3D9JA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
137
structure length
137
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 56
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9jA00
1EYHA 4JXTA 4AVXA 1JWFA 1JUQA 1ELKA 1HFAA 2L0IA 3D9IA 2MOWA 4Q96A 3D9MA 1UJJA 2DCPA 1HX8A 1XGWA 1JWGA 3CLJA 1EDUA 1X5BA 3D9OA 3D9NA 3G2SA 3ZYMA 1VDYA 1HG2A 5CMYA 4Q94A 3G2UA 3G2TA 3ONLA 1INZA 3LDZA 4FLBA 4NACA 3ZYKA 3RRUA 1DVPA 2KM4A 2L0TB 2BF0X 3D9LA 3ONKA 3D9KA 3G2WA 4GZCA 3G2VA 2DIWA 3ZYLA 1SZAA 3ZYQA 2QY7A 5J08A 3D9PA 4FU3A 1MHQA 1SZ9A 2V8SE 4HFGA 5LOZA 1H0AA 3D9JA 5CMWA 2LO6A 1JPLA 1HF8A 5LP0A 1UJKA 1HG5A 1PY1A 1LF8A 4GZDA
chains in the Genus database with same CATH superfamily
4CRWA 2WXOA 5G04C 4GTTA 1O5MA 3L6AA 4BX9A 3HXCA 4IULA 3BG0B 1U3CA 5JJ6A 2RFMA 4CDNA 3EIQC 2EIME 4O1OA 1JCQA 4AM9A 1BU9A 1MX2A 5FWQA 3ULYA 3JUEA 5HKPA 2YINA 1TR4A 4L7TA 4HI9A 4GZCA 1FCHA 3LY8A 4KZ0A 1JPLA 2J07A 3CHOA 4PDXA 4GZ3A 3DSXA 4YNDA 5FZSA 2R59A 4HOQA 1Z6TA 2ZGGA 5ENRD 4A55A 2DYSE 3PREA 3FDHA 3PZDA 4UWGA 5AJDA 5G2NA 5A6CA 1KT1A 1EF1C 1IKND 3PDNA 4TXPA 3ISMC 1ZU2A 3TXNA 1WM5A 3IKOB 4DX2A 2WXHA 1WG0A 2IFUA 4FLHA 3LDZA 5AYWD 3TXMA 4CZ2D 3CK7A 1SZAA 3HYMB 3MV3B 3Q5MA 4AOFA 4GMLA 3SNXA 2V4HC 4U07A 4GPMA 3MKRA 3FH7A 4ATGA 4C0MA 4J0UA 3ULQA 2ZIRA 5G04J 4PS8A 1N0QA 4EHMA 1IXVA 1OWNA 2J49A 1UJKA 3QWVA 1Z3XA 2LSUA 2X6KA 1HE8A 1HFAA 5BT1A 2B6CA 4GA2A 3CHPA 3FTWA 1IQUA 3LYAA 1BI8B 1FVHA 4OVUA 4BTBA 2FI7A 4GTMA 3S7DA 3FH5A 3Q78A 2QY7A 5LFAA 2RG8A 2R05A 4G8KA 3DSSA 5LP0A 4BX8A 3EU5A 3ZVVA 3AS8A 2X3MA 3R9MA 4GMRA 1QNFA 3HHMA 1O1SA 3V2XA 5E76A 3CK9A 3MKQB 4WWOA 3KAEA 3AAAC 1V55E 2WXNA 3KD7A 1EYHA 1ELKA 4U95D 3O48A 3ZHEB 4HQDA 2XEVA 2OV8A 5JJ7A 3L9TA 3S7FA 3PZ1A 3EHNA 4U8YD 1UN8A 3PRZA 1MHQA 3CEQA 1H2UA 2LNIA 3DSVA 3ESKA 1NFIE 3UT4A 5KJNA 5CMYA 1AP7A 3ZIMA 2XGMA 4LERA 2PQRA 3BU8A 3L17A 1D9SA 2LO6A 3B7UX 1HF8A 4FA6A 4Q69A 5H7PA 3BUAA 1WDYA 1INZA 2MHKA 4GCOA 4G11A 3FUNA 3HDXA 2UWJG 4UWLA 2HM8A 3D3MA 5BXOA 2PZIA 5AARA 3W9FA 5LCWJ 4DK5A 2J9QA 4BFRA 1RW2A 2Y0BG 3ASGA 2GRPB 4UQZA 3RO2A 1D8EA 3EIJA 5JHBA 1EDUA 1FT1A 1A5EA 1N9AA 4M3OA 5CCLA 3QNKA 3TWQA 4DX6D 4J8DA 4N5QA 4RSYA 3MYVA 2AXUA 3DWLG 3U64A 2IF4A 4F6RD 3IXEA 3QARA 3ZGQA 1E7VA 2PQNA 3D9NA 4QQIA 1H2VC 3T5XA 5EX0A 2OOEA 1S63A 3CHSA 4DLQA 5EIDA 4HNAD 1KT0A 3CKBA 5D0OD 3OXFA 2DBAA 3CGHA 3PZ2A 2DVWA 3UI2A 1HG2A 2AXVA 3SF4A 3EUVA 2F0YA 4DUIA 4EECA 3C72A 3U3WA 3FTSA 3RO3A 5JMND 3Q75A 3ASHA 4CDMA 5BV0A 4JPSA 3CHQA 3FH8A 2CHXA 3SO8A 1B89A 2ZISA 5G05C 1V54E 2ZU6B 1IQRA 4KT6B 2WB2A 3I3NA 3AU4A 1ELRA 3ASDA 4I43A 1OWMA 2FO7A 2WMNA 4NQ0A 3L22A 4ME2A 3HVEA 3GZSA 2L6JA 1N0RA 2Q7FA 3UINC 4F3VA 3PVLA 2ETCA 4D10C 5D0QD 3FUEA 4L23A 1IYGA 1SZ9A 3PEUB 3TWSA 3U66A 2VGXA 1RZ4A 4K5BA 5KNHD 4GYOA 5B1BE 3V79K 5BXUA 2WQHA 1E90A 4TRQA 1WY6A 1N4SA 3G2VA 3U4TA 2UY1A 1E8YA 4IYPA 3D9JA 4JA9A 4GZDA 3CV0A 3FU6A 3Q49B 3DXKG 4H7YA 1HX8A 1LD7A 3CLJA 3KS2A 2P9NG 3HRAA 4ANXA 3CIAA 4A3TA 3TAXA 4ANWA 2WXFA 3L16A 5HQ8A 3SI5A 3AG2E 4MLPA 2P58C 1PAQA 5EX3A 5KJLA 5A7DB 5AENA 2XGSA 5EKQD 3C3QA 4EBAG 1UW4B 4OAVB 3TWVA 2OVBA 5G55A 1TNOA 2VTBA 4I6JA 3B7BA 3QKYA 3QC1A 4J8SA 4GTRA 4UWKA 4ZFHA 1X5BA 4TUMA 3BEEA 4K0RA 2I9CA 4PH4B 3S2AA 1N4RA 3LVRE 4DX7D 2WXQA 5ARGA 4CT0A 3J5QB 3GW4A 3FUHA 2X6IA 3QOUA 3KEZA 2DZOA 2DYRE 4J6IA 2IQCA 2P9UG 3L82A 4JC8A 5FTPA 4APOA 3E32A 1MJ0A 1S70B 2Y4TA 2AVPA 1FVFA 2VYIA 2KZTA 3ONKA 3G2WA 2HO1A 3ZYQA 3FTUA 4FJYA 2XHEA 4HOTA 1H6KA 5AJLA 1S64A 1PC2A 4I9EA 5JJTA 3FTVA 2AJAA 2VSNA 4JB8P 4UI9K 2XCCA 2QYUA 2R03A 3ZYKA 3FTXA 3QAQA 1H2TC 3C3OA 2FEZA 1YA0A 4O6FA 3MZLB 3RRNB 2EINE 3ULEG 2V5FA 1JUQA 3EJNA 3ASOE 4HLLA 2XQ0A 2FO1E 3J5PA 4FHKA 5B1AE 3B7SA 4HB5A 4U96D 1OCOE 3ZUVB 4KZCA 4U63A 2XPZA 1O1RA 2X38A 2E0IA 4RG6A 4G2VA 2QC9A 5JA4D 3RKVA 3LXUX 3JXJA 3D9IA 4U8HA 1Z3YA 2R5SA 2WXRA 3IEGA 3FU0A 2GROB 4F7AA 3RAUA 4J8EA 2L6BA 4JEHA 4KMOA 4WNDA 2LSVA 3Q79A 4GZ6A 3JUIA 4C48B 4FHJA 1N52A 4JXTA 3I4RB 3PUJA 1Q2ZA 2DWZA 1MZCA 2PM7A 1H19A 4KVOA 1TNYA 2L0TB 4IN3B 5ITZF 5J08A 3KSLA 3HG0D 4JHKA 4LRZA 4BT8A 4P29A 4UI9J 1U3DA 2J08A 3ABLE 4YDOA 2CFZA 5FJYA 2NC9A 3LCAA 1E8ZA 2BKKB 3ZW3A 4Z68A 2J09A 5AQBA 4HVBA 4N2SA 2FF4A 1TN6A 2L9BA 3CVQA 4GZ5A 2QYJA 4NACA 3JYSA 3Q15A 3R7RA 2IEJA 3OXGA 3Q73A 3JQ1A 1OCRE 4A1SA 4EZJA 5B3SE 3F6QA 3MCXA 4B93B 1N4QA 3UMVA 1P5QA 4UQXA 2A4ZA 2HE0A 2QFCA 2YQ8A 1QZ2A 4N5CA 2PNNA 5LCWC 4HORA 3HVEB 4BSXA 4FU3A 3APFA 5ANRA 3EU9A 3UTMA 3OTNA 3C5RA 4N3AA 1OWOA 4XI0A 1KZPA 3IHYA 1SVXA 3PZ3A 3RU0A 3ZYMA 3B7TA 2XGOA 2VGXB 1HH8A 4JD2G 4UWHA 1E96B 2C0LA 3DSWA 2YHCA 1H6OA 4FC8A 5EILA 2GRRB 1W3BA 3UXGA 3ESLA 2UY1B 4Q96A 3FWVA 4RLYA 2MRIA 2EQXA 1TNUA 3S7BA 3W9GA 4CT4A 2X6HA 3DSUA 3T5VA 4L9PA 3UQ3A 4PS7A 3LEWA 2J8SD 4BTAA 2HYZA 4ANUA 3ZXSA 4AP2A 2JLBA 3Q9UC 5T4YA 2XS1A 1Z5SC 3ABME 3FHEA 2P9IG 2F37A 5C2YA 4TXQA 4HBDA 2WXKA 3PE4A 2VTBB 4HRMB 3TWRA 2R02A 5CBNA 3EDTB 1YCSB 3ML9A 3AS5A 2XRYA 2CFUA 2GRNB 1XNFA 2WVIA 3V30A 5KWDA 4HOUA 3SZ7A 2AW6A 5EYPF 4RQIA 2P9SG 3SHFA 3Q9NC 1NI1A 2X6FA 1MX4A 2WMOA 2QZAA 3ZEFA 5BW8C 1N95A 2XENA 3FULA 1KZOA 3AS4A 3NQPA 4WAFA 3PNTB 2XPYA 3ZU7B 4KBQA 3LS8A 2KZTB 3URZA 3ABKE 2NSZA 4URKA 1NA0A 3L08A 2NXPA 1SW6A 4RG9A 2FBNA 1OCZE 3KSQA 2BF0X 3PEVB 4BWRA 2AWIA 3CVNA 3MEKA 2DZNA 5KNGA 3PH0C 3TWWA 5FINA 4MRUA 1N11A 3EHMA 3KEAA 4XX5A 1TN7A 5CBOA 5ENSD 1OY3D 2H6GA 1G3NB 3ZKJA 2XS8A 5CEDB 4JEUA 2V4LA 4M7CA 4FULA 2M63A 2A5EA 3Q7FA 3C3RA 5KJKA 2WXMA 4CGWA 2BUGA 4K5CA 4RVBA 4N2QA 1IHGA 5CHEE 3NBNB 5T8IA 2EIKE 3WG7E 4I9CA 1H0AA 5DBKA 1MYOA 3FY4A 5E75A 3CHMA 2A5UA 1NP7A 2WPVA 5ENPD 3E33A 2Y69E 5FQ6A 3OXLA 3PNLB 4J8YA 3D9PA 2OVFA 4DX1A 3IV0A 4KYOB 5BPPA 5CRVA 2GRLA 2KXPC 2V5QC 3E34A 4ATZD 3ASNE 2JEKA 2Y3AA 2OEWA 2P9LG 3SFXA 5M72A 5AQ9A 4DJAA 3CVPA 4HFGA 4AY6A 1S0PA 4ACKA 3FTYA 2I2OA 1FPPA 1WAO1 4DX5D 1JWGA 4FLBA 1ELWA 2J4DA 3MGBA 4B8CB 3APCA 4XZ4A 4BEPA 5A23A 3BG1B 3V31A 4AEZC 2IJGX 3B95A 3VLFA 4LNUD 3CR3A 4UUCA 4PUCA 1NA3A 4AXHA 5FQ4A 1O1TA 1KLXA 3TL5A 3E30A 2H6HA 3P1UA 2C2LA 4YDEA 1JWFA 3VLDA 5HS0A 4CCAA 3G2SA 5LX8A 4XE0A 2LAIA 4EPZA 5HI7A 1E8WA 2V8SE 1HS6A 1NL4A 5ANLA 1E8XA 2R2LA 4GCNA 1UJJA 2VGEA 4NIKA 1IHBA 1VDYA 3QWPA 4GYWA 3B7RL 3UIPC 2WXIA 2XZTG 4A3VA 3CHRA 4CEMA 5FZRA 3RSEG 4UI9C 3LVQE 3Q4AB 1DCQA 2H6IA 4X8QA 2YNQA 4I6EA 3ZN3A 3QJZA 4BY6A 5AAOA 2MOWA 3L54A 3TJPA 2DCPA 4KVMA 3K9IA 3ONLA 5EYLA 4GTOA 4I1MA 4G25A 4HXIA 4O1PA 4JVSA 2VSYA 4B8AA 4ILHB 2P9KG 1L5JA 4BETA 1UN9A 3G2TA 4N39A 1TNZA 3WXXA 3NOCD 2KCVA 2E2EA 4V3IA 1YMPA 5D66A 4JA7A 4GA1A 3HXBA 5ENOD 2VGYA 5CRUA 2ETAA 5D2MC 3VTYA 2R17C 4A1GA 2GGFA 4N3BA 3D9LA 4TV3A 4YDWA 2BEDA 2F8YA 4LCTA 2J4BA 4BSZB 3CKCA 3NB2A 4YDYA 2KATA 4B0ZA 1AWCB 4C0EA 2IO2C 3FUJA 4L2LA 3D9KA 1BI7B 3CQCB 2GW1A 3T9KA 4CYMD 2IO3C 5CCMA 4Y6WA 5ARFA 1NZNA 3MA5A 1LTXA 3PZ4A 4B89A 3CVYA 1TYQG 1HO8A 4DPRA 3NZUA 1QYMA 3ZNGA 3C98A 1OCCE 2JABA 3DBSA 1OT8A 3GZ1A 1PY1A 4ZHBA 2KCKA 3PE3A 1E7UA 3L13A 4HI8A 3D9OA 1N4PA 4U8VD 4FADA 3R9AB 3SBTB 1BD8A 1Y6IA 3CVVA 2KM4A 1EPUA 1HXIA 3SY2A 5AQAA 4G24A 4HLEA 2WXGA 4TUUA 1K1AA 4I2WA 4FP7A 5AN8A 3P2BA 4I1OB 2WQ6A 2IU1A 4F1PA 2AXZA 3SQVA 2XPIA 5FZQA 1TJCA 1K8KG 4QFVA 2CG2A 5FQ7A 2IOLA 4ILGA 4AVXA 4JW1A 3JXIA 3JQ0A 1OXJA 4DI3A 5EN5D 4WUYA 5BNWA 1ZB1A 4R7LA 4U0SA 3DPYA 3UM1A 4I17A 2RD0A 1FT2A 4GTSA 4JHRA 4LNGA 3UM3A 3FUKA 5C1DA 3QDNA 1Y8MA 3CQGB 3FU5A 4JHJA 4E6HA 3HIZA 5JHAA 4NURA 4J7WA 4XKBA 5CEAA 4U0ZA 5T3RA 3RRUA 2KCLA 4JL0A 1UG3A 3Q47B 3PS6A 4DRXE 5LOZA 4PS3A 3TWUA 1QQEA 4GYYA 3CVUA 4EQFA 2NYJA 3AG1E 4BT9A 4F1SA 4F53A 3FEYA 4GU5A 5CERB 4G8LA 2I6HA 3D9HA 4UWFA 3LY7A 2CHWA 5AQ7A 4YVQC 2FULA 2EILE 5J90A 1OWPA 4XIFA 1TNBA 4HS2A 2VQ2A 3ZPJA 4GTVA 3I5PA 4GB9A 4EZLA 2P2CP 3UIOC 2BTDA 3LPZA 4K03A 2PM6A 4Y6CA 3FUIA 1BPOA 3MV2B 3DEPA 4DLOA 5KCMA 4U04A 2Y1LE 1H6PA 2BKGA 3AJIA 3BQOA 5CECB 3ENEA 4L2YA 2ZXWE 4JZYA 3V2OA 2RKKA 1N54A 2WXLA 4MKTA 2F8XK 1K1BA 2WM9A 2PL2A 2DIWA 4ACLA 3CVWA 4I1AA 4DI4A 4W9RA 3EHRA 3UUXA 2KBXA 4WNEA 4CDRA 3NF1A 4MS6A 3TG5A 1OWLA 3E37A 4Q94A 3CK8A 3DPDA 1BLXB 4G23A 3UKUG 3QK0A 5FQ8A 4HRLA 1DVPA 1JCSA 3DEOA 4TXRA 3FP3A 1JCRA 2ONDA 3R7QA 4APFA 3IHVA 3T8MA 1HG5A 3JCKC 2ZGDA 4OAUC 3UKRG 3TWTA 5FT9A 2XZDG 3FUFA 3AG3E 4AIFA 3UM0A 2XRZA 4IRUA 3GZ2A 2LXMA 4WWNA 5BUZA 3UT7A 4I6GA 1SA4A 3ZFWA 5KJMA 3HXEA 5DIZA 3LJ3A 2C0MA 4ANVA 4MBGA 3OAWA 2H6FA 3UX4A 2VSXE 3SFYA 2WXJA 3DXMG 3CSTA 5IY5E 1YYHA 2L0IA 5ENTD 3D9MA 4XEIG 3DRAA 5HRYA 3MJWA 4GTQA 4UQYA 3G2UA 3RRMB 4EZKA 3AU5A 4C9BB 3PUKA 3APDA 3UT8A 3T8KA 4LEUA 2Y4UA 2P9PG 3HXFA 3IBEA 3VTXA 3S7JA 3QB2A 3HXDA 4G1TA 3FEXA 1GW6A 4K5AB 1DNPA 5BV1A 3ASFA 3SGHA 2WQ7A 4BESA 3ZXPA 4AV7A 4BERA 4I2ZA 2XEEA 1N94A 4LUNU 3B13A 2RFAA 4GMJA 3X2QE 3MKQA 1U2VG 4WNFA 2GRQB 2ETBA 1A17A 2EIJE 3LJNA 1D8DA 1UOHA 4H7XA 3NAWA 4WNGA 1LD8A 4AY5A 3RIBA 2ILRA 3ZHEA 2IY0C 3ZRHA 1TJFA 3QWWA 1MQSA 2CG3A 2HR2A 1SQMA 3ZYLA 1X81A 4LG6A 5KBAA 3E4BA 4CGVA 2GRMA 1TEZA 3TWXA 3CVXA 3Q7AA 3RK6A 2IOSA 4LNBA 1ZBPA 4O60A 4XKCA 4A63B 4KXKB 2OCCE 2KC7A 2YHEA 3SBSA 5G05J 2CHZA 5EIBE 2MYOA 3UM2A 3N71A 2VSOE 2WXPA 4L1BA 3I4GA 4GTPA 2B0OE 1LF8A 1HZ4A 2I1JA 4WWPA 4E85A 2X6JA 2V0PA 4HRNA 1DCEA 1HU3A 4NRHB 3CVLA 4ILIA 4GA0A 3AG4E 5FIOA 4ABNA 1OUVA 3FTZA 5EDSA 3NOGD 3MX3A 3RJVA 2LUHA 5ENNA 4FJZA 4J8FA 3FUDA 4OVVA 3FUMA 4AJWA 3DSTA 1K3ZD 2I1KA 1KPSB 3SFZA 2XEHA 2OEVA 3GYZA 1MX6A 5ENQD 1SA5A 4B94A 3SD5A 3TG4A 4U0UA 3TGOA 2XCBA 3U9WA 3LKUA 4HOSA 2VJ8A 3LY9A 4EBAA 5AIJA 4U7EB 4N3CA 1QBQA 2LAHA 3O4ZA 3VLEA 3FU3A 2LXLA 4LSZE 3ML8A 1XGWA 1TN8A 4GPKA 1DC2A 3EHQA 4GAAA 3NZSA 3UPVA 4YVOA 2IONA 3CSFA 3FFLA 4G26A 5CMWA 4XI9A 4OYSA
chains in the Genus database with same CATH topology
5FQ7A 2IOLA 3LS8A 2KZTB 3CV0A 3FU6A 3Q49B 4ILGA 4JW1A 3URZA 2WXOA 4AVXA 3JQ0A 5G04C 2NSZA 4H7YA 4DI3A 4URKA 1HX8A 3CLJA 3KS2A 4WUYA 5BNWA 4R7LA 1NA0A 3L08A 4ANXA 4U0SA 2NXPA 3L6AA 3CIAA 4A3TA 4RG9A 2FBNA 4I17A 2WXFA 3L16A 3TAXA 4ANWA 5HQ8A 4BX9A 2RD0A 2BF0X 3PEVB 4IULA 4BWRA 2AWIA 3BG0B 1U3CA 3CVNA 5JJ6A 4CDNA 3EIQC 4JHRA 3SI5A 4MLPA 4AM9A 3FUKA 5C1DA 2P58C 1PAQA 5EX3A 3MEKA 5KJLA 5A7DB 3QDNA 5FWQA 5AENA 1Y8MA 3CQGB 3FU5A 3PH0C 4JHJA 4E6HA 2XGSA 3HIZA 5EKQD 4MRUA 5JHAA 4NURA 3EHMA 4EBAG 1UW4B 4XX5A 4XKBA 2YINA 2OVBA 5G55A 4U0ZA 2VTBA 4L7TA 5T3RA 3RRUA 2KCLA 4I6JA 4JL0A 1UG3A 4GZCA 1FCHA 3LY8A 3Q47B 3PS6A 3QKYA 2V4LA 4JEUA 3QC1A 4J8SA 5LOZA 4PS3A 4UWKA 4KZ0A 1QQEA 1JPLA 2J07A 4GYYA 3CHOA 3CVUA 4PDXA 1X5BA 4GZ3A 4EQFA 4FULA 4YNDA 5FZSA 2M63A 2R59A 4HOQA 1Z6TA 3BEEA 4A55A 4BT9A 4K0RA 5KJKA 2WXMA 3PREA 3FDHA 4CGWA 2BUGA 4F1SA 3PZDA 4RVBA 2I9CA 4UWGA 1IHGA 4F53A 4PH4B 4N2QA 5CHEE 5AJDA 3S2AA 5G2NA 5A6CA 1KT1A 1EF1C 3FEYA 4GU5A 5T8IA 2I6HA 3LVRE 3PDNA 4UWFA 4I9CA 2WXQA 3LY7A 5ARGA 4CT0A 1H0AA 5DBKA 3GW4A 2CHWA 3FUHA 2X6IA 3QOUA 3KEZA 1ZU2A 3TXNA 4YVQC 2FULA 1WM5A 3IKOB 4J6IA 5J90A 1OWPA 3FY4A 4XIFA 2IQCA 4HS2A 5E75A 2VQ2A 3CHMA 2A5UA 3ZPJA 2WXHA 2IFUA 3I5PA 4GB9A 4JC8A 5FTPA 4APOA 4EZLA 1NP7A 2WPVA 4FLHA 3LDZA 2Y4TA 2AVPA 5AYWD 2BTDA 1FVFA 2VYIA 2KZTA 3LPZA 5FQ6A 3TXMA 3ONKA 3G2WA 2PM6A 4K03A 2HO1A 1SZAA 3CK7A 3HYMB 3MV3B 3OXLA 3FTUA 3PNLB 3Q5MA 3D9PA 3FUIA 4GMLA 3ZYQA 4AOFA 1BPOA 2OVFA 4FJYA 2XHEA 4HOTA 1H6KA 3SNXA 5AJLA 3MV2B 4OYSA 3IV0A 4U07A 4KYOB 4DLOA 1PC2A 3MKRA 5KCMA 4U04A 3FH7A 4I9EA 4ATGA 5JJTA 3FTVA 5BPPA 4C0MA 3ENEA 4J0UA 2VSNA 4L2YA 3ULQA 2GRLA 4UI9K 2XCCA 4JZYA 1N54A 2WXLA 5G04J 2JEKA 4MKTA 3ZYKA 3FTXA 2WM9A 2Y3AA 3QAQA 4PS8A 1H2TC 2PL2A 2FEZA 2DIWA 1YA0A 4O6FA 5M72A 4ACLA 3CVWA 4DJAA 3CVPA 4HFGA 4I1AA 1OWNA 1S0PA 3MZLB 3RRNB 4ACKA 4AY6A 2J49A 4DI4A 1UJKA 3QWVA 3FTYA 4W9RA 2I2OA 1Z3XA 2V5FA 3UUXA 1JUQA 2LSUA 1WAO1 2X6KA 1HE8A 1HFAA 3EJNA 4WNEA 4CDRA 5BT1A 3NF1A 4MS6A 3TG5A 1OWLA 4GA2A 2XQ0A 3CHPA 1JWGA 4FHKA 3FTWA 3B7SA 1IQUA 3LYAA 4Q94A 1FVHA 3CK8A 3DPDA 4OVUA 4BTBA 4G23A 4FLBA 2FI7A 3QK0A 5FQ8A 4KZCA 1DVPA 1ELWA 2J4DA 4U63A 2XPZA 3S7DA 3FH5A 2X38A 3MGBA 2E0IA 3FP3A 2QY7A 2ONDA 4B8CB 3APCA 5LFAA 4RG6A 2RG8A 4XZ4A 5A23A 3R7QA 4APFA 3BG1B 5LP0A 3IHVA 3T8MA 1HG5A 4G2VA 2IJGX 4AEZC 4BX8A 3ZVVA 3AS8A 3JCKC 2X3MA 3RKVA 3LXUX 3D9IA 5FT9A 4U8HA 1Z3YA 3FUFA 2R5SA 2WXRA 3VLFA 1QNFA 3IEGA 3HHMA 3FU0A 3CR3A 4AIFA 2XRZA 4IRUA 4PUCA 3GZ2A 1NA3A 4F7AA 4AXHA 4J8EA 4JEHA 4KMOA 4WNDA 3CK9A 4WWNA 3MKQB 5E76A 2LSVA 4WWOA 3KAEA 5BUZA 5FQ4A 1KLXA 2WXNA 3JUIA 4GZ6A 3TL5A 3UT7A 4FHJA 3P1UA 1N52A 2C2LA 4I6GA 3KD7A 1EYHA 4JXTA 3ZFWA 1JWFA 3VLDA 5KJMA 1ELKA 3O48A 5DIZA 3I4RB 3PUJA 3LJ3A 2C0MA 4CCAA 3ZHEB 2XEVA 3G2SA 4ANVA 3OAWA 5LX8A 2PM7A 2OV8A 4XE0A 5JJ7A 2LAIA 1H19A 3UX4A 4EPZA 2VSXE 5HI7A 3S7FA 4KVOA 3EHNA 2L0TB 4IN3B 1UN8A 1E8WA 3PRZA 5J08A 1MHQA 2WXJA 2V8SE 3CSTA 3CEQA 1HS6A 1H2UA 4JHKA 2LNIA 1E8XA 4LRZA 5ANLA 4BT8A 4P29A 3ESKA 4UI9J 1U3DA 2L0IA 3D9MA 4GCNA 1UJJA 3UT4A 5KJNA 2J08A 1VDYA 3QWPA 4GYWA 5CMYA 3MJWA 2CFZA 4UQYA 3B7RL 5FJYA 3G2UA 3RRMB 2WXIA 2XGMA 4A3VA 3ZIMA 2NC9A 4LERA 4EZKA 2PQRA 3LCAA 3AU5A 3CHRA 1E8ZA 3L17A 3ZW3A 4CEMA 5FZRA 4C9BB 3PUKA 4UI9C 2J09A 4HVBA 3LVQE 2LO6A 4N2SA 3Q4AB 3B7UX 1HF8A 4FA6A 2YNQA 3APDA 3UT8A 4I6EA 4LEUA 2Y4UA 4Q69A 3ZN3A 3IBEA 3QJZA 3VTXA 4BY6A 2FF4A 2MOWA 3L54A 3S7JA 3TJPA 2DCPA 1INZA 4KVMA 2MHKA 4GCOA 4G11A 3QB2A 2L9BA 3K9IA 3FUNA 3HDXA 3CVQA 4G1TA 3FEXA 2UWJG 4UWLA 4GZ5A 3ONLA 1GW6A 4NACA 3JYSA 1DNPA 2HM8A 3D3MA 5BV1A 3ASFA 3Q15A 3SGHA 2PZIA 4I1MA 3R7RA 5LCWJ 3OXGA 4DK5A 4G25A 2WQ7A 4HXIA 2J9QA 3JQ1A 4JVSA 2VSYA 4A1SA 4BFRA 4AV7A 3ASGA 4EZJA 4UQZA 4I2ZA 3RO2A 3MCXA 3EIJA 4B8AA 4ILHB 4LUNU 3UMVA 3B13A 1P5QA 4UQXA 2A4ZA 4GMJA 2QFCA 5JHBA 1EDUA 1L5JA 3MKQA 2YQ8A 1UN9A 4WNFA 3G2TA 4N39A 1QZ2A 3WXXA 4N5CA 5LCWC 4M3OA 5CCLA 3QNKA 4HORA 2KCVA 1A17A 3HVEB 4BSXA 4H7XA 4WNGA 4J8DA 4AY5A 4RSYA 4FU3A 2E2EA 3APFA 2ILRA 4V3IA 3MYVA 2AXUA 3RIBA 5ANRA 3U64A 3ZHEA 2IF4A 3OTNA 3QARA 3ZRHA 4N3AA 3ZGQA 4JA7A 1OWOA 4XI0A 4GA1A 1E7VA 1TJFA 2PQNA 3IHYA 3QWWA 3RU0A 3D9NA 3ZYMA 1MQSA 2VGYA 3B7TA 3VTYA 2CG3A 2XGOA 1H2VC 2R17C 3T5XA 2VGXB 4A1GA 1HH8A 5EX0A 2HR2A 2GGFA 4N3BA 4UWHA 3D9LA 1E96B 1SQMA 4TV3A 2OOEA 2C0LA 3ZYLA 3CHSA 3E4BA 2YHCA 4CGVA 2GRMA 1TEZA 4FC8A 4DLQA 3CVXA 3RK6A 1KT0A 1W3BA 4LCTA 3CKBA 5D0OD 3OXFA 2IOSA 3ESLA 4CRWA 2UY1B 4Q96A 1ZBPA 2DBAA 4XKCA 3CGHA 4KXKB 4Y6CA 3FWVA 2YHEA 2KC7A 1HG2A 2AXVA 2J4BA 2MRIA 3SBSA 3SF4A 3CKCA 2EQXA 3S7BA 2KATA 5G05J 4B0ZA 4C0EA 2CHZA 4EECA 3U3WA 3FUJA 4L2LA 3D9KA 3FTSA 3RO3A 4CT4A 2X6HA 3T5VA 3ASHA 3UQ3A 3N71A 3CQCB 4PS7A 4CDMA 2GW1A 2VSOE 3LEWA 5BV0A 2WXPA 4L1BA 3I4GA 2HYZA 3CHQA 4JPSA 4ANUA 4BTAA 1LF8A 3ZXSA 1HZ4A 4AP2A 3FH8A 2I1JA 5CCMA 2CHXA 4Y6WA 4WWPA 2JLBA 4E85A 2X6JA 1B89A 5T4YA 2V0PA 5ARFA 1NZNA 5G05C 3MA5A 2ZU6B 1HU3A 3FHEA 4NRHB 1IQRA 3CVLA 4ILIA 4KT6B 4GA0A 2WB2A 4B89A 5C2YA 3CVYA 3I3NA 4ABNA 3AU4A 1HO8A 1OUVA 3FTZA 4DPRA 5EDSA 2WXKA 1ELRA 3MX3A 3ASDA 3RJVA 4I43A 3NZUA 3C98A 5ENNA 4FJZA 4J8FA 3FUDA 1OWMA 3DBSA 3PE4A 4OVVA 3FUMA 4AJWA 3GZ1A 2FO7A 2VTBB 1PY1A 2I1KA 2WMNA 3SFZA 4NQ0A 2KCKA 3GYZA 3L22A 3PE3A 4ME2A 4B94A 1E7UA 3SD5A 3L13A 3HVEA 3GZSA 2L6JA 3D9OA 3EDTB 4FADA 2Q7FA 3R9AB 3TG4A 4F3VA 3PVLA 4U0UA 3ML9A 3SBTB 3TGOA 4D10C 5D0QD 3AS5A 3FUEA 1Y6IA 3CVVA 2KM4A 2XCBA 1EPUA 4L23A 1HXIA 1IYGA 3U9WA 3LKUA 4HOSA 2VJ8A 2CFUA 2XRYA 3LY9A 4G24A 4EBAA 4HLEA 1SZ9A 2WXGA 4TUUA 5AIJA 1XNFA 2WVIA 3PEUB 4HOUA 4N3CA 3U66A 4I2WA 3SZ7A 2VGXA 2LAHA 4FP7A 3O4ZA 3VLEA 2AW6A 3FU3A 4GYOA 3ML8A 1XGWA 3P2BA 3SHFA 2WQHA 4GPKA 4I1OB 1E90A 2X6FA 2WQ6A 2IU1A 2WMOA 3ZEFA 4TRQA 5BW8C 3FULA 4GAAA 2AXZA 3AS4A 1WY6A 3NZSA 3NQPA 2XPIA 3G2VA 5FZQA 3U4TA 1TJCA 4WAFA 2UY1A 3UPVA 4QFVA 4YVOA 2IONA 3CSFA 1E8YA 2CG2A 3FFLA 4IYPA 4G26A 3PNTB 3D9JA 4JA9A 2XPYA 5CMWA 4KBQA 4XI9A 4GZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYH A;  4JXT A;  4AVX A;  1JWF A;  1JUQ A;  1ELK A;  1HFA A;  2L0I A;  3D9I A;  2MOW A;  4Q96 A;  3D9M A;  1UJJ A;  2DCP A;  1HX8 A;  1XGW A;  1JWG A;  3CLJ A;  1EDU A;  1X5B A;  3D9O A;  3D9N A;  3G2S A;  3ZYM A;  1VDY A;  1HG2 A;  5CMY A;  4Q94 A;  3G2U A;  3G2T A;  3ONL A;  1INZ A;  3LDZ A;  4FLB A;  4NAC A;  3ZYK A;  3RRU A;  1DVP A;  2KM4 A;  2L0T B;  2BF0 X;  3D9L A;  3ONK A;  3D9K A;  3G2W A;  4GZC A;  3G2V A;  2DIW A;  3ZYL A;  1SZA A;  3ZYQ A;  2QY7 A;  5J08 A;  3D9P A;  4FU3 A;  1MHQ A;  1SZ9 A;  2V8S E;  4HFG A;  5LOZ A;  1H0A A;  3D9J A;  5CMW A;  2LO6 A;  1JPL A;  1HF8 A;  5LP0 A;  1UJK A;  1HG5 A;  1PY1 A;  1LF8 A;  4GZD A; 
#chains in the Genus database with same CATH topology
 4CRW A;  2WXO A;  5G04 C;  4GTT A;  1O5M A;  3L6A A;  4BX9 A;  3HXC A;  4IUL A;  3BG0 B;  1U3C A;  5JJ6 A;  2RFM A;  4CDN A;  3EIQ C;  2EIM E;  4O1O A;  1JCQ A;  4AM9 A;  1BU9 A;  1MX2 A;  5FWQ A;  3ULY A;  3JUE A;  5HKP A;  2YIN A;  1TR4 A;  4L7T A;  4HI9 A;  4GZC A;  1FCH A;  3LY8 A;  4KZ0 A;  1JPL A;  2J07 A;  3CHO A;  4PDX A;  4GZ3 A;  3DSX A;  4YND A;  5FZS A;  2R59 A;  4HOQ A;  1Z6T A;  2ZGG A;  5ENR D;  4A55 A;  2DYS E;  3PRE A;  3FDH A;  3PZD A;  4UWG A;  5AJD A;  5G2N A;  5A6C A;  1KT1 A;  1EF1 C;  1IKN D;  3PDN A;  4TXP A;  3ISM C;  1ZU2 A;  3TXN A;  1WM5 A;  3IKO B;  4DX2 A;  2WXH A;  1WG0 A;  2IFU A;  4FLH A;  3LDZ A;  5AYW D;  3TXM A;  4CZ2 D;  3CK7 A;  1SZA A;  3HYM B;  3MV3 B;  3Q5M A;  4AOF A;  4GML A;  3SNX A;  2V4H C;  4U07 A;  4GPM A;  3MKR A;  3FH7 A;  4ATG A;  4C0M A;  4J0U A;  3ULQ A;  2ZIR A;  5G04 J;  4PS8 A;  1N0Q A;  4EHM A;  1IXV A;  1OWN A;  2J49 A;  1UJK A;  3QWV A;  1Z3X A;  2LSU A;  2X6K A;  1HE8 A;  1HFA A;  5BT1 A;  2B6C A;  4GA2 A;  3CHP A;  3FTW A;  1IQU A;  3LYA A;  1BI8 B;  1FVH A;  4OVU A;  4BTB A;  2FI7 A;  4GTM A;  3S7D A;  3FH5 A;  3Q78 A;  2QY7 A;  5LFA A;  2RG8 A;  2R05 A;  4G8K A;  3DSS A;  5LP0 A;  4BX8 A;  3EU5 A;  3ZVV A;  3AS8 A;  2X3M A;  3R9M A;  4GMR A;  1QNF A;  3HHM A;  1O1S A;  3V2X A;  5E76 A;  3CK9 A;  3MKQ B;  4WWO A;  3KAE A;  3AAA C;  1V55 E;  2WXN A;  3KD7 A;  1EYH A;  1ELK A;  4U95 D;  3O48 A;  3ZHE B;  4HQD A;  2XEV A;  2OV8 A;  5JJ7 A;  3L9T A;  3S7F A;  3PZ1 A;  3EHN A;  4U8Y D;  1UN8 A;  3PRZ A;  1MHQ A;  3CEQ A;  1H2U A;  2LNI A;  3DSV A;  3ESK A;  1NFI E;  3UT4 A;  5KJN A;  5CMY A;  1AP7 A;  3ZIM A;  2XGM A;  4LER A;  2PQR A;  3BU8 A;  3L17 A;  1D9S A;  2LO6 A;  3B7U X;  1HF8 A;  4FA6 A;  4Q69 A;  5H7P A;  3BUA A;  1WDY A;  1INZ A;  2MHK A;  4GCO A;  4G11 A;  3FUN A;  3HDX A;  2UWJ G;  4UWL A;  2HM8 A;  3D3M A;  5BXO A;  2PZI A;  5AAR A;  3W9F A;  5LCW J;  4DK5 A;  2J9Q A;  4BFR A;  1RW2 A;  2Y0B G;  3ASG A;  2GRP B;  4UQZ A;  3RO2 A;  1D8E A;  3EIJ A;  5JHB A;  1EDU A;  1FT1 A;  1A5E A;  1N9A A;  4M3O A;  5CCL A;  3QNK A;  3TWQ A;  4DX6 D;  4J8D A;  4N5Q A;  4RSY A;  3MYV A;  2AXU A;  3DWL G;  3U64 A;  2IF4 A;  4F6R D;  3IXE A;  3QAR A;  3ZGQ A;  1E7V A;  2PQN A;  3D9N A;  4QQI A;  1H2V C;  3T5X A;  5EX0 A;  2OOE A;  1S63 A;  3CHS A;  4DLQ A;  5EID A;  4HNA D;  1KT0 A;  3CKB A;  5D0O D;  3OXF A;  2DBA A;  3CGH A;  3PZ2 A;  2DVW A;  3UI2 A;  1HG2 A;  2AXV A;  3SF4 A;  3EUV A;  2F0Y A;  4DUI A;  4EEC A;  3C72 A;  3U3W A;  3FTS A;  3RO3 A;  5JMN D;  3Q75 A;  3ASH A;  4CDM A;  5BV0 A;  4JPS A;  3CHQ A;  3FH8 A;  2CHX A;  3SO8 A;  1B89 A;  2ZIS A;  5G05 C;  1V54 E;  2ZU6 B;  1IQR A;  4KT6 B;  2WB2 A;  3I3N A;  3AU4 A;  1ELR A;  3ASD A;  4I43 A;  1OWM A;  2FO7 A;  2WMN A;  4NQ0 A;  3L22 A;  4ME2 A;  3HVE A;  3GZS A;  2L6J A;  1N0R A;  2Q7F A;  3UIN C;  4F3V A;  3PVL A;  2ETC A;  4D10 C;  5D0Q D;  3FUE A;  4L23 A;  1IYG A;  1SZ9 A;  3PEU B;  3TWS A;  3U66 A;  2VGX A;  1RZ4 A;  4K5B A;  5KNH D;  4GYO A;  5B1B E;  3V79 K;  5BXU A;  2WQH A;  1E90 A;  4TRQ A;  1WY6 A;  1N4S A;  3G2V A;  3U4T A;  2UY1 A;  1E8Y A;  4IYP A;  3D9J A;  4JA9 A;  4GZD A;  3CV0 A;  3FU6 A;  3Q49 B;  3DXK G;  4H7Y A;  1HX8 A;  1LD7 A;  3CLJ A;  3KS2 A;  2P9N G;  3HRA A;  4ANX A;  3CIA A;  4A3T A;  3TAX A;  4ANW A;  2WXF A;  3L16 A;  5HQ8 A;  3SI5 A;  3AG2 E;  4MLP A;  2P58 C;  1PAQ A;  5EX3 A;  5KJL A;  5A7D B;  5AEN A;  2XGS A;  5EKQ D;  3C3Q A;  4EBA G;  1UW4 B;  4OAV B;  3TWV A;  2OVB A;  5G55 A;  1TNO A;  2VTB A;  4I6J A;  3B7B A;  3QKY A;  3QC1 A;  4J8S A;  4GTR A;  4UWK A;  4ZFH A;  1X5B A;  4TUM A;  3BEE A;  4K0R A;  2I9C A;  4PH4 B;  3S2A A;  1N4R A;  3LVR E;  4DX7 D;  2WXQ A;  5ARG A;  4CT0 A;  3J5Q B;  3GW4 A;  3FUH A;  2X6I A;  3QOU A;  3KEZ A;  2DZO A;  2DYR E;  4J6I A;  2IQC A;  2P9U G;  3L82 A;  4JC8 A;  5FTP A;  4APO A;  3E32 A;  1MJ0 A;  1S70 B;  2Y4T A;  2AVP A;  1FVF A;  2VYI A;  2KZT A;  3ONK A;  3G2W A;  2HO1 A;  3ZYQ A;  3FTU A;  4FJY A;  2XHE A;  4HOT A;  1H6K A;  5AJL A;  1S64 A;  1PC2 A;  4I9E A;  5JJT A;  3FTV A;  2AJA A;  2VSN A;  4JB8 P;  4UI9 K;  2XCC A;  2QYU A;  2R03 A;  3ZYK A;  3FTX A;  3QAQ A;  1H2T C;  3C3O A;  2FEZ A;  1YA0 A;  4O6F A;  3MZL B;  3RRN B;  2EIN E;  3ULE G;  2V5F A;  1JUQ A;  3EJN A;  3ASO E;  4HLL A;  2XQ0 A;  2FO1 E;  3J5P A;  4FHK A;  5B1A E;  3B7S A;  4HB5 A;  4U96 D;  1OCO E;  3ZUV B;  4KZC A;  4U63 A;  2XPZ A;  1O1R A;  2X38 A;  2E0I A;  4RG6 A;  4G2V A;  2QC9 A;  5JA4 D;  3RKV A;  3LXU X;  3JXJ A;  3D9I A;  4U8H A;  1Z3Y A;  2R5S A;  2WXR A;  3IEG A;  3FU0 A;  2GRO B;  4F7A A;  3RAU A;  4J8E A;  2L6B A;  4JEH A;  4KMO A;  4WND A;  2LSV A;  3Q79 A;  4GZ6 A;  3JUI A;  4C48 B;  4FHJ A;  1N52 A;  4JXT A;  3I4R B;  3PUJ A;  1Q2Z A;  2DWZ A;  1MZC A;  2PM7 A;  1H19 A;  4KVO A;  1TNY A;  2L0T B;  4IN3 B;  5ITZ F;  5J08 A;  3KSL A;  3HG0 D;  4JHK A;  4LRZ A;  4BT8 A;  4P29 A;  4UI9 J;  1U3D A;  2J08 A;  3ABL E;  4YDO A;  2CFZ A;  5FJY A;  2NC9 A;  3LCA A;  1E8Z A;  2BKK B;  3ZW3 A;  4Z68 A;  2J09 A;  5AQB A;  4HVB A;  4N2S A;  2FF4 A;  1TN6 A;  2L9B A;  3CVQ A;  4GZ5 A;  2QYJ A;  4NAC A;  3JYS A;  3Q15 A;  3R7R A;  2IEJ A;  3OXG A;  3Q73 A;  3JQ1 A;  1OCR E;  4A1S A;  4EZJ A;  5B3S E;  3F6Q A;  3MCX A;  4B93 B;  1N4Q A;  3UMV A;  1P5Q A;  4UQX A;  2A4Z A;  2HE0 A;  2QFC A;  2YQ8 A;  1QZ2 A;  4N5C A;  2PNN A;  5LCW C;  4HOR A;  3HVE B;  4BSX A;  4FU3 A;  3APF A;  5ANR A;  3EU9 A;  3UTM A;  3OTN A;  3C5R A;  4N3A A;  1OWO A;  4XI0 A;  1KZP A;  3IHY A;  1SVX A;  3PZ3 A;  3RU0 A;  3ZYM A;  3B7T A;  2XGO A;  2VGX B;  1HH8 A;  4JD2 G;  4UWH A;  1E96 B;  2C0L A;  3DSW A;  2YHC A;  1H6O A;  4FC8 A;  5EIL A;  2GRR B;  1W3B A;  3UXG A;  3ESL A;  2UY1 B;  4Q96 A;  3FWV A;  4RLY A;  2MRI A;  2EQX A;  1TNU A;  3S7B A;  3W9G A;  4CT4 A;  2X6H A;  3DSU A;  3T5V A;  4L9P A;  3UQ3 A;  4PS7 A;  3LEW A;  2J8S D;  4BTA A;  2HYZ A;  4ANU A;  3ZXS A;  4AP2 A;  2JLB A;  3Q9U C;  5T4Y A;  2XS1 A;  1Z5S C;  3ABM E;  3FHE A;  2P9I G;  2F37 A;  5C2Y A;  4TXQ A;  4HBD A;  2WXK A;  3PE4 A;  2VTB B;  4HRM B;  3TWR A;  2R02 A;  5CBN A;  3EDT B;  1YCS B;  3ML9 A;  3AS5 A;  2XRY A;  2CFU A;  2GRN B;  1XNF A;  2WVI A;  3V30 A;  5KWD A;  4HOU A;  3SZ7 A;  2AW6 A;  5EYP F;  4RQI A;  2P9S G;  3SHF A;  3Q9N C;  1NI1 A;  2X6F A;  1MX4 A;  2WMO A;  2QZA A;  3ZEF A;  5BW8 C;  1N95 A;  2XEN A;  3FUL A;  1KZO A;  3AS4 A;  3NQP A;  4WAF A;  3PNT B;  2XPY A;  3ZU7 B;  4KBQ A;  3LS8 A;  2KZT B;  3URZ A;  3ABK E;  2NSZ A;  4URK A;  1NA0 A;  3L08 A;  2NXP A;  1SW6 A;  4RG9 A;  2FBN A;  1OCZ E;  3KSQ A;  2BF0 X;  3PEV B;  4BWR A;  2AWI A;  3CVN A;  3MEK A;  2DZN A;  5KNG A;  3PH0 C;  3TWW A;  5FIN A;  4MRU A;  1N11 A;  3EHM A;  3KEA A;  4XX5 A;  1TN7 A;  5CBO A;  5ENS D;  1OY3 D;  2H6G A;  1G3N B;  3ZKJ A;  2XS8 A;  5CED B;  4JEU A;  2V4L A;  4M7C A;  4FUL A;  2M63 A;  2A5E A;  3Q7F A;  3C3R A;  5KJK A;  2WXM A;  4CGW A;  2BUG A;  4K5C A;  4RVB A;  4N2Q A;  1IHG A;  5CHE E;  3NBN B;  5T8I A;  2EIK E;  3WG7 E;  4I9C A;  1H0A A;  5DBK A;  1MYO A;  3FY4 A;  5E75 A;  3CHM A;  2A5U A;  1NP7 A;  2WPV A;  5ENP D;  3E33 A;  2Y69 E;  5FQ6 A;  3OXL A;  3PNL B;  4J8Y A;  3D9P A;  2OVF A;  4DX1 A;  3IV0 A;  4KYO B;  5BPP A;  5CRV A;  2GRL A;  2KXP C;  2V5Q C;  3E34 A;  4ATZ D;  3ASN E;  2JEK A;  2Y3A A;  2OEW A;  2P9L G;  3SFX A;  5M72 A;  5AQ9 A;  4DJA A;  3CVP A;  4HFG A;  4AY6 A;  1S0P A;  4ACK A;  3FTY A;  2I2O A;  1FPP A;  1WAO 1;  4DX5 D;  1JWG A;  4FLB A;  1ELW A;  2J4D A;  3MGB A;  4B8C B;  3APC A;  4XZ4 A;  4BEP A;  5A23 A;  3BG1 B;  3V31 A;  4AEZ C;  2IJG X;  3B95 A;  3VLF A;  4LNU D;  3CR3 A;  4UUC A;  4PUC A;  1NA3 A;  4AXH A;  5FQ4 A;  1O1T A;  1KLX A;  3TL5 A;  3E30 A;  2H6H A;  3P1U A;  2C2L A;  4YDE A;  1JWF A;  3VLD A;  5HS0 A;  4CCA A;  3G2S A;  5LX8 A;  4XE0 A;  2LAI A;  4EPZ A;  5HI7 A;  1E8W A;  2V8S E;  1HS6 A;  1NL4 A;  5ANL A;  1E8X A;  2R2L A;  4GCN A;  1UJJ A;  2VGE A;  4NIK A;  1IHB A;  1VDY A;  3QWP A;  4GYW A;  3B7R L;  3UIP C;  2WXI A;  2XZT G;  4A3V A;  3CHR A;  4CEM A;  5FZR A;  3RSE G;  4UI9 C;  3LVQ E;  3Q4A B;  1DCQ A;  2H6I A;  4X8Q A;  2YNQ A;  4I6E A;  3ZN3 A;  3QJZ A;  4BY6 A;  5AAO A;  2MOW A;  3L54 A;  3TJP A;  2DCP A;  4KVM A;  3K9I A;  3ONL A;  5EYL A;  4GTO A;  4I1M A;  4G25 A;  4HXI A;  4O1P A;  4JVS A;  2VSY A;  4B8A A;  4ILH B;  2P9K G;  1L5J A;  4BET A;  1UN9 A;  3G2T A;  4N39 A;  1TNZ A;  3WXX A;  3NOC D;  2KCV A;  2E2E A;  4V3I A;  1YMP A;  5D66 A;  4JA7 A;  4GA1 A;  3HXB A;  5ENO D;  2VGY A;  5CRU A;  2ETA A;  5D2M C;  3VTY A;  2R17 C;  4A1G A;  2GGF A;  4N3B A;  3D9L A;  4TV3 A;  4YDW A;  2BED A;  2F8Y A;  4LCT A;  2J4B A;  4BSZ B;  3CKC A;  3NB2 A;  4YDY A;  2KAT A;  4B0Z A;  1AWC B;  4C0E A;  2IO2 C;  3FUJ A;  4L2L A;  3D9K A;  1BI7 B;  3CQC B;  2GW1 A;  3T9K A;  4CYM D;  2IO3 C;  5CCM A;  4Y6W A;  5ARF A;  1NZN A;  3MA5 A;  1LTX A;  3PZ4 A;  4B89 A;  3CVY A;  1TYQ G;  1HO8 A;  4DPR A;  3NZU A;  1QYM A;  3ZNG A;  3C98 A;  1OCC E;  2JAB A;  3DBS A;  1OT8 A;  3GZ1 A;  1PY1 A;  4ZHB A;  2KCK A;  3PE3 A;  1E7U A;  3L13 A;  4HI8 A;  3D9O A;  1N4P A;  4U8V D;  4FAD A;  3R9A B;  3SBT B;  1BD8 A;  1Y6I A;  3CVV A;  2KM4 A;  1EPU A;  1HXI A;  3SY2 A;  5AQA A;  4G24 A;  4HLE A;  2WXG A;  4TUU A;  1K1A A;  4I2W A;  4FP7 A;  5AN8 A;  3P2B A;  4I1O B;  2WQ6 A;  2IU1 A;  4F1P A;  2AXZ A;  3SQV A;  2XPI A;  5FZQ A;  1TJC A;  1K8K G;  4QFV A;  2CG2 A;  5FQ7 A;  2IOL A;  4ILG A;  4AVX A;  4JW1 A;  3JXI A;  3JQ0 A;  1OXJ A;  4DI3 A;  5EN5 D;  4WUY A;  5BNW A;  1ZB1 A;  4R7L A;  4U0S A;  3DPY A;  3UM1 A;  4I17 A;  2RD0 A;  1FT2 A;  4GTS A;  4JHR A;  4LNG A;  3UM3 A;  3FUK A;  5C1D A;  3QDN A;  1Y8M A;  3CQG B;  3FU5 A;  4JHJ A;  4E6H A;  3HIZ A;  5JHA A;  4NUR A;  4J7W A;  4XKB A;  5CEA A;  4U0Z A;  5T3R A;  3RRU A;  2KCL A;  4JL0 A;  1UG3 A;  3Q47 B;  3PS6 A;  4DRX E;  5LOZ A;  4PS3 A;  3TWU A;  1QQE A;  4GYY A;  3CVU A;  4EQF A;  2NYJ A;  3AG1 E;  4BT9 A;  4F1S A;  4F53 A;  3FEY A;  4GU5 A;  5CER B;  4G8L A;  2I6H A;  3D9H A;  4UWF A;  3LY7 A;  2CHW A;  5AQ7 A;  4YVQ C;  2FUL A;  2EIL E;  5J90 A;  1OWP A;  4XIF A;  1TNB A;  4HS2 A;  2VQ2 A;  3ZPJ A;  4GTV A;  3I5P A;  4GB9 A;  4EZL A;  2P2C P;  3UIO C;  2BTD A;  3LPZ A;  4K03 A;  2PM6 A;  4Y6C A;  3FUI A;  1BPO A;  3MV2 B;  3DEP A;  4DLO A;  5KCM A;  4U04 A;  2Y1L E;  1H6P A;  2BKG A;  3AJI A;  3BQO A;  5CEC B;  3ENE A;  4L2Y A;  2ZXW E;  4JZY A;  3V2O A;  2RKK A;  1N54 A;  2WXL A;  4MKT A;  2F8X K;  1K1B A;  2WM9 A;  2PL2 A;  2DIW A;  4ACL A;  3CVW A;  4I1A A;  4DI4 A;  4W9R A;  3EHR A;  3UUX A;  2KBX A;  4WNE A;  4CDR A;  3NF1 A;  4MS6 A;  3TG5 A;  1OWL A;  3E37 A;  4Q94 A;  3CK8 A;  3DPD A;  1BLX B;  4G23 A;  3UKU G;  3QK0 A;  5FQ8 A;  4HRL A;  1DVP A;  1JCS A;  3DEO A;  4TXR A;  3FP3 A;  1JCR A;  2OND A;  3R7Q A;  4APF A;  3IHV A;  3T8M A;  1HG5 A;  3JCK C;  2ZGD A;  4OAU C;  3UKR G;  3TWT A;  5FT9 A;  2XZD G;  3FUF A;  3AG3 E;  4AIF A;  3UM0 A;  2XRZ A;  4IRU A;  3GZ2 A;  2LXM A;  4WWN A;  5BUZ A;  3UT7 A;  4I6G A;  1SA4 A;  3ZFW A;  5KJM A;  3HXE A;  5DIZ A;  3LJ3 A;  2C0M A;  4ANV A;  4MBG A;  3OAW A;  2H6F A;  3UX4 A;  2VSX E;  3SFY A;  2WXJ A;  3DXM G;  3CST A;  5IY5 E;  1YYH A;  2L0I A;  5ENT D;  3D9M A;  4XEI G;  3DRA A;  5HRY A;  3MJW A;  4GTQ A;  4UQY A;  3G2U A;  3RRM B;  4EZK A;  3AU5 A;  4C9B B;  3PUK A;  3APD A;  3UT8 A;  3T8K A;  4LEU A;  2Y4U A;  2P9P G;  3HXF A;  3IBE A;  3VTX A;  3S7J A;  3QB2 A;  3HXD A;  4G1T A;  3FEX A;  1GW6 A;  4K5A B;  1DNP A;  5BV1 A;  3ASF A;  3SGH A;  2WQ7 A;  4BES A;  3ZXP A;  4AV7 A;  4BER A;  4I2Z A;  2XEE A;  1N94 A;  4LUN U;  3B13 A;  2RFA A;  4GMJ A;  3X2Q E;  3MKQ A;  1U2V G;  4WNF A;  2GRQ B;  2ETB A;  1A17 A;  2EIJ E;  3LJN A;  1D8D A;  1UOH A;  4H7X A;  3NAW A;  4WNG A;  1LD8 A;  4AY5 A;  3RIB A;  2ILR A;  3ZHE A;  2IY0 C;  3ZRH A;  1TJF A;  3QWW A;  1MQS A;  2CG3 A;  2HR2 A;  1SQM A;  3ZYL A;  1X81 A;  4LG6 A;  5KBA A;  3E4B A;  4CGV A;  2GRM A;  1TEZ A;  3TWX A;  3CVX A;  3Q7A A;  3RK6 A;  2IOS A;  4LNB A;  1ZBP A;  4O60 A;  4XKC A;  4A63 B;  4KXK B;  2OCC E;  2KC7 A;  2YHE A;  3SBS A;  5G05 J;  2CHZ A;  5EIB E;  2MYO A;  3UM2 A;  3N71 A;  2VSO E;  2WXP A;  4L1B A;  3I4G A;  4GTP A;  2B0O E;  1LF8 A;  1HZ4 A;  2I1J A;  4WWP A;  4E85 A;  2X6J A;  2V0P A;  4HRN A;  1DCE A;  1HU3 A;  4NRH B;  3CVL A;  4ILI A;  4GA0 A;  3AG4 E;  5FIO A;  4ABN A;  1OUV A;  3FTZ A;  5EDS A;  3NOG D;  3MX3 A;  3RJV A;  2LUH A;  5ENN A;  4FJZ A;  4J8F A;  3FUD A;  4OVV A;  3FUM A;  4AJW A;  3DST A;  1K3Z D;  2I1K A;  1KPS B;  3SFZ A;  2XEH A;  2OEV A;  3GYZ A;  1MX6 A;  5ENQ D;  1SA5 A;  4B94 A;  3SD5 A;  3TG4 A;  4U0U A;  3TGO A;  2XCB A;  3U9W A;  3LKU A;  4HOS A;  2VJ8 A;  3LY9 A;  4EBA A;  5AIJ A;  4U7E B;  4N3C A;  1QBQ A;  2LAH A;  3O4Z A;  3VLE A;  3FU3 A;  2LXL A;  4LSZ E;  3ML8 A;  1XGW A;  1TN8 A;  4GPK A;  1DC2 A;  3EHQ A;  4GAA A;  3NZS A;  3UPV A;  4YVO A;  2ION A;  3CSF A;  3FFL A;  4G26 A;  5CMW A;  4XI9 A;  4OYS A; 
#chains in the Genus database with same CATH homology
 5FQ7 A;  2IOL A;  3LS8 A;  2KZT B;  3CV0 A;  3FU6 A;  3Q49 B;  4ILG A;  4JW1 A;  3URZ A;  2WXO A;  4AVX A;  3JQ0 A;  5G04 C;  2NSZ A;  4H7Y A;  4DI3 A;  4URK A;  1HX8 A;  3CLJ A;  3KS2 A;  4WUY A;  5BNW A;  4R7L A;  1NA0 A;  3L08 A;  4ANX A;  4U0S A;  2NXP A;  3L6A A;  3CIA A;  4A3T A;  4RG9 A;  2FBN A;  4I17 A;  2WXF A;  3L16 A;  3TAX A;  4ANW A;  5HQ8 A;  4BX9 A;  2RD0 A;  2BF0 X;  3PEV B;  4IUL A;  4BWR A;  2AWI A;  3BG0 B;  1U3C A;  3CVN A;  5JJ6 A;  4CDN A;  3EIQ C;  4JHR A;  3SI5 A;  4MLP A;  4AM9 A;  3FUK A;  5C1D A;  2P58 C;  1PAQ A;  5EX3 A;  3MEK A;  5KJL A;  5A7D B;  3QDN A;  5FWQ A;  5AEN A;  1Y8M A;  3CQG B;  3FU5 A;  3PH0 C;  4JHJ A;  4E6H A;  2XGS A;  3HIZ A;  5EKQ D;  4MRU A;  5JHA A;  4NUR A;  3EHM A;  4EBA G;  1UW4 B;  4XX5 A;  4XKB A;  2YIN A;  2OVB A;  5G55 A;  4U0Z A;  2VTB A;  4L7T A;  5T3R A;  3RRU A;  2KCL A;  4I6J A;  4JL0 A;  1UG3 A;  4GZC A;  1FCH A;  3LY8 A;  3Q47 B;  3PS6 A;  3QKY A;  2V4L A;  4JEU A;  3QC1 A;  4J8S A;  5LOZ A;  4PS3 A;  4UWK A;  4KZ0 A;  1QQE A;  1JPL A;  2J07 A;  4GYY A;  3CHO A;  3CVU A;  4PDX A;  1X5B A;  4GZ3 A;  4EQF A;  4FUL A;  4YND A;  5FZS A;  2M63 A;  2R59 A;  4HOQ A;  1Z6T A;  3BEE A;  4A55 A;  4BT9 A;  4K0R A;  5KJK A;  2WXM A;  3PRE A;  3FDH A;  4CGW A;  2BUG A;  4F1S A;  3PZD A;  4RVB A;  2I9C A;  4UWG A;  1IHG A;  4F53 A;  4PH4 B;  4N2Q A;  5CHE E;  5AJD A;  3S2A A;  5G2N A;  5A6C A;  1KT1 A;  1EF1 C;  3FEY A;  4GU5 A;  5T8I A;  2I6H A;  3LVR E;  3PDN A;  4UWF A;  4I9C A;  2WXQ A;  3LY7 A;  5ARG A;  4CT0 A;  1H0A A;  5DBK A;  3GW4 A;  2CHW A;  3FUH A;  2X6I A;  3QOU A;  3KEZ A;  1ZU2 A;  3TXN A;  4YVQ C;  2FUL A;  1WM5 A;  3IKO B;  4J6I A;  5J90 A;  1OWP A;  3FY4 A;  4XIF A;  2IQC A;  4HS2 A;  5E75 A;  2VQ2 A;  3CHM A;  2A5U A;  3ZPJ A;  2WXH A;  2IFU A;  3I5P A;  4GB9 A;  4JC8 A;  5FTP A;  4APO A;  4EZL A;  1NP7 A;  2WPV A;  4FLH A;  3LDZ A;  2Y4T A;  2AVP A;  5AYW D;  2BTD A;  1FVF A;  2VYI A;  2KZT A;  3LPZ A;  5FQ6 A;  3TXM A;  3ONK A;  3G2W A;  2PM6 A;  4K03 A;  2HO1 A;  1SZA A;  3CK7 A;  3HYM B;  3MV3 B;  3OXL A;  3FTU A;  3PNL B;  3Q5M A;  3D9P A;  3FUI A;  4GML A;  3ZYQ A;  4AOF A;  1BPO A;  2OVF A;  4FJY A;  2XHE A;  4HOT A;  1H6K A;  3SNX A;  5AJL A;  3MV2 B;  4OYS A;  3IV0 A;  4U07 A;  4KYO B;  4DLO A;  1PC2 A;  3MKR A;  5KCM A;  4U04 A;  3FH7 A;  4I9E A;  4ATG A;  5JJT A;  3FTV A;  5BPP A;  4C0M A;  3ENE A;  4J0U A;  2VSN A;  4L2Y A;  3ULQ A;  2GRL A;  4UI9 K;  2XCC A;  4JZY A;  1N54 A;  2WXL A;  5G04 J;  2JEK A;  4MKT A;  3ZYK A;  3FTX A;  2WM9 A;  2Y3A A;  3QAQ A;  4PS8 A;  1H2T C;  2PL2 A;  2FEZ A;  2DIW A;  1YA0 A;  4O6F A;  5M72 A;  4ACL A;  3CVW A;  4DJA A;  3CVP A;  4HFG A;  4I1A A;  1OWN A;  1S0P A;  3MZL B;  3RRN B;  4ACK A;  4AY6 A;  2J49 A;  4DI4 A;  1UJK A;  3QWV A;  3FTY A;  4W9R A;  2I2O A;  1Z3X A;  2V5F A;  3UUX A;  1JUQ A;  2LSU A;  1WAO 1;  2X6K A;  1HE8 A;  1HFA A;  3EJN A;  4WNE A;  4CDR A;  5BT1 A;  3NF1 A;  4MS6 A;  3TG5 A;  1OWL A;  4GA2 A;  2XQ0 A;  3CHP A;  1JWG A;  4FHK A;  3FTW A;  3B7S A;  1IQU A;  3LYA A;  4Q94 A;  1FVH A;  3CK8 A;  3DPD A;  4OVU A;  4BTB A;  4G23 A;  4FLB A;  2FI7 A;  3QK0 A;  5FQ8 A;  4KZC A;  1DVP A;  1ELW A;  2J4D A;  4U63 A;  2XPZ A;  3S7D A;  3FH5 A;  2X38 A;  3MGB A;  2E0I A;  3FP3 A;  2QY7 A;  2OND A;  4B8C B;  3APC A;  5LFA A;  4RG6 A;  2RG8 A;  4XZ4 A;  5A23 A;  3R7Q A;  4APF A;  3BG1 B;  5LP0 A;  3IHV A;  3T8M A;  1HG5 A;  4G2V A;  2IJG X;  4AEZ C;  4BX8 A;  3ZVV A;  3AS8 A;  3JCK C;  2X3M A;  3RKV A;  3LXU X;  3D9I A;  5FT9 A;  4U8H A;  1Z3Y A;  3FUF A;  2R5S A;  2WXR A;  3VLF A;  1QNF A;  3IEG A;  3HHM A;  3FU0 A;  3CR3 A;  4AIF A;  2XRZ A;  4IRU A;  4PUC A;  3GZ2 A;  1NA3 A;  4F7A A;  4AXH A;  4J8E A;  4JEH A;  4KMO A;  4WND A;  3CK9 A;  4WWN A;  3MKQ B;  5E76 A;  2LSV A;  4WWO A;  3KAE A;  5BUZ A;  5FQ4 A;  1KLX A;  2WXN A;  3JUI A;  4GZ6 A;  3TL5 A;  3UT7 A;  4FHJ A;  3P1U A;  1N52 A;  2C2L A;  4I6G A;  3KD7 A;  1EYH A;  4JXT A;  3ZFW A;  1JWF A;  3VLD A;  5KJM A;  1ELK A;  3O48 A;  5DIZ A;  3I4R B;  3PUJ A;  3LJ3 A;  2C0M A;  4CCA A;  3ZHE B;  2XEV A;  3G2S A;  4ANV A;  3OAW A;  5LX8 A;  2PM7 A;  2OV8 A;  4XE0 A;  5JJ7 A;  2LAI A;  1H19 A;  3UX4 A;  4EPZ A;  2VSX E;  5HI7 A;  3S7F A;  4KVO A;  3EHN A;  2L0T B;  4IN3 B;  1UN8 A;  1E8W A;  3PRZ A;  5J08 A;  1MHQ A;  2WXJ A;  2V8S E;  3CST A;  3CEQ A;  1HS6 A;  1H2U A;  4JHK A;  2LNI A;  1E8X A;  4LRZ A;  5ANL A;  4BT8 A;  4P29 A;  3ESK A;  4UI9 J;  1U3D A;  2L0I A;  3D9M A;  4GCN A;  1UJJ A;  3UT4 A;  5KJN A;  2J08 A;  1VDY A;  3QWP A;  4GYW A;  5CMY A;  3MJW A;  2CFZ A;  4UQY A;  3B7R L;  5FJY A;  3G2U A;  3RRM B;  2WXI A;  2XGM A;  4A3V A;  3ZIM A;  2NC9 A;  4LER A;  4EZK A;  2PQR A;  3LCA A;  3AU5 A;  3CHR A;  1E8Z A;  3L17 A;  3ZW3 A;  4CEM A;  5FZR A;  4C9B B;  3PUK A;  4UI9 C;  2J09 A;  4HVB A;  3LVQ E;  2LO6 A;  4N2S A;  3Q4A B;  3B7U X;  1HF8 A;  4FA6 A;  2YNQ A;  3APD A;  3UT8 A;  4I6E A;  4LEU A;  2Y4U A;  4Q69 A;  3ZN3 A;  3IBE A;  3QJZ A;  3VTX A;  4BY6 A;  2FF4 A;  2MOW A;  3L54 A;  3S7J A;  3TJP A;  2DCP A;  1INZ A;  4KVM A;  2MHK A;  4GCO A;  4G11 A;  3QB2 A;  2L9B A;  3K9I A;  3FUN A;  3HDX A;  3CVQ A;  4G1T A;  3FEX A;  2UWJ G;  4UWL A;  4GZ5 A;  3ONL A;  1GW6 A;  4NAC A;  3JYS A;  1DNP A;  2HM8 A;  3D3M A;  5BV1 A;  3ASF A;  3Q15 A;  3SGH A;  2PZI A;  4I1M A;  3R7R A;  5LCW J;  3OXG A;  4DK5 A;  4G25 A;  2WQ7 A;  4HXI A;  2J9Q A;  3JQ1 A;  4JVS A;  2VSY A;  4A1S A;  4BFR A;  4AV7 A;  3ASG A;  4EZJ A;  4UQZ A;  4I2Z A;  3RO2 A;  3MCX A;  3EIJ A;  4B8A A;  4ILH B;  4LUN U;  3UMV A;  3B13 A;  1P5Q A;  4UQX A;  2A4Z A;  4GMJ A;  2QFC A;  5JHB A;  1EDU A;  1L5J A;  3MKQ A;  2YQ8 A;  1UN9 A;  4WNF A;  3G2T A;  4N39 A;  1QZ2 A;  3WXX A;  4N5C A;  5LCW C;  4M3O A;  5CCL A;  3QNK A;  4HOR A;  2KCV A;  1A17 A;  3HVE B;  4BSX A;  4H7X A;  4WNG A;  4J8D A;  4AY5 A;  4RSY A;  4FU3 A;  2E2E A;  3APF A;  2ILR A;  4V3I A;  3MYV A;  2AXU A;  3RIB A;  5ANR A;  3U64 A;  3ZHE A;  2IF4 A;  3OTN A;  3QAR A;  3ZRH A;  4N3A A;  3ZGQ A;  4JA7 A;  1OWO A;  4XI0 A;  4GA1 A;  1E7V A;  1TJF A;  2PQN A;  3IHY A;  3QWW A;  3RU0 A;  3D9N A;  3ZYM A;  1MQS A;  2VGY A;  3B7T A;  3VTY A;  2CG3 A;  2XGO A;  1H2V C;  2R17 C;  3T5X A;  2VGX B;  4A1G A;  1HH8 A;  5EX0 A;  2HR2 A;  2GGF A;  4N3B A;  4UWH A;  3D9L A;  1E96 B;  1SQM A;  4TV3 A;  2OOE A;  2C0L A;  3ZYL A;  3CHS A;  3E4B A;  2YHC A;  4CGV A;  2GRM A;  1TEZ A;  4FC8 A;  4DLQ A;  3CVX A;  3RK6 A;  1KT0 A;  1W3B A;  4LCT A;  3CKB A;  5D0O D;  3OXF A;  2IOS A;  3ESL A;  4CRW A;  2UY1 B;  4Q96 A;  1ZBP A;  2DBA A;  4XKC A;  3CGH A;  4KXK B;  4Y6C A;  3FWV A;  2YHE A;  2KC7 A;  1HG2 A;  2AXV A;  2J4B A;  2MRI A;  3SBS A;  3SF4 A;  3CKC A;  2EQX A;  3S7B A;  2KAT A;  5G05 J;  4B0Z A;  4C0E A;  2CHZ A;  4EEC A;  3U3W A;  3FUJ A;  4L2L A;  3D9K A;  3FTS A;  3RO3 A;  4CT4 A;  2X6H A;  3T5V A;  3ASH A;  3UQ3 A;  3N71 A;  3CQC B;  4PS7 A;  4CDM A;  2GW1 A;  2VSO E;  3LEW A;  5BV0 A;  2WXP A;  4L1B A;  3I4G A;  2HYZ A;  3CHQ A;  4JPS A;  4ANU A;  4BTA A;  1LF8 A;  3ZXS A;  1HZ4 A;  4AP2 A;  3FH8 A;  2I1J A;  5CCM A;  2CHX A;  4Y6W A;  4WWP A;  2JLB A;  4E85 A;  2X6J A;  1B89 A;  5T4Y A;  2V0P A;  5ARF A;  1NZN A;  5G05 C;  3MA5 A;  2ZU6 B;  1HU3 A;  3FHE A;  4NRH B;  1IQR A;  3CVL A;  4ILI A;  4KT6 B;  4GA0 A;  2WB2 A;  4B89 A;  5C2Y A;  3CVY A;  3I3N A;  4ABN A;  3AU4 A;  1HO8 A;  1OUV A;  3FTZ A;  4DPR A;  5EDS A;  2WXK A;  1ELR A;  3MX3 A;  3ASD A;  3RJV A;  4I43 A;  3NZU A;  3C98 A;  5ENN A;  4FJZ A;  4J8F A;  3FUD A;  1OWM A;  3DBS A;  3PE4 A;  4OVV A;  3FUM A;  4AJW A;  3GZ1 A;  2FO7 A;  2VTB B;  1PY1 A;  2I1K A;  2WMN A;  3SFZ A;  4NQ0 A;  2KCK A;  3GYZ A;  3L22 A;  3PE3 A;  4ME2 A;  4B94 A;  1E7U A;  3SD5 A;  3L13 A;  3HVE A;  3GZS A;  2L6J A;  3D9O A;  3EDT B;  4FAD A;  2Q7F A;  3R9A B;  3TG4 A;  4F3V A;  3PVL A;  4U0U A;  3ML9 A;  3SBT B;  3TGO A;  4D10 C;  5D0Q D;  3AS5 A;  3FUE A;  1Y6I A;  3CVV A;  2KM4 A;  2XCB A;  1EPU A;  4L23 A;  1HXI A;  1IYG A;  3U9W A;  3LKU A;  4HOS A;  2VJ8 A;  2CFU A;  2XRY A;  3LY9 A;  4G24 A;  4EBA A;  4HLE A;  1SZ9 A;  2WXG A;  4TUU A;  5AIJ A;  1XNF A;  2WVI A;  3PEU B;  4HOU A;  4N3C A;  3U66 A;  4I2W A;  3SZ7 A;  2VGX A;  2LAH A;  4FP7 A;  3O4Z A;  3VLE A;  2AW6 A;  3FU3 A;  4GYO A;  3ML8 A;  1XGW A;  3P2B A;  3SHF A;  2WQH A;  4GPK A;  4I1O B;  1E90 A;  2X6F A;  2WQ6 A;  2IU1 A;  2WMO A;  3ZEF A;  4TRQ A;  5BW8 C;  3FUL A;  4GAA A;  2AXZ A;  3AS4 A;  1WY6 A;  3NZS A;  3NQP A;  2XPI A;  3G2V A;  5FZQ A;  3U4T A;  1TJC A;  4WAF A;  2UY1 A;  3UPV A;  4QFV A;  4YVO A;  2ION A;  3CSF A;  1E8Y A;  2CG2 A;  3FFL A;  4IYP A;  4G26 A;  3PNT B;  3D9J A;  4JA9 A;  2XPY A;  5CMW A;  4KBQ A;  4XI9 A;  4GZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...