;  3ONL A;  4AVX A;  3G2U A;  1JWF A;  3D9J A;  3D9N A;  1X5B A;  3ZYM A;  3G2S A;  3ZYK A; 
#chains in the Genus database with same CATH topology
 3C3R A;  4J8Y A;  2FBN A;  1HG5 A;  5CCL A;  2R59 A;  4BET A;  2WXQ A;  1NA3 A;  2MYO A;  4G8L A;  1JWF A;  3TG4 A;  4N2S A;  3UUX A;  4PS8 A;  5G04 C;  3CK8 A;  2X38 A;  2WXM A;  4J6I A;  1QZ2 A;  4FHJ A;  2X6F A;  5B1B E;  4FLB A;  5BNW A;  3UKR G;  4HXI A;  3IKO B;  4BT9 A;  2XPY A;  2YHE A;  4CT4 A;  3AG1 E;  4BER A;  2KM4 A;  4JPS A;  4NRH B;  4CCA A;  3S7B A;  5JHB A;  3U4T A;  3LYA A;  3CHR A;  3KS2 A;  4BES A;  3ESL A;  2WXO A;  3Q9U C;  4I6E A;  4FLH A;  5FQ6 A;  1TNB A;  3Q7A A;  1N11 A;  5C1D A;  2J08 A;  1FPP A;  1UW4 B;  1KLX A;  1LD8 A;  3TWW A;  3OAW A;  2HO1 A;  3FTS A;  4AM9 A;  2LUH A;  4LER A;  4FAD A;  1V55 E;  4PUC A;  3Q15 A;  3FUK A;  1K1B A;  3APF A;  4EPZ A;  4J7W A;  4GTT A;  5KNG A;  4GYY A;  1OCZ E;  1HE8 A;  1K8K G;  1AWC B;  5BV0 A;  4L23 A;  3RRN B;  3DXM G;  2WB2 A;  1O1T A;  3ASD A;  2WXP A;  3RO3 A;  3ULY A;  2PNN A;  1FT2 A;  5AQA A;  3RRM B;  3S7J A;  2EQX A;  4AV7 A;  3BU8 A;  4A55 A;  2JAB A;  1ZU2 A;  3LJ3 A;  2LAH A;  2PZI A;  4YDE A;  4JHR A;  5LOZ A;  4BY6 A;  3CIA A;  4JHJ A;  3ASG A;  4LUN U;  2AWI A;  2IJG X;  1OUV A;  3ABM E;  3L6A A;  4JD2 G;  3OXL A;  3FTY A;  3LDZ A;  4NUR A;  1EF1 C;  2VSN A;  4N2Q A;  1FCH A;  3MEK A;  3JQ0 A;  3ML9 A;  4RLY A;  1D8D A;  3HIZ A;  4TV3 A;  3SHF A;  3ZW3 A;  4UWF A;  3L82 A;  5FQ4 A;  3FTU A;  3CVU A;  3ZHE B;  3CVV A;  3FH7 A;  3HVE A;  2IFU A;  5H7P A;  3DEP A;  4KVO A;  1NI1 A;  2Y1L E;  2KAT A;  3BG0 B;  3WG7 E;  1YMP A;  3PEV B;  3CVN A;  3D3M A;  2DZO A;  2FUL A;  3GZS A;  2YIN A;  4Q69 A;  2FEZ A;  1N0R A;  1N52 A;  2X6H A;  3L08 A;  2CHW A;  1WDY A;  3SF4 A;  1HXI A;  5CED B;  3U9W A;  5JJT A;  4FJZ A;  1EYH A;  2A4Z A;  1NFI E;  2P9N G;  3EJN A;  1YYH A;  3NOC D;  1DNP A;  4AJW A;  5AYW D;  3PZ4 A;  1OCO E;  5HRY A;  1N95 A;  5CHE E;  3EHN A;  1TR4 A;  4EBA A;  4GAA A;  2GRR B;  1E8Z A;  3I4R B;  3LVR E;  1K3Z D;  4N39 A;  1H19 A;  3UTM A;  4F1P A;  3PUJ A;  4DX2 A;  1WM5 A;  2P9L G;  3OXG A;  3TWV A;  3E37 A;  3EHQ A;  1O5M A;  1FVF A;  3KD7 A;  1U2V G;  4GMR A;  4PH4 B;  3DSU A;  4JL0 A;  4BEP A;  3AU4 A;  1YA0 A;  3TWX A;  5KNH D;  3ZVV A;  1OWN A;  5E76 A;  4FU3 A;  3QDN A;  1GW6 A;  2A5U A;  1IHG A;  2P58 C;  2OVB A;  4L9P A;  3LXU X;  3FU5 A;  3R9M A;  1QYM A;  4RSY A;  1IQU A;  3LY8 A;  1BLX B;  4PS3 A;  3FP3 A;  4FC8 A;  4B89 A;  3SBS A;  4Z68 A;  4J8E A;  1TJF A;  2I1J A;  1Q2Z A;  2GRP B;  2OVF A;  2XEV A;  4GPK A;  3CVX A;  3FTZ A;  1NA0 A;  4KBQ A;  2V8S E;  3D9H A;  4A3V A;  3HG0 D;  2OEW A;  4APO A;  3AS5 A;  5FT9 A;  3U66 A;  2A5E A;  5EDS A;  4GTQ A;  2B6C A;  3FEX A;  3QWW A;  4XI9 A;  1KT1 A;  5ANR A;  2XEH A;  1U3C A;  1WG0 A;  5HQ8 A;  5CBO A;  4ILG A;  5ENO D;  4ANX A;  4U0Z A;  4DX1 A;  1WAO 1;  4B93 B;  2R5S A;  3RIB A;  5KBA A;  3C72 A;  4U8H A;  4XX5 A;  4JA7 A;  2P9P G;  4LNG A;  4B94 A;  4UWH A;  5DIZ A;  1N4S A;  2L6B A;  3EIJ A;  3GZ1 A;  2I1K A;  3IHV A;  4FHK A;  2VGY A;  3CVW A;  4A1G A;  2ETC A;  1LF8 A;  1N9A A;  2UY1 B;  4K5A B;  2PM7 A;  3G2T A;  2AXV A;  3KEA A;  1JUQ A;  4C9B B;  1W3B A;  3T5X A;  3ZYK A;  2PM6 A;  2XCB A;  3AG3 E;  2XGS A;  3UI2 A;  4O60 A;  2VGX A;  1QQE A;  2Y4U A;  3EIQ C;  4MKT A;  2B0O E;  3JXI A;  2AXZ A;  4G26 A;  5AAO A;  1IYG A;  3U64 A;  5HI7 A;  4K03 A;  4GCO A;  4N3B A;  2WPV A;  4GZD A;  3MA5 A;  4YVQ C;  2VQ2 A;  4UUC A;  3MCX A;  3UKU G;  4HI9 A;  4I1O B;  1HS6 A;  4MRU A;  4YVO A;  4HOR A;  4HRM B;  1TN8 A;  3PE3 A;  2V0P A;  2P9U G;  4CGV A;  2RFM A;  3EHM A;  3CV0 A;  2VSO E;  4F3V A;  4HVB A;  3ZRH A;  4O6F A;  4RQI A;  2IF4 A;  3CHQ A;  3ZHE A;  3K9I A;  4GYW A;  2H6I A;  2Y69 E;  4XKB A;  1OY3 D;  3D9N A;  3DSV A;  2ZXW E;  5M72 A;  5ENN A;  1ELK A;  4PS7 A;  4OVU A;  3SGH A;  3LY7 A;  3E4B A;  4GCN A;  1AP7 A;  3HXD A;  4OAV B;  4ZHB A;  1HU3 A;  4TXQ A;  3UQ3 A;  1SA5 A;  2HE0 A;  2LSV A;  2DZN A;  5KJN A;  4BTB A;  3CVL A;  2RFA A;  3ZXP A;  4BSX A;  1WY6 A;  3Q79 A;  1KZP A;  4G24 A;  3VLD A;  4EBA G;  5C2Y A;  3D9P A;  3IV0 A;  1S64 A;  3JUI A;  1H2V C;  4LSZ E;  4ANV A;  3PS6 A;  4MLP A;  4JW1 A;  1H6K A;  3SY2 A;  4YDW A;  4DJA A;  1TNO A;  2P9K G;  4UQX A;  3ASN E;  5EKQ D;  2LSU A;  4G8K A;  4AVX A;  1K1A A;  5AQ7 A;  4EQF A;  3ZPJ A;  3PEU B;  3QB2 A;  1E96 B;  2MHK A;  2WXJ A;  4JVS A;  3TG5 A;  4CZ2 D;  3LCA A;  5ITZ F;  4TUU A;  1BI7 B;  3ML8 A;  3URZ A;  2J8S D;  4C48 B;  2BTD A;  2DYR E;  4XEI G;  4GZ3 A;  4O1P A;  3RSE G;  4XKC A;  1JCQ A;  1E7V A;  3CKB A;  3DSS A;  4AXH A;  3B7R L;  3FFL A;  4I1A A;  5LFA A;  3DBS A;  2EIL E;  3QKY A;  2PQN A;  4U63 A;  4HBD A;  5AJL A;  1BI8 B;  3FU3 A;  2F37 A;  3NF1 A;  5FZR A;  5AAR A;  3P2B A;  1UJK A;  3F6Q A;  1PC2 A;  3V2O A;  4DLO A;  4D10 C;  2GW1 A;  1DC2 A;  4CDR A;  3S7D A;  4KT6 B;  1G3N B;  2OOE A;  3G2S A;  3B7U X;  2OND A;  3PZ2 A;  1Y6I A;  4YDO A;  3TWT A;  2BUG A;  1LTX A;  3VLF A;  4M7C A;  1NZN A;  1SQM A;  3CHM A;  2MRI A;  2YNQ A;  3IBE A;  2WMN A;  2X6I A;  4AY6 A;  1NL4 A;  5LCW C;  2KZT B;  3NB2 A;  4GTO A;  4CT0 A;  3PE4 A;  3UM3 A;  2ZU6 B;  5ANL A;  3OTN A;  3CVP A;  2FO7 A;  1PY1 A;  4E85 A;  2H6H A;  3L22 A;  4GTS A;  4LNU D;  5D2M C;  3I3N A;  4U0S A;  2WVI A;  1ZBP A;  3G2W A;  1S63 A;  3CEQ A;  3FU0 A;  2ETA A;  4UQZ A;  5FZS A;  4GTM A;  4B0Z A;  1OWM A;  4GYO A;  5EIB E;  3AU5 A;  5JHA A;  3UM1 A;  1N54 A;  4K5C A;  3FH5 A;  1SZ9 A;  3HYM B;  4BX8 A;  3EDT B;  1OCC E;  2IOL A;  3RKV A;  4N5Q A;  2ZGG A;  4A3T A;  2GRO B;  4KZC A;  3L9T A;  3UMV A;  1D8E A;  4GZ5 A;  3JYS A;  3AG4 E;  5KWD A;  2KCK A;  3PZ1 A;  3V2X A;  5BPP A;  1JPL A;  3QWP A;  3JCK C;  4EEC A;  3TWS A;  4MBG A;  1X5B A;  4AIF A;  4JEH A;  4HOU A;  4IRU A;  3T8K A;  4KVM A;  2CG2 A;  4WWN A;  5ENR D;  5BV1 A;  1IKN D;  3Q7F A;  4HI8 A;  2F8X K;  5E75 A;  4HLE A;  3L17 A;  5ENQ D;  4I9C A;  4DUI A;  3FUM A;  5LCW J;  5A7D B;  1A5E A;  4LNB A;  5EID A;  4ZFH A;  3QC1 A;  3SBT B;  2DWZ A;  5EYL A;  1BD8 A;  1INZ A;  2IU1 A;  2CHZ A;  3PNT B;  3LPZ A;  4G11 A;  4WWO A;  5G55 A;  3Q4A B;  3KEZ A;  4TUM A;  4EZK A;  2FF4 A;  3V79 K;  1H0A A;  2ZIS A;  3Q75 A;  4JC8 A;  5JJ6 A;  3AAA C;  4J8D A;  2IOS A;  4L2Y A;  3UXG A;  4F53 A;  5ENT D;  2PL2 A;  5B1A E;  3MV3 B;  4EHM A;  3NAW A;  4WND A;  5CMW A;  2L6J A;  2GRM A;  3TXM A;  3RU0 A;  3LJN A;  1JCR A;  1H2U A;  5FQ8 A;  2R05 A;  1OT8 A;  3ZEF A;  2EIM E;  3X2Q E;  5LX8 A;  2Y4T A;  2KCL A;  4OYS A;  3BG1 B;  1QNF A;  2QYU A;  3FTW A;  3FUD A;  3IXE A;  2XS8 A;  2DCP A;  4HQD A;  3Q49 B;  3PH0 C;  1IXV A;  2LNI A;  5ARG A;  3QAQ A;  1UOH A;  3JQ1 A;  3QK0 A;  3DSW A;  1V54 E;  3B95 A;  3ZGQ A;  4HLL A;  2L0T B;  3MX3 A;  5FIO A;  3ABK E;  2IO3 C;  2ION A;  3DPD A;  1DCQ A;  4FA6 A;  3ASH A;  2F8Y A;  3Q73 A;  3RRU A;  3FUJ A;  4ILH B;  5AIJ A;  5FWQ A;  4L7T A;  2MOW A;  4J0U A;  3HRA A;  4K0R A;  4L2L A;  2H6F A;  3PZD A;  1UN9 A;  3CHP A;  3HXF A;  3Q78 A;  3CK7 A;  1E8X A;  2VGX B;  3TXN A;  2JLB A;  2X6K A;  4FJY A;  2VTB B;  3RK6 A;  4IN3 B;  4BFR A;  2VSX E;  4U96 D;  1ELW A;  3PRZ A;  2J4D A;  1LD7 A;  4UI9 K;  5J08 A;  3SFY A;  4DPR A;  4GZ6 A;  2E0I A;  2WXL A;  3PDN A;  4WUY A;  3V30 A;  3LVQ E;  4HB5 A;  3ZU7 B;  3FUN A;  2LAI A;  1TN7 A;  2L9B A;  3DRA A;  4C0M A;  4I1M A;  4G2V A;  2J09 A;  1TNY A;  4O1O A;  2QFC A;  3AJI A;  1MQS A;  3N71 A;  1MX6 A;  2XRY A;  2IY0 C;  4XIF A;  4M3O A;  3D9L A;  4Y6C A;  2KXP C;  4HFG A;  5D0Q D;  2J07 A;  3QOU A;  3ULE G;  5AJD A;  2NSZ A;  2VJ8 A;  3AS8 A;  3DSX A;  3ISM C;  2WXR A;  4I2Z A;  4I9E A;  4XI0 A;  5BT1 A;  2J49 A;  2V4H C;  3BUA A;  1RZ4 A;  4DI3 A;  5BXO A;  5CBN A;  3TAX A;  4E6H A;  1E90 A;  5EX0 A;  3C3Q A;  2WM9 A;  1Y8M A;  4UQY A;  5CEA A;  3SD5 A;  4BT8 A;  4HOQ A;  2JEK A;  2OV8 A;  2XEN A;  4BSZ B;  5FIN A;  4UWK A;  1SA4 A;  3ESK A;  4W9R A;  1SZA A;  4NQ0 A;  4BX9 A;  3ONL A;  4DI4 A;  2IEJ A;  2P2C P;  3CVQ A;  4HRL A;  4LRZ A;  4YND A;  3ZFW A;  3JUE A;  3U3W A;  3AG2 E;  4TRQ A;  2PQR A;  4TXP A;  3T5V A;  1H2T C;  3CLJ A;  3BQO A;  4DX5 D;  3UIO C;  4QFV A;  5AQB A;  3TL5 A;  3E33 A;  3W9F A;  4CRW A;  2E2E A;  3B7B A;  5KJM A;  1DCE A;  5AEN A;  1SVX A;  3D9K A;  5A23 A;  3CVY A;  4GTR A;  1S70 B;  4WNF A;  5A6C A;  2P9S G;  4HOS A;  3LS8 A;  2WXH A;  1MYO A;  1OWO A;  2NXP A;  3APC A;  4AEZ C;  3CQG B;  3PNL B;  3DPY A;  5AQ9 A;  1BU9 A;  4QQI A;  3O4Z A;  4UI9 C;  4HNA D;  1N4R A;  4JHK A;  1HF8 A;  3MV2 B;  5D0O D;  3FUE A;  3D9M A;  2UY1 A;  3D9I A;  3CHS A;  5EIL A;  4JXT A;  2XCC A;  3I4G A;  1XNF A;  4H7X A;  4OAU C;  3SO8 A;  5LP0 A;  3KAE A;  1HX8 A;  4AOF A;  4ME2 A;  2CFU A;  2CG3 A;  3T9K A;  3RJV A;  3SQV A;  4B8C B;  3NZS A;  1O1R A;  4NAC A;  4V3I A;  3R7Q A;  3NOG D;  1HFA A;  1OWL A;  2V5F A;  4P29 A;  2WXK A;  3R9A B;  4U8V D;  4G1T A;  2V4L A;  3P1U A;  1H6O A;  3FU6 A;  4GML A;  5EN5 D;  3D9J A;  3VTY A;  5ENS D;  4WAF A;  1P5Q A;  3HXC A;  4IUL A;  2XS1 A;  4Q96 A;  1MHQ A;  4GZC A;  4L1B A;  5JJ7 A;  2IQC A;  3RAU A;  3IHY A;  4DX6 D;  4MS6 A;  3CST A;  2RKK A;  3QWV A;  3PZ3 A;  3QNK A;  4FP7 A;  3IEG A;  4JZY A;  1UN8 A;  3T8M A;  1A17 A;  1E7U A;  3BEE A;  3FDH A;  3TWQ A;  4F6R D;  4RG9 A;  2AJA A;  2L0I A;  5T4Y A;  4U0U A;  3HDX A;  4N3A A;  5BUZ A;  2DYS E;  3PVL A;  2HYZ A;  4KMO A;  4B8A A;  4LG6 A;  2IO2 C;  3LY9 A;  4JA9 A;  1HG2 A;  2C0L A;  3CHO A;  1MX2 A;  3DEO A;  3DST A;  2VSY A;  3CQC B;  3J5P A;  3ENE A;  5CER B;  1IQR A;  3L13 A;  3FUH A;  3QJZ A;  2XHE A;  4G25 A;  3ZKJ A;  4H7Y A;  5EX3 A;  2C0M A;  4I2W A;  3VLE A;  1L5J A;  3C3O A;  4DX7 D;  2YHC A;  5ENP D;  3O48 A;  3VTX A;  4ABN A;  4U95 D;  3ASO E;  2XZD G;  4AY5 A;  2XEE A;  4KZ0 A;  2AW6 A;  4ATZ D;  1UG3 A;  4CGW A;  3ZXS A;  3UIN C;  4LCT A;  3ABL E;  2X3M A;  5T8I A;  2Y0B G;  3FUF A;  5G2N A;  4I17 A;  2QYJ A;  4DK5 A;  3E34 A;  1BPO A;  3GZ2 A;  3FY4 A;  1N94 A;  4U7E B;  4I43 A;  1TJC A;  4N5C A;  1U3D A;  4ANU A;  3WXX A;  2WXI A;  2GRN B;  4X8Q A;  2XZT G;  1Z6T A;  3UX4 A;  2GRL A;  2KBX A;  3JXJ A;  4TXR A;  4DRX E;  3LKU A;  1KPS B;  4EZJ A;  3UM0 A;  1Z5S C;  3L16 A;  1TEZ A;  1OWP A;  5HKP A;  1N4Q A;  2H6G A;  3KSQ A;  4ACL A;  2DIW A;  2M63 A;  4KXK B;  4GTV A;  4J8F A;  4U07 A;  4A63 B;  4URK A;  2DBA A;  2C2L A;  3ZNG A;  1Z3X A;  2WQ7 A;  3HXB A;  4YDY A;  2XGO A;  2LO6 A;  3EU9 A;  3ULQ A;  3UT4 A;  4J8S A;  2I9C A;  2RG8 A;  3ZYM A;  2YQ8 A;  4GA1 A;  2FO1 E;  1TNZ A;  4IYP A;  3FTV A;  4G23 A;  3OXF A;  4F7A A;  4GA2 A;  2KC7 A;  1FT1 A;  1IHB A;  4EZL A;  3UT8 A;  3NZU A;  4XZ4 A;  5FQ7 A;  3D9O A;  3CK9 A;  3GW4 A;  3ZUV B;  2X6J A;  3UIP C;  3NBN B;  2DVW A;  2I6H A;  5EYP F;  4BTA A;  3E32 A;  3DWL G;  2P9I G;  2Y3A A;  4UWL A;  3AS4 A;  5CMY A;  4Q94 A;  1UJJ A;  2VYI A;  3Q5M A;  2ZIR A;  1RW2 A;  4APF A;  3ONK A;  3SNX A;  2XRZ A;  1JCS A;  5BW8 C;  1OXJ A;  3SFZ A;  5JA4 D;  3CKC A;  3KSL A;  1ZB1 A;  3MKQ B;  3MYV A;  1DVP A;  2UWJ G;  2I2O A;  3EU5 A;  3NQP A;  4HS2 A;  3B13 A;  3FHE A;  5KJK A;  1HO8 A;  5KJL A;  2QZA A;  4RVB A;  4BWR A;  2R02 A;  3B7T A;  4CDM A;  3TWR A;  1MJ0 A;  5G05 C;  2LXL A;  3J5Q B;  5AN8 A;  2WQ6 A;  4RG6 A;  3SI5 A;  1TN6 A;  2KCV A;  3PUK A;  1ELR A;  5BXU A;  4HRN A;  1N4P A;  3FTX A;  1HH8 A;  2FI7 A;  4OVV A;  1OCR E;  4K5B A;  1KZO A;  1MZC A;  1D9S A;  4CDN A;  3ASF A;  4UWG A;  4Y6W A;  2BF0 X;  3W9G A;  3G2V A;  2QC9 A;  5B3S E;  3UPV A;  2BED A;  2EIK E;  1N0Q A;  2RD0 A;  4F1S A;  4JB8 P;  3ZN3 A;  1Z3Y A;  5JMN D;  3MKR A;  3CSF A;  2ETB A;  2BKG A;  4R7L A;  1X81 A;  3ZIM A;  2OEV A;  3UT7 A;  2XQ0 A;  4GU5 A;  2XPI A;  4WNE A;  4UI9 J;  1H6P A;  3SFX A;  4GB9 A;  5FTP A;  1O1S A;  4AP2 A;  3MKQ A;  3MJW A;  3QAR A;  2R2L A;  4LEU A;  3APD A;  5CRV A;  4ILI A;  1EDU A;  3EHR A;  2XGM A;  1S0P A;  4ANW A;  4I6J A;  4ACK A;  1SW6 A;  1QBQ A;  1MX4 A;  3MZL B;  1JWG A;  3PRE A;  4GA0 A;  3UM2 A;  2Q7F A;  3G2U A;  2VGE A;  1PAQ A;  4WWP A;  1E8Y A;  4WNG A;  2GRQ B;  4N3C A;  4XE0 A;  4A1S A;  2ZGD A;  1YCS B;  2AVP A;  3MGB A;  4FUL A;  1TNU A;  2VTB A;  3CR3 A;  5T3R A;  2F0Y A;  5IY5 E;  2XPZ A;  3TGO A;  3S2A A;  3DXK G;  5G04 J;  2WXN A;  2LXM A;  5KCM A;  3TJP A;  5HS0 A;  5G05 J;  5FZQ A;  3LEW A;  4C0E A;  3FUL A;  2OCC E;  2WXF A;  2WXG A;  4GMJ A;  2EIJ E;  1B89 A;  5ARF A;  2ILR A;  2WQH A;  3E30 A;  3R7R A;  2GGF A;  2BKK B;  2NYJ A;  2HM8 A;  4ATG A;  2R03 A;  4KYO B;  2NC9 A;  4CYM D;  4GPM A;  3FH8 A;  3TWU A;  2CFZ A;  3B7S A;  3CGH A;  5FJY A;  5DBK A;  3HVE B;  2R17 C;  4GTP A;  3HXE A;  3SZ7 A;  4I6G A;  2QY7 A;  1NP7 A;  4PDX A;  1TYQ G;  3C5R A;  5J90 A;  1EPU A;  5D66 A;  1XGW A;  5CRU A;  2WMO A;  3S7F A;  2KZT A;  3L54 A;  3ZYL A;  3V31 A;  4HOT A;  2AXU A;  4U04 A;  1FVH A;  3HHM A;  5CEC B;  3EUV A;  4CEM A;  3ZYQ A;  2J9Q A;  2J4B A;  4NIK A;  4DLQ A;  1VDY A;  3Q47 B;  3FEY A;  2EIN E;  2CHX A;  1KT0 A;  1E8W A;  2HR2 A;  1HZ4 A;  2V5Q C;  3FWV A;  3I5P A;  3RO2 A;  4JEU A;  4U8Y D;  3C98 A;  3Q9N C;  3FUI A;  3GYZ A;  5CCM A; 
#chains in the Genus database with same CATH homology
 2X3M A;  5HI7 A;  4K03 A;  5T8I A;  4GCO A;  4N3B A;  2FBN A;  2WPV A;  4GZD A;  3MA5 A;  3ZGQ A;  3FUF A;  4YVQ C;  2VQ2 A;  1HG5 A;  5CCL A;  2L0T B;  3MX3 A;  5G2N A;  3MCX A;  4I17 A;  4I1O B;  1HS6 A;  4DK5 A;  2R59 A;  2ION A;  1BPO A;  3GZ2 A;  3DPD A;  2WXQ A;  3FY4 A;  4FA6 A;  4MRU A;  3ASH A;  1NA3 A;  4I43 A;  3RRU A;  4YVO A;  3FUJ A;  4HOR A;  1TJC A;  4ILH B;  1JWF A;  5AIJ A;  3TG4 A;  4N2S A;  3UUX A;  3PE3 A;  4PS8 A;  5FWQ A;  2V0P A;  4N5C A;  4L7T A;  1U3D A;  2MOW A;  3CK8 A;  4J0U A;  5G04 C;  4ANU A;  2X38 A;  4K0R A;  4L2L A;  3WXX A;  4CGV A;  3PZD A;  2WXI A;  3EHM A;  1UN9 A;  2WXM A;  3CHP A;  3CV0 A;  2VSO E;  4J6I A;  3CK7 A;  1E8X A;  1QZ2 A;  2VGX B;  3ZRH A;  4F3V A;  4O6F A;  4FHJ A;  2JLB A;  3TXN A;  4HVB A;  1Z6T A;  2X6K A;  2IF4 A;  4FJY A;  2VTB B;  3CHQ A;  3RK6 A;  2X6F A;  4IN3 B;  3K9I A;  4FLB A;  3UX4 A;  2VSX E;  2GRL A;  4GYW A;  3ZHE A;  4BFR A;  4HXI A;  5BNW A;  3IKO B;  4XKB A;  4BT9 A;  2XPY A;  2YHE A;  3D9N A;  4CT4 A;  1ELW A;  3LKU A;  3PRZ A;  2J4D A;  4EZJ A;  5M72 A;  5ENN A;  1ELK A;  4PS7 A;  2KM4 A;  4JPS A;  4NRH B;  4OVU A;  4UI9 K;  3LY7 A;  3SGH A;  4CCA A;  3E4B A;  4GCN A;  3S7B A;  5JHB A;  3L16 A;  5J08 A;  1TEZ A;  1OWP A;  3U4T A;  3LYA A;  4DPR A;  3CHR A;  4GZ6 A;  2E0I A;  2WXL A;  3PDN A;  1HU3 A;  4WUY A;  3UQ3 A;  3LVQ E;  4ACL A;  3KS2 A;  3ESL A;  2LSV A;  2WXO A;  2DIW A;  4BTB A;  5KJN A;  3CVL A;  2M63 A;  3FUN A;  4KXK B;  4J8F A;  2LAI A;  1WY6 A;  4BSX A;  4U07 A;  2L9B A;  4I6E A;  4FLH A;  4URK A;  4C0M A;  4I1M A;  4G2V A;  4G24 A;  3VLD A;  2J09 A;  5FQ6 A;  2DBA A;  2C2L A;  2QFC A;  1MQS A;  1Z3X A;  2WQ7 A;  4EBA G;  5C2Y A;  3D9P A;  3N71 A;  5C1D A;  2XRY A;  3IV0 A;  2J08 A;  1UW4 B;  4XIF A;  4M3O A;  1KLX A;  3D9L A;  3JUI A;  4Y6C A;  4HFG A;  1H2V C;  4ANV A;  2XGO A;  2LO6 A;  5D0Q D;  3PS6 A;  4MLP A;  4JW1 A;  1H6K A;  3OAW A;  2HO1 A;  4DJA A;  2J07 A;  3QOU A;  3ULQ A;  3FTS A;  3UT4 A;  4UQX A;  4J8S A;  5EKQ D;  4AM9 A;  4FAD A;  2I9C A;  4LER A;  2LSU A;  5AJD A;  2NSZ A;  4AVX A;  4PUC A;  2VJ8 A;  3AS8 A;  2RG8 A;  3Q15 A;  3FUK A;  3ZYM A;  2YQ8 A;  3APF A;  4GA1 A;  4EQF A;  3ZPJ A;  3PEU B;  2WXR A;  4EPZ A;  4I2Z A;  3QB2 A;  4I9E A;  3FTV A;  1E96 B;  2MHK A;  2J49 A;  3OXF A;  4G23 A;  4IYP A;  4XI0 A;  4GA2 A;  4F7A A;  2KC7 A;  5BT1 A;  2WXJ A;  4JVS A;  4GYY A;  3TG5 A;  4DI3 A;  3LCA A;  4EZL A;  1HE8 A;  4TUU A;  3UT8 A;  3ML8 A;  3NZU A;  4XZ4 A;  5FQ7 A;  3TAX A;  5BV0 A;  4E6H A;  1E90 A;  4L23 A;  3URZ A;  5EX0 A;  3RRN B;  3D9O A;  3CK9 A;  3GW4 A;  2BTD A;  2WB2 A;  2X6J A;  3ASD A;  2WM9 A;  2WXP A;  3RO3 A;  1Y8M A;  2I6H A;  4UQY A;  3RRM B;  3S7J A;  3SD5 A;  4BT8 A;  2EQX A;  4AV7 A;  4BTA A;  4GZ3 A;  4HOQ A;  4A55 A;  2JEK A;  2OV8 A;  1E7V A;  4XKC A;  3CKB A;  4UWK A;  3ESK A;  4AXH A;  2Y3A A;  3B7R L;  1ZU2 A;  3LJ3 A;  4W9R A;  2LAH A;  1SZA A;  2PZI A;  3FFL A;  4UWL A;  4I1A A;  3AS4 A;  4JHR A;  5LFA A;  5LOZ A;  3DBS A;  3QKY A;  5CMY A;  4BY6 A;  4NQ0 A;  3CIA A;  4JHJ A;  1UJJ A;  2VYI A;  4Q94 A;  4BX9 A;  2PQN A;  3ASG A;  3ONL A;  4LUN U;  2AWI A;  4U63 A;  5AJL A;  3Q5M A;  2IJG X;  4DI4 A;  3FU3 A;  3NF1 A;  4APF A;  1OUV A;  3CVQ A;  3L6A A;  3ONK A;  5FZR A;  3SNX A;  4LRZ A;  2XRZ A;  4YND A;  3OXL A;  3FTY A;  3LDZ A;  4NUR A;  1EF1 C;  3ZFW A;  5BW8 C;  3P2B A;  1UJK A;  3SFZ A;  2VSN A;  1PC2 A;  3U3W A;  4N2Q A;  1FCH A;  3MEK A;  3JQ0 A;  3ML9 A;  4DLO A;  4D10 C;  3CKC A;  2GW1 A;  3HIZ A;  4TV3 A;  4TRQ A;  3MKQ B;  3SHF A;  4UWF A;  3ZW3 A;  2PQR A;  4CDR A;  3MYV A;  5FQ4 A;  3FTU A;  3S7D A;  1H2T C;  3CLJ A;  3T5V A;  3ZHE B;  3CVV A;  3CVU A;  3FH7 A;  4KT6 B;  1DVP A;  2UWJ G;  4QFV A;  2I2O A;  3NQP A;  3TL5 A;  4CRW A;  3HVE A;  4HS2 A;  2IFU A;  3B13 A;  2OOE A;  2E2E A;  3FHE A;  3G2S A;  5KJM A;  4KVO A;  5KJK A;  1HO8 A;  5AEN A;  3B7U X;  5A23 A;  3D9K A;  3CVY A;  5KJL A;  2OND A;  4RVB A;  4BWR A;  3B7T A;  2KAT A;  4WNF A;  4CDM A;  1Y6I A;  5A6C A;  3BG0 B;  5G05 C;  3PEV B;  2WQ6 A;  3CVN A;  3D3M A;  4HOS A;  3LS8 A;  4RG6 A;  2FUL A;  3GZS A;  2YIN A;  2BUG A;  4Q69 A;  2WXH A;  3SI5 A;  2KCV A;  2FEZ A;  3VLF A;  1OWO A;  3PUK A;  1ELR A;  2NXP A;  3APC A;  4AEZ C;  3CQG B;  3PNL B;  1NZN A;  1N52 A;  2X6H A;  1SQM A;  3L08 A;  3FTX A;  1HH8 A;  2CHW A;  2FI7 A;  4OVV A;  3O4Z A;  3CHM A;  4UI9 C;  3SF4 A;  2MRI A;  2YNQ A;  4JHK A;  3IBE A;  1HXI A;  1HF8 A;  4CDN A;  3U9W A;  2WMN A;  5JJT A;  2X6I A;  4FJZ A;  1EYH A;  4AY6 A;  2A4Z A;  3ASF A;  3MV2 B;  5LCW C;  2KZT B;  3EJN A;  5D0O D;  3FUE A;  1DNP A;  4UWG A;  4Y6W A;  4AJW A;  4CT0 A;  2BF0 X;  3D9M A;  5AYW D;  2UY1 A;  3D9I A;  3PE4 A;  2ZU6 B;  3G2V A;  3OTN A;  3CHS A;  5ANL A;  4JXT A;  2XCC A;  3CVP A;  5CHE E;  3I4G A;  3UPV A;  2FO7 A;  1PY1 A;  4E85 A;  3EHN A;  4EBA A;  4GAA A;  3L22 A;  2RD0 A;  1XNF A;  4F1S A;  4H7X A;  3ZN3 A;  1Z3Y A;  1E8Z A;  3I4R B;  3MKR A;  3CSF A;  5LP0 A;  3I3N A;  3LVR E;  4U0S A;  2WVI A;  4N39 A;  1H19 A;  1ZBP A;  3G2W A;  4R7L A;  3KAE A;  1HX8 A;  3CEQ A;  3ZIM A;  3PUJ A;  4AOF A;  4ME2 A;  2CFU A;  1WM5 A;  2CG3 A;  3RJV A;  3OXG A;  3FU0 A;  3UT7 A;  2XQ0 A;  4GU5 A;  4B8C B;  3NZS A;  2XPI A;  4WNE A;  4UQZ A;  5FZS A;  4NAC A;  4V3I A;  4UI9 J;  1FVF A;  4GB9 A;  3KD7 A;  5FTP A;  3R7Q A;  4B0Z A;  1OWM A;  4GYO A;  4PH4 B;  4AP2 A;  3AU5 A;  3MKQ A;  3MJW A;  3QAR A;  1HFA A;  5JHA A;  4JL0 A;  3AU4 A;  4LEU A;  3APD A;  1OWL A;  1YA0 A;  2V5F A;  2WXK A;  4P29 A;  3R9A B;  1N54 A;  4ILI A;  1EDU A;  4G1T A;  3ZVV A;  2V4L A;  2XGM A;  3FH5 A;  3P1U A;  1OWN A;  1S0P A;  1SZ9 A;  4ANW A;  3HYM B;  5E76 A;  4I6J A;  4ACK A;  4FU3 A;  3QDN A;  4BX8 A;  3EDT B;  1GW6 A;  3MZL B;  1JWG A;  2IOL A;  3PRE A;  4GA0 A;  3FU6 A;  3RKV A;  4GML A;  2Q7F A;  3G2U A;  3D9J A;  2A5U A;  1IHG A;  2P58 C;  3VTY A;  4A3T A;  2OVB A;  1PAQ A;  4WAF A;  1P5Q A;  4KZC A;  4WWP A;  1E8Y A;  3LXU X;  3FU5 A;  4WNG A;  4IUL A;  3UMV A;  4GZ5 A;  3JYS A;  4N3C A;  4RSY A;  1IQU A;  4Q96 A;  1MHQ A;  4GZC A;  4XE0 A;  3LY8 A;  4A1S A;  2KCK A;  4L1B A;  4PS3 A;  3FP3 A;  4FC8 A;  4B89 A;  5JJ7 A;  2AVP A;  3MGB A;  3SBS A;  2IQC A;  5BPP A;  4FUL A;  4J8E A;  1JPL A;  2VTB A;  1TJF A;  3CR3 A;  3JCK C;  3QWP A;  2I1J A;  4EEC A;  5T3R A;  3IHY A;  2OVF A;  4MS6 A;  2XEV A;  2XPZ A;  3S2A A;  3TGO A;  3CVX A;  4GPK A;  3CST A;  3FTZ A;  5G04 J;  3QWV A;  3QNK A;  1X5B A;  2WXN A;  3IEG A;  4FP7 A;  4JZY A;  4AIF A;  4JEH A;  1UN8 A;  5KCM A;  4HOU A;  4IRU A;  3TJP A;  3T8M A;  4KVM A;  1NA0 A;  1A17 A;  2V8S E;  4KBQ A;  5FZQ A;  5G05 J;  1E7U A;  2CG2 A;  3BEE A;  3FDH A;  3LEW A;  4A3V A;  4WWN A;  4APO A;  3AS5 A;  4C0E A;  5BV1 A;  3FUL A;  5FT9 A;  2WXF A;  3U66 A;  5EDS A;  2WXG A;  4GMJ A;  4RG9 A;  1B89 A;  2L0I A;  5T4Y A;  4U0U A;  5ARF A;  3FEX A;  2ILR A;  2WQH A;  3QWW A;  5E75 A;  4HLE A;  3L17 A;  4XI9 A;  1KT1 A;  3R7R A;  4I9C A;  5ANR A;  2GGF A;  2HM8 A;  3HDX A;  4ATG A;  1U3C A;  3FUM A;  4KYO B;  4N3A A;  5BUZ A;  5LCW J;  2NC9 A;  5A7D B;  5HQ8 A;  3PVL A;  4ILG A;  3QC1 A;  4ANX A;  3SBT B;  2HYZ A;  4KMO A;  4B8A A;  3FH8 A;  4U0Z A;  2CFZ A;  3B7S A;  3CGH A;  5FJY A;  1WAO 1;  5DBK A;  3HVE B;  1INZ A;  2R5S A;  2R17 C;  3RIB A;  2IU1 A;  3LY9 A;  2CHZ A;  3PNT B;  3LPZ A;  4G11 A;  3SZ7 A;  4I6G A;  4JA9 A;  4WWO A;  2QY7 A;  1NP7 A;  5G55 A;  3Q4A B;  3KEZ A;  1HG2 A;  4JA7 A;  4U8H A;  4XX5 A;  2C0L A;  3CHO A;  4EZK A;  4B94 A;  4PDX A;  2FF4 A;  4UWH A;  5DIZ A;  5J90 A;  1EPU A;  1H0A A;  4JC8 A;  5JJ6 A;  3EIJ A;  4J8D A;  1XGW A;  2IOS A;  2VSY A;  4L2Y A;  3GZ1 A;  2I1K A;  4F53 A;  2PL2 A;  2WMO A;  3CQC B;  3IHV A;  4FHK A;  2VGY A;  1IQR A;  3ENE A;  3MV3 B;  4WND A;  4A1G A;  3S7F A;  2KZT A;  5CMW A;  3L54 A;  1LF8 A;  2L6J A;  3CVW A;  3ZYL A;  2GRM A;  3L13 A;  3FUH A;  3TXM A;  2UY1 B;  3RU0 A;  2PM7 A;  3G2T A;  2XHE A;  3QJZ A;  4HOT A;  4G25 A;  1H2U A;  5FQ8 A;  2AXU A;  2AXV A;  4H7Y A;  4U04 A;  1JUQ A;  4C9B B;  3ZEF A;  1W3B A;  5EX3 A;  3T5X A;  1FVH A;  2C0M A;  4I2W A;  2Y4T A;  3ZYK A;  5LX8 A;  2PM6 A;  2KCL A;  2XCB A;  3HHM A;  4OYS A;  3VLE A;  1L5J A;  3BG1 B;  1QNF A;  3ZYQ A;  2XGS A;  2J9Q A;  4CEM A;  2J4B A;  2YHC A;  3FTW A;  1VDY A;  3FUD A;  3O48 A;  3Q47 B;  3VTX A;  4DLQ A;  2VGX A;  2DCP A;  3FEY A;  1QQE A;  2CHX A;  2Y4U A;  1KT0 A;  3Q49 B;  1E8W A;  4ABN A;  2HR2 A;  3PH0 C;  3EIQ C;  1HZ4 A;  2LNI A;  3FWV A;  5ARG A;  4MKT A;  4AY5 A;  3I5P A;  4KZ0 A;  3RO2 A;  2AXZ A;  3QAQ A;  4G26 A;  2AW6 A;  4JEU A;  1UG3 A;  3JQ1 A;  3C98 A;  4CGW A;  1IYG A;  3FUI A;  3U64 A;  3ZXS A;  3GYZ A;  4LCT A;  3QK0 A;  5CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...